1DF0B

Crystal structure of m-calpain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
176
Chain Sequence
NESEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M-CALPAIN
publication title Crystal structure of calpain reveals the structural basis for Ca(2+)-dependent protease activity and a novel mode of enzyme activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 56
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 1999-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1df0B00
1K9PA 1MQ1A 2BBMA 2MJWB 2JT0A 1NX0A 1F4QA 1K94A 2TN4A 3EVUA 2KI6D 4QJ4B 2LHIA 4OCIA 2HQ8A 1CTRA 4C0KA 3BUOB 1F71A 1K9UA 2HPSA 1PALA 2LV7A 1BF5A 1QV0A 3WNXB 1CLLA 2LMVA 1K9KA 1DJWA 1A75A 4ICBA 2JPTA 1SCMC 2LP2A 5CPVA 3C1VA 1S3PA 2HETA 5F6TA 1HQVA 3OB2B 1N2DA 2K0JA 2F33A 3OP0A 2LVKA 4IL1A 3K21A 2L0PA 2NZ0A 4YI8A 3SG3A 2L4IA 2L4HA 4DRWA 1CKKA 1SL8A 2M7NA 2G9BA 3NSOA 2ZRSA 3BYAA 4XYNA 1U5IA 5I2OA 1XA5A 2PALA 1LA0A 3OX5A 2WNDA 1OQPA 4HREE 1J55A 1EXRA 1DJYA 2ISDA 1RROA 1SRAA 4DIRA 2R2IA 5GQQC 2ZNEA 4MRXA 2LP3A 4PE1A 4I5JA 3TUYB 3KPXA 2Y4QA 2JU0A 1WY9A 1NPQA 1Q80A 2MBXA 1W7JB 2LLTA 3I5GC 1AHRA 2K2FA 2M49B 2JNXA 2KFHA 4OKHA 1L2OB 1CM1A 2LMTA 4HRGA 2LANA 1ZFSA 3ICBA 1CM4A 1LKJA 4OV2A 1FF1A 2LNKA 1C7WA 3NSLA 1A2XA 1YRUB 1JSAA 2Y1NA 1G4YR 2K2AA 2KI4B 2HQWA 2AMIA 2CXJA 3VRPA 2LVVA 1EG4A 1YUTA 2WORA 5HYDA 1CDNA 2OS8C 1YUSA 2DOQA 2QPTA 2H61A 2JC2A 2JT3A 3FWBA 4GNKB 3CS1A 2LAPA 2LUCA 1ALWA 2JXCA 4GUKA 2JXLA 1ALVA 3O4YA 2L50A 1CMGA 1NX3A 1BODA 1QX2A 2BBNA 3QRXA 2KBIA 1EH2A 2EGDA 2BL0B 1A29A 1B9AA 3CTNA 1J1EA 1SK6D 2IS9A 3I5IB 4WQ2A 1SW8A 1PSRA 1IWQA 1A75B 1UHHA 2CTNA 4NDDA 5AANA 1C7VA 1R2UA 4MSPA 1IJ6A 5HLVA 1UURA 4PE0A 1H8BA 1BMOA 3VGOA 1DJGA 1QJTA 1QX5B 4ETOA 1CFFA 1YTZC 2MHHA 4M2QA 3IQQA 3AAJA 3HX4A 5ER4X 2KI6C 3SIAA 2BE6A 2SASA 2F2PA 2OTGB 4ORAB 1LVCD 2GGZA 1Y0VH 3JTDB 4MZJA 3TS5C 1U5IB 5I2LA 4F0ZB 1QASA 1BR4B 1NIWA 1XK4A 1B7TY 1S6IA 2K8MB 1UP5A 1QLKA 1KQMC 4WQ3A 2AAOA 1OMRA 3RM1A 3VRRA 2WOSA 1KWOB 1TNXA 4XJKA 1IH0A 3NXAA 1V1GA 1IRJA 4P5OE 1SL7A 3RLZA 1TRFA 4GAOA 1AVSA 3WHUB 1QVIZ 1UHJA 1K90D 4MRYA 1KQVA 4MEWA 2K7OA 1YX8A 1ZMZA 1DMOA 4A4BA 1KK7Y 2Y5IA 1S6JA 2PASA 1FBVA 1NWDA 1M46A 1KK8B 3VRNA 2FCEA 3M0WA 3SG6A 2BKHB 1CLMA 4A4CA 1BU3A 4GGFA 4WRIA 3SG5A 1SL9A 1IG5A 3KO0A 1PVAA 5KSZA 3EK7A 4ORBB 1NP8A 1S5GZ 3ZNIA 2FCDA 2VRGA 4PHJA 1AJ5A 2K7DA 1YR5A 1ZUZA 3LCPC 1K2HA 5CSIA 2EC6B 1FI5A 1WRKA 1HT9A 1S1EA 4JPZB 3I5FB 1MXEA 4QJ5B 3EK4A 3O78A 1KFUS 4JQ0D 2M9GA 1IKUA 2BCBA 5AERA 3PSRA 2WCFA 4PHMA 3JVTB 1KCYA 1X02A 1QATA 2JTTA 4FTGA 4JWQA 4HSZA 2L98A 4MN0A 5K89A 1TIZA 4CFQA 2JRFA 1GJYA 2MAZA 4M2PA 3NSIA 2B1UA 3BUWB 1UHNA 2KYFA 2JULA 2PSRA 1IQ3A 2F3YA 1YRTB 1SMGA 1QIWA 2KHNA 3H4SE 1J7OA 1JBAA 2KQYA 4MLWA 3FWCA 1EG3A 2QACA 1SPYA 2MLFC 1GGZA 1IQ5A 4UPGA 1AUIB 2E30A 3AKAA 3KEVA 3O2PA 1TTXA 2CNPA 1K95A 1QV1A 1VRKA 1YVHA 2V53A 3HCMA 2LE9B 1ZOTB 3FS7A 1PVBA 1SR6B 3PN7B 1NCXA 1K93D 2KFGA 3CGAA 5I8NA 3PATA 5AXIA 4N1GA 4CLNA 2Y1MA 4U8DA 4XJKB 2JTZA 1H4BA 1FW4A 1TOPA 3E3RA 1OMDA 1FI6A 2BCAA 2F8PA 1N0YA 3GK2A 3SG2A 2AUCA 3SIBA 1TCFA 3TUYC 1DJZA 1EL4A 4AOMA 1Y1XA 1V1FA 2LM5A 1B4CA 1A4PA 3DVJA 1LXFC 1S26D 1L7ZA 5J3XA 5ER5A 1YVLA 1E8AA 4BY5A 1WRLA 2LCPA 2MLEC 1M45A 3GK4X 1BG1A 1MXLC 1F4OA 2NLNA 1L2OC 3KHEA 4AQJA 1WDCB 1RTP1 1LINA 1RWYA 2MRDA 1XK4C 1WLZA 3SG7A 1C07A 4PCWA 2KYCA 3CR5X 1DTLA 5DKNA 1ZACA 2KI4C 4GBAA 3EKHA 4TNCA 4YGDB 5HKWA 2F2OA 1Y1AA 1F55A 4YGCB 5FYXA 3SJSA 1RJVA 2OPOA 4YI9A 2JZIA 5G08A 1CFCA 1GGWA 3PM8A 4OVNF 1A03A 2O5GA 2G2BA 1MWNA 4YGBB 2M3WA 3CZTX 3TDZA 5D69A 2CCMA 4MVFA 1MR8A 2LVJA 3AAKA 1DGVA 1B1GA 2M0RA 4N1FA 2L2EA 4QJ3B 2I94A 2GGMA 4CFRA 2Q4UA 2NCOA 3CLNA 1AJ4A 2M29A 2LC5A 3BUMB 1B8LA 3BOWB 1TNWA 2BL0C 1NX1A 1CDLA 3I5IC 3LK1A 4N5XA 4CIDA 1PULA 5JOLA 3D0YA 2I2RE 1KFXS 1BR1B 4D1EA 1DJHA 2ZRTA 2HF5A 1NSHA 2ZN8A 2I18A 1OZSA 1RK9A 3O6BA 1LA3A 4YRUA 2JT8A 2LVIA 3WHTB 1OE9B 1WRZA 2I7AA 2SCPA 2KSPA 1IGVA 1B8CA 1PRWA 4I5LB 5PALA 4C0JA 2KFFA 4P2YB 2CBLA 2FJUB 2NXQA 2PVBA 4MZLA 1NCZA 1DF0A 2OTGC 3CR2A 1SCMB 3LK0A 5HKZA 5IBWA 1OMVA 3JTDC 3BQ3A 4DCKA 1DJIA 3VROA 1DJXA 1CNPA 2WC8A 4YBHB 1F54A 5AEQA 1XVJA 2BCXA 4GGNA 2ZFDA 1KWOC 1NX2A 1MHOA 1XFVO 2O60A 4YGAA 2PMYA 2COLB 4USLA 1F70A 3I5HB 1PSBA 2M97A 2RGIA 3A4UB 1N65A 2E6WA 2WCBA 5D7FA 1JFJA 3BUXB 1M31A 1SKTA 1XFZO 5CSFA 2K7CA 5DKQA 1NUBA 2KAYA 1D1OA 1J7QA 1QXPA 1QLSA 1KSOA 3BOWA 4Q04A 1KFUL 1CFDA 1KK8C 2KAVA 1JF2A 1B7TZ 1EJ3A 1UUSA 1Y6WA 4L9MA 4OR9B 4PE7A 5JJGA 5AFPA 1G8IA 2JWWA 3EVRA 4PE4A 1UWOA 2BE4A 1KSMA 1QS7A 3I5GB 1DGUA 2KBMA 4GFTA 1AK8A 2KDHA 1YUUA 3NSKA 2H61C 3AKBA 5HKYA 1BJFA 1QTXA 5HLOA 3WXAA 2BECA 3I5HC 1SY9A 4GPLB 3TZ1A 3DVEA 2LMUA 5BPJA 3VRQA 4C0LA 1XFWO 2EC6C 1MUXA 1SBJA 2ZN9A 1KK7Z 2D8NA 1F8HA 4ORCB 1CDMA 2K61A 3I5FC 2OS8B 4MZKA 1SCVA 2K7BA 3PLFB 1NCYA 2Q91A 1IJ5A 4NQGA 1G33A 3JVTC 1CFPA 4ZCUA 1DVIA 4NDBA 3D0YB 1TN4A 1MF8B 4DUQA 3TDIA 1J7RA 3DF0A 1FPWA 1YX7A 2MA2A 3IF7A 3CWGA 3GK1A 5KTYA 1JFKA 3LLEA 3CR4X 4CPVA 3DVKA 1J1DA 1K96A 1TNPA 1BLQA 1JWDA 2L5XB 1BT6A 2PRUA 1RFJA 1SYMA 2EHBA 4FQOA 5B8IB 1W7IB 1M63B 5DKRA 1DF0B 2JQ6A 2GV5A 1AP4A 2KAXA 4R1EA 1OSAA 2JOJA 5CSNA 1SR6C 3PN7C 3MSEB 3SG4A 2LUXA 2KQ6A 2LHLA 5CSJA 1CMFA 1QVIY 3TDUA 3BXKA 1NYAA 1XFYO 3TS5B 2F3ZA 1CB1A 1UHIA 1S6CA 5I2QA 3LL8B 2LLUA 1KQMB 3BUNB 1QIVA 2FOTA 4YGEB 4E68A 1J7PA 4DS7A 1TNQA 2KNEA 1M39A 2CT9A 1R6PA 1TCOB 5TNCA 3DVMA 3DD4A 4PHKA 3EKJA 3OHMB 1JUOA 1UHKA 1YURA 1WDCC 4I5KA 1S5GY 2H2KA 1BOCA 2LLSA 1PK0D 3F45A 3IQOA 1CDPA 1OOJA 4GGFC 3GOFA 1B47A 1QX7A 3KF9A 2KOTA 2L51A 2WCEA 1XO5A 1KFXL 2M1UA 1CLBA 4HRHA 4PALA 4AQIA 1DT7B 2M8UA 2P6BB 1RECA 3PALA 2KGBC 2ZKMX 1S36A 1WLMA 2M7LA 1XFUO 2M1KB 3EK8A 3OB1B 1XFXO 3EVVA 2JNFA 3PFVA 1GQMA 1ODBA 2BKIB 1B8RA 4NDCA 1OZOA 4PDZA 2KGRA 1XYDA 1Y1UA 4ZCVA 1JC2A 2NCPA 4MBEA 1JF0A 3ZWHA 4I5NB 5KU1A 2ZNDA 4BY4A 3D10A 1K8UA 3DF0B 4M2OA 4PHNA 1SNLA 3A8RA 3OX6A 3FIAA 2A4JA
chains in the Genus database with same CATH superfamily
1K9PA 1MQ1A 2BBMA 2MJWB 3OGNA 2JT0A 1NX0A 1F4QA 1K94A 2H8VA 2TN4A 3EVUA 2KI6D 4QJ4B 2LHIA 4OCIA 2HQ8A 1CTRA 4C0KA 3BUOB 1F71A 1K9UA 2HPSA 1PALA 2BAPA 2LV7A 1BF5A 1QV0A 3D74A 3WNXB 1CLLA 2LMVA 1K9KA 1DJWA 3CYZA 1A75A 4ICBA 2JPTA 1SCMC 2LP2A 5CPVA 3C1VA 1S3PA 2HETA 5F6TA 1HQVA 3OB2B 1N2DA 3PJIA 2K0JA 2F33A 1OOIX 3OP0A 2LVKA 4IL1A 1OOFA 3K21A 3BFHA 2L0PA 2NZ0A 4YI8A 2WCLA 3SG3A 2L4IA 2L4HA 4DRWA 1CKKA 1SL8A 2M7NA 2G9BA 3NSOA 1Z2CB 2ZRSA 3O4XA 3BYAA 4XYNA 1U5IA 5I2OA 3CZ1A 1XA5A 2PALA 1LA0A 2KLDA 3OX5A 2WNDA 1OQPA 4HREE 1J55A 1EXRA 1DJYA 2ISDA 1RROA 1SRAA 5EL2A 3S0DA 4DIRA 2R2IA 5GQQC 2ZNEA 4MRXA 2LP3A 4PE1A 4I5JA 3TUYB 3KPXA 2Y4QA 2JU0A 1WY9A 1NPQA 1Q80A 2MBXA 2WC5A 1W7JB 2LLTA 3I5GC 1AHRA 2K2FA 2M49B 2JNXA 2KFHA 4OKHA 4JKTA 1L2OB 1CM1A 2LMTA 4HRGA 2LANA 1ZFSA 3ICBA 3L4LA 3B7AA 1CM4A 1LKJA 4OV2A 1FF1A 2LNKA 1C7WA 3NSLA 1A2XA 1YRUB 1JSAA 2Y1NA 1G4YR 2K2AA 2KI4B 2HQWA 2AMIA 2CXJA 3VRPA 2LVVA 1EG4A 1YUTA 2WORA 5HYDA 1CDNA 2OS8C 1YUSA 2DOQA 2QPTA 2H61A 2JC2A 2JT3A 3FWBA 1P28A 4GNKB 3CS1A 3VB1A 2LAPA 2LUCA 1ALWA 2JXCA 4GUKA 3S0AA 3D77A 2JXLA 1ALVA 3O4YA 2L50A 1CMGA 3DXLA 1NX3A 2KPHA 1XFRA 1BODA 1QX2A 2BBNA 3QRXA 2KBIA 2WCKA 1EH2A 2EGDA 2BL0B 3UNWA 1A29A 1B9AA 3CTNA 1J1EA 1SK6D 2IS9A 3I5IB 1C3ZA 4WQ2A 4PT1A 1SW8A 1PSRA 1IWQA 1A75B 1UHHA 2CTNA 3FE8A 4NDDA 5AANA 1C7VA 1R2UA 5HL1A 3D73A 4MSPA 1IJ6A 5HLVA 1UURA 3SS5A 4PE0A 1H8BA 1BMOA 3VGOA 1DJGA 1QJTA 1QX5B 3S0BA 4ETOA 4JD9A 5FI7A 5JJGA 1CFFA 1YTZC 2MHHA 3NGVA 3IQQA 4M2QA 3AAJA 2GTEA 3HX4A 5ER4X 2KI6C 3SIAA 3BFAA 2BE6A 2SASA 2F2PA 2PQLA 1C3YA 2OTGB 4ORAB 3PM2A 1LVCD 2GGZA 1Y0VH 3JTDB 4MZJA 3TS5C 3R72A 1U5IB 5I2LA 4F0ZB 1QASA 3R1OA 1BR4B 1NIWA 1XK4A 1B7TY 1S6IA 2K8MB 1UP5A 1QLKA 1KQMC 4WQ3A 2AAOA 1OMRA 3RM1A 3VRRA 2WOSA 1KWOB 1TNXA 4XJKA 1IH0A 3NXAA 1V1GA 1IRJA 3SIBA 3RZSA 3NHIA 4P5OE 3D76A 1SL7A 3RLZA 1TRFA 4GAOA 1SSEB 1AVSA 3WHUB 3R1PA 1QVIZ 1UHJA 1K90D 4MRYA 1KQVA 4MEWA 2K7OA 1YX8A 1ZMZA 1DMOA 4A4BA 1KK7Y 1Z4HA 2Y5IA 1S6JA 2PASA 1FBVA 1NWDA 1M46A 1KK8B 3VRNA 2FCEA 3M0WA 3SG6A 2BKHB 1CLMA 4A4CA 1BU3A 4GGFA 4WRIA 3SG5A 1SL9A 1IG5A 3KO0A 1PVAA 5KSZA 3EK7A 4F7FA 4ORBB 1NP8A 1S5GZ 3BJHA 3ZNIA 2FCDA 2VRGA 4PHJA 1AJ5A 2K7DA 1YR5A 1ZUZA 3LCPC 1K2HA 5CSIA 2WCMA 2EC6B 1FI5A 1WRKA 1HT9A 2PYQA 1S1EA 3CZ0A 4JPZB 3I5FB 3N7HA 1MXEA 4QJ5B 3EK4A 3O78A 1KFUS 1T14A 4JQ0D 2M9GA 1IKUA 2BCBA 3L47A 3PSRA 2WCFA 4PHMA 5AERA 3JVTB 1KCYA 1X02A 1QATA 2JTTA 4FTGA 4JWQA 4HSZA 5D3OA 2L98A 4MN0A 5K89A 1TIZA 4CFQA 2JRFA 1GJYA 2MAZA 2BNXA 4M2PA 3NSIA 2B1UA 3BUWB 1UHNA 2KYFA 2JULA 2PSRA 1IQ3A 2F3YA 3DZTA 1YRTB 1SMGA 3S0FA 1QIWA 2KHNA 3H4SE 1J7OA 1JBAA 2KQYA 4MLWA 3FWCA 1EG3A 2QACA 1SPYA 1W9ZA 2MLFC 1GGZA 1IQ5A 4UPGA 1AUIB 2E30A 3AKAA 3KEVA 3O2PA 1TTXA 1K95A 1QV1A 1VRKA 1YVHA 2CNPA 2V53A 2WCHA 3HCMA 2LE9B 1ZOTB 3FS7A 1PVBA 1SR6B 3PN7B 1NCXA 3DY9A 1K93D 2KFGA 3CGAA 5I8NA 3PATA 1DELA 5AXIA 4N1GA 4CLNA 2Y1MA 4U8DA 4XJKB 2JTZA 1DQEA 1H4BA 1FW4A 1TOPA 3E3RA 3OBVA 1OMDA 1FI6A 2BCAA 2F8PA 1N0YA 2YGUA 3GK2A 2AUCA 4KYNA 3SG2A 1TUZA 1TCFA 4IJ7A 3TUYC 1DJZA 1EL4A 5FI6A 4AOMA 1Y1XA 1V1FA 2LM5A 1B4CA 1A4PA 3DVJA 1LXFC 1S26D 1L7ZA 5J3XA 5ER5A 1YVLA 1E8AA 4BY5A 1WRLA 2LCPA 2L2CA 1M45A 2MLEC 3GK4X 1BG1A 1MXLC 1F4OA 2NLNA 1L2OC 1OOHA 3KHEA 4AQJA 1WDCB 1RTP1 1LINA 1RWYA 2MRDA 1XK4C 1WLZA 3SG7A 1C07A 3B88A 2KYCA 3CR5X 4PCWA 1DTLA 5DKNA 3S0GA 1ZACA 2KI4C 4GBAA 3EKHA 4TNCA 4YGDB 5HKWA 1IIOA 2F2OA 2QEOA 1Y1AA 5DICA 1F55A 4YGCB 5FYXA 3SJSA 1RJVA 2OPOA 4YI9A 2JZIA 5G08A 1CFCA 1GGWA 3PM8A 4OVNF 1A03A 1GM0A 4INWA 2O5GA 2G2BA 1MWNA 4YGBB 2M3WA 2QEBA 3CZTX 5D69A 3TDZA 2CCMA 4MVFA 1MR8A 2LVJA 2KLEA 1DGVA 3AAKA 1B1GA 2M0RA 4N1FA 2L2EA 4QJ3B 2I94A 2GGMA 4CFRA 2Q4UA 2NCOA 3CLNA 1AJ4A 2M29A 2LC5A 3BUMB 1B8LA 3BOWB 1TNWA 2BL0C 1NX1A 1CDLA 3I5IC 3LK1A 4N5XA 4CIDA 1PULA 5JOLA 3D0YA 2I2RE 1KFXS 3B87A 1BR1B 4D1EA 1DJHA 1LS8A 2HF5A 2ZRTA 1NSHA 2ZN8A 2I18A 1OZSA 1RK9A 3CDNA 1LA3A 3O6BA 2JT8A 4YRUA 2LVIA 3WHTB 1OE9B 1WRZA 2I7AA 4FQTA 2SCPA 2KSPA 1IGVA 1B8CA 1PRWA 4I5LB 5PALA 1DEKA 4C0JA 2KFFA 4P2YB 2CBLA 2FJUB 2JPOA 2NXQA 2P71A 2PVBA 4MZLA 1NCZA 1DF0A 2OTGC 3CR2A 1SCMB 3LK0A 5HKZA 5IBWA 1OMVA 3EG5B 3JTDC 3BQ3A 3D75A 4DCKA 5I94A 1DJIA 3VROA 3IVTA 1DJXA 1CNPA 2QEVA 2WC8A 4YBHB 1F54A 2L5YA 5AEQA 1XVJA 2BCXA 4GGNA 2ZFDA 1KWOC 1NX2A 1MHOA 1XFVO 2O60A 4YGAA 2PMYA 2COLB 2ERBA 4USLA 1F70A 3I5HB 1PSBA 2M97A 2RGIA 2P70A 3A4UB 1N65A 2E6WA 2WCBA 5D7FA 1JFJA 3BUXB 1M31A 1SKTA 1XFZO 3V2LA 5CSFA 2WCJA 2K7CA 5DKQA 1NUBA 1OOGA 2KAYA 1D1OA 1J7QA 1QXPA 1QLSA 1KSOA 1DC1A 3BOWA 4Q04A 1KFUL 1CFDA 1KK8C 2KAVA 1JF2A 1B7TZ 1EJ3A 1UUSA 1Y6WA 4L9MA 4OR9B 4PE7A 3UO9A 5AFPA 1G8IA 2JWWA 3EVRA 4PE4A 1UWOA 2BE4A 1KSMA 1QS7A 3I5GB 1DGUA 2KBMA 4GFTA 1AK8A 2KDHA 1YUUA 3NSKA 2H61C 3AKBA 5HKYA 1BJFA 1QTXA 5HLOA 4INXA 3WXAA 2BECA 2QDIA 3I5HC 1SY9A 4GPLB 3TZ1A 3DVEA 2LMUA 5BPJA 3VRQA 4C0LA 1XFWO 2EC6C 1MUXA 2QEHA 1SBJA 2ZN9A 1KK7Z 2D8NA 1F8HA 4ORCB 1CDMA 2K61A 3I5FC 2OS8B 4MZKA 1SCVA 2K7BA 3PLFB 3Q8IA 1NCYA 2Q91A 1IJ5A 4NQGA 1G33A 3JVTC 1CFPA 4ZCUA 1ORGA 1DVIA 4NDBA 3D0YB 3DYEA 1TN4A 1MF8B 3QMEA 4DUQA 3TDIA 1J7RA 3DF0A 1FPWA 1YX7A 2MA2A 3B6XA 3CWGA 3IF7A 3GK1A 5KTYA 1JFKA 3CZ2A 3LLEA 3CR4X 4CPVA 3DVKA 1J1DA 1K96A 1TNPA 1BLQA 1JWDA 2L5XB 1BT6A 2PRUA 1RFJA 1SYMA 2EHBA 4FQOA 5B8IB 1W7IB 1M63B 5DKRA 1DF0B 3S0EA 2JQ6A 2GV5A 1AP4A 2KAXA 4R1EA 1OSAA 2JOJA 2WC6A 1SR6C 3PN7C 4OZDA 5CSNA 3MSEB 3SG4A 2LUXA 5FI2A 2KQ6A 2LHLA 5CSJA 1CMFA 1QVIY 3TDUA 3BXKA 2K60A 1NYAA 1XFYO 3TS5B 2F3ZA 1CB1A 1UHIA 1S6CA 5I2QA 3LL8B 2LLUA 1KQMB 3NHTA 3BUNB 1QIVA 2FOTA 4YGEB 4E68A 1J7PA 4DS7A 1TNQA 2KNEA 1M39A 2CT9A 1R6PA 1TWOA 3R1VA 1TCOB 5TNCA 3DVMA 3DD4A 4PHKA 3EKJA 3OHMB 1JUOA 1UHKA 1YURA 1WDCC 4I5KA 1S5GY 3SS4A 2H2KA 1BOCA 3BFBA 2LLSA 2FJYA 1PK0D 3F45A 3IQOA 1CDPA 1OOJA 4GGFC 3GOFA 1B47A 1QX7A 3KF9A 2KOTA 2L51A 2WCEA 1XO5A 1KFXL 2M1UA 1CLBA 4HRHA 3B86A 1OW4A 4PALA 3FE6A 4AQIA 1DT7B 2M8UA 2P6BB 1RECA 3PALA 2KGBC 2ZKMX 1TUJA 3D78A 1S36A 1WLMA 3L4AA 2M7LA 1XFUO 2M1KB 3EK8A 3OB1B 1XFXO 3CABA 3EVVA 2JNFA 3PFVA 3FE9A 1QWVA 1GQMA 1ODBA 2BKIB 1B8RA 4NDCA 1OZOA 3SS3A 4PDZA 2KGRA 1XYDA 1Y1UA 4ZCVA 1JC2A 2NCPA 4MBEA 1JF0A 3ZWHA 4I5NB 5KU1A 3K1EA 2ZNDA 4BY4A 3D10A 1K8UA 3DF0B 4M2OA 4PHNA 1SNLA 3A8RA 3OX6A 3FIAA 2A4JA
chains in the Genus database with same CATH topology
1K9PA 1MQ1A 2BBMA 2MJWB 2JT0A 1NX0A 1F4QA 1K94A 2TN4A 3EVUA 2KI6D 4QJ4B 2LHIA 4OCIA 2HQ8A 1CTRA 4C0KA 3BUOB 1F71A 1K9UA 2HPSA 1PALA 2LV7A 1BF5A 1QV0A 3WNXB 1CLLA 2LMVA 1K9KA 1DJWA 1A75A 4ICBA 2JPTA 1SCMC 2LP2A 5CPVA 3C1VA 1S3PA 2HETA 5F6TA 1HQVA 3OB2B 1N2DA 2K0JA 2F33A 3OP0A 2LVKA 4IL1A 3K21A 2L0PA 2NZ0A 4YI8A 3SG3A 2L4IA 2L4HA 4DRWA 1CKKA 1SL8A 2M7NA 2G9BA 3NSOA 2ZRSA 3BYAA 4XYNA 1U5IA 5I2OA 1XA5A 2PALA 1LA0A 3OX5A 2WNDA 1OQPA 4HREE 1J55A 1EXRA 1DJYA 2ISDA 1RROA 1SRAA 4DIRA 2R2IA 5GQQC 2ZNEA 4MRXA 2LP3A 4PE1A 4I5JA 3TUYB 3KPXA 2Y4QA 2JU0A 1WY9A 1NPQA 1Q80A 2MBXA 1W7JB 2LLTA 3I5GC 1AHRA 2K2FA 2M49B 2JNXA 2KFHA 4OKHA 1L2OB 1CM1A 2LMTA 4HRGA 2LANA 1ZFSA 3ICBA 1CM4A 1LKJA 4OV2A 1FF1A 2LNKA 1C7WA 3NSLA 1A2XA 1YRUB 1JSAA 2Y1NA 1G4YR 2K2AA 2KI4B 2HQWA 2AMIA 2CXJA 3VRPA 2LVVA 1EG4A 1YUTA 2WORA 5HYDA 1CDNA 2OS8C 1YUSA 2DOQA 2QPTA 2H61A 2JC2A 2JT3A 3FWBA 4GNKB 3CS1A 2LAPA 2LUCA 1ALWA 2JXCA 4GUKA 2JXLA 1ALVA 3O4YA 2L50A 1CMGA 1NX3A 1BODA 1QX2A 2BBNA 3QRXA 2KBIA 1EH2A 2EGDA 2BL0B 1A29A 1B9AA 3CTNA 1J1EA 1SK6D 2IS9A 3I5IB 4WQ2A 1SW8A 1PSRA 1IWQA 1A75B 1UHHA 2CTNA 4NDDA 5AANA 1C7VA 1R2UA 4MSPA 1IJ6A 5HLVA 1UURA 4PE0A 1H8BA 1BMOA 3VGOA 1DJGA 1QJTA 1QX5B 4ETOA 1CFFA 1YTZC 2MHHA 4M2QA 3IQQA 3AAJA 3HX4A 5ER4X 2KI6C 3SIAA 2BE6A 2SASA 2F2PA 2OTGB 4ORAB 1LVCD 2GGZA 1Y0VH 3JTDB 4MZJA 3TS5C 1U5IB 5I2LA 4F0ZB 1QASA 1BR4B 1NIWA 1XK4A 1B7TY 1S6IA 2K8MB 1UP5A 1QLKA 1KQMC 4WQ3A 2AAOA 1OMRA 3RM1A 3VRRA 2WOSA 1KWOB 1TNXA 4XJKA 1IH0A 3NXAA 1V1GA 1IRJA 4P5OE 1SL7A 3RLZA 1TRFA 4GAOA 1AVSA 3WHUB 1QVIZ 1UHJA 1K90D 4MRYA 1KQVA 4MEWA 2K7OA 1YX8A 1ZMZA 1DMOA 4A4BA 1KK7Y 2Y5IA 1S6JA 2PASA 1FBVA 1NWDA 1M46A 1KK8B 3VRNA 2FCEA 3M0WA 3SG6A 2BKHB 1CLMA 4A4CA 1BU3A 4GGFA 4WRIA 3SG5A 1SL9A 1IG5A 3KO0A 1PVAA 5KSZA 3EK7A 4ORBB 1NP8A 1S5GZ 3ZNIA 2FCDA 2VRGA 4PHJA 1AJ5A 2K7DA 1YR5A 1ZUZA 3LCPC 1K2HA 5CSIA 2EC6B 1FI5A 1WRKA 1HT9A 1S1EA 4JPZB 3I5FB 1MXEA 4QJ5B 3EK4A 3O78A 1KFUS 4JQ0D 2M9GA 1IKUA 2BCBA 5AERA 3PSRA 2WCFA 4PHMA 3JVTB 1KCYA 1X02A 1QATA 2JTTA 4FTGA 4JWQA 4HSZA 2L98A 4MN0A 5K89A 1TIZA 4CFQA 2JRFA 1GJYA 2MAZA 4M2PA 3NSIA 2B1UA 3BUWB 1UHNA 2KYFA 2JULA 2PSRA 1IQ3A 2F3YA 1YRTB 1SMGA 1QIWA 2KHNA 3H4SE 1J7OA 1JBAA 2KQYA 4MLWA 3FWCA 1EG3A 2QACA 1SPYA 2MLFC 1GGZA 1IQ5A 4UPGA 1AUIB 2E30A 3AKAA 3KEVA 3O2PA 1TTXA 2CNPA 1K95A 1QV1A 1VRKA 1YVHA 2V53A 3HCMA 2LE9B 1ZOTB 3FS7A 1PVBA 1SR6B 3PN7B 1NCXA 1K93D 2KFGA 3CGAA 5I8NA 3PATA 5AXIA 4N1GA 4CLNA 2Y1MA 4U8DA 4XJKB 2JTZA 1H4BA 1FW4A 1TOPA 3E3RA 1OMDA 1FI6A 2BCAA 2F8PA 1N0YA 3GK2A 3SG2A 2AUCA 3SIBA 1TCFA 3TUYC 1DJZA 1EL4A 4AOMA 1Y1XA 1V1FA 2LM5A 1B4CA 1A4PA 3DVJA 1LXFC 1S26D 1L7ZA 5J3XA 5ER5A 1YVLA 1E8AA 4BY5A 1WRLA 2LCPA 2MLEC 1M45A 3GK4X 1BG1A 1MXLC 1F4OA 2NLNA 1L2OC 3KHEA 4AQJA 1WDCB 1RTP1 1LINA 1RWYA 2MRDA 1XK4C 1WLZA 3SG7A 1C07A 4PCWA 2KYCA 3CR5X 1DTLA 5DKNA 1ZACA 2KI4C 4GBAA 3EKHA 4TNCA 4YGDB 5HKWA 2F2OA 1Y1AA 1F55A 4YGCB 5FYXA 3SJSA 1RJVA 2OPOA 4YI9A 2JZIA 5G08A 1CFCA 1GGWA 3PM8A 4OVNF 1A03A 2O5GA 2G2BA 1MWNA 4YGBB 2M3WA 3CZTX 3TDZA 5D69A 2CCMA 4MVFA 1MR8A 2LVJA 3AAKA 1DGVA 1B1GA 2M0RA 4N1FA 2L2EA 4QJ3B 2I94A 2GGMA 4CFRA 2Q4UA 2NCOA 3CLNA 1AJ4A 2M29A 2LC5A 3BUMB 1B8LA 3BOWB 1TNWA 2BL0C 1NX1A 1CDLA 3I5IC 3LK1A 4N5XA 4CIDA 1PULA 5JOLA 3D0YA 2I2RE 1KFXS 1BR1B 4D1EA 1DJHA 2ZRTA 2HF5A 1NSHA 2ZN8A 2I18A 1OZSA 1RK9A 3O6BA 1LA3A 4YRUA 2JT8A 2LVIA 3WHTB 1OE9B 1WRZA 2I7AA 2SCPA 2KSPA 1IGVA 1B8CA 1PRWA 4I5LB 5PALA 4C0JA 2KFFA 4P2YB 2CBLA 2FJUB 2NXQA 2PVBA 4MZLA 1NCZA 1DF0A 2OTGC 3CR2A 1SCMB 3LK0A 5HKZA 5IBWA 1OMVA 3JTDC 3BQ3A 4DCKA 1DJIA 3VROA 1DJXA 1CNPA 2WC8A 4YBHB 1F54A 5AEQA 1XVJA 2BCXA 4GGNA 2ZFDA 1KWOC 1NX2A 1MHOA 1XFVO 2O60A 4YGAA 2PMYA 2COLB 4USLA 1F70A 3I5HB 1PSBA 2M97A 2RGIA 3A4UB 1N65A 2E6WA 2WCBA 5D7FA 1JFJA 3BUXB 1M31A 1SKTA 1XFZO 5CSFA 2K7CA 5DKQA 1NUBA 2KAYA 1D1OA 1J7QA 1QXPA 1QLSA 1KSOA 3BOWA 4Q04A 1KFUL 1CFDA 1KK8C 2KAVA 1JF2A 1B7TZ 1EJ3A 1UUSA 1Y6WA 4L9MA 4OR9B 4PE7A 5JJGA 5AFPA 1G8IA 2JWWA 3EVRA 4PE4A 1UWOA 2BE4A 1KSMA 1QS7A 3I5GB 1DGUA 2KBMA 4GFTA 1AK8A 2KDHA 1YUUA 3NSKA 2H61C 3AKBA 5HKYA 1BJFA 1QTXA 5HLOA 3WXAA 2BECA 3I5HC 1SY9A 4GPLB 3TZ1A 3DVEA 2LMUA 5BPJA 3VRQA 4C0LA 1XFWO 2EC6C 1MUXA 1SBJA 2ZN9A 1KK7Z 2D8NA 1F8HA 4ORCB 1CDMA 2K61A 3I5FC 2OS8B 4MZKA 1SCVA 2K7BA 3PLFB 1NCYA 2Q91A 1IJ5A 4NQGA 1G33A 3JVTC 1CFPA 4ZCUA 1DVIA 4NDBA 3D0YB 1TN4A 1MF8B 4DUQA 3TDIA 1J7RA 3DF0A 1FPWA 1YX7A 2MA2A 3IF7A 3CWGA 3GK1A 5KTYA 1JFKA 3LLEA 3CR4X 4CPVA 3DVKA 1J1DA 1K96A 1TNPA 1BLQA 1JWDA 2L5XB 1BT6A 2PRUA 1RFJA 1SYMA 2EHBA 4FQOA 5B8IB 1W7IB 1M63B 5DKRA 1DF0B 2JQ6A 2GV5A 1AP4A 2KAXA 4R1EA 1OSAA 2JOJA 5CSNA 1SR6C 3PN7C 3MSEB 3SG4A 2LUXA 2KQ6A 2LHLA 5CSJA 1CMFA 1QVIY 3TDUA 3BXKA 1NYAA 1XFYO 3TS5B 2F3ZA 1CB1A 1UHIA 1S6CA 5I2QA 3LL8B 2LLUA 1KQMB 3BUNB 1QIVA 2FOTA 4YGEB 4E68A 1J7PA 4DS7A 1TNQA 2KNEA 1M39A 2CT9A 1R6PA 1TCOB 5TNCA 3DVMA 3DD4A 4PHKA 3EKJA 3OHMB 1JUOA 1UHKA 1YURA 1WDCC 4I5KA 1S5GY 2H2KA 1BOCA 2LLSA 1PK0D 3F45A 3IQOA 1CDPA 1OOJA 4GGFC 3GOFA 1B47A 1QX7A 3KF9A 2KOTA 2L51A 2WCEA 1XO5A 1KFXL 2M1UA 1CLBA 4HRHA 4PALA 4AQIA 1DT7B 2M8UA 2P6BB 1RECA 3PALA 2KGBC 2ZKMX 1S36A 1WLMA 2M7LA 1XFUO 2M1KB 3EK8A 3OB1B 1XFXO 3EVVA 2JNFA 3PFVA 1GQMA 1ODBA 2BKIB 1B8RA 4NDCA 1OZOA 4PDZA 2KGRA 1XYDA 1Y1UA 4ZCVA 1JC2A 2NCPA 4MBEA 1JF0A 3ZWHA 4I5NB 5KU1A 2ZNDA 4BY4A 3D10A 1K8UA 3DF0B 4M2OA 4PHNA 1SNLA 3A8RA 3OX6A 3FIAA 2A4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9P A;  1MQ1 A;  2BBM A;  2MJW B;  2JT0 A;  1NX0 A;  1F4Q A;  1K94 A;  2TN4 A;  3EVU A;  2KI6 D;  4QJ4 B;  2LHI A;  4OCI A;  2HQ8 A;  1CTR A;  4C0K A;  3BUO B;  1F71 A;  1K9U A;  2HPS A;  1PAL A;  2LV7 A;  1BF5 A;  1QV0 A;  3WNX B;  1CLL A;  2LMV A;  1K9K A;  1DJW A;  1A75 A;  4ICB A;  2JPT A;  1SCM C;  2LP2 A;  5CPV A;  3C1V A;  1S3P A;  2HET A;  5F6T A;  1HQV A;  3OB2 B;  1N2D A;  2K0J A;  2F33 A;  3OP0 A;  2LVK A;  4IL1 A;  3K21 A;  2L0P A;  2NZ0 A;  4YI8 A;  3SG3 A;  2L4I A;  2L4H A;  4DRW A;  1CKK A;  1SL8 A;  2M7N A;  2G9B A;  3NSO A;  2ZRS A;  3BYA A;  4XYN A;  1U5I A;  5I2O A;  1XA5 A;  2PAL A;  1LA0 A;  3OX5 A;  2WND A;  1OQP A;  4HRE E;  1J55 A;  1EXR A;  1DJY A;  2ISD A;  1RRO A;  1SRA A;  4DIR A;  2R2I A;  5GQQ C;  2ZNE A;  4MRX A;  2LP3 A;  4PE1 A;  4I5J A;  3TUY B;  3KPX A;  2Y4Q A;  2JU0 A;  1WY9 A;  1NPQ A;  1Q80 A;  2MBX A;  1W7J B;  2LLT A;  3I5G C;  1AHR A;  2K2F A;  2M49 B;  2JNX A;  2KFH A;  4OKH A;  1L2O B;  1CM1 A;  2LMT A;  4HRG A;  2LAN A;  1ZFS A;  3ICB A;  1CM4 A;  1LKJ A;  4OV2 A;  1FF1 A;  2LNK A;  1C7W A;  3NSL A;  1A2X A;  1YRU B;  1JSA A;  2Y1N A;  1G4Y R;  2K2A A;  2KI4 B;  2HQW A;  2AMI A;  2CXJ A;  3VRP A;  2LVV A;  1EG4 A;  1YUT A;  2WOR A;  5HYD A;  1CDN A;  2OS8 C;  1YUS A;  2DOQ A;  2QPT A;  2H61 A;  2JC2 A;  2JT3 A;  3FWB A;  4GNK B;  3CS1 A;  2LAP A;  2LUC A;  1ALW A;  2JXC A;  4GUK A;  2JXL A;  1ALV A;  3O4Y A;  2L50 A;  1CMG A;  1NX3 A;  1BOD A;  1QX2 A;  2BBN A;  3QRX A;  2KBI A;  1EH2 A;  2EGD A;  2BL0 B;  1A29 A;  1B9A A;  3CTN A;  1J1E A;  1SK6 D;  2IS9 A;  3I5I B;  4WQ2 A;  1SW8 A;  1PSR A;  1IWQ A;  1A75 B;  1UHH A;  2CTN A;  4NDD A;  5AAN A;  1C7V A;  1R2U A;  4MSP A;  1IJ6 A;  5HLV A;  1UUR A;  4PE0 A;  1H8B A;  1BMO A;  3VGO A;  1DJG A;  1QJT A;  1QX5 B;  4ETO A;  1CFF A;  1YTZ C;  2MHH A;  4M2Q A;  3IQQ A;  3AAJ A;  3HX4 A;  5ER4 X;  2KI6 C;  3SIA A;  2BE6 A;  2SAS A;  2F2P A;  2OTG B;  4ORA B;  1LVC D;  2GGZ A;  1Y0V H;  3JTD B;  4MZJ A;  3TS5 C;  1U5I B;  5I2L A;  4F0Z B;  1QAS A;  1BR4 B;  1NIW A;  1XK4 A;  1B7T Y;  1S6I A;  2K8M B;  1UP5 A;  1QLK A;  1KQM C;  4WQ3 A;  2AAO A;  1OMR A;  3RM1 A;  3VRR A;  2WOS A;  1KWO B;  1TNX A;  4XJK A;  1IH0 A;  3NXA A;  1V1G A;  1IRJ A;  4P5O E;  1SL7 A;  3RLZ A;  1TRF A;  4GAO A;  1AVS A;  3WHU B;  1QVI Z;  1UHJ A;  1K90 D;  4MRY A;  1KQV A;  4MEW A;  2K7O A;  1YX8 A;  1ZMZ A;  1DMO A;  4A4B A;  1KK7 Y;  2Y5I A;  1S6J A;  2PAS A;  1FBV A;  1NWD A;  1M46 A;  1KK8 B;  3VRN A;  2FCE A;  3M0W A;  3SG6 A;  2BKH B;  1CLM A;  4A4C A;  1BU3 A;  4GGF A;  4WRI A;  3SG5 A;  1SL9 A;  1IG5 A;  3KO0 A;  1PVA A;  5KSZ A;  3EK7 A;  4ORB B;  1NP8 A;  1S5G Z;  3ZNI A;  2FCD A;  2VRG A;  4PHJ A;  1AJ5 A;  2K7D A;  1YR5 A;  1ZUZ A;  3LCP C;  1K2H A;  5CSI A;  2EC6 B;  1FI5 A;  1WRK A;  1HT9 A;  1S1E A;  4JPZ B;  3I5F B;  1MXE A;  4QJ5 B;  3EK4 A;  3O78 A;  1KFU S;  4JQ0 D;  2M9G A;  1IKU A;  2BCB A;  5AER A;  3PSR A;  2WCF A;  4PHM A;  3JVT B;  1KCY A;  1X02 A;  1QAT A;  2JTT A;  4FTG A;  4JWQ A;  4HSZ A;  2L98 A;  4MN0 A;  5K89 A;  1TIZ A;  4CFQ A;  2JRF A;  1GJY A;  2MAZ A;  4M2P A;  3NSI A;  2B1U A;  3BUW B;  1UHN A;  2KYF A;  2JUL A;  2PSR A;  1IQ3 A;  2F3Y A;  1YRT B;  1SMG A;  1QIW A;  2KHN A;  3H4S E;  1J7O A;  1JBA A;  2KQY A;  4MLW A;  3FWC A;  1EG3 A;  2QAC A;  1SPY A;  2MLF C;  1GGZ A;  1IQ5 A;  4UPG A;  1AUI B;  2E30 A;  3AKA A;  3KEV A;  3O2P A;  1TTX A;  2CNP A;  1K95 A;  1QV1 A;  1VRK A;  1YVH A;  2V53 A;  3HCM A;  2LE9 B;  1ZOT B;  3FS7 A;  1PVB A;  1SR6 B;  3PN7 B;  1NCX A;  1K93 D;  2KFG A;  3CGA A;  5I8N A;  3PAT A;  5AXI A;  4N1G A;  4CLN A;  2Y1M A;  4U8D A;  4XJK B;  2JTZ A;  1H4B A;  1FW4 A;  1TOP A;  3E3R A;  1OMD A;  1FI6 A;  2BCA A;  2F8P A;  1N0Y A;  3GK2 A;  3SG2 A;  2AUC A;  3SIB A;  1TCF A;  3TUY C;  1DJZ A;  1EL4 A;  4AOM A;  1Y1X A;  1V1F A;  2LM5 A;  1B4C A;  1A4P A;  3DVJ A;  1LXF C;  1S26 D;  1L7Z A;  5J3X A;  5ER5 A;  1YVL A;  1E8A A;  4BY5 A;  1WRL A;  2LCP A;  2MLE C;  1M45 A;  3GK4 X;  1BG1 A;  1MXL C;  1F4O A;  2NLN A;  1L2O C;  3KHE A;  4AQJ A;  1WDC B;  1RTP 1;  1LIN A;  1RWY A;  2MRD A;  1XK4 C;  1WLZ A;  3SG7 A;  1C07 A;  4PCW A;  2KYC A;  3CR5 X;  1DTL A;  5DKN A;  1ZAC A;  2KI4 C;  4GBA A;  3EKH A;  4TNC A;  4YGD B;  5HKW A;  2F2O A;  1Y1A A;  1F55 A;  4YGC B;  5FYX A;  3SJS A;  1RJV A;  2OPO A;  4YI9 A;  2JZI A;  5G08 A;  1CFC A;  1GGW A;  3PM8 A;  4OVN F;  1A03 A;  2O5G A;  2G2B A;  1MWN A;  4YGB B;  2M3W A;  3CZT X;  3TDZ A;  5D69 A;  2CCM A;  4MVF A;  1MR8 A;  2LVJ A;  3AAK A;  1DGV A;  1B1G A;  2M0R A;  4N1F A;  2L2E A;  4QJ3 B;  2I94 A;  2GGM A;  4CFR A;  2Q4U A;  2NCO A;  3CLN A;  1AJ4 A;  2M29 A;  2LC5 A;  3BUM B;  1B8L A;  3BOW B;  1TNW A;  2BL0 C;  1NX1 A;  1CDL A;  3I5I C;  3LK1 A;  4N5X A;  4CID A;  1PUL A;  5JOL A;  3D0Y A;  2I2R E;  1KFX S;  1BR1 B;  4D1E A;  1DJH A;  2ZRT A;  2HF5 A;  1NSH A;  2ZN8 A;  2I18 A;  1OZS A;  1RK9 A;  3O6B A;  1LA3 A;  4YRU A;  2JT8 A;  2LVI A;  3WHT B;  1OE9 B;  1WRZ A;  2I7A A;  2SCP A;  2KSP A;  1IGV A;  1B8C A;  1PRW A;  4I5L B;  5PAL A;  4C0J A;  2KFF A;  4P2Y B;  2CBL A;  2FJU B;  2NXQ A;  2PVB A;  4MZL A;  1NCZ A;  1DF0 A;  2OTG C;  3CR2 A;  1SCM B;  3LK0 A;  5HKZ A;  5IBW A;  1OMV A;  3JTD C;  3BQ3 A;  4DCK A;  1DJI A;  3VRO A;  1DJX A;  1CNP A;  2WC8 A;  4YBH B;  1F54 A;  5AEQ A;  1XVJ A;  2BCX A;  4GGN A;  2ZFD A;  1KWO C;  1NX2 A;  1MHO A;  1XFV O;  2O60 A;  4YGA A;  2PMY A;  2COL B;  4USL A;  1F70 A;  3I5H B;  1PSB A;  2M97 A;  2RGI A;  3A4U B;  1N65 A;  2E6W A;  2WCB A;  5D7F A;  1JFJ A;  3BUX B;  1M31 A;  1SKT A;  1XFZ O;  5CSF A;  2K7C A;  5DKQ A;  1NUB A;  2KAY A;  1D1O A;  1J7Q A;  1QXP A;  1QLS A;  1KSO A;  3BOW A;  4Q04 A;  1KFU L;  1CFD A;  1KK8 C;  2KAV A;  1JF2 A;  1B7T Z;  1EJ3 A;  1UUS A;  1Y6W A;  4L9M A;  4OR9 B;  4PE7 A;  5JJG A;  5AFP A;  1G8I A;  2JWW A;  3EVR A;  4PE4 A;  1UWO A;  2BE4 A;  1KSM A;  1QS7 A;  3I5G B;  1DGU A;  2KBM A;  4GFT A;  1AK8 A;  2KDH A;  1YUU A;  3NSK A;  2H61 C;  3AKB A;  5HKY A;  1BJF A;  1QTX A;  5HLO A;  3WXA A;  2BEC A;  3I5H C;  1SY9 A;  4GPL B;  3TZ1 A;  3DVE A;  2LMU A;  5BPJ A;  3VRQ A;  4C0L A;  1XFW O;  2EC6 C;  1MUX A;  1SBJ A;  2ZN9 A;  1KK7 Z;  2D8N A;  1F8H A;  4ORC B;  1CDM A;  2K61 A;  3I5F C;  2OS8 B;  4MZK A;  1SCV A;  2K7B A;  3PLF B;  1NCY A;  2Q91 A;  1IJ5 A;  4NQG A;  1G33 A;  3JVT C;  1CFP A;  4ZCU A;  1DVI A;  4NDB A;  3D0Y B;  1TN4 A;  1MF8 B;  4DUQ A;  3TDI A;  1J7R A;  3DF0 A;  1FPW A;  1YX7 A;  2MA2 A;  3IF7 A;  3CWG A;  3GK1 A;  5KTY A;  1JFK A;  3LLE A;  3CR4 X;  4CPV A;  3DVK A;  1J1D A;  1K96 A;  1TNP A;  1BLQ A;  1JWD A;  2L5X B;  1BT6 A;  2PRU A;  1RFJ A;  1SYM A;  2EHB A;  4FQO A;  5B8I B;  1W7I B;  1M63 B;  5DKR A;  1DF0 B;  2JQ6 A;  2GV5 A;  1AP4 A;  2KAX A;  4R1E A;  1OSA A;  2JOJ A;  5CSN A;  1SR6 C;  3PN7 C;  3MSE B;  3SG4 A;  2LUX A;  2KQ6 A;  2LHL A;  5CSJ A;  1CMF A;  1QVI Y;  3TDU A;  3BXK A;  1NYA A;  1XFY O;  3TS5 B;  2F3Z A;  1CB1 A;  1UHI A;  1S6C A;  5I2Q A;  3LL8 B;  2LLU A;  1KQM B;  3BUN B;  1QIV A;  2FOT A;  4YGE B;  4E68 A;  1J7P A;  4DS7 A;  1TNQ A;  2KNE A;  1M39 A;  2CT9 A;  1R6P A;  1TCO B;  5TNC A;  3DVM A;  3DD4 A;  4PHK A;  3EKJ A;  3OHM B;  1JUO A;  1UHK A;  1YUR A;  1WDC C;  4I5K A;  1S5G Y;  2H2K A;  1BOC A;  2LLS A;  1PK0 D;  3F45 A;  3IQO A;  1CDP A;  1OOJ A;  4GGF C;  3GOF A;  1B47 A;  1QX7 A;  3KF9 A;  2KOT A;  2L51 A;  2WCE A;  1XO5 A;  1KFX L;  2M1U A;  1CLB A;  4HRH A;  4PAL A;  4AQI A;  1DT7 B;  2M8U A;  2P6B B;  1REC A;  3PAL A;  2KGB C;  2ZKM X;  1S36 A;  1WLM A;  2M7L A;  1XFU O;  2M1K B;  3EK8 A;  3OB1 B;  1XFX O;  3EVV A;  2JNF A;  3PFV A;  1GQM A;  1ODB A;  2BKI B;  1B8R A;  4NDC A;  1OZO A;  4PDZ A;  2KGR A;  1XYD A;  1Y1U A;  4ZCV A;  1JC2 A;  2NCP A;  4MBE A;  1JF0 A;  3ZWH A;  4I5N B;  5KU1 A;  2ZND A;  4BY4 A;  3D10 A;  1K8U A;  3DF0 B;  4M2O A;  4PHN A;  1SNL A;  3A8R A;  3OX6 A;  3FIA A;  2A4J A; 
#chains in the Genus database with same CATH topology
 1K9P A;  1MQ1 A;  2BBM A;  2MJW B;  3OGN A;  2JT0 A;  1NX0 A;  1F4Q A;  1K94 A;  2H8V A;  2TN4 A;  3EVU A;  2KI6 D;  4QJ4 B;  2LHI A;  4OCI A;  2HQ8 A;  1CTR A;  4C0K A;  3BUO B;  1F71 A;  1K9U A;  2HPS A;  1PAL A;  2BAP A;  2LV7 A;  1BF5 A;  1QV0 A;  3D74 A;  3WNX B;  1CLL A;  2LMV A;  1K9K A;  1DJW A;  3CYZ A;  1A75 A;  4ICB A;  2JPT A;  1SCM C;  2LP2 A;  5CPV A;  3C1V A;  1S3P A;  2HET A;  5F6T A;  1HQV A;  3OB2 B;  1N2D A;  3PJI A;  2K0J A;  2F33 A;  1OOI X;  3OP0 A;  2LVK A;  4IL1 A;  1OOF A;  3K21 A;  3BFH A;  2L0P A;  2NZ0 A;  4YI8 A;  2WCL A;  3SG3 A;  2L4I A;  2L4H A;  4DRW A;  1CKK A;  1SL8 A;  2M7N A;  2G9B A;  3NSO A;  1Z2C B;  2ZRS A;  3O4X A;  3BYA A;  4XYN A;  1U5I A;  5I2O A;  3CZ1 A;  1XA5 A;  2PAL A;  1LA0 A;  2KLD A;  3OX5 A;  2WND A;  1OQP A;  4HRE E;  1J55 A;  1EXR A;  1DJY A;  2ISD A;  1RRO A;  1SRA A;  5EL2 A;  3S0D A;  4DIR A;  2R2I A;  5GQQ C;  2ZNE A;  4MRX A;  2LP3 A;  4PE1 A;  4I5J A;  3TUY B;  3KPX A;  2Y4Q A;  2JU0 A;  1WY9 A;  1NPQ A;  1Q80 A;  2MBX A;  2WC5 A;  1W7J B;  2LLT A;  3I5G C;  1AHR A;  2K2F A;  2M49 B;  2JNX A;  2KFH A;  4OKH A;  4JKT A;  1L2O B;  1CM1 A;  2LMT A;  4HRG A;  2LAN A;  1ZFS A;  3ICB A;  3L4L A;  3B7A A;  1CM4 A;  1LKJ A;  4OV2 A;  1FF1 A;  2LNK A;  1C7W A;  3NSL A;  1A2X A;  1YRU B;  1JSA A;  2Y1N A;  1G4Y R;  2K2A A;  2KI4 B;  2HQW A;  2AMI A;  2CXJ A;  3VRP A;  2LVV A;  1EG4 A;  1YUT A;  2WOR A;  5HYD A;  1CDN A;  2OS8 C;  1YUS A;  2DOQ A;  2QPT A;  2H61 A;  2JC2 A;  2JT3 A;  3FWB A;  1P28 A;  4GNK B;  3CS1 A;  3VB1 A;  2LAP A;  2LUC A;  1ALW A;  2JXC A;  4GUK A;  3S0A A;  3D77 A;  2JXL A;  1ALV A;  3O4Y A;  2L50 A;  1CMG A;  3DXL A;  1NX3 A;  2KPH A;  1XFR A;  1BOD A;  1QX2 A;  2BBN A;  3QRX A;  2KBI A;  2WCK A;  1EH2 A;  2EGD A;  2BL0 B;  3UNW A;  1A29 A;  1B9A A;  3CTN A;  1J1E A;  1SK6 D;  2IS9 A;  3I5I B;  1C3Z A;  4WQ2 A;  4PT1 A;  1SW8 A;  1PSR A;  1IWQ A;  1A75 B;  1UHH A;  2CTN A;  3FE8 A;  4NDD A;  5AAN A;  1C7V A;  1R2U A;  5HL1 A;  3D73 A;  4MSP A;  1IJ6 A;  5HLV A;  1UUR A;  3SS5 A;  4PE0 A;  1H8B A;  1BMO A;  3VGO A;  1DJG A;  1QJT A;  1QX5 B;  3S0B A;  4ETO A;  4JD9 A;  5FI7 A;  5JJG A;  1CFF A;  1YTZ C;  2MHH A;  3NGV A;  3IQQ A;  4M2Q A;  3AAJ A;  2GTE A;  3HX4 A;  5ER4 X;  2KI6 C;  3SIA A;  3BFA A;  2BE6 A;  2SAS A;  2F2P A;  2PQL A;  1C3Y A;  2OTG B;  4ORA B;  3PM2 A;  1LVC D;  2GGZ A;  1Y0V H;  3JTD B;  4MZJ A;  3TS5 C;  3R72 A;  1U5I B;  5I2L A;  4F0Z B;  1QAS A;  3R1O A;  1BR4 B;  1NIW A;  1XK4 A;  1B7T Y;  1S6I A;  2K8M B;  1UP5 A;  1QLK A;  1KQM C;  4WQ3 A;  2AAO A;  1OMR A;  3RM1 A;  3VRR A;  2WOS A;  1KWO B;  1TNX A;  4XJK A;  1IH0 A;  3NXA A;  1V1G A;  1IRJ A;  3SIB A;  3RZS A;  3NHI A;  4P5O E;  3D76 A;  1SL7 A;  3RLZ A;  1TRF A;  4GAO A;  1SSE B;  1AVS A;  3WHU B;  3R1P A;  1QVI Z;  1UHJ A;  1K90 D;  4MRY A;  1KQV A;  4MEW A;  2K7O A;  1YX8 A;  1ZMZ A;  1DMO A;  4A4B A;  1KK7 Y;  1Z4H A;  2Y5I A;  1S6J A;  2PAS A;  1FBV A;  1NWD A;  1M46 A;  1KK8 B;  3VRN A;  2FCE A;  3M0W A;  3SG6 A;  2BKH B;  1CLM A;  4A4C A;  1BU3 A;  4GGF A;  4WRI A;  3SG5 A;  1SL9 A;  1IG5 A;  3KO0 A;  1PVA A;  5KSZ A;  3EK7 A;  4F7F A;  4ORB B;  1NP8 A;  1S5G Z;  3BJH A;  3ZNI A;  2FCD A;  2VRG A;  4PHJ A;  1AJ5 A;  2K7D A;  1YR5 A;  1ZUZ A;  3LCP C;  1K2H A;  5CSI A;  2WCM A;  2EC6 B;  1FI5 A;  1WRK A;  1HT9 A;  2PYQ A;  1S1E A;  3CZ0 A;  4JPZ B;  3I5F B;  3N7H A;  1MXE A;  4QJ5 B;  3EK4 A;  3O78 A;  1KFU S;  1T14 A;  4JQ0 D;  2M9G A;  1IKU A;  2BCB A;  3L47 A;  3PSR A;  2WCF A;  4PHM A;  5AER A;  3JVT B;  1KCY A;  1X02 A;  1QAT A;  2JTT A;  4FTG A;  4JWQ A;  4HSZ A;  5D3O A;  2L98 A;  4MN0 A;  5K89 A;  1TIZ A;  4CFQ A;  2JRF A;  1GJY A;  2MAZ A;  2BNX A;  4M2P A;  3NSI A;  2B1U A;  3BUW B;  1UHN A;  2KYF A;  2JUL A;  2PSR A;  1IQ3 A;  2F3Y A;  3DZT A;  1YRT B;  1SMG A;  3S0F A;  1QIW A;  2KHN A;  3H4S E;  1J7O A;  1JBA A;  2KQY A;  4MLW A;  3FWC A;  1EG3 A;  2QAC A;  1SPY A;  1W9Z A;  2MLF C;  1GGZ A;  1IQ5 A;  4UPG A;  1AUI B;  2E30 A;  3AKA A;  3KEV A;  3O2P A;  1TTX A;  1K95 A;  1QV1 A;  1VRK A;  1YVH A;  2CNP A;  2V53 A;  2WCH A;  3HCM A;  2LE9 B;  1ZOT B;  3FS7 A;  1PVB A;  1SR6 B;  3PN7 B;  1NCX A;  3DY9 A;  1K93 D;  2KFG A;  3CGA A;  5I8N A;  3PAT A;  1DEL A;  5AXI A;  4N1G A;  4CLN A;  2Y1M A;  4U8D A;  4XJK B;  2JTZ A;  1DQE A;  1H4B A;  1FW4 A;  1TOP A;  3E3R A;  3OBV A;  1OMD A;  1FI6 A;  2BCA A;  2F8P A;  1N0Y A;  2YGU A;  3GK2 A;  2AUC A;  4KYN A;  3SG2 A;  1TUZ A;  1TCF A;  4IJ7 A;  3TUY C;  1DJZ A;  1EL4 A;  5FI6 A;  4AOM A;  1Y1X A;  1V1F A;  2LM5 A;  1B4C A;  1A4P A;  3DVJ A;  1LXF C;  1S26 D;  1L7Z A;  5J3X A;  5ER5 A;  1YVL A;  1E8A A;  4BY5 A;  1WRL A;  2LCP A;  2L2C A;  1M45 A;  2MLE C;  3GK4 X;  1BG1 A;  1MXL C;  1F4O A;  2NLN A;  1L2O C;  1OOH A;  3KHE A;  4AQJ A;  1WDC B;  1RTP 1;  1LIN A;  1RWY A;  2MRD A;  1XK4 C;  1WLZ A;  3SG7 A;  1C07 A;  3B88 A;  2KYC A;  3CR5 X;  4PCW A;  1DTL A;  5DKN A;  3S0G A;  1ZAC A;  2KI4 C;  4GBA A;  3EKH A;  4TNC A;  4YGD B;  5HKW A;  1IIO A;  2F2O A;  2QEO A;  1Y1A A;  5DIC A;  1F55 A;  4YGC B;  5FYX A;  3SJS A;  1RJV A;  2OPO A;  4YI9 A;  2JZI A;  5G08 A;  1CFC A;  1GGW A;  3PM8 A;  4OVN F;  1A03 A;  1GM0 A;  4INW A;  2O5G A;  2G2B A;  1MWN A;  4YGB B;  2M3W A;  2QEB A;  3CZT X;  5D69 A;  3TDZ A;  2CCM A;  4MVF A;  1MR8 A;  2LVJ A;  2KLE A;  1DGV A;  3AAK A;  1B1G A;  2M0R A;  4N1F A;  2L2E A;  4QJ3 B;  2I94 A;  2GGM A;  4CFR A;  2Q4U A;  2NCO A;  3CLN A;  1AJ4 A;  2M29 A;  2LC5 A;  3BUM B;  1B8L A;  3BOW B;  1TNW A;  2BL0 C;  1NX1 A;  1CDL A;  3I5I C;  3LK1 A;  4N5X A;  4CID A;  1PUL A;  5JOL A;  3D0Y A;  2I2R E;  1KFX S;  3B87 A;  1BR1 B;  4D1E A;  1DJH A;  1LS8 A;  2HF5 A;  2ZRT A;  1NSH A;  2ZN8 A;  2I18 A;  1OZS A;  1RK9 A;  3CDN A;  1LA3 A;  3O6B A;  2JT8 A;  4YRU A;  2LVI A;  3WHT B;  1OE9 B;  1WRZ A;  2I7A A;  4FQT A;  2SCP A;  2KSP A;  1IGV A;  1B8C A;  1PRW A;  4I5L B;  5PAL A;  1DEK A;  4C0J A;  2KFF A;  4P2Y B;  2CBL A;  2FJU B;  2JPO A;  2NXQ A;  2P71 A;  2PVB A;  4MZL A;  1NCZ A;  1DF0 A;  2OTG C;  3CR2 A;  1SCM B;  3LK0 A;  5HKZ A;  5IBW A;  1OMV A;  3EG5 B;  3JTD C;  3BQ3 A;  3D75 A;  4DCK A;  5I94 A;  1DJI A;  3VRO A;  3IVT A;  1DJX A;  1CNP A;  2QEV A;  2WC8 A;  4YBH B;  1F54 A;  2L5Y A;  5AEQ A;  1XVJ A;  2BCX A;  4GGN A;  2ZFD A;  1KWO C;  1NX2 A;  1MHO A;  1XFV O;  2O60 A;  4YGA A;  2PMY A;  2COL B;  2ERB A;  4USL A;  1F70 A;  3I5H B;  1PSB A;  2M97 A;  2RGI A;  2P70 A;  3A4U B;  1N65 A;  2E6W A;  2WCB A;  5D7F A;  1JFJ A;  3BUX B;  1M31 A;  1SKT A;  1XFZ O;  3V2L A;  5CSF A;  2WCJ A;  2K7C A;  5DKQ A;  1NUB A;  1OOG A;  2KAY A;  1D1O A;  1J7Q A;  1QXP A;  1QLS A;  1KSO A;  1DC1 A;  3BOW A;  4Q04 A;  1KFU L;  1CFD A;  1KK8 C;  2KAV A;  1JF2 A;  1B7T Z;  1EJ3 A;  1UUS A;  1Y6W A;  4L9M A;  4OR9 B;  4PE7 A;  3UO9 A;  5AFP A;  1G8I A;  2JWW A;  3EVR A;  4PE4 A;  1UWO A;  2BE4 A;  1KSM A;  1QS7 A;  3I5G B;  1DGU A;  2KBM A;  4GFT A;  1AK8 A;  2KDH A;  1YUU A;  3NSK A;  2H61 C;  3AKB A;  5HKY A;  1BJF A;  1QTX A;  5HLO A;  4INX A;  3WXA A;  2BEC A;  2QDI A;  3I5H C;  1SY9 A;  4GPL B;  3TZ1 A;  3DVE A;  2LMU A;  5BPJ A;  3VRQ A;  4C0L A;  1XFW O;  2EC6 C;  1MUX A;  2QEH A;  1SBJ A;  2ZN9 A;  1KK7 Z;  2D8N A;  1F8H A;  4ORC B;  1CDM A;  2K61 A;  3I5F C;  2OS8 B;  4MZK A;  1SCV A;  2K7B A;  3PLF B;  3Q8I A;  1NCY A;  2Q91 A;  1IJ5 A;  4NQG A;  1G33 A;  3JVT C;  1CFP A;  4ZCU A;  1ORG A;  1DVI A;  4NDB A;  3D0Y B;  3DYE A;  1TN4 A;  1MF8 B;  3QME A;  4DUQ A;  3TDI A;  1J7R A;  3DF0 A;  1FPW A;  1YX7 A;  2MA2 A;  3B6X A;  3CWG A;  3IF7 A;  3GK1 A;  5KTY A;  1JFK A;  3CZ2 A;  3LLE A;  3CR4 X;  4CPV A;  3DVK A;  1J1D A;  1K96 A;  1TNP A;  1BLQ A;  1JWD A;  2L5X B;  1BT6 A;  2PRU A;  1RFJ A;  1SYM A;  2EHB A;  4FQO A;  5B8I B;  1W7I B;  1M63 B;  5DKR A;  1DF0 B;  3S0E A;  2JQ6 A;  2GV5 A;  1AP4 A;  2KAX A;  4R1E A;  1OSA A;  2JOJ A;  2WC6 A;  1SR6 C;  3PN7 C;  4OZD A;  5CSN A;  3MSE B;  3SG4 A;  2LUX A;  5FI2 A;  2KQ6 A;  2LHL A;  5CSJ A;  1CMF A;  1QVI Y;  3TDU A;  3BXK A;  2K60 A;  1NYA A;  1XFY O;  3TS5 B;  2F3Z A;  1CB1 A;  1UHI A;  1S6C A;  5I2Q A;  3LL8 B;  2LLU A;  1KQM B;  3NHT A;  3BUN B;  1QIV A;  2FOT A;  4YGE B;  4E68 A;  1J7P A;  4DS7 A;  1TNQ A;  2KNE A;  1M39 A;  2CT9 A;  1R6P A;  1TWO A;  3R1V A;  1TCO B;  5TNC A;  3DVM A;  3DD4 A;  4PHK A;  3EKJ A;  3OHM B;  1JUO A;  1UHK A;  1YUR A;  1WDC C;  4I5K A;  1S5G Y;  3SS4 A;  2H2K A;  1BOC A;  3BFB A;  2LLS A;  2FJY A;  1PK0 D;  3F45 A;  3IQO A;  1CDP A;  1OOJ A;  4GGF C;  3GOF A;  1B47 A;  1QX7 A;  3KF9 A;  2KOT A;  2L51 A;  2WCE A;  1XO5 A;  1KFX L;  2M1U A;  1CLB A;  4HRH A;  3B86 A;  1OW4 A;  4PAL A;  3FE6 A;  4AQI A;  1DT7 B;  2M8U A;  2P6B B;  1REC A;  3PAL A;  2KGB C;  2ZKM X;  1TUJ A;  3D78 A;  1S36 A;  1WLM A;  3L4A A;  2M7L A;  1XFU O;  2M1K B;  3EK8 A;  3OB1 B;  1XFX O;  3CAB A;  3EVV A;  2JNF A;  3PFV A;  3FE9 A;  1QWV A;  1GQM A;  1ODB A;  2BKI B;  1B8R A;  4NDC A;  1OZO A;  3SS3 A;  4PDZ A;  2KGR A;  1XYD A;  1Y1U A;  4ZCV A;  1JC2 A;  2NCP A;  4MBE A;  1JF0 A;  3ZWH A;  4I5N B;  5KU1 A;  3K1E A;  2ZND A;  4BY4 A;  3D10 A;  1K8U A;  3DF0 B;  4M2O A;  4PHN A;  1SNL A;  3A8R A;  3OX6 A;  3FIA A;  2A4J A; 
#chains in the Genus database with same CATH homology
 1K9P A;  1MQ1 A;  2BBM A;  2MJW B;  2JT0 A;  1NX0 A;  1F4Q A;  1K94 A;  2TN4 A;  3EVU A;  2KI6 D;  4QJ4 B;  2LHI A;  4OCI A;  2HQ8 A;  1CTR A;  4C0K A;  3BUO B;  1F71 A;  1K9U A;  2HPS A;  1PAL A;  2LV7 A;  1BF5 A;  1QV0 A;  3WNX B;  1CLL A;  2LMV A;  1K9K A;  1DJW A;  1A75 A;  4ICB A;  2JPT A;  1SCM C;  2LP2 A;  5CPV A;  3C1V A;  1S3P A;  2HET A;  5F6T A;  1HQV A;  3OB2 B;  1N2D A;  2K0J A;  2F33 A;  3OP0 A;  2LVK A;  4IL1 A;  3K21 A;  2L0P A;  2NZ0 A;  4YI8 A;  3SG3 A;  2L4I A;  2L4H A;  4DRW A;  1CKK A;  1SL8 A;  2M7N A;  2G9B A;  3NSO A;  2ZRS A;  3BYA A;  4XYN A;  1U5I A;  5I2O A;  1XA5 A;  2PAL A;  1LA0 A;  3OX5 A;  2WND A;  1OQP A;  4HRE E;  1J55 A;  1EXR A;  1DJY A;  2ISD A;  1RRO A;  1SRA A;  4DIR A;  2R2I A;  5GQQ C;  2ZNE A;  4MRX A;  2LP3 A;  4PE1 A;  4I5J A;  3TUY B;  3KPX A;  2Y4Q A;  2JU0 A;  1WY9 A;  1NPQ A;  1Q80 A;  2MBX A;  1W7J B;  2LLT A;  3I5G C;  1AHR A;  2K2F A;  2M49 B;  2JNX A;  2KFH A;  4OKH A;  1L2O B;  1CM1 A;  2LMT A;  4HRG A;  2LAN A;  1ZFS A;  3ICB A;  1CM4 A;  1LKJ A;  4OV2 A;  1FF1 A;  2LNK A;  1C7W A;  3NSL A;  1A2X A;  1YRU B;  1JSA A;  2Y1N A;  1G4Y R;  2K2A A;  2KI4 B;  2HQW A;  2AMI A;  2CXJ A;  3VRP A;  2LVV A;  1EG4 A;  1YUT A;  2WOR A;  5HYD A;  1CDN A;  2OS8 C;  1YUS A;  2DOQ A;  2QPT A;  2H61 A;  2JC2 A;  2JT3 A;  3FWB A;  4GNK B;  3CS1 A;  2LAP A;  2LUC A;  1ALW A;  2JXC A;  4GUK A;  2JXL A;  1ALV A;  3O4Y A;  2L50 A;  1CMG A;  1NX3 A;  1BOD A;  1QX2 A;  2BBN A;  3QRX A;  2KBI A;  1EH2 A;  2EGD A;  2BL0 B;  1A29 A;  1B9A A;  3CTN A;  1J1E A;  1SK6 D;  2IS9 A;  3I5I B;  4WQ2 A;  1SW8 A;  1PSR A;  1IWQ A;  1A75 B;  1UHH A;  2CTN A;  4NDD A;  5AAN A;  1C7V A;  1R2U A;  4MSP A;  1IJ6 A;  5HLV A;  1UUR A;  4PE0 A;  1H8B A;  1BMO A;  3VGO A;  1DJG A;  1QJT A;  1QX5 B;  4ETO A;  1CFF A;  1YTZ C;  2MHH A;  4M2Q A;  3IQQ A;  3AAJ A;  3HX4 A;  5ER4 X;  2KI6 C;  3SIA A;  2BE6 A;  2SAS A;  2F2P A;  2OTG B;  4ORA B;  1LVC D;  2GGZ A;  1Y0V H;  3JTD B;  4MZJ A;  3TS5 C;  1U5I B;  5I2L A;  4F0Z B;  1QAS A;  1BR4 B;  1NIW A;  1XK4 A;  1B7T Y;  1S6I A;  2K8M B;  1UP5 A;  1QLK A;  1KQM C;  4WQ3 A;  2AAO A;  1OMR A;  3RM1 A;  3VRR A;  2WOS A;  1KWO B;  1TNX A;  4XJK A;  1IH0 A;  3NXA A;  1V1G A;  1IRJ A;  4P5O E;  1SL7 A;  3RLZ A;  1TRF A;  4GAO A;  1AVS A;  3WHU B;  1QVI Z;  1UHJ A;  1K90 D;  4MRY A;  1KQV A;  4MEW A;  2K7O A;  1YX8 A;  1ZMZ A;  1DMO A;  4A4B A;  1KK7 Y;  2Y5I A;  1S6J A;  2PAS A;  1FBV A;  1NWD A;  1M46 A;  1KK8 B;  3VRN A;  2FCE A;  3M0W A;  3SG6 A;  2BKH B;  1CLM A;  4A4C A;  1BU3 A;  4GGF A;  4WRI A;  3SG5 A;  1SL9 A;  1IG5 A;  3KO0 A;  1PVA A;  5KSZ A;  3EK7 A;  4ORB B;  1NP8 A;  1S5G Z;  3ZNI A;  2FCD A;  2VRG A;  4PHJ A;  1AJ5 A;  2K7D A;  1YR5 A;  1ZUZ A;  3LCP C;  1K2H A;  5CSI A;  2EC6 B;  1FI5 A;  1WRK A;  1HT9 A;  1S1E A;  4JPZ B;  3I5F B;  1MXE A;  4QJ5 B;  3EK4 A;  3O78 A;  1KFU S;  4JQ0 D;  2M9G A;  1IKU A;  2BCB A;  5AER A;  3PSR A;  2WCF A;  4PHM A;  3JVT B;  1KCY A;  1X02 A;  1QAT A;  2JTT A;  4FTG A;  4JWQ A;  4HSZ A;  2L98 A;  4MN0 A;  5K89 A;  1TIZ A;  4CFQ A;  2JRF A;  1GJY A;  2MAZ A;  4M2P A;  3NSI A;  2B1U A;  3BUW B;  1UHN A;  2KYF A;  2JUL A;  2PSR A;  1IQ3 A;  2F3Y A;  1YRT B;  1SMG A;  1QIW A;  2KHN A;  3H4S E;  1J7O A;  1JBA A;  2KQY A;  4MLW A;  3FWC A;  1EG3 A;  2QAC A;  1SPY A;  2MLF C;  1GGZ A;  1IQ5 A;  4UPG A;  1AUI B;  2E30 A;  3AKA A;  3KEV A;  3O2P A;  1TTX A;  2CNP A;  1K95 A;  1QV1 A;  1VRK A;  1YVH A;  2V53 A;  3HCM A;  2LE9 B;  1ZOT B;  3FS7 A;  1PVB A;  1SR6 B;  3PN7 B;  1NCX A;  1K93 D;  2KFG A;  3CGA A;  5I8N A;  3PAT A;  5AXI A;  4N1G A;  4CLN A;  2Y1M A;  4U8D A;  4XJK B;  2JTZ A;  1H4B A;  1FW4 A;  1TOP A;  3E3R A;  1OMD A;  1FI6 A;  2BCA A;  2F8P A;  1N0Y A;  3GK2 A;  3SG2 A;  2AUC A;  3SIB A;  1TCF A;  3TUY C;  1DJZ A;  1EL4 A;  4AOM A;  1Y1X A;  1V1F A;  2LM5 A;  1B4C A;  1A4P A;  3DVJ A;  1LXF C;  1S26 D;  1L7Z A;  5J3X A;  5ER5 A;  1YVL A;  1E8A A;  4BY5 A;  1WRL A;  2LCP A;  2MLE C;  1M45 A;  3GK4 X;  1BG1 A;  1MXL C;  1F4O A;  2NLN A;  1L2O C;  3KHE A;  4AQJ A;  1WDC B;  1RTP 1;  1LIN A;  1RWY A;  2MRD A;  1XK4 C;  1WLZ A;  3SG7 A;  1C07 A;  4PCW A;  2KYC A;  3CR5 X;  1DTL A;  5DKN A;  1ZAC A;  2KI4 C;  4GBA A;  3EKH A;  4TNC A;  4YGD B;  5HKW A;  2F2O A;  1Y1A A;  1F55 A;  4YGC B;  5FYX A;  3SJS A;  1RJV A;  2OPO A;  4YI9 A;  2JZI A;  5G08 A;  1CFC A;  1GGW A;  3PM8 A;  4OVN F;  1A03 A;  2O5G A;  2G2B A;  1MWN A;  4YGB B;  2M3W A;  3CZT X;  3TDZ A;  5D69 A;  2CCM A;  4MVF A;  1MR8 A;  2LVJ A;  3AAK A;  1DGV A;  1B1G A;  2M0R A;  4N1F A;  2L2E A;  4QJ3 B;  2I94 A;  2GGM A;  4CFR A;  2Q4U A;  2NCO A;  3CLN A;  1AJ4 A;  2M29 A;  2LC5 A;  3BUM B;  1B8L A;  3BOW B;  1TNW A;  2BL0 C;  1NX1 A;  1CDL A;  3I5I C;  3LK1 A;  4N5X A;  4CID A;  1PUL A;  5JOL A;  3D0Y A;  2I2R E;  1KFX S;  1BR1 B;  4D1E A;  1DJH A;  2ZRT A;  2HF5 A;  1NSH A;  2ZN8 A;  2I18 A;  1OZS A;  1RK9 A;  3O6B A;  1LA3 A;  4YRU A;  2JT8 A;  2LVI A;  3WHT B;  1OE9 B;  1WRZ A;  2I7A A;  2SCP A;  2KSP A;  1IGV A;  1B8C A;  1PRW A;  4I5L B;  5PAL A;  4C0J A;  2KFF A;  4P2Y B;  2CBL A;  2FJU B;  2NXQ A;  2PVB A;  4MZL A;  1NCZ A;  1DF0 A;  2OTG C;  3CR2 A;  1SCM B;  3LK0 A;  5HKZ A;  5IBW A;  1OMV A;  3JTD C;  3BQ3 A;  4DCK A;  1DJI A;  3VRO A;  1DJX A;  1CNP A;  2WC8 A;  4YBH B;  1F54 A;  5AEQ A;  1XVJ A;  2BCX A;  4GGN A;  2ZFD A;  1KWO C;  1NX2 A;  1MHO A;  1XFV O;  2O60 A;  4YGA A;  2PMY A;  2COL B;  4USL A;  1F70 A;  3I5H B;  1PSB A;  2M97 A;  2RGI A;  3A4U B;  1N65 A;  2E6W A;  2WCB A;  5D7F A;  1JFJ A;  3BUX B;  1M31 A;  1SKT A;  1XFZ O;  5CSF A;  2K7C A;  5DKQ A;  1NUB A;  2KAY A;  1D1O A;  1J7Q A;  1QXP A;  1QLS A;  1KSO A;  3BOW A;  4Q04 A;  1KFU L;  1CFD A;  1KK8 C;  2KAV A;  1JF2 A;  1B7T Z;  1EJ3 A;  1UUS A;  1Y6W A;  4L9M A;  4OR9 B;  4PE7 A;  5JJG A;  5AFP A;  1G8I A;  2JWW A;  3EVR A;  4PE4 A;  1UWO A;  2BE4 A;  1KSM A;  1QS7 A;  3I5G B;  1DGU A;  2KBM A;  4GFT A;  1AK8 A;  2KDH A;  1YUU A;  3NSK A;  2H61 C;  3AKB A;  5HKY A;  1BJF A;  1QTX A;  5HLO A;  3WXA A;  2BEC A;  3I5H C;  1SY9 A;  4GPL B;  3TZ1 A;  3DVE A;  2LMU A;  5BPJ A;  3VRQ A;  4C0L A;  1XFW O;  2EC6 C;  1MUX A;  1SBJ A;  2ZN9 A;  1KK7 Z;  2D8N A;  1F8H A;  4ORC B;  1CDM A;  2K61 A;  3I5F C;  2OS8 B;  4MZK A;  1SCV A;  2K7B A;  3PLF B;  1NCY A;  2Q91 A;  1IJ5 A;  4NQG A;  1G33 A;  3JVT C;  1CFP A;  4ZCU A;  1DVI A;  4NDB A;  3D0Y B;  1TN4 A;  1MF8 B;  4DUQ A;  3TDI A;  1J7R A;  3DF0 A;  1FPW A;  1YX7 A;  2MA2 A;  3IF7 A;  3CWG A;  3GK1 A;  5KTY A;  1JFK A;  3LLE A;  3CR4 X;  4CPV A;  3DVK A;  1J1D A;  1K96 A;  1TNP A;  1BLQ A;  1JWD A;  2L5X B;  1BT6 A;  2PRU A;  1RFJ A;  1SYM A;  2EHB A;  4FQO A;  5B8I B;  1W7I B;  1M63 B;  5DKR A;  1DF0 B;  2JQ6 A;  2GV5 A;  1AP4 A;  2KAX A;  4R1E A;  1OSA A;  2JOJ A;  5CSN A;  1SR6 C;  3PN7 C;  3MSE B;  3SG4 A;  2LUX A;  2KQ6 A;  2LHL A;  5CSJ A;  1CMF A;  1QVI Y;  3TDU A;  3BXK A;  1NYA A;  1XFY O;  3TS5 B;  2F3Z A;  1CB1 A;  1UHI A;  1S6C A;  5I2Q A;  3LL8 B;  2LLU A;  1KQM B;  3BUN B;  1QIV A;  2FOT A;  4YGE B;  4E68 A;  1J7P A;  4DS7 A;  1TNQ A;  2KNE A;  1M39 A;  2CT9 A;  1R6P A;  1TCO B;  5TNC A;  3DVM A;  3DD4 A;  4PHK A;  3EKJ A;  3OHM B;  1JUO A;  1UHK A;  1YUR A;  1WDC C;  4I5K A;  1S5G Y;  2H2K A;  1BOC A;  2LLS A;  1PK0 D;  3F45 A;  3IQO A;  1CDP A;  1OOJ A;  4GGF C;  3GOF A;  1B47 A;  1QX7 A;  3KF9 A;  2KOT A;  2L51 A;  2WCE A;  1XO5 A;  1KFX L;  2M1U A;  1CLB A;  4HRH A;  4PAL A;  4AQI A;  1DT7 B;  2M8U A;  2P6B B;  1REC A;  3PAL A;  2KGB C;  2ZKM X;  1S36 A;  1WLM A;  2M7L A;  1XFU O;  2M1K B;  3EK8 A;  3OB1 B;  1XFX O;  3EVV A;  2JNF A;  3PFV A;  1GQM A;  1ODB A;  2BKI B;  1B8R A;  4NDC A;  1OZO A;  4PDZ A;  2KGR A;  1XYD A;  1Y1U A;  4ZCV A;  1JC2 A;  2NCP A;  4MBE A;  1JF0 A;  3ZWH A;  4I5N B;  5KU1 A;  2ZND A;  4BY4 A;  3D10 A;  1K8U A;  3DF0 B;  4M2O A;  4PHN A;  1SNL A;  3A8R A;  3OX6 A;  3FIA A;  2A4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...