1KCYA

Nmr solution structure of apo calbindin d9k (f36g + p43m mutant)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEGPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calbindin D9k
publication title The EF-hand domain: a globally cooperative structural unit.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 25
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kcyA00
1V1GA 3LL8B 2ZKMX 1F55A 3WNXB 2WORA 1QLKA 5AEQA 1KFXS 2LCPA 1DJWA 1NCXA 1DJYA 1AHRA 1WLMA 5ER5A 4AQIA 1B7TZ 5KU1A 1YX8A 3I5IC 4GBAA 2BBNA 1JBAA 2I2RE 2KYFA 4YRUA 1SK6D 5HLOA 4PHMA 1ZACA 3BUXB 5PALA 1SCVA 1K2HA 1XFUO 2HETA 2COLB 2LE9B 1OMDA 4C0JA 4I5JA 4MSPA 1DJGA 4PHNA 3I5IB 2G9BA 3LLEA 4YGBB 1DGVA 5IBWA 1BR4B 1IGVA 3GK2A 1MQ1A 1QLSA 1IQ5A 2GGZA 1F4OA 2OTGC 4PE7A 1CFCA 4NDCA 1RWYA 2MRDA 2JT0A 4DUQA 2MAZA 5CSIA 2CBLA 4GGFA 4P2YB 1SYMA 1XVJA 1KFXL 1RFJA 1HT9A 1YUSA 1A4PA 1ZFSA 2JOJA 4XYNA 1CKKA 4XJKB 1TNPA 1Y6WA 1QX5B 2OTGB 1B1GA 1W7IB 2SCPA 2JTZA 5FYXA 1K9KA 3HX4A 3D10A 1Y1AA 1DF0A 2KI6C 4F0ZB 1PRWA 3PFVA 2ZN9A 1SCMB 4ORAB 5DKQA 2HQ8A 4ZCVA 5J3XA 1B8RA 2Q4UA 1B8CA 3C1VA 1N2DA 2PSRA 4PE1A 3LK0A 4HREE 1FW4A 2ZNDA 2LVIA 2K7OA 2EHBA 1UHIA 4YI8A 1WRLA 1EG4A 1QX7A 2LC5A 4D1EA 3I5GC 3NXAA 1M31A 1CM4A 1S5GZ 2BBMA 4FQOA 1BJFA 3BXKA 2LNKA 3DVKA 3SG7A 1RK9A 2O5GA 1XK4C 2OPOA 2TN4A 1YUTA 3BOWA 3FIAA 1DJIA 4YGCB 1KQMB 3TUYC 3I5FC 2PMYA 3A4UB 2KHNA 3I5GB 3OX5A 4E68A 1MHOA 3D0YA 1U5IA 3EVUA 1FPWA 4CLNA 1J7PA 1UWOA 2WCEA 2KQ6A 3TUYB 3I5FB 2K0JA 4YGDB 3ZNIA 1K8UA 2NLNA 3EVVA 1KK8C 2AMIA 3EK7A 4OCIA 2JNXA 3PN7C 2KFGA 3RM1A 2DOQA 2F33A 2HPSA 1CLLA 2LLTA 4AOMA 4CFQA 1CM1A 1QX2A 1XA5A 3PN7B 4FTGA 2KQYA 2K7CA 3NSKA 2ZRSA 3IQOA 1UUSA 1QIWA 1IWQA 4PE4A 1YRTB 2F3ZA 4QJ5B 2M7LA 1NP8A 1OZOA 2JT8A 1A03A 1LINA 4PHKA 5GQQC 2ISDA 4BY5A 4C0KA 4DRWA 5KSZA 2JXCA 1S6CA 3BQ3A 2KI6D 2KAVA 1FI5A 3O2PA 1C07A 4WQ3A 2JT3A 1LKJA 4AQJA 1PSBA 1TCOB 4MBEA 1BG1A 2BCAA 1QJTA 1XO5A 2V53A 4PE0A 1SY9A 2LP3A 3IQQA 1TCFA 1UHNA 1MXLC 1JFKA 1Y1UA 4GNKB 2LAPA 4WQ2A 2K7DA 2KBMA 1WDCB 2EGDA 3SJSA 1BR1B 5I2OA 1YTZC 2KI4C 2JWWA 1A75A 1AUIB 5B8IB 1CMFA 4GGNA 1IG5A 3EVRA 5I2LA 1BT6A 1S26D 1KSOA 2KI4B 2K7BA 5CSFA 2H2KA 3VGOA 1CNPA 3DVJA 3SG5A 3AAKA 1MR8A 2MLEC 4M2QA 1QATA 3DVMA 2F3YA 1EJ3A 3SG3A 1BU3A 1J1EA 1G4YR 4ORCB 3CLNA 1UHJA 1DJXA 2M0RA 1KFUL 2CT9A 3M0WA 2L2EA 4MLWA 1GGZA 5TNCA 5AANA 1ZOTB 1F8HA 3PALA 3CWGA 2CNPA 1Y0VH 4DS7A 1G33A 2GV5A 2MHHA 3BOWB 2LHIA 2Y1MA 4ORBB 4GFTA 3OP0A 3BUNB 1CDPA 2VRGA 2BKHB 1FBVA 1E8AA 3DF0B 1JC2A 1NIWA 1OMRA 1SCMC 2M1UA 1SL7A 1XFWO 1IH0A 1PVBA 2WCFA 1TIZA 1PSRA 1C7VA 3WXAA 2LVVA 1CLBA 2MLFC 2R2IA 2K2AA 5AERA 2K2FA 4L9MA 3VROA 2KFHA 1PALA 2M49B 3EKJA 4ZCUA 1M63B 2ZRTA 1BF5A 2CXJA 2KGBC 3EKHA 4MZLA 1LVCD 3VRQA 2WOSA 1AK8A 4JPZB 1L7ZA 2P6BB 1LA0A 3TS5C 2KSPA 4N1GA 4IL1A 1KQMC 2BCBA 1WY9A 3PM8A 1H4BA 4ICBA 1PK0D 2H61C 3FWCA 1HQVA 2E30A 2KDHA 1OE9B 3TS5B 2Q91A 1DJZA 2QPTA 4MRXA 3OHMB 4YGEB 1MF8B 1R6PA 5CSJA 1NCYA 1UHHA 1RJVA 2KOTA 4MZJA 1JF2A 2L50A 3CTNA 1WRKA 2JC2A 2F2PA 1RECA 4GPLB 5JJGA 2QACA 3BUOB 1CB1A 1NYAA 5D69A 1A29A 1UP5A 3SG2A 4NDBA 4PHJA 2KGRA 3JTDC 5AFPA 4NQGA 1S6JA 2PVBA 4N1FA 3RLZA 2WNDA 1IKUA 1GGWA 2LMUA 4NDDA 3O4YA 2IS9A 4GAOA 1NCZA 1YX7A 1YR5A 1QVIY 1JF0A 1K96A 3KPXA 2LMTA 3JTDB 2AAOA 1IJ6A 5HKWA 4XJKA 2JULA 3GK4X 4I5KA 2PRUA 1YVLA 2KNEA 1QV1A 4Q04A 2M3WA 2Y5IA 2JNFA 2NXQA 4CIDA 1J55A 2NZ0A 3FWBA 1NX3A 4HRGA 1IJ5A 1SNLA 1QASA 4YGAA 1MUXA 1WDCC 3KEVA 4DCKA 1CMGA 1ODBA 2L4IA 3TDUA 1XFYO 1KFUS 4GGFC 4MEWA 4A4BA 1XFVO 4WRIA 3TZ1A 3IF7A 1SKTA 1UHKA 3TDIA 5BPJA 1C7WA 5JOLA 4DIRA 2PALA 5AXIA 1F70A 1NX0A 2L98A 4MRYA 1CTRA 2M1KB 4OKHA 4TNCA 1G8IA 1K90D 4PDZA 4ETOA 3FS7A 1K94A 2M29A 3A8RA 1KQVA 1M45A 1QIVA 2LHLA 1S3PA 2M9GA 2LUCA 1AVSA 1CDLA 1DF0B 3CS1A 1OMVA 5HKYA 4YI9A 1OSAA 3ICBA 4PALA 5F6TA 1TN4A 1KK7Y 4YBHB 3CR2A 1A2XA 1SRAA 1XFZO 1NSHA 2CCMA 2SASA 1F54A 1DMOA 3SIBA 1DVIA 3O78A 1KWOC 1OQPA 1S1EA 2JPTA 3K21A 4I5NB 2I94A 4QJ3B 3OX6A 1BOCA 1D1OA 2Y4QA 1AJ5A 1CFPA 1BMOA 1SL8A 2L5XB 4JQ0D 1QXPA 4MZKA 1KWOB 3BYAA 3VRNA 3SG6A 1F71A 1SPYA 1BODA 1EL4A 4A4CA 1B7TY 3VRPA 1N65A 1RTP1 3CR5X 4BY4A 2FJUB 2ZN8A 3D0YB 3CZTX 2G2BA 1U5IB 2MA2A 2B1UA 2ZNEA 1SL9A 3OB2B 1B4CA 2JRFA 2JTTA 5I8NA 1LXFC 2JXLA 1XYDA 2BE6A 1FF1A 2EC6C 3H4SE 3MSEB 1ZUZA 1QV0A 1IRJA 1QS7A 1QTXA 2LP2A 3CGAA 3CR4X 1XFXO 2BE4A 4MVFA 2BL0C 1EH2A 3PATA 2M97A 4OV2A 2EC6B 1FI6A 2Y1NA 1DJHA 1YURA 3GK1A 1L2OC 3AAJA 2PASA 1TTXA 2MBXA 1ZMZA 1B47A 2BL0B 2D8NA 2JZIA 2LVJA 1SMGA 1SR6C 1LA3A 1IQ3A 3KO0A 3BUMB 2BCXA 1TRFA 1DTLA 3F45A 5G08A 1L2OB 4CFRA 2BECA 3WHUB 5CSNA 2L0PA 1EXRA 1AJ4A 1YRUB 2LLUA 1SR6B 3DVEA 1MWNA 1YUUA 1JUOA 2K8MB 5ER4X 4MN0A 2GGMA 2BKIB 4QJ4B 1RROA 1N0YA 4OVNF 1S5GY 2ZFDA 1YVHA 2M8UA 2HF5A 1K9PA 3LCPC 2KYCA 1NWDA 2FCEA 2M7NA 1TOPA 4P5OE 1A75B 4JWQA 3OB1B 1B9AA 3KHEA 1B8LA 1CLMA 3AKBA 1K93D 4R1EA 2LV7A 1X02A 1K95A 2JU0A 4USLA 3TDZA 3DF0A 1NUBA 1Y1XA 1OZSA 5HYDA 1JFJA 1F4QA 1WLZA 1QVIZ 2L51A 1M46A 2LVKA 4M2PA 3NSLA 3VRRA 5K89A 4UPGA 1BLQA 1VRKA 1S36A 2E6WA 2LLSA 1MXEA 3EK8A 1SBJA 2LMVA 2I7AA 2F8PA 1CFDA 5D7FA 4N5XA 3JVTC 3ZWHA 1TNQA 1OOJA 1J7QA 4I5LB 2LUXA 1KSMA 1NX1A 2I18A 1KK8B 3PSRA 2K61A 5CPVA 1H8BA 4HSZA 1TNWA 1CDNA 3LK1A 3KF9A 1ALVA 3NSOA 2HQWA 1AP4A 2KBIA 3JVTB 4U8DA 5DKRA 1S6IA 2KFFA 1EG3A 2LANA 2MJWB 1CFFA 2WC8A 2O60A 3AKAA 1KCYA 5HKZA 2FOTA 2NCPA 2RGIA 1WRZA 2OS8C 3NSIA 1JWDA 1UURA 1J1DA 1J7OA 4PCWA 3I5HC 3PLFB 2F2OA 3SIAA 1Q80A 1SW8A 5HLVA 4M2OA 3DD4A 1JSAA 3GOFA 2H61A 1K9UA 2CTNA 4C0LA 2JQ6A 4GUKA 5DKNA 5KTYA 1XK4A 2WCBA 1NPQA 2OS8B 4OR9B 2FCDA 3I5HB 1GQMA 1M39A 1DGUA 1KK7Z 3E3RA 4HRHA 5I2QA 1J7RA 1GJYA 1TNXA 2KAXA 1PVAA 1V1FA 3BUWB 1CDMA 3HCMA 3SG4A 1PULA 2LM5A 3O6BA 3EK4A 2NCOA 1W7JB 2A4JA 1NX2A 3QRXA 4CPVA 3WHTB 1ALWA 2KAYA 2AUCA 1R2UA 1DT7B 2L4HA
chains in the Genus database with same CATH superfamily
1V1GA 2WCHA 3LL8B 2ZKMX 1F55A 3WNXB 2WORA 1QLKA 5AEQA 1KFXS 4INWA 2LCPA 1DJWA 1C3ZA 1NCXA 3CZ1A 1DJYA 1AHRA 1WLMA 5ER5A 4AQIA 1B7TZ 5KU1A 3NGVA 1YX8A 3I5IC 4GBAA 2BBNA 1JBAA 1W9ZA 2I2RE 2KYFA 4YRUA 1SK6D 5HLOA 1LS8A 4PHMA 1ZACA 3BUXB 5PALA 1DC1A 1SCVA 1K2HA 1XFUO 2HETA 2COLB 2LE9B 1OMDA 4C0JA 4I5JA 4MSPA 1DJGA 4PHNA 3I5IB 2G9BA 3LLEA 4YGBB 1DGVA 2PYQA 5IBWA 1BR4B 1IGVA 3GK2A 1MQ1A 1QLSA 1IQ5A 2GGZA 1F4OA 2OTGC 4PE7A 1CFCA 4NDCA 1RWYA 2MRDA 2JT0A 4DUQA 2MAZA 5CSIA 2CBLA 4GGFA 4P2YB 1SYMA 1XVJA 1KFXL 1RFJA 1HT9A 1YUSA 1A4PA 1ZFSA 2JOJA 4XYNA 3PJIA 1CKKA 4XJKB 1TNPA 1Y6WA 1QX5B 2OTGB 1B1GA 1W7IB 2SCPA 2JTZA 5FYXA 1K9KA 3HX4A 3D10A 1Y1AA 3DXLA 1DF0A 3R1OA 2KI6C 4F0ZB 1PRWA 3PFVA 2ZN9A 1SCMB 4ORAB 5DKQA 2HQ8A 4ZCVA 5J3XA 1OW4A 1B8RA 2Q4UA 1B8CA 3C1VA 1N2DA 2PSRA 4PE1A 3LK0A 2H8VA 4HREE 1FW4A 2ZNDA 2LVIA 2K7OA 2EHBA 1UHIA 4YI8A 1WRLA 4JD9A 1EG4A 1QX7A 2LC5A 1QWVA 4D1EA 3I5GC 3NXAA 1M31A 1CM4A 1S5GZ 2BBMA 4FQOA 1BJFA 3BXKA 2LNKA 5FI2A 3DVKA 3SG7A 1RK9A 2O5GA 1XK4C 2OPOA 2TN4A 1YUTA 3BOWA 3FIAA 1DJIA 4YGCB 1KQMB 3TUYC 3I5FC 2PMYA 3A4UB 2KHNA 3I5GB 1SSEB 3OX5A 5I94A 4E68A 1MHOA 3D0YA 1U5IA 3EVUA 1FPWA 4CLNA 1J7PA 1UWOA 2WCEA 2KQ6A 3TUYB 3I5FB 2K0JA 4YGDB 3ZNIA 1K8UA 2NLNA 3EVVA 1KK8C 2AMIA 3D77A 3EK7A 2JNXA 4OCIA 1TUJA 3PN7C 2KFGA 3RM1A 2DOQA 2F33A 2HPSA 1CLLA 2LLTA 4AOMA 4CFQA 1CM1A 3BFHA 1QX2A 1XA5A 3PN7B 4FTGA 2KQYA 3K1EA 2K7CA 3NSKA 1T14A 2ZRSA 3IQOA 1UUSA 1QIWA 1IWQA 3SS4A 4PE4A 1YRTB 2F3ZA 4QJ5B 2M7LA 1NP8A 1OZOA 2JT8A 1A03A 1LINA 4PHKA 5GQQC 2ISDA 3UNWA 4BY5A 4C0KA 4DRWA 5KSZA 1Z2CB 2JXCA 5D3OA 1S6CA 3BQ3A 2KI6D 2KAVA 1FI5A 3L47A 3V2LA 3O2PA 1C07A 4WQ3A 2JT3A 1LKJA 4AQJA 1PSBA 1TCOB 4MBEA 1BG1A 2BCAA 1QJTA 1XO5A 2V53A 4PE0A 1SY9A 2LP3A 3IQQA 1TCFA 1UHNA 1MXLC 1JFKA 1Y1UA 3DY9A 4GNKB 2LAPA 3D75A 4WQ2A 2K7DA 2KBMA 1WDCB 2EGDA 3SJSA 1BR1B 5I2OA 1YTZC 2KI4C 2JWWA 1A75A 3Q8IA 1AUIB 5EL2A 5B8IB 1CMFA 4GGNA 1IG5A 3FE8A 3EVRA 5I2LA 1BT6A 1S26D 1KSOA 2KI4B 2K7BA 3D74A 2H2KA 5CSFA 3VGOA 1CNPA 3DVJA 3SG5A 3AAKA 1MR8A 1ORGA 2MLEC 4M2QA 1QATA 3DVMA 4F7FA 2F3YA 1EJ3A 3SG3A 1BU3A 1J1EA 1G4YR 2KPHA 4ORCB 3CLNA 1UHJA 1DJXA 2M0RA 1KFUL 3D76A 2CT9A 3M0WA 2L2EA 4MLWA 1GGZA 2L2CA 5TNCA 5AANA 1ZOTB 1F8HA 2QEOA 1Z4HA 3PALA 2ERBA 3CWGA 2CNPA 3FE6A 1Y0VH 4DS7A 1G33A 2GV5A 2MHHA 3BOWB 2LHIA 2Y1MA 4ORBB 4GFTA 3NHTA 5HL1A 3OP0A 3BUNB 1CDPA 3D78A 2VRGA 2BKHB 1FBVA 1E8AA 3DF0B 1JC2A 1NIWA 1OMRA 3BFBA 1SCMC 2M1UA 1SL7A 1XFWO 1IH0A 3NHIA 1PVBA 2WCFA 1TIZA 1PSRA 1C7VA 3WXAA 2LVVA 1CLBA 2MLFC 2R2IA 2K2AA 5AERA 2K2FA 4L9MA 3D73A 2KFHA 1PALA 2M49B 3EKJA 2KLDA 3S0BA 4ZCUA 3VROA 1M63B 2ZRTA 1BF5A 4FQTA 3L4AA 2CXJA 2KGBC 3EKHA 4MZLA 1LVCD 3VRQA 2WOSA 2JPOA 4JPZB 1AK8A 1L7ZA 2P6BB 1LA0A 3TS5C 1GM0A 2KSPA 4N1GA 4IL1A 1KQMC 2BCBA 2P71A 1WY9A 3PM8A 1H4BA 1P28A 4ICBA 3B87A 1PK0D 3OGNA 2H61C 3FWCA 1HQVA 2E30A 2KDHA 1OE9B 3BFAA 2Q91A 3TS5B 3O4XA 1DJZA 2QPTA 4MRXA 3OHMB 4YGEB 1MF8B 1R6PA 5CSJA 1NCYA 1UHHA 1RJVA 3OBVA 2KOTA 4MZJA 1JF2A 2L50A 3CTNA 1WRKA 2JC2A 2F2PA 1RECA 4GPLB 5JJGA 2QACA 3BUOB 1CB1A 1NYAA 5D69A 1A29A 1UP5A 3SG2A 4NDBA 4PHJA 2KGRA 3JTDC 5AFPA 4NQGA 3RZSA 1S6JA 2PVBA 4N1FA 3RLZA 2WNDA 1IKUA 1GGWA 2LMUA 4NDDA 3O4YA 2IS9A 4GAOA 1NCZA 1YX7A 1YR5A 1QVIY 1JF0A 1K96A 1DQEA 3KPXA 2LMTA 3JTDB 2AAOA 1IJ6A 5HKWA 4XJKA 2JULA 3GK4X 4I5KA 2PRUA 1YVLA 2KNEA 1QV1A 4Q04A 2M3WA 2Y5IA 3B88A 2JNFA 2NXQA 4CIDA 1J55A 2NZ0A 3FWBA 1NX3A 1OOGA 4HRGA 1IJ5A 1SNLA 1QASA 3R1PA 4YGAA 1MUXA 1WDCC 3KEVA 4DCKA 1CMGA 1ODBA 2L4IA 3TDUA 1XFYO 1KFUS 4GGFC 4MEWA 4A4BA 1XFVO 4WRIA 3TZ1A 3IF7A 1SKTA 1UHKA 3TDIA 5BPJA 1C7WA 5JOLA 4DIRA 2PALA 5AXIA 1F70A 1NX0A 2L98A 3UO9A 4MRYA 1CTRA 2M1KB 2P70A 4OKHA 4TNCA 1G8IA 1K90D 4PDZA 4PT1A 4ETOA 3FS7A 1K94A 2M29A 3A8RA 1KQVA 1M45A 3CYZA 1QIVA 2LHLA 1S3PA 2M9GA 2LUCA 3CDNA 1AVSA 1CDLA 1DF0B 2L5YA 3CS1A 1OMVA 5HKYA 4INXA 4YI9A 1OSAA 3ICBA 4PALA 5F6TA 1TN4A 1KK7Y 4YBHB 3CR2A 1A2XA 1SRAA 1XFZO 1NSHA 2CCMA 2SASA 2WC6A 3FE9A 3S0AA 3B7AA 1F54A 1DMOA 3SIBA 1DVIA 3O78A 5FI7A 1KWOC 1OQPA 3CZ2A 1S1EA 3DYEA 2JPTA 3K21A 4I5NB 2I94A 4QJ3B 3OX6A 1BOCA 1D1OA 2Y4QA 3N7HA 1AJ5A 1CFPA 1BMOA 1SL8A 2L5XB 4JQ0D 1QXPA 4MZKA 1KWOB 2WCMA 3BYAA 3VRNA 3SG6A 1F71A 1SPYA 1BODA 1EL4A 4A4CA 1B7TY 3VRPA 3CABA 1N65A 1RTP1 3CR5X 4BY4A 2FJUB 2ZN8A 2K60A 3CZTX 2G2BA 1U5IB 2MA2A 2B1UA 3B6XA 3D0YB 2ZNEA 1SL9A 3OB2B 1B4CA 2JRFA 2JTTA 5I8NA 1LXFC 2JXLA 1XYDA 2BE6A 3SS3A 2EC6C 3H4SE 3MSEB 1FF1A 1XFRA 1ZUZA 1QV0A 1IRJA 1QS7A 1QTXA 2LP2A 3CGAA 3CR4X 3R72A 1XFXO 2BE4A 4MVFA 2BL0C 3VB1A 3PATA 1EH2A 3S0GA 2M97A 4OV2A 5FI6A 2EC6B 1FI6A 2Y1NA 1DJHA 1YURA 3GK1A 3S0FA 1L2OC 3AAJA 2QEVA 2PASA 1TTXA 2MBXA 1ZMZA 1B47A 2BL0B 2D8NA 2JZIA 2LVJA 1SMGA 1SR6C 1LA3A 1IQ3A 3KO0A 3BUMB 2BCXA 1TRFA 2BNXA 1DTLA 2KLEA 3F45A 1L2OB 5G08A 4CFRA 2BECA 3WHUB 5CSNA 2L0PA 1EXRA 1AJ4A 1YRUB 2LLUA 1SR6B 3DVEA 1MWNA 1YUUA 1JUOA 2K8MB 2WCLA 4MN0A 5ER4X 2GGMA 2BKIB 4QJ4B 1RROA 1N0YA 4OVNF 1S5GY 2ZFDA 1YVHA 2M8UA 2HF5A 1K9PA 3LCPC 2KYCA 1NWDA 2FCEA 2M7NA 3IVTA 1TOPA 3S0EA 4P5OE 3PM2A 4IJ7A 1A75B 4JWQA 3OB1B 1B9AA 3KHEA 1B8LA 1CLMA 2QDIA 1K93D 3AKBA 4JKTA 4R1EA 2LV7A 1X02A 1K95A 3S0DA 2JU0A 4USLA 3TDZA 3DF0A 1OOIX 1C3YA 2QEHA 1NUBA 1Y1XA 1OZSA 5HYDA 1JFJA 1F4QA 1WLZA 1QVIZ 2L51A 1M46A 2LVKA 4M2PA 3NSLA 3VRRA 5K89A 4UPGA 1BLQA 1VRKA 1S36A 2E6WA 3DZTA 1DELA 2LLSA 1TWOA 1IIOA 1MXEA 2WCKA 3EK8A 1SBJA 2LMVA 2PQLA 3B86A 2I7AA 2F8PA 3EG5B 1CFDA 5D7FA 2BAPA 4N5XA 3JVTC 3ZWHA 1TNQA 1OOJA 3L4LA 1J7QA 4I5LB 2LUXA 1KSMA 1NX1A 2I18A 1KK8B 2QEBA 2K61A 3PSRA 2WCJA 5CPVA 1H8BA 4HSZA 1TNWA 4KYNA 1CDNA 3LK1A 3KF9A 3CZ0A 1OOHA 1ALVA 2GTEA 2HQWA 3NSOA 2KBIA 1AP4A 3JVTB 3SS5A 1TUZA 1DEKA 1OOFA 4U8DA 5DKRA 1S6IA 2KFFA 3BJHA 1EG3A 2LANA 2MJWB 1CFFA 2WC8A 2O60A 3AKAA 1KCYA 5HKZA 2FOTA 2NCPA 2RGIA 1WRZA 2OS8C 3NSIA 1JWDA 1UURA 1J1DA 1J7OA 4PCWA 3I5HC 3PLFB 2F2OA 2YGUA 3SIAA 1Q80A 1SW8A 5HLVA 4M2OA 3DD4A 1JSAA 3GOFA 2H61A 1K9UA 2CTNA 2WC5A 2JQ6A 4GUKA 4OZDA 5DKNA 4C0LA 1XK4A 5KTYA 2WCBA 1NPQA 2OS8B 4OR9B 2FCDA 3I5HB 1GQMA 1M39A 1DGUA 1KK7Z 3E3RA 4HRHA 5I2QA 1J7RA 1GJYA 1TNXA 2KAXA 3QMEA 1PVAA 1V1FA 3BUWB 1CDMA 3HCMA 3SG4A 1PULA 2LM5A 3O6BA 3EK4A 2FJYA 2NCOA 1W7JB 2A4JA 1NX2A 3QRXA 3R1VA 4CPVA 3WHTB 1ALWA 5DICA 2KAYA 2AUCA 1R2UA 1DT7B 2L4HA
chains in the Genus database with same CATH topology
1V1GA 3LL8B 2ZKMX 1F55A 3WNXB 2WORA 1QLKA 5AEQA 1KFXS 2LCPA 1DJWA 1NCXA 1DJYA 1AHRA 1WLMA 5ER5A 4AQIA 1B7TZ 5KU1A 1YX8A 3I5IC 4GBAA 2BBNA 1JBAA 2I2RE 2KYFA 4YRUA 1SK6D 5HLOA 4PHMA 1ZACA 3BUXB 5PALA 1SCVA 1K2HA 1XFUO 2HETA 2COLB 2LE9B 1OMDA 4C0JA 4I5JA 4MSPA 1DJGA 4PHNA 3I5IB 2G9BA 3LLEA 4YGBB 1DGVA 5IBWA 1BR4B 1IGVA 3GK2A 1MQ1A 1QLSA 1IQ5A 2GGZA 1F4OA 2OTGC 4PE7A 1CFCA 4NDCA 1RWYA 2MRDA 2JT0A 4DUQA 2MAZA 5CSIA 2CBLA 4GGFA 4P2YB 1SYMA 1XVJA 1KFXL 1RFJA 1HT9A 1YUSA 1A4PA 1ZFSA 2JOJA 4XYNA 1CKKA 4XJKB 1TNPA 1Y6WA 1QX5B 2OTGB 1B1GA 1W7IB 2SCPA 2JTZA 5FYXA 1K9KA 3HX4A 3D10A 1Y1AA 1DF0A 2KI6C 4F0ZB 1PRWA 3PFVA 2ZN9A 1SCMB 4ORAB 5DKQA 2HQ8A 4ZCVA 5J3XA 1B8RA 2Q4UA 1B8CA 3C1VA 1N2DA 2PSRA 4PE1A 3LK0A 4HREE 1FW4A 2ZNDA 2LVIA 2K7OA 2EHBA 1UHIA 4YI8A 1WRLA 1EG4A 1QX7A 2LC5A 4D1EA 3I5GC 3NXAA 1M31A 1CM4A 1S5GZ 2BBMA 4FQOA 1BJFA 3BXKA 2LNKA 3DVKA 3SG7A 1RK9A 2O5GA 1XK4C 2OPOA 2TN4A 1YUTA 3BOWA 3FIAA 1DJIA 4YGCB 1KQMB 3TUYC 3I5FC 2PMYA 3A4UB 2KHNA 3I5GB 3OX5A 4E68A 1MHOA 3D0YA 1U5IA 3EVUA 1FPWA 4CLNA 1J7PA 1UWOA 2WCEA 2KQ6A 3TUYB 3I5FB 2K0JA 4YGDB 3ZNIA 1K8UA 2NLNA 3EVVA 1KK8C 2AMIA 3EK7A 4OCIA 2JNXA 3PN7C 2KFGA 3RM1A 2DOQA 2F33A 2HPSA 1CLLA 2LLTA 4AOMA 4CFQA 1CM1A 1QX2A 1XA5A 3PN7B 4FTGA 2KQYA 2K7CA 3NSKA 2ZRSA 3IQOA 1UUSA 1QIWA 1IWQA 4PE4A 1YRTB 2F3ZA 4QJ5B 2M7LA 1NP8A 1OZOA 2JT8A 1A03A 1LINA 4PHKA 5GQQC 2ISDA 4BY5A 4C0KA 4DRWA 5KSZA 2JXCA 1S6CA 3BQ3A 2KI6D 2KAVA 1FI5A 3O2PA 1C07A 4WQ3A 2JT3A 1LKJA 4AQJA 1PSBA 1TCOB 4MBEA 1BG1A 2BCAA 1QJTA 1XO5A 2V53A 4PE0A 1SY9A 2LP3A 3IQQA 1TCFA 1UHNA 1MXLC 1JFKA 1Y1UA 4GNKB 2LAPA 4WQ2A 2K7DA 2KBMA 1WDCB 2EGDA 3SJSA 1BR1B 5I2OA 1YTZC 2KI4C 2JWWA 1A75A 1AUIB 5B8IB 1CMFA 4GGNA 1IG5A 3EVRA 5I2LA 1BT6A 1S26D 1KSOA 2KI4B 2K7BA 5CSFA 2H2KA 3VGOA 1CNPA 3DVJA 3SG5A 3AAKA 1MR8A 2MLEC 4M2QA 1QATA 3DVMA 2F3YA 1EJ3A 3SG3A 1BU3A 1J1EA 1G4YR 4ORCB 3CLNA 1UHJA 1DJXA 2M0RA 1KFUL 2CT9A 3M0WA 2L2EA 4MLWA 1GGZA 5TNCA 5AANA 1ZOTB 1F8HA 3PALA 3CWGA 2CNPA 1Y0VH 4DS7A 1G33A 2GV5A 2MHHA 3BOWB 2LHIA 2Y1MA 4ORBB 4GFTA 3OP0A 3BUNB 1CDPA 2VRGA 2BKHB 1FBVA 1E8AA 3DF0B 1JC2A 1NIWA 1OMRA 1SCMC 2M1UA 1SL7A 1XFWO 1IH0A 1PVBA 2WCFA 1TIZA 1PSRA 1C7VA 3WXAA 2LVVA 1CLBA 2MLFC 2R2IA 2K2AA 5AERA 2K2FA 4L9MA 3VROA 2KFHA 1PALA 2M49B 3EKJA 4ZCUA 1M63B 2ZRTA 1BF5A 2CXJA 2KGBC 3EKHA 4MZLA 1LVCD 3VRQA 2WOSA 1AK8A 4JPZB 1L7ZA 2P6BB 1LA0A 3TS5C 2KSPA 4N1GA 4IL1A 1KQMC 2BCBA 1WY9A 3PM8A 1H4BA 4ICBA 1PK0D 2H61C 3FWCA 1HQVA 2E30A 2KDHA 1OE9B 3TS5B 2Q91A 1DJZA 2QPTA 4MRXA 3OHMB 4YGEB 1MF8B 1R6PA 5CSJA 1NCYA 1UHHA 1RJVA 2KOTA 4MZJA 1JF2A 2L50A 3CTNA 1WRKA 2JC2A 2F2PA 1RECA 4GPLB 5JJGA 2QACA 3BUOB 1CB1A 1NYAA 5D69A 1A29A 1UP5A 3SG2A 4NDBA 4PHJA 2KGRA 3JTDC 5AFPA 4NQGA 1S6JA 2PVBA 4N1FA 3RLZA 2WNDA 1IKUA 1GGWA 2LMUA 4NDDA 3O4YA 2IS9A 4GAOA 1NCZA 1YX7A 1YR5A 1QVIY 1JF0A 1K96A 3KPXA 2LMTA 3JTDB 2AAOA 1IJ6A 5HKWA 4XJKA 2JULA 3GK4X 4I5KA 2PRUA 1YVLA 2KNEA 1QV1A 4Q04A 2M3WA 2Y5IA 2JNFA 2NXQA 4CIDA 1J55A 2NZ0A 3FWBA 1NX3A 4HRGA 1IJ5A 1SNLA 1QASA 4YGAA 1MUXA 1WDCC 3KEVA 4DCKA 1CMGA 1ODBA 2L4IA 3TDUA 1XFYO 1KFUS 4GGFC 4MEWA 4A4BA 1XFVO 4WRIA 3TZ1A 3IF7A 1SKTA 1UHKA 3TDIA 5BPJA 1C7WA 5JOLA 4DIRA 2PALA 5AXIA 1F70A 1NX0A 2L98A 4MRYA 1CTRA 2M1KB 4OKHA 4TNCA 1G8IA 1K90D 4PDZA 4ETOA 3FS7A 1K94A 2M29A 3A8RA 1KQVA 1M45A 1QIVA 2LHLA 1S3PA 2M9GA 2LUCA 1AVSA 1CDLA 1DF0B 3CS1A 1OMVA 5HKYA 4YI9A 1OSAA 3ICBA 4PALA 5F6TA 1TN4A 1KK7Y 4YBHB 3CR2A 1A2XA 1SRAA 1XFZO 1NSHA 2CCMA 2SASA 1F54A 1DMOA 3SIBA 1DVIA 3O78A 1KWOC 1OQPA 1S1EA 2JPTA 3K21A 4I5NB 2I94A 4QJ3B 3OX6A 1BOCA 1D1OA 2Y4QA 1AJ5A 1CFPA 1BMOA 1SL8A 2L5XB 4JQ0D 1QXPA 4MZKA 1KWOB 3BYAA 3VRNA 3SG6A 1F71A 1SPYA 1BODA 1EL4A 4A4CA 1B7TY 3VRPA 1N65A 1RTP1 3CR5X 4BY4A 2FJUB 2ZN8A 3D0YB 3CZTX 2G2BA 1U5IB 2MA2A 2B1UA 2ZNEA 1SL9A 3OB2B 1B4CA 2JRFA 2JTTA 5I8NA 1LXFC 2JXLA 1XYDA 2BE6A 1FF1A 2EC6C 3H4SE 3MSEB 1ZUZA 1QV0A 1IRJA 1QS7A 1QTXA 2LP2A 3CGAA 3CR4X 1XFXO 2BE4A 4MVFA 2BL0C 1EH2A 3PATA 2M97A 4OV2A 2EC6B 1FI6A 2Y1NA 1DJHA 1YURA 3GK1A 1L2OC 3AAJA 2PASA 1TTXA 2MBXA 1ZMZA 1B47A 2BL0B 2D8NA 2JZIA 2LVJA 1SMGA 1SR6C 1LA3A 1IQ3A 3KO0A 3BUMB 2BCXA 1TRFA 1DTLA 3F45A 5G08A 1L2OB 4CFRA 2BECA 3WHUB 5CSNA 2L0PA 1EXRA 1AJ4A 1YRUB 2LLUA 1SR6B 3DVEA 1MWNA 1YUUA 1JUOA 2K8MB 5ER4X 4MN0A 2GGMA 2BKIB 4QJ4B 1RROA 1N0YA 4OVNF 1S5GY 2ZFDA 1YVHA 2M8UA 2HF5A 1K9PA 3LCPC 2KYCA 1NWDA 2FCEA 2M7NA 1TOPA 4P5OE 1A75B 4JWQA 3OB1B 1B9AA 3KHEA 1B8LA 1CLMA 3AKBA 1K93D 4R1EA 2LV7A 1X02A 1K95A 2JU0A 4USLA 3TDZA 3DF0A 1NUBA 1Y1XA 1OZSA 5HYDA 1JFJA 1F4QA 1WLZA 1QVIZ 2L51A 1M46A 2LVKA 4M2PA 3NSLA 3VRRA 5K89A 4UPGA 1BLQA 1VRKA 1S36A 2E6WA 2LLSA 1MXEA 3EK8A 1SBJA 2LMVA 2I7AA 2F8PA 1CFDA 5D7FA 4N5XA 3JVTC 3ZWHA 1TNQA 1OOJA 1J7QA 4I5LB 2LUXA 1KSMA 1NX1A 2I18A 1KK8B 3PSRA 2K61A 5CPVA 1H8BA 4HSZA 1TNWA 1CDNA 3LK1A 3KF9A 1ALVA 3NSOA 2HQWA 1AP4A 2KBIA 3JVTB 4U8DA 5DKRA 1S6IA 2KFFA 1EG3A 2LANA 2MJWB 1CFFA 2WC8A 2O60A 3AKAA 1KCYA 5HKZA 2FOTA 2NCPA 2RGIA 1WRZA 2OS8C 3NSIA 1JWDA 1UURA 1J1DA 1J7OA 4PCWA 3I5HC 3PLFB 2F2OA 3SIAA 1Q80A 1SW8A 5HLVA 4M2OA 3DD4A 1JSAA 3GOFA 2H61A 1K9UA 2CTNA 4C0LA 2JQ6A 4GUKA 5DKNA 5KTYA 1XK4A 2WCBA 1NPQA 2OS8B 4OR9B 2FCDA 3I5HB 1GQMA 1M39A 1DGUA 1KK7Z 3E3RA 4HRHA 5I2QA 1J7RA 1GJYA 1TNXA 2KAXA 1PVAA 1V1FA 3BUWB 1CDMA 3HCMA 3SG4A 1PULA 2LM5A 3O6BA 3EK4A 2NCOA 1W7JB 2A4JA 1NX2A 3QRXA 4CPVA 3WHTB 1ALWA 2KAYA 2AUCA 1R2UA 1DT7B 2L4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1G A;  3LL8 B;  2ZKM X;  1F55 A;  3WNX B;  2WOR A;  1QLK A;  5AEQ A;  1KFX S;  2LCP A;  1DJW A;  1NCX A;  1DJY A;  1AHR A;  1WLM A;  5ER5 A;  4AQI A;  1B7T Z;  5KU1 A;  1YX8 A;  3I5I C;  4GBA A;  2BBN A;  1JBA A;  2I2R E;  2KYF A;  4YRU A;  1SK6 D;  5HLO A;  4PHM A;  1ZAC A;  3BUX B;  5PAL A;  1SCV A;  1K2H A;  1XFU O;  2HET A;  2COL B;  2LE9 B;  1OMD A;  4C0J A;  4I5J A;  4MSP A;  1DJG A;  4PHN A;  3I5I B;  2G9B A;  3LLE A;  4YGB B;  1DGV A;  5IBW A;  1BR4 B;  1IGV A;  3GK2 A;  1MQ1 A;  1QLS A;  1IQ5 A;  2GGZ A;  1F4O A;  2OTG C;  4PE7 A;  1CFC A;  4NDC A;  1RWY A;  2MRD A;  2JT0 A;  4DUQ A;  2MAZ A;  5CSI A;  2CBL A;  4GGF A;  4P2Y B;  1SYM A;  1XVJ A;  1KFX L;  1RFJ A;  1HT9 A;  1YUS A;  1A4P A;  1ZFS A;  2JOJ A;  4XYN A;  1CKK A;  4XJK B;  1TNP A;  1Y6W A;  1QX5 B;  2OTG B;  1B1G A;  1W7I B;  2SCP A;  2JTZ A;  5FYX A;  1K9K A;  3HX4 A;  3D10 A;  1Y1A A;  1DF0 A;  2KI6 C;  4F0Z B;  1PRW A;  3PFV A;  2ZN9 A;  1SCM B;  4ORA B;  5DKQ A;  2HQ8 A;  4ZCV A;  5J3X A;  1B8R A;  2Q4U A;  1B8C A;  3C1V A;  1N2D A;  2PSR A;  4PE1 A;  3LK0 A;  4HRE E;  1FW4 A;  2ZND A;  2LVI A;  2K7O A;  2EHB A;  1UHI A;  4YI8 A;  1WRL A;  1EG4 A;  1QX7 A;  2LC5 A;  4D1E A;  3I5G C;  3NXA A;  1M31 A;  1CM4 A;  1S5G Z;  2BBM A;  4FQO A;  1BJF A;  3BXK A;  2LNK A;  3DVK A;  3SG7 A;  1RK9 A;  2O5G A;  1XK4 C;  2OPO A;  2TN4 A;  1YUT A;  3BOW A;  3FIA A;  1DJI A;  4YGC B;  1KQM B;  3TUY C;  3I5F C;  2PMY A;  3A4U B;  2KHN A;  3I5G B;  3OX5 A;  4E68 A;  1MHO A;  3D0Y A;  1U5I A;  3EVU A;  1FPW A;  4CLN A;  1J7P A;  1UWO A;  2WCE A;  2KQ6 A;  3TUY B;  3I5F B;  2K0J A;  4YGD B;  3ZNI A;  1K8U A;  2NLN A;  3EVV A;  1KK8 C;  2AMI A;  3EK7 A;  4OCI A;  2JNX A;  3PN7 C;  2KFG A;  3RM1 A;  2DOQ A;  2F33 A;  2HPS A;  1CLL A;  2LLT A;  4AOM A;  4CFQ A;  1CM1 A;  1QX2 A;  1XA5 A;  3PN7 B;  4FTG A;  2KQY A;  2K7C A;  3NSK A;  2ZRS A;  3IQO A;  1UUS A;  1QIW A;  1IWQ A;  4PE4 A;  1YRT B;  2F3Z A;  4QJ5 B;  2M7L A;  1NP8 A;  1OZO A;  2JT8 A;  1A03 A;  1LIN A;  4PHK A;  5GQQ C;  2ISD A;  4BY5 A;  4C0K A;  4DRW A;  5KSZ A;  2JXC A;  1S6C A;  3BQ3 A;  2KI6 D;  2KAV A;  1FI5 A;  3O2P A;  1C07 A;  4WQ3 A;  2JT3 A;  1LKJ A;  4AQJ A;  1PSB A;  1TCO B;  4MBE A;  1BG1 A;  2BCA A;  1QJT A;  1XO5 A;  2V53 A;  4PE0 A;  1SY9 A;  2LP3 A;  3IQQ A;  1TCF A;  1UHN A;  1MXL C;  1JFK A;  1Y1U A;  4GNK B;  2LAP A;  4WQ2 A;  2K7D A;  2KBM A;  1WDC B;  2EGD A;  3SJS A;  1BR1 B;  5I2O A;  1YTZ C;  2KI4 C;  2JWW A;  1A75 A;  1AUI B;  5B8I B;  1CMF A;  4GGN A;  1IG5 A;  3EVR A;  5I2L A;  1BT6 A;  1S26 D;  1KSO A;  2KI4 B;  2K7B A;  5CSF A;  2H2K A;  3VGO A;  1CNP A;  3DVJ A;  3SG5 A;  3AAK A;  1MR8 A;  2MLE C;  4M2Q A;  1QAT A;  3DVM A;  2F3Y A;  1EJ3 A;  3SG3 A;  1BU3 A;  1J1E A;  1G4Y R;  4ORC B;  3CLN A;  1UHJ A;  1DJX A;  2M0R A;  1KFU L;  2CT9 A;  3M0W A;  2L2E A;  4MLW A;  1GGZ A;  5TNC A;  5AAN A;  1ZOT B;  1F8H A;  3PAL A;  3CWG A;  2CNP A;  1Y0V H;  4DS7 A;  1G33 A;  2GV5 A;  2MHH A;  3BOW B;  2LHI A;  2Y1M A;  4ORB B;  4GFT A;  3OP0 A;  3BUN B;  1CDP A;  2VRG A;  2BKH B;  1FBV A;  1E8A A;  3DF0 B;  1JC2 A;  1NIW A;  1OMR A;  1SCM C;  2M1U A;  1SL7 A;  1XFW O;  1IH0 A;  1PVB A;  2WCF A;  1TIZ A;  1PSR A;  1C7V A;  3WXA A;  2LVV A;  1CLB A;  2MLF C;  2R2I A;  2K2A A;  5AER A;  2K2F A;  4L9M A;  3VRO A;  2KFH A;  1PAL A;  2M49 B;  3EKJ A;  4ZCU A;  1M63 B;  2ZRT A;  1BF5 A;  2CXJ A;  2KGB C;  3EKH A;  4MZL A;  1LVC D;  3VRQ A;  2WOS A;  1AK8 A;  4JPZ B;  1L7Z A;  2P6B B;  1LA0 A;  3TS5 C;  2KSP A;  4N1G A;  4IL1 A;  1KQM C;  2BCB A;  1WY9 A;  3PM8 A;  1H4B A;  4ICB A;  1PK0 D;  2H61 C;  3FWC A;  1HQV A;  2E30 A;  2KDH A;  1OE9 B;  3TS5 B;  2Q91 A;  1DJZ A;  2QPT A;  4MRX A;  3OHM B;  4YGE B;  1MF8 B;  1R6P A;  5CSJ A;  1NCY A;  1UHH A;  1RJV A;  2KOT A;  4MZJ A;  1JF2 A;  2L50 A;  3CTN A;  1WRK A;  2JC2 A;  2F2P A;  1REC A;  4GPL B;  5JJG A;  2QAC A;  3BUO B;  1CB1 A;  1NYA A;  5D69 A;  1A29 A;  1UP5 A;  3SG2 A;  4NDB A;  4PHJ A;  2KGR A;  3JTD C;  5AFP A;  4NQG A;  1S6J A;  2PVB A;  4N1F A;  3RLZ A;  2WND A;  1IKU A;  1GGW A;  2LMU A;  4NDD A;  3O4Y A;  2IS9 A;  4GAO A;  1NCZ A;  1YX7 A;  1YR5 A;  1QVI Y;  1JF0 A;  1K96 A;  3KPX A;  2LMT A;  3JTD B;  2AAO A;  1IJ6 A;  5HKW A;  4XJK A;  2JUL A;  3GK4 X;  4I5K A;  2PRU A;  1YVL A;  2KNE A;  1QV1 A;  4Q04 A;  2M3W A;  2Y5I A;  2JNF A;  2NXQ A;  4CID A;  1J55 A;  2NZ0 A;  3FWB A;  1NX3 A;  4HRG A;  1IJ5 A;  1SNL A;  1QAS A;  4YGA A;  1MUX A;  1WDC C;  3KEV A;  4DCK A;  1CMG A;  1ODB A;  2L4I A;  3TDU A;  1XFY O;  1KFU S;  4GGF C;  4MEW A;  4A4B A;  1XFV O;  4WRI A;  3TZ1 A;  3IF7 A;  1SKT A;  1UHK A;  3TDI A;  5BPJ A;  1C7W A;  5JOL A;  4DIR A;  2PAL A;  5AXI A;  1F70 A;  1NX0 A;  2L98 A;  4MRY A;  1CTR A;  2M1K B;  4OKH A;  4TNC A;  1G8I A;  1K90 D;  4PDZ A;  4ETO A;  3FS7 A;  1K94 A;  2M29 A;  3A8R A;  1KQV A;  1M45 A;  1QIV A;  2LHL A;  1S3P A;  2M9G A;  2LUC A;  1AVS A;  1CDL A;  1DF0 B;  3CS1 A;  1OMV A;  5HKY A;  4YI9 A;  1OSA A;  3ICB A;  4PAL A;  5F6T A;  1TN4 A;  1KK7 Y;  4YBH B;  3CR2 A;  1A2X A;  1SRA A;  1XFZ O;  1NSH A;  2CCM A;  2SAS A;  1F54 A;  1DMO A;  3SIB A;  1DVI A;  3O78 A;  1KWO C;  1OQP A;  1S1E A;  2JPT A;  3K21 A;  4I5N B;  2I94 A;  4QJ3 B;  3OX6 A;  1BOC A;  1D1O A;  2Y4Q A;  1AJ5 A;  1CFP A;  1BMO A;  1SL8 A;  2L5X B;  4JQ0 D;  1QXP A;  4MZK A;  1KWO B;  3BYA A;  3VRN A;  3SG6 A;  1F71 A;  1SPY A;  1BOD A;  1EL4 A;  4A4C A;  1B7T Y;  3VRP A;  1N65 A;  1RTP 1;  3CR5 X;  4BY4 A;  2FJU B;  2ZN8 A;  3D0Y B;  3CZT X;  2G2B A;  1U5I B;  2MA2 A;  2B1U A;  2ZNE A;  1SL9 A;  3OB2 B;  1B4C A;  2JRF A;  2JTT A;  5I8N A;  1LXF C;  2JXL A;  1XYD A;  2BE6 A;  1FF1 A;  2EC6 C;  3H4S E;  3MSE B;  1ZUZ A;  1QV0 A;  1IRJ A;  1QS7 A;  1QTX A;  2LP2 A;  3CGA A;  3CR4 X;  1XFX O;  2BE4 A;  4MVF A;  2BL0 C;  1EH2 A;  3PAT A;  2M97 A;  4OV2 A;  2EC6 B;  1FI6 A;  2Y1N A;  1DJH A;  1YUR A;  3GK1 A;  1L2O C;  3AAJ A;  2PAS A;  1TTX A;  2MBX A;  1ZMZ A;  1B47 A;  2BL0 B;  2D8N A;  2JZI A;  2LVJ A;  1SMG A;  1SR6 C;  1LA3 A;  1IQ3 A;  3KO0 A;  3BUM B;  2BCX A;  1TRF A;  1DTL A;  3F45 A;  5G08 A;  1L2O B;  4CFR A;  2BEC A;  3WHU B;  5CSN A;  2L0P A;  1EXR A;  1AJ4 A;  1YRU B;  2LLU A;  1SR6 B;  3DVE A;  1MWN A;  1YUU A;  1JUO A;  2K8M B;  5ER4 X;  4MN0 A;  2GGM A;  2BKI B;  4QJ4 B;  1RRO A;  1N0Y A;  4OVN F;  1S5G Y;  2ZFD A;  1YVH A;  2M8U A;  2HF5 A;  1K9P A;  3LCP C;  2KYC A;  1NWD A;  2FCE A;  2M7N A;  1TOP A;  4P5O E;  1A75 B;  4JWQ A;  3OB1 B;  1B9A A;  3KHE A;  1B8L A;  1CLM A;  3AKB A;  1K93 D;  4R1E A;  2LV7 A;  1X02 A;  1K95 A;  2JU0 A;  4USL A;  3TDZ A;  3DF0 A;  1NUB A;  1Y1X A;  1OZS A;  5HYD A;  1JFJ A;  1F4Q A;  1WLZ A;  1QVI Z;  2L51 A;  1M46 A;  2LVK A;  4M2P A;  3NSL A;  3VRR A;  5K89 A;  4UPG A;  1BLQ A;  1VRK A;  1S36 A;  2E6W A;  2LLS A;  1MXE A;  3EK8 A;  1SBJ A;  2LMV A;  2I7A A;  2F8P A;  1CFD A;  5D7F A;  4N5X A;  3JVT C;  3ZWH A;  1TNQ A;  1OOJ A;  1J7Q A;  4I5L B;  2LUX A;  1KSM A;  1NX1 A;  2I18 A;  1KK8 B;  3PSR A;  2K61 A;  5CPV A;  1H8B A;  4HSZ A;  1TNW A;  1CDN A;  3LK1 A;  3KF9 A;  1ALV A;  3NSO A;  2HQW A;  1AP4 A;  2KBI A;  3JVT B;  4U8D A;  5DKR A;  1S6I A;  2KFF A;  1EG3 A;  2LAN A;  2MJW B;  1CFF A;  2WC8 A;  2O60 A;  3AKA A;  1KCY A;  5HKZ A;  2FOT A;  2NCP A;  2RGI A;  1WRZ A;  2OS8 C;  3NSI A;  1JWD A;  1UUR A;  1J1D A;  1J7O A;  4PCW A;  3I5H C;  3PLF B;  2F2O A;  3SIA A;  1Q80 A;  1SW8 A;  5HLV A;  4M2O A;  3DD4 A;  1JSA A;  3GOF A;  2H61 A;  1K9U A;  2CTN A;  4C0L A;  2JQ6 A;  4GUK A;  5DKN A;  5KTY A;  1XK4 A;  2WCB A;  1NPQ A;  2OS8 B;  4OR9 B;  2FCD A;  3I5H B;  1GQM A;  1M39 A;  1DGU A;  1KK7 Z;  3E3R A;  4HRH A;  5I2Q A;  1J7R A;  1GJY A;  1TNX A;  2KAX A;  1PVA A;  1V1F A;  3BUW B;  1CDM A;  3HCM A;  3SG4 A;  1PUL A;  2LM5 A;  3O6B A;  3EK4 A;  2NCO A;  1W7J B;  2A4J A;  1NX2 A;  3QRX A;  4CPV A;  3WHT B;  1ALW A;  2KAY A;  2AUC A;  1R2U A;  1DT7 B;  2L4H A; 
#chains in the Genus database with same CATH topology
 1V1G A;  2WCH A;  3LL8 B;  2ZKM X;  1F55 A;  3WNX B;  2WOR A;  1QLK A;  5AEQ A;  1KFX S;  4INW A;  2LCP A;  1DJW A;  1C3Z A;  1NCX A;  3CZ1 A;  1DJY A;  1AHR A;  1WLM A;  5ER5 A;  4AQI A;  1B7T Z;  5KU1 A;  3NGV A;  1YX8 A;  3I5I C;  4GBA A;  2BBN A;  1JBA A;  1W9Z A;  2I2R E;  2KYF A;  4YRU A;  1SK6 D;  5HLO A;  1LS8 A;  4PHM A;  1ZAC A;  3BUX B;  5PAL A;  1DC1 A;  1SCV A;  1K2H A;  1XFU O;  2HET A;  2COL B;  2LE9 B;  1OMD A;  4C0J A;  4I5J A;  4MSP A;  1DJG A;  4PHN A;  3I5I B;  2G9B A;  3LLE A;  4YGB B;  1DGV A;  2PYQ A;  5IBW A;  1BR4 B;  1IGV A;  3GK2 A;  1MQ1 A;  1QLS A;  1IQ5 A;  2GGZ A;  1F4O A;  2OTG C;  4PE7 A;  1CFC A;  4NDC A;  1RWY A;  2MRD A;  2JT0 A;  4DUQ A;  2MAZ A;  5CSI A;  2CBL A;  4GGF A;  4P2Y B;  1SYM A;  1XVJ A;  1KFX L;  1RFJ A;  1HT9 A;  1YUS A;  1A4P A;  1ZFS A;  2JOJ A;  4XYN A;  3PJI A;  1CKK A;  4XJK B;  1TNP A;  1Y6W A;  1QX5 B;  2OTG B;  1B1G A;  1W7I B;  2SCP A;  2JTZ A;  5FYX A;  1K9K A;  3HX4 A;  3D10 A;  1Y1A A;  3DXL A;  1DF0 A;  3R1O A;  2KI6 C;  4F0Z B;  1PRW A;  3PFV A;  2ZN9 A;  1SCM B;  4ORA B;  5DKQ A;  2HQ8 A;  4ZCV A;  5J3X A;  1OW4 A;  1B8R A;  2Q4U A;  1B8C A;  3C1V A;  1N2D A;  2PSR A;  4PE1 A;  3LK0 A;  2H8V A;  4HRE E;  1FW4 A;  2ZND A;  2LVI A;  2K7O A;  2EHB A;  1UHI A;  4YI8 A;  1WRL A;  4JD9 A;  1EG4 A;  1QX7 A;  2LC5 A;  1QWV A;  4D1E A;  3I5G C;  3NXA A;  1M31 A;  1CM4 A;  1S5G Z;  2BBM A;  4FQO A;  1BJF A;  3BXK A;  2LNK A;  5FI2 A;  3DVK A;  3SG7 A;  1RK9 A;  2O5G A;  1XK4 C;  2OPO A;  2TN4 A;  1YUT A;  3BOW A;  3FIA A;  1DJI A;  4YGC B;  1KQM B;  3TUY C;  3I5F C;  2PMY A;  3A4U B;  2KHN A;  3I5G B;  1SSE B;  3OX5 A;  5I94 A;  4E68 A;  1MHO A;  3D0Y A;  1U5I A;  3EVU A;  1FPW A;  4CLN A;  1J7P A;  1UWO A;  2WCE A;  2KQ6 A;  3TUY B;  3I5F B;  2K0J A;  4YGD B;  3ZNI A;  1K8U A;  2NLN A;  3EVV A;  1KK8 C;  2AMI A;  3D77 A;  3EK7 A;  2JNX A;  4OCI A;  1TUJ A;  3PN7 C;  2KFG A;  3RM1 A;  2DOQ A;  2F33 A;  2HPS A;  1CLL A;  2LLT A;  4AOM A;  4CFQ A;  1CM1 A;  3BFH A;  1QX2 A;  1XA5 A;  3PN7 B;  4FTG A;  2KQY A;  3K1E A;  2K7C A;  3NSK A;  1T14 A;  2ZRS A;  3IQO A;  1UUS A;  1QIW A;  1IWQ A;  3SS4 A;  4PE4 A;  1YRT B;  2F3Z A;  4QJ5 B;  2M7L A;  1NP8 A;  1OZO A;  2JT8 A;  1A03 A;  1LIN A;  4PHK A;  5GQQ C;  2ISD A;  3UNW A;  4BY5 A;  4C0K A;  4DRW A;  5KSZ A;  1Z2C B;  2JXC A;  5D3O A;  1S6C A;  3BQ3 A;  2KI6 D;  2KAV A;  1FI5 A;  3L47 A;  3V2L A;  3O2P A;  1C07 A;  4WQ3 A;  2JT3 A;  1LKJ A;  4AQJ A;  1PSB A;  1TCO B;  4MBE A;  1BG1 A;  2BCA A;  1QJT A;  1XO5 A;  2V53 A;  4PE0 A;  1SY9 A;  2LP3 A;  3IQQ A;  1TCF A;  1UHN A;  1MXL C;  1JFK A;  1Y1U A;  3DY9 A;  4GNK B;  2LAP A;  3D75 A;  4WQ2 A;  2K7D A;  2KBM A;  1WDC B;  2EGD A;  3SJS A;  1BR1 B;  5I2O A;  1YTZ C;  2KI4 C;  2JWW A;  1A75 A;  3Q8I A;  1AUI B;  5EL2 A;  5B8I B;  1CMF A;  4GGN A;  1IG5 A;  3FE8 A;  3EVR A;  5I2L A;  1BT6 A;  1S26 D;  1KSO A;  2KI4 B;  2K7B A;  3D74 A;  2H2K A;  5CSF A;  3VGO A;  1CNP A;  3DVJ A;  3SG5 A;  3AAK A;  1MR8 A;  1ORG A;  2MLE C;  4M2Q A;  1QAT A;  3DVM A;  4F7F A;  2F3Y A;  1EJ3 A;  3SG3 A;  1BU3 A;  1J1E A;  1G4Y R;  2KPH A;  4ORC B;  3CLN A;  1UHJ A;  1DJX A;  2M0R A;  1KFU L;  3D76 A;  2CT9 A;  3M0W A;  2L2E A;  4MLW A;  1GGZ A;  2L2C A;  5TNC A;  5AAN A;  1ZOT B;  1F8H A;  2QEO A;  1Z4H A;  3PAL A;  2ERB A;  3CWG A;  2CNP A;  3FE6 A;  1Y0V H;  4DS7 A;  1G33 A;  2GV5 A;  2MHH A;  3BOW B;  2LHI A;  2Y1M A;  4ORB B;  4GFT A;  3NHT A;  5HL1 A;  3OP0 A;  3BUN B;  1CDP A;  3D78 A;  2VRG A;  2BKH B;  1FBV A;  1E8A A;  3DF0 B;  1JC2 A;  1NIW A;  1OMR A;  3BFB A;  1SCM C;  2M1U A;  1SL7 A;  1XFW O;  1IH0 A;  3NHI A;  1PVB A;  2WCF A;  1TIZ A;  1PSR A;  1C7V A;  3WXA A;  2LVV A;  1CLB A;  2MLF C;  2R2I A;  2K2A A;  5AER A;  2K2F A;  4L9M A;  3D73 A;  2KFH A;  1PAL A;  2M49 B;  3EKJ A;  2KLD A;  3S0B A;  4ZCU A;  3VRO A;  1M63 B;  2ZRT A;  1BF5 A;  4FQT A;  3L4A A;  2CXJ A;  2KGB C;  3EKH A;  4MZL A;  1LVC D;  3VRQ A;  2WOS A;  2JPO A;  4JPZ B;  1AK8 A;  1L7Z A;  2P6B B;  1LA0 A;  3TS5 C;  1GM0 A;  2KSP A;  4N1G A;  4IL1 A;  1KQM C;  2BCB A;  2P71 A;  1WY9 A;  3PM8 A;  1H4B A;  1P28 A;  4ICB A;  3B87 A;  1PK0 D;  3OGN A;  2H61 C;  3FWC A;  1HQV A;  2E30 A;  2KDH A;  1OE9 B;  3BFA A;  2Q91 A;  3TS5 B;  3O4X A;  1DJZ A;  2QPT A;  4MRX A;  3OHM B;  4YGE B;  1MF8 B;  1R6P A;  5CSJ A;  1NCY A;  1UHH A;  1RJV A;  3OBV A;  2KOT A;  4MZJ A;  1JF2 A;  2L50 A;  3CTN A;  1WRK A;  2JC2 A;  2F2P A;  1REC A;  4GPL B;  5JJG A;  2QAC A;  3BUO B;  1CB1 A;  1NYA A;  5D69 A;  1A29 A;  1UP5 A;  3SG2 A;  4NDB A;  4PHJ A;  2KGR A;  3JTD C;  5AFP A;  4NQG A;  3RZS A;  1S6J A;  2PVB A;  4N1F A;  3RLZ A;  2WND A;  1IKU A;  1GGW A;  2LMU A;  4NDD A;  3O4Y A;  2IS9 A;  4GAO A;  1NCZ A;  1YX7 A;  1YR5 A;  1QVI Y;  1JF0 A;  1K96 A;  1DQE A;  3KPX A;  2LMT A;  3JTD B;  2AAO A;  1IJ6 A;  5HKW A;  4XJK A;  2JUL A;  3GK4 X;  4I5K A;  2PRU A;  1YVL A;  2KNE A;  1QV1 A;  4Q04 A;  2M3W A;  2Y5I A;  3B88 A;  2JNF A;  2NXQ A;  4CID A;  1J55 A;  2NZ0 A;  3FWB A;  1NX3 A;  1OOG A;  4HRG A;  1IJ5 A;  1SNL A;  1QAS A;  3R1P A;  4YGA A;  1MUX A;  1WDC C;  3KEV A;  4DCK A;  1CMG A;  1ODB A;  2L4I A;  3TDU A;  1XFY O;  1KFU S;  4GGF C;  4MEW A;  4A4B A;  1XFV O;  4WRI A;  3TZ1 A;  3IF7 A;  1SKT A;  1UHK A;  3TDI A;  5BPJ A;  1C7W A;  5JOL A;  4DIR A;  2PAL A;  5AXI A;  1F70 A;  1NX0 A;  2L98 A;  3UO9 A;  4MRY A;  1CTR A;  2M1K B;  2P70 A;  4OKH A;  4TNC A;  1G8I A;  1K90 D;  4PDZ A;  4PT1 A;  4ETO A;  3FS7 A;  1K94 A;  2M29 A;  3A8R A;  1KQV A;  1M45 A;  3CYZ A;  1QIV A;  2LHL A;  1S3P A;  2M9G A;  2LUC A;  3CDN A;  1AVS A;  1CDL A;  1DF0 B;  2L5Y A;  3CS1 A;  1OMV A;  5HKY A;  4INX A;  4YI9 A;  1OSA A;  3ICB A;  4PAL A;  5F6T A;  1TN4 A;  1KK7 Y;  4YBH B;  3CR2 A;  1A2X A;  1SRA A;  1XFZ O;  1NSH A;  2CCM A;  2SAS A;  2WC6 A;  3FE9 A;  3S0A A;  3B7A A;  1F54 A;  1DMO A;  3SIB A;  1DVI A;  3O78 A;  5FI7 A;  1KWO C;  1OQP A;  3CZ2 A;  1S1E A;  3DYE A;  2JPT A;  3K21 A;  4I5N B;  2I94 A;  4QJ3 B;  3OX6 A;  1BOC A;  1D1O A;  2Y4Q A;  3N7H A;  1AJ5 A;  1CFP A;  1BMO A;  1SL8 A;  2L5X B;  4JQ0 D;  1QXP A;  4MZK A;  1KWO B;  2WCM A;  3BYA A;  3VRN A;  3SG6 A;  1F71 A;  1SPY A;  1BOD A;  1EL4 A;  4A4C A;  1B7T Y;  3VRP A;  3CAB A;  1N65 A;  1RTP 1;  3CR5 X;  4BY4 A;  2FJU B;  2ZN8 A;  2K60 A;  3CZT X;  2G2B A;  1U5I B;  2MA2 A;  2B1U A;  3B6X A;  3D0Y B;  2ZNE A;  1SL9 A;  3OB2 B;  1B4C A;  2JRF A;  2JTT A;  5I8N A;  1LXF C;  2JXL A;  1XYD A;  2BE6 A;  3SS3 A;  2EC6 C;  3H4S E;  3MSE B;  1FF1 A;  1XFR A;  1ZUZ A;  1QV0 A;  1IRJ A;  1QS7 A;  1QTX A;  2LP2 A;  3CGA A;  3CR4 X;  3R72 A;  1XFX O;  2BE4 A;  4MVF A;  2BL0 C;  3VB1 A;  3PAT A;  1EH2 A;  3S0G A;  2M97 A;  4OV2 A;  5FI6 A;  2EC6 B;  1FI6 A;  2Y1N A;  1DJH A;  1YUR A;  3GK1 A;  3S0F A;  1L2O C;  3AAJ A;  2QEV A;  2PAS A;  1TTX A;  2MBX A;  1ZMZ A;  1B47 A;  2BL0 B;  2D8N A;  2JZI A;  2LVJ A;  1SMG A;  1SR6 C;  1LA3 A;  1IQ3 A;  3KO0 A;  3BUM B;  2BCX A;  1TRF A;  2BNX A;  1DTL A;  2KLE A;  3F45 A;  1L2O B;  5G08 A;  4CFR A;  2BEC A;  3WHU B;  5CSN A;  2L0P A;  1EXR A;  1AJ4 A;  1YRU B;  2LLU A;  1SR6 B;  3DVE A;  1MWN A;  1YUU A;  1JUO A;  2K8M B;  2WCL A;  4MN0 A;  5ER4 X;  2GGM A;  2BKI B;  4QJ4 B;  1RRO A;  1N0Y A;  4OVN F;  1S5G Y;  2ZFD A;  1YVH A;  2M8U A;  2HF5 A;  1K9P A;  3LCP C;  2KYC A;  1NWD A;  2FCE A;  2M7N A;  3IVT A;  1TOP A;  3S0E A;  4P5O E;  3PM2 A;  4IJ7 A;  1A75 B;  4JWQ A;  3OB1 B;  1B9A A;  3KHE A;  1B8L A;  1CLM A;  2QDI A;  1K93 D;  3AKB A;  4JKT A;  4R1E A;  2LV7 A;  1X02 A;  1K95 A;  3S0D A;  2JU0 A;  4USL A;  3TDZ A;  3DF0 A;  1OOI X;  1C3Y A;  2QEH A;  1NUB A;  1Y1X A;  1OZS A;  5HYD A;  1JFJ A;  1F4Q A;  1WLZ A;  1QVI Z;  2L51 A;  1M46 A;  2LVK A;  4M2P A;  3NSL A;  3VRR A;  5K89 A;  4UPG A;  1BLQ A;  1VRK A;  1S36 A;  2E6W A;  3DZT A;  1DEL A;  2LLS A;  1TWO A;  1IIO A;  1MXE A;  2WCK A;  3EK8 A;  1SBJ A;  2LMV A;  2PQL A;  3B86 A;  2I7A A;  2F8P A;  3EG5 B;  1CFD A;  5D7F A;  2BAP A;  4N5X A;  3JVT C;  3ZWH A;  1TNQ A;  1OOJ A;  3L4L A;  1J7Q A;  4I5L B;  2LUX A;  1KSM A;  1NX1 A;  2I18 A;  1KK8 B;  2QEB A;  2K61 A;  3PSR A;  2WCJ A;  5CPV A;  1H8B A;  4HSZ A;  1TNW A;  4KYN A;  1CDN A;  3LK1 A;  3KF9 A;  3CZ0 A;  1OOH A;  1ALV A;  2GTE A;  2HQW A;  3NSO A;  2KBI A;  1AP4 A;  3JVT B;  3SS5 A;  1TUZ A;  1DEK A;  1OOF A;  4U8D A;  5DKR A;  1S6I A;  2KFF A;  3BJH A;  1EG3 A;  2LAN A;  2MJW B;  1CFF A;  2WC8 A;  2O60 A;  3AKA A;  1KCY A;  5HKZ A;  2FOT A;  2NCP A;  2RGI A;  1WRZ A;  2OS8 C;  3NSI A;  1JWD A;  1UUR A;  1J1D A;  1J7O A;  4PCW A;  3I5H C;  3PLF B;  2F2O A;  2YGU A;  3SIA A;  1Q80 A;  1SW8 A;  5HLV A;  4M2O A;  3DD4 A;  1JSA A;  3GOF A;  2H61 A;  1K9U A;  2CTN A;  2WC5 A;  2JQ6 A;  4GUK A;  4OZD A;  5DKN A;  4C0L A;  1XK4 A;  5KTY A;  2WCB A;  1NPQ A;  2OS8 B;  4OR9 B;  2FCD A;  3I5H B;  1GQM A;  1M39 A;  1DGU A;  1KK7 Z;  3E3R A;  4HRH A;  5I2Q A;  1J7R A;  1GJY A;  1TNX A;  2KAX A;  3QME A;  1PVA A;  1V1F A;  3BUW B;  1CDM A;  3HCM A;  3SG4 A;  1PUL A;  2LM5 A;  3O6B A;  3EK4 A;  2FJY A;  2NCO A;  1W7J B;  2A4J A;  1NX2 A;  3QRX A;  3R1V A;  4CPV A;  3WHT B;  1ALW A;  5DIC A;  2KAY A;  2AUC A;  1R2U A;  1DT7 B;  2L4H A; 
#chains in the Genus database with same CATH homology
 1V1G A;  3LL8 B;  2ZKM X;  1F55 A;  3WNX B;  2WOR A;  1QLK A;  5AEQ A;  1KFX S;  2LCP A;  1DJW A;  1NCX A;  1DJY A;  1AHR A;  1WLM A;  5ER5 A;  4AQI A;  1B7T Z;  5KU1 A;  1YX8 A;  3I5I C;  4GBA A;  2BBN A;  1JBA A;  2I2R E;  2KYF A;  4YRU A;  1SK6 D;  5HLO A;  4PHM A;  1ZAC A;  3BUX B;  5PAL A;  1SCV A;  1K2H A;  1XFU O;  2HET A;  2COL B;  2LE9 B;  1OMD A;  4C0J A;  4I5J A;  4MSP A;  1DJG A;  4PHN A;  3I5I B;  2G9B A;  3LLE A;  4YGB B;  1DGV A;  5IBW A;  1BR4 B;  1IGV A;  3GK2 A;  1MQ1 A;  1QLS A;  1IQ5 A;  2GGZ A;  1F4O A;  2OTG C;  4PE7 A;  1CFC A;  4NDC A;  1RWY A;  2MRD A;  2JT0 A;  4DUQ A;  2MAZ A;  5CSI A;  2CBL A;  4GGF A;  4P2Y B;  1SYM A;  1XVJ A;  1KFX L;  1RFJ A;  1HT9 A;  1YUS A;  1A4P A;  1ZFS A;  2JOJ A;  4XYN A;  1CKK A;  4XJK B;  1TNP A;  1Y6W A;  1QX5 B;  2OTG B;  1B1G A;  1W7I B;  2SCP A;  2JTZ A;  5FYX A;  1K9K A;  3HX4 A;  3D10 A;  1Y1A A;  1DF0 A;  2KI6 C;  4F0Z B;  1PRW A;  3PFV A;  2ZN9 A;  1SCM B;  4ORA B;  5DKQ A;  2HQ8 A;  4ZCV A;  5J3X A;  1B8R A;  2Q4U A;  1B8C A;  3C1V A;  1N2D A;  2PSR A;  4PE1 A;  3LK0 A;  4HRE E;  1FW4 A;  2ZND A;  2LVI A;  2K7O A;  2EHB A;  1UHI A;  4YI8 A;  1WRL A;  1EG4 A;  1QX7 A;  2LC5 A;  4D1E A;  3I5G C;  3NXA A;  1M31 A;  1CM4 A;  1S5G Z;  2BBM A;  4FQO A;  1BJF A;  3BXK A;  2LNK A;  3DVK A;  3SG7 A;  1RK9 A;  2O5G A;  1XK4 C;  2OPO A;  2TN4 A;  1YUT A;  3BOW A;  3FIA A;  1DJI A;  4YGC B;  1KQM B;  3TUY C;  3I5F C;  2PMY A;  3A4U B;  2KHN A;  3I5G B;  3OX5 A;  4E68 A;  1MHO A;  3D0Y A;  1U5I A;  3EVU A;  1FPW A;  4CLN A;  1J7P A;  1UWO A;  2WCE A;  2KQ6 A;  3TUY B;  3I5F B;  2K0J A;  4YGD B;  3ZNI A;  1K8U A;  2NLN A;  3EVV A;  1KK8 C;  2AMI A;  3EK7 A;  4OCI A;  2JNX A;  3PN7 C;  2KFG A;  3RM1 A;  2DOQ A;  2F33 A;  2HPS A;  1CLL A;  2LLT A;  4AOM A;  4CFQ A;  1CM1 A;  1QX2 A;  1XA5 A;  3PN7 B;  4FTG A;  2KQY A;  2K7C A;  3NSK A;  2ZRS A;  3IQO A;  1UUS A;  1QIW A;  1IWQ A;  4PE4 A;  1YRT B;  2F3Z A;  4QJ5 B;  2M7L A;  1NP8 A;  1OZO A;  2JT8 A;  1A03 A;  1LIN A;  4PHK A;  5GQQ C;  2ISD A;  4BY5 A;  4C0K A;  4DRW A;  5KSZ A;  2JXC A;  1S6C A;  3BQ3 A;  2KI6 D;  2KAV A;  1FI5 A;  3O2P A;  1C07 A;  4WQ3 A;  2JT3 A;  1LKJ A;  4AQJ A;  1PSB A;  1TCO B;  4MBE A;  1BG1 A;  2BCA A;  1QJT A;  1XO5 A;  2V53 A;  4PE0 A;  1SY9 A;  2LP3 A;  3IQQ A;  1TCF A;  1UHN A;  1MXL C;  1JFK A;  1Y1U A;  4GNK B;  2LAP A;  4WQ2 A;  2K7D A;  2KBM A;  1WDC B;  2EGD A;  3SJS A;  1BR1 B;  5I2O A;  1YTZ C;  2KI4 C;  2JWW A;  1A75 A;  1AUI B;  5B8I B;  1CMF A;  4GGN A;  1IG5 A;  3EVR A;  5I2L A;  1BT6 A;  1S26 D;  1KSO A;  2KI4 B;  2K7B A;  5CSF A;  2H2K A;  3VGO A;  1CNP A;  3DVJ A;  3SG5 A;  3AAK A;  1MR8 A;  2MLE C;  4M2Q A;  1QAT A;  3DVM A;  2F3Y A;  1EJ3 A;  3SG3 A;  1BU3 A;  1J1E A;  1G4Y R;  4ORC B;  3CLN A;  1UHJ A;  1DJX A;  2M0R A;  1KFU L;  2CT9 A;  3M0W A;  2L2E A;  4MLW A;  1GGZ A;  5TNC A;  5AAN A;  1ZOT B;  1F8H A;  3PAL A;  3CWG A;  2CNP A;  1Y0V H;  4DS7 A;  1G33 A;  2GV5 A;  2MHH A;  3BOW B;  2LHI A;  2Y1M A;  4ORB B;  4GFT A;  3OP0 A;  3BUN B;  1CDP A;  2VRG A;  2BKH B;  1FBV A;  1E8A A;  3DF0 B;  1JC2 A;  1NIW A;  1OMR A;  1SCM C;  2M1U A;  1SL7 A;  1XFW O;  1IH0 A;  1PVB A;  2WCF A;  1TIZ A;  1PSR A;  1C7V A;  3WXA A;  2LVV A;  1CLB A;  2MLF C;  2R2I A;  2K2A A;  5AER A;  2K2F A;  4L9M A;  3VRO A;  2KFH A;  1PAL A;  2M49 B;  3EKJ A;  4ZCU A;  1M63 B;  2ZRT A;  1BF5 A;  2CXJ A;  2KGB C;  3EKH A;  4MZL A;  1LVC D;  3VRQ A;  2WOS A;  1AK8 A;  4JPZ B;  1L7Z A;  2P6B B;  1LA0 A;  3TS5 C;  2KSP A;  4N1G A;  4IL1 A;  1KQM C;  2BCB A;  1WY9 A;  3PM8 A;  1H4B A;  4ICB A;  1PK0 D;  2H61 C;  3FWC A;  1HQV A;  2E30 A;  2KDH A;  1OE9 B;  3TS5 B;  2Q91 A;  1DJZ A;  2QPT A;  4MRX A;  3OHM B;  4YGE B;  1MF8 B;  1R6P A;  5CSJ A;  1NCY A;  1UHH A;  1RJV A;  2KOT A;  4MZJ A;  1JF2 A;  2L50 A;  3CTN A;  1WRK A;  2JC2 A;  2F2P A;  1REC A;  4GPL B;  5JJG A;  2QAC A;  3BUO B;  1CB1 A;  1NYA A;  5D69 A;  1A29 A;  1UP5 A;  3SG2 A;  4NDB A;  4PHJ A;  2KGR A;  3JTD C;  5AFP A;  4NQG A;  1S6J A;  2PVB A;  4N1F A;  3RLZ A;  2WND A;  1IKU A;  1GGW A;  2LMU A;  4NDD A;  3O4Y A;  2IS9 A;  4GAO A;  1NCZ A;  1YX7 A;  1YR5 A;  1QVI Y;  1JF0 A;  1K96 A;  3KPX A;  2LMT A;  3JTD B;  2AAO A;  1IJ6 A;  5HKW A;  4XJK A;  2JUL A;  3GK4 X;  4I5K A;  2PRU A;  1YVL A;  2KNE A;  1QV1 A;  4Q04 A;  2M3W A;  2Y5I A;  2JNF A;  2NXQ A;  4CID A;  1J55 A;  2NZ0 A;  3FWB A;  1NX3 A;  4HRG A;  1IJ5 A;  1SNL A;  1QAS A;  4YGA A;  1MUX A;  1WDC C;  3KEV A;  4DCK A;  1CMG A;  1ODB A;  2L4I A;  3TDU A;  1XFY O;  1KFU S;  4GGF C;  4MEW A;  4A4B A;  1XFV O;  4WRI A;  3TZ1 A;  3IF7 A;  1SKT A;  1UHK A;  3TDI A;  5BPJ A;  1C7W A;  5JOL A;  4DIR A;  2PAL A;  5AXI A;  1F70 A;  1NX0 A;  2L98 A;  4MRY A;  1CTR A;  2M1K B;  4OKH A;  4TNC A;  1G8I A;  1K90 D;  4PDZ A;  4ETO A;  3FS7 A;  1K94 A;  2M29 A;  3A8R A;  1KQV A;  1M45 A;  1QIV A;  2LHL A;  1S3P A;  2M9G A;  2LUC A;  1AVS A;  1CDL A;  1DF0 B;  3CS1 A;  1OMV A;  5HKY A;  4YI9 A;  1OSA A;  3ICB A;  4PAL A;  5F6T A;  1TN4 A;  1KK7 Y;  4YBH B;  3CR2 A;  1A2X A;  1SRA A;  1XFZ O;  1NSH A;  2CCM A;  2SAS A;  1F54 A;  1DMO A;  3SIB A;  1DVI A;  3O78 A;  1KWO C;  1OQP A;  1S1E A;  2JPT A;  3K21 A;  4I5N B;  2I94 A;  4QJ3 B;  3OX6 A;  1BOC A;  1D1O A;  2Y4Q A;  1AJ5 A;  1CFP A;  1BMO A;  1SL8 A;  2L5X B;  4JQ0 D;  1QXP A;  4MZK A;  1KWO B;  3BYA A;  3VRN A;  3SG6 A;  1F71 A;  1SPY A;  1BOD A;  1EL4 A;  4A4C A;  1B7T Y;  3VRP A;  1N65 A;  1RTP 1;  3CR5 X;  4BY4 A;  2FJU B;  2ZN8 A;  3D0Y B;  3CZT X;  2G2B A;  1U5I B;  2MA2 A;  2B1U A;  2ZNE A;  1SL9 A;  3OB2 B;  1B4C A;  2JRF A;  2JTT A;  5I8N A;  1LXF C;  2JXL A;  1XYD A;  2BE6 A;  1FF1 A;  2EC6 C;  3H4S E;  3MSE B;  1ZUZ A;  1QV0 A;  1IRJ A;  1QS7 A;  1QTX A;  2LP2 A;  3CGA A;  3CR4 X;  1XFX O;  2BE4 A;  4MVF A;  2BL0 C;  1EH2 A;  3PAT A;  2M97 A;  4OV2 A;  2EC6 B;  1FI6 A;  2Y1N A;  1DJH A;  1YUR A;  3GK1 A;  1L2O C;  3AAJ A;  2PAS A;  1TTX A;  2MBX A;  1ZMZ A;  1B47 A;  2BL0 B;  2D8N A;  2JZI A;  2LVJ A;  1SMG A;  1SR6 C;  1LA3 A;  1IQ3 A;  3KO0 A;  3BUM B;  2BCX A;  1TRF A;  1DTL A;  3F45 A;  5G08 A;  1L2O B;  4CFR A;  2BEC A;  3WHU B;  5CSN A;  2L0P A;  1EXR A;  1AJ4 A;  1YRU B;  2LLU A;  1SR6 B;  3DVE A;  1MWN A;  1YUU A;  1JUO A;  2K8M B;  5ER4 X;  4MN0 A;  2GGM A;  2BKI B;  4QJ4 B;  1RRO A;  1N0Y A;  4OVN F;  1S5G Y;  2ZFD A;  1YVH A;  2M8U A;  2HF5 A;  1K9P A;  3LCP C;  2KYC A;  1NWD A;  2FCE A;  2M7N A;  1TOP A;  4P5O E;  1A75 B;  4JWQ A;  3OB1 B;  1B9A A;  3KHE A;  1B8L A;  1CLM A;  3AKB A;  1K93 D;  4R1E A;  2LV7 A;  1X02 A;  1K95 A;  2JU0 A;  4USL A;  3TDZ A;  3DF0 A;  1NUB A;  1Y1X A;  1OZS A;  5HYD A;  1JFJ A;  1F4Q A;  1WLZ A;  1QVI Z;  2L51 A;  1M46 A;  2LVK A;  4M2P A;  3NSL A;  3VRR A;  5K89 A;  4UPG A;  1BLQ A;  1VRK A;  1S36 A;  2E6W A;  2LLS A;  1MXE A;  3EK8 A;  1SBJ A;  2LMV A;  2I7A A;  2F8P A;  1CFD A;  5D7F A;  4N5X A;  3JVT C;  3ZWH A;  1TNQ A;  1OOJ A;  1J7Q A;  4I5L B;  2LUX A;  1KSM A;  1NX1 A;  2I18 A;  1KK8 B;  3PSR A;  2K61 A;  5CPV A;  1H8B A;  4HSZ A;  1TNW A;  1CDN A;  3LK1 A;  3KF9 A;  1ALV A;  3NSO A;  2HQW A;  1AP4 A;  2KBI A;  3JVT B;  4U8D A;  5DKR A;  1S6I A;  2KFF A;  1EG3 A;  2LAN A;  2MJW B;  1CFF A;  2WC8 A;  2O60 A;  3AKA A;  1KCY A;  5HKZ A;  2FOT A;  2NCP A;  2RGI A;  1WRZ A;  2OS8 C;  3NSI A;  1JWD A;  1UUR A;  1J1D A;  1J7O A;  4PCW A;  3I5H C;  3PLF B;  2F2O A;  3SIA A;  1Q80 A;  1SW8 A;  5HLV A;  4M2O A;  3DD4 A;  1JSA A;  3GOF A;  2H61 A;  1K9U A;  2CTN A;  4C0L A;  2JQ6 A;  4GUK A;  5DKN A;  5KTY A;  1XK4 A;  2WCB A;  1NPQ A;  2OS8 B;  4OR9 B;  2FCD A;  3I5H B;  1GQM A;  1M39 A;  1DGU A;  1KK7 Z;  3E3R A;  4HRH A;  5I2Q A;  1J7R A;  1GJY A;  1TNX A;  2KAX A;  1PVA A;  1V1F A;  3BUW B;  1CDM A;  3HCM A;  3SG4 A;  1PUL A;  2LM5 A;  3O6B A;  3EK4 A;  2NCO A;  1W7J B;  2A4J A;  1NX2 A;  3QRX A;  4CPV A;  3WHT B;  1ALW A;  2KAY A;  2AUC A;  1R2U A;  1DT7 B;  2L4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...