1KCYA

Nmr solution structure of apo calbindin d9k (f36g + p43m mutant)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEGPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords calbindin D9k
publication title The EF-hand domain: a globally cooperative structural unit.
pubmed doi rcsb
source organism Bos taurus
total genus 25
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kcyA00
2LVKA 1UWOA 1B4CA 3TDZA 1KSMA 3K21A 4N5XA 5K89A 1CFFA 2MHHA 1QLKA 1IJ6A 5HLOA 5HKZA 1XFVO 2BKIB 2LUCA 3I5IC 3KF9A 1CDLA 1H4BA 5CPVA 1TNWA 2LNKA 3OHMB 4PHJA 5PALA 1U5IA 5ER4X 5D69A 2E6WA 1FPWA 4PE1A 1CM4A 5DKNA 1CM1A 2ZN9A 2KI6D 1N0YA 1RK9A 1DF0B 1SBJA 1J7RA 1J7OA 1NX1A 3AAKA 1MF8B 2M7NA 5DKQA 1JBAA 1XO5A 1OZOA 4NQGA 4OCIA 4C0LA 4BY4A 1IH0A 2CXJA 2K7CA 1OSAA 2K61A 2Q4UA 3I5FC 2LMUA 2H2KA 2BCBA 1QX5B 4MZKA 3DVKA 1M31A 2CTNA 3VGOA 1IKUA 1SL9A 2KI4C 3EK4A 1UHNA 3NSIA 2COLB 4PHKA 5I8NA 1DJYA 2WCBA 3I5GC 2ZNEA 4YBHB 2JRFA 3NXAA 1KFUS 1KFUL 2JXCA 3I5HC 3JTDC 1F4OA 4OKHA 3BUMB 1UP5A 1LA3A 1F54A 1WRLA 2OTGB 1EG4A 1PSBA 3CR4X 2M7LA 1XA5A 2LMVA 1H8BA 3CGAA 2JU0A 4M2PA 4AQIA 2AUCA 4GFTA 1B47A 4DIRA 2HETA 2Y1NA 5HKYA 4XJKB 3TUYB 3DVJA 1C7WA 1AJ4A 4WQ3A 1S6CA 1D1OA 2Y5IA 4PALA 3KEVA 3VRPA 1KK8B 1JFJA 1DJWA 4I5LB 1MWNA 2I7AA 3SG6A 2KBMA 3F45A 2KAYA 1TNXA 1PVAA 3OB2B 2AAOA 3E3RA 5AANA 4CFRA 4YGDB 4PHNA 2WOSA 1IQ3A 2NXQA 1WDCB 3ZWHA 2BL0C 1QATA 1R6PA 2EC6B 2I94A 3EKJA 1Q80A 1NCXA 2LCPA 3BUXB 5FYXA 1FI6A 4ORBB 2KFGA 1PULA 4YGAA 2ZFDA 1QIVA 2JT8A 1L2OC 1BJFA 1UUSA 1K2HA 1MR8A 2AMIA 2JPTA 3RM1A 3BXKA 2F3ZA 4YRUA 1R2UA 1XFWO 1ZACA 2WCFA 2EHBA 2L98A 4MEWA 1OMDA 1F55A 1AUIB 1CLMA 1TCOB 3IQOA 4CLNA 1SYMA 2KFHA 4JQ0D 2G2BA 3AKAA 4QJ4B 2FCDA 2FJUB 5I2QA 1M63B 4U8DA 1F70A 4MVFA 3SJSA 2NZ0A 3KO0A 3CZTX 1N65A 2PVBA 3M0WA 4OV2A 1TTXA 4WQ2A 1J1DA 5CSFA 3OX6A 1SCVA 1J7PA 3O2PA 4HSZA 2M0RA 5CSIA 1DJXA 1SW8A 2IS9A 4P5OE 1KQMB 1KWOC 1GQMA 1YURA 1B1GA 1BODA 2JTZA 2K2FA 2V53A 2M1KB 1RECA 3SIBA 2MJWB 2NCPA 2FOTA 2L4HA 2LP3A 1M45A 1PK0D 1J7QA 1BMOA 4PE7A 1IWQA 1TN4A 2B1UA 1E8AA 2L51A 2KFFA 3HCMA 2LC5A 1L7ZA 3D0YB 1V1GA 4DRWA 1MXLC 3VRNA 1NSHA 1FI5A 2K8MB 5DKRA 1TRFA 1HQVA 2JC2A 3QRXA 4I5KA 3PM8A 2JTTA 4GPLB 1JF2A 1SRAA 1K9KA 1JF0A 1IGVA 3PSRA 2I18A 1BG1A 1NYAA 2PSRA 4QJ5B 2BBNA 1HT9A 2H61C 1K90D 1DJIA 1QXPA 3EVRA 5TNCA 4BY5A 4UPGA 2P6BB 1J1EA 1JFKA 4HRHA 4PE4A 4ORCB 2Y1MA 4MRXA 2O60A 1B7TZ 4FTGA 1BF5A 1CMGA 1FF1A 5AERA 1LXFC 5HLVA 1S26D 2PRUA 5HYDA 3BOWB 1YRTB 1XVJA 2VRGA 4HREE 4PE0A 2TN4A 2WC8A 1WRKA 4M2QA 1OE9B 2LANA 2JWWA 3PFVA 3DD4A 2L0PA 4XYNA 4YGCB 1JUOA 1KSOA 1NX3A 1QJTA 5CSJA 1DMOA 1X02A 3A4UB 1K93D 2JXLA 1BR1B 1FW4A 1KCYA 2LLSA 3GK2A 1EJ3A 2O5GA 3JVTB 1C7VA 3SG2A 1M39A 2L50A 1B8CA 4DUQA 4QJ3B 3ZNIA 2LM5A 3BQ3A 1UURA 2JNFA 1UHIA 1S6IA 4L9MA 2BECA 2MAZA 2LV7A 2OS8B 2QACA 2OTGC 3SG5A 1ODBA 5IBWA 1BR4B 3TDUA 1SR6B 4MBEA 1TCFA 3PN7B 4R1EA 3BUNB 1AP4A 3H4SE 1GJYA 2BE4A 2JT3A 2HF5A 2CT9A 2KYCA 1IG5A 2OPOA 2M49B 3OX5A 3TUYC 2L2EA 1WLMA 1MQ1A 2LLUA 3CTNA 1Y0VH 1YVLA 1G4YR 1KK8C 1LA0A 3EVUA 2KHNA 4TNCA 2KAXA 4GAOA 3MSEB 4PHMA 1IRJA 3OP0A 3DVMA 4NDDA 1LKJA 2ZNDA 3NSKA 2M3WA 2KAVA 3NSLA 4GUKA 1LVCD 3DF0A 1U5IB 2FCEA 2MA2A 1A75A 1OMRA 4GGFC 1QVIZ 1W7JB 2LMTA 2DOQA 2KOTA 5BPJA 4HRGA 1WRZA 1AK8A 2MLEC 1WDCC 1F8HA 3C1VA 1DT7B 3KHEA 1SCMB 4MZLA 2EC6C 5J3XA 3O78A 4P2YB 1UHJA 2EGDA 2WNDA 1QX2A 1NUBA 1XK4C 2JOJA 3IQQA 5GQQC 1YX7A 2M29A 3SG3A 2JULA 2H61A 4ORAB 1OQPA 3EVVA 5JOLA 1QLSA 2CCMA 1K94A 1ZOTB 2MLFC 4F0ZB 1G8IA 1K9PA 1XFXO 1Y1AA 3SG4A 1XFYO 1XYDA 2LVVA 2SCPA 5I2OA 4DS7A 3WXAA 1ZUZA 2ZRSA 1TNPA 4ETOA 1QTXA 1QV0A 3VROA 1A03A 3GK1A 2KGBC 2I2RE 2BCAA 3VRQA 3RLZA 1DGUA 5JJGA 1B8RA 4M2OA 1XFZO 3CR5X 1KQVA 1WLZA 2F2PA 4OVNF 2KBIA 3A8RA 1BOCA 1NCZA 5I2LA 4CFQA 1LINA 1UHKA 2LVIA 2LUXA 5B8IB 4CIDA 1MHOA 1KQMC 1TIZA 4FQOA 4YGEB 4C0KA 1NX2A 1CDMA 1ZMZA 3GOFA 3FWCA 1B7TY 2A4JA 1NP8A 2M97A 3CS1A 1Y1UA 2BBMA 2HPSA 2PMYA 3O4YA 1NX0A 3BUWB 1NWDA 1PVBA 3TS5B 4USLA 1TOPA 2KI6C 2KQ6A 2LE9B 2JT0A 2L4IA 1RJVA 2JZIA 2ZRTA 4YI9A 1SL7A 1Y6WA 1A75B 2RGIA 3LLEA 1VRKA 3D10A 3PALA 1DTLA 1JC2A 4D1EA 3EK8A 3O6BA 2LAPA 3LK0A 1MUXA 1CMFA 1YRUB 3I5IB 2PASA 4E68A 1BT6A 2BCXA 4NDBA 1CNPA 3AKBA 2F8PA 1KK7Z 1YUTA 4GGFA 1IJ5A 3FS7A 4GNKB 3CR2A 4ZCVA 3CLNA 1QV1A 1W7IB 1OOJA 1RFJA 4I5JA 1ZFSA 2WORA 3FIAA 5ER5A 5D7FA 1JSAA 4ICBA 1BLQA 3I5FB 4I5NB 1SK6D 4JPZB 4MLWA 1WY9A 1XK4A 3PATA 1EL4A 2KNEA 2PALA 5KTYA 1GGZA 1AHRA 2KI4B 2L5XB 1DJHA 1S6JA 3I5GB 2JQ6A 1QX7A 4GGNA 1YTZC 3I5HB 1TNQA 3JTDB 1AJ5A 1ALVA 2NCOA 2GV5A 2ISDA 1CFDA 3JVTC 3BUOB 3SIAA 1OMVA 1NIWA 3WHUB 3KPXA 1QVIY 5HKWA 4C0JA 5CSNA 1CLLA 2HQWA 4OR9B 3IF7A 2K7OA 1S1EA 1M46A 5AFPA 2OS8C 1J55A 1SL8A 1CDPA 2KGRA 1SR6C 5KU1A 1A2XA 2LVJA 3PN7C 1B9AA 1EG3A 2R2IA 2LLTA 2BKHB 1IQ5A 2CBLA 1F4QA 1SMGA 1A4PA 1NCYA 1ALWA 1RTP1 3CWGA 3NSOA 4MRYA 1QASA 3HX4A 3SG7A 1EH2A 4MSPA 1YUSA 2MRDA 2ZKMX 1YUUA 1S5GY 1PALA 1K9UA 1K8UA 2G9BA 2K2AA 1CLBA 2SASA 4AOMA 1RROA 2M1UA 2F3YA 1S36A 2M8UA 4AQJA 1EXRA 1MXEA 4WRIA 1DVIA 2BL0B 2D8NA 2KQYA 1DGVA 2JNXA 4A4BA 4PDZA 2GGZA 2ZN8A 1PRWA 1DJGA 4N1GA 3D0YA 5AEQA 1G33A 3WHTB 3WNXB 4CPVA 2GGMA 1C07A 1QIWA 4MN0A 1SPYA 4MZJA 1SKTA 4NDCA 2F2OA 2KYFA 4A4CA 1SCMC 5AXIA 1RWYA 1S5GZ 1L2OB 1SY9A 3LCPC 1OZSA 4PCWA 1PSRA 3VRRA 1A29A 1CB1A 4JWQA 5F6TA 1DF0A 1BU3A 1DJZA 2K7BA 1KFXS 1KFXL 1YR5A 1AVSA 3LL8B 4ZCUA 2LHLA 3BOWA 3TZ1A 3BYAA 4YGBB 2K0JA 1YX8A 3AAJA 3EKHA 2KSPA 4N1FA 2KDHA 1FBVA 4Q04A 5G08A 1JWDA 3EK7A 1XFUO 1CDNA 3OB1B 1KWOB 1K96A 2WCEA 3DVEA 4YI8A 1UHHA 2Y4QA 1S3PA 2LHIA 1QS7A 4DCKA 2K7DA 2Q91A 2HQ8A 1CFPA 1YVHA 1NPQA 1KK7Y 2MBXA 5KSZA 2E30A 1SNLA 1CTRA 1Y1XA 3GK4X 3DF0B 3PLFB 2LP2A 1GGWA 2QPTA 4XJKA 3TDIA 4GBAA 3TS5C 4IL1A 2BE6A 2M9GA 1CKKA 2CNPA 2NLNA 3ICBA 1CFCA 1K95A 2F33A 1F71A 1B8LA 1N2DA 3LK1A 3FWBA 1V1FA
chains in the Genus database with same CATH superfamily
2LVKA 1UWOA 1B4CA 3TDZA 1KSMA 3K21A 4N5XA 3VB1A 5K89A 1CFFA 2MHHA 3OBVA 1QLKA 1IJ6A 5HLOA 5HKZA 1XFVO 2BKIB 2LUCA 3I5IC 3KF9A 1CDLA 1H4BA 5CPVA 1TNWA 2LNKA 3OHMB 4PHJA 5PALA 1U5IA 5ER4X 5D69A 2E6WA 1FPWA 4JD9A 4PE1A 1CM4A 5DKNA 1CM1A 2ZN9A 1T14A 1N0YA 2KI6D 1RK9A 1DF0B 1SBJA 1J7RA 1J7OA 1NX1A 3AAKA 1MF8B 2M7NA 5DKQA 3EG5B 1JBAA 1XO5A 4PT1A 1OZOA 4NQGA 4OCIA 4C0LA 4BY4A 1IH0A 2CXJA 2K7CA 1OSAA 2K61A 2Q4UA 3I5FC 2LMUA 2H2KA 2BCBA 1QX5B 4MZKA 3DVKA 1M31A 2CTNA 3PJIA 3VGOA 1IKUA 1SL9A 2KI4C 3EK4A 1UHNA 3NSIA 2COLB 4PHKA 5I8NA 1DJYA 2WCBA 3I5GC 2ZNEA 4YBHB 2JRFA 3NXAA 1KFUS 1KFUL 2JXCA 2L5YA 3I5HC 3JTDC 1F4OA 4OKHA 3BUMB 3S0GA 1UP5A 1LA3A 1F54A 1WRLA 3S0DA 2OTGB 1EG4A 1PSBA 3CR4X 2M7LA 1XA5A 2LMVA 1TWOA 3R1PA 1H8BA 3CGAA 2JU0A 4M2PA 4AQIA 2AUCA 3D78A 4GFTA 1B47A 4DIRA 1W9ZA 2HETA 2Y1NA 4XJKB 5HKYA 1DEKA 3TUYB 3DVJA 1C7WA 1AJ4A 4WQ3A 1S6CA 1DQEA 3B87A 1D1OA 2Y5IA 4PALA 3FE9A 3KEVA 1KK8B 3VRPA 1JFJA 1DJWA 4I5LB 1MWNA 2WC5A 3DY9A 3BFAA 2I7AA 3SG6A 2KBMA 3F45A 2KAYA 1TNXA 1PVAA 3OB2B 2AAOA 3E3RA 5AANA 4CFRA 4YGDB 4PHNA 2WOSA 1IQ3A 2NXQA 1WDCB 3ZWHA 2BL0C 1SSEB 1QATA 1R6PA 2EC6B 3RZSA 1Z2CB 2I94A 3EKJA 1Q80A 1NCXA 2LCPA 3BUXB 5FYXA 1FI6A 3Q8IA 4ORBB 2KFGA 1PULA 1GM0A 3D74A 4YGAA 2ZFDA 1QIVA 2JT8A 3S0BA 1L2OC 4F7FA 2KPHA 1BJFA 1UUSA 1K2HA 2H8VA 1ORGA 1MR8A 2AMIA 2JPTA 3RM1A 3BXKA 2F3ZA 4YRUA 1R2UA 1XFWO 1ZACA 2WCFA 2EHBA 2L98A 4MEWA 1OMDA 1F55A 1AUIB 1CLMA 1TCOB 3IQOA 4CLNA 2P71A 1SYMA 2KFHA 4JQ0D 2G2BA 3AKAA 4QJ4B 2FCDA 2FJUB 5I2QA 3QMEA 1M63B 3NGVA 4U8DA 3DZTA 1F70A 4MVFA 3SJSA 2NZ0A 3KO0A 3CZTX 1N65A 2PVBA 3M0WA 4OV2A 1TTXA 2WCHA 1J1DA 4WQ2A 5CSFA 2FJYA 1SCVA 3OX6A 1J7PA 3O2PA 4HSZA 2M0RA 5CSIA 1DJXA 3OGNA 1SW8A 3FE8A 3L4LA 2IS9A 4P5OE 1KQMB 3CYZA 1KWOC 1GQMA 1YURA 1B1GA 1BODA 2JTZA 2K2FA 2V53A 2M1KB 1RECA 3SIBA 2MJWB 2NCPA 2FOTA 2L4HA 2LP3A 1M45A 1PK0D 3D75A 3S0FA 1J7QA 1BMOA 2WCJA 4PE7A 1IWQA 1TN4A 2B1UA 1E8AA 2L51A 2KFFA 5HL1A 3HCMA 2LC5A 3O4XA 1L7ZA 3D0YB 1V1GA 4DRWA 1MXLC 4JKTA 1NSHA 3VRNA 2K8MB 1FI5A 5DKRA 1TRFA 1HQVA 2JC2A 3S0EA 3QRXA 4I5KA 3PM8A 2JTTA 4GPLB 1JF2A 5D3OA 3L4AA 1SRAA 1K9KA 1JF0A 1IGVA 3PSRA 2I18A 1BG1A 1NYAA 2PSRA 4QJ5B 2BBNA 1HT9A 2H61C 4KYNA 1K90D 1DJIA 1OW4A 2QDIA 1QXPA 1TUJA 3EVRA 5TNCA 4BY5A 5I94A 4UPGA 2P6BB 1J1EA 1JFKA 4HRHA 4PE4A 4ORCB 2Y1MA 4MRXA 2O60A 1B7TZ 4FTGA 1BF5A 1CMGA 1FF1A 5AERA 1LXFC 2WC6A 1S26D 5HLVA 2PRUA 5HYDA 3BOWB 1YRTB 1XVJA 2VRGA 4HREE 4PE0A 2TN4A 2WC8A 1WRKA 4M2QA 1OE9B 3NHTA 2LANA 2JWWA 3PFVA 3DD4A 2L0PA 4XYNA 4YGCB 1JUOA 1LS8A 1KSOA 1NX3A 1QJTA 5CSJA 1DMOA 1X02A 3A4UB 1K93D 2JXLA 1BR1B 1FW4A 1KCYA 2LLSA 1P28A 3GK2A 1EJ3A 2O5GA 3JVTB 1C7VA 3SG2A 1M39A 2L50A 1B8CA 4DUQA 4IJ7A 1OOHA 4QJ3B 3ZNIA 2LM5A 3BQ3A 1UURA 2ERBA 4FQTA 2JNFA 1TUZA 1UHIA 1S6IA 1XFRA 2BECA 4L9MA 2MAZA 4INWA 2GTEA 2LV7A 2OS8B 2QACA 2OTGC 3SG5A 1ODBA 5IBWA 3CZ1A 1DC1A 1BR4B 3D76A 3TDUA 1SR6B 4MBEA 1TCFA 3PN7B 5DICA 4R1EA 3BUNB 3SS3A 3H4SE 3R1OA 1AP4A 1GJYA 2BE4A 2JT3A 2HF5A 2WCKA 2CT9A 2KYCA 1IG5A 2OPOA 3S0AA 2M49B 3B6XA 3FE6A 3OX5A 3TUYC 2L2EA 3B86A 1WLMA 1MQ1A 2LLUA 3CTNA 1Y0VH 2WCMA 1YVLA 1G4YR 1KK8C 1LA0A 3EVUA 2KHNA 4TNCA 2KAXA 2P70A 3MSEB 4GAOA 1IRJA 3OP0A 4PHMA 3DVMA 4NDDA 1LKJA 2ZNDA 3NSKA 2M3WA 2KAVA 3NSLA 4GUKA 1LVCD 3DF0A 1U5IB 2FCEA 2MA2A 1A75A 1OMRA 4GGFC 1QVIZ 1W7JB 2LMTA 2DOQA 2KOTA 5BPJA 4HRGA 1WRZA 1AK8A 2MLEC 1WDCC 1F8HA 3C1VA 1DT7B 3KHEA 1SCMB 4MZLA 2EC6C 5EL2A 5J3XA 3O78A 2PYQA 4P2YB 1UHJA 2EGDA 2WNDA 1QX2A 1NUBA 1XK4C 2JOJA 3BFBA 3IQQA 1YX7A 2M29A 3CZ0A 5GQQC 2JULA 2H61A 4ORAB 1OQPA 3EVVA 5FI2A 5JOLA 1QLSA 2CCMA 1K94A 1ZOTB 2QEOA 2MLFC 4F0ZB 1G8IA 1K9PA 1XFXO 3SS5A 1Y1AA 3SG4A 1XFYO 1XYDA 2LVVA 2SCPA 5I2OA 4DS7A 3WXAA 1ZUZA 2ZRSA 1TNPA 4ETOA 1DELA 1QTXA 1QV0A 4OZDA 3VROA 1A03A 3GK1A 2KGBC 2I2RE 2BCAA 3VRQA 3RLZA 1DGUA 5JJGA 1B8RA 4M2OA 1XFZO 3CR5X 1KQVA 1WLZA 2F2PA 4OVNF 2KBIA 3A8RA 1C3ZA 1BOCA 1NCZA 5FI7A 5I2LA 4CFQA 1LINA 1UHKA 2LVIA 2LUXA 5B8IB 4CIDA 1MHOA 1KQMC 1TIZA 4FQOA 4YGEB 4C0KA 1NX2A 1CDMA 1ZMZA 3GOFA 3V2LA 3FWCA 1B7TY 2A4JA 1NP8A 2PQLA 2M97A 3CS1A 1Y1UA 2BBMA 2HPSA 2PMYA 3O4YA 1NX0A 3BUWB 1NWDA 1PVBA 3TS5B 4USLA 1TOPA 2KI6C 2KQ6A 2LE9B 2JT0A 2L4IA 1RJVA 2JZIA 2QEBA 2ZRTA 4YI9A 1SL7A 1Y6WA 1A75B 2RGIA 3LLEA 1QWVA 1VRKA 3IVTA 3D10A 3PALA 1DTLA 1JC2A 4D1EA 3EK8A 3O6BA 2LAPA 3LK0A 1MUXA 3CABA 1CMFA 1YRUB 3I5IB 2YGUA 2PASA 4E68A 1BT6A 2BCXA 4NDBA 1CNPA 3AKBA 2F8PA 1KK7Z 1YUTA 4GGFA 1IJ5A 3FS7A 4GNKB 3CR2A 4ZCVA 3CLNA 1QV1A 1W7IB 5FI6A 1OOJA 1RFJA 4I5JA 1ZFSA 2WORA 3FIAA 3BFHA 1OOIX 5D7FA 5ER5A 1JSAA 4ICBA 1BLQA 3I5FB 4I5NB 1SK6D 4JPZB 4MLWA 1WY9A 1XK4A 3PATA 1OOGA 1EL4A 2KNEA 2PALA 5KTYA 3SS4A 1GGZA 1AHRA 2KI4B 2L5XB 1DJHA 1S6JA 3I5GB 2JQ6A 1QX7A 3K1EA 3UNWA 4GGNA 1YTZC 3I5HB 1TNQA 3CZ2A 3JTDB 1AJ5A 1ALVA 2NCOA 2GV5A 2ISDA 1CFDA 2KLDA 3JVTC 3BUOB 3SIAA 1OMVA 1NIWA 3R72A 3KPXA 3WHUB 1QVIY 5HKWA 4C0JA 5CSNA 1CLLA 2HQWA 4OR9B 3IF7A 2K7OA 3R1VA 1S1EA 1M46A 5AFPA 2OS8C 1J55A 3N7HA 1SL8A 1CDPA 2KGRA 1SR6C 5KU1A 1A2XA 2LVJA 3PN7C 3BJHA 1B9AA 1EG3A 2R2IA 2LLTA 2BKHB 1IQ5A 2CBLA 1F4QA 1SMGA 1A4PA 1NCYA 1ALWA 1RTP1 3CWGA 3NSOA 4MRYA 1QASA 3HX4A 4INXA 3SG7A 4MSPA 1YUSA 1EH2A 2MRDA 2ZKMX 3B7AA 1YUUA 1S5GY 1PALA 1K9UA 1K8UA 2G9BA 3DYEA 2K2AA 1CLBA 3DXLA 2SASA 4AOMA 1RROA 2M1UA 2F3YA 1S36A 2M8UA 4AQJA 1EXRA 1MXEA 4WRIA 1DVIA 2QEVA 2BL0B 2D8NA 2KQYA 1DGVA 2JNXA 4A4BA 4PDZA 2GGZA 2ZN8A 1PRWA 1DJGA 4N1GA 3D0YA 5AEQA 1G33A 3WHTB 3WNXB 4CPVA 2GGMA 1C07A 1QIWA 2K60A 1Z4HA 1SPYA 4MN0A 4MZJA 1SKTA 2KLEA 4NDCA 2F2OA 2KYFA 2L2CA 4A4CA 3B88A 1SCMC 5AXIA 1RWYA 1S5GZ 1L2OB 1C3YA 1SY9A 3LCPC 1OZSA 4PCWA 1IIOA 3UO9A 1PSRA 3CDNA 1OOFA 3VRRA 2BNXA 3D77A 1A29A 1CB1A 4JWQA 5F6TA 1DF0A 1BU3A 1DJZA 2K7BA 3SG3A 2WCLA 1KFXS 1KFXL 1YR5A 1AVSA 3LL8B 4ZCUA 2LHLA 3BOWA 3TZ1A 3BYAA 4YGBB 2K0JA 1YX8A 3AAJA 3EKHA 2KSPA 4N1FA 2KDHA 1FBVA 4Q04A 5G08A 1JWDA 3EK7A 3PM2A 1XFUO 1CDNA 3OB1B 1KWOB 1K96A 2WCEA 3DVEA 4YI8A 1UHHA 2Y4QA 1S3PA 2LHIA 1QS7A 4DCKA 2K7DA 2Q91A 2BAPA 2HQ8A 3NHIA 1CFPA 1YVHA 1NPQA 2JPOA 1KK7Y 2MBXA 5KSZA 2E30A 1SNLA 1CTRA 1Y1XA 3GK4X 3DF0B 3PLFB 2LP2A 1GGWA 3D73A 2QPTA 4XJKA 3TDIA 4GBAA 3TS5C 4IL1A 2BE6A 2M9GA 1CKKA 2CNPA 2NLNA 3ICBA 1CFCA 1K95A 2QEHA 2F33A 1F71A 1B8LA 3L47A 1N2DA 3LK1A 3FWBA 1V1FA
chains in the Genus database with same CATH topology
2LVKA 1UWOA 1B4CA 3TDZA 1KSMA 3K21A 4N5XA 5K89A 1CFFA 2MHHA 1QLKA 1IJ6A 5HLOA 5HKZA 1XFVO 2BKIB 2LUCA 3I5IC 3KF9A 1CDLA 1H4BA 5CPVA 1TNWA 2LNKA 3OHMB 4PHJA 5PALA 1U5IA 5ER4X 5D69A 2E6WA 1FPWA 4PE1A 1CM4A 5DKNA 1CM1A 2ZN9A 2KI6D 1N0YA 1RK9A 1DF0B 1SBJA 1J7RA 1J7OA 1NX1A 3AAKA 1MF8B 2M7NA 5DKQA 1JBAA 1XO5A 1OZOA 4NQGA 4OCIA 4C0LA 4BY4A 1IH0A 2CXJA 2K7CA 1OSAA 2K61A 2Q4UA 3I5FC 2LMUA 2H2KA 2BCBA 1QX5B 4MZKA 3DVKA 1M31A 2CTNA 3VGOA 1IKUA 1SL9A 2KI4C 3EK4A 1UHNA 3NSIA 2COLB 4PHKA 5I8NA 1DJYA 2WCBA 3I5GC 2ZNEA 4YBHB 2JRFA 3NXAA 1KFUS 1KFUL 2JXCA 3I5HC 3JTDC 1F4OA 4OKHA 3BUMB 1UP5A 1LA3A 1F54A 1WRLA 2OTGB 1EG4A 1PSBA 3CR4X 2M7LA 1XA5A 2LMVA 1H8BA 3CGAA 2JU0A 4M2PA 4AQIA 2AUCA 4GFTA 1B47A 4DIRA 2HETA 2Y1NA 5HKYA 4XJKB 3TUYB 3DVJA 1C7WA 1AJ4A 4WQ3A 1S6CA 1D1OA 2Y5IA 4PALA 3KEVA 3VRPA 1KK8B 1JFJA 1DJWA 4I5LB 1MWNA 2I7AA 3SG6A 2KBMA 3F45A 2KAYA 1TNXA 1PVAA 3OB2B 2AAOA 3E3RA 5AANA 4CFRA 4YGDB 4PHNA 2WOSA 1IQ3A 2NXQA 1WDCB 3ZWHA 2BL0C 1QATA 1R6PA 2EC6B 2I94A 3EKJA 1Q80A 1NCXA 2LCPA 3BUXB 5FYXA 1FI6A 4ORBB 2KFGA 1PULA 4YGAA 2ZFDA 1QIVA 2JT8A 1L2OC 1BJFA 1UUSA 1K2HA 1MR8A 2AMIA 2JPTA 3RM1A 3BXKA 2F3ZA 4YRUA 1R2UA 1XFWO 1ZACA 2WCFA 2EHBA 2L98A 4MEWA 1OMDA 1F55A 1AUIB 1CLMA 1TCOB 3IQOA 4CLNA 1SYMA 2KFHA 4JQ0D 2G2BA 3AKAA 4QJ4B 2FCDA 2FJUB 5I2QA 1M63B 4U8DA 1F70A 4MVFA 3SJSA 2NZ0A 3KO0A 3CZTX 1N65A 2PVBA 3M0WA 4OV2A 1TTXA 4WQ2A 1J1DA 5CSFA 3OX6A 1SCVA 1J7PA 3O2PA 4HSZA 2M0RA 5CSIA 1DJXA 1SW8A 2IS9A 4P5OE 1KQMB 1KWOC 1GQMA 1YURA 1B1GA 1BODA 2JTZA 2K2FA 2V53A 2M1KB 1RECA 3SIBA 2MJWB 2NCPA 2FOTA 2L4HA 2LP3A 1M45A 1PK0D 1J7QA 1BMOA 4PE7A 1IWQA 1TN4A 2B1UA 1E8AA 2L51A 2KFFA 3HCMA 2LC5A 1L7ZA 3D0YB 1V1GA 4DRWA 1MXLC 3VRNA 1NSHA 1FI5A 2K8MB 5DKRA 1TRFA 1HQVA 2JC2A 3QRXA 4I5KA 3PM8A 2JTTA 4GPLB 1JF2A 1SRAA 1K9KA 1JF0A 1IGVA 3PSRA 2I18A 1BG1A 1NYAA 2PSRA 4QJ5B 2BBNA 1HT9A 2H61C 1K90D 1DJIA 1QXPA 3EVRA 5TNCA 4BY5A 4UPGA 2P6BB 1J1EA 1JFKA 4HRHA 4PE4A 4ORCB 2Y1MA 4MRXA 2O60A 1B7TZ 4FTGA 1BF5A 1CMGA 1FF1A 5AERA 1LXFC 5HLVA 1S26D 2PRUA 5HYDA 3BOWB 1YRTB 1XVJA 2VRGA 4HREE 4PE0A 2TN4A 2WC8A 1WRKA 4M2QA 1OE9B 2LANA 2JWWA 3PFVA 3DD4A 2L0PA 4XYNA 4YGCB 1JUOA 1KSOA 1NX3A 1QJTA 5CSJA 1DMOA 1X02A 3A4UB 1K93D 2JXLA 1BR1B 1FW4A 1KCYA 2LLSA 3GK2A 1EJ3A 2O5GA 3JVTB 1C7VA 3SG2A 1M39A 2L50A 1B8CA 4DUQA 4QJ3B 3ZNIA 2LM5A 3BQ3A 1UURA 2JNFA 1UHIA 1S6IA 4L9MA 2BECA 2MAZA 2LV7A 2OS8B 2QACA 2OTGC 3SG5A 1ODBA 5IBWA 1BR4B 3TDUA 1SR6B 4MBEA 1TCFA 3PN7B 4R1EA 3BUNB 1AP4A 3H4SE 1GJYA 2BE4A 2JT3A 2HF5A 2CT9A 2KYCA 1IG5A 2OPOA 2M49B 3OX5A 3TUYC 2L2EA 1WLMA 1MQ1A 2LLUA 3CTNA 1Y0VH 1YVLA 1G4YR 1KK8C 1LA0A 3EVUA 2KHNA 4TNCA 2KAXA 4GAOA 3MSEB 4PHMA 1IRJA 3OP0A 3DVMA 4NDDA 1LKJA 2ZNDA 3NSKA 2M3WA 2KAVA 3NSLA 4GUKA 1LVCD 3DF0A 1U5IB 2FCEA 2MA2A 1A75A 1OMRA 4GGFC 1QVIZ 1W7JB 2LMTA 2DOQA 2KOTA 5BPJA 4HRGA 1WRZA 1AK8A 2MLEC 1WDCC 1F8HA 3C1VA 1DT7B 3KHEA 1SCMB 4MZLA 2EC6C 5J3XA 3O78A 4P2YB 1UHJA 2EGDA 2WNDA 1QX2A 1NUBA 1XK4C 2JOJA 3IQQA 5GQQC 1YX7A 2M29A 3SG3A 2JULA 2H61A 4ORAB 1OQPA 3EVVA 5JOLA 1QLSA 2CCMA 1K94A 1ZOTB 2MLFC 4F0ZB 1G8IA 1K9PA 1XFXO 1Y1AA 3SG4A 1XFYO 1XYDA 2LVVA 2SCPA 5I2OA 4DS7A 3WXAA 1ZUZA 2ZRSA 1TNPA 4ETOA 1QTXA 1QV0A 3VROA 1A03A 3GK1A 2KGBC 2I2RE 2BCAA 3VRQA 3RLZA 1DGUA 5JJGA 1B8RA 4M2OA 1XFZO 3CR5X 1KQVA 1WLZA 2F2PA 4OVNF 2KBIA 3A8RA 1BOCA 1NCZA 5I2LA 4CFQA 1LINA 1UHKA 2LVIA 2LUXA 5B8IB 4CIDA 1MHOA 1KQMC 1TIZA 4FQOA 4YGEB 4C0KA 1NX2A 1CDMA 1ZMZA 3GOFA 3FWCA 1B7TY 2A4JA 1NP8A 2M97A 3CS1A 1Y1UA 2BBMA 2HPSA 2PMYA 3O4YA 1NX0A 3BUWB 1NWDA 1PVBA 3TS5B 4USLA 1TOPA 2KI6C 2KQ6A 2LE9B 2JT0A 2L4IA 1RJVA 2JZIA 2ZRTA 4YI9A 1SL7A 1Y6WA 1A75B 2RGIA 3LLEA 1VRKA 3D10A 3PALA 1DTLA 1JC2A 4D1EA 3EK8A 3O6BA 2LAPA 3LK0A 1MUXA 1CMFA 1YRUB 3I5IB 2PASA 4E68A 1BT6A 2BCXA 4NDBA 1CNPA 3AKBA 2F8PA 1KK7Z 1YUTA 4GGFA 1IJ5A 3FS7A 4GNKB 3CR2A 4ZCVA 3CLNA 1QV1A 1W7IB 1OOJA 1RFJA 4I5JA 1ZFSA 2WORA 3FIAA 5ER5A 5D7FA 1JSAA 4ICBA 1BLQA 3I5FB 4I5NB 1SK6D 4JPZB 4MLWA 1WY9A 1XK4A 3PATA 1EL4A 2KNEA 2PALA 5KTYA 1GGZA 1AHRA 2KI4B 2L5XB 1DJHA 1S6JA 3I5GB 2JQ6A 1QX7A 4GGNA 1YTZC 3I5HB 1TNQA 3JTDB 1AJ5A 1ALVA 2NCOA 2GV5A 2ISDA 1CFDA 3JVTC 3BUOB 3SIAA 1OMVA 1NIWA 3WHUB 3KPXA 1QVIY 5HKWA 4C0JA 5CSNA 1CLLA 2HQWA 4OR9B 3IF7A 2K7OA 1S1EA 1M46A 5AFPA 2OS8C 1J55A 1SL8A 1CDPA 2KGRA 1SR6C 5KU1A 1A2XA 2LVJA 3PN7C 1B9AA 1EG3A 2R2IA 2LLTA 2BKHB 1IQ5A 2CBLA 1F4QA 1SMGA 1A4PA 1NCYA 1ALWA 1RTP1 3CWGA 3NSOA 4MRYA 1QASA 3HX4A 3SG7A 1EH2A 4MSPA 1YUSA 2MRDA 2ZKMX 1YUUA 1S5GY 1PALA 1K9UA 1K8UA 2G9BA 2K2AA 1CLBA 2SASA 4AOMA 1RROA 2M1UA 2F3YA 1S36A 2M8UA 4AQJA 1EXRA 1MXEA 4WRIA 1DVIA 2BL0B 2D8NA 2KQYA 1DGVA 2JNXA 4A4BA 4PDZA 2GGZA 2ZN8A 1PRWA 1DJGA 4N1GA 3D0YA 5AEQA 1G33A 3WHTB 3WNXB 4CPVA 2GGMA 1C07A 1QIWA 4MN0A 1SPYA 4MZJA 1SKTA 4NDCA 2F2OA 2KYFA 4A4CA 1SCMC 5AXIA 1RWYA 1S5GZ 1L2OB 1SY9A 3LCPC 1OZSA 4PCWA 1PSRA 3VRRA 1A29A 1CB1A 4JWQA 5F6TA 1DF0A 1BU3A 1DJZA 2K7BA 1KFXS 1KFXL 1YR5A 1AVSA 3LL8B 4ZCUA 2LHLA 3BOWA 3TZ1A 3BYAA 4YGBB 2K0JA 1YX8A 3AAJA 3EKHA 2KSPA 4N1FA 2KDHA 1FBVA 4Q04A 5G08A 1JWDA 3EK7A 1XFUO 1CDNA 3OB1B 1KWOB 1K96A 2WCEA 3DVEA 4YI8A 1UHHA 2Y4QA 1S3PA 2LHIA 1QS7A 4DCKA 2K7DA 2Q91A 2HQ8A 1CFPA 1YVHA 1NPQA 1KK7Y 2MBXA 5KSZA 2E30A 1SNLA 1CTRA 1Y1XA 3GK4X 3DF0B 3PLFB 2LP2A 1GGWA 2QPTA 4XJKA 3TDIA 4GBAA 3TS5C 4IL1A 2BE6A 2M9GA 1CKKA 2CNPA 2NLNA 3ICBA 1CFCA 1K95A 2F33A 1F71A 1B8LA 1N2DA 3LK1A 3FWBA 1V1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVK A;  1UWO A;  1B4C A;  3TDZ A;  1KSM A;  3K21 A;  4N5X A;  5K89 A;  1CFF A;  2MHH A;  1QLK A;  1IJ6 A;  5HLO A;  5HKZ A;  1XFV O;  2BKI B;  2LUC A;  3I5I C;  3KF9 A;  1CDL A;  1H4B A;  5CPV A;  1TNW A;  2LNK A;  3OHM B;  4PHJ A;  5PAL A;  1U5I A;  5ER4 X;  5D69 A;  2E6W A;  1FPW A;  4PE1 A;  1CM4 A;  5DKN A;  1CM1 A;  2ZN9 A;  2KI6 D;  1N0Y A;  1RK9 A;  1DF0 B;  1SBJ A;  1J7R A;  1J7O A;  1NX1 A;  3AAK A;  1MF8 B;  2M7N A;  5DKQ A;  1JBA A;  1XO5 A;  1OZO A;  4NQG A;  4OCI A;  4C0L A;  4BY4 A;  1IH0 A;  2CXJ A;  2K7C A;  1OSA A;  2K61 A;  2Q4U A;  3I5F C;  2LMU A;  2H2K A;  2BCB A;  1QX5 B;  4MZK A;  3DVK A;  1M31 A;  2CTN A;  3VGO A;  1IKU A;  1SL9 A;  2KI4 C;  3EK4 A;  1UHN A;  3NSI A;  2COL B;  4PHK A;  5I8N A;  1DJY A;  2WCB A;  3I5G C;  2ZNE A;  4YBH B;  2JRF A;  3NXA A;  1KFU S;  1KFU L;  2JXC A;  3I5H C;  3JTD C;  1F4O A;  4OKH A;  3BUM B;  1UP5 A;  1LA3 A;  1F54 A;  1WRL A;  2OTG B;  1EG4 A;  1PSB A;  3CR4 X;  2M7L A;  1XA5 A;  2LMV A;  1H8B A;  3CGA A;  2JU0 A;  4M2P A;  4AQI A;  2AUC A;  4GFT A;  1B47 A;  4DIR A;  2HET A;  2Y1N A;  5HKY A;  4XJK B;  3TUY B;  3DVJ A;  1C7W A;  1AJ4 A;  4WQ3 A;  1S6C A;  1D1O A;  2Y5I A;  4PAL A;  3KEV A;  3VRP A;  1KK8 B;  1JFJ A;  1DJW A;  4I5L B;  1MWN A;  2I7A A;  3SG6 A;  2KBM A;  3F45 A;  2KAY A;  1TNX A;  1PVA A;  3OB2 B;  2AAO A;  3E3R A;  5AAN A;  4CFR A;  4YGD B;  4PHN A;  2WOS A;  1IQ3 A;  2NXQ A;  1WDC B;  3ZWH A;  2BL0 C;  1QAT A;  1R6P A;  2EC6 B;  2I94 A;  3EKJ A;  1Q80 A;  1NCX A;  2LCP A;  3BUX B;  5FYX A;  1FI6 A;  4ORB B;  2KFG A;  1PUL A;  4YGA A;  2ZFD A;  1QIV A;  2JT8 A;  1L2O C;  1BJF A;  1UUS A;  1K2H A;  1MR8 A;  2AMI A;  2JPT A;  3RM1 A;  3BXK A;  2F3Z A;  4YRU A;  1R2U A;  1XFW O;  1ZAC A;  2WCF A;  2EHB A;  2L98 A;  4MEW A;  1OMD A;  1F55 A;  1AUI B;  1CLM A;  1TCO B;  3IQO A;  4CLN A;  1SYM A;  2KFH A;  4JQ0 D;  2G2B A;  3AKA A;  4QJ4 B;  2FCD A;  2FJU B;  5I2Q A;  1M63 B;  4U8D A;  1F70 A;  4MVF A;  3SJS A;  2NZ0 A;  3KO0 A;  3CZT X;  1N65 A;  2PVB A;  3M0W A;  4OV2 A;  1TTX A;  4WQ2 A;  1J1D A;  5CSF A;  3OX6 A;  1SCV A;  1J7P A;  3O2P A;  4HSZ A;  2M0R A;  5CSI A;  1DJX A;  1SW8 A;  2IS9 A;  4P5O E;  1KQM B;  1KWO C;  1GQM A;  1YUR A;  1B1G A;  1BOD A;  2JTZ A;  2K2F A;  2V53 A;  2M1K B;  1REC A;  3SIB A;  2MJW B;  2NCP A;  2FOT A;  2L4H A;  2LP3 A;  1M45 A;  1PK0 D;  1J7Q A;  1BMO A;  4PE7 A;  1IWQ A;  1TN4 A;  2B1U A;  1E8A A;  2L51 A;  2KFF A;  3HCM A;  2LC5 A;  1L7Z A;  3D0Y B;  1V1G A;  4DRW A;  1MXL C;  3VRN A;  1NSH A;  1FI5 A;  2K8M B;  5DKR A;  1TRF A;  1HQV A;  2JC2 A;  3QRX A;  4I5K A;  3PM8 A;  2JTT A;  4GPL B;  1JF2 A;  1SRA A;  1K9K A;  1JF0 A;  1IGV A;  3PSR A;  2I18 A;  1BG1 A;  1NYA A;  2PSR A;  4QJ5 B;  2BBN A;  1HT9 A;  2H61 C;  1K90 D;  1DJI A;  1QXP A;  3EVR A;  5TNC A;  4BY5 A;  4UPG A;  2P6B B;  1J1E A;  1JFK A;  4HRH A;  4PE4 A;  4ORC B;  2Y1M A;  4MRX A;  2O60 A;  1B7T Z;  4FTG A;  1BF5 A;  1CMG A;  1FF1 A;  5AER A;  1LXF C;  5HLV A;  1S26 D;  2PRU A;  5HYD A;  3BOW B;  1YRT B;  1XVJ A;  2VRG A;  4HRE E;  4PE0 A;  2TN4 A;  2WC8 A;  1WRK A;  4M2Q A;  1OE9 B;  2LAN A;  2JWW A;  3PFV A;  3DD4 A;  2L0P A;  4XYN A;  4YGC B;  1JUO A;  1KSO A;  1NX3 A;  1QJT A;  5CSJ A;  1DMO A;  1X02 A;  3A4U B;  1K93 D;  2JXL A;  1BR1 B;  1FW4 A;  1KCY A;  2LLS A;  3GK2 A;  1EJ3 A;  2O5G A;  3JVT B;  1C7V A;  3SG2 A;  1M39 A;  2L50 A;  1B8C A;  4DUQ A;  4QJ3 B;  3ZNI A;  2LM5 A;  3BQ3 A;  1UUR A;  2JNF A;  1UHI A;  1S6I A;  4L9M A;  2BEC A;  2MAZ A;  2LV7 A;  2OS8 B;  2QAC A;  2OTG C;  3SG5 A;  1ODB A;  5IBW A;  1BR4 B;  3TDU A;  1SR6 B;  4MBE A;  1TCF A;  3PN7 B;  4R1E A;  3BUN B;  1AP4 A;  3H4S E;  1GJY A;  2BE4 A;  2JT3 A;  2HF5 A;  2CT9 A;  2KYC A;  1IG5 A;  2OPO A;  2M49 B;  3OX5 A;  3TUY C;  2L2E A;  1WLM A;  1MQ1 A;  2LLU A;  3CTN A;  1Y0V H;  1YVL A;  1G4Y R;  1KK8 C;  1LA0 A;  3EVU A;  2KHN A;  4TNC A;  2KAX A;  4GAO A;  3MSE B;  4PHM A;  1IRJ A;  3OP0 A;  3DVM A;  4NDD A;  1LKJ A;  2ZND A;  3NSK A;  2M3W A;  2KAV A;  3NSL A;  4GUK A;  1LVC D;  3DF0 A;  1U5I B;  2FCE A;  2MA2 A;  1A75 A;  1OMR A;  4GGF C;  1QVI Z;  1W7J B;  2LMT A;  2DOQ A;  2KOT A;  5BPJ A;  4HRG A;  1WRZ A;  1AK8 A;  2MLE C;  1WDC C;  1F8H A;  3C1V A;  1DT7 B;  3KHE A;  1SCM B;  4MZL A;  2EC6 C;  5J3X A;  3O78 A;  4P2Y B;  1UHJ A;  2EGD A;  2WND A;  1QX2 A;  1NUB A;  1XK4 C;  2JOJ A;  3IQQ A;  5GQQ C;  1YX7 A;  2M29 A;  3SG3 A;  2JUL A;  2H61 A;  4ORA B;  1OQP A;  3EVV A;  5JOL A;  1QLS A;  2CCM A;  1K94 A;  1ZOT B;  2MLF C;  4F0Z B;  1G8I A;  1K9P A;  1XFX O;  1Y1A A;  3SG4 A;  1XFY O;  1XYD A;  2LVV A;  2SCP A;  5I2O A;  4DS7 A;  3WXA A;  1ZUZ A;  2ZRS A;  1TNP A;  4ETO A;  1QTX A;  1QV0 A;  3VRO A;  1A03 A;  3GK1 A;  2KGB C;  2I2R E;  2BCA A;  3VRQ A;  3RLZ A;  1DGU A;  5JJG A;  1B8R A;  4M2O A;  1XFZ O;  3CR5 X;  1KQV A;  1WLZ A;  2F2P A;  4OVN F;  2KBI A;  3A8R A;  1BOC A;  1NCZ A;  5I2L A;  4CFQ A;  1LIN A;  1UHK A;  2LVI A;  2LUX A;  5B8I B;  4CID A;  1MHO A;  1KQM C;  1TIZ A;  4FQO A;  4YGE B;  4C0K A;  1NX2 A;  1CDM A;  1ZMZ A;  3GOF A;  3FWC A;  1B7T Y;  2A4J A;  1NP8 A;  2M97 A;  3CS1 A;  1Y1U A;  2BBM A;  2HPS A;  2PMY A;  3O4Y A;  1NX0 A;  3BUW B;  1NWD A;  1PVB A;  3TS5 B;  4USL A;  1TOP A;  2KI6 C;  2KQ6 A;  2LE9 B;  2JT0 A;  2L4I A;  1RJV A;  2JZI A;  2ZRT A;  4YI9 A;  1SL7 A;  1Y6W A;  1A75 B;  2RGI A;  3LLE A;  1VRK A;  3D10 A;  3PAL A;  1DTL A;  1JC2 A;  4D1E A;  3EK8 A;  3O6B A;  2LAP A;  3LK0 A;  1MUX A;  1CMF A;  1YRU B;  3I5I B;  2PAS A;  4E68 A;  1BT6 A;  2BCX A;  4NDB A;  1CNP A;  3AKB A;  2F8P A;  1KK7 Z;  1YUT A;  4GGF A;  1IJ5 A;  3FS7 A;  4GNK B;  3CR2 A;  4ZCV A;  3CLN A;  1QV1 A;  1W7I B;  1OOJ A;  1RFJ A;  4I5J A;  1ZFS A;  2WOR A;  3FIA A;  5ER5 A;  5D7F A;  1JSA A;  4ICB A;  1BLQ A;  3I5F B;  4I5N B;  1SK6 D;  4JPZ B;  4MLW A;  1WY9 A;  1XK4 A;  3PAT A;  1EL4 A;  2KNE A;  2PAL A;  5KTY A;  1GGZ A;  1AHR A;  2KI4 B;  2L5X B;  1DJH A;  1S6J A;  3I5G B;  2JQ6 A;  1QX7 A;  4GGN A;  1YTZ C;  3I5H B;  1TNQ A;  3JTD B;  1AJ5 A;  1ALV A;  2NCO A;  2GV5 A;  2ISD A;  1CFD A;  3JVT C;  3BUO B;  3SIA A;  1OMV A;  1NIW A;  3WHU B;  3KPX A;  1QVI Y;  5HKW A;  4C0J A;  5CSN A;  1CLL A;  2HQW A;  4OR9 B;  3IF7 A;  2K7O A;  1S1E A;  1M46 A;  5AFP A;  2OS8 C;  1J55 A;  1SL8 A;  1CDP A;  2KGR A;  1SR6 C;  5KU1 A;  1A2X A;  2LVJ A;  3PN7 C;  1B9A A;  1EG3 A;  2R2I A;  2LLT A;  2BKH B;  1IQ5 A;  2CBL A;  1F4Q A;  1SMG A;  1A4P A;  1NCY A;  1ALW A;  1RTP 1;  3CWG A;  3NSO A;  4MRY A;  1QAS A;  3HX4 A;  3SG7 A;  1EH2 A;  4MSP A;  1YUS A;  2MRD A;  2ZKM X;  1YUU A;  1S5G Y;  1PAL A;  1K9U A;  1K8U A;  2G9B A;  2K2A A;  1CLB A;  2SAS A;  4AOM A;  1RRO A;  2M1U A;  2F3Y A;  1S36 A;  2M8U A;  4AQJ A;  1EXR A;  1MXE A;  4WRI A;  1DVI A;  2BL0 B;  2D8N A;  2KQY A;  1DGV A;  2JNX A;  4A4B A;  4PDZ A;  2GGZ A;  2ZN8 A;  1PRW A;  1DJG A;  4N1G A;  3D0Y A;  5AEQ A;  1G33 A;  3WHT B;  3WNX B;  4CPV A;  2GGM A;  1C07 A;  1QIW A;  4MN0 A;  1SPY A;  4MZJ A;  1SKT A;  4NDC A;  2F2O A;  2KYF A;  4A4C A;  1SCM C;  5AXI A;  1RWY A;  1S5G Z;  1L2O B;  1SY9 A;  3LCP C;  1OZS A;  4PCW A;  1PSR A;  3VRR A;  1A29 A;  1CB1 A;  4JWQ A;  5F6T A;  1DF0 A;  1BU3 A;  1DJZ A;  2K7B A;  1KFX S;  1KFX L;  1YR5 A;  1AVS A;  3LL8 B;  4ZCU A;  2LHL A;  3BOW A;  3TZ1 A;  3BYA A;  4YGB B;  2K0J A;  1YX8 A;  3AAJ A;  3EKH A;  2KSP A;  4N1F A;  2KDH A;  1FBV A;  4Q04 A;  5G08 A;  1JWD A;  3EK7 A;  1XFU O;  1CDN A;  3OB1 B;  1KWO B;  1K96 A;  2WCE A;  3DVE A;  4YI8 A;  1UHH A;  2Y4Q A;  1S3P A;  2LHI A;  1QS7 A;  4DCK A;  2K7D A;  2Q91 A;  2HQ8 A;  1CFP A;  1YVH A;  1NPQ A;  1KK7 Y;  2MBX A;  5KSZ A;  2E30 A;  1SNL A;  1CTR A;  1Y1X A;  3GK4 X;  3DF0 B;  3PLF B;  2LP2 A;  1GGW A;  2QPT A;  4XJK A;  3TDI A;  4GBA A;  3TS5 C;  4IL1 A;  2BE6 A;  2M9G A;  1CKK A;  2CNP A;  2NLN A;  3ICB A;  1CFC A;  1K95 A;  2F33 A;  1F71 A;  1B8L A;  1N2D A;  3LK1 A;  3FWB A;  1V1F A; 
#chains in the Genus database with same CATH topology
 2LVK A;  1UWO A;  1B4C A;  3TDZ A;  1KSM A;  3K21 A;  4N5X A;  3VB1 A;  5K89 A;  1CFF A;  2MHH A;  3OBV A;  1QLK A;  1IJ6 A;  5HLO A;  5HKZ A;  1XFV O;  2BKI B;  2LUC A;  3I5I C;  3KF9 A;  1CDL A;  1H4B A;  5CPV A;  1TNW A;  2LNK A;  3OHM B;  4PHJ A;  5PAL A;  1U5I A;  5ER4 X;  5D69 A;  2E6W A;  1FPW A;  4JD9 A;  4PE1 A;  1CM4 A;  5DKN A;  1CM1 A;  2ZN9 A;  1T14 A;  1N0Y A;  2KI6 D;  1RK9 A;  1DF0 B;  1SBJ A;  1J7R A;  1J7O A;  1NX1 A;  3AAK A;  1MF8 B;  2M7N A;  5DKQ A;  3EG5 B;  1JBA A;  1XO5 A;  4PT1 A;  1OZO A;  4NQG A;  4OCI A;  4C0L A;  4BY4 A;  1IH0 A;  2CXJ A;  2K7C A;  1OSA A;  2K61 A;  2Q4U A;  3I5F C;  2LMU A;  2H2K A;  2BCB A;  1QX5 B;  4MZK A;  3DVK A;  1M31 A;  2CTN A;  3PJI A;  3VGO A;  1IKU A;  1SL9 A;  2KI4 C;  3EK4 A;  1UHN A;  3NSI A;  2COL B;  4PHK A;  5I8N A;  1DJY A;  2WCB A;  3I5G C;  2ZNE A;  4YBH B;  2JRF A;  3NXA A;  1KFU S;  1KFU L;  2JXC A;  2L5Y A;  3I5H C;  3JTD C;  1F4O A;  4OKH A;  3BUM B;  3S0G A;  1UP5 A;  1LA3 A;  1F54 A;  1WRL A;  3S0D A;  2OTG B;  1EG4 A;  1PSB A;  3CR4 X;  2M7L A;  1XA5 A;  2LMV A;  1TWO A;  3R1P A;  1H8B A;  3CGA A;  2JU0 A;  4M2P A;  4AQI A;  2AUC A;  3D78 A;  4GFT A;  1B47 A;  4DIR A;  1W9Z A;  2HET A;  2Y1N A;  4XJK B;  5HKY A;  1DEK A;  3TUY B;  3DVJ A;  1C7W A;  1AJ4 A;  4WQ3 A;  1S6C A;  1DQE A;  3B87 A;  1D1O A;  2Y5I A;  4PAL A;  3FE9 A;  3KEV A;  1KK8 B;  3VRP A;  1JFJ A;  1DJW A;  4I5L B;  1MWN A;  2WC5 A;  3DY9 A;  3BFA A;  2I7A A;  3SG6 A;  2KBM A;  3F45 A;  2KAY A;  1TNX A;  1PVA A;  3OB2 B;  2AAO A;  3E3R A;  5AAN A;  4CFR A;  4YGD B;  4PHN A;  2WOS A;  1IQ3 A;  2NXQ A;  1WDC B;  3ZWH A;  2BL0 C;  1SSE B;  1QAT A;  1R6P A;  2EC6 B;  3RZS A;  1Z2C B;  2I94 A;  3EKJ A;  1Q80 A;  1NCX A;  2LCP A;  3BUX B;  5FYX A;  1FI6 A;  3Q8I A;  4ORB B;  2KFG A;  1PUL A;  1GM0 A;  3D74 A;  4YGA A;  2ZFD A;  1QIV A;  2JT8 A;  3S0B A;  1L2O C;  4F7F A;  2KPH A;  1BJF A;  1UUS A;  1K2H A;  2H8V A;  1ORG A;  1MR8 A;  2AMI A;  2JPT A;  3RM1 A;  3BXK A;  2F3Z A;  4YRU A;  1R2U A;  1XFW O;  1ZAC A;  2WCF A;  2EHB A;  2L98 A;  4MEW A;  1OMD A;  1F55 A;  1AUI B;  1CLM A;  1TCO B;  3IQO A;  4CLN A;  2P71 A;  1SYM A;  2KFH A;  4JQ0 D;  2G2B A;  3AKA A;  4QJ4 B;  2FCD A;  2FJU B;  5I2Q A;  3QME A;  1M63 B;  3NGV A;  4U8D A;  3DZT A;  1F70 A;  4MVF A;  3SJS A;  2NZ0 A;  3KO0 A;  3CZT X;  1N65 A;  2PVB A;  3M0W A;  4OV2 A;  1TTX A;  2WCH A;  1J1D A;  4WQ2 A;  5CSF A;  2FJY A;  1SCV A;  3OX6 A;  1J7P A;  3O2P A;  4HSZ A;  2M0R A;  5CSI A;  1DJX A;  3OGN A;  1SW8 A;  3FE8 A;  3L4L A;  2IS9 A;  4P5O E;  1KQM B;  3CYZ A;  1KWO C;  1GQM A;  1YUR A;  1B1G A;  1BOD A;  2JTZ A;  2K2F A;  2V53 A;  2M1K B;  1REC A;  3SIB A;  2MJW B;  2NCP A;  2FOT A;  2L4H A;  2LP3 A;  1M45 A;  1PK0 D;  3D75 A;  3S0F A;  1J7Q A;  1BMO A;  2WCJ A;  4PE7 A;  1IWQ A;  1TN4 A;  2B1U A;  1E8A A;  2L51 A;  2KFF A;  5HL1 A;  3HCM A;  2LC5 A;  3O4X A;  1L7Z A;  3D0Y B;  1V1G A;  4DRW A;  1MXL C;  4JKT A;  1NSH A;  3VRN A;  2K8M B;  1FI5 A;  5DKR A;  1TRF A;  1HQV A;  2JC2 A;  3S0E A;  3QRX A;  4I5K A;  3PM8 A;  2JTT A;  4GPL B;  1JF2 A;  5D3O A;  3L4A A;  1SRA A;  1K9K A;  1JF0 A;  1IGV A;  3PSR A;  2I18 A;  1BG1 A;  1NYA A;  2PSR A;  4QJ5 B;  2BBN A;  1HT9 A;  2H61 C;  4KYN A;  1K90 D;  1DJI A;  1OW4 A;  2QDI A;  1QXP A;  1TUJ A;  3EVR A;  5TNC A;  4BY5 A;  5I94 A;  4UPG A;  2P6B B;  1J1E A;  1JFK A;  4HRH A;  4PE4 A;  4ORC B;  2Y1M A;  4MRX A;  2O60 A;  1B7T Z;  4FTG A;  1BF5 A;  1CMG A;  1FF1 A;  5AER A;  1LXF C;  2WC6 A;  1S26 D;  5HLV A;  2PRU A;  5HYD A;  3BOW B;  1YRT B;  1XVJ A;  2VRG A;  4HRE E;  4PE0 A;  2TN4 A;  2WC8 A;  1WRK A;  4M2Q A;  1OE9 B;  3NHT A;  2LAN A;  2JWW A;  3PFV A;  3DD4 A;  2L0P A;  4XYN A;  4YGC B;  1JUO A;  1LS8 A;  1KSO A;  1NX3 A;  1QJT A;  5CSJ A;  1DMO A;  1X02 A;  3A4U B;  1K93 D;  2JXL A;  1BR1 B;  1FW4 A;  1KCY A;  2LLS A;  1P28 A;  3GK2 A;  1EJ3 A;  2O5G A;  3JVT B;  1C7V A;  3SG2 A;  1M39 A;  2L50 A;  1B8C A;  4DUQ A;  4IJ7 A;  1OOH A;  4QJ3 B;  3ZNI A;  2LM5 A;  3BQ3 A;  1UUR A;  2ERB A;  4FQT A;  2JNF A;  1TUZ A;  1UHI A;  1S6I A;  1XFR A;  2BEC A;  4L9M A;  2MAZ A;  4INW A;  2GTE A;  2LV7 A;  2OS8 B;  2QAC A;  2OTG C;  3SG5 A;  1ODB A;  5IBW A;  3CZ1 A;  1DC1 A;  1BR4 B;  3D76 A;  3TDU A;  1SR6 B;  4MBE A;  1TCF A;  3PN7 B;  5DIC A;  4R1E A;  3BUN B;  3SS3 A;  3H4S E;  3R1O A;  1AP4 A;  1GJY A;  2BE4 A;  2JT3 A;  2HF5 A;  2WCK A;  2CT9 A;  2KYC A;  1IG5 A;  2OPO A;  3S0A A;  2M49 B;  3B6X A;  3FE6 A;  3OX5 A;  3TUY C;  2L2E A;  3B86 A;  1WLM A;  1MQ1 A;  2LLU A;  3CTN A;  1Y0V H;  2WCM A;  1YVL A;  1G4Y R;  1KK8 C;  1LA0 A;  3EVU A;  2KHN A;  4TNC A;  2KAX A;  2P70 A;  3MSE B;  4GAO A;  1IRJ A;  3OP0 A;  4PHM A;  3DVM A;  4NDD A;  1LKJ A;  2ZND A;  3NSK A;  2M3W A;  2KAV A;  3NSL A;  4GUK A;  1LVC D;  3DF0 A;  1U5I B;  2FCE A;  2MA2 A;  1A75 A;  1OMR A;  4GGF C;  1QVI Z;  1W7J B;  2LMT A;  2DOQ A;  2KOT A;  5BPJ A;  4HRG A;  1WRZ A;  1AK8 A;  2MLE C;  1WDC C;  1F8H A;  3C1V A;  1DT7 B;  3KHE A;  1SCM B;  4MZL A;  2EC6 C;  5EL2 A;  5J3X A;  3O78 A;  2PYQ A;  4P2Y B;  1UHJ A;  2EGD A;  2WND A;  1QX2 A;  1NUB A;  1XK4 C;  2JOJ A;  3BFB A;  3IQQ A;  1YX7 A;  2M29 A;  3CZ0 A;  5GQQ C;  2JUL A;  2H61 A;  4ORA B;  1OQP A;  3EVV A;  5FI2 A;  5JOL A;  1QLS A;  2CCM A;  1K94 A;  1ZOT B;  2QEO A;  2MLF C;  4F0Z B;  1G8I A;  1K9P A;  1XFX O;  3SS5 A;  1Y1A A;  3SG4 A;  1XFY O;  1XYD A;  2LVV A;  2SCP A;  5I2O A;  4DS7 A;  3WXA A;  1ZUZ A;  2ZRS A;  1TNP A;  4ETO A;  1DEL A;  1QTX A;  1QV0 A;  4OZD A;  3VRO A;  1A03 A;  3GK1 A;  2KGB C;  2I2R E;  2BCA A;  3VRQ A;  3RLZ A;  1DGU A;  5JJG A;  1B8R A;  4M2O A;  1XFZ O;  3CR5 X;  1KQV A;  1WLZ A;  2F2P A;  4OVN F;  2KBI A;  3A8R A;  1C3Z A;  1BOC A;  1NCZ A;  5FI7 A;  5I2L A;  4CFQ A;  1LIN A;  1UHK A;  2LVI A;  2LUX A;  5B8I B;  4CID A;  1MHO A;  1KQM C;  1TIZ A;  4FQO A;  4YGE B;  4C0K A;  1NX2 A;  1CDM A;  1ZMZ A;  3GOF A;  3V2L A;  3FWC A;  1B7T Y;  2A4J A;  1NP8 A;  2PQL A;  2M97 A;  3CS1 A;  1Y1U A;  2BBM A;  2HPS A;  2PMY A;  3O4Y A;  1NX0 A;  3BUW B;  1NWD A;  1PVB A;  3TS5 B;  4USL A;  1TOP A;  2KI6 C;  2KQ6 A;  2LE9 B;  2JT0 A;  2L4I A;  1RJV A;  2JZI A;  2QEB A;  2ZRT A;  4YI9 A;  1SL7 A;  1Y6W A;  1A75 B;  2RGI A;  3LLE A;  1QWV A;  1VRK A;  3IVT A;  3D10 A;  3PAL A;  1DTL A;  1JC2 A;  4D1E A;  3EK8 A;  3O6B A;  2LAP A;  3LK0 A;  1MUX A;  3CAB A;  1CMF A;  1YRU B;  3I5I B;  2YGU A;  2PAS A;  4E68 A;  1BT6 A;  2BCX A;  4NDB A;  1CNP A;  3AKB A;  2F8P A;  1KK7 Z;  1YUT A;  4GGF A;  1IJ5 A;  3FS7 A;  4GNK B;  3CR2 A;  4ZCV A;  3CLN A;  1QV1 A;  1W7I B;  5FI6 A;  1OOJ A;  1RFJ A;  4I5J A;  1ZFS A;  2WOR A;  3FIA A;  3BFH A;  1OOI X;  5D7F A;  5ER5 A;  1JSA A;  4ICB A;  1BLQ A;  3I5F B;  4I5N B;  1SK6 D;  4JPZ B;  4MLW A;  1WY9 A;  1XK4 A;  3PAT A;  1OOG A;  1EL4 A;  2KNE A;  2PAL A;  5KTY A;  3SS4 A;  1GGZ A;  1AHR A;  2KI4 B;  2L5X B;  1DJH A;  1S6J A;  3I5G B;  2JQ6 A;  1QX7 A;  3K1E A;  3UNW A;  4GGN A;  1YTZ C;  3I5H B;  1TNQ A;  3CZ2 A;  3JTD B;  1AJ5 A;  1ALV A;  2NCO A;  2GV5 A;  2ISD A;  1CFD A;  2KLD A;  3JVT C;  3BUO B;  3SIA A;  1OMV A;  1NIW A;  3R72 A;  3KPX A;  3WHU B;  1QVI Y;  5HKW A;  4C0J A;  5CSN A;  1CLL A;  2HQW A;  4OR9 B;  3IF7 A;  2K7O A;  3R1V A;  1S1E A;  1M46 A;  5AFP A;  2OS8 C;  1J55 A;  3N7H A;  1SL8 A;  1CDP A;  2KGR A;  1SR6 C;  5KU1 A;  1A2X A;  2LVJ A;  3PN7 C;  3BJH A;  1B9A A;  1EG3 A;  2R2I A;  2LLT A;  2BKH B;  1IQ5 A;  2CBL A;  1F4Q A;  1SMG A;  1A4P A;  1NCY A;  1ALW A;  1RTP 1;  3CWG A;  3NSO A;  4MRY A;  1QAS A;  3HX4 A;  4INX A;  3SG7 A;  4MSP A;  1YUS A;  1EH2 A;  2MRD A;  2ZKM X;  3B7A A;  1YUU A;  1S5G Y;  1PAL A;  1K9U A;  1K8U A;  2G9B A;  3DYE A;  2K2A A;  1CLB A;  3DXL A;  2SAS A;  4AOM A;  1RRO A;  2M1U A;  2F3Y A;  1S36 A;  2M8U A;  4AQJ A;  1EXR A;  1MXE A;  4WRI A;  1DVI A;  2QEV A;  2BL0 B;  2D8N A;  2KQY A;  1DGV A;  2JNX A;  4A4B A;  4PDZ A;  2GGZ A;  2ZN8 A;  1PRW A;  1DJG A;  4N1G A;  3D0Y A;  5AEQ A;  1G33 A;  3WHT B;  3WNX B;  4CPV A;  2GGM A;  1C07 A;  1QIW A;  2K60 A;  1Z4H A;  1SPY A;  4MN0 A;  4MZJ A;  1SKT A;  2KLE A;  4NDC A;  2F2O A;  2KYF A;  2L2C A;  4A4C A;  3B88 A;  1SCM C;  5AXI A;  1RWY A;  1S5G Z;  1L2O B;  1C3Y A;  1SY9 A;  3LCP C;  1OZS A;  4PCW A;  1IIO A;  3UO9 A;  1PSR A;  3CDN A;  1OOF A;  3VRR A;  2BNX A;  3D77 A;  1A29 A;  1CB1 A;  4JWQ A;  5F6T A;  1DF0 A;  1BU3 A;  1DJZ A;  2K7B A;  3SG3 A;  2WCL A;  1KFX S;  1KFX L;  1YR5 A;  1AVS A;  3LL8 B;  4ZCU A;  2LHL A;  3BOW A;  3TZ1 A;  3BYA A;  4YGB B;  2K0J A;  1YX8 A;  3AAJ A;  3EKH A;  2KSP A;  4N1F A;  2KDH A;  1FBV A;  4Q04 A;  5G08 A;  1JWD A;  3EK7 A;  3PM2 A;  1XFU O;  1CDN A;  3OB1 B;  1KWO B;  1K96 A;  2WCE A;  3DVE A;  4YI8 A;  1UHH A;  2Y4Q A;  1S3P A;  2LHI A;  1QS7 A;  4DCK A;  2K7D A;  2Q91 A;  2BAP A;  2HQ8 A;  3NHI A;  1CFP A;  1YVH A;  1NPQ A;  2JPO A;  1KK7 Y;  2MBX A;  5KSZ A;  2E30 A;  1SNL A;  1CTR A;  1Y1X A;  3GK4 X;  3DF0 B;  3PLF B;  2LP2 A;  1GGW A;  3D73 A;  2QPT A;  4XJK A;  3TDI A;  4GBA A;  3TS5 C;  4IL1 A;  2BE6 A;  2M9G A;  1CKK A;  2CNP A;  2NLN A;  3ICB A;  1CFC A;  1K95 A;  2QEH A;  2F33 A;  1F71 A;  1B8L A;  3L47 A;  1N2D A;  3LK1 A;  3FWB A;  1V1F A; 
#chains in the Genus database with same CATH homology
 2LVK A;  1UWO A;  1B4C A;  3TDZ A;  1KSM A;  3K21 A;  4N5X A;  5K89 A;  1CFF A;  2MHH A;  1QLK A;  1IJ6 A;  5HLO A;  5HKZ A;  1XFV O;  2BKI B;  2LUC A;  3I5I C;  3KF9 A;  1CDL A;  1H4B A;  5CPV A;  1TNW A;  2LNK A;  3OHM B;  4PHJ A;  5PAL A;  1U5I A;  5ER4 X;  5D69 A;  2E6W A;  1FPW A;  4PE1 A;  1CM4 A;  5DKN A;  1CM1 A;  2ZN9 A;  2KI6 D;  1N0Y A;  1RK9 A;  1DF0 B;  1SBJ A;  1J7R A;  1J7O A;  1NX1 A;  3AAK A;  1MF8 B;  2M7N A;  5DKQ A;  1JBA A;  1XO5 A;  1OZO A;  4NQG A;  4OCI A;  4C0L A;  4BY4 A;  1IH0 A;  2CXJ A;  2K7C A;  1OSA A;  2K61 A;  2Q4U A;  3I5F C;  2LMU A;  2H2K A;  2BCB A;  1QX5 B;  4MZK A;  3DVK A;  1M31 A;  2CTN A;  3VGO A;  1IKU A;  1SL9 A;  2KI4 C;  3EK4 A;  1UHN A;  3NSI A;  2COL B;  4PHK A;  5I8N A;  1DJY A;  2WCB A;  3I5G C;  2ZNE A;  4YBH B;  2JRF A;  3NXA A;  1KFU S;  1KFU L;  2JXC A;  3I5H C;  3JTD C;  1F4O A;  4OKH A;  3BUM B;  1UP5 A;  1LA3 A;  1F54 A;  1WRL A;  2OTG B;  1EG4 A;  1PSB A;  3CR4 X;  2M7L A;  1XA5 A;  2LMV A;  1H8B A;  3CGA A;  2JU0 A;  4M2P A;  4AQI A;  2AUC A;  4GFT A;  1B47 A;  4DIR A;  2HET A;  2Y1N A;  5HKY A;  4XJK B;  3TUY B;  3DVJ A;  1C7W A;  1AJ4 A;  4WQ3 A;  1S6C A;  1D1O A;  2Y5I A;  4PAL A;  3KEV A;  3VRP A;  1KK8 B;  1JFJ A;  1DJW A;  4I5L B;  1MWN A;  2I7A A;  3SG6 A;  2KBM A;  3F45 A;  2KAY A;  1TNX A;  1PVA A;  3OB2 B;  2AAO A;  3E3R A;  5AAN A;  4CFR A;  4YGD B;  4PHN A;  2WOS A;  1IQ3 A;  2NXQ A;  1WDC B;  3ZWH A;  2BL0 C;  1QAT A;  1R6P A;  2EC6 B;  2I94 A;  3EKJ A;  1Q80 A;  1NCX A;  2LCP A;  3BUX B;  5FYX A;  1FI6 A;  4ORB B;  2KFG A;  1PUL A;  4YGA A;  2ZFD A;  1QIV A;  2JT8 A;  1L2O C;  1BJF A;  1UUS A;  1K2H A;  1MR8 A;  2AMI A;  2JPT A;  3RM1 A;  3BXK A;  2F3Z A;  4YRU A;  1R2U A;  1XFW O;  1ZAC A;  2WCF A;  2EHB A;  2L98 A;  4MEW A;  1OMD A;  1F55 A;  1AUI B;  1CLM A;  1TCO B;  3IQO A;  4CLN A;  1SYM A;  2KFH A;  4JQ0 D;  2G2B A;  3AKA A;  4QJ4 B;  2FCD A;  2FJU B;  5I2Q A;  1M63 B;  4U8D A;  1F70 A;  4MVF A;  3SJS A;  2NZ0 A;  3KO0 A;  3CZT X;  1N65 A;  2PVB A;  3M0W A;  4OV2 A;  1TTX A;  4WQ2 A;  1J1D A;  5CSF A;  3OX6 A;  1SCV A;  1J7P A;  3O2P A;  4HSZ A;  2M0R A;  5CSI A;  1DJX A;  1SW8 A;  2IS9 A;  4P5O E;  1KQM B;  1KWO C;  1GQM A;  1YUR A;  1B1G A;  1BOD A;  2JTZ A;  2K2F A;  2V53 A;  2M1K B;  1REC A;  3SIB A;  2MJW B;  2NCP A;  2FOT A;  2L4H A;  2LP3 A;  1M45 A;  1PK0 D;  1J7Q A;  1BMO A;  4PE7 A;  1IWQ A;  1TN4 A;  2B1U A;  1E8A A;  2L51 A;  2KFF A;  3HCM A;  2LC5 A;  1L7Z A;  3D0Y B;  1V1G A;  4DRW A;  1MXL C;  3VRN A;  1NSH A;  1FI5 A;  2K8M B;  5DKR A;  1TRF A;  1HQV A;  2JC2 A;  3QRX A;  4I5K A;  3PM8 A;  2JTT A;  4GPL B;  1JF2 A;  1SRA A;  1K9K A;  1JF0 A;  1IGV A;  3PSR A;  2I18 A;  1BG1 A;  1NYA A;  2PSR A;  4QJ5 B;  2BBN A;  1HT9 A;  2H61 C;  1K90 D;  1DJI A;  1QXP A;  3EVR A;  5TNC A;  4BY5 A;  4UPG A;  2P6B B;  1J1E A;  1JFK A;  4HRH A;  4PE4 A;  4ORC B;  2Y1M A;  4MRX A;  2O60 A;  1B7T Z;  4FTG A;  1BF5 A;  1CMG A;  1FF1 A;  5AER A;  1LXF C;  5HLV A;  1S26 D;  2PRU A;  5HYD A;  3BOW B;  1YRT B;  1XVJ A;  2VRG A;  4HRE E;  4PE0 A;  2TN4 A;  2WC8 A;  1WRK A;  4M2Q A;  1OE9 B;  2LAN A;  2JWW A;  3PFV A;  3DD4 A;  2L0P A;  4XYN A;  4YGC B;  1JUO A;  1KSO A;  1NX3 A;  1QJT A;  5CSJ A;  1DMO A;  1X02 A;  3A4U B;  1K93 D;  2JXL A;  1BR1 B;  1FW4 A;  1KCY A;  2LLS A;  3GK2 A;  1EJ3 A;  2O5G A;  3JVT B;  1C7V A;  3SG2 A;  1M39 A;  2L50 A;  1B8C A;  4DUQ A;  4QJ3 B;  3ZNI A;  2LM5 A;  3BQ3 A;  1UUR A;  2JNF A;  1UHI A;  1S6I A;  4L9M A;  2BEC A;  2MAZ A;  2LV7 A;  2OS8 B;  2QAC A;  2OTG C;  3SG5 A;  1ODB A;  5IBW A;  1BR4 B;  3TDU A;  1SR6 B;  4MBE A;  1TCF A;  3PN7 B;  4R1E A;  3BUN B;  1AP4 A;  3H4S E;  1GJY A;  2BE4 A;  2JT3 A;  2HF5 A;  2CT9 A;  2KYC A;  1IG5 A;  2OPO A;  2M49 B;  3OX5 A;  3TUY C;  2L2E A;  1WLM A;  1MQ1 A;  2LLU A;  3CTN A;  1Y0V H;  1YVL A;  1G4Y R;  1KK8 C;  1LA0 A;  3EVU A;  2KHN A;  4TNC A;  2KAX A;  4GAO A;  3MSE B;  4PHM A;  1IRJ A;  3OP0 A;  3DVM A;  4NDD A;  1LKJ A;  2ZND A;  3NSK A;  2M3W A;  2KAV A;  3NSL A;  4GUK A;  1LVC D;  3DF0 A;  1U5I B;  2FCE A;  2MA2 A;  1A75 A;  1OMR A;  4GGF C;  1QVI Z;  1W7J B;  2LMT A;  2DOQ A;  2KOT A;  5BPJ A;  4HRG A;  1WRZ A;  1AK8 A;  2MLE C;  1WDC C;  1F8H A;  3C1V A;  1DT7 B;  3KHE A;  1SCM B;  4MZL A;  2EC6 C;  5J3X A;  3O78 A;  4P2Y B;  1UHJ A;  2EGD A;  2WND A;  1QX2 A;  1NUB A;  1XK4 C;  2JOJ A;  3IQQ A;  5GQQ C;  1YX7 A;  2M29 A;  3SG3 A;  2JUL A;  2H61 A;  4ORA B;  1OQP A;  3EVV A;  5JOL A;  1QLS A;  2CCM A;  1K94 A;  1ZOT B;  2MLF C;  4F0Z B;  1G8I A;  1K9P A;  1XFX O;  1Y1A A;  3SG4 A;  1XFY O;  1XYD A;  2LVV A;  2SCP A;  5I2O A;  4DS7 A;  3WXA A;  1ZUZ A;  2ZRS A;  1TNP A;  4ETO A;  1QTX A;  1QV0 A;  3VRO A;  1A03 A;  3GK1 A;  2KGB C;  2I2R E;  2BCA A;  3VRQ A;  3RLZ A;  1DGU A;  5JJG A;  1B8R A;  4M2O A;  1XFZ O;  3CR5 X;  1KQV A;  1WLZ A;  2F2P A;  4OVN F;  2KBI A;  3A8R A;  1BOC A;  1NCZ A;  5I2L A;  4CFQ A;  1LIN A;  1UHK A;  2LVI A;  2LUX A;  5B8I B;  4CID A;  1MHO A;  1KQM C;  1TIZ A;  4FQO A;  4YGE B;  4C0K A;  1NX2 A;  1CDM A;  1ZMZ A;  3GOF A;  3FWC A;  1B7T Y;  2A4J A;  1NP8 A;  2M97 A;  3CS1 A;  1Y1U A;  2BBM A;  2HPS A;  2PMY A;  3O4Y A;  1NX0 A;  3BUW B;  1NWD A;  1PVB A;  3TS5 B;  4USL A;  1TOP A;  2KI6 C;  2KQ6 A;  2LE9 B;  2JT0 A;  2L4I A;  1RJV A;  2JZI A;  2ZRT A;  4YI9 A;  1SL7 A;  1Y6W A;  1A75 B;  2RGI A;  3LLE A;  1VRK A;  3D10 A;  3PAL A;  1DTL A;  1JC2 A;  4D1E A;  3EK8 A;  3O6B A;  2LAP A;  3LK0 A;  1MUX A;  1CMF A;  1YRU B;  3I5I B;  2PAS A;  4E68 A;  1BT6 A;  2BCX A;  4NDB A;  1CNP A;  3AKB A;  2F8P A;  1KK7 Z;  1YUT A;  4GGF A;  1IJ5 A;  3FS7 A;  4GNK B;  3CR2 A;  4ZCV A;  3CLN A;  1QV1 A;  1W7I B;  1OOJ A;  1RFJ A;  4I5J A;  1ZFS A;  2WOR A;  3FIA A;  5ER5 A;  5D7F A;  1JSA A;  4ICB A;  1BLQ A;  3I5F B;  4I5N B;  1SK6 D;  4JPZ B;  4MLW A;  1WY9 A;  1XK4 A;  3PAT A;  1EL4 A;  2KNE A;  2PAL A;  5KTY A;  1GGZ A;  1AHR A;  2KI4 B;  2L5X B;  1DJH A;  1S6J A;  3I5G B;  2JQ6 A;  1QX7 A;  4GGN A;  1YTZ C;  3I5H B;  1TNQ A;  3JTD B;  1AJ5 A;  1ALV A;  2NCO A;  2GV5 A;  2ISD A;  1CFD A;  3JVT C;  3BUO B;  3SIA A;  1OMV A;  1NIW A;  3WHU B;  3KPX A;  1QVI Y;  5HKW A;  4C0J A;  5CSN A;  1CLL A;  2HQW A;  4OR9 B;  3IF7 A;  2K7O A;  1S1E A;  1M46 A;  5AFP A;  2OS8 C;  1J55 A;  1SL8 A;  1CDP A;  2KGR A;  1SR6 C;  5KU1 A;  1A2X A;  2LVJ A;  3PN7 C;  1B9A A;  1EG3 A;  2R2I A;  2LLT A;  2BKH B;  1IQ5 A;  2CBL A;  1F4Q A;  1SMG A;  1A4P A;  1NCY A;  1ALW A;  1RTP 1;  3CWG A;  3NSO A;  4MRY A;  1QAS A;  3HX4 A;  3SG7 A;  1EH2 A;  4MSP A;  1YUS A;  2MRD A;  2ZKM X;  1YUU A;  1S5G Y;  1PAL A;  1K9U A;  1K8U A;  2G9B A;  2K2A A;  1CLB A;  2SAS A;  4AOM A;  1RRO A;  2M1U A;  2F3Y A;  1S36 A;  2M8U A;  4AQJ A;  1EXR A;  1MXE A;  4WRI A;  1DVI A;  2BL0 B;  2D8N A;  2KQY A;  1DGV A;  2JNX A;  4A4B A;  4PDZ A;  2GGZ A;  2ZN8 A;  1PRW A;  1DJG A;  4N1G A;  3D0Y A;  5AEQ A;  1G33 A;  3WHT B;  3WNX B;  4CPV A;  2GGM A;  1C07 A;  1QIW A;  4MN0 A;  1SPY A;  4MZJ A;  1SKT A;  4NDC A;  2F2O A;  2KYF A;  4A4C A;  1SCM C;  5AXI A;  1RWY A;  1S5G Z;  1L2O B;  1SY9 A;  3LCP C;  1OZS A;  4PCW A;  1PSR A;  3VRR A;  1A29 A;  1CB1 A;  4JWQ A;  5F6T A;  1DF0 A;  1BU3 A;  1DJZ A;  2K7B A;  1KFX S;  1KFX L;  1YR5 A;  1AVS A;  3LL8 B;  4ZCU A;  2LHL A;  3BOW A;  3TZ1 A;  3BYA A;  4YGB B;  2K0J A;  1YX8 A;  3AAJ A;  3EKH A;  2KSP A;  4N1F A;  2KDH A;  1FBV A;  4Q04 A;  5G08 A;  1JWD A;  3EK7 A;  1XFU O;  1CDN A;  3OB1 B;  1KWO B;  1K96 A;  2WCE A;  3DVE A;  4YI8 A;  1UHH A;  2Y4Q A;  1S3P A;  2LHI A;  1QS7 A;  4DCK A;  2K7D A;  2Q91 A;  2HQ8 A;  1CFP A;  1YVH A;  1NPQ A;  1KK7 Y;  2MBX A;  5KSZ A;  2E30 A;  1SNL A;  1CTR A;  1Y1X A;  3GK4 X;  3DF0 B;  3PLF B;  2LP2 A;  1GGW A;  2QPT A;  4XJK A;  3TDI A;  4GBA A;  3TS5 C;  4IL1 A;  2BE6 A;  2M9G A;  1CKK A;  2CNP A;  2NLN A;  3ICB A;  1CFC A;  1K95 A;  2F33 A;  1F71 A;  1B8L A;  1N2D A;  3LK1 A;  3FWB A;  1V1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...