1DF0B

Crystal structure of m-calpain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
176
Chain Sequence
NESEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords M-CALPAIN
publication title Crystal structure of calpain reveals the structural basis for Ca(2+)-dependent protease activity and a novel mode of enzyme activation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 56
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 1999-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1df0B00
1FBVA 1JFJA 3A4UB 2KI4C 1SMGA 1PSRA 1TCFA 4GGFA 1B7TY 4ZCUA 4AQJA 3EK7A 1SBJA 1YX7A 2LAPA 3DVKA 1FI5A 3DVMA 1DT7B 2CT9A 2KAXA 1ODBA 3KEVA 5ER4X 2KAYA 5G08A 3KPXA 1LINA 1QS7A 3PN7C 2LVJA 2LE9B 1FI6A 1M39A 1RWYA 5HKZA 4MLWA 2KBMA 1B8RA 2JNXA 1BG1A 1C07A 3EKHA 1NX0A 2M8UA 4JPZB 1MF8B 1CTRA 4FQOA 2K7DA 2JNFA 1NCXA 5GQQC 4MN0A 1SL7A 1F4QA 1IGVA 1QVIY 2K7CA 1DJZA 4PHJA 1TNXA 4AOMA 1PVAA 1F70A 2GGZA 1DF0A 1IH0A 1MR8A 1KFXL 1WLZA 2H61C 1KQVA 1H4BA 1TOPA 2ZN9A 1YRUB 4YBHB 2RGIA 3JTDB 1Y6WA 3SG7A 1SCMB 3F45A 2CNPA 2KFGA 1QJTA 1LKJA 5TNCA 4NDCA 2WCFA 1B4CA 1JF2A 1MHOA 2M7LA 5HYDA 3EK4A 5CSNA 2F8PA 4N1GA 1V1FA 1CFDA 1A03A 1B8LA 1KK7Y 2EGDA 3A8RA 3JVTB 1SCVA 2NZ0A 1WLMA 2KQ6A 1NP8A 1NX1A 3GOFA 4PCWA 3CR4X 5IBWA 1Y1XA 2LCPA 5HKWA 3IQQA 2BL0C 3C1VA 1BT6A 2KNEA 3VRPA 3GK2A 1S36A 1J7QA 2LP2A 2V53A 4Q04A 2Y1NA 1U5IB 3BUNB 1K90D 1J55A 2PMYA 1N65A 1QV0A 4QJ3B 2MBXA 3VRRA 1X02A 5DKNA 1YR5A 2JZIA 3FS7A 1WDCB 2G2BA 2KFFA 1J7RA 1QIVA 2L0PA 2HQWA 1WY9A 4CPVA 1QIWA 1WRLA 1OOJA 1CLBA 4PDZA 2JXCA 1M31A 1LXFC 2LLSA 1QASA 5DKRA 2JT0A 3DVJA 1CM1A 1SW8A 5FYXA 4A4BA 4DCKA 5DKQA 3EVRA 2O60A 5BPJA 4DUQA 5D69A 3GK1A 3I5FB 2WCBA 2ZNDA 3HCMA 1YUTA 2LLTA 3SIAA 3CZTX 1EL4A 1XK4A 3NSIA 3O6BA 1SY9A 1PRWA 3PATA 3CLNA 1M63B 1S6CA 4QJ4B 5AANA 2LUCA 1BR4B 1S5GZ 1U5IA 3LCPC 4GPLB 1S6JA 4MBEA 4YGEB 1EH2A 2BECA 1AJ4A 1MXEA 3VROA 2OS8B 4GUKA 1DJWA 2K8MB 2JULA 1Q80A 2M1KB 4I5JA 1AJ5A 1YUUA 1SR6B 2KFHA 2LUXA 1OZOA 4M2QA 5I8NA 2KI6D 2PVBA 4UPGA 1TNWA 2ZN8A 2KOTA 1UHHA 3CR5X 1JSAA 4L9MA 4USLA 1G8IA 2KYCA 2MHHA 5KTYA 1CDNA 2KAVA 1KK8C 3AAJA 5HKYA 3O78A 2L51A 1TCOB 2L4HA 3EVVA 1OZSA 1CLMA 1HQVA 1RTP1 1XFYO 1XFUO 2Q91A 2WORA 3VRQA 2EHBA 2OTGC 1J1EA 2KI4B 1EXRA 1NX2A 1NCZA 2KQYA 4M2OA 2E30A 4PE0A 1BLQA 1HT9A 2BBMA 1XVJA 3SG4A 1BODA 1SK6D 1KFXS 2OTGB 1F55A 1TIZA 1QLSA 1N2DA 4YGDB 2JC2A 1CKKA 1K95A 3VRNA 4IL1A 3PN7B 4MEWA 3H4SE 3E3RA 2JT3A 5B8IB 1A4PA 4P2YB 3CS1A 1KFUL 3FIAA 2M9GA 1QX5B 1QATA 3SIBA 5CSJA 4CFRA 2L50A 2MLEC 1OSAA 2M0RA 5PALA 3PSRA 1DJGA 1G33A 1A29A 4U8DA 2KBIA 1DJIA 1YRTB 2JOJA 1JBAA 3RLZA 1DVIA 2F3ZA 2O5GA 3O4YA 1S5GY 4OKHA 3I5IC 1DTLA 1S6IA 2M49B 1LA0A 2CXJA 2Q4UA 4JQ0D 2NCOA 3TS5C 1IKUA 3TDIA 2LANA 4PHKA 3RM1A 2PRUA 1RECA 2K0JA 2ZFDA 3BYAA 3CR2A 3MSEB 1QLKA 2K2AA 2MRDA 4NQGA 1A2XA 1CLLA 1AUIB 1YX8A 3CTNA 1TNQA 4YI9A 4DRWA 1ALVA 2HQ8A 2WC8A 2COLB 1BU3A 1IRJA 3TDZA 4OR9B 1GJYA 5JOLA 1RJVA 3NSLA 1AK8A 4I5NB 4FTGA 1JFKA 5JJGA 2M3WA 4A4CA 3EK8A 2A4JA 1RROA 4PALA 1K9UA 3ZNIA 1CFCA 2GGMA 2L5XB 2ZKMX 5CSIA 2ZRSA 2F2OA 1YVLA 1V1GA 1UUSA 1K94A 4GGNA 1XFXO 1NX3A 2BL0B 1WRKA 1Y1UA 1KQMC 3PM8A 4WQ3A 2MAZA 2PSRA 4D1EA 4YI8A 2LP3A 2H61A 1K9PA 1PK0D 1J7OA 2KYFA 5HLOA 4JWQA 1JWDA 3AKBA 5CPVA 1KQMB 4YGAA 3SG2A 2LVVA 2SASA 3M0WA 1JC2A 5I2LA 1K2HA 3WHUB 1RFJA 2ISDA 1L2OC 1OMDA 3PALA 1CMFA 2P6BB 5I2OA 2L2EA 1NSHA 1UHKA 1UHIA 1QX7A 1B7TZ 1M45A 5D7FA 1KSMA 2LC5A 1ZUZA 2KI6C 4OCIA 3TUYC 1PULA 1DJXA 1KWOC 1RK9A 2K7BA 3SG3A 2KHNA 5AEQA 1NPQA 2FOTA 2R2IA 1KCYA 1IG5A 2LHLA 2CBLA 3BOWB 1OMVA 2M1UA 1H8BA 2WOSA 1QTXA 4GBAA 5AFPA 2EC6C 1R2UA 1JF0A 1KWOB 4I5KA 1ALWA 1BR1B 1ZMZA 2AUCA 4GGFC 1C7VA 1DMOA 2HF5A 4M2PA 1DGUA 3LK1A 2BCAA 3BXKA 1SL8A 5CSFA 1BF5A 3OB1B 1NCYA 1UHNA 1EG3A 1XYDA 2JQ6A 2MJWB 3EKJA 1CNPA 2LHIA 4MSPA 1QVIZ 1K9KA 3KF9A 2Y1MA 4N5XA 3LK0A 3EVUA 5AERA 5K89A 2JXLA 1MWNA 2HETA 3FWBA 1AP4A 1W7IB 2BE4A 1NYAA 3VGOA 1VRKA 3SG5A 2FCDA 1PALA 1XO5A 1EG4A 2AAOA 3OB2B 1A75B 2I18A 3FWCA 1UP5A 1KK8B 2F2PA 1GGZA 1KFUS 4ZCVA 4XJKB 5KU1A 4PHMA 4E68A 2K61A 3I5HC 4ORCB 4YGBB 1CM4A 2GV5A 3QRXA 4OV2A 4HREE 4QJ5B 1B9AA 1KSOA 1PVBA 1S26D 1IWQA 4YGCB 1XFWO 1KK7Z 1AHRA 1MXLC 1IJ5A 1SNLA 3I5HB 3KHEA 4MZKA 1ZOTB 2WNDA 3IF7A 1K93D 2DOQA 1YUSA 4N1FA 5HLVA 3NSOA 1BOCA 2QACA 2BCXA 3BUOB 1F4OA 2BBNA 1SL9A 4CFQA 1NWDA 3LLEA 1GGWA 3WXAA 2MA2A 1FF1A 3DD4A 1QV1A 2LNKA 2I94A 4R1EA 4DS7A 3ZWHA 2M7NA 4PHNA 2F33A 2SCPA 4ETOA 1MQ1A 1CMGA 1BMOA 2LMUA 1FW4A 1IQ5A 1CFPA 4NDDA 5KSZA 2OPOA 1A75A 1DJYA 1B47A 1NIWA 1F71A 1JUOA 4DIRA 3K21A 2Y4QA 4XJKA 3D0YB 1XA5A 3PLFB 3HX4A 2AMIA 1ZACA 3BUMB 3I5IB 2BE6A 4AQIA 2JRFA 1K8UA 4TNCA 1CDMA 2B1UA 3TS5B 1L7ZA 5ER5A 2BKIB 2HPSA 4PE1A 2KGBC 3JTDC 3SJSA 2F3YA 2I2RE 4ORBB 1SCMC 4MVFA 2PASA 2Y5IA 1EJ3A 4MRYA 1S3PA 2LVKA 2LV7A 4BY5A 3CWGA 4ICBA 2FJUB 2JTTA 2K7OA 2KGRA 1J1DA 1CFFA 1G4YR 1CB1A 1Y1AA 1R6PA 3JVTC 3OX6A 3PFVA 3NXAA 4XYNA 3OP0A 1DGVA 1B8CA 2NCPA 3KO0A 1D1OA 1SYMA 2LMTA 2JT8A 1C7WA 3AAKA 2KSPA 4CIDA 2I7AA 2WCEA 2BKHB 1XFZO 2QPTA 2ZRTA 1GQMA 1XK4C 2CCMA 2LLUA 3DF0B 4PE7A 2LMVA 3D0YA 1YURA 2JWWA 1UURA 4C0KA 1TN4A 1J7PA 1IQ3A 2FCEA 4GFTA 3BQ3A 1YTZC 2D8NA 1SPYA 1M46A 2CTNA 3NSKA 1CDLA 1WDCC 1SKTA 3BUWB 4F0ZB 1ZFSA 4PE4A 1CDPA 1L2OB 2PALA 1DJHA 2LVIA 2K2FA 3GK4X 1SRAA 1B1GA 3O2PA 4GNKB 4MZJA 2E6WA 1FPWA 1OQPA 2TN4A 2NLNA 1NUBA 1QXPA 1E8AA 2MLFC 3TUYB 4C0LA 5I2QA 4C0JA 5F6TA 3I5FC 3OHMB 5AXIA 3WHTB 3IQOA 2G9BA 2VRGA 4CLNA 2EC6B 3LL8B 1IJ6A 4HRGA 2JPTA 2KDHA 3DF0A 4MRXA 1OMRA 2H2KA 1XFVO 1K96A 3OX5A 1F8HA 3I5GC 4BY4A 3ICBA 1YVHA 4HSZA 4NDBA 3D10A 1UHJA 2OS8C 4HRHA 2JU0A 3SG6A 2BCBA 4YRUA 1PSBA 1TRFA 2LM5A 5J3XA 1MUXA 4ORAB 3I5GB 4MZLA 1LVCD 1SR6C 1S1EA 1UWOA 3TZ1A 2ZNEA 1LA3A 3AKAA 4P5OE 1W7JB 2NXQA 4GAOA 1TNPA 1OE9B 4WRIA 3BUXB 4WQ2A 4OVNF 1N0YA 1BJFA 1WRZA 2L4IA 1AVSA 2M29A 3DVEA 2L98A 3WNXB 2JTZA 3BOWA 1QX2A 2IS9A 1F54A 1Y0VH 1TTXA 3TDUA 1DF0B 2M97A 3CGAA 4I5LB
chains in the Genus database with same CATH superfamily
1FBVA 1JFJA 3A4UB 2KI4C 1SMGA 1PSRA 1TCFA 4GGFA 1B7TY 4ZCUA 4AQJA 3EK7A 1SBJA 1YX7A 2LAPA 3DVKA 1FI5A 3DVMA 1DT7B 2CT9A 2KAXA 1ODBA 3KEVA 5ER4X 2KAYA 5G08A 3KPXA 1LINA 1QS7A 3PN7C 2LVJA 4FQTA 3D75A 2LE9B 3L47A 1FI6A 1M39A 1RWYA 1TUJA 5HKZA 4MLWA 2KBMA 1B8RA 2JNXA 3D78A 1BG1A 1C07A 2P71A 3EKHA 1NX0A 2M8UA 3OGNA 1MF8B 4JPZB 1CTRA 4FQOA 1OOGA 2K7DA 2JNFA 1NCXA 5GQQC 2KPHA 4MN0A 1SL7A 1T14A 1F4QA 1IGVA 1QVIY 2K7CA 1OOFA 1DJZA 3PM2A 1TNXA 4PHJA 1PVAA 4PT1A 4AOMA 2GGZA 5EL2A 1DF0A 1F70A 1IH0A 1MR8A 1KFXL 1WLZA 2H61C 1KQVA 1H4BA 1TOPA 2ERBA 2ZN9A 1C3YA 1YRUB 4YBHB 5FI6A 3NHTA 2RGIA 3JTDB 4OZDA 1Y6WA 3SG7A 1SCMB 3F45A 2CNPA 1TUZA 2KFGA 1QJTA 1LKJA 5TNCA 3UO9A 4NDCA 2WCFA 3NHIA 1B4CA 3D74A 1JF2A 1MHOA 2M7LA 1Z4HA 5HYDA 3EK4A 3NGVA 5CSNA 2F8PA 4N1GA 5DICA 1V1FA 1CFDA 1A03A 1B8LA 1KK7Y 2EGDA 3A8RA 3JVTB 1SCVA 2NZ0A 1WLMA 2KQ6A 1NP8A 1NX1A 3RZSA 3GOFA 4PCWA 3CZ0A 3CR4X 5IBWA 1Y1XA 2LCPA 2YGUA 5HKWA 3SS4A 3IQQA 4QJ5B 2BL0C 3C1VA 1BT6A 2KNEA 2QDIA 3VRPA 3GK2A 1S36A 1J7QA 2LP2A 2V53A 2WCJA 4Q04A 2Y1NA 1U5IB 3BUNB 1K90D 1J55A 2PMYA 1N65A 1QV0A 4QJ3B 4JD9A 2MBXA 3VRRA 1X02A 5DKNA 1YR5A 3IVTA 4KYNA 2JZIA 3FS7A 3DYEA 1WDCB 2G2BA 2KFFA 1J7RA 1QIVA 2L0PA 2HQWA 3EG5B 3R72A 1WY9A 4CPVA 1QIWA 1WRLA 1OOJA 1CLBA 4PDZA 2JXCA 1M31A 3VB1A 1LXFC 2QEOA 2LLSA 1QASA 1LS8A 5DKRA 2JT0A 3DVJA 1CM1A 1SW8A 5FYXA 4A4BA 4DCKA 5DKQA 3EVRA 2O60A 5BPJA 4DUQA 5D69A 3GK1A 3B86A 3I5FB 2WCBA 2ZNDA 3HCMA 1YUTA 2LLTA 3SIAA 3CZTX 3BJHA 1EL4A 1XK4A 3NSIA 3O6BA 1SY9A 1PRWA 3PATA 3CLNA 1M63B 1S6CA 4QJ4B 5AANA 2LUCA 1BR4B 1S5GZ 1U5IA 3LCPC 4GPLB 1S6JA 4MBEA 4YGEB 1EH2A 2BECA 1AJ4A 2JPOA 1MXEA 3VROA 2OS8B 4GUKA 1DJWA 2K8MB 5FI2A 2JULA 1Q80A 2M1KB 4I5JA 1AJ5A 1YUUA 1SR6B 4IJ7A 3S0GA 2KFHA 2LUXA 1OZOA 2P70A 1OOHA 2KI6D 2WC5A 4M2QA 2PVBA 5I8NA 2KLDA 4UPGA 3BFAA 1TNWA 2ZN8A 2KOTA 1UHHA 3B88A 3CR5X 4L9MA 1JSAA 4USLA 1G8IA 2KYCA 2MHHA 5KTYA 1CDNA 3B87A 2KAVA 1KK8C 3AAJA 5HKYA 3O78A 2L51A 1TCOB 2L4HA 3EVVA 1OZSA 1CLMA 1HQVA 1RTP1 1XFYO 1XFUO 2Q91A 2WORA 3VRQA 2EHBA 2OTGC 1J1EA 2KI4B 2QEBA 3R1PA 1EXRA 1NX2A 1NCZA 2KQYA 4M2OA 2E30A 4PE0A 1BLQA 1HT9A 1DC1A 2BBMA 1XVJA 3SG4A 1BODA 1SK6D 1GM0A 1KFXS 2OTGB 1F55A 1TIZA 1QLSA 1N2DA 4YGDB 2JC2A 1CKKA 1K95A 2WCLA 3VRNA 4IL1A 3PN7B 4MEWA 3H4SE 3E3RA 2JT3A 5B8IB 1A4PA 4P2YB 3CS1A 1KFUL 3FIAA 2M9GA 1QX5B 1QATA 3SIBA 5CSJA 4CFRA 2L50A 2MLEC 1OSAA 2M0RA 5PALA 3PSRA 1DJGA 1G33A 1A29A 4U8DA 2KBIA 1DJIA 1XFRA 1YRTB 3D76A 2JOJA 1JBAA 3RLZA 1DVIA 2F3ZA 2O5GA 3O4YA 1S5GY 4OKHA 1OW4A 3CZ2A 3I5IC 1DTLA 1S6IA 2M49B 1LA0A 2CXJA 2Q4UA 4JQ0D 2NCOA 3TS5C 1IKUA 2GTEA 2LANA 4PHKA 3TDIA 3RM1A 2PRUA 1RECA 2K0JA 2ZFDA 3BYAA 3CR2A 3MSEB 1QLKA 2K2AA 2L5YA 2MRDA 4INXA 1A2XA 1CLLA 3SS3A 1AUIB 1YX8A 3CTNA 1TNQA 4YI9A 4DRWA 1ALVA 2HQ8A 2WC8A 2COLB 1BU3A 1IRJA 3TDZA 4OR9B 1GJYA 5JOLA 1RJVA 4F7FA 3NSLA 1AK8A 4I5NB 4FTGA 1JFKA 5JJGA 2M3WA 4A4CA 3EK8A 2A4JA 3L4LA 3V2LA 1RROA 4PALA 1K9UA 3ZNIA 1CFCA 2GGMA 2L5XB 3S0AA 2ZKMX 5CSIA 2ZRSA 2F2OA 1YVLA 2H8VA 1V1GA 1UUSA 1K94A 4GGNA 1XFXO 1NX3A 2BL0B 1WRKA 3DZTA 1Y1UA 1KQMC 3PM8A 4WQ3A 2MAZA 2PSRA 4D1EA 4YI8A 2LP3A 2H61A 5D3OA 1K9PA 1PK0D 3B6XA 2KYFA 5HLOA 4JWQA 1J7OA 1JWDA 3AKBA 5CPVA 1KQMB 4YGAA 3SG2A 2LVVA 1P28A 2SASA 3M0WA 1JC2A 5I2LA 1K2HA 3WHUB 1RFJA 2ISDA 1L2OC 3BFHA 3QMEA 1OMDA 3CDNA 3PALA 1CMFA 2P6BB 5I2OA 2L2EA 1NSHA 1UHKA 1UHIA 1QX7A 2QEVA 1B7TZ 1M45A 5D7FA 1KSMA 2LC5A 3FE9A 1ZUZA 3CZ1A 2KI6C 4OCIA 3TUYC 1PULA 1DJXA 1KWOC 1RK9A 2K7BA 3SG3A 2KHNA 5AEQA 1NPQA 2FOTA 2R2IA 1KCYA 1IG5A 2LHLA 2CBLA 3BOWB 1OMVA 2M1UA 3Q8IA 1H8BA 2WOSA 1QTXA 4GBAA 5AFPA 2EC6C 1R2UA 1JF0A 1KWOB 4I5KA 1ALWA 1BR1B 1ZMZA 2AUCA 4GGFC 1C7VA 1DMOA 2HF5A 3R1VA 4M2PA 1DGUA 3LK1A 3B7AA 2BCAA 3CYZA 3BXKA 1SL8A 5CSFA 1BF5A 3DXLA 3OB1B 1NCYA 1UHNA 1EG3A 1XYDA 2JQ6A 2MJWB 3EKJA 1CNPA 2LHIA 4MSPA 1QVIZ 1K9KA 3KF9A 2Y1MA 4N5XA 3LK0A 3EVUA 5AERA 3S0EA 5K89A 2JXLA 3UNWA 1MWNA 2HETA 3FWBA 1AP4A 3D73A 1W7IB 2BE4A 1NYAA 3VGOA 3SS5A 1VRKA 3SG5A 2WC6A 2FCDA 1PALA 1XO5A 1EG4A 2AAOA 3OB2B 1A75B 2I18A 3FWCA 1UP5A 1KK8B 2F2PA 1GGZA 1KFUS 4ZCVA 4XJKB 5HL1A 5KU1A 4PHMA 4E68A 2K61A 3I5HC 4ORCB 4YGBB 1CM4A 2GV5A 3O4XA 3QRXA 4HREE 4OV2A 1B9AA 1KSOA 1PVBA 1S26D 1IWQA 4YGCB 1XFWO 1KK7Z 1AHRA 1MXLC 1IJ5A 1SNLA 3I5HB 3KHEA 4MZKA 1ZOTB 3S0FA 2WNDA 3IF7A 1K93D 2DOQA 1YUSA 4N1FA 4JKTA 5HLVA 3S0BA 2WCHA 3NSOA 1BOCA 2QACA 2BCXA 3BUOB 1F4OA 5I94A 2BBNA 1SL9A 2BAPA 4CFQA 1OOIX 2BNXA 5FI7A 1NWDA 3LLEA 1GGWA 3WXAA 2MA2A 1FF1A 3DD4A 1QV1A 3D77A 2K60A 2LNKA 2I94A 4R1EA 4DS7A 3ZWHA 2M7NA 4PHNA 1ORGA 1W9ZA 2F33A 2SCPA 4ETOA 2WCKA 1MQ1A 1CMGA 1BMOA 2LMUA 1FW4A 1IQ5A 3R1OA 1CFPA 4NDDA 5KSZA 2OPOA 1A75A 1DJYA 1B47A 1NIWA 1F71A 4INWA 1JUOA 4DIRA 3K21A 1DQEA 2Y4QA 4XJKA 3D0YB 1XA5A 3PLFB 3HX4A 2AMIA 3CABA 1ZACA 1SSEB 3BUMB 3I5IB 2BE6A 4AQIA 2JRFA 1K8UA 3FE6A 1CDMA 2B1UA 4TNCA 3TS5B 1L7ZA 5ER5A 2BKIB 2HPSA 4PE1A 2KGBC 3JTDC 3SJSA 2QEHA 2F3YA 2I2RE 4ORBB 1SCMC 4MVFA 2PASA 2Y5IA 1EJ3A 4MRYA 1S3PA 2LVKA 2LV7A 4BY5A 3CWGA 4ICBA 2FJUB 2JTTA 2K7OA 2KGRA 1J1DA 3N7HA 1CFFA 1G4YR 1CB1A 1Y1AA 1R6PA 3JVTC 3OX6A 2PQLA 3NXAA 3PFVA 3OP0A 1DGVA 4XYNA 1B8CA 2NCPA 3KO0A 1D1OA 1SYMA 2LMTA 2JT8A 1C7WA 3AAKA 2KSPA 4CIDA 2I7AA 1IIOA 2WCEA 2BKHB 1XFZO 2QPTA 2ZRTA 1GQMA 1XK4C 2CCMA 2LLUA 3DF0B 4PE7A 2LMVA 3BFBA 3D0YA 1YURA 2JWWA 1UURA 4C0KA 1TN4A 1J7PA 1IQ3A 2FCEA 4GFTA 3BQ3A 1YTZC 2D8NA 3S0DA 1SPYA 1M46A 2CTNA 3NSKA 1CDLA 1WDCC 1SKTA 3BUWB 4F0ZB 1ZFSA 4PE4A 3OBVA 1CDPA 4NQGA 1L2OB 2PALA 1DJHA 1TWOA 2LVIA 2K2FA 3GK4X 1SRAA 3DY9A 1B1GA 3O2PA 4GNKB 4MZJA 2E6WA 1FPWA 1OQPA 2TN4A 2NLNA 1NUBA 1QXPA 1E8AA 3K1EA 2MLFC 3L4AA 3TUYB 4C0LA 5I2QA 1DELA 5F6TA 3I5FC 4C0JA 3OHMB 5AXIA 3WHTB 2PYQA 3IQOA 2G9BA 2VRGA 4CLNA 2EC6B 2L2CA 1IJ6A 3LL8B 4HRGA 2JPTA 2KDHA 3DF0A 4MRXA 1OMRA 2H2KA 1XFVO 2WCMA 1DEKA 1K96A 3OX5A 1F8HA 2FJYA 3I5GC 4BY4A 3ICBA 1YVHA 3PJIA 4HSZA 4NDBA 3D10A 1UHJA 2OS8C 4HRHA 2JU0A 3SG6A 2BCBA 4YRUA 1PSBA 1TRFA 2LM5A 5J3XA 1MUXA 4ORAB 3I5GB 4MZLA 1LVCD 1SR6C 1S1EA 1UWOA 3TZ1A 2ZNEA 1LA3A 3AKAA 4P5OE 1W7JB 2NXQA 4GAOA 1TNPA 1OE9B 4WRIA 3BUXB 1QWVA 4WQ2A 4OVNF 1N0YA 1BJFA 1WRZA 2KLEA 1AVSA 2L4IA 2M29A 3DVEA 3FE8A 2L98A 3WNXB 2JTZA 3BOWA 1Z2CB 1QX2A 2IS9A 1F54A 1Y0VH 1TTXA 3TDUA 1C3ZA 1DF0B 2M97A 3CGAA 4I5LB
chains in the Genus database with same CATH topology
1FBVA 1JFJA 3A4UB 2KI4C 1SMGA 1PSRA 1TCFA 4GGFA 1B7TY 4ZCUA 4AQJA 3EK7A 1SBJA 1YX7A 2LAPA 3DVKA 1FI5A 3DVMA 1DT7B 2CT9A 2KAXA 1ODBA 3KEVA 5ER4X 2KAYA 5G08A 3KPXA 1LINA 1QS7A 3PN7C 2LVJA 2LE9B 1FI6A 1M39A 1RWYA 5HKZA 4MLWA 2KBMA 1B8RA 2JNXA 1BG1A 1C07A 3EKHA 1NX0A 2M8UA 4JPZB 1MF8B 1CTRA 4FQOA 2K7DA 2JNFA 1NCXA 5GQQC 4MN0A 1SL7A 1F4QA 1IGVA 1QVIY 2K7CA 1DJZA 4PHJA 1TNXA 4AOMA 1PVAA 1F70A 2GGZA 1DF0A 1IH0A 1MR8A 1KFXL 1WLZA 2H61C 1KQVA 1H4BA 1TOPA 2ZN9A 1YRUB 4YBHB 2RGIA 3JTDB 1Y6WA 3SG7A 1SCMB 3F45A 2CNPA 2KFGA 1QJTA 1LKJA 5TNCA 4NDCA 2WCFA 1B4CA 1JF2A 1MHOA 2M7LA 5HYDA 3EK4A 5CSNA 2F8PA 4N1GA 1V1FA 1CFDA 1A03A 1B8LA 1KK7Y 2EGDA 3A8RA 3JVTB 1SCVA 2NZ0A 1WLMA 2KQ6A 1NP8A 1NX1A 3GOFA 4PCWA 3CR4X 5IBWA 1Y1XA 2LCPA 5HKWA 3IQQA 2BL0C 3C1VA 1BT6A 2KNEA 3VRPA 3GK2A 1S36A 1J7QA 2LP2A 2V53A 4Q04A 2Y1NA 1U5IB 3BUNB 1K90D 1J55A 2PMYA 1N65A 1QV0A 4QJ3B 2MBXA 3VRRA 1X02A 5DKNA 1YR5A 2JZIA 3FS7A 1WDCB 2G2BA 2KFFA 1J7RA 1QIVA 2L0PA 2HQWA 1WY9A 4CPVA 1QIWA 1WRLA 1OOJA 1CLBA 4PDZA 2JXCA 1M31A 1LXFC 2LLSA 1QASA 5DKRA 2JT0A 3DVJA 1CM1A 1SW8A 5FYXA 4A4BA 4DCKA 5DKQA 3EVRA 2O60A 5BPJA 4DUQA 5D69A 3GK1A 3I5FB 2WCBA 2ZNDA 3HCMA 1YUTA 2LLTA 3SIAA 3CZTX 1EL4A 1XK4A 3NSIA 3O6BA 1SY9A 1PRWA 3PATA 3CLNA 1M63B 1S6CA 4QJ4B 5AANA 2LUCA 1BR4B 1S5GZ 1U5IA 3LCPC 4GPLB 1S6JA 4MBEA 4YGEB 1EH2A 2BECA 1AJ4A 1MXEA 3VROA 2OS8B 4GUKA 1DJWA 2K8MB 2JULA 1Q80A 2M1KB 4I5JA 1AJ5A 1YUUA 1SR6B 2KFHA 2LUXA 1OZOA 4M2QA 5I8NA 2KI6D 2PVBA 4UPGA 1TNWA 2ZN8A 2KOTA 1UHHA 3CR5X 1JSAA 4L9MA 4USLA 1G8IA 2KYCA 2MHHA 5KTYA 1CDNA 2KAVA 1KK8C 3AAJA 5HKYA 3O78A 2L51A 1TCOB 2L4HA 3EVVA 1OZSA 1CLMA 1HQVA 1RTP1 1XFYO 1XFUO 2Q91A 2WORA 3VRQA 2EHBA 2OTGC 1J1EA 2KI4B 1EXRA 1NX2A 1NCZA 2KQYA 4M2OA 2E30A 4PE0A 1BLQA 1HT9A 2BBMA 1XVJA 3SG4A 1BODA 1SK6D 1KFXS 2OTGB 1F55A 1TIZA 1QLSA 1N2DA 4YGDB 2JC2A 1CKKA 1K95A 3VRNA 4IL1A 3PN7B 4MEWA 3H4SE 3E3RA 2JT3A 5B8IB 1A4PA 4P2YB 3CS1A 1KFUL 3FIAA 2M9GA 1QX5B 1QATA 3SIBA 5CSJA 4CFRA 2L50A 2MLEC 1OSAA 2M0RA 5PALA 3PSRA 1DJGA 1G33A 1A29A 4U8DA 2KBIA 1DJIA 1YRTB 2JOJA 1JBAA 3RLZA 1DVIA 2F3ZA 2O5GA 3O4YA 1S5GY 4OKHA 3I5IC 1DTLA 1S6IA 2M49B 1LA0A 2CXJA 2Q4UA 4JQ0D 2NCOA 3TS5C 1IKUA 3TDIA 2LANA 4PHKA 3RM1A 2PRUA 1RECA 2K0JA 2ZFDA 3BYAA 3CR2A 3MSEB 1QLKA 2K2AA 2MRDA 4NQGA 1A2XA 1CLLA 1AUIB 1YX8A 3CTNA 1TNQA 4YI9A 4DRWA 1ALVA 2HQ8A 2WC8A 2COLB 1BU3A 1IRJA 3TDZA 4OR9B 1GJYA 5JOLA 1RJVA 3NSLA 1AK8A 4I5NB 4FTGA 1JFKA 5JJGA 2M3WA 4A4CA 3EK8A 2A4JA 1RROA 4PALA 1K9UA 3ZNIA 1CFCA 2GGMA 2L5XB 2ZKMX 5CSIA 2ZRSA 2F2OA 1YVLA 1V1GA 1UUSA 1K94A 4GGNA 1XFXO 1NX3A 2BL0B 1WRKA 1Y1UA 1KQMC 3PM8A 4WQ3A 2MAZA 2PSRA 4D1EA 4YI8A 2LP3A 2H61A 1K9PA 1PK0D 1J7OA 2KYFA 5HLOA 4JWQA 1JWDA 3AKBA 5CPVA 1KQMB 4YGAA 3SG2A 2LVVA 2SASA 3M0WA 1JC2A 5I2LA 1K2HA 3WHUB 1RFJA 2ISDA 1L2OC 1OMDA 3PALA 1CMFA 2P6BB 5I2OA 2L2EA 1NSHA 1UHKA 1UHIA 1QX7A 1B7TZ 1M45A 5D7FA 1KSMA 2LC5A 1ZUZA 2KI6C 4OCIA 3TUYC 1PULA 1DJXA 1KWOC 1RK9A 2K7BA 3SG3A 2KHNA 5AEQA 1NPQA 2FOTA 2R2IA 1KCYA 1IG5A 2LHLA 2CBLA 3BOWB 1OMVA 2M1UA 1H8BA 2WOSA 1QTXA 4GBAA 5AFPA 2EC6C 1R2UA 1JF0A 1KWOB 4I5KA 1ALWA 1BR1B 1ZMZA 2AUCA 4GGFC 1C7VA 1DMOA 2HF5A 4M2PA 1DGUA 3LK1A 2BCAA 3BXKA 1SL8A 5CSFA 1BF5A 3OB1B 1NCYA 1UHNA 1EG3A 1XYDA 2JQ6A 2MJWB 3EKJA 1CNPA 2LHIA 4MSPA 1QVIZ 1K9KA 3KF9A 2Y1MA 4N5XA 3LK0A 3EVUA 5AERA 5K89A 2JXLA 1MWNA 2HETA 3FWBA 1AP4A 1W7IB 2BE4A 1NYAA 3VGOA 1VRKA 3SG5A 2FCDA 1PALA 1XO5A 1EG4A 2AAOA 3OB2B 1A75B 2I18A 3FWCA 1UP5A 1KK8B 2F2PA 1GGZA 1KFUS 4ZCVA 4XJKB 5KU1A 4PHMA 4E68A 2K61A 3I5HC 4ORCB 4YGBB 1CM4A 2GV5A 3QRXA 4OV2A 4HREE 4QJ5B 1B9AA 1KSOA 1PVBA 1S26D 1IWQA 4YGCB 1XFWO 1KK7Z 1AHRA 1MXLC 1IJ5A 1SNLA 3I5HB 3KHEA 4MZKA 1ZOTB 2WNDA 3IF7A 1K93D 2DOQA 1YUSA 4N1FA 5HLVA 3NSOA 1BOCA 2QACA 2BCXA 3BUOB 1F4OA 2BBNA 1SL9A 4CFQA 1NWDA 3LLEA 1GGWA 3WXAA 2MA2A 1FF1A 3DD4A 1QV1A 2LNKA 2I94A 4R1EA 4DS7A 3ZWHA 2M7NA 4PHNA 2F33A 2SCPA 4ETOA 1MQ1A 1CMGA 1BMOA 2LMUA 1FW4A 1IQ5A 1CFPA 4NDDA 5KSZA 2OPOA 1A75A 1DJYA 1B47A 1NIWA 1F71A 1JUOA 4DIRA 3K21A 2Y4QA 4XJKA 3D0YB 1XA5A 3PLFB 3HX4A 2AMIA 1ZACA 3BUMB 3I5IB 2BE6A 4AQIA 2JRFA 1K8UA 4TNCA 1CDMA 2B1UA 3TS5B 1L7ZA 5ER5A 2BKIB 2HPSA 4PE1A 2KGBC 3JTDC 3SJSA 2F3YA 2I2RE 4ORBB 1SCMC 4MVFA 2PASA 2Y5IA 1EJ3A 4MRYA 1S3PA 2LVKA 2LV7A 4BY5A 3CWGA 4ICBA 2FJUB 2JTTA 2K7OA 2KGRA 1J1DA 1CFFA 1G4YR 1CB1A 1Y1AA 1R6PA 3JVTC 3OX6A 3PFVA 3NXAA 4XYNA 3OP0A 1DGVA 1B8CA 2NCPA 3KO0A 1D1OA 1SYMA 2LMTA 2JT8A 1C7WA 3AAKA 2KSPA 4CIDA 2I7AA 2WCEA 2BKHB 1XFZO 2QPTA 2ZRTA 1GQMA 1XK4C 2CCMA 2LLUA 3DF0B 4PE7A 2LMVA 3D0YA 1YURA 2JWWA 1UURA 4C0KA 1TN4A 1J7PA 1IQ3A 2FCEA 4GFTA 3BQ3A 1YTZC 2D8NA 1SPYA 1M46A 2CTNA 3NSKA 1CDLA 1WDCC 1SKTA 3BUWB 4F0ZB 1ZFSA 4PE4A 1CDPA 1L2OB 2PALA 1DJHA 2LVIA 2K2FA 3GK4X 1SRAA 1B1GA 3O2PA 4GNKB 4MZJA 2E6WA 1FPWA 1OQPA 2TN4A 2NLNA 1NUBA 1QXPA 1E8AA 2MLFC 3TUYB 4C0LA 5I2QA 4C0JA 5F6TA 3I5FC 3OHMB 5AXIA 3WHTB 3IQOA 2G9BA 2VRGA 4CLNA 2EC6B 3LL8B 1IJ6A 4HRGA 2JPTA 2KDHA 3DF0A 4MRXA 1OMRA 2H2KA 1XFVO 1K96A 3OX5A 1F8HA 3I5GC 4BY4A 3ICBA 1YVHA 4HSZA 4NDBA 3D10A 1UHJA 2OS8C 4HRHA 2JU0A 3SG6A 2BCBA 4YRUA 1PSBA 1TRFA 2LM5A 5J3XA 1MUXA 4ORAB 3I5GB 4MZLA 1LVCD 1SR6C 1S1EA 1UWOA 3TZ1A 2ZNEA 1LA3A 3AKAA 4P5OE 1W7JB 2NXQA 4GAOA 1TNPA 1OE9B 4WRIA 3BUXB 4WQ2A 4OVNF 1N0YA 1BJFA 1WRZA 2L4IA 1AVSA 2M29A 3DVEA 2L98A 3WNXB 2JTZA 3BOWA 1QX2A 2IS9A 1F54A 1Y0VH 1TTXA 3TDUA 1DF0B 2M97A 3CGAA 4I5LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBV A;  1JFJ A;  3A4U B;  2KI4 C;  1SMG A;  1PSR A;  1TCF A;  4GGF A;  1B7T Y;  4ZCU A;  4AQJ A;  3EK7 A;  1SBJ A;  1YX7 A;  2LAP A;  3DVK A;  1FI5 A;  3DVM A;  1DT7 B;  2CT9 A;  2KAX A;  1ODB A;  3KEV A;  5ER4 X;  2KAY A;  5G08 A;  3KPX A;  1LIN A;  1QS7 A;  3PN7 C;  2LVJ A;  2LE9 B;  1FI6 A;  1M39 A;  1RWY A;  5HKZ A;  4MLW A;  2KBM A;  1B8R A;  2JNX A;  1BG1 A;  1C07 A;  3EKH A;  1NX0 A;  2M8U A;  4JPZ B;  1MF8 B;  1CTR A;  4FQO A;  2K7D A;  2JNF A;  1NCX A;  5GQQ C;  4MN0 A;  1SL7 A;  1F4Q A;  1IGV A;  1QVI Y;  2K7C A;  1DJZ A;  4PHJ A;  1TNX A;  4AOM A;  1PVA A;  1F70 A;  2GGZ A;  1DF0 A;  1IH0 A;  1MR8 A;  1KFX L;  1WLZ A;  2H61 C;  1KQV A;  1H4B A;  1TOP A;  2ZN9 A;  1YRU B;  4YBH B;  2RGI A;  3JTD B;  1Y6W A;  3SG7 A;  1SCM B;  3F45 A;  2CNP A;  2KFG A;  1QJT A;  1LKJ A;  5TNC A;  4NDC A;  2WCF A;  1B4C A;  1JF2 A;  1MHO A;  2M7L A;  5HYD A;  3EK4 A;  5CSN A;  2F8P A;  4N1G A;  1V1F A;  1CFD A;  1A03 A;  1B8L A;  1KK7 Y;  2EGD A;  3A8R A;  3JVT B;  1SCV A;  2NZ0 A;  1WLM A;  2KQ6 A;  1NP8 A;  1NX1 A;  3GOF A;  4PCW A;  3CR4 X;  5IBW A;  1Y1X A;  2LCP A;  5HKW A;  3IQQ A;  2BL0 C;  3C1V A;  1BT6 A;  2KNE A;  3VRP A;  3GK2 A;  1S36 A;  1J7Q A;  2LP2 A;  2V53 A;  4Q04 A;  2Y1N A;  1U5I B;  3BUN B;  1K90 D;  1J55 A;  2PMY A;  1N65 A;  1QV0 A;  4QJ3 B;  2MBX A;  3VRR A;  1X02 A;  5DKN A;  1YR5 A;  2JZI A;  3FS7 A;  1WDC B;  2G2B A;  2KFF A;  1J7R A;  1QIV A;  2L0P A;  2HQW A;  1WY9 A;  4CPV A;  1QIW A;  1WRL A;  1OOJ A;  1CLB A;  4PDZ A;  2JXC A;  1M31 A;  1LXF C;  2LLS A;  1QAS A;  5DKR A;  2JT0 A;  3DVJ A;  1CM1 A;  1SW8 A;  5FYX A;  4A4B A;  4DCK A;  5DKQ A;  3EVR A;  2O60 A;  5BPJ A;  4DUQ A;  5D69 A;  3GK1 A;  3I5F B;  2WCB A;  2ZND A;  3HCM A;  1YUT A;  2LLT A;  3SIA A;  3CZT X;  1EL4 A;  1XK4 A;  3NSI A;  3O6B A;  1SY9 A;  1PRW A;  3PAT A;  3CLN A;  1M63 B;  1S6C A;  4QJ4 B;  5AAN A;  2LUC A;  1BR4 B;  1S5G Z;  1U5I A;  3LCP C;  4GPL B;  1S6J A;  4MBE A;  4YGE B;  1EH2 A;  2BEC A;  1AJ4 A;  1MXE A;  3VRO A;  2OS8 B;  4GUK A;  1DJW A;  2K8M B;  2JUL A;  1Q80 A;  2M1K B;  4I5J A;  1AJ5 A;  1YUU A;  1SR6 B;  2KFH A;  2LUX A;  1OZO A;  4M2Q A;  5I8N A;  2KI6 D;  2PVB A;  4UPG A;  1TNW A;  2ZN8 A;  2KOT A;  1UHH A;  3CR5 X;  1JSA A;  4L9M A;  4USL A;  1G8I A;  2KYC A;  2MHH A;  5KTY A;  1CDN A;  2KAV A;  1KK8 C;  3AAJ A;  5HKY A;  3O78 A;  2L51 A;  1TCO B;  2L4H A;  3EVV A;  1OZS A;  1CLM A;  1HQV A;  1RTP 1;  1XFY O;  1XFU O;  2Q91 A;  2WOR A;  3VRQ A;  2EHB A;  2OTG C;  1J1E A;  2KI4 B;  1EXR A;  1NX2 A;  1NCZ A;  2KQY A;  4M2O A;  2E30 A;  4PE0 A;  1BLQ A;  1HT9 A;  2BBM A;  1XVJ A;  3SG4 A;  1BOD A;  1SK6 D;  1KFX S;  2OTG B;  1F55 A;  1TIZ A;  1QLS A;  1N2D A;  4YGD B;  2JC2 A;  1CKK A;  1K95 A;  3VRN A;  4IL1 A;  3PN7 B;  4MEW A;  3H4S E;  3E3R A;  2JT3 A;  5B8I B;  1A4P A;  4P2Y B;  3CS1 A;  1KFU L;  3FIA A;  2M9G A;  1QX5 B;  1QAT A;  3SIB A;  5CSJ A;  4CFR A;  2L50 A;  2MLE C;  1OSA A;  2M0R A;  5PAL A;  3PSR A;  1DJG A;  1G33 A;  1A29 A;  4U8D A;  2KBI A;  1DJI A;  1YRT B;  2JOJ A;  1JBA A;  3RLZ A;  1DVI A;  2F3Z A;  2O5G A;  3O4Y A;  1S5G Y;  4OKH A;  3I5I C;  1DTL A;  1S6I A;  2M49 B;  1LA0 A;  2CXJ A;  2Q4U A;  4JQ0 D;  2NCO A;  3TS5 C;  1IKU A;  3TDI A;  2LAN A;  4PHK A;  3RM1 A;  2PRU A;  1REC A;  2K0J A;  2ZFD A;  3BYA A;  3CR2 A;  3MSE B;  1QLK A;  2K2A A;  2MRD A;  4NQG A;  1A2X A;  1CLL A;  1AUI B;  1YX8 A;  3CTN A;  1TNQ A;  4YI9 A;  4DRW A;  1ALV A;  2HQ8 A;  2WC8 A;  2COL B;  1BU3 A;  1IRJ A;  3TDZ A;  4OR9 B;  1GJY A;  5JOL A;  1RJV A;  3NSL A;  1AK8 A;  4I5N B;  4FTG A;  1JFK A;  5JJG A;  2M3W A;  4A4C A;  3EK8 A;  2A4J A;  1RRO A;  4PAL A;  1K9U A;  3ZNI A;  1CFC A;  2GGM A;  2L5X B;  2ZKM X;  5CSI A;  2ZRS A;  2F2O A;  1YVL A;  1V1G A;  1UUS A;  1K94 A;  4GGN A;  1XFX O;  1NX3 A;  2BL0 B;  1WRK A;  1Y1U A;  1KQM C;  3PM8 A;  4WQ3 A;  2MAZ A;  2PSR A;  4D1E A;  4YI8 A;  2LP3 A;  2H61 A;  1K9P A;  1PK0 D;  1J7O A;  2KYF A;  5HLO A;  4JWQ A;  1JWD A;  3AKB A;  5CPV A;  1KQM B;  4YGA A;  3SG2 A;  2LVV A;  2SAS A;  3M0W A;  1JC2 A;  5I2L A;  1K2H A;  3WHU B;  1RFJ A;  2ISD A;  1L2O C;  1OMD A;  3PAL A;  1CMF A;  2P6B B;  5I2O A;  2L2E A;  1NSH A;  1UHK A;  1UHI A;  1QX7 A;  1B7T Z;  1M45 A;  5D7F A;  1KSM A;  2LC5 A;  1ZUZ A;  2KI6 C;  4OCI A;  3TUY C;  1PUL A;  1DJX A;  1KWO C;  1RK9 A;  2K7B A;  3SG3 A;  2KHN A;  5AEQ A;  1NPQ A;  2FOT A;  2R2I A;  1KCY A;  1IG5 A;  2LHL A;  2CBL A;  3BOW B;  1OMV A;  2M1U A;  1H8B A;  2WOS A;  1QTX A;  4GBA A;  5AFP A;  2EC6 C;  1R2U A;  1JF0 A;  1KWO B;  4I5K A;  1ALW A;  1BR1 B;  1ZMZ A;  2AUC A;  4GGF C;  1C7V A;  1DMO A;  2HF5 A;  4M2P A;  1DGU A;  3LK1 A;  2BCA A;  3BXK A;  1SL8 A;  5CSF A;  1BF5 A;  3OB1 B;  1NCY A;  1UHN A;  1EG3 A;  1XYD A;  2JQ6 A;  2MJW B;  3EKJ A;  1CNP A;  2LHI A;  4MSP A;  1QVI Z;  1K9K A;  3KF9 A;  2Y1M A;  4N5X A;  3LK0 A;  3EVU A;  5AER A;  5K89 A;  2JXL A;  1MWN A;  2HET A;  3FWB A;  1AP4 A;  1W7I B;  2BE4 A;  1NYA A;  3VGO A;  1VRK A;  3SG5 A;  2FCD A;  1PAL A;  1XO5 A;  1EG4 A;  2AAO A;  3OB2 B;  1A75 B;  2I18 A;  3FWC A;  1UP5 A;  1KK8 B;  2F2P A;  1GGZ A;  1KFU S;  4ZCV A;  4XJK B;  5KU1 A;  4PHM A;  4E68 A;  2K61 A;  3I5H C;  4ORC B;  4YGB B;  1CM4 A;  2GV5 A;  3QRX A;  4OV2 A;  4HRE E;  4QJ5 B;  1B9A A;  1KSO A;  1PVB A;  1S26 D;  1IWQ A;  4YGC B;  1XFW O;  1KK7 Z;  1AHR A;  1MXL C;  1IJ5 A;  1SNL A;  3I5H B;  3KHE A;  4MZK A;  1ZOT B;  2WND A;  3IF7 A;  1K93 D;  2DOQ A;  1YUS A;  4N1F A;  5HLV A;  3NSO A;  1BOC A;  2QAC A;  2BCX A;  3BUO B;  1F4O A;  2BBN A;  1SL9 A;  4CFQ A;  1NWD A;  3LLE A;  1GGW A;  3WXA A;  2MA2 A;  1FF1 A;  3DD4 A;  1QV1 A;  2LNK A;  2I94 A;  4R1E A;  4DS7 A;  3ZWH A;  2M7N A;  4PHN A;  2F33 A;  2SCP A;  4ETO A;  1MQ1 A;  1CMG A;  1BMO A;  2LMU A;  1FW4 A;  1IQ5 A;  1CFP A;  4NDD A;  5KSZ A;  2OPO A;  1A75 A;  1DJY A;  1B47 A;  1NIW A;  1F71 A;  1JUO A;  4DIR A;  3K21 A;  2Y4Q A;  4XJK A;  3D0Y B;  1XA5 A;  3PLF B;  3HX4 A;  2AMI A;  1ZAC A;  3BUM B;  3I5I B;  2BE6 A;  4AQI A;  2JRF A;  1K8U A;  4TNC A;  1CDM A;  2B1U A;  3TS5 B;  1L7Z A;  5ER5 A;  2BKI B;  2HPS A;  4PE1 A;  2KGB C;  3JTD C;  3SJS A;  2F3Y A;  2I2R E;  4ORB B;  1SCM C;  4MVF A;  2PAS A;  2Y5I A;  1EJ3 A;  4MRY A;  1S3P A;  2LVK A;  2LV7 A;  4BY5 A;  3CWG A;  4ICB A;  2FJU B;  2JTT A;  2K7O A;  2KGR A;  1J1D A;  1CFF A;  1G4Y R;  1CB1 A;  1Y1A A;  1R6P A;  3JVT C;  3OX6 A;  3PFV A;  3NXA A;  4XYN A;  3OP0 A;  1DGV A;  1B8C A;  2NCP A;  3KO0 A;  1D1O A;  1SYM A;  2LMT A;  2JT8 A;  1C7W A;  3AAK A;  2KSP A;  4CID A;  2I7A A;  2WCE A;  2BKH B;  1XFZ O;  2QPT A;  2ZRT A;  1GQM A;  1XK4 C;  2CCM A;  2LLU A;  3DF0 B;  4PE7 A;  2LMV A;  3D0Y A;  1YUR A;  2JWW A;  1UUR A;  4C0K A;  1TN4 A;  1J7P A;  1IQ3 A;  2FCE A;  4GFT A;  3BQ3 A;  1YTZ C;  2D8N A;  1SPY A;  1M46 A;  2CTN A;  3NSK A;  1CDL A;  1WDC C;  1SKT A;  3BUW B;  4F0Z B;  1ZFS A;  4PE4 A;  1CDP A;  1L2O B;  2PAL A;  1DJH A;  2LVI A;  2K2F A;  3GK4 X;  1SRA A;  1B1G A;  3O2P A;  4GNK B;  4MZJ A;  2E6W A;  1FPW A;  1OQP A;  2TN4 A;  2NLN A;  1NUB A;  1QXP A;  1E8A A;  2MLF C;  3TUY B;  4C0L A;  5I2Q A;  4C0J A;  5F6T A;  3I5F C;  3OHM B;  5AXI A;  3WHT B;  3IQO A;  2G9B A;  2VRG A;  4CLN A;  2EC6 B;  3LL8 B;  1IJ6 A;  4HRG A;  2JPT A;  2KDH A;  3DF0 A;  4MRX A;  1OMR A;  2H2K A;  1XFV O;  1K96 A;  3OX5 A;  1F8H A;  3I5G C;  4BY4 A;  3ICB A;  1YVH A;  4HSZ A;  4NDB A;  3D10 A;  1UHJ A;  2OS8 C;  4HRH A;  2JU0 A;  3SG6 A;  2BCB A;  4YRU A;  1PSB A;  1TRF A;  2LM5 A;  5J3X A;  1MUX A;  4ORA B;  3I5G B;  4MZL A;  1LVC D;  1SR6 C;  1S1E A;  1UWO A;  3TZ1 A;  2ZNE A;  1LA3 A;  3AKA A;  4P5O E;  1W7J B;  2NXQ A;  4GAO A;  1TNP A;  1OE9 B;  4WRI A;  3BUX B;  4WQ2 A;  4OVN F;  1N0Y A;  1BJF A;  1WRZ A;  2L4I A;  1AVS A;  2M29 A;  3DVE A;  2L98 A;  3WNX B;  2JTZ A;  3BOW A;  1QX2 A;  2IS9 A;  1F54 A;  1Y0V H;  1TTX A;  3TDU A;  1DF0 B;  2M97 A;  3CGA A;  4I5L B; 
#chains in the Genus database with same CATH topology
 1FBV A;  1JFJ A;  3A4U B;  2KI4 C;  1SMG A;  1PSR A;  1TCF A;  4GGF A;  1B7T Y;  4ZCU A;  4AQJ A;  3EK7 A;  1SBJ A;  1YX7 A;  2LAP A;  3DVK A;  1FI5 A;  3DVM A;  1DT7 B;  2CT9 A;  2KAX A;  1ODB A;  3KEV A;  5ER4 X;  2KAY A;  5G08 A;  3KPX A;  1LIN A;  1QS7 A;  3PN7 C;  2LVJ A;  4FQT A;  3D75 A;  2LE9 B;  3L47 A;  1FI6 A;  1M39 A;  1RWY A;  1TUJ A;  5HKZ A;  4MLW A;  2KBM A;  1B8R A;  2JNX A;  3D78 A;  1BG1 A;  1C07 A;  2P71 A;  3EKH A;  1NX0 A;  2M8U A;  3OGN A;  1MF8 B;  4JPZ B;  1CTR A;  4FQO A;  1OOG A;  2K7D A;  2JNF A;  1NCX A;  5GQQ C;  2KPH A;  4MN0 A;  1SL7 A;  1T14 A;  1F4Q A;  1IGV A;  1QVI Y;  2K7C A;  1OOF A;  1DJZ A;  3PM2 A;  1TNX A;  4PHJ A;  1PVA A;  4PT1 A;  4AOM A;  2GGZ A;  5EL2 A;  1DF0 A;  1F70 A;  1IH0 A;  1MR8 A;  1KFX L;  1WLZ A;  2H61 C;  1KQV A;  1H4B A;  1TOP A;  2ERB A;  2ZN9 A;  1C3Y A;  1YRU B;  4YBH B;  5FI6 A;  3NHT A;  2RGI A;  3JTD B;  4OZD A;  1Y6W A;  3SG7 A;  1SCM B;  3F45 A;  2CNP A;  1TUZ A;  2KFG A;  1QJT A;  1LKJ A;  5TNC A;  3UO9 A;  4NDC A;  2WCF A;  3NHI A;  1B4C A;  3D74 A;  1JF2 A;  1MHO A;  2M7L A;  1Z4H A;  5HYD A;  3EK4 A;  3NGV A;  5CSN A;  2F8P A;  4N1G A;  5DIC A;  1V1F A;  1CFD A;  1A03 A;  1B8L A;  1KK7 Y;  2EGD A;  3A8R A;  3JVT B;  1SCV A;  2NZ0 A;  1WLM A;  2KQ6 A;  1NP8 A;  1NX1 A;  3RZS A;  3GOF A;  4PCW A;  3CZ0 A;  3CR4 X;  5IBW A;  1Y1X A;  2LCP A;  2YGU A;  5HKW A;  3SS4 A;  3IQQ A;  4QJ5 B;  2BL0 C;  3C1V A;  1BT6 A;  2KNE A;  2QDI A;  3VRP A;  3GK2 A;  1S36 A;  1J7Q A;  2LP2 A;  2V53 A;  2WCJ A;  4Q04 A;  2Y1N A;  1U5I B;  3BUN B;  1K90 D;  1J55 A;  2PMY A;  1N65 A;  1QV0 A;  4QJ3 B;  4JD9 A;  2MBX A;  3VRR A;  1X02 A;  5DKN A;  1YR5 A;  3IVT A;  4KYN A;  2JZI A;  3FS7 A;  3DYE A;  1WDC B;  2G2B A;  2KFF A;  1J7R A;  1QIV A;  2L0P A;  2HQW A;  3EG5 B;  3R72 A;  1WY9 A;  4CPV A;  1QIW A;  1WRL A;  1OOJ A;  1CLB A;  4PDZ A;  2JXC A;  1M31 A;  3VB1 A;  1LXF C;  2QEO A;  2LLS A;  1QAS A;  1LS8 A;  5DKR A;  2JT0 A;  3DVJ A;  1CM1 A;  1SW8 A;  5FYX A;  4A4B A;  4DCK A;  5DKQ A;  3EVR A;  2O60 A;  5BPJ A;  4DUQ A;  5D69 A;  3GK1 A;  3B86 A;  3I5F B;  2WCB A;  2ZND A;  3HCM A;  1YUT A;  2LLT A;  3SIA A;  3CZT X;  3BJH A;  1EL4 A;  1XK4 A;  3NSI A;  3O6B A;  1SY9 A;  1PRW A;  3PAT A;  3CLN A;  1M63 B;  1S6C A;  4QJ4 B;  5AAN A;  2LUC A;  1BR4 B;  1S5G Z;  1U5I A;  3LCP C;  4GPL B;  1S6J A;  4MBE A;  4YGE B;  1EH2 A;  2BEC A;  1AJ4 A;  2JPO A;  1MXE A;  3VRO A;  2OS8 B;  4GUK A;  1DJW A;  2K8M B;  5FI2 A;  2JUL A;  1Q80 A;  2M1K B;  4I5J A;  1AJ5 A;  1YUU A;  1SR6 B;  4IJ7 A;  3S0G A;  2KFH A;  2LUX A;  1OZO A;  2P70 A;  1OOH A;  2KI6 D;  2WC5 A;  4M2Q A;  2PVB A;  5I8N A;  2KLD A;  4UPG A;  3BFA A;  1TNW A;  2ZN8 A;  2KOT A;  1UHH A;  3B88 A;  3CR5 X;  4L9M A;  1JSA A;  4USL A;  1G8I A;  2KYC A;  2MHH A;  5KTY A;  1CDN A;  3B87 A;  2KAV A;  1KK8 C;  3AAJ A;  5HKY A;  3O78 A;  2L51 A;  1TCO B;  2L4H A;  3EVV A;  1OZS A;  1CLM A;  1HQV A;  1RTP 1;  1XFY O;  1XFU O;  2Q91 A;  2WOR A;  3VRQ A;  2EHB A;  2OTG C;  1J1E A;  2KI4 B;  2QEB A;  3R1P A;  1EXR A;  1NX2 A;  1NCZ A;  2KQY A;  4M2O A;  2E30 A;  4PE0 A;  1BLQ A;  1HT9 A;  1DC1 A;  2BBM A;  1XVJ A;  3SG4 A;  1BOD A;  1SK6 D;  1GM0 A;  1KFX S;  2OTG B;  1F55 A;  1TIZ A;  1QLS A;  1N2D A;  4YGD B;  2JC2 A;  1CKK A;  1K95 A;  2WCL A;  3VRN A;  4IL1 A;  3PN7 B;  4MEW A;  3H4S E;  3E3R A;  2JT3 A;  5B8I B;  1A4P A;  4P2Y B;  3CS1 A;  1KFU L;  3FIA A;  2M9G A;  1QX5 B;  1QAT A;  3SIB A;  5CSJ A;  4CFR A;  2L50 A;  2MLE C;  1OSA A;  2M0R A;  5PAL A;  3PSR A;  1DJG A;  1G33 A;  1A29 A;  4U8D A;  2KBI A;  1DJI A;  1XFR A;  1YRT B;  3D76 A;  2JOJ A;  1JBA A;  3RLZ A;  1DVI A;  2F3Z A;  2O5G A;  3O4Y A;  1S5G Y;  4OKH A;  1OW4 A;  3CZ2 A;  3I5I C;  1DTL A;  1S6I A;  2M49 B;  1LA0 A;  2CXJ A;  2Q4U A;  4JQ0 D;  2NCO A;  3TS5 C;  1IKU A;  2GTE A;  2LAN A;  4PHK A;  3TDI A;  3RM1 A;  2PRU A;  1REC A;  2K0J A;  2ZFD A;  3BYA A;  3CR2 A;  3MSE B;  1QLK A;  2K2A A;  2L5Y A;  2MRD A;  4INX A;  1A2X A;  1CLL A;  3SS3 A;  1AUI B;  1YX8 A;  3CTN A;  1TNQ A;  4YI9 A;  4DRW A;  1ALV A;  2HQ8 A;  2WC8 A;  2COL B;  1BU3 A;  1IRJ A;  3TDZ A;  4OR9 B;  1GJY A;  5JOL A;  1RJV A;  4F7F A;  3NSL A;  1AK8 A;  4I5N B;  4FTG A;  1JFK A;  5JJG A;  2M3W A;  4A4C A;  3EK8 A;  2A4J A;  3L4L A;  3V2L A;  1RRO A;  4PAL A;  1K9U A;  3ZNI A;  1CFC A;  2GGM A;  2L5X B;  3S0A A;  2ZKM X;  5CSI A;  2ZRS A;  2F2O A;  1YVL A;  2H8V A;  1V1G A;  1UUS A;  1K94 A;  4GGN A;  1XFX O;  1NX3 A;  2BL0 B;  1WRK A;  3DZT A;  1Y1U A;  1KQM C;  3PM8 A;  4WQ3 A;  2MAZ A;  2PSR A;  4D1E A;  4YI8 A;  2LP3 A;  2H61 A;  5D3O A;  1K9P A;  1PK0 D;  3B6X A;  2KYF A;  5HLO A;  4JWQ A;  1J7O A;  1JWD A;  3AKB A;  5CPV A;  1KQM B;  4YGA A;  3SG2 A;  2LVV A;  1P28 A;  2SAS A;  3M0W A;  1JC2 A;  5I2L A;  1K2H A;  3WHU B;  1RFJ A;  2ISD A;  1L2O C;  3BFH A;  3QME A;  1OMD A;  3CDN A;  3PAL A;  1CMF A;  2P6B B;  5I2O A;  2L2E A;  1NSH A;  1UHK A;  1UHI A;  1QX7 A;  2QEV A;  1B7T Z;  1M45 A;  5D7F A;  1KSM A;  2LC5 A;  3FE9 A;  1ZUZ A;  3CZ1 A;  2KI6 C;  4OCI A;  3TUY C;  1PUL A;  1DJX A;  1KWO C;  1RK9 A;  2K7B A;  3SG3 A;  2KHN A;  5AEQ A;  1NPQ A;  2FOT A;  2R2I A;  1KCY A;  1IG5 A;  2LHL A;  2CBL A;  3BOW B;  1OMV A;  2M1U A;  3Q8I A;  1H8B A;  2WOS A;  1QTX A;  4GBA A;  5AFP A;  2EC6 C;  1R2U A;  1JF0 A;  1KWO B;  4I5K A;  1ALW A;  1BR1 B;  1ZMZ A;  2AUC A;  4GGF C;  1C7V A;  1DMO A;  2HF5 A;  3R1V A;  4M2P A;  1DGU A;  3LK1 A;  3B7A A;  2BCA A;  3CYZ A;  3BXK A;  1SL8 A;  5CSF A;  1BF5 A;  3DXL A;  3OB1 B;  1NCY A;  1UHN A;  1EG3 A;  1XYD A;  2JQ6 A;  2MJW B;  3EKJ A;  1CNP A;  2LHI A;  4MSP A;  1QVI Z;  1K9K A;  3KF9 A;  2Y1M A;  4N5X A;  3LK0 A;  3EVU A;  5AER A;  3S0E A;  5K89 A;  2JXL A;  3UNW A;  1MWN A;  2HET A;  3FWB A;  1AP4 A;  3D73 A;  1W7I B;  2BE4 A;  1NYA A;  3VGO A;  3SS5 A;  1VRK A;  3SG5 A;  2WC6 A;  2FCD A;  1PAL A;  1XO5 A;  1EG4 A;  2AAO A;  3OB2 B;  1A75 B;  2I18 A;  3FWC A;  1UP5 A;  1KK8 B;  2F2P A;  1GGZ A;  1KFU S;  4ZCV A;  4XJK B;  5HL1 A;  5KU1 A;  4PHM A;  4E68 A;  2K61 A;  3I5H C;  4ORC B;  4YGB B;  1CM4 A;  2GV5 A;  3O4X A;  3QRX A;  4HRE E;  4OV2 A;  1B9A A;  1KSO A;  1PVB A;  1S26 D;  1IWQ A;  4YGC B;  1XFW O;  1KK7 Z;  1AHR A;  1MXL C;  1IJ5 A;  1SNL A;  3I5H B;  3KHE A;  4MZK A;  1ZOT B;  3S0F A;  2WND A;  3IF7 A;  1K93 D;  2DOQ A;  1YUS A;  4N1F A;  4JKT A;  5HLV A;  3S0B A;  2WCH A;  3NSO A;  1BOC A;  2QAC A;  2BCX A;  3BUO B;  1F4O A;  5I94 A;  2BBN A;  1SL9 A;  2BAP A;  4CFQ A;  1OOI X;  2BNX A;  5FI7 A;  1NWD A;  3LLE A;  1GGW A;  3WXA A;  2MA2 A;  1FF1 A;  3DD4 A;  1QV1 A;  3D77 A;  2K60 A;  2LNK A;  2I94 A;  4R1E A;  4DS7 A;  3ZWH A;  2M7N A;  4PHN A;  1ORG A;  1W9Z A;  2F33 A;  2SCP A;  4ETO A;  2WCK A;  1MQ1 A;  1CMG A;  1BMO A;  2LMU A;  1FW4 A;  1IQ5 A;  3R1O A;  1CFP A;  4NDD A;  5KSZ A;  2OPO A;  1A75 A;  1DJY A;  1B47 A;  1NIW A;  1F71 A;  4INW A;  1JUO A;  4DIR A;  3K21 A;  1DQE A;  2Y4Q A;  4XJK A;  3D0Y B;  1XA5 A;  3PLF B;  3HX4 A;  2AMI A;  3CAB A;  1ZAC A;  1SSE B;  3BUM B;  3I5I B;  2BE6 A;  4AQI A;  2JRF A;  1K8U A;  3FE6 A;  1CDM A;  2B1U A;  4TNC A;  3TS5 B;  1L7Z A;  5ER5 A;  2BKI B;  2HPS A;  4PE1 A;  2KGB C;  3JTD C;  3SJS A;  2QEH A;  2F3Y A;  2I2R E;  4ORB B;  1SCM C;  4MVF A;  2PAS A;  2Y5I A;  1EJ3 A;  4MRY A;  1S3P A;  2LVK A;  2LV7 A;  4BY5 A;  3CWG A;  4ICB A;  2FJU B;  2JTT A;  2K7O A;  2KGR A;  1J1D A;  3N7H A;  1CFF A;  1G4Y R;  1CB1 A;  1Y1A A;  1R6P A;  3JVT C;  3OX6 A;  2PQL A;  3NXA A;  3PFV A;  3OP0 A;  1DGV A;  4XYN A;  1B8C A;  2NCP A;  3KO0 A;  1D1O A;  1SYM A;  2LMT A;  2JT8 A;  1C7W A;  3AAK A;  2KSP A;  4CID A;  2I7A A;  1IIO A;  2WCE A;  2BKH B;  1XFZ O;  2QPT A;  2ZRT A;  1GQM A;  1XK4 C;  2CCM A;  2LLU A;  3DF0 B;  4PE7 A;  2LMV A;  3BFB A;  3D0Y A;  1YUR A;  2JWW A;  1UUR A;  4C0K A;  1TN4 A;  1J7P A;  1IQ3 A;  2FCE A;  4GFT A;  3BQ3 A;  1YTZ C;  2D8N A;  3S0D A;  1SPY A;  1M46 A;  2CTN A;  3NSK A;  1CDL A;  1WDC C;  1SKT A;  3BUW B;  4F0Z B;  1ZFS A;  4PE4 A;  3OBV A;  1CDP A;  4NQG A;  1L2O B;  2PAL A;  1DJH A;  1TWO A;  2LVI A;  2K2F A;  3GK4 X;  1SRA A;  3DY9 A;  1B1G A;  3O2P A;  4GNK B;  4MZJ A;  2E6W A;  1FPW A;  1OQP A;  2TN4 A;  2NLN A;  1NUB A;  1QXP A;  1E8A A;  3K1E A;  2MLF C;  3L4A A;  3TUY B;  4C0L A;  5I2Q A;  1DEL A;  5F6T A;  3I5F C;  4C0J A;  3OHM B;  5AXI A;  3WHT B;  2PYQ A;  3IQO A;  2G9B A;  2VRG A;  4CLN A;  2EC6 B;  2L2C A;  1IJ6 A;  3LL8 B;  4HRG A;  2JPT A;  2KDH A;  3DF0 A;  4MRX A;  1OMR A;  2H2K A;  1XFV O;  2WCM A;  1DEK A;  1K96 A;  3OX5 A;  1F8H A;  2FJY A;  3I5G C;  4BY4 A;  3ICB A;  1YVH A;  3PJI A;  4HSZ A;  4NDB A;  3D10 A;  1UHJ A;  2OS8 C;  4HRH A;  2JU0 A;  3SG6 A;  2BCB A;  4YRU A;  1PSB A;  1TRF A;  2LM5 A;  5J3X A;  1MUX A;  4ORA B;  3I5G B;  4MZL A;  1LVC D;  1SR6 C;  1S1E A;  1UWO A;  3TZ1 A;  2ZNE A;  1LA3 A;  3AKA A;  4P5O E;  1W7J B;  2NXQ A;  4GAO A;  1TNP A;  1OE9 B;  4WRI A;  3BUX B;  1QWV A;  4WQ2 A;  4OVN F;  1N0Y A;  1BJF A;  1WRZ A;  2KLE A;  1AVS A;  2L4I A;  2M29 A;  3DVE A;  3FE8 A;  2L98 A;  3WNX B;  2JTZ A;  3BOW A;  1Z2C B;  1QX2 A;  2IS9 A;  1F54 A;  1Y0V H;  1TTX A;  3TDU A;  1C3Z A;  1DF0 B;  2M97 A;  3CGA A;  4I5L B; 
#chains in the Genus database with same CATH homology
 1FBV A;  1JFJ A;  3A4U B;  2KI4 C;  1SMG A;  1PSR A;  1TCF A;  4GGF A;  1B7T Y;  4ZCU A;  4AQJ A;  3EK7 A;  1SBJ A;  1YX7 A;  2LAP A;  3DVK A;  1FI5 A;  3DVM A;  1DT7 B;  2CT9 A;  2KAX A;  1ODB A;  3KEV A;  5ER4 X;  2KAY A;  5G08 A;  3KPX A;  1LIN A;  1QS7 A;  3PN7 C;  2LVJ A;  2LE9 B;  1FI6 A;  1M39 A;  1RWY A;  5HKZ A;  4MLW A;  2KBM A;  1B8R A;  2JNX A;  1BG1 A;  1C07 A;  3EKH A;  1NX0 A;  2M8U A;  4JPZ B;  1MF8 B;  1CTR A;  4FQO A;  2K7D A;  2JNF A;  1NCX A;  5GQQ C;  4MN0 A;  1SL7 A;  1F4Q A;  1IGV A;  1QVI Y;  2K7C A;  1DJZ A;  4PHJ A;  1TNX A;  4AOM A;  1PVA A;  1F70 A;  2GGZ A;  1DF0 A;  1IH0 A;  1MR8 A;  1KFX L;  1WLZ A;  2H61 C;  1KQV A;  1H4B A;  1TOP A;  2ZN9 A;  1YRU B;  4YBH B;  2RGI A;  3JTD B;  1Y6W A;  3SG7 A;  1SCM B;  3F45 A;  2CNP A;  2KFG A;  1QJT A;  1LKJ A;  5TNC A;  4NDC A;  2WCF A;  1B4C A;  1JF2 A;  1MHO A;  2M7L A;  5HYD A;  3EK4 A;  5CSN A;  2F8P A;  4N1G A;  1V1F A;  1CFD A;  1A03 A;  1B8L A;  1KK7 Y;  2EGD A;  3A8R A;  3JVT B;  1SCV A;  2NZ0 A;  1WLM A;  2KQ6 A;  1NP8 A;  1NX1 A;  3GOF A;  4PCW A;  3CR4 X;  5IBW A;  1Y1X A;  2LCP A;  5HKW A;  3IQQ A;  2BL0 C;  3C1V A;  1BT6 A;  2KNE A;  3VRP A;  3GK2 A;  1S36 A;  1J7Q A;  2LP2 A;  2V53 A;  4Q04 A;  2Y1N A;  1U5I B;  3BUN B;  1K90 D;  1J55 A;  2PMY A;  1N65 A;  1QV0 A;  4QJ3 B;  2MBX A;  3VRR A;  1X02 A;  5DKN A;  1YR5 A;  2JZI A;  3FS7 A;  1WDC B;  2G2B A;  2KFF A;  1J7R A;  1QIV A;  2L0P A;  2HQW A;  1WY9 A;  4CPV A;  1QIW A;  1WRL A;  1OOJ A;  1CLB A;  4PDZ A;  2JXC A;  1M31 A;  1LXF C;  2LLS A;  1QAS A;  5DKR A;  2JT0 A;  3DVJ A;  1CM1 A;  1SW8 A;  5FYX A;  4A4B A;  4DCK A;  5DKQ A;  3EVR A;  2O60 A;  5BPJ A;  4DUQ A;  5D69 A;  3GK1 A;  3I5F B;  2WCB A;  2ZND A;  3HCM A;  1YUT A;  2LLT A;  3SIA A;  3CZT X;  1EL4 A;  1XK4 A;  3NSI A;  3O6B A;  1SY9 A;  1PRW A;  3PAT A;  3CLN A;  1M63 B;  1S6C A;  4QJ4 B;  5AAN A;  2LUC A;  1BR4 B;  1S5G Z;  1U5I A;  3LCP C;  4GPL B;  1S6J A;  4MBE A;  4YGE B;  1EH2 A;  2BEC A;  1AJ4 A;  1MXE A;  3VRO A;  2OS8 B;  4GUK A;  1DJW A;  2K8M B;  2JUL A;  1Q80 A;  2M1K B;  4I5J A;  1AJ5 A;  1YUU A;  1SR6 B;  2KFH A;  2LUX A;  1OZO A;  4M2Q A;  5I8N A;  2KI6 D;  2PVB A;  4UPG A;  1TNW A;  2ZN8 A;  2KOT A;  1UHH A;  3CR5 X;  1JSA A;  4L9M A;  4USL A;  1G8I A;  2KYC A;  2MHH A;  5KTY A;  1CDN A;  2KAV A;  1KK8 C;  3AAJ A;  5HKY A;  3O78 A;  2L51 A;  1TCO B;  2L4H A;  3EVV A;  1OZS A;  1CLM A;  1HQV A;  1RTP 1;  1XFY O;  1XFU O;  2Q91 A;  2WOR A;  3VRQ A;  2EHB A;  2OTG C;  1J1E A;  2KI4 B;  1EXR A;  1NX2 A;  1NCZ A;  2KQY A;  4M2O A;  2E30 A;  4PE0 A;  1BLQ A;  1HT9 A;  2BBM A;  1XVJ A;  3SG4 A;  1BOD A;  1SK6 D;  1KFX S;  2OTG B;  1F55 A;  1TIZ A;  1QLS A;  1N2D A;  4YGD B;  2JC2 A;  1CKK A;  1K95 A;  3VRN A;  4IL1 A;  3PN7 B;  4MEW A;  3H4S E;  3E3R A;  2JT3 A;  5B8I B;  1A4P A;  4P2Y B;  3CS1 A;  1KFU L;  3FIA A;  2M9G A;  1QX5 B;  1QAT A;  3SIB A;  5CSJ A;  4CFR A;  2L50 A;  2MLE C;  1OSA A;  2M0R A;  5PAL A;  3PSR A;  1DJG A;  1G33 A;  1A29 A;  4U8D A;  2KBI A;  1DJI A;  1YRT B;  2JOJ A;  1JBA A;  3RLZ A;  1DVI A;  2F3Z A;  2O5G A;  3O4Y A;  1S5G Y;  4OKH A;  3I5I C;  1DTL A;  1S6I A;  2M49 B;  1LA0 A;  2CXJ A;  2Q4U A;  4JQ0 D;  2NCO A;  3TS5 C;  1IKU A;  3TDI A;  2LAN A;  4PHK A;  3RM1 A;  2PRU A;  1REC A;  2K0J A;  2ZFD A;  3BYA A;  3CR2 A;  3MSE B;  1QLK A;  2K2A A;  2MRD A;  4NQG A;  1A2X A;  1CLL A;  1AUI B;  1YX8 A;  3CTN A;  1TNQ A;  4YI9 A;  4DRW A;  1ALV A;  2HQ8 A;  2WC8 A;  2COL B;  1BU3 A;  1IRJ A;  3TDZ A;  4OR9 B;  1GJY A;  5JOL A;  1RJV A;  3NSL A;  1AK8 A;  4I5N B;  4FTG A;  1JFK A;  5JJG A;  2M3W A;  4A4C A;  3EK8 A;  2A4J A;  1RRO A;  4PAL A;  1K9U A;  3ZNI A;  1CFC A;  2GGM A;  2L5X B;  2ZKM X;  5CSI A;  2ZRS A;  2F2O A;  1YVL A;  1V1G A;  1UUS A;  1K94 A;  4GGN A;  1XFX O;  1NX3 A;  2BL0 B;  1WRK A;  1Y1U A;  1KQM C;  3PM8 A;  4WQ3 A;  2MAZ A;  2PSR A;  4D1E A;  4YI8 A;  2LP3 A;  2H61 A;  1K9P A;  1PK0 D;  1J7O A;  2KYF A;  5HLO A;  4JWQ A;  1JWD A;  3AKB A;  5CPV A;  1KQM B;  4YGA A;  3SG2 A;  2LVV A;  2SAS A;  3M0W A;  1JC2 A;  5I2L A;  1K2H A;  3WHU B;  1RFJ A;  2ISD A;  1L2O C;  1OMD A;  3PAL A;  1CMF A;  2P6B B;  5I2O A;  2L2E A;  1NSH A;  1UHK A;  1UHI A;  1QX7 A;  1B7T Z;  1M45 A;  5D7F A;  1KSM A;  2LC5 A;  1ZUZ A;  2KI6 C;  4OCI A;  3TUY C;  1PUL A;  1DJX A;  1KWO C;  1RK9 A;  2K7B A;  3SG3 A;  2KHN A;  5AEQ A;  1NPQ A;  2FOT A;  2R2I A;  1KCY A;  1IG5 A;  2LHL A;  2CBL A;  3BOW B;  1OMV A;  2M1U A;  1H8B A;  2WOS A;  1QTX A;  4GBA A;  5AFP A;  2EC6 C;  1R2U A;  1JF0 A;  1KWO B;  4I5K A;  1ALW A;  1BR1 B;  1ZMZ A;  2AUC A;  4GGF C;  1C7V A;  1DMO A;  2HF5 A;  4M2P A;  1DGU A;  3LK1 A;  2BCA A;  3BXK A;  1SL8 A;  5CSF A;  1BF5 A;  3OB1 B;  1NCY A;  1UHN A;  1EG3 A;  1XYD A;  2JQ6 A;  2MJW B;  3EKJ A;  1CNP A;  2LHI A;  4MSP A;  1QVI Z;  1K9K A;  3KF9 A;  2Y1M A;  4N5X A;  3LK0 A;  3EVU A;  5AER A;  5K89 A;  2JXL A;  1MWN A;  2HET A;  3FWB A;  1AP4 A;  1W7I B;  2BE4 A;  1NYA A;  3VGO A;  1VRK A;  3SG5 A;  2FCD A;  1PAL A;  1XO5 A;  1EG4 A;  2AAO A;  3OB2 B;  1A75 B;  2I18 A;  3FWC A;  1UP5 A;  1KK8 B;  2F2P A;  1GGZ A;  1KFU S;  4ZCV A;  4XJK B;  5KU1 A;  4PHM A;  4E68 A;  2K61 A;  3I5H C;  4ORC B;  4YGB B;  1CM4 A;  2GV5 A;  3QRX A;  4OV2 A;  4HRE E;  4QJ5 B;  1B9A A;  1KSO A;  1PVB A;  1S26 D;  1IWQ A;  4YGC B;  1XFW O;  1KK7 Z;  1AHR A;  1MXL C;  1IJ5 A;  1SNL A;  3I5H B;  3KHE A;  4MZK A;  1ZOT B;  2WND A;  3IF7 A;  1K93 D;  2DOQ A;  1YUS A;  4N1F A;  5HLV A;  3NSO A;  1BOC A;  2QAC A;  2BCX A;  3BUO B;  1F4O A;  2BBN A;  1SL9 A;  4CFQ A;  1NWD A;  3LLE A;  1GGW A;  3WXA A;  2MA2 A;  1FF1 A;  3DD4 A;  1QV1 A;  2LNK A;  2I94 A;  4R1E A;  4DS7 A;  3ZWH A;  2M7N A;  4PHN A;  2F33 A;  2SCP A;  4ETO A;  1MQ1 A;  1CMG A;  1BMO A;  2LMU A;  1FW4 A;  1IQ5 A;  1CFP A;  4NDD A;  5KSZ A;  2OPO A;  1A75 A;  1DJY A;  1B47 A;  1NIW A;  1F71 A;  1JUO A;  4DIR A;  3K21 A;  2Y4Q A;  4XJK A;  3D0Y B;  1XA5 A;  3PLF B;  3HX4 A;  2AMI A;  1ZAC A;  3BUM B;  3I5I B;  2BE6 A;  4AQI A;  2JRF A;  1K8U A;  4TNC A;  1CDM A;  2B1U A;  3TS5 B;  1L7Z A;  5ER5 A;  2BKI B;  2HPS A;  4PE1 A;  2KGB C;  3JTD C;  3SJS A;  2F3Y A;  2I2R E;  4ORB B;  1SCM C;  4MVF A;  2PAS A;  2Y5I A;  1EJ3 A;  4MRY A;  1S3P A;  2LVK A;  2LV7 A;  4BY5 A;  3CWG A;  4ICB A;  2FJU B;  2JTT A;  2K7O A;  2KGR A;  1J1D A;  1CFF A;  1G4Y R;  1CB1 A;  1Y1A A;  1R6P A;  3JVT C;  3OX6 A;  3PFV A;  3NXA A;  4XYN A;  3OP0 A;  1DGV A;  1B8C A;  2NCP A;  3KO0 A;  1D1O A;  1SYM A;  2LMT A;  2JT8 A;  1C7W A;  3AAK A;  2KSP A;  4CID A;  2I7A A;  2WCE A;  2BKH B;  1XFZ O;  2QPT A;  2ZRT A;  1GQM A;  1XK4 C;  2CCM A;  2LLU A;  3DF0 B;  4PE7 A;  2LMV A;  3D0Y A;  1YUR A;  2JWW A;  1UUR A;  4C0K A;  1TN4 A;  1J7P A;  1IQ3 A;  2FCE A;  4GFT A;  3BQ3 A;  1YTZ C;  2D8N A;  1SPY A;  1M46 A;  2CTN A;  3NSK A;  1CDL A;  1WDC C;  1SKT A;  3BUW B;  4F0Z B;  1ZFS A;  4PE4 A;  1CDP A;  1L2O B;  2PAL A;  1DJH A;  2LVI A;  2K2F A;  3GK4 X;  1SRA A;  1B1G A;  3O2P A;  4GNK B;  4MZJ A;  2E6W A;  1FPW A;  1OQP A;  2TN4 A;  2NLN A;  1NUB A;  1QXP A;  1E8A A;  2MLF C;  3TUY B;  4C0L A;  5I2Q A;  4C0J A;  5F6T A;  3I5F C;  3OHM B;  5AXI A;  3WHT B;  3IQO A;  2G9B A;  2VRG A;  4CLN A;  2EC6 B;  3LL8 B;  1IJ6 A;  4HRG A;  2JPT A;  2KDH A;  3DF0 A;  4MRX A;  1OMR A;  2H2K A;  1XFV O;  1K96 A;  3OX5 A;  1F8H A;  3I5G C;  4BY4 A;  3ICB A;  1YVH A;  4HSZ A;  4NDB A;  3D10 A;  1UHJ A;  2OS8 C;  4HRH A;  2JU0 A;  3SG6 A;  2BCB A;  4YRU A;  1PSB A;  1TRF A;  2LM5 A;  5J3X A;  1MUX A;  4ORA B;  3I5G B;  4MZL A;  1LVC D;  1SR6 C;  1S1E A;  1UWO A;  3TZ1 A;  2ZNE A;  1LA3 A;  3AKA A;  4P5O E;  1W7J B;  2NXQ A;  4GAO A;  1TNP A;  1OE9 B;  4WRI A;  3BUX B;  4WQ2 A;  4OVN F;  1N0Y A;  1BJF A;  1WRZ A;  2L4I A;  1AVS A;  2M29 A;  3DVE A;  2L98 A;  3WNX B;  2JTZ A;  3BOW A;  1QX2 A;  2IS9 A;  1F54 A;  1Y0V H;  1TTX A;  3TDU A;  1DF0 B;  2M97 A;  3CGA A;  4I5L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...