1DF0B

Crystal structure of m-calpain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
176
Chain Sequence
NESEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M-CALPAIN
publication title Crystal structure of calpain reveals the structural basis for Ca(2+)-dependent protease activity and a novel mode of enzyme activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 56
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 1999-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1df0B00
1YUUA 1OMDA 2L5XB 1KK7Z 2GGZA 3DF0B 1DT7B 1SL9A 5AXIA 1EXRA 3LL8B 4GGNA 1NCXA 1AJ5A 2BBNA 2BBMA 2EGDA 1Y1UA 3CWGA 4DS7A 1YUSA 1V1FA 2CTNA 4P2YB 5HLVA 1DF0A 1J1EA 2OTGB 2LVVA 2BL0B 3ZNIA 3KHEA 1J7OA 2JNXA 2KBMA 5I2OA 3BUNB 2G2BA 1Y6WA 2QPTA 2LC5A 2EC6B 3H4SE 1B9AA 1NCYA 1SL8A 3O2PA 2KQ6A 1BF5A 4BY4A 1JF2A 2Y4QA 2F33A 1BMOA 3SJSA 1R6PA 4GNKB 3ZWHA 2ZN9A 3LK1A 1DJIA 1SR6C 1ZMZA 2K7BA 3CTNA 5TNCA 4AQJA 2M97A 1UUSA 4DIRA 1QS7A 2AAOA 1JUOA 3RLZA 1CLMA 2LV7A 1XFZO 2ZNEA 3OB2B 3I5IB 2PRUA 1KSOA 3DD4A 3PN7C 4JPZB 4YI8A 3JVTC 1TOPA 5AERA 5JJGA 1MHOA 3CZTX 2M0RA 4PHMA 2H61C 2MLEC 1A03A 1Q80A 2KNEA 2RGIA 4N5XA 4P5OE 1TCFA 1RTP1 1E8AA 2JU0A 2LHIA 1CB1A 3TDIA 2OPOA 1CLLA 1K96A 3PM8A 1NPQA 5AANA 1C7WA 2KBIA 1IQ3A 3D10A 4CPVA 1F4OA 1DJYA 2BKIB 2COLB 2VRGA 3OP0A 1CLBA 2OTGC 1JWDA 1K9KA 4D1EA 2BL0C 1XK4A 2FCEA 2M7NA 2PMYA 4YGAA 4ORAB 1UHNA 2ZRTA 2GGMA 1KFUS 2HETA 1NWDA 3LK0A 1DGVA 2Y5IA 4JQ0D 2KI4B 1M63B 1YVHA 3FS7A 1DF0B 5F6TA 1DVIA 1JBAA 2LM5A 2JC2A 1XA5A 5AEQA 4M2OA 4WQ3A 5KTYA 4CFRA 1NX0A 3WHTB 3BOWA 1PSBA 4OVNF 1YURA 1MR8A 2MJWB 3FWBA 2LVJA 2WCFA 5CSIA 3PLFB 4I5JA 1NUBA 5B8IB 1RROA 2LUXA 3HCMA 2SCPA 1NX1A 3DVJA 3VRQA 1KFXS 2K2AA 1WY9A 1IRJA 1A75B 1YRUB 3I5IC 1BT6A 2LNKA 3M0WA 2NLNA 1BLQA 3RM1A 2HPSA 2Q91A 2LMTA 1HT9A 2L50A 2MAZA 4ORCB 4Q04A 3TDZA 1BR4B 1EL4A 1G4YR 3SG2A 1DMOA 1IJ5A 4OCIA 4PE4A 1QX7A 1F71A 3TUYB 1XVJA 4YI9A 1OE9B 2BCBA 3DVMA 4GUKA 1QX2A 2M3WA 2SASA 3BQ3A 4CFQA 3C1VA 4IL1A 1NCZA 2LANA 2M1UA 2L4HA 4MZKA 1B8RA 1RECA 3AKAA 4GPLB 1QIVA 2M49B 4N1GA 3TZ1A 3BYAA 5CPVA 2IS9A 4HRHA 3VGOA 1L7ZA 2ZN8A 4FQOA 1F70A 1WRZA 3D0YA 1GJYA 3SIBA 4ZCVA 1MF8B 2JNFA 1FF1A 4MRYA 1KSMA 5BPJA 1ODBA 1B4CA 4CIDA 4MLWA 3K21A 5DKNA 1W7JB 2M29A 1TNXA 1AK8A 1IH0A 1UURA 5KU1A 2HQWA 2LHLA 2NXQA 1F54A 2LE9B 1BJFA 3BOWB 1NYAA 3FIAA 1RFJA 5AFPA 3EVUA 2MBXA 2LUCA 2K61A 1CM1A 1DJWA 2FCDA 3I5GB 3SG3A 2O60A 2WNDA 2L51A 3TUYC 1J55A 2KDHA 3A4UB 1ZUZA 4OV2A 4PHJA 1K93D 4GBAA 3EVVA 1B47A 1SK6D 3TS5C 3IQQA 3NSIA 2ZNDA 2TN4A 1BG1A 4PHKA 2LP3A 2WC8A 3EK4A 3JTDB 4ORBB 3PFVA 4BY5A 1IGVA 2JT8A 1SL7A 1ZOTB 1OQPA 4YGCB 1CDMA 1X02A 1EJ3A 1K9UA 2NCPA 1QXPA 1J7QA 2PALA 1BU3A 1S6JA 1QJTA 3O78A 1G33A 1SKTA 3SG6A 1MUXA 4FTGA 1H4BA 2NCOA 1BODA 3EVRA 3NSOA 3VRNA 5J3XA 2MHHA 2MRDA 1QLKA 2AMIA 1OMVA 5I8NA 4N1FA 1J1DA 2KYFA 4M2QA 4YRUA 3NSLA 4L9MA 1YUTA 1TNQA 3O6BA 2KFGA 3CR4X 5G08A 3SG5A 1CDLA 1BR1B 1MQ1A 1XFXO 5HKYA 1K2HA 2JPTA 1MXEA 2PVBA 2M8UA 1OOJA 3CGAA 3I5GC 1ZFSA 1PULA 1QV0A 2F3ZA 4CLNA 3BUXB 1XFUO 4A4CA 1DTLA 2KSPA 2L98A 4R1EA 2KGRA 1M39A 2I94A 1KFUL 1N2DA 1SNLA 1K9PA 1CDNA 1B1GA 2K7CA 3JTDC 3SG4A 2ISDA 1QASA 4I5KA 1QTXA 3OB1B 5CSNA 1CFCA 1AHRA 2LVKA 4XYNA 1IWQA 2JXCA 4DRWA 1TIZA 3EK8A 4AQIA 1AUIB 2K0JA 2BCAA 3CLNA 1YTZC 2KYCA 3VROA 4WQ2A 1CM4A 1HQVA 5JOLA 1FI5A 2H61A 1S5GY 1JSAA 1TCOB 1MXLC 3WXAA 5GQQC 3BUMB 1OZSA 1PSRA 1GGWA 1KFXL 2JULA 1R2UA 3OX5A 1TN4A 1PVAA 4AOMA 1CFPA 1UHIA 1VRKA 3NXAA 1XFVO 2R2IA 4MSPA 3EKHA 3SG7A 1QVIY 1TTXA 3TDUA 4QJ3B 1S1EA 1CMFA 1NX3A 1QATA 4OKHA 2P6BB 1GGZA 1KQMB 3TS5B 1MWNA 4NDDA 1JF0A 4UPGA 2JTTA 1SRAA 2MLFC 4YBHB 2KAXA 3CR2A 1S5GZ 5D7FA 1OMRA 3PALA 2M1KB 1EH2A 4ICBA 1F4QA 2O5GA 1DGUA 4MZLA 4YGDB 3WNXB 2M9GA 3AAJA 2KOTA 2LMVA 4A4BA 2HQ8A 3EK7A 2JZIA 5ER5A 1SYMA 1H8BA 4PDZA 1QVIZ 2K7DA 3O4YA 1YX7A 4MVFA 1NSHA 3LLEA 1FI6A 2AUCA 2BKHB 1NIWA 3I5FB 1LINA 2F2OA 2Y1MA 1S6CA 1K90D 2KGBC 1KWOC 4I5NB 1U5IA 1ALVA 4GAOA 1Y1AA 2EHBA 2KI6D 1J7PA 1ZACA 4MRXA 1TRFA 1B7TY 1PVBA 1UP5A 4GGFA 1WLMA 2KAVA 2BECA 3AKBA 4PHNA 4NDCA 4I5LB 1OSAA 1IQ5A 1SW8A 2V53A 4PE0A 2A4JA 5IBWA 1NP8A 1QV1A 5DKRA 5I2LA 1JFKA 1DJZA 2F8PA 2KI6C 4QJ4B 1JC2A 1AP4A 2Y1NA 1LA0A 3F45A 2F3YA 2WORA 1XO5A 4MEWA 1TNPA 2I18A 2H2KA 3LCPC 4C0LA 1KQMC 3E3RA 2WCBA 1B7TZ 2JOJA 1ALWA 1CMGA 1M31A 3QRXA 3GK2A 2KFFA 3PATA 2NZ0A 5KSZA 4JWQA 3OX6A 1KQVA 1M45A 1K94A 2PSRA 5FYXA 4C0KA 5HKWA 5PALA 1LA3A 1LXFC 4C0JA 2CNPA 4MN0A 3MSEB 3NSKA 1JFJA 2LVIA 1B8CA 3WHUB 4HRGA 1XK4C 2BCXA 1WDCB 3BXKA 3GK4X 3I5FC 4ETOA 1QLSA 1DJHA 1K95A 1SPYA 4XJKA 1A75A 1S6IA 4NDBA 2JRFA 4HSZA 4PE1A 1SMGA 2Q4UA 5ER4X 1YRTB 2KQYA 1KCYA 3KEVA 4NQGA 1IG5A 1UHHA 1F8HA 1RK9A 2I2RE 3VRRA 3BUWB 3D0YB 1IKUA 1TNWA 4DUQA 3CR5X 1L2OC 1KK8B 1U5IB 1FW4A 2BE4A 2L2EA 5HLOA 1LVCD 1AVSA 1EG4A 2HF5A 1UWOA 1SBJA 1DJXA 1YR5A 1Y0VH 2LMUA 2G9BA 1AJ4A 1B8LA 1OZOA 4USLA 2E6WA 2E30A 3ICBA 2LP2A 5CSFA 3A8RA 3VRPA 2JWWA 1A4PA 4U8DA 4ZCUA 4HREE 5HKZA 1KWOB 2JQ6A 2OS8B 2JTZA 5DKQA 1CTRA 1XYDA 2KFHA 1A2XA 2KHNA 3I5HB 3DVKA 2L4IA 2KAYA 2I7AA 2JT0A 3OHMB 4MZJA 1C7VA 1WDCC 1K8UA 1A29A 2L0PA 2LLTA 3DF0A 4GFTA 2EC6C 1WLZA 2LLUA 1V1GA 1F55A 1SCMB 2WCEA 3KPXA 1CDPA 3CS1A 4PE7A 3SIAA 2CXJA 2GV5A 1CFFA 1RWYA 3IF7A 4MBEA 1J7RA 1LKJA 3HX4A 1CFDA 1CNPA 2FOTA 2CBLA 1PRWA 4XJKB 2M7LA 1KK8C 4F0ZB 1DJGA 3DVEA 1EG3A 3FWCA 3PSRA 2WOSA 4PCWA 4GGFC 1FPWA 2CCMA 4PALA 2ZFDA 1SY9A 2JT3A 1QX5B 5HYDA 1S26D 1UHJA 1YX8A 2LAPA 2JXLA 1G8IA 1YVLA 4YGBB 1C07A 1IJ6A 1QIWA 3IQOA 1W7IB 2FJUB 2ZKMX 2LCPA 1WRLA 1Y1XA 2ZRSA 1N65A 4WRIA 5K89A 2K2FA 2F2PA 5CSJA 2PASA 1XFWO 2OS8C 1SCVA 4E68A 1BOCA 3I5HC 2QACA 1KK7Y 2BE6A 2D8NA 2MA2A 1PALA 4YGEB 3EKJA 5D69A 1S3PA 1UHKA 1D1OA 1WRKA 1FBVA 1PK0D 1SR6B 2KI4C 4M2PA 1XFYO 3AAKA 2CT9A 1N0YA 1NX2A 3KO0A 5I2QA 1S36A 2B1UA 2K8MB 1L2OB 4TNCA 2DOQA 1CKKA 1GQMA 4QJ5B 3BUOB 1SCMC 3GOFA 2LLSA 1M46A 4DCKA 3KF9A 1RJVA 2K7OA 3PN7B 3JVTB 3GK1A 4OR9B
chains in the Genus database with same CATH superfamily
1YUUA 1OMDA 3S0EA 2L5XB 1KK7Z 2GGZA 3DF0B 1DT7B 1SL9A 5AXIA 1P28A 3D77A 1EXRA 3LL8B 4GGNA 1NCXA 1AJ5A 2BBNA 2BBMA 2EGDA 1Y1UA 3CWGA 4DS7A 1YUSA 1V1FA 2CTNA 4P2YB 5HLVA 1DF0A 1J1EA 2OTGB 3N7HA 2LVVA 2BL0B 3ZNIA 3IVTA 1DELA 3KHEA 2QEVA 1J7OA 2JNXA 2KBMA 5I2OA 4KYNA 3BUNB 2G2BA 1Y6WA 2QPTA 2QDIA 2LC5A 2K60A 4JKTA 2EC6B 3CDNA 3SS3A 2BNXA 3H4SE 1B9AA 1NCYA 1SL8A 3O2PA 5FI7A 2KQ6A 1LS8A 1BF5A 4BY4A 1JF2A 3BFHA 2Y4QA 2F33A 1BMOA 3SJSA 1R6PA 4GNKB 3ZWHA 2ZN9A 3LK1A 1DJIA 1SR6C 1ZMZA 2K7BA 3CTNA 5TNCA 4AQJA 2M97A 1UUSA 4DIRA 1QS7A 2AAOA 1JUOA 3RLZA 1CLMA 2LV7A 1XFZO 2ZNEA 3OB2B 1Z4HA 3I5IB 2PRUA 1KSOA 3DD4A 3PN7C 4JPZB 1XFRA 3JVTC 1TOPA 4YI8A 5AERA 3BJHA 1MHOA 3CZTX 2M0RA 4PHMA 2H61C 2MLEC 2WCMA 1A03A 1Q80A 2KNEA 2RGIA 4N5XA 4P5OE 1TCFA 1RTP1 1E8AA 2JU0A 2LHIA 1CB1A 3TDIA 2OPOA 1CLLA 1K96A 3PM8A 1NPQA 5AANA 1C7WA 3CZ1A 2KBIA 1IQ3A 3D10A 4CPVA 1F4OA 1DJYA 2BKIB 2COLB 2VRGA 3OP0A 1CLBA 2OTGC 3NHTA 1K9KA 1JWDA 4D1EA 2BL0C 1OOGA 2WC5A 1XK4A 2FCEA 2M7NA 2PMYA 4YGAA 1TUZA 4ORAB 1UHNA 2ZRTA 2GGMA 1KFUS 2HETA 1NWDA 1OOFA 3LK0A 1DGVA 2Y5IA 4JQ0D 2KI4B 1M63B 1YVHA 3FS7A 1DF0B 5F6TA 1DVIA 1JBAA 2LM5A 2JC2A 1XA5A 5AEQA 4M2OA 4WQ3A 5KTYA 4CFRA 1NX0A 3WHTB 3BOWA 1PSBA 4OVNF 1YURA 1DC1A 1MR8A 2MJWB 3FWBA 2LVJA 2WCFA 5CSIA 3PLFB 4I5JA 1NUBA 5B8IB 1RROA 2LUXA 3HCMA 2SCPA 1NX1A 3DVJA 3VRQA 1KFXS 2K2AA 1WY9A 1IRJA 1A75B 1YRUB 3I5IC 1BT6A 2LNKA 3K1EA 2NLNA 3M0WA 1BLQA 3RM1A 2HPSA 1OOIX 2JPOA 2Q91A 2WCKA 2LMTA 1HT9A 2L50A 2MAZA 4ORCB 4Q04A 3TDZA 1BR4B 1EL4A 1G4YR 3SG2A 1DMOA 1IJ5A 4OCIA 4PE4A 1QX7A 1F71A 3TUYB 1XVJA 4YI9A 1OE9B 2BCBA 5I94A 3DVMA 4GUKA 4FQTA 3UNWA 1QX2A 2M3WA 2SASA 3BQ3A 4CFQA 3C1VA 4IL1A 1NCZA 2LANA 2M1UA 2L4HA 4MZKA 1B8RA 1RECA 3AKAA 3FE9A 4GPLB 1QIVA 3B86A 3DXLA 2M49B 4N1GA 3TZ1A 3BYAA 5CPVA 2IS9A 4HRHA 3VGOA 1L7ZA 2ZN8A 3DY9A 4FQOA 1F70A 1WRZA 3D0YA 1GJYA 4INWA 3SIBA 4ZCVA 3R1VA 1MF8B 2JNFA 3D73A 1FF1A 4MRYA 3UO9A 1KSMA 5BPJA 3OGNA 1ODBA 3CZ0A 1B4CA 4CIDA 4MLWA 5FI2A 3K21A 5DKNA 3B6XA 5HL1A 1W7JB 2M29A 1TNXA 1AK8A 1IH0A 1UURA 5KU1A 2HQWA 2LHLA 2NXQA 3S0AA 1F54A 2LE9B 1BJFA 3BOWB 1NYAA 3FIAA 1RFJA 5AFPA 3EVUA 2MBXA 2LUCA 2K61A 1CM1A 1DJWA 2FCDA 3I5GB 4JD9A 3SG3A 2O60A 2WNDA 2L51A 3TUYC 1J55A 2KDHA 3A4UB 2KLDA 1ZUZA 4OV2A 4PHJA 1K93D 4GBAA 3EVVA 1B47A 1SK6D 3TS5C 3IQQA 3NSIA 2ZNDA 2TN4A 1BG1A 4PHKA 2LP3A 2WC8A 3EK4A 3JTDB 4ORBB 3OBVA 3PFVA 4BY5A 1IGVA 2JT8A 1SL7A 1ZOTB 1SSEB 1OQPA 4YGCB 1CDMA 1X02A 2L5YA 4INXA 1EJ3A 1K9UA 2NCPA 1QXPA 1J7QA 2PALA 1BU3A 1S6JA 5JJGA 1QJTA 3O78A 1G33A 1SKTA 1GM0A 1T14A 2GTEA 5DICA 3SG6A 1MUXA 4FTGA 1H4BA 2NCOA 1BODA 3EVRA 3NSOA 3VRNA 5J3XA 2MHHA 2MRDA 1QLKA 2QEOA 2AMIA 3L4LA 1OMVA 5I8NA 4N1FA 3D78A 1J1DA 2QEHA 2KYFA 4M2QA 4YRUA 3NSLA 4L9MA 1YUTA 1TNQA 3O6BA 5D3OA 2KFGA 3CR4X 5G08A 3SG5A 1CDLA 1BR1B 1MQ1A 1XFXO 2H8VA 5HKYA 1K2HA 2JPTA 1MXEA 2PVBA 2M8UA 1OOJA 2QEBA 3CGAA 3I5GC 1ZFSA 1PULA 1QV0A 2F3ZA 4CLNA 3BUXB 1XFUO 4A4CA 3CZ2A 1DTLA 2KSPA 2L98A 4R1EA 2KGRA 1M39A 2I94A 1KFUL 1N2DA 1SNLA 3PJIA 1K9PA 3R1PA 1CDNA 1B1GA 2K7CA 3JTDC 3SG4A 2ISDA 1QASA 4I5KA 1QTXA 3OB1B 5CSNA 1CFCA 1AHRA 2LVKA 4XYNA 1IWQA 2JXCA 4DRWA 1TIZA 3EK8A 4AQIA 1AUIB 2K0JA 2BCAA 3CLNA 1YTZC 2KYCA 3VROA 4WQ2A 1CM4A 1HQVA 5JOLA 1FI5A 2H61A 1S5GY 1JSAA 1TCOB 1MXLC 3WXAA 5GQQC 3BUMB 1OZSA 1PSRA 1GGWA 1KFXL 2JULA 1R2UA 3B7AA 3OX5A 1TN4A 1PVAA 4AOMA 1CFPA 1UHIA 3EG5B 1VRKA 3NXAA 1XFVO 2R2IA 4MSPA 3EKHA 2BAPA 3SG7A 1QVIY 1TTXA 3TDUA 4QJ3B 1S1EA 1CMFA 1NX3A 1QATA 4OKHA 2P6BB 1GGZA 1KQMB 2KPHA 2WC6A 5FI6A 3TS5B 1MWNA 4NDDA 1JF0A 4UPGA 2JTTA 1SRAA 2MLFC 4YBHB 2KAXA 3CR2A 1S5GZ 3FE6A 5D7FA 1OMRA 4F7FA 3PALA 3D74A 2M1KB 1EH2A 4ICBA 1F4QA 2O5GA 1DGUA 4MZLA 4YGDB 3WNXB 2M9GA 3AAJA 2KOTA 2LMVA 4A4BA 2HQ8A 3EK7A 2JZIA 5ER5A 1SYMA 3DYEA 1H8BA 4PDZA 1QVIZ 2K7DA 3O4YA 1YX7A 4MVFA 1NSHA 1Z2CB 3LLEA 1FI6A 2AUCA 2BKHB 1NIWA 3I5FB 1LINA 2F2OA 2L2CA 2Y1MA 1S6CA 1K90D 2KGBC 1KWOC 4I5NB 1U5IA 2FJYA 1ALVA 4GAOA 1Y1AA 2EHBA 2KI6D 1J7PA 1ZACA 4MRXA 1TRFA 1B7TY 1PVBA 1UP5A 4GGFA 1WLMA 2KAVA 3CABA 2BECA 3AKBA 4PHNA 4NDCA 4I5LB 1OSAA 1IQ5A 1SW8A 2V53A 4PE0A 3D75A 2A4JA 5IBWA 1NP8A 1QV1A 5DKRA 5I2LA 1JFKA 1DJZA 1IIOA 2F8PA 2KI6C 5EL2A 3V2LA 4QJ4B 1AP4A 2Y1NA 1JC2A 1LA0A 3F45A 2F3YA 2WORA 1XO5A 4MEWA 3DZTA 1TNPA 2I18A 2H2KA 2WCJA 3LCPC 3CYZA 4C0LA 1KQMC 3E3RA 2WCBA 1B7TZ 2JOJA 1ALWA 1CMGA 1M31A 3QRXA 3GK2A 2KFFA 3PATA 2NZ0A 5KSZA 4JWQA 3OX6A 4IJ7A 1KQVA 1M45A 3RZSA 1K94A 2PSRA 3NHIA 5FYXA 4C0KA 5HKWA 5PALA 1LA3A 1LXFC 4C0JA 3SS5A 2CNPA 1TWOA 4MN0A 3MSEB 3NSKA 1C3ZA 1JFJA 2LVIA 1B8CA 3WHUB 4HRGA 1XK4C 2BCXA 1WDCB 3BXKA 3GK4X 3I5FC 4ETOA 1QLSA 1DJHA 1K95A 1SPYA 3NGVA 4XJKA 3QMEA 1A75A 1S6IA 2PYQA 2WCHA 4NDBA 2JRFA 4HSZA 4PE1A 1SMGA 2Q4UA 5ER4X 1YRTB 2KQYA 1KCYA 3KEVA 4NQGA 3S0DA 1IG5A 1UHHA 1F8HA 1RK9A 3S0BA 2I2RE 3VRRA 3BUWB 3D0YB 1IKUA 2KLEA 1TNWA 3O4XA 4DUQA 3CR5X 1L2OC 3Q8IA 1KK8B 1U5IB 3BFAA 1FW4A 2BE4A 2L2EA 3B87A 2P70A 5HLOA 1LVCD 1AVSA 1EG4A 1ORGA 2HF5A 3S0GA 1UWOA 1SBJA 1DJXA 1YR5A 1Y0VH 2LMUA 2G9BA 3D76A 1AJ4A 1B8LA 1OZOA 4USLA 2E6WA 2E30A 3ICBA 2LP2A 5CSFA 3A8RA 3VRPA 2JWWA 1A4PA 4U8DA 3B88A 4HREE 4ZCUA 1KWOB 2PQLA 5HKZA 2JQ6A 1C3YA 3R72A 2OS8B 2JTZA 5DKQA 1CTRA 1XYDA 2KFHA 1A2XA 2KHNA 3I5HB 3DVKA 2WCLA 2L4IA 3VB1A 2KAYA 2I7AA 2JT0A 3OHMB 4MZJA 1C7VA 1WDCC 1K8UA 1A29A 2L0PA 2LLTA 3DF0A 4OZDA 4GFTA 2EC6C 1WLZA 2LLUA 1V1GA 1F55A 1SCMB 2WCEA 3KPXA 1CDPA 3CS1A 4PE7A 3SIAA 2CXJA 2GV5A 3L4AA 1CFFA 1RWYA 3IF7A 4MBEA 1J7RA 1LKJA 3HX4A 1CFDA 1CNPA 2FOTA 2CBLA 1PRWA 4XJKB 2M7LA 1KK8C 4F0ZB 1DJGA 3BFBA 1EG3A 1OOHA 3DVEA 3FWCA 3PSRA 3SS4A 2WOSA 4PCWA 4GGFC 1FPWA 2CCMA 4PALA 2ZFDA 1SY9A 2JT3A 3FE8A 1QX5B 5HYDA 1S26D 1UHJA 1YX8A 2LAPA 1DEKA 2JXLA 1G8IA 1YVLA 3PM2A 4YGBB 1C07A 1IJ6A 1QIWA 3IQOA 1W7IB 2FJUB 2YGUA 2ZKMX 2LCPA 1WRLA 1Y1XA 1TUJA 2ZRSA 1N65A 4WRIA 1W9ZA 5K89A 2K2FA 2F2PA 5CSJA 2PASA 1XFWO 2OS8C 1SCVA 4E68A 1BOCA 3I5HC 2QACA 3L47A 1KK7Y 1DQEA 1OW4A 2BE6A 2D8NA 1PALA 2MA2A 4YGEB 3EKJA 5D69A 3R1OA 1S3PA 1UHKA 1D1OA 1WRKA 1FBVA 2P71A 1PK0D 1SR6B 2KI4C 4M2PA 1XFYO 3AAKA 2CT9A 1N0YA 1NX2A 3KO0A 5I2QA 1S36A 2B1UA 2K8MB 1L2OB 4TNCA 2DOQA 1CKKA 1GQMA 4QJ5B 1QWVA 3BUOB 1SCMC 3GOFA 2LLSA 1M46A 4PT1A 4DCKA 3KF9A 1RJVA 2K7OA 3PN7B 2ERBA 3JVTB 3GK1A 3S0FA 4OR9B
chains in the Genus database with same CATH topology
1YUUA 1OMDA 2L5XB 1KK7Z 2GGZA 3DF0B 1DT7B 1SL9A 5AXIA 1EXRA 3LL8B 4GGNA 1NCXA 1AJ5A 2BBNA 2BBMA 2EGDA 1Y1UA 3CWGA 4DS7A 1YUSA 1V1FA 2CTNA 4P2YB 5HLVA 1DF0A 1J1EA 2OTGB 2LVVA 2BL0B 3ZNIA 3KHEA 1J7OA 2JNXA 2KBMA 5I2OA 3BUNB 2G2BA 1Y6WA 2QPTA 2LC5A 2EC6B 3H4SE 1B9AA 1NCYA 1SL8A 3O2PA 2KQ6A 1BF5A 4BY4A 1JF2A 2Y4QA 2F33A 1BMOA 3SJSA 1R6PA 4GNKB 3ZWHA 2ZN9A 3LK1A 1DJIA 1SR6C 1ZMZA 2K7BA 3CTNA 5TNCA 4AQJA 2M97A 1UUSA 4DIRA 1QS7A 2AAOA 1JUOA 3RLZA 1CLMA 2LV7A 1XFZO 2ZNEA 3OB2B 3I5IB 2PRUA 1KSOA 3DD4A 3PN7C 4JPZB 4YI8A 3JVTC 1TOPA 5AERA 5JJGA 1MHOA 3CZTX 2M0RA 4PHMA 2H61C 2MLEC 1A03A 1Q80A 2KNEA 2RGIA 4N5XA 4P5OE 1TCFA 1RTP1 1E8AA 2JU0A 2LHIA 1CB1A 3TDIA 2OPOA 1CLLA 1K96A 3PM8A 1NPQA 5AANA 1C7WA 2KBIA 1IQ3A 3D10A 4CPVA 1F4OA 1DJYA 2BKIB 2COLB 2VRGA 3OP0A 1CLBA 2OTGC 1JWDA 1K9KA 4D1EA 2BL0C 1XK4A 2FCEA 2M7NA 2PMYA 4YGAA 4ORAB 1UHNA 2ZRTA 2GGMA 1KFUS 2HETA 1NWDA 3LK0A 1DGVA 2Y5IA 4JQ0D 2KI4B 1M63B 1YVHA 3FS7A 1DF0B 5F6TA 1DVIA 1JBAA 2LM5A 2JC2A 1XA5A 5AEQA 4M2OA 4WQ3A 5KTYA 4CFRA 1NX0A 3WHTB 3BOWA 1PSBA 4OVNF 1YURA 1MR8A 2MJWB 3FWBA 2LVJA 2WCFA 5CSIA 3PLFB 4I5JA 1NUBA 5B8IB 1RROA 2LUXA 3HCMA 2SCPA 1NX1A 3DVJA 3VRQA 1KFXS 2K2AA 1WY9A 1IRJA 1A75B 1YRUB 3I5IC 1BT6A 2LNKA 3M0WA 2NLNA 1BLQA 3RM1A 2HPSA 2Q91A 2LMTA 1HT9A 2L50A 2MAZA 4ORCB 4Q04A 3TDZA 1BR4B 1EL4A 1G4YR 3SG2A 1DMOA 1IJ5A 4OCIA 4PE4A 1QX7A 1F71A 3TUYB 1XVJA 4YI9A 1OE9B 2BCBA 3DVMA 4GUKA 1QX2A 2M3WA 2SASA 3BQ3A 4CFQA 3C1VA 4IL1A 1NCZA 2LANA 2M1UA 2L4HA 4MZKA 1B8RA 1RECA 3AKAA 4GPLB 1QIVA 2M49B 4N1GA 3TZ1A 3BYAA 5CPVA 2IS9A 4HRHA 3VGOA 1L7ZA 2ZN8A 4FQOA 1F70A 1WRZA 3D0YA 1GJYA 3SIBA 4ZCVA 1MF8B 2JNFA 1FF1A 4MRYA 1KSMA 5BPJA 1ODBA 1B4CA 4CIDA 4MLWA 3K21A 5DKNA 1W7JB 2M29A 1TNXA 1AK8A 1IH0A 1UURA 5KU1A 2HQWA 2LHLA 2NXQA 1F54A 2LE9B 1BJFA 3BOWB 1NYAA 3FIAA 1RFJA 5AFPA 3EVUA 2MBXA 2LUCA 2K61A 1CM1A 1DJWA 2FCDA 3I5GB 3SG3A 2O60A 2WNDA 2L51A 3TUYC 1J55A 2KDHA 3A4UB 1ZUZA 4OV2A 4PHJA 1K93D 4GBAA 3EVVA 1B47A 1SK6D 3TS5C 3IQQA 3NSIA 2ZNDA 2TN4A 1BG1A 4PHKA 2LP3A 2WC8A 3EK4A 3JTDB 4ORBB 3PFVA 4BY5A 1IGVA 2JT8A 1SL7A 1ZOTB 1OQPA 4YGCB 1CDMA 1X02A 1EJ3A 1K9UA 2NCPA 1QXPA 1J7QA 2PALA 1BU3A 1S6JA 1QJTA 3O78A 1G33A 1SKTA 3SG6A 1MUXA 4FTGA 1H4BA 2NCOA 1BODA 3EVRA 3NSOA 3VRNA 5J3XA 2MHHA 2MRDA 1QLKA 2AMIA 1OMVA 5I8NA 4N1FA 1J1DA 2KYFA 4M2QA 4YRUA 3NSLA 4L9MA 1YUTA 1TNQA 3O6BA 2KFGA 3CR4X 5G08A 3SG5A 1CDLA 1BR1B 1MQ1A 1XFXO 5HKYA 1K2HA 2JPTA 1MXEA 2PVBA 2M8UA 1OOJA 3CGAA 3I5GC 1ZFSA 1PULA 1QV0A 2F3ZA 4CLNA 3BUXB 1XFUO 4A4CA 1DTLA 2KSPA 2L98A 4R1EA 2KGRA 1M39A 2I94A 1KFUL 1N2DA 1SNLA 1K9PA 1CDNA 1B1GA 2K7CA 3JTDC 3SG4A 2ISDA 1QASA 4I5KA 1QTXA 3OB1B 5CSNA 1CFCA 1AHRA 2LVKA 4XYNA 1IWQA 2JXCA 4DRWA 1TIZA 3EK8A 4AQIA 1AUIB 2K0JA 2BCAA 3CLNA 1YTZC 2KYCA 3VROA 4WQ2A 1CM4A 1HQVA 5JOLA 1FI5A 2H61A 1S5GY 1JSAA 1TCOB 1MXLC 3WXAA 5GQQC 3BUMB 1OZSA 1PSRA 1GGWA 1KFXL 2JULA 1R2UA 3OX5A 1TN4A 1PVAA 4AOMA 1CFPA 1UHIA 1VRKA 3NXAA 1XFVO 2R2IA 4MSPA 3EKHA 3SG7A 1QVIY 1TTXA 3TDUA 4QJ3B 1S1EA 1CMFA 1NX3A 1QATA 4OKHA 2P6BB 1GGZA 1KQMB 3TS5B 1MWNA 4NDDA 1JF0A 4UPGA 2JTTA 1SRAA 2MLFC 4YBHB 2KAXA 3CR2A 1S5GZ 5D7FA 1OMRA 3PALA 2M1KB 1EH2A 4ICBA 1F4QA 2O5GA 1DGUA 4MZLA 4YGDB 3WNXB 2M9GA 3AAJA 2KOTA 2LMVA 4A4BA 2HQ8A 3EK7A 2JZIA 5ER5A 1SYMA 1H8BA 4PDZA 1QVIZ 2K7DA 3O4YA 1YX7A 4MVFA 1NSHA 3LLEA 1FI6A 2AUCA 2BKHB 1NIWA 3I5FB 1LINA 2F2OA 2Y1MA 1S6CA 1K90D 2KGBC 1KWOC 4I5NB 1U5IA 1ALVA 4GAOA 1Y1AA 2EHBA 2KI6D 1J7PA 1ZACA 4MRXA 1TRFA 1B7TY 1PVBA 1UP5A 4GGFA 1WLMA 2KAVA 2BECA 3AKBA 4PHNA 4NDCA 4I5LB 1OSAA 1IQ5A 1SW8A 2V53A 4PE0A 2A4JA 5IBWA 1NP8A 1QV1A 5DKRA 5I2LA 1JFKA 1DJZA 2F8PA 2KI6C 4QJ4B 1JC2A 1AP4A 2Y1NA 1LA0A 3F45A 2F3YA 2WORA 1XO5A 4MEWA 1TNPA 2I18A 2H2KA 3LCPC 4C0LA 1KQMC 3E3RA 2WCBA 1B7TZ 2JOJA 1ALWA 1CMGA 1M31A 3QRXA 3GK2A 2KFFA 3PATA 2NZ0A 5KSZA 4JWQA 3OX6A 1KQVA 1M45A 1K94A 2PSRA 5FYXA 4C0KA 5HKWA 5PALA 1LA3A 1LXFC 4C0JA 2CNPA 4MN0A 3MSEB 3NSKA 1JFJA 2LVIA 1B8CA 3WHUB 4HRGA 1XK4C 2BCXA 1WDCB 3BXKA 3GK4X 3I5FC 4ETOA 1QLSA 1DJHA 1K95A 1SPYA 4XJKA 1A75A 1S6IA 4NDBA 2JRFA 4HSZA 4PE1A 1SMGA 2Q4UA 5ER4X 1YRTB 2KQYA 1KCYA 3KEVA 4NQGA 1IG5A 1UHHA 1F8HA 1RK9A 2I2RE 3VRRA 3BUWB 3D0YB 1IKUA 1TNWA 4DUQA 3CR5X 1L2OC 1KK8B 1U5IB 1FW4A 2BE4A 2L2EA 5HLOA 1LVCD 1AVSA 1EG4A 2HF5A 1UWOA 1SBJA 1DJXA 1YR5A 1Y0VH 2LMUA 2G9BA 1AJ4A 1B8LA 1OZOA 4USLA 2E6WA 2E30A 3ICBA 2LP2A 5CSFA 3A8RA 3VRPA 2JWWA 1A4PA 4U8DA 4ZCUA 4HREE 5HKZA 1KWOB 2JQ6A 2OS8B 2JTZA 5DKQA 1CTRA 1XYDA 2KFHA 1A2XA 2KHNA 3I5HB 3DVKA 2L4IA 2KAYA 2I7AA 2JT0A 3OHMB 4MZJA 1C7VA 1WDCC 1K8UA 1A29A 2L0PA 2LLTA 3DF0A 4GFTA 2EC6C 1WLZA 2LLUA 1V1GA 1F55A 1SCMB 2WCEA 3KPXA 1CDPA 3CS1A 4PE7A 3SIAA 2CXJA 2GV5A 1CFFA 1RWYA 3IF7A 4MBEA 1J7RA 1LKJA 3HX4A 1CFDA 1CNPA 2FOTA 2CBLA 1PRWA 4XJKB 2M7LA 1KK8C 4F0ZB 1DJGA 3DVEA 1EG3A 3FWCA 3PSRA 2WOSA 4PCWA 4GGFC 1FPWA 2CCMA 4PALA 2ZFDA 1SY9A 2JT3A 1QX5B 5HYDA 1S26D 1UHJA 1YX8A 2LAPA 2JXLA 1G8IA 1YVLA 4YGBB 1C07A 1IJ6A 1QIWA 3IQOA 1W7IB 2FJUB 2ZKMX 2LCPA 1WRLA 1Y1XA 2ZRSA 1N65A 4WRIA 5K89A 2K2FA 2F2PA 5CSJA 2PASA 1XFWO 2OS8C 1SCVA 4E68A 1BOCA 3I5HC 2QACA 1KK7Y 2BE6A 2D8NA 2MA2A 1PALA 4YGEB 3EKJA 5D69A 1S3PA 1UHKA 1D1OA 1WRKA 1FBVA 1PK0D 1SR6B 2KI4C 4M2PA 1XFYO 3AAKA 2CT9A 1N0YA 1NX2A 3KO0A 5I2QA 1S36A 2B1UA 2K8MB 1L2OB 4TNCA 2DOQA 1CKKA 1GQMA 4QJ5B 3BUOB 1SCMC 3GOFA 2LLSA 1M46A 4DCKA 3KF9A 1RJVA 2K7OA 3PN7B 3JVTB 3GK1A 4OR9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUU A;  1OMD A;  2L5X B;  1KK7 Z;  2GGZ A;  3DF0 B;  1DT7 B;  1SL9 A;  5AXI A;  1EXR A;  3LL8 B;  4GGN A;  1NCX A;  1AJ5 A;  2BBN A;  2BBM A;  2EGD A;  1Y1U A;  3CWG A;  4DS7 A;  1YUS A;  1V1F A;  2CTN A;  4P2Y B;  5HLV A;  1DF0 A;  1J1E A;  2OTG B;  2LVV A;  2BL0 B;  3ZNI A;  3KHE A;  1J7O A;  2JNX A;  2KBM A;  5I2O A;  3BUN B;  2G2B A;  1Y6W A;  2QPT A;  2LC5 A;  2EC6 B;  3H4S E;  1B9A A;  1NCY A;  1SL8 A;  3O2P A;  2KQ6 A;  1BF5 A;  4BY4 A;  1JF2 A;  2Y4Q A;  2F33 A;  1BMO A;  3SJS A;  1R6P A;  4GNK B;  3ZWH A;  2ZN9 A;  3LK1 A;  1DJI A;  1SR6 C;  1ZMZ A;  2K7B A;  3CTN A;  5TNC A;  4AQJ A;  2M97 A;  1UUS A;  4DIR A;  1QS7 A;  2AAO A;  1JUO A;  3RLZ A;  1CLM A;  2LV7 A;  1XFZ O;  2ZNE A;  3OB2 B;  3I5I B;  2PRU A;  1KSO A;  3DD4 A;  3PN7 C;  4JPZ B;  4YI8 A;  3JVT C;  1TOP A;  5AER A;  5JJG A;  1MHO A;  3CZT X;  2M0R A;  4PHM A;  2H61 C;  2MLE C;  1A03 A;  1Q80 A;  2KNE A;  2RGI A;  4N5X A;  4P5O E;  1TCF A;  1RTP 1;  1E8A A;  2JU0 A;  2LHI A;  1CB1 A;  3TDI A;  2OPO A;  1CLL A;  1K96 A;  3PM8 A;  1NPQ A;  5AAN A;  1C7W A;  2KBI A;  1IQ3 A;  3D10 A;  4CPV A;  1F4O A;  1DJY A;  2BKI B;  2COL B;  2VRG A;  3OP0 A;  1CLB A;  2OTG C;  1JWD A;  1K9K A;  4D1E A;  2BL0 C;  1XK4 A;  2FCE A;  2M7N A;  2PMY A;  4YGA A;  4ORA B;  1UHN A;  2ZRT A;  2GGM A;  1KFU S;  2HET A;  1NWD A;  3LK0 A;  1DGV A;  2Y5I A;  4JQ0 D;  2KI4 B;  1M63 B;  1YVH A;  3FS7 A;  1DF0 B;  5F6T A;  1DVI A;  1JBA A;  2LM5 A;  2JC2 A;  1XA5 A;  5AEQ A;  4M2O A;  4WQ3 A;  5KTY A;  4CFR A;  1NX0 A;  3WHT B;  3BOW A;  1PSB A;  4OVN F;  1YUR A;  1MR8 A;  2MJW B;  3FWB A;  2LVJ A;  2WCF A;  5CSI A;  3PLF B;  4I5J A;  1NUB A;  5B8I B;  1RRO A;  2LUX A;  3HCM A;  2SCP A;  1NX1 A;  3DVJ A;  3VRQ A;  1KFX S;  2K2A A;  1WY9 A;  1IRJ A;  1A75 B;  1YRU B;  3I5I C;  1BT6 A;  2LNK A;  3M0W A;  2NLN A;  1BLQ A;  3RM1 A;  2HPS A;  2Q91 A;  2LMT A;  1HT9 A;  2L50 A;  2MAZ A;  4ORC B;  4Q04 A;  3TDZ A;  1BR4 B;  1EL4 A;  1G4Y R;  3SG2 A;  1DMO A;  1IJ5 A;  4OCI A;  4PE4 A;  1QX7 A;  1F71 A;  3TUY B;  1XVJ A;  4YI9 A;  1OE9 B;  2BCB A;  3DVM A;  4GUK A;  1QX2 A;  2M3W A;  2SAS A;  3BQ3 A;  4CFQ A;  3C1V A;  4IL1 A;  1NCZ A;  2LAN A;  2M1U A;  2L4H A;  4MZK A;  1B8R A;  1REC A;  3AKA A;  4GPL B;  1QIV A;  2M49 B;  4N1G A;  3TZ1 A;  3BYA A;  5CPV A;  2IS9 A;  4HRH A;  3VGO A;  1L7Z A;  2ZN8 A;  4FQO A;  1F70 A;  1WRZ A;  3D0Y A;  1GJY A;  3SIB A;  4ZCV A;  1MF8 B;  2JNF A;  1FF1 A;  4MRY A;  1KSM A;  5BPJ A;  1ODB A;  1B4C A;  4CID A;  4MLW A;  3K21 A;  5DKN A;  1W7J B;  2M29 A;  1TNX A;  1AK8 A;  1IH0 A;  1UUR A;  5KU1 A;  2HQW A;  2LHL A;  2NXQ A;  1F54 A;  2LE9 B;  1BJF A;  3BOW B;  1NYA A;  3FIA A;  1RFJ A;  5AFP A;  3EVU A;  2MBX A;  2LUC A;  2K61 A;  1CM1 A;  1DJW A;  2FCD A;  3I5G B;  3SG3 A;  2O60 A;  2WND A;  2L51 A;  3TUY C;  1J55 A;  2KDH A;  3A4U B;  1ZUZ A;  4OV2 A;  4PHJ A;  1K93 D;  4GBA A;  3EVV A;  1B47 A;  1SK6 D;  3TS5 C;  3IQQ A;  3NSI A;  2ZND A;  2TN4 A;  1BG1 A;  4PHK A;  2LP3 A;  2WC8 A;  3EK4 A;  3JTD B;  4ORB B;  3PFV A;  4BY5 A;  1IGV A;  2JT8 A;  1SL7 A;  1ZOT B;  1OQP A;  4YGC B;  1CDM A;  1X02 A;  1EJ3 A;  1K9U A;  2NCP A;  1QXP A;  1J7Q A;  2PAL A;  1BU3 A;  1S6J A;  1QJT A;  3O78 A;  1G33 A;  1SKT A;  3SG6 A;  1MUX A;  4FTG A;  1H4B A;  2NCO A;  1BOD A;  3EVR A;  3NSO A;  3VRN A;  5J3X A;  2MHH A;  2MRD A;  1QLK A;  2AMI A;  1OMV A;  5I8N A;  4N1F A;  1J1D A;  2KYF A;  4M2Q A;  4YRU A;  3NSL A;  4L9M A;  1YUT A;  1TNQ A;  3O6B A;  2KFG A;  3CR4 X;  5G08 A;  3SG5 A;  1CDL A;  1BR1 B;  1MQ1 A;  1XFX O;  5HKY A;  1K2H A;  2JPT A;  1MXE A;  2PVB A;  2M8U A;  1OOJ A;  3CGA A;  3I5G C;  1ZFS A;  1PUL A;  1QV0 A;  2F3Z A;  4CLN A;  3BUX B;  1XFU O;  4A4C A;  1DTL A;  2KSP A;  2L98 A;  4R1E A;  2KGR A;  1M39 A;  2I94 A;  1KFU L;  1N2D A;  1SNL A;  1K9P A;  1CDN A;  1B1G A;  2K7C A;  3JTD C;  3SG4 A;  2ISD A;  1QAS A;  4I5K A;  1QTX A;  3OB1 B;  5CSN A;  1CFC A;  1AHR A;  2LVK A;  4XYN A;  1IWQ A;  2JXC A;  4DRW A;  1TIZ A;  3EK8 A;  4AQI A;  1AUI B;  2K0J A;  2BCA A;  3CLN A;  1YTZ C;  2KYC A;  3VRO A;  4WQ2 A;  1CM4 A;  1HQV A;  5JOL A;  1FI5 A;  2H61 A;  1S5G Y;  1JSA A;  1TCO B;  1MXL C;  3WXA A;  5GQQ C;  3BUM B;  1OZS A;  1PSR A;  1GGW A;  1KFX L;  2JUL A;  1R2U A;  3OX5 A;  1TN4 A;  1PVA A;  4AOM A;  1CFP A;  1UHI A;  1VRK A;  3NXA A;  1XFV O;  2R2I A;  4MSP A;  3EKH A;  3SG7 A;  1QVI Y;  1TTX A;  3TDU A;  4QJ3 B;  1S1E A;  1CMF A;  1NX3 A;  1QAT A;  4OKH A;  2P6B B;  1GGZ A;  1KQM B;  3TS5 B;  1MWN A;  4NDD A;  1JF0 A;  4UPG A;  2JTT A;  1SRA A;  2MLF C;  4YBH B;  2KAX A;  3CR2 A;  1S5G Z;  5D7F A;  1OMR A;  3PAL A;  2M1K B;  1EH2 A;  4ICB A;  1F4Q A;  2O5G A;  1DGU A;  4MZL A;  4YGD B;  3WNX B;  2M9G A;  3AAJ A;  2KOT A;  2LMV A;  4A4B A;  2HQ8 A;  3EK7 A;  2JZI A;  5ER5 A;  1SYM A;  1H8B A;  4PDZ A;  1QVI Z;  2K7D A;  3O4Y A;  1YX7 A;  4MVF A;  1NSH A;  3LLE A;  1FI6 A;  2AUC A;  2BKH B;  1NIW A;  3I5F B;  1LIN A;  2F2O A;  2Y1M A;  1S6C A;  1K90 D;  2KGB C;  1KWO C;  4I5N B;  1U5I A;  1ALV A;  4GAO A;  1Y1A A;  2EHB A;  2KI6 D;  1J7P A;  1ZAC A;  4MRX A;  1TRF A;  1B7T Y;  1PVB A;  1UP5 A;  4GGF A;  1WLM A;  2KAV A;  2BEC A;  3AKB A;  4PHN A;  4NDC A;  4I5L B;  1OSA A;  1IQ5 A;  1SW8 A;  2V53 A;  4PE0 A;  2A4J A;  5IBW A;  1NP8 A;  1QV1 A;  5DKR A;  5I2L A;  1JFK A;  1DJZ A;  2F8P A;  2KI6 C;  4QJ4 B;  1JC2 A;  1AP4 A;  2Y1N A;  1LA0 A;  3F45 A;  2F3Y A;  2WOR A;  1XO5 A;  4MEW A;  1TNP A;  2I18 A;  2H2K A;  3LCP C;  4C0L A;  1KQM C;  3E3R A;  2WCB A;  1B7T Z;  2JOJ A;  1ALW A;  1CMG A;  1M31 A;  3QRX A;  3GK2 A;  2KFF A;  3PAT A;  2NZ0 A;  5KSZ A;  4JWQ A;  3OX6 A;  1KQV A;  1M45 A;  1K94 A;  2PSR A;  5FYX A;  4C0K A;  5HKW A;  5PAL A;  1LA3 A;  1LXF C;  4C0J A;  2CNP A;  4MN0 A;  3MSE B;  3NSK A;  1JFJ A;  2LVI A;  1B8C A;  3WHU B;  4HRG A;  1XK4 C;  2BCX A;  1WDC B;  3BXK A;  3GK4 X;  3I5F C;  4ETO A;  1QLS A;  1DJH A;  1K95 A;  1SPY A;  4XJK A;  1A75 A;  1S6I A;  4NDB A;  2JRF A;  4HSZ A;  4PE1 A;  1SMG A;  2Q4U A;  5ER4 X;  1YRT B;  2KQY A;  1KCY A;  3KEV A;  4NQG A;  1IG5 A;  1UHH A;  1F8H A;  1RK9 A;  2I2R E;  3VRR A;  3BUW B;  3D0Y B;  1IKU A;  1TNW A;  4DUQ A;  3CR5 X;  1L2O C;  1KK8 B;  1U5I B;  1FW4 A;  2BE4 A;  2L2E A;  5HLO A;  1LVC D;  1AVS A;  1EG4 A;  2HF5 A;  1UWO A;  1SBJ A;  1DJX A;  1YR5 A;  1Y0V H;  2LMU A;  2G9B A;  1AJ4 A;  1B8L A;  1OZO A;  4USL A;  2E6W A;  2E30 A;  3ICB A;  2LP2 A;  5CSF A;  3A8R A;  3VRP A;  2JWW A;  1A4P A;  4U8D A;  4ZCU A;  4HRE E;  5HKZ A;  1KWO B;  2JQ6 A;  2OS8 B;  2JTZ A;  5DKQ A;  1CTR A;  1XYD A;  2KFH A;  1A2X A;  2KHN A;  3I5H B;  3DVK A;  2L4I A;  2KAY A;  2I7A A;  2JT0 A;  3OHM B;  4MZJ A;  1C7V A;  1WDC C;  1K8U A;  1A29 A;  2L0P A;  2LLT A;  3DF0 A;  4GFT A;  2EC6 C;  1WLZ A;  2LLU A;  1V1G A;  1F55 A;  1SCM B;  2WCE A;  3KPX A;  1CDP A;  3CS1 A;  4PE7 A;  3SIA A;  2CXJ A;  2GV5 A;  1CFF A;  1RWY A;  3IF7 A;  4MBE A;  1J7R A;  1LKJ A;  3HX4 A;  1CFD A;  1CNP A;  2FOT A;  2CBL A;  1PRW A;  4XJK B;  2M7L A;  1KK8 C;  4F0Z B;  1DJG A;  3DVE A;  1EG3 A;  3FWC A;  3PSR A;  2WOS A;  4PCW A;  4GGF C;  1FPW A;  2CCM A;  4PAL A;  2ZFD A;  1SY9 A;  2JT3 A;  1QX5 B;  5HYD A;  1S26 D;  1UHJ A;  1YX8 A;  2LAP A;  2JXL A;  1G8I A;  1YVL A;  4YGB B;  1C07 A;  1IJ6 A;  1QIW A;  3IQO A;  1W7I B;  2FJU B;  2ZKM X;  2LCP A;  1WRL A;  1Y1X A;  2ZRS A;  1N65 A;  4WRI A;  5K89 A;  2K2F A;  2F2P A;  5CSJ A;  2PAS A;  1XFW O;  2OS8 C;  1SCV A;  4E68 A;  1BOC A;  3I5H C;  2QAC A;  1KK7 Y;  2BE6 A;  2D8N A;  2MA2 A;  1PAL A;  4YGE B;  3EKJ A;  5D69 A;  1S3P A;  1UHK A;  1D1O A;  1WRK A;  1FBV A;  1PK0 D;  1SR6 B;  2KI4 C;  4M2P A;  1XFY O;  3AAK A;  2CT9 A;  1N0Y A;  1NX2 A;  3KO0 A;  5I2Q A;  1S36 A;  2B1U A;  2K8M B;  1L2O B;  4TNC A;  2DOQ A;  1CKK A;  1GQM A;  4QJ5 B;  3BUO B;  1SCM C;  3GOF A;  2LLS A;  1M46 A;  4DCK A;  3KF9 A;  1RJV A;  2K7O A;  3PN7 B;  3JVT B;  3GK1 A;  4OR9 B; 
#chains in the Genus database with same CATH topology
 1YUU A;  1OMD A;  3S0E A;  2L5X B;  1KK7 Z;  2GGZ A;  3DF0 B;  1DT7 B;  1SL9 A;  5AXI A;  1P28 A;  3D77 A;  1EXR A;  3LL8 B;  4GGN A;  1NCX A;  1AJ5 A;  2BBN A;  2BBM A;  2EGD A;  1Y1U A;  3CWG A;  4DS7 A;  1YUS A;  1V1F A;  2CTN A;  4P2Y B;  5HLV A;  1DF0 A;  1J1E A;  2OTG B;  3N7H A;  2LVV A;  2BL0 B;  3ZNI A;  3IVT A;  1DEL A;  3KHE A;  2QEV A;  1J7O A;  2JNX A;  2KBM A;  5I2O A;  4KYN A;  3BUN B;  2G2B A;  1Y6W A;  2QPT A;  2QDI A;  2LC5 A;  2K60 A;  4JKT A;  2EC6 B;  3CDN A;  3SS3 A;  2BNX A;  3H4S E;  1B9A A;  1NCY A;  1SL8 A;  3O2P A;  5FI7 A;  2KQ6 A;  1LS8 A;  1BF5 A;  4BY4 A;  1JF2 A;  3BFH A;  2Y4Q A;  2F33 A;  1BMO A;  3SJS A;  1R6P A;  4GNK B;  3ZWH A;  2ZN9 A;  3LK1 A;  1DJI A;  1SR6 C;  1ZMZ A;  2K7B A;  3CTN A;  5TNC A;  4AQJ A;  2M97 A;  1UUS A;  4DIR A;  1QS7 A;  2AAO A;  1JUO A;  3RLZ A;  1CLM A;  2LV7 A;  1XFZ O;  2ZNE A;  3OB2 B;  1Z4H A;  3I5I B;  2PRU A;  1KSO A;  3DD4 A;  3PN7 C;  4JPZ B;  1XFR A;  3JVT C;  1TOP A;  4YI8 A;  5AER A;  3BJH A;  1MHO A;  3CZT X;  2M0R A;  4PHM A;  2H61 C;  2MLE C;  2WCM A;  1A03 A;  1Q80 A;  2KNE A;  2RGI A;  4N5X A;  4P5O E;  1TCF A;  1RTP 1;  1E8A A;  2JU0 A;  2LHI A;  1CB1 A;  3TDI A;  2OPO A;  1CLL A;  1K96 A;  3PM8 A;  1NPQ A;  5AAN A;  1C7W A;  3CZ1 A;  2KBI A;  1IQ3 A;  3D10 A;  4CPV A;  1F4O A;  1DJY A;  2BKI B;  2COL B;  2VRG A;  3OP0 A;  1CLB A;  2OTG C;  3NHT A;  1K9K A;  1JWD A;  4D1E A;  2BL0 C;  1OOG A;  2WC5 A;  1XK4 A;  2FCE A;  2M7N A;  2PMY A;  4YGA A;  1TUZ A;  4ORA B;  1UHN A;  2ZRT A;  2GGM A;  1KFU S;  2HET A;  1NWD A;  1OOF A;  3LK0 A;  1DGV A;  2Y5I A;  4JQ0 D;  2KI4 B;  1M63 B;  1YVH A;  3FS7 A;  1DF0 B;  5F6T A;  1DVI A;  1JBA A;  2LM5 A;  2JC2 A;  1XA5 A;  5AEQ A;  4M2O A;  4WQ3 A;  5KTY A;  4CFR A;  1NX0 A;  3WHT B;  3BOW A;  1PSB A;  4OVN F;  1YUR A;  1DC1 A;  1MR8 A;  2MJW B;  3FWB A;  2LVJ A;  2WCF A;  5CSI A;  3PLF B;  4I5J A;  1NUB A;  5B8I B;  1RRO A;  2LUX A;  3HCM A;  2SCP A;  1NX1 A;  3DVJ A;  3VRQ A;  1KFX S;  2K2A A;  1WY9 A;  1IRJ A;  1A75 B;  1YRU B;  3I5I C;  1BT6 A;  2LNK A;  3K1E A;  2NLN A;  3M0W A;  1BLQ A;  3RM1 A;  2HPS A;  1OOI X;  2JPO A;  2Q91 A;  2WCK A;  2LMT A;  1HT9 A;  2L50 A;  2MAZ A;  4ORC B;  4Q04 A;  3TDZ A;  1BR4 B;  1EL4 A;  1G4Y R;  3SG2 A;  1DMO A;  1IJ5 A;  4OCI A;  4PE4 A;  1QX7 A;  1F71 A;  3TUY B;  1XVJ A;  4YI9 A;  1OE9 B;  2BCB A;  5I94 A;  3DVM A;  4GUK A;  4FQT A;  3UNW A;  1QX2 A;  2M3W A;  2SAS A;  3BQ3 A;  4CFQ A;  3C1V A;  4IL1 A;  1NCZ A;  2LAN A;  2M1U A;  2L4H A;  4MZK A;  1B8R A;  1REC A;  3AKA A;  3FE9 A;  4GPL B;  1QIV A;  3B86 A;  3DXL A;  2M49 B;  4N1G A;  3TZ1 A;  3BYA A;  5CPV A;  2IS9 A;  4HRH A;  3VGO A;  1L7Z A;  2ZN8 A;  3DY9 A;  4FQO A;  1F70 A;  1WRZ A;  3D0Y A;  1GJY A;  4INW A;  3SIB A;  4ZCV A;  3R1V A;  1MF8 B;  2JNF A;  3D73 A;  1FF1 A;  4MRY A;  3UO9 A;  1KSM A;  5BPJ A;  3OGN A;  1ODB A;  3CZ0 A;  1B4C A;  4CID A;  4MLW A;  5FI2 A;  3K21 A;  5DKN A;  3B6X A;  5HL1 A;  1W7J B;  2M29 A;  1TNX A;  1AK8 A;  1IH0 A;  1UUR A;  5KU1 A;  2HQW A;  2LHL A;  2NXQ A;  3S0A A;  1F54 A;  2LE9 B;  1BJF A;  3BOW B;  1NYA A;  3FIA A;  1RFJ A;  5AFP A;  3EVU A;  2MBX A;  2LUC A;  2K61 A;  1CM1 A;  1DJW A;  2FCD A;  3I5G B;  4JD9 A;  3SG3 A;  2O60 A;  2WND A;  2L51 A;  3TUY C;  1J55 A;  2KDH A;  3A4U B;  2KLD A;  1ZUZ A;  4OV2 A;  4PHJ A;  1K93 D;  4GBA A;  3EVV A;  1B47 A;  1SK6 D;  3TS5 C;  3IQQ A;  3NSI A;  2ZND A;  2TN4 A;  1BG1 A;  4PHK A;  2LP3 A;  2WC8 A;  3EK4 A;  3JTD B;  4ORB B;  3OBV A;  3PFV A;  4BY5 A;  1IGV A;  2JT8 A;  1SL7 A;  1ZOT B;  1SSE B;  1OQP A;  4YGC B;  1CDM A;  1X02 A;  2L5Y A;  4INX A;  1EJ3 A;  1K9U A;  2NCP A;  1QXP A;  1J7Q A;  2PAL A;  1BU3 A;  1S6J A;  5JJG A;  1QJT A;  3O78 A;  1G33 A;  1SKT A;  1GM0 A;  1T14 A;  2GTE A;  5DIC A;  3SG6 A;  1MUX A;  4FTG A;  1H4B A;  2NCO A;  1BOD A;  3EVR A;  3NSO A;  3VRN A;  5J3X A;  2MHH A;  2MRD A;  1QLK A;  2QEO A;  2AMI A;  3L4L A;  1OMV A;  5I8N A;  4N1F A;  3D78 A;  1J1D A;  2QEH A;  2KYF A;  4M2Q A;  4YRU A;  3NSL A;  4L9M A;  1YUT A;  1TNQ A;  3O6B A;  5D3O A;  2KFG A;  3CR4 X;  5G08 A;  3SG5 A;  1CDL A;  1BR1 B;  1MQ1 A;  1XFX O;  2H8V A;  5HKY A;  1K2H A;  2JPT A;  1MXE A;  2PVB A;  2M8U A;  1OOJ A;  2QEB A;  3CGA A;  3I5G C;  1ZFS A;  1PUL A;  1QV0 A;  2F3Z A;  4CLN A;  3BUX B;  1XFU O;  4A4C A;  3CZ2 A;  1DTL A;  2KSP A;  2L98 A;  4R1E A;  2KGR A;  1M39 A;  2I94 A;  1KFU L;  1N2D A;  1SNL A;  3PJI A;  1K9P A;  3R1P A;  1CDN A;  1B1G A;  2K7C A;  3JTD C;  3SG4 A;  2ISD A;  1QAS A;  4I5K A;  1QTX A;  3OB1 B;  5CSN A;  1CFC A;  1AHR A;  2LVK A;  4XYN A;  1IWQ A;  2JXC A;  4DRW A;  1TIZ A;  3EK8 A;  4AQI A;  1AUI B;  2K0J A;  2BCA A;  3CLN A;  1YTZ C;  2KYC A;  3VRO A;  4WQ2 A;  1CM4 A;  1HQV A;  5JOL A;  1FI5 A;  2H61 A;  1S5G Y;  1JSA A;  1TCO B;  1MXL C;  3WXA A;  5GQQ C;  3BUM B;  1OZS A;  1PSR A;  1GGW A;  1KFX L;  2JUL A;  1R2U A;  3B7A A;  3OX5 A;  1TN4 A;  1PVA A;  4AOM A;  1CFP A;  1UHI A;  3EG5 B;  1VRK A;  3NXA A;  1XFV O;  2R2I A;  4MSP A;  3EKH A;  2BAP A;  3SG7 A;  1QVI Y;  1TTX A;  3TDU A;  4QJ3 B;  1S1E A;  1CMF A;  1NX3 A;  1QAT A;  4OKH A;  2P6B B;  1GGZ A;  1KQM B;  2KPH A;  2WC6 A;  5FI6 A;  3TS5 B;  1MWN A;  4NDD A;  1JF0 A;  4UPG A;  2JTT A;  1SRA A;  2MLF C;  4YBH B;  2KAX A;  3CR2 A;  1S5G Z;  3FE6 A;  5D7F A;  1OMR A;  4F7F A;  3PAL A;  3D74 A;  2M1K B;  1EH2 A;  4ICB A;  1F4Q A;  2O5G A;  1DGU A;  4MZL A;  4YGD B;  3WNX B;  2M9G A;  3AAJ A;  2KOT A;  2LMV A;  4A4B A;  2HQ8 A;  3EK7 A;  2JZI A;  5ER5 A;  1SYM A;  3DYE A;  1H8B A;  4PDZ A;  1QVI Z;  2K7D A;  3O4Y A;  1YX7 A;  4MVF A;  1NSH A;  1Z2C B;  3LLE A;  1FI6 A;  2AUC A;  2BKH B;  1NIW A;  3I5F B;  1LIN A;  2F2O A;  2L2C A;  2Y1M A;  1S6C A;  1K90 D;  2KGB C;  1KWO C;  4I5N B;  1U5I A;  2FJY A;  1ALV A;  4GAO A;  1Y1A A;  2EHB A;  2KI6 D;  1J7P A;  1ZAC A;  4MRX A;  1TRF A;  1B7T Y;  1PVB A;  1UP5 A;  4GGF A;  1WLM A;  2KAV A;  3CAB A;  2BEC A;  3AKB A;  4PHN A;  4NDC A;  4I5L B;  1OSA A;  1IQ5 A;  1SW8 A;  2V53 A;  4PE0 A;  3D75 A;  2A4J A;  5IBW A;  1NP8 A;  1QV1 A;  5DKR A;  5I2L A;  1JFK A;  1DJZ A;  1IIO A;  2F8P A;  2KI6 C;  5EL2 A;  3V2L A;  4QJ4 B;  1AP4 A;  2Y1N A;  1JC2 A;  1LA0 A;  3F45 A;  2F3Y A;  2WOR A;  1XO5 A;  4MEW A;  3DZT A;  1TNP A;  2I18 A;  2H2K A;  2WCJ A;  3LCP C;  3CYZ A;  4C0L A;  1KQM C;  3E3R A;  2WCB A;  1B7T Z;  2JOJ A;  1ALW A;  1CMG A;  1M31 A;  3QRX A;  3GK2 A;  2KFF A;  3PAT A;  2NZ0 A;  5KSZ A;  4JWQ A;  3OX6 A;  4IJ7 A;  1KQV A;  1M45 A;  3RZS A;  1K94 A;  2PSR A;  3NHI A;  5FYX A;  4C0K A;  5HKW A;  5PAL A;  1LA3 A;  1LXF C;  4C0J A;  3SS5 A;  2CNP A;  1TWO A;  4MN0 A;  3MSE B;  3NSK A;  1C3Z A;  1JFJ A;  2LVI A;  1B8C A;  3WHU B;  4HRG A;  1XK4 C;  2BCX A;  1WDC B;  3BXK A;  3GK4 X;  3I5F C;  4ETO A;  1QLS A;  1DJH A;  1K95 A;  1SPY A;  3NGV A;  4XJK A;  3QME A;  1A75 A;  1S6I A;  2PYQ A;  2WCH A;  4NDB A;  2JRF A;  4HSZ A;  4PE1 A;  1SMG A;  2Q4U A;  5ER4 X;  1YRT B;  2KQY A;  1KCY A;  3KEV A;  4NQG A;  3S0D A;  1IG5 A;  1UHH A;  1F8H A;  1RK9 A;  3S0B A;  2I2R E;  3VRR A;  3BUW B;  3D0Y B;  1IKU A;  2KLE A;  1TNW A;  3O4X A;  4DUQ A;  3CR5 X;  1L2O C;  3Q8I A;  1KK8 B;  1U5I B;  3BFA A;  1FW4 A;  2BE4 A;  2L2E A;  3B87 A;  2P70 A;  5HLO A;  1LVC D;  1AVS A;  1EG4 A;  1ORG A;  2HF5 A;  3S0G A;  1UWO A;  1SBJ A;  1DJX A;  1YR5 A;  1Y0V H;  2LMU A;  2G9B A;  3D76 A;  1AJ4 A;  1B8L A;  1OZO A;  4USL A;  2E6W A;  2E30 A;  3ICB A;  2LP2 A;  5CSF A;  3A8R A;  3VRP A;  2JWW A;  1A4P A;  4U8D A;  3B88 A;  4HRE E;  4ZCU A;  1KWO B;  2PQL A;  5HKZ A;  2JQ6 A;  1C3Y A;  3R72 A;  2OS8 B;  2JTZ A;  5DKQ A;  1CTR A;  1XYD A;  2KFH A;  1A2X A;  2KHN A;  3I5H B;  3DVK A;  2WCL A;  2L4I A;  3VB1 A;  2KAY A;  2I7A A;  2JT0 A;  3OHM B;  4MZJ A;  1C7V A;  1WDC C;  1K8U A;  1A29 A;  2L0P A;  2LLT A;  3DF0 A;  4OZD A;  4GFT A;  2EC6 C;  1WLZ A;  2LLU A;  1V1G A;  1F55 A;  1SCM B;  2WCE A;  3KPX A;  1CDP A;  3CS1 A;  4PE7 A;  3SIA A;  2CXJ A;  2GV5 A;  3L4A A;  1CFF A;  1RWY A;  3IF7 A;  4MBE A;  1J7R A;  1LKJ A;  3HX4 A;  1CFD A;  1CNP A;  2FOT A;  2CBL A;  1PRW A;  4XJK B;  2M7L A;  1KK8 C;  4F0Z B;  1DJG A;  3BFB A;  1EG3 A;  1OOH A;  3DVE A;  3FWC A;  3PSR A;  3SS4 A;  2WOS A;  4PCW A;  4GGF C;  1FPW A;  2CCM A;  4PAL A;  2ZFD A;  1SY9 A;  2JT3 A;  3FE8 A;  1QX5 B;  5HYD A;  1S26 D;  1UHJ A;  1YX8 A;  2LAP A;  1DEK A;  2JXL A;  1G8I A;  1YVL A;  3PM2 A;  4YGB B;  1C07 A;  1IJ6 A;  1QIW A;  3IQO A;  1W7I B;  2FJU B;  2YGU A;  2ZKM X;  2LCP A;  1WRL A;  1Y1X A;  1TUJ A;  2ZRS A;  1N65 A;  4WRI A;  1W9Z A;  5K89 A;  2K2F A;  2F2P A;  5CSJ A;  2PAS A;  1XFW O;  2OS8 C;  1SCV A;  4E68 A;  1BOC A;  3I5H C;  2QAC A;  3L47 A;  1KK7 Y;  1DQE A;  1OW4 A;  2BE6 A;  2D8N A;  1PAL A;  2MA2 A;  4YGE B;  3EKJ A;  5D69 A;  3R1O A;  1S3P A;  1UHK A;  1D1O A;  1WRK A;  1FBV A;  2P71 A;  1PK0 D;  1SR6 B;  2KI4 C;  4M2P A;  1XFY O;  3AAK A;  2CT9 A;  1N0Y A;  1NX2 A;  3KO0 A;  5I2Q A;  1S36 A;  2B1U A;  2K8M B;  1L2O B;  4TNC A;  2DOQ A;  1CKK A;  1GQM A;  4QJ5 B;  1QWV A;  3BUO B;  1SCM C;  3GOF A;  2LLS A;  1M46 A;  4PT1 A;  4DCK A;  3KF9 A;  1RJV A;  2K7O A;  3PN7 B;  2ERB A;  3JVT B;  3GK1 A;  3S0F A;  4OR9 B; 
#chains in the Genus database with same CATH homology
 1YUU A;  1OMD A;  2L5X B;  1KK7 Z;  2GGZ A;  3DF0 B;  1DT7 B;  1SL9 A;  5AXI A;  1EXR A;  3LL8 B;  4GGN A;  1NCX A;  1AJ5 A;  2BBN A;  2BBM A;  2EGD A;  1Y1U A;  3CWG A;  4DS7 A;  1YUS A;  1V1F A;  2CTN A;  4P2Y B;  5HLV A;  1DF0 A;  1J1E A;  2OTG B;  2LVV A;  2BL0 B;  3ZNI A;  3KHE A;  1J7O A;  2JNX A;  2KBM A;  5I2O A;  3BUN B;  2G2B A;  1Y6W A;  2QPT A;  2LC5 A;  2EC6 B;  3H4S E;  1B9A A;  1NCY A;  1SL8 A;  3O2P A;  2KQ6 A;  1BF5 A;  4BY4 A;  1JF2 A;  2Y4Q A;  2F33 A;  1BMO A;  3SJS A;  1R6P A;  4GNK B;  3ZWH A;  2ZN9 A;  3LK1 A;  1DJI A;  1SR6 C;  1ZMZ A;  2K7B A;  3CTN A;  5TNC A;  4AQJ A;  2M97 A;  1UUS A;  4DIR A;  1QS7 A;  2AAO A;  1JUO A;  3RLZ A;  1CLM A;  2LV7 A;  1XFZ O;  2ZNE A;  3OB2 B;  3I5I B;  2PRU A;  1KSO A;  3DD4 A;  3PN7 C;  4JPZ B;  4YI8 A;  3JVT C;  1TOP A;  5AER A;  5JJG A;  1MHO A;  3CZT X;  2M0R A;  4PHM A;  2H61 C;  2MLE C;  1A03 A;  1Q80 A;  2KNE A;  2RGI A;  4N5X A;  4P5O E;  1TCF A;  1RTP 1;  1E8A A;  2JU0 A;  2LHI A;  1CB1 A;  3TDI A;  2OPO A;  1CLL A;  1K96 A;  3PM8 A;  1NPQ A;  5AAN A;  1C7W A;  2KBI A;  1IQ3 A;  3D10 A;  4CPV A;  1F4O A;  1DJY A;  2BKI B;  2COL B;  2VRG A;  3OP0 A;  1CLB A;  2OTG C;  1JWD A;  1K9K A;  4D1E A;  2BL0 C;  1XK4 A;  2FCE A;  2M7N A;  2PMY A;  4YGA A;  4ORA B;  1UHN A;  2ZRT A;  2GGM A;  1KFU S;  2HET A;  1NWD A;  3LK0 A;  1DGV A;  2Y5I A;  4JQ0 D;  2KI4 B;  1M63 B;  1YVH A;  3FS7 A;  1DF0 B;  5F6T A;  1DVI A;  1JBA A;  2LM5 A;  2JC2 A;  1XA5 A;  5AEQ A;  4M2O A;  4WQ3 A;  5KTY A;  4CFR A;  1NX0 A;  3WHT B;  3BOW A;  1PSB A;  4OVN F;  1YUR A;  1MR8 A;  2MJW B;  3FWB A;  2LVJ A;  2WCF A;  5CSI A;  3PLF B;  4I5J A;  1NUB A;  5B8I B;  1RRO A;  2LUX A;  3HCM A;  2SCP A;  1NX1 A;  3DVJ A;  3VRQ A;  1KFX S;  2K2A A;  1WY9 A;  1IRJ A;  1A75 B;  1YRU B;  3I5I C;  1BT6 A;  2LNK A;  3M0W A;  2NLN A;  1BLQ A;  3RM1 A;  2HPS A;  2Q91 A;  2LMT A;  1HT9 A;  2L50 A;  2MAZ A;  4ORC B;  4Q04 A;  3TDZ A;  1BR4 B;  1EL4 A;  1G4Y R;  3SG2 A;  1DMO A;  1IJ5 A;  4OCI A;  4PE4 A;  1QX7 A;  1F71 A;  3TUY B;  1XVJ A;  4YI9 A;  1OE9 B;  2BCB A;  3DVM A;  4GUK A;  1QX2 A;  2M3W A;  2SAS A;  3BQ3 A;  4CFQ A;  3C1V A;  4IL1 A;  1NCZ A;  2LAN A;  2M1U A;  2L4H A;  4MZK A;  1B8R A;  1REC A;  3AKA A;  4GPL B;  1QIV A;  2M49 B;  4N1G A;  3TZ1 A;  3BYA A;  5CPV A;  2IS9 A;  4HRH A;  3VGO A;  1L7Z A;  2ZN8 A;  4FQO A;  1F70 A;  1WRZ A;  3D0Y A;  1GJY A;  3SIB A;  4ZCV A;  1MF8 B;  2JNF A;  1FF1 A;  4MRY A;  1KSM A;  5BPJ A;  1ODB A;  1B4C A;  4CID A;  4MLW A;  3K21 A;  5DKN A;  1W7J B;  2M29 A;  1TNX A;  1AK8 A;  1IH0 A;  1UUR A;  5KU1 A;  2HQW A;  2LHL A;  2NXQ A;  1F54 A;  2LE9 B;  1BJF A;  3BOW B;  1NYA A;  3FIA A;  1RFJ A;  5AFP A;  3EVU A;  2MBX A;  2LUC A;  2K61 A;  1CM1 A;  1DJW A;  2FCD A;  3I5G B;  3SG3 A;  2O60 A;  2WND A;  2L51 A;  3TUY C;  1J55 A;  2KDH A;  3A4U B;  1ZUZ A;  4OV2 A;  4PHJ A;  1K93 D;  4GBA A;  3EVV A;  1B47 A;  1SK6 D;  3TS5 C;  3IQQ A;  3NSI A;  2ZND A;  2TN4 A;  1BG1 A;  4PHK A;  2LP3 A;  2WC8 A;  3EK4 A;  3JTD B;  4ORB B;  3PFV A;  4BY5 A;  1IGV A;  2JT8 A;  1SL7 A;  1ZOT B;  1OQP A;  4YGC B;  1CDM A;  1X02 A;  1EJ3 A;  1K9U A;  2NCP A;  1QXP A;  1J7Q A;  2PAL A;  1BU3 A;  1S6J A;  1QJT A;  3O78 A;  1G33 A;  1SKT A;  3SG6 A;  1MUX A;  4FTG A;  1H4B A;  2NCO A;  1BOD A;  3EVR A;  3NSO A;  3VRN A;  5J3X A;  2MHH A;  2MRD A;  1QLK A;  2AMI A;  1OMV A;  5I8N A;  4N1F A;  1J1D A;  2KYF A;  4M2Q A;  4YRU A;  3NSL A;  4L9M A;  1YUT A;  1TNQ A;  3O6B A;  2KFG A;  3CR4 X;  5G08 A;  3SG5 A;  1CDL A;  1BR1 B;  1MQ1 A;  1XFX O;  5HKY A;  1K2H A;  2JPT A;  1MXE A;  2PVB A;  2M8U A;  1OOJ A;  3CGA A;  3I5G C;  1ZFS A;  1PUL A;  1QV0 A;  2F3Z A;  4CLN A;  3BUX B;  1XFU O;  4A4C A;  1DTL A;  2KSP A;  2L98 A;  4R1E A;  2KGR A;  1M39 A;  2I94 A;  1KFU L;  1N2D A;  1SNL A;  1K9P A;  1CDN A;  1B1G A;  2K7C A;  3JTD C;  3SG4 A;  2ISD A;  1QAS A;  4I5K A;  1QTX A;  3OB1 B;  5CSN A;  1CFC A;  1AHR A;  2LVK A;  4XYN A;  1IWQ A;  2JXC A;  4DRW A;  1TIZ A;  3EK8 A;  4AQI A;  1AUI B;  2K0J A;  2BCA A;  3CLN A;  1YTZ C;  2KYC A;  3VRO A;  4WQ2 A;  1CM4 A;  1HQV A;  5JOL A;  1FI5 A;  2H61 A;  1S5G Y;  1JSA A;  1TCO B;  1MXL C;  3WXA A;  5GQQ C;  3BUM B;  1OZS A;  1PSR A;  1GGW A;  1KFX L;  2JUL A;  1R2U A;  3OX5 A;  1TN4 A;  1PVA A;  4AOM A;  1CFP A;  1UHI A;  1VRK A;  3NXA A;  1XFV O;  2R2I A;  4MSP A;  3EKH A;  3SG7 A;  1QVI Y;  1TTX A;  3TDU A;  4QJ3 B;  1S1E A;  1CMF A;  1NX3 A;  1QAT A;  4OKH A;  2P6B B;  1GGZ A;  1KQM B;  3TS5 B;  1MWN A;  4NDD A;  1JF0 A;  4UPG A;  2JTT A;  1SRA A;  2MLF C;  4YBH B;  2KAX A;  3CR2 A;  1S5G Z;  5D7F A;  1OMR A;  3PAL A;  2M1K B;  1EH2 A;  4ICB A;  1F4Q A;  2O5G A;  1DGU A;  4MZL A;  4YGD B;  3WNX B;  2M9G A;  3AAJ A;  2KOT A;  2LMV A;  4A4B A;  2HQ8 A;  3EK7 A;  2JZI A;  5ER5 A;  1SYM A;  1H8B A;  4PDZ A;  1QVI Z;  2K7D A;  3O4Y A;  1YX7 A;  4MVF A;  1NSH A;  3LLE A;  1FI6 A;  2AUC A;  2BKH B;  1NIW A;  3I5F B;  1LIN A;  2F2O A;  2Y1M A;  1S6C A;  1K90 D;  2KGB C;  1KWO C;  4I5N B;  1U5I A;  1ALV A;  4GAO A;  1Y1A A;  2EHB A;  2KI6 D;  1J7P A;  1ZAC A;  4MRX A;  1TRF A;  1B7T Y;  1PVB A;  1UP5 A;  4GGF A;  1WLM A;  2KAV A;  2BEC A;  3AKB A;  4PHN A;  4NDC A;  4I5L B;  1OSA A;  1IQ5 A;  1SW8 A;  2V53 A;  4PE0 A;  2A4J A;  5IBW A;  1NP8 A;  1QV1 A;  5DKR A;  5I2L A;  1JFK A;  1DJZ A;  2F8P A;  2KI6 C;  4QJ4 B;  1JC2 A;  1AP4 A;  2Y1N A;  1LA0 A;  3F45 A;  2F3Y A;  2WOR A;  1XO5 A;  4MEW A;  1TNP A;  2I18 A;  2H2K A;  3LCP C;  4C0L A;  1KQM C;  3E3R A;  2WCB A;  1B7T Z;  2JOJ A;  1ALW A;  1CMG A;  1M31 A;  3QRX A;  3GK2 A;  2KFF A;  3PAT A;  2NZ0 A;  5KSZ A;  4JWQ A;  3OX6 A;  1KQV A;  1M45 A;  1K94 A;  2PSR A;  5FYX A;  4C0K A;  5HKW A;  5PAL A;  1LA3 A;  1LXF C;  4C0J A;  2CNP A;  4MN0 A;  3MSE B;  3NSK A;  1JFJ A;  2LVI A;  1B8C A;  3WHU B;  4HRG A;  1XK4 C;  2BCX A;  1WDC B;  3BXK A;  3GK4 X;  3I5F C;  4ETO A;  1QLS A;  1DJH A;  1K95 A;  1SPY A;  4XJK A;  1A75 A;  1S6I A;  4NDB A;  2JRF A;  4HSZ A;  4PE1 A;  1SMG A;  2Q4U A;  5ER4 X;  1YRT B;  2KQY A;  1KCY A;  3KEV A;  4NQG A;  1IG5 A;  1UHH A;  1F8H A;  1RK9 A;  2I2R E;  3VRR A;  3BUW B;  3D0Y B;  1IKU A;  1TNW A;  4DUQ A;  3CR5 X;  1L2O C;  1KK8 B;  1U5I B;  1FW4 A;  2BE4 A;  2L2E A;  5HLO A;  1LVC D;  1AVS A;  1EG4 A;  2HF5 A;  1UWO A;  1SBJ A;  1DJX A;  1YR5 A;  1Y0V H;  2LMU A;  2G9B A;  1AJ4 A;  1B8L A;  1OZO A;  4USL A;  2E6W A;  2E30 A;  3ICB A;  2LP2 A;  5CSF A;  3A8R A;  3VRP A;  2JWW A;  1A4P A;  4U8D A;  4ZCU A;  4HRE E;  5HKZ A;  1KWO B;  2JQ6 A;  2OS8 B;  2JTZ A;  5DKQ A;  1CTR A;  1XYD A;  2KFH A;  1A2X A;  2KHN A;  3I5H B;  3DVK A;  2L4I A;  2KAY A;  2I7A A;  2JT0 A;  3OHM B;  4MZJ A;  1C7V A;  1WDC C;  1K8U A;  1A29 A;  2L0P A;  2LLT A;  3DF0 A;  4GFT A;  2EC6 C;  1WLZ A;  2LLU A;  1V1G A;  1F55 A;  1SCM B;  2WCE A;  3KPX A;  1CDP A;  3CS1 A;  4PE7 A;  3SIA A;  2CXJ A;  2GV5 A;  1CFF A;  1RWY A;  3IF7 A;  4MBE A;  1J7R A;  1LKJ A;  3HX4 A;  1CFD A;  1CNP A;  2FOT A;  2CBL A;  1PRW A;  4XJK B;  2M7L A;  1KK8 C;  4F0Z B;  1DJG A;  3DVE A;  1EG3 A;  3FWC A;  3PSR A;  2WOS A;  4PCW A;  4GGF C;  1FPW A;  2CCM A;  4PAL A;  2ZFD A;  1SY9 A;  2JT3 A;  1QX5 B;  5HYD A;  1S26 D;  1UHJ A;  1YX8 A;  2LAP A;  2JXL A;  1G8I A;  1YVL A;  4YGB B;  1C07 A;  1IJ6 A;  1QIW A;  3IQO A;  1W7I B;  2FJU B;  2ZKM X;  2LCP A;  1WRL A;  1Y1X A;  2ZRS A;  1N65 A;  4WRI A;  5K89 A;  2K2F A;  2F2P A;  5CSJ A;  2PAS A;  1XFW O;  2OS8 C;  1SCV A;  4E68 A;  1BOC A;  3I5H C;  2QAC A;  1KK7 Y;  2BE6 A;  2D8N A;  2MA2 A;  1PAL A;  4YGE B;  3EKJ A;  5D69 A;  1S3P A;  1UHK A;  1D1O A;  1WRK A;  1FBV A;  1PK0 D;  1SR6 B;  2KI4 C;  4M2P A;  1XFY O;  3AAK A;  2CT9 A;  1N0Y A;  1NX2 A;  3KO0 A;  5I2Q A;  1S36 A;  2B1U A;  2K8M B;  1L2O B;  4TNC A;  2DOQ A;  1CKK A;  1GQM A;  4QJ5 B;  3BUO B;  1SCM C;  3GOF A;  2LLS A;  1M46 A;  4DCK A;  3KF9 A;  1RJV A;  2K7O A;  3PN7 B;  3JVT B;  3GK1 A;  4OR9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...