1KCYA

Nmr solution structure of apo calbindin d9k (f36g + p43m mutant)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEGPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calbindin D9k
publication title The EF-hand domain: a globally cooperative structural unit.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 25
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kcyA00
1SL8A 2TN4A 3BUWB 2ZRSA 2JT8A 4D1EA 1YUTA 2ZFDA 1OMVA 1WDCB 3O78A 4XJKA 2LVVA 1JUOA 4GGFC 5CPVA 2JT3A 5HKYA 4WQ2A 1A75A 2JXLA 1RJVA 1QS7A 2LC5A 2CTNA 2ZN9A 1SL9A 1OQPA 1J7OA 5D7FA 4AOMA 2KBMA 1BR1B 2JRFA 2HQWA 1S6IA 5DKRA 2A4JA 5K89A 1FI6A 1VRKA 3CWGA 2OS8B 1NPQA 1KSMA 3I5FB 1CM4A 3NXAA 4MZJA 1MF8B 1SY9A 2JTZA 3BUOB 4PALA 1CKKA 1XFWO 1JBAA 1C7WA 2GGMA 4WRIA 2CCMA 2JT0A 1SRAA 5I2OA 3EVUA 2HETA 5KU1A 2HF5A 2L51A 4GUKA 1RK9A 1U5IB 4XYNA 1EJ3A 4CLNA 1IJ5A 1KK7Y 1G8IA 2BBMA 1FPWA 2MRDA 2F2OA 5ER4X 4CIDA 1XFVO 1Y1UA 4CPVA 4I5JA 1CFCA 1W7JB 4MVFA 2K2FA 3JVTC 1L2OB 4BY4A 1QIVA 1CLLA 1CMFA 1QV0A 1UHKA 3RM1A 4R1EA 1TOPA 3JTDC 2NLNA 5ER5A 4OV2A 4AQJA 3NSLA 5TNCA 1NSHA 2M8UA 1F8HA 5CSIA 1GQMA 1WRZA 4PHNA 3VRRA 4QJ4B 2KI6C 2K2AA 2WC8A 1UHHA 3LL8B 3SJSA 3DF0B 3E3RA 1RECA 3MSEB 1GJYA 2JNXA 3CLNA 1WDCC 3I5HC 1S6CA 1QVIY 2JPTA 3KF9A 1SR6C 1R6PA 2F8PA 1J7QA 1Y6WA 1KWOB 1QXPA 1IQ5A 2L50A 2Y5IA 2PMYA 1F4OA 1ZUZA 1S5GZ 2I18A 3K21A 1ALVA 2WNDA 3QRXA 1FW4A 5HLVA 4YGEB 1JSAA 4PE7A 1GGWA 1DJHA 3NSIA 1XFYO 1SNLA 1ZMZA 2OS8C 1QLSA 2K7DA 2KFGA 3I5FC 2I94A 4DUQA 1KQMB 1S26D 3SG2A 2NXQA 2KAXA 5IBWA 4OR9B 1F4QA 1G33A 3SG7A 3KPXA 1IWQA 1BMOA 1ZFSA 1MXEA 2LNKA 1YX8A 3VROA 5D69A 1NCYA 1DJYA 1K8UA 1QTXA 1S3PA 1AP4A 4L9MA 1XFZO 2SCPA 1H4BA 2KYCA 2KDHA 2NCOA 1MUXA 4YGDB 2BECA 1QX5B 1J7RA 1JFKA 1EH2A 1HT9A 2H61C 4DS7A 2ISDA 4A4CA 2WCFA 1NIWA 1L2OC 1YURA 2LLUA 4YGBB 1XYDA 1A4PA 1SL7A 3CTNA 4NDDA 3ZWHA 1OMRA 2MLEC 2LP3A 1ODBA 1M31A 2ZNDA 3OX6A 4PHMA 5AERA 1TCFA 2AUCA 3M0WA 4U8DA 3VRNA 1N0YA 2PVBA 5I2LA 2RGIA 3TUYB 4FTGA 4XJKB 2PSRA 1YUUA 5AXIA 4GGFA 1A75B 1B8RA 2HPSA 1N2DA 2G2BA 3EK4A 1XFUO 3ICBA 3OB2B 3OB1B 3OHMB 1KFXL 1CDNA 1EG3A 3KEVA 3OP0A 1KWOC 2KYFA 5HYDA 2H2KA 1DJIA 4MSPA 1PRWA 4Q04A 2BCAA 1CTRA 2L98A 4GPLB 1AVSA 5HLOA 3TDUA 1QX7A 1YVHA 1DJXA 5AANA 2KFHA 1SCMC 4GBAA 2F3YA 2SASA 1W7IB 3LCPC 2M1UA 2JWWA 3PLFB 1AUIB 1WLMA 4ETOA 2LLSA 4P2YB 1UURA 1KQMC 1Y1AA 5CSNA 1F71A 1PSBA 3AAKA 2KBIA 1DVIA 4IL1A 1A2XA 2KHNA 1F54A 1B7TZ 2JU0A 3D0YA 2QPTA 1WLZA 2KGBC 1BT6A 1G4YR 1CLBA 2E30A 3O2PA 2F3ZA 1MXLC 1CNPA 2NZ0A 2K8MB 3HCMA 1YUSA 2KAVA 5JJGA 1QLKA 1SK6D 4PE1A 4BY5A 1LKJA 1NCXA 2ZN8A 1KK8B 1KFUL 3CGAA 2LV7A 2OPOA 1M45A 1K95A 2Y1NA 1IH0A 1JWDA 1LA3A 1JF0A 3GK4X 1AHRA 2MA2A 1YX7A 2Q4UA 2JXCA 1FF1A 2EGDA 4I5NB 1TNQA 3DVKA 1CMGA 1CFDA 3NSOA 3SG4A 3TUYC 4DRWA 1BF5A 2AAOA 1QV1A 2CXJA 2KAYA 2OTGB 5KTYA 1BR4B 4QJ3B 2BE6A 2L4IA 1J55A 2PRUA 4C0KA 1YR5A 2LMUA 1YRUB 2LM5A 2Y1MA 4HRGA 1PSRA 3IQOA 1XA5A 3GK2A 1CB1A 4YI8A 4PE0A 3SG5A 1OZSA 3PSRA 1NX1A 1IQ3A 4MN0A 1UHJA 4PDZA 1J1EA 1MWNA 1WRLA 3F45A 1CFFA 4N5XA 2M29A 1KCYA 3DD4A 3WHUB 1S5GY 4ZCUA 1DF0A 2ZRTA 2ZKMX 2M97A 2M0RA 1NP8A 1NCZA 4ORBB 1OMDA 2WOSA 2K61A 3EK7A 3BOWA 3O6BA 1IKUA 2CT9A 2LUXA 1RROA 3PFVA 4A4BA 1MQ1A 2KI4B 4HRHA 1DTLA 2FCDA 3GK1A 1M39A 2LHIA 2K7CA 3D10A 3GOFA 2NCPA 1K9UA 1LA0A 1QX2A 2B1UA 2LANA 2PALA 1S36A 1J7PA 2L4HA 1OE9B 2LMVA 2IS9A 1CDLA 3AKBA 1MR8A 4MEWA 1KSOA 1PVBA 1XK4A 4N1GA 1K9PA 1DMOA 4FQOA 4CFQA 1CFPA 3IQQA 5GQQC 3I5GB 4YBHB 1RTP1 2LVIA 3ZNIA 1BU3A 5AFPA 1MHOA 4MBEA 4NDBA 3RLZA 2F2PA 2BBNA 3BQ3A 4PHKA 1K2HA 1TN4A 2LE9B 2MLFC 4OKHA 4GNKB 1FBVA 1UHNA 2L5XB 2LVJA 1B9AA 2WCBA 2COLB 2EC6B 3AAJA 2OTGC 3O4YA 2JZIA 1BODA 4GGNA 1OZOA 3BUXB 1J1DA 1E8AA 3A4UB 3BXKA 2KNEA 1DT7B 1K90D 2KQYA 4N1FA 1NYAA 4MRYA 4ORCB 1LINA 4JPZB 1IG5A 3SG6A 2O5GA 1TNXA 1XFXO 2M1KB 4GFTA 1A29A 1BLQA 1PALA 3TDZA 1SW8A 2O60A 4JQ0D 2WORA 2MBXA 1LVCD 2ZNEA 2MJWB 1UUSA 4YGCB 3KO0A 5G08A 1IGVA 2R2IA 4MRXA 2LUCA 4ZCVA 2M7LA 2LLTA 2CBLA 3TS5B 4YI9A 3D0YB 2BL0B 3FS7A 2HQ8A 2KI4C 3CZTX 4I5LB 4TNCA 3FIAA 3JVTB 4M2QA 2JOJA 4MZLA 2M49B 1C7VA 3NSKA 4PHJA 1S6JA 2M9GA 2L2EA 4F0ZB 2VRGA 1JC2A 1B7TY 2AMIA 1OOJA 3KHEA 3SG3A 1TNPA 2G9BA 3CS1A 2CNPA 5B8IB 1CDMA 3PATA 3I5GC 1JF2A 3OX5A 2FOTA 1DJZA 3TDIA 4YRUA 3VGOA 1K9KA 1AJ4A 1B47A 4JWQA 3I5HB 3PALA 2P6BB 3LK1A 1SR6B 5CSJA 1QASA 4WQ3A 4C0LA 1H8BA 1UWOA 1QIWA 3WXAA 1HQVA 1SPYA 2FJUB 1PK0D 2EC6C 3CR5X 1K96A 1KQVA 4MLWA 2K7BA 1QJTA 5F6TA 3CR2A 3PN7B 4OCIA 4E68A 1CLMA 3DVMA 3FWBA 1SMGA 1BG1A 1OSAA 1QATA 1GGZA 3VRQA 2E6WA 1D1OA 3A8RA 1DF0B 5KSZA 1DJGA 1EG4A 1AK8A 3SIBA 2FCEA 4DCKA 3SIAA 3WHTB 3BOWB 3C1VA 3CR4X 2KGRA 5PALA 2JC2A 2LAPA 5BPJA 1EL4A 2JNFA 2BE4A 4PE4A 3TS5C 1NX2A 2BL0C 5FYXA 1IRJA 1XO5A 1WRKA 2M3WA 5HKZA 1UHIA 3H4SE 4ORAB 1BOCA 1NUBA 4M2OA 1KK7Z 3I5IB 2LHLA 4AQIA 3BUMB 2Q91A 2MAZA 1B1GA 3DVJA 1K93D 4I5KA 1R2UA 1AJ5A 2WCEA 2K0JA 1ZOTB 1CDPA 2V53A 1U5IA 2K7OA 4USLA 1DGVA 1L7ZA 3LLEA 4PCWA 1F55A 4C0JA 1NX0A 1YRTB 4NQGA 4GAOA 1PULA 2H61A 2BCXA 2LMTA 2LVKA 1YVLA 3FWCA 2JTTA 1SBJA 2JQ6A 5I2QA 2DOQA 1KK8C 3HX4A 2KQ6A 5I8NA 3VRPA 4OVNF 3PM8A 2PASA 1QVIZ 1B4CA 1NWDA 1RWYA 3EVVA 1S1EA 1UP5A 3EK8A 1SCMB 3PN7C 2I7AA 1SYMA 3DF0A 4M2PA 4HREE 1EXRA 5DKQA 4UPGA 1B8LA 3LK0A 4NDCA 1WY9A 1Y1XA 2BCBA 3WNXB 1JFJA 3EKJA 4CFRA 1RFJA 5DKNA 1KFXS 1M63B 3IF7A 5JOLA 1LXFC 4QJ5B 5HKWA 1A03A 1ZACA 1K94A 1BJFA 2BKIB 2LP2A 1C07A 1XVJA 2EHBA 1YTZC 1FI5A 3TZ1A 1Q80A 2QACA 2KSPA 4DIRA 3EVRA 2F33A 2JULA 3I5IC 1NX3A 1XK4C 1ALWA 1F70A 3EKHA 3BUNB 1V1FA 4YGAA 1DGUA 2D8NA 1B8CA 4HSZA 4MZKA 2GGZA 1CM1A 1M46A 1DJWA 1N65A 5AEQA 1TNWA 1IJ6A 1TCOB 2BKHB 2Y4QA 1TTXA 4P5OE 2M7NA 2LCPA 3DVEA 3JTDB 2KOTA 1X02A 1SKTA 2KI6D 1Y0VH 5J3XA 1TIZA 1TRFA 1KFUS 2GV5A 1PVAA 4ICBA 1SCVA 2I2RE 2MHHA 2KFFA 2L0PA 3BYAA 3AKAA 5CSFA 1V1GA
chains in the Genus database with same CATH superfamily
3D75A 1SL8A 2TN4A 3BUWB 2ZRSA 3PJIA 2JT8A 4D1EA 1YUTA 2ZFDA 1OMVA 1WDCB 3O78A 4XJKA 2LVVA 1JUOA 4GGFC 5CPVA 2JT3A 5HKYA 4WQ2A 1A75A 2JXLA 3O4XA 1RJVA 1QS7A 3S0AA 2LC5A 2CTNA 2ZN9A 1SL9A 1SSEB 1OQPA 1J7OA 5D7FA 3BFBA 2KBMA 4AOMA 1BR1B 2JRFA 2HQWA 1S6IA 5DKRA 2A4JA 5K89A 1FI6A 1VRKA 3CWGA 2OS8B 1NPQA 1KSMA 3I5FB 1CM4A 2YGUA 3L4LA 3NXAA 4MZJA 1MF8B 1SY9A 2JTZA 3BUOB 4PALA 1CKKA 1XFWO 1JBAA 1C7WA 2GGMA 2L2CA 4WRIA 2CCMA 2JT0A 1SRAA 5I2OA 3EVUA 2HETA 5KU1A 2HF5A 2L51A 4GUKA 3SS5A 1RK9A 1U5IB 4XYNA 1EJ3A 4CLNA 1IJ5A 3B88A 1KK7Y 1G8IA 2BBMA 1FPWA 2MRDA 1W9ZA 2F2OA 5ER4X 4CIDA 1XFVO 1Y1UA 3NHIA 4I5JA 4CPVA 1CFCA 1W7JB 4MVFA 1OOIX 2K2FA 3JVTC 1L2OB 4BY4A 1QIVA 1TWOA 1CLLA 3CYZA 1CMFA 1QV0A 1UHKA 3RM1A 4R1EA 1TOPA 3JTDC 2NLNA 5ER5A 4OV2A 3B7AA 4AQJA 3NSLA 1T14A 1NSHA 2M8UA 5TNCA 1F8HA 5CSIA 1GQMA 1OOFA 1WRZA 4PHNA 3DYEA 3VRRA 4QJ4B 2KI6C 2K2AA 2WC8A 1UHHA 3LL8B 3SJSA 3DF0B 3E3RA 1RECA 3MSEB 1GJYA 2JNXA 3CLNA 1WDCC 3I5HC 1S6CA 1QVIY 2JPTA 3KF9A 1SR6C 1R6PA 2F8PA 1J7QA 1Y6WA 1KWOB 1QXPA 1IQ5A 2L50A 2Y5IA 2PMYA 1F4OA 1ZUZA 1S5GZ 2I18A 3K21A 1ALVA 2WNDA 4OZDA 3QRXA 1FW4A 5HLVA 4YGEB 1JSAA 4PE7A 1LS8A 1GGWA 1DJHA 4IJ7A 3NSIA 1XFYO 3V2LA 1SNLA 2GTEA 1ZMZA 2OS8C 1QLSA 3S0DA 2K7DA 2KFGA 3I5FC 1ORGA 2I94A 4DUQA 3BFAA 3D73A 1KQMB 1S26D 3SG2A 2NXQA 2KAXA 3SS3A 5IBWA 4OR9B 1F4QA 1G33A 3SG7A 3KPXA 1IWQA 1BMOA 1ZFSA 1MXEA 1DQEA 2LNKA 1YX8A 2WC5A 3VROA 5D69A 1NCYA 1DJYA 1K8UA 1QTXA 1S3PA 1AP4A 4L9MA 1XFZO 2SCPA 1H4BA 2KYCA 2KDHA 2NCOA 1MUXA 4YGDB 2BECA 1QX5B 1J7RA 1JFKA 1EH2A 1HT9A 2H61C 2KPHA 3CABA 2ISDA 4A4CA 4DS7A 2WCFA 1NIWA 1L2OC 1YURA 2LLUA 4YGBB 1XYDA 1A4PA 1DELA 1SL7A 3CTNA 4NDDA 3ZWHA 1OMRA 3CDNA 2MLEC 2LP3A 1ODBA 1M31A 2ZNDA 3OX6A 4PHMA 5AERA 1TCFA 2AUCA 3M0WA 4U8DA 2ERBA 3VRNA 1N0YA 2PVBA 5I2LA 2RGIA 3TUYB 4FTGA 4XJKB 2PSRA 1YUUA 2H8VA 5AXIA 2KLEA 4GGFA 1A75B 1B8RA 2HPSA 1N2DA 2G2BA 2WCMA 1XFUO 3EK4A 3ICBA 3OB2B 3OB1B 3BJHA 3OHMB 1KFXL 1CDNA 1QWVA 1EG3A 3KEVA 3OP0A 1KWOC 2KYFA 5HYDA 2H2KA 1DJIA 4MSPA 1PRWA 3IVTA 4Q04A 2BCAA 1CTRA 2L98A 4GPLB 1AVSA 2BNXA 3R1PA 1QX7A 3D76A 4JKTA 5HLOA 1YVHA 1DJXA 5AANA 2KFHA 1SCMC 2L5YA 2F3YA 2SASA 1W7IB 3LCPC 4GBAA 2M1UA 2JWWA 3PLFB 1AUIB 1WLMA 4ETOA 2LLSA 4P2YB 1UURA 1KQMC 1Y1AA 5CSNA 1F71A 1PSBA 3AAKA 2KBIA 1DVIA 4IL1A 5FI6A 3VB1A 4F7FA 1TUJA 1A2XA 1DEKA 2KHNA 2QDIA 1F54A 5FI2A 1B7TZ 2JU0A 3D0YA 2QPTA 1WLZA 2KGBC 3S0EA 3S0FA 1BT6A 1G4YR 1CLBA 2E30A 3O2PA 2F3ZA 1MXLC 1CNPA 2NZ0A 2K8MB 3HCMA 1YUSA 2KAVA 5JJGA 1QLKA 3R1VA 1SK6D 4PE1A 4PT1A 4BY5A 1LKJA 1NCXA 1OOHA 2ZN8A 1KK8B 1KFUL 3CGAA 2LV7A 2OPOA 1M45A 1K95A 2Y1NA 1IH0A 1JWDA 1LA3A 1JF0A 3GK4X 1AHRA 2MA2A 1YX7A 3SS4A 2Q4UA 3NHTA 3OBVA 2JXCA 1FF1A 2EGDA 4I5NB 1TNQA 3DVKA 1CMGA 1CFDA 2WC6A 3NSOA 3SG4A 4DRWA 3TUYC 1BF5A 2AAOA 1QV1A 2CXJA 2KAYA 2OTGB 5KTYA 1BR4B 4QJ3B 2BE6A 2L4IA 1J55A 2PRUA 1XFRA 3D78A 4C0KA 1YR5A 2LMUA 1YRUB 2LM5A 2Y1MA 4HRGA 1P28A 1PSRA 3IQOA 1XA5A 3GK2A 1CB1A 4YI8A 4PE0A 3SG5A 1OZSA 4FQTA 3PSRA 4JD9A 1NX1A 1IQ3A 4MN0A 1UHJA 4PDZA 1J1EA 1MWNA 1WRLA 3F45A 1CFFA 4N5XA 2M29A 2P70A 1KCYA 3DD4A 3WHUB 3FE6A 2PYQA 1S5GY 3R1OA 4ZCUA 1DF0A 2ZRTA 2ZKMX 4INWA 2M97A 2M0RA 1NP8A 1NCZA 4ORBB 1OMDA 2WOSA 2K61A 3EK7A 3BOWA 2QEOA 3O6BA 1IKUA 2CT9A 2LUXA 1RROA 3PFVA 4A4BA 1MQ1A 2KI4B 2WCJA 4HRHA 1DTLA 2FCDA 3GK1A 1M39A 2LHIA 2K7CA 3D10A 3GOFA 2NCPA 1K9UA 1LA0A 1QX2A 2B1UA 2LANA 2PALA 1S36A 3NGVA 2L4HA 1OE9B 1J7PA 2LMVA 2IS9A 1CDLA 3AKBA 1MR8A 4MEWA 1KSOA 1PVBA 1XK4A 2KLDA 1K9PA 4N1GA 1DMOA 4FQOA 4CFQA 1CFPA 3IQQA 5GQQC 3I5GB 4YBHB 1RTP1 2LVIA 3ZNIA 1BU3A 5AFPA 1MHOA 4MBEA 4NDBA 3RLZA 1C3ZA 2F2PA 2BBNA 3BQ3A 4PHKA 1K2HA 3D74A 1TN4A 2WCKA 2LE9B 2MLFC 2WCLA 1OOGA 4OKHA 4GNKB 1FBVA 1UHNA 2L5XB 2LVJA 1B9AA 2WCBA 2COLB 2EC6B 3AAJA 2OTGC 3L47A 3O4YA 2JZIA 1BODA 4INXA 4GGNA 1OZOA 1TUZA 3BUXB 1J1DA 1E8AA 3A4UB 3BXKA 2KNEA 1DT7B 1K90D 2KQYA 4N1FA 1NYAA 4MRYA 4ORCB 1LINA 4JPZB 1IG5A 3SG6A 2O5GA 2WCHA 3Q8IA 1TNXA 3DY9A 1XFXO 2M1KB 5EL2A 4GFTA 1A29A 1BLQA 1PALA 3TDZA 1SW8A 2O60A 4JQ0D 2WORA 2MBXA 1LVCD 2ZNEA 2MJWB 1UUSA 4YGCB 3KO0A 5G08A 1IGVA 2R2IA 4MRXA 2LUCA 4ZCVA 2M7LA 3K1EA 2LLTA 3B87A 2CBLA 3FE9A 4YI9A 3TS5B 3D0YB 2BL0B 3FS7A 2HQ8A 2KI4C 2P71A 3CZTX 4I5LB 4TNCA 3FIAA 3L4AA 3JVTB 4M2QA 2JOJA 4MZLA 2M49B 1C7VA 3NSKA 4PHJA 1S6JA 2M9GA 2L2EA 4F0ZB 2VRGA 1JC2A 1B7TY 2AMIA 1OOJA 3KHEA 3SG3A 1TNPA 2G9BA 3B86A 3CS1A 2CNPA 5B8IB 1CDMA 3PATA 3I5GC 1JF2A 3OX5A 2FOTA 1DJZA 3N7HA 3TDIA 4YRUA 5HL1A 3VGOA 1K9KA 1Z4HA 1AJ4A 1B47A 4JWQA 3I5HB 3PALA 2P6BB 3LK1A 1SR6B 5CSJA 1QASA 4WQ3A 4C0LA 1H8BA 1UWOA 1QIWA 3WXAA 2QEVA 1HQVA 1SPYA 2FJUB 1PK0D 2EC6C 3CR5X 1K96A 1KQVA 4MLWA 2K7BA 1QJTA 5F6TA 3CR2A 3R72A 3PN7B 4OCIA 3PM2A 4E68A 1CLMA 3DVMA 3FWBA 1SMGA 1BG1A 1OSAA 1QATA 3RZSA 1GGZA 1GM0A 3VRQA 1OW4A 2E6WA 1D1OA 3A8RA 1DF0B 5KSZA 1DJGA 1EG4A 1AK8A 3SIBA 2FCEA 4DCKA 3SIAA 3OGNA 3WHTB 3BOWB 2JPOA 3C1VA 3CR4X 2KGRA 5PALA 2JC2A 2LAPA 5BPJA 1EL4A 5DICA 2JNFA 2BE4A 5I94A 4PE4A 3TS5C 1NX2A 3S0GA 2BL0C 5FYXA 1IRJA 1XO5A 3FE8A 1WRKA 1Z2CB 3CZ1A 2M3WA 3UNWA 5HKZA 1UHIA 3H4SE 4ORAB 1BOCA 1NUBA 4M2OA 1KK7Z 3I5IB 4KYNA 3S0BA 2LHLA 4AQIA 1C3YA 3BUMB 2Q91A 2MAZA 1B1GA 1DC1A 3DVJA 1K93D 4I5KA 3EG5B 5D3OA 1R2UA 1AJ5A 2WCEA 2K0JA 3QMEA 1ZOTB 1CDPA 2V53A 1U5IA 2K7OA 3CZ0A 4USLA 1DGVA 1L7ZA 3LLEA 4PCWA 1F55A 4C0JA 1NX0A 1YRTB 4NQGA 4GAOA 1PULA 2H61A 2BCXA 2LMTA 2LVKA 1YVLA 3FWCA 2JTTA 1SBJA 2JQ6A 5I2QA 2DOQA 2FJYA 1KK8C 3HX4A 2KQ6A 5I8NA 3VRPA 4OVNF 3PM8A 2PASA 1QVIZ 1B4CA 1NWDA 1RWYA 3CZ2A 3EVVA 1S1EA 1UP5A 3DZTA 3EK8A 1SCMB 3PN7C 2I7AA 2BAPA 1SYMA 3DF0A 4M2PA 4HREE 2PQLA 1EXRA 5DKQA 4UPGA 1B8LA 3LK0A 4NDCA 1WY9A 1Y1XA 2BCBA 3WNXB 1JFJA 3EKJA 2K60A 1RFJA 5DKNA 4CFRA 1KFXS 1M63B 3IF7A 5JOLA 1LXFC 4QJ5B 5HKWA 1A03A 1ZACA 1K94A 1BJFA 1IIOA 2BKIB 2LP2A 1C07A 1XVJA 2EHBA 2QEHA 1YTZC 1FI5A 3TZ1A 1Q80A 2QACA 2KSPA 4DIRA 3BFHA 3EVRA 2F33A 2JULA 3B6XA 3D77A 3I5IC 1NX3A 1XK4C 1ALWA 1F70A 3EKHA 3BUNB 1V1FA 4YGAA 1DGUA 2D8NA 1B8CA 4HSZA 3DXLA 4MZKA 2GGZA 5FI7A 1CM1A 1M46A 1DJWA 1N65A 2QEBA 5AEQA 1TNWA 3UO9A 1IJ6A 1TCOB 2BKHB 2Y4QA 1TTXA 4P5OE 2M7NA 2LCPA 3DVEA 3JTDB 2KOTA 1X02A 1SKTA 2KI6D 1Y0VH 5J3XA 1TIZA 1TRFA 1KFUS 2GV5A 1PVAA 4ICBA 1SCVA 2I2RE 2MHHA 2KFFA 2L0PA 3BYAA 3AKAA 5CSFA 3TDUA 1V1GA
chains in the Genus database with same CATH topology
1SL8A 2TN4A 3BUWB 2ZRSA 2JT8A 4D1EA 1YUTA 2ZFDA 1OMVA 1WDCB 3O78A 4XJKA 2LVVA 1JUOA 4GGFC 5CPVA 2JT3A 5HKYA 4WQ2A 1A75A 2JXLA 1RJVA 1QS7A 2LC5A 2CTNA 2ZN9A 1SL9A 1OQPA 1J7OA 5D7FA 4AOMA 2KBMA 1BR1B 2JRFA 2HQWA 1S6IA 5DKRA 2A4JA 5K89A 1FI6A 1VRKA 3CWGA 2OS8B 1NPQA 1KSMA 3I5FB 1CM4A 3NXAA 4MZJA 1MF8B 1SY9A 2JTZA 3BUOB 4PALA 1CKKA 1XFWO 1JBAA 1C7WA 2GGMA 4WRIA 2CCMA 2JT0A 1SRAA 5I2OA 3EVUA 2HETA 5KU1A 2HF5A 2L51A 4GUKA 1RK9A 1U5IB 4XYNA 1EJ3A 4CLNA 1IJ5A 1KK7Y 1G8IA 2BBMA 1FPWA 2MRDA 2F2OA 5ER4X 4CIDA 1XFVO 1Y1UA 4CPVA 4I5JA 1CFCA 1W7JB 4MVFA 2K2FA 3JVTC 1L2OB 4BY4A 1QIVA 1CLLA 1CMFA 1QV0A 1UHKA 3RM1A 4R1EA 1TOPA 3JTDC 2NLNA 5ER5A 4OV2A 4AQJA 3NSLA 5TNCA 1NSHA 2M8UA 1F8HA 5CSIA 1GQMA 1WRZA 4PHNA 3VRRA 4QJ4B 2KI6C 2K2AA 2WC8A 1UHHA 3LL8B 3SJSA 3DF0B 3E3RA 1RECA 3MSEB 1GJYA 2JNXA 3CLNA 1WDCC 3I5HC 1S6CA 1QVIY 2JPTA 3KF9A 1SR6C 1R6PA 2F8PA 1J7QA 1Y6WA 1KWOB 1QXPA 1IQ5A 2L50A 2Y5IA 2PMYA 1F4OA 1ZUZA 1S5GZ 2I18A 3K21A 1ALVA 2WNDA 3QRXA 1FW4A 5HLVA 4YGEB 1JSAA 4PE7A 1GGWA 1DJHA 3NSIA 1XFYO 1SNLA 1ZMZA 2OS8C 1QLSA 2K7DA 2KFGA 3I5FC 2I94A 4DUQA 1KQMB 1S26D 3SG2A 2NXQA 2KAXA 5IBWA 4OR9B 1F4QA 1G33A 3SG7A 3KPXA 1IWQA 1BMOA 1ZFSA 1MXEA 2LNKA 1YX8A 3VROA 5D69A 1NCYA 1DJYA 1K8UA 1QTXA 1S3PA 1AP4A 4L9MA 1XFZO 2SCPA 1H4BA 2KYCA 2KDHA 2NCOA 1MUXA 4YGDB 2BECA 1QX5B 1J7RA 1JFKA 1EH2A 1HT9A 2H61C 4DS7A 2ISDA 4A4CA 2WCFA 1NIWA 1L2OC 1YURA 2LLUA 4YGBB 1XYDA 1A4PA 1SL7A 3CTNA 4NDDA 3ZWHA 1OMRA 2MLEC 2LP3A 1ODBA 1M31A 2ZNDA 3OX6A 4PHMA 5AERA 1TCFA 2AUCA 3M0WA 4U8DA 3VRNA 1N0YA 2PVBA 5I2LA 2RGIA 3TUYB 4FTGA 4XJKB 2PSRA 1YUUA 5AXIA 4GGFA 1A75B 1B8RA 2HPSA 1N2DA 2G2BA 3EK4A 1XFUO 3ICBA 3OB2B 3OB1B 3OHMB 1KFXL 1CDNA 1EG3A 3KEVA 3OP0A 1KWOC 2KYFA 5HYDA 2H2KA 1DJIA 4MSPA 1PRWA 4Q04A 2BCAA 1CTRA 2L98A 4GPLB 1AVSA 5HLOA 3TDUA 1QX7A 1YVHA 1DJXA 5AANA 2KFHA 1SCMC 4GBAA 2F3YA 2SASA 1W7IB 3LCPC 2M1UA 2JWWA 3PLFB 1AUIB 1WLMA 4ETOA 2LLSA 4P2YB 1UURA 1KQMC 1Y1AA 5CSNA 1F71A 1PSBA 3AAKA 2KBIA 1DVIA 4IL1A 1A2XA 2KHNA 1F54A 1B7TZ 2JU0A 3D0YA 2QPTA 1WLZA 2KGBC 1BT6A 1G4YR 1CLBA 2E30A 3O2PA 2F3ZA 1MXLC 1CNPA 2NZ0A 2K8MB 3HCMA 1YUSA 2KAVA 5JJGA 1QLKA 1SK6D 4PE1A 4BY5A 1LKJA 1NCXA 2ZN8A 1KK8B 1KFUL 3CGAA 2LV7A 2OPOA 1M45A 1K95A 2Y1NA 1IH0A 1JWDA 1LA3A 1JF0A 3GK4X 1AHRA 2MA2A 1YX7A 2Q4UA 2JXCA 1FF1A 2EGDA 4I5NB 1TNQA 3DVKA 1CMGA 1CFDA 3NSOA 3SG4A 3TUYC 4DRWA 1BF5A 2AAOA 1QV1A 2CXJA 2KAYA 2OTGB 5KTYA 1BR4B 4QJ3B 2BE6A 2L4IA 1J55A 2PRUA 4C0KA 1YR5A 2LMUA 1YRUB 2LM5A 2Y1MA 4HRGA 1PSRA 3IQOA 1XA5A 3GK2A 1CB1A 4YI8A 4PE0A 3SG5A 1OZSA 3PSRA 1NX1A 1IQ3A 4MN0A 1UHJA 4PDZA 1J1EA 1MWNA 1WRLA 3F45A 1CFFA 4N5XA 2M29A 1KCYA 3DD4A 3WHUB 1S5GY 4ZCUA 1DF0A 2ZRTA 2ZKMX 2M97A 2M0RA 1NP8A 1NCZA 4ORBB 1OMDA 2WOSA 2K61A 3EK7A 3BOWA 3O6BA 1IKUA 2CT9A 2LUXA 1RROA 3PFVA 4A4BA 1MQ1A 2KI4B 4HRHA 1DTLA 2FCDA 3GK1A 1M39A 2LHIA 2K7CA 3D10A 3GOFA 2NCPA 1K9UA 1LA0A 1QX2A 2B1UA 2LANA 2PALA 1S36A 1J7PA 2L4HA 1OE9B 2LMVA 2IS9A 1CDLA 3AKBA 1MR8A 4MEWA 1KSOA 1PVBA 1XK4A 4N1GA 1K9PA 1DMOA 4FQOA 4CFQA 1CFPA 3IQQA 5GQQC 3I5GB 4YBHB 1RTP1 2LVIA 3ZNIA 1BU3A 5AFPA 1MHOA 4MBEA 4NDBA 3RLZA 2F2PA 2BBNA 3BQ3A 4PHKA 1K2HA 1TN4A 2LE9B 2MLFC 4OKHA 4GNKB 1FBVA 1UHNA 2L5XB 2LVJA 1B9AA 2WCBA 2COLB 2EC6B 3AAJA 2OTGC 3O4YA 2JZIA 1BODA 4GGNA 1OZOA 3BUXB 1J1DA 1E8AA 3A4UB 3BXKA 2KNEA 1DT7B 1K90D 2KQYA 4N1FA 1NYAA 4MRYA 4ORCB 1LINA 4JPZB 1IG5A 3SG6A 2O5GA 1TNXA 1XFXO 2M1KB 4GFTA 1A29A 1BLQA 1PALA 3TDZA 1SW8A 2O60A 4JQ0D 2WORA 2MBXA 1LVCD 2ZNEA 2MJWB 1UUSA 4YGCB 3KO0A 5G08A 1IGVA 2R2IA 4MRXA 2LUCA 4ZCVA 2M7LA 2LLTA 2CBLA 3TS5B 4YI9A 3D0YB 2BL0B 3FS7A 2HQ8A 2KI4C 3CZTX 4I5LB 4TNCA 3FIAA 3JVTB 4M2QA 2JOJA 4MZLA 2M49B 1C7VA 3NSKA 4PHJA 1S6JA 2M9GA 2L2EA 4F0ZB 2VRGA 1JC2A 1B7TY 2AMIA 1OOJA 3KHEA 3SG3A 1TNPA 2G9BA 3CS1A 2CNPA 5B8IB 1CDMA 3PATA 3I5GC 1JF2A 3OX5A 2FOTA 1DJZA 3TDIA 4YRUA 3VGOA 1K9KA 1AJ4A 1B47A 4JWQA 3I5HB 3PALA 2P6BB 3LK1A 1SR6B 5CSJA 1QASA 4WQ3A 4C0LA 1H8BA 1UWOA 1QIWA 3WXAA 1HQVA 1SPYA 2FJUB 1PK0D 2EC6C 3CR5X 1K96A 1KQVA 4MLWA 2K7BA 1QJTA 5F6TA 3CR2A 3PN7B 4OCIA 4E68A 1CLMA 3DVMA 3FWBA 1SMGA 1BG1A 1OSAA 1QATA 1GGZA 3VRQA 2E6WA 1D1OA 3A8RA 1DF0B 5KSZA 1DJGA 1EG4A 1AK8A 3SIBA 2FCEA 4DCKA 3SIAA 3WHTB 3BOWB 3C1VA 3CR4X 2KGRA 5PALA 2JC2A 2LAPA 5BPJA 1EL4A 2JNFA 2BE4A 4PE4A 3TS5C 1NX2A 2BL0C 5FYXA 1IRJA 1XO5A 1WRKA 2M3WA 5HKZA 1UHIA 3H4SE 4ORAB 1BOCA 1NUBA 4M2OA 1KK7Z 3I5IB 2LHLA 4AQIA 3BUMB 2Q91A 2MAZA 1B1GA 3DVJA 1K93D 4I5KA 1R2UA 1AJ5A 2WCEA 2K0JA 1ZOTB 1CDPA 2V53A 1U5IA 2K7OA 4USLA 1DGVA 1L7ZA 3LLEA 4PCWA 1F55A 4C0JA 1NX0A 1YRTB 4NQGA 4GAOA 1PULA 2H61A 2BCXA 2LMTA 2LVKA 1YVLA 3FWCA 2JTTA 1SBJA 2JQ6A 5I2QA 2DOQA 1KK8C 3HX4A 2KQ6A 5I8NA 3VRPA 4OVNF 3PM8A 2PASA 1QVIZ 1B4CA 1NWDA 1RWYA 3EVVA 1S1EA 1UP5A 3EK8A 1SCMB 3PN7C 2I7AA 1SYMA 3DF0A 4M2PA 4HREE 1EXRA 5DKQA 4UPGA 1B8LA 3LK0A 4NDCA 1WY9A 1Y1XA 2BCBA 3WNXB 1JFJA 3EKJA 4CFRA 1RFJA 5DKNA 1KFXS 1M63B 3IF7A 5JOLA 1LXFC 4QJ5B 5HKWA 1A03A 1ZACA 1K94A 1BJFA 2BKIB 2LP2A 1C07A 1XVJA 2EHBA 1YTZC 1FI5A 3TZ1A 1Q80A 2QACA 2KSPA 4DIRA 3EVRA 2F33A 2JULA 3I5IC 1NX3A 1XK4C 1ALWA 1F70A 3EKHA 3BUNB 1V1FA 4YGAA 1DGUA 2D8NA 1B8CA 4HSZA 4MZKA 2GGZA 1CM1A 1M46A 1DJWA 1N65A 5AEQA 1TNWA 1IJ6A 1TCOB 2BKHB 2Y4QA 1TTXA 4P5OE 2M7NA 2LCPA 3DVEA 3JTDB 2KOTA 1X02A 1SKTA 2KI6D 1Y0VH 5J3XA 1TIZA 1TRFA 1KFUS 2GV5A 1PVAA 4ICBA 1SCVA 2I2RE 2MHHA 2KFFA 2L0PA 3BYAA 3AKAA 5CSFA 1V1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL8 A;  2TN4 A;  3BUW B;  2ZRS A;  2JT8 A;  4D1E A;  1YUT A;  2ZFD A;  1OMV A;  1WDC B;  3O78 A;  4XJK A;  2LVV A;  1JUO A;  4GGF C;  5CPV A;  2JT3 A;  5HKY A;  4WQ2 A;  1A75 A;  2JXL A;  1RJV A;  1QS7 A;  2LC5 A;  2CTN A;  2ZN9 A;  1SL9 A;  1OQP A;  1J7O A;  5D7F A;  4AOM A;  2KBM A;  1BR1 B;  2JRF A;  2HQW A;  1S6I A;  5DKR A;  2A4J A;  5K89 A;  1FI6 A;  1VRK A;  3CWG A;  2OS8 B;  1NPQ A;  1KSM A;  3I5F B;  1CM4 A;  3NXA A;  4MZJ A;  1MF8 B;  1SY9 A;  2JTZ A;  3BUO B;  4PAL A;  1CKK A;  1XFW O;  1JBA A;  1C7W A;  2GGM A;  4WRI A;  2CCM A;  2JT0 A;  1SRA A;  5I2O A;  3EVU A;  2HET A;  5KU1 A;  2HF5 A;  2L51 A;  4GUK A;  1RK9 A;  1U5I B;  4XYN A;  1EJ3 A;  4CLN A;  1IJ5 A;  1KK7 Y;  1G8I A;  2BBM A;  1FPW A;  2MRD A;  2F2O A;  5ER4 X;  4CID A;  1XFV O;  1Y1U A;  4CPV A;  4I5J A;  1CFC A;  1W7J B;  4MVF A;  2K2F A;  3JVT C;  1L2O B;  4BY4 A;  1QIV A;  1CLL A;  1CMF A;  1QV0 A;  1UHK A;  3RM1 A;  4R1E A;  1TOP A;  3JTD C;  2NLN A;  5ER5 A;  4OV2 A;  4AQJ A;  3NSL A;  5TNC A;  1NSH A;  2M8U A;  1F8H A;  5CSI A;  1GQM A;  1WRZ A;  4PHN A;  3VRR A;  4QJ4 B;  2KI6 C;  2K2A A;  2WC8 A;  1UHH A;  3LL8 B;  3SJS A;  3DF0 B;  3E3R A;  1REC A;  3MSE B;  1GJY A;  2JNX A;  3CLN A;  1WDC C;  3I5H C;  1S6C A;  1QVI Y;  2JPT A;  3KF9 A;  1SR6 C;  1R6P A;  2F8P A;  1J7Q A;  1Y6W A;  1KWO B;  1QXP A;  1IQ5 A;  2L50 A;  2Y5I A;  2PMY A;  1F4O A;  1ZUZ A;  1S5G Z;  2I18 A;  3K21 A;  1ALV A;  2WND A;  3QRX A;  1FW4 A;  5HLV A;  4YGE B;  1JSA A;  4PE7 A;  1GGW A;  1DJH A;  3NSI A;  1XFY O;  1SNL A;  1ZMZ A;  2OS8 C;  1QLS A;  2K7D A;  2KFG A;  3I5F C;  2I94 A;  4DUQ A;  1KQM B;  1S26 D;  3SG2 A;  2NXQ A;  2KAX A;  5IBW A;  4OR9 B;  1F4Q A;  1G33 A;  3SG7 A;  3KPX A;  1IWQ A;  1BMO A;  1ZFS A;  1MXE A;  2LNK A;  1YX8 A;  3VRO A;  5D69 A;  1NCY A;  1DJY A;  1K8U A;  1QTX A;  1S3P A;  1AP4 A;  4L9M A;  1XFZ O;  2SCP A;  1H4B A;  2KYC A;  2KDH A;  2NCO A;  1MUX A;  4YGD B;  2BEC A;  1QX5 B;  1J7R A;  1JFK A;  1EH2 A;  1HT9 A;  2H61 C;  4DS7 A;  2ISD A;  4A4C A;  2WCF A;  1NIW A;  1L2O C;  1YUR A;  2LLU A;  4YGB B;  1XYD A;  1A4P A;  1SL7 A;  3CTN A;  4NDD A;  3ZWH A;  1OMR A;  2MLE C;  2LP3 A;  1ODB A;  1M31 A;  2ZND A;  3OX6 A;  4PHM A;  5AER A;  1TCF A;  2AUC A;  3M0W A;  4U8D A;  3VRN A;  1N0Y A;  2PVB A;  5I2L A;  2RGI A;  3TUY B;  4FTG A;  4XJK B;  2PSR A;  1YUU A;  5AXI A;  4GGF A;  1A75 B;  1B8R A;  2HPS A;  1N2D A;  2G2B A;  3EK4 A;  1XFU O;  3ICB A;  3OB2 B;  3OB1 B;  3OHM B;  1KFX L;  1CDN A;  1EG3 A;  3KEV A;  3OP0 A;  1KWO C;  2KYF A;  5HYD A;  2H2K A;  1DJI A;  4MSP A;  1PRW A;  4Q04 A;  2BCA A;  1CTR A;  2L98 A;  4GPL B;  1AVS A;  5HLO A;  3TDU A;  1QX7 A;  1YVH A;  1DJX A;  5AAN A;  2KFH A;  1SCM C;  4GBA A;  2F3Y A;  2SAS A;  1W7I B;  3LCP C;  2M1U A;  2JWW A;  3PLF B;  1AUI B;  1WLM A;  4ETO A;  2LLS A;  4P2Y B;  1UUR A;  1KQM C;  1Y1A A;  5CSN A;  1F71 A;  1PSB A;  3AAK A;  2KBI A;  1DVI A;  4IL1 A;  1A2X A;  2KHN A;  1F54 A;  1B7T Z;  2JU0 A;  3D0Y A;  2QPT A;  1WLZ A;  2KGB C;  1BT6 A;  1G4Y R;  1CLB A;  2E30 A;  3O2P A;  2F3Z A;  1MXL C;  1CNP A;  2NZ0 A;  2K8M B;  3HCM A;  1YUS A;  2KAV A;  5JJG A;  1QLK A;  1SK6 D;  4PE1 A;  4BY5 A;  1LKJ A;  1NCX A;  2ZN8 A;  1KK8 B;  1KFU L;  3CGA A;  2LV7 A;  2OPO A;  1M45 A;  1K95 A;  2Y1N A;  1IH0 A;  1JWD A;  1LA3 A;  1JF0 A;  3GK4 X;  1AHR A;  2MA2 A;  1YX7 A;  2Q4U A;  2JXC A;  1FF1 A;  2EGD A;  4I5N B;  1TNQ A;  3DVK A;  1CMG A;  1CFD A;  3NSO A;  3SG4 A;  3TUY C;  4DRW A;  1BF5 A;  2AAO A;  1QV1 A;  2CXJ A;  2KAY A;  2OTG B;  5KTY A;  1BR4 B;  4QJ3 B;  2BE6 A;  2L4I A;  1J55 A;  2PRU A;  4C0K A;  1YR5 A;  2LMU A;  1YRU B;  2LM5 A;  2Y1M A;  4HRG A;  1PSR A;  3IQO A;  1XA5 A;  3GK2 A;  1CB1 A;  4YI8 A;  4PE0 A;  3SG5 A;  1OZS A;  3PSR A;  1NX1 A;  1IQ3 A;  4MN0 A;  1UHJ A;  4PDZ A;  1J1E A;  1MWN A;  1WRL A;  3F45 A;  1CFF A;  4N5X A;  2M29 A;  1KCY A;  3DD4 A;  3WHU B;  1S5G Y;  4ZCU A;  1DF0 A;  2ZRT A;  2ZKM X;  2M97 A;  2M0R A;  1NP8 A;  1NCZ A;  4ORB B;  1OMD A;  2WOS A;  2K61 A;  3EK7 A;  3BOW A;  3O6B A;  1IKU A;  2CT9 A;  2LUX A;  1RRO A;  3PFV A;  4A4B A;  1MQ1 A;  2KI4 B;  4HRH A;  1DTL A;  2FCD A;  3GK1 A;  1M39 A;  2LHI A;  2K7C A;  3D10 A;  3GOF A;  2NCP A;  1K9U A;  1LA0 A;  1QX2 A;  2B1U A;  2LAN A;  2PAL A;  1S36 A;  1J7P A;  2L4H A;  1OE9 B;  2LMV A;  2IS9 A;  1CDL A;  3AKB A;  1MR8 A;  4MEW A;  1KSO A;  1PVB A;  1XK4 A;  4N1G A;  1K9P A;  1DMO A;  4FQO A;  4CFQ A;  1CFP A;  3IQQ A;  5GQQ C;  3I5G B;  4YBH B;  1RTP 1;  2LVI A;  3ZNI A;  1BU3 A;  5AFP A;  1MHO A;  4MBE A;  4NDB A;  3RLZ A;  2F2P A;  2BBN A;  3BQ3 A;  4PHK A;  1K2H A;  1TN4 A;  2LE9 B;  2MLF C;  4OKH A;  4GNK B;  1FBV A;  1UHN A;  2L5X B;  2LVJ A;  1B9A A;  2WCB A;  2COL B;  2EC6 B;  3AAJ A;  2OTG C;  3O4Y A;  2JZI A;  1BOD A;  4GGN A;  1OZO A;  3BUX B;  1J1D A;  1E8A A;  3A4U B;  3BXK A;  2KNE A;  1DT7 B;  1K90 D;  2KQY A;  4N1F A;  1NYA A;  4MRY A;  4ORC B;  1LIN A;  4JPZ B;  1IG5 A;  3SG6 A;  2O5G A;  1TNX A;  1XFX O;  2M1K B;  4GFT A;  1A29 A;  1BLQ A;  1PAL A;  3TDZ A;  1SW8 A;  2O60 A;  4JQ0 D;  2WOR A;  2MBX A;  1LVC D;  2ZNE A;  2MJW B;  1UUS A;  4YGC B;  3KO0 A;  5G08 A;  1IGV A;  2R2I A;  4MRX A;  2LUC A;  4ZCV A;  2M7L A;  2LLT A;  2CBL A;  3TS5 B;  4YI9 A;  3D0Y B;  2BL0 B;  3FS7 A;  2HQ8 A;  2KI4 C;  3CZT X;  4I5L B;  4TNC A;  3FIA A;  3JVT B;  4M2Q A;  2JOJ A;  4MZL A;  2M49 B;  1C7V A;  3NSK A;  4PHJ A;  1S6J A;  2M9G A;  2L2E A;  4F0Z B;  2VRG A;  1JC2 A;  1B7T Y;  2AMI A;  1OOJ A;  3KHE A;  3SG3 A;  1TNP A;  2G9B A;  3CS1 A;  2CNP A;  5B8I B;  1CDM A;  3PAT A;  3I5G C;  1JF2 A;  3OX5 A;  2FOT A;  1DJZ A;  3TDI A;  4YRU A;  3VGO A;  1K9K A;  1AJ4 A;  1B47 A;  4JWQ A;  3I5H B;  3PAL A;  2P6B B;  3LK1 A;  1SR6 B;  5CSJ A;  1QAS A;  4WQ3 A;  4C0L A;  1H8B A;  1UWO A;  1QIW A;  3WXA A;  1HQV A;  1SPY A;  2FJU B;  1PK0 D;  2EC6 C;  3CR5 X;  1K96 A;  1KQV A;  4MLW A;  2K7B A;  1QJT A;  5F6T A;  3CR2 A;  3PN7 B;  4OCI A;  4E68 A;  1CLM A;  3DVM A;  3FWB A;  1SMG A;  1BG1 A;  1OSA A;  1QAT A;  1GGZ A;  3VRQ A;  2E6W A;  1D1O A;  3A8R A;  1DF0 B;  5KSZ A;  1DJG A;  1EG4 A;  1AK8 A;  3SIB A;  2FCE A;  4DCK A;  3SIA A;  3WHT B;  3BOW B;  3C1V A;  3CR4 X;  2KGR A;  5PAL A;  2JC2 A;  2LAP A;  5BPJ A;  1EL4 A;  2JNF A;  2BE4 A;  4PE4 A;  3TS5 C;  1NX2 A;  2BL0 C;  5FYX A;  1IRJ A;  1XO5 A;  1WRK A;  2M3W A;  5HKZ A;  1UHI A;  3H4S E;  4ORA B;  1BOC A;  1NUB A;  4M2O A;  1KK7 Z;  3I5I B;  2LHL A;  4AQI A;  3BUM B;  2Q91 A;  2MAZ A;  1B1G A;  3DVJ A;  1K93 D;  4I5K A;  1R2U A;  1AJ5 A;  2WCE A;  2K0J A;  1ZOT B;  1CDP A;  2V53 A;  1U5I A;  2K7O A;  4USL A;  1DGV A;  1L7Z A;  3LLE A;  4PCW A;  1F55 A;  4C0J A;  1NX0 A;  1YRT B;  4NQG A;  4GAO A;  1PUL A;  2H61 A;  2BCX A;  2LMT A;  2LVK A;  1YVL A;  3FWC A;  2JTT A;  1SBJ A;  2JQ6 A;  5I2Q A;  2DOQ A;  1KK8 C;  3HX4 A;  2KQ6 A;  5I8N A;  3VRP A;  4OVN F;  3PM8 A;  2PAS A;  1QVI Z;  1B4C A;  1NWD A;  1RWY A;  3EVV A;  1S1E A;  1UP5 A;  3EK8 A;  1SCM B;  3PN7 C;  2I7A A;  1SYM A;  3DF0 A;  4M2P A;  4HRE E;  1EXR A;  5DKQ A;  4UPG A;  1B8L A;  3LK0 A;  4NDC A;  1WY9 A;  1Y1X A;  2BCB A;  3WNX B;  1JFJ A;  3EKJ A;  4CFR A;  1RFJ A;  5DKN A;  1KFX S;  1M63 B;  3IF7 A;  5JOL A;  1LXF C;  4QJ5 B;  5HKW A;  1A03 A;  1ZAC A;  1K94 A;  1BJF A;  2BKI B;  2LP2 A;  1C07 A;  1XVJ A;  2EHB A;  1YTZ C;  1FI5 A;  3TZ1 A;  1Q80 A;  2QAC A;  2KSP A;  4DIR A;  3EVR A;  2F33 A;  2JUL A;  3I5I C;  1NX3 A;  1XK4 C;  1ALW A;  1F70 A;  3EKH A;  3BUN B;  1V1F A;  4YGA A;  1DGU A;  2D8N A;  1B8C A;  4HSZ A;  4MZK A;  2GGZ A;  1CM1 A;  1M46 A;  1DJW A;  1N65 A;  5AEQ A;  1TNW A;  1IJ6 A;  1TCO B;  2BKH B;  2Y4Q A;  1TTX A;  4P5O E;  2M7N A;  2LCP A;  3DVE A;  3JTD B;  2KOT A;  1X02 A;  1SKT A;  2KI6 D;  1Y0V H;  5J3X A;  1TIZ A;  1TRF A;  1KFU S;  2GV5 A;  1PVA A;  4ICB A;  1SCV A;  2I2R E;  2MHH A;  2KFF A;  2L0P A;  3BYA A;  3AKA A;  5CSF A;  1V1G A; 
#chains in the Genus database with same CATH topology
 3D75 A;  1SL8 A;  2TN4 A;  3BUW B;  2ZRS A;  3PJI A;  2JT8 A;  4D1E A;  1YUT A;  2ZFD A;  1OMV A;  1WDC B;  3O78 A;  4XJK A;  2LVV A;  1JUO A;  4GGF C;  5CPV A;  2JT3 A;  5HKY A;  4WQ2 A;  1A75 A;  2JXL A;  3O4X A;  1RJV A;  1QS7 A;  3S0A A;  2LC5 A;  2CTN A;  2ZN9 A;  1SL9 A;  1SSE B;  1OQP A;  1J7O A;  5D7F A;  3BFB A;  2KBM A;  4AOM A;  1BR1 B;  2JRF A;  2HQW A;  1S6I A;  5DKR A;  2A4J A;  5K89 A;  1FI6 A;  1VRK A;  3CWG A;  2OS8 B;  1NPQ A;  1KSM A;  3I5F B;  1CM4 A;  2YGU A;  3L4L A;  3NXA A;  4MZJ A;  1MF8 B;  1SY9 A;  2JTZ A;  3BUO B;  4PAL A;  1CKK A;  1XFW O;  1JBA A;  1C7W A;  2GGM A;  2L2C A;  4WRI A;  2CCM A;  2JT0 A;  1SRA A;  5I2O A;  3EVU A;  2HET A;  5KU1 A;  2HF5 A;  2L51 A;  4GUK A;  3SS5 A;  1RK9 A;  1U5I B;  4XYN A;  1EJ3 A;  4CLN A;  1IJ5 A;  3B88 A;  1KK7 Y;  1G8I A;  2BBM A;  1FPW A;  2MRD A;  1W9Z A;  2F2O A;  5ER4 X;  4CID A;  1XFV O;  1Y1U A;  3NHI A;  4I5J A;  4CPV A;  1CFC A;  1W7J B;  4MVF A;  1OOI X;  2K2F A;  3JVT C;  1L2O B;  4BY4 A;  1QIV A;  1TWO A;  1CLL A;  3CYZ A;  1CMF A;  1QV0 A;  1UHK A;  3RM1 A;  4R1E A;  1TOP A;  3JTD C;  2NLN A;  5ER5 A;  4OV2 A;  3B7A A;  4AQJ A;  3NSL A;  1T14 A;  1NSH A;  2M8U A;  5TNC A;  1F8H A;  5CSI A;  1GQM A;  1OOF A;  1WRZ A;  4PHN A;  3DYE A;  3VRR A;  4QJ4 B;  2KI6 C;  2K2A A;  2WC8 A;  1UHH A;  3LL8 B;  3SJS A;  3DF0 B;  3E3R A;  1REC A;  3MSE B;  1GJY A;  2JNX A;  3CLN A;  1WDC C;  3I5H C;  1S6C A;  1QVI Y;  2JPT A;  3KF9 A;  1SR6 C;  1R6P A;  2F8P A;  1J7Q A;  1Y6W A;  1KWO B;  1QXP A;  1IQ5 A;  2L50 A;  2Y5I A;  2PMY A;  1F4O A;  1ZUZ A;  1S5G Z;  2I18 A;  3K21 A;  1ALV A;  2WND A;  4OZD A;  3QRX A;  1FW4 A;  5HLV A;  4YGE B;  1JSA A;  4PE7 A;  1LS8 A;  1GGW A;  1DJH A;  4IJ7 A;  3NSI A;  1XFY O;  3V2L A;  1SNL A;  2GTE A;  1ZMZ A;  2OS8 C;  1QLS A;  3S0D A;  2K7D A;  2KFG A;  3I5F C;  1ORG A;  2I94 A;  4DUQ A;  3BFA A;  3D73 A;  1KQM B;  1S26 D;  3SG2 A;  2NXQ A;  2KAX A;  3SS3 A;  5IBW A;  4OR9 B;  1F4Q A;  1G33 A;  3SG7 A;  3KPX A;  1IWQ A;  1BMO A;  1ZFS A;  1MXE A;  1DQE A;  2LNK A;  1YX8 A;  2WC5 A;  3VRO A;  5D69 A;  1NCY A;  1DJY A;  1K8U A;  1QTX A;  1S3P A;  1AP4 A;  4L9M A;  1XFZ O;  2SCP A;  1H4B A;  2KYC A;  2KDH A;  2NCO A;  1MUX A;  4YGD B;  2BEC A;  1QX5 B;  1J7R A;  1JFK A;  1EH2 A;  1HT9 A;  2H61 C;  2KPH A;  3CAB A;  2ISD A;  4A4C A;  4DS7 A;  2WCF A;  1NIW A;  1L2O C;  1YUR A;  2LLU A;  4YGB B;  1XYD A;  1A4P A;  1DEL A;  1SL7 A;  3CTN A;  4NDD A;  3ZWH A;  1OMR A;  3CDN A;  2MLE C;  2LP3 A;  1ODB A;  1M31 A;  2ZND A;  3OX6 A;  4PHM A;  5AER A;  1TCF A;  2AUC A;  3M0W A;  4U8D A;  2ERB A;  3VRN A;  1N0Y A;  2PVB A;  5I2L A;  2RGI A;  3TUY B;  4FTG A;  4XJK B;  2PSR A;  1YUU A;  2H8V A;  5AXI A;  2KLE A;  4GGF A;  1A75 B;  1B8R A;  2HPS A;  1N2D A;  2G2B A;  2WCM A;  1XFU O;  3EK4 A;  3ICB A;  3OB2 B;  3OB1 B;  3BJH A;  3OHM B;  1KFX L;  1CDN A;  1QWV A;  1EG3 A;  3KEV A;  3OP0 A;  1KWO C;  2KYF A;  5HYD A;  2H2K A;  1DJI A;  4MSP A;  1PRW A;  3IVT A;  4Q04 A;  2BCA A;  1CTR A;  2L98 A;  4GPL B;  1AVS A;  2BNX A;  3R1P A;  1QX7 A;  3D76 A;  4JKT A;  5HLO A;  1YVH A;  1DJX A;  5AAN A;  2KFH A;  1SCM C;  2L5Y A;  2F3Y A;  2SAS A;  1W7I B;  3LCP C;  4GBA A;  2M1U A;  2JWW A;  3PLF B;  1AUI B;  1WLM A;  4ETO A;  2LLS A;  4P2Y B;  1UUR A;  1KQM C;  1Y1A A;  5CSN A;  1F71 A;  1PSB A;  3AAK A;  2KBI A;  1DVI A;  4IL1 A;  5FI6 A;  3VB1 A;  4F7F A;  1TUJ A;  1A2X A;  1DEK A;  2KHN A;  2QDI A;  1F54 A;  5FI2 A;  1B7T Z;  2JU0 A;  3D0Y A;  2QPT A;  1WLZ A;  2KGB C;  3S0E A;  3S0F A;  1BT6 A;  1G4Y R;  1CLB A;  2E30 A;  3O2P A;  2F3Z A;  1MXL C;  1CNP A;  2NZ0 A;  2K8M B;  3HCM A;  1YUS A;  2KAV A;  5JJG A;  1QLK A;  3R1V A;  1SK6 D;  4PE1 A;  4PT1 A;  4BY5 A;  1LKJ A;  1NCX A;  1OOH A;  2ZN8 A;  1KK8 B;  1KFU L;  3CGA A;  2LV7 A;  2OPO A;  1M45 A;  1K95 A;  2Y1N A;  1IH0 A;  1JWD A;  1LA3 A;  1JF0 A;  3GK4 X;  1AHR A;  2MA2 A;  1YX7 A;  3SS4 A;  2Q4U A;  3NHT A;  3OBV A;  2JXC A;  1FF1 A;  2EGD A;  4I5N B;  1TNQ A;  3DVK A;  1CMG A;  1CFD A;  2WC6 A;  3NSO A;  3SG4 A;  4DRW A;  3TUY C;  1BF5 A;  2AAO A;  1QV1 A;  2CXJ A;  2KAY A;  2OTG B;  5KTY A;  1BR4 B;  4QJ3 B;  2BE6 A;  2L4I A;  1J55 A;  2PRU A;  1XFR A;  3D78 A;  4C0K A;  1YR5 A;  2LMU A;  1YRU B;  2LM5 A;  2Y1M A;  4HRG A;  1P28 A;  1PSR A;  3IQO A;  1XA5 A;  3GK2 A;  1CB1 A;  4YI8 A;  4PE0 A;  3SG5 A;  1OZS A;  4FQT A;  3PSR A;  4JD9 A;  1NX1 A;  1IQ3 A;  4MN0 A;  1UHJ A;  4PDZ A;  1J1E A;  1MWN A;  1WRL A;  3F45 A;  1CFF A;  4N5X A;  2M29 A;  2P70 A;  1KCY A;  3DD4 A;  3WHU B;  3FE6 A;  2PYQ A;  1S5G Y;  3R1O A;  4ZCU A;  1DF0 A;  2ZRT A;  2ZKM X;  4INW A;  2M97 A;  2M0R A;  1NP8 A;  1NCZ A;  4ORB B;  1OMD A;  2WOS A;  2K61 A;  3EK7 A;  3BOW A;  2QEO A;  3O6B A;  1IKU A;  2CT9 A;  2LUX A;  1RRO A;  3PFV A;  4A4B A;  1MQ1 A;  2KI4 B;  2WCJ A;  4HRH A;  1DTL A;  2FCD A;  3GK1 A;  1M39 A;  2LHI A;  2K7C A;  3D10 A;  3GOF A;  2NCP A;  1K9U A;  1LA0 A;  1QX2 A;  2B1U A;  2LAN A;  2PAL A;  1S36 A;  3NGV A;  2L4H A;  1OE9 B;  1J7P A;  2LMV A;  2IS9 A;  1CDL A;  3AKB A;  1MR8 A;  4MEW A;  1KSO A;  1PVB A;  1XK4 A;  2KLD A;  1K9P A;  4N1G A;  1DMO A;  4FQO A;  4CFQ A;  1CFP A;  3IQQ A;  5GQQ C;  3I5G B;  4YBH B;  1RTP 1;  2LVI A;  3ZNI A;  1BU3 A;  5AFP A;  1MHO A;  4MBE A;  4NDB A;  3RLZ A;  1C3Z A;  2F2P A;  2BBN A;  3BQ3 A;  4PHK A;  1K2H A;  3D74 A;  1TN4 A;  2WCK A;  2LE9 B;  2MLF C;  2WCL A;  1OOG A;  4OKH A;  4GNK B;  1FBV A;  1UHN A;  2L5X B;  2LVJ A;  1B9A A;  2WCB A;  2COL B;  2EC6 B;  3AAJ A;  2OTG C;  3L47 A;  3O4Y A;  2JZI A;  1BOD A;  4INX A;  4GGN A;  1OZO A;  1TUZ A;  3BUX B;  1J1D A;  1E8A A;  3A4U B;  3BXK A;  2KNE A;  1DT7 B;  1K90 D;  2KQY A;  4N1F A;  1NYA A;  4MRY A;  4ORC B;  1LIN A;  4JPZ B;  1IG5 A;  3SG6 A;  2O5G A;  2WCH A;  3Q8I A;  1TNX A;  3DY9 A;  1XFX O;  2M1K B;  5EL2 A;  4GFT A;  1A29 A;  1BLQ A;  1PAL A;  3TDZ A;  1SW8 A;  2O60 A;  4JQ0 D;  2WOR A;  2MBX A;  1LVC D;  2ZNE A;  2MJW B;  1UUS A;  4YGC B;  3KO0 A;  5G08 A;  1IGV A;  2R2I A;  4MRX A;  2LUC A;  4ZCV A;  2M7L A;  3K1E A;  2LLT A;  3B87 A;  2CBL A;  3FE9 A;  4YI9 A;  3TS5 B;  3D0Y B;  2BL0 B;  3FS7 A;  2HQ8 A;  2KI4 C;  2P71 A;  3CZT X;  4I5L B;  4TNC A;  3FIA A;  3L4A A;  3JVT B;  4M2Q A;  2JOJ A;  4MZL A;  2M49 B;  1C7V A;  3NSK A;  4PHJ A;  1S6J A;  2M9G A;  2L2E A;  4F0Z B;  2VRG A;  1JC2 A;  1B7T Y;  2AMI A;  1OOJ A;  3KHE A;  3SG3 A;  1TNP A;  2G9B A;  3B86 A;  3CS1 A;  2CNP A;  5B8I B;  1CDM A;  3PAT A;  3I5G C;  1JF2 A;  3OX5 A;  2FOT A;  1DJZ A;  3N7H A;  3TDI A;  4YRU A;  5HL1 A;  3VGO A;  1K9K A;  1Z4H A;  1AJ4 A;  1B47 A;  4JWQ A;  3I5H B;  3PAL A;  2P6B B;  3LK1 A;  1SR6 B;  5CSJ A;  1QAS A;  4WQ3 A;  4C0L A;  1H8B A;  1UWO A;  1QIW A;  3WXA A;  2QEV A;  1HQV A;  1SPY A;  2FJU B;  1PK0 D;  2EC6 C;  3CR5 X;  1K96 A;  1KQV A;  4MLW A;  2K7B A;  1QJT A;  5F6T A;  3CR2 A;  3R72 A;  3PN7 B;  4OCI A;  3PM2 A;  4E68 A;  1CLM A;  3DVM A;  3FWB A;  1SMG A;  1BG1 A;  1OSA A;  1QAT A;  3RZS A;  1GGZ A;  1GM0 A;  3VRQ A;  1OW4 A;  2E6W A;  1D1O A;  3A8R A;  1DF0 B;  5KSZ A;  1DJG A;  1EG4 A;  1AK8 A;  3SIB A;  2FCE A;  4DCK A;  3SIA A;  3OGN A;  3WHT B;  3BOW B;  2JPO A;  3C1V A;  3CR4 X;  2KGR A;  5PAL A;  2JC2 A;  2LAP A;  5BPJ A;  1EL4 A;  5DIC A;  2JNF A;  2BE4 A;  5I94 A;  4PE4 A;  3TS5 C;  1NX2 A;  3S0G A;  2BL0 C;  5FYX A;  1IRJ A;  1XO5 A;  3FE8 A;  1WRK A;  1Z2C B;  3CZ1 A;  2M3W A;  3UNW A;  5HKZ A;  1UHI A;  3H4S E;  4ORA B;  1BOC A;  1NUB A;  4M2O A;  1KK7 Z;  3I5I B;  4KYN A;  3S0B A;  2LHL A;  4AQI A;  1C3Y A;  3BUM B;  2Q91 A;  2MAZ A;  1B1G A;  1DC1 A;  3DVJ A;  1K93 D;  4I5K A;  3EG5 B;  5D3O A;  1R2U A;  1AJ5 A;  2WCE A;  2K0J A;  3QME A;  1ZOT B;  1CDP A;  2V53 A;  1U5I A;  2K7O A;  3CZ0 A;  4USL A;  1DGV A;  1L7Z A;  3LLE A;  4PCW A;  1F55 A;  4C0J A;  1NX0 A;  1YRT B;  4NQG A;  4GAO A;  1PUL A;  2H61 A;  2BCX A;  2LMT A;  2LVK A;  1YVL A;  3FWC A;  2JTT A;  1SBJ A;  2JQ6 A;  5I2Q A;  2DOQ A;  2FJY A;  1KK8 C;  3HX4 A;  2KQ6 A;  5I8N A;  3VRP A;  4OVN F;  3PM8 A;  2PAS A;  1QVI Z;  1B4C A;  1NWD A;  1RWY A;  3CZ2 A;  3EVV A;  1S1E A;  1UP5 A;  3DZT A;  3EK8 A;  1SCM B;  3PN7 C;  2I7A A;  2BAP A;  1SYM A;  3DF0 A;  4M2P A;  4HRE E;  2PQL A;  1EXR A;  5DKQ A;  4UPG A;  1B8L A;  3LK0 A;  4NDC A;  1WY9 A;  1Y1X A;  2BCB A;  3WNX B;  1JFJ A;  3EKJ A;  2K60 A;  1RFJ A;  5DKN A;  4CFR A;  1KFX S;  1M63 B;  3IF7 A;  5JOL A;  1LXF C;  4QJ5 B;  5HKW A;  1A03 A;  1ZAC A;  1K94 A;  1BJF A;  1IIO A;  2BKI B;  2LP2 A;  1C07 A;  1XVJ A;  2EHB A;  2QEH A;  1YTZ C;  1FI5 A;  3TZ1 A;  1Q80 A;  2QAC A;  2KSP A;  4DIR A;  3BFH A;  3EVR A;  2F33 A;  2JUL A;  3B6X A;  3D77 A;  3I5I C;  1NX3 A;  1XK4 C;  1ALW A;  1F70 A;  3EKH A;  3BUN B;  1V1F A;  4YGA A;  1DGU A;  2D8N A;  1B8C A;  4HSZ A;  3DXL A;  4MZK A;  2GGZ A;  5FI7 A;  1CM1 A;  1M46 A;  1DJW A;  1N65 A;  2QEB A;  5AEQ A;  1TNW A;  3UO9 A;  1IJ6 A;  1TCO B;  2BKH B;  2Y4Q A;  1TTX A;  4P5O E;  2M7N A;  2LCP A;  3DVE A;  3JTD B;  2KOT A;  1X02 A;  1SKT A;  2KI6 D;  1Y0V H;  5J3X A;  1TIZ A;  1TRF A;  1KFU S;  2GV5 A;  1PVA A;  4ICB A;  1SCV A;  2I2R E;  2MHH A;  2KFF A;  2L0P A;  3BYA A;  3AKA A;  5CSF A;  3TDU A;  1V1G A; 
#chains in the Genus database with same CATH homology
 1SL8 A;  2TN4 A;  3BUW B;  2ZRS A;  2JT8 A;  4D1E A;  1YUT A;  2ZFD A;  1OMV A;  1WDC B;  3O78 A;  4XJK A;  2LVV A;  1JUO A;  4GGF C;  5CPV A;  2JT3 A;  5HKY A;  4WQ2 A;  1A75 A;  2JXL A;  1RJV A;  1QS7 A;  2LC5 A;  2CTN A;  2ZN9 A;  1SL9 A;  1OQP A;  1J7O A;  5D7F A;  4AOM A;  2KBM A;  1BR1 B;  2JRF A;  2HQW A;  1S6I A;  5DKR A;  2A4J A;  5K89 A;  1FI6 A;  1VRK A;  3CWG A;  2OS8 B;  1NPQ A;  1KSM A;  3I5F B;  1CM4 A;  3NXA A;  4MZJ A;  1MF8 B;  1SY9 A;  2JTZ A;  3BUO B;  4PAL A;  1CKK A;  1XFW O;  1JBA A;  1C7W A;  2GGM A;  4WRI A;  2CCM A;  2JT0 A;  1SRA A;  5I2O A;  3EVU A;  2HET A;  5KU1 A;  2HF5 A;  2L51 A;  4GUK A;  1RK9 A;  1U5I B;  4XYN A;  1EJ3 A;  4CLN A;  1IJ5 A;  1KK7 Y;  1G8I A;  2BBM A;  1FPW A;  2MRD A;  2F2O A;  5ER4 X;  4CID A;  1XFV O;  1Y1U A;  4CPV A;  4I5J A;  1CFC A;  1W7J B;  4MVF A;  2K2F A;  3JVT C;  1L2O B;  4BY4 A;  1QIV A;  1CLL A;  1CMF A;  1QV0 A;  1UHK A;  3RM1 A;  4R1E A;  1TOP A;  3JTD C;  2NLN A;  5ER5 A;  4OV2 A;  4AQJ A;  3NSL A;  5TNC A;  1NSH A;  2M8U A;  1F8H A;  5CSI A;  1GQM A;  1WRZ A;  4PHN A;  3VRR A;  4QJ4 B;  2KI6 C;  2K2A A;  2WC8 A;  1UHH A;  3LL8 B;  3SJS A;  3DF0 B;  3E3R A;  1REC A;  3MSE B;  1GJY A;  2JNX A;  3CLN A;  1WDC C;  3I5H C;  1S6C A;  1QVI Y;  2JPT A;  3KF9 A;  1SR6 C;  1R6P A;  2F8P A;  1J7Q A;  1Y6W A;  1KWO B;  1QXP A;  1IQ5 A;  2L50 A;  2Y5I A;  2PMY A;  1F4O A;  1ZUZ A;  1S5G Z;  2I18 A;  3K21 A;  1ALV A;  2WND A;  3QRX A;  1FW4 A;  5HLV A;  4YGE B;  1JSA A;  4PE7 A;  1GGW A;  1DJH A;  3NSI A;  1XFY O;  1SNL A;  1ZMZ A;  2OS8 C;  1QLS A;  2K7D A;  2KFG A;  3I5F C;  2I94 A;  4DUQ A;  1KQM B;  1S26 D;  3SG2 A;  2NXQ A;  2KAX A;  5IBW A;  4OR9 B;  1F4Q A;  1G33 A;  3SG7 A;  3KPX A;  1IWQ A;  1BMO A;  1ZFS A;  1MXE A;  2LNK A;  1YX8 A;  3VRO A;  5D69 A;  1NCY A;  1DJY A;  1K8U A;  1QTX A;  1S3P A;  1AP4 A;  4L9M A;  1XFZ O;  2SCP A;  1H4B A;  2KYC A;  2KDH A;  2NCO A;  1MUX A;  4YGD B;  2BEC A;  1QX5 B;  1J7R A;  1JFK A;  1EH2 A;  1HT9 A;  2H61 C;  4DS7 A;  2ISD A;  4A4C A;  2WCF A;  1NIW A;  1L2O C;  1YUR A;  2LLU A;  4YGB B;  1XYD A;  1A4P A;  1SL7 A;  3CTN A;  4NDD A;  3ZWH A;  1OMR A;  2MLE C;  2LP3 A;  1ODB A;  1M31 A;  2ZND A;  3OX6 A;  4PHM A;  5AER A;  1TCF A;  2AUC A;  3M0W A;  4U8D A;  3VRN A;  1N0Y A;  2PVB A;  5I2L A;  2RGI A;  3TUY B;  4FTG A;  4XJK B;  2PSR A;  1YUU A;  5AXI A;  4GGF A;  1A75 B;  1B8R A;  2HPS A;  1N2D A;  2G2B A;  3EK4 A;  1XFU O;  3ICB A;  3OB2 B;  3OB1 B;  3OHM B;  1KFX L;  1CDN A;  1EG3 A;  3KEV A;  3OP0 A;  1KWO C;  2KYF A;  5HYD A;  2H2K A;  1DJI A;  4MSP A;  1PRW A;  4Q04 A;  2BCA A;  1CTR A;  2L98 A;  4GPL B;  1AVS A;  5HLO A;  3TDU A;  1QX7 A;  1YVH A;  1DJX A;  5AAN A;  2KFH A;  1SCM C;  4GBA A;  2F3Y A;  2SAS A;  1W7I B;  3LCP C;  2M1U A;  2JWW A;  3PLF B;  1AUI B;  1WLM A;  4ETO A;  2LLS A;  4P2Y B;  1UUR A;  1KQM C;  1Y1A A;  5CSN A;  1F71 A;  1PSB A;  3AAK A;  2KBI A;  1DVI A;  4IL1 A;  1A2X A;  2KHN A;  1F54 A;  1B7T Z;  2JU0 A;  3D0Y A;  2QPT A;  1WLZ A;  2KGB C;  1BT6 A;  1G4Y R;  1CLB A;  2E30 A;  3O2P A;  2F3Z A;  1MXL C;  1CNP A;  2NZ0 A;  2K8M B;  3HCM A;  1YUS A;  2KAV A;  5JJG A;  1QLK A;  1SK6 D;  4PE1 A;  4BY5 A;  1LKJ A;  1NCX A;  2ZN8 A;  1KK8 B;  1KFU L;  3CGA A;  2LV7 A;  2OPO A;  1M45 A;  1K95 A;  2Y1N A;  1IH0 A;  1JWD A;  1LA3 A;  1JF0 A;  3GK4 X;  1AHR A;  2MA2 A;  1YX7 A;  2Q4U A;  2JXC A;  1FF1 A;  2EGD A;  4I5N B;  1TNQ A;  3DVK A;  1CMG A;  1CFD A;  3NSO A;  3SG4 A;  3TUY C;  4DRW A;  1BF5 A;  2AAO A;  1QV1 A;  2CXJ A;  2KAY A;  2OTG B;  5KTY A;  1BR4 B;  4QJ3 B;  2BE6 A;  2L4I A;  1J55 A;  2PRU A;  4C0K A;  1YR5 A;  2LMU A;  1YRU B;  2LM5 A;  2Y1M A;  4HRG A;  1PSR A;  3IQO A;  1XA5 A;  3GK2 A;  1CB1 A;  4YI8 A;  4PE0 A;  3SG5 A;  1OZS A;  3PSR A;  1NX1 A;  1IQ3 A;  4MN0 A;  1UHJ A;  4PDZ A;  1J1E A;  1MWN A;  1WRL A;  3F45 A;  1CFF A;  4N5X A;  2M29 A;  1KCY A;  3DD4 A;  3WHU B;  1S5G Y;  4ZCU A;  1DF0 A;  2ZRT A;  2ZKM X;  2M97 A;  2M0R A;  1NP8 A;  1NCZ A;  4ORB B;  1OMD A;  2WOS A;  2K61 A;  3EK7 A;  3BOW A;  3O6B A;  1IKU A;  2CT9 A;  2LUX A;  1RRO A;  3PFV A;  4A4B A;  1MQ1 A;  2KI4 B;  4HRH A;  1DTL A;  2FCD A;  3GK1 A;  1M39 A;  2LHI A;  2K7C A;  3D10 A;  3GOF A;  2NCP A;  1K9U A;  1LA0 A;  1QX2 A;  2B1U A;  2LAN A;  2PAL A;  1S36 A;  1J7P A;  2L4H A;  1OE9 B;  2LMV A;  2IS9 A;  1CDL A;  3AKB A;  1MR8 A;  4MEW A;  1KSO A;  1PVB A;  1XK4 A;  4N1G A;  1K9P A;  1DMO A;  4FQO A;  4CFQ A;  1CFP A;  3IQQ A;  5GQQ C;  3I5G B;  4YBH B;  1RTP 1;  2LVI A;  3ZNI A;  1BU3 A;  5AFP A;  1MHO A;  4MBE A;  4NDB A;  3RLZ A;  2F2P A;  2BBN A;  3BQ3 A;  4PHK A;  1K2H A;  1TN4 A;  2LE9 B;  2MLF C;  4OKH A;  4GNK B;  1FBV A;  1UHN A;  2L5X B;  2LVJ A;  1B9A A;  2WCB A;  2COL B;  2EC6 B;  3AAJ A;  2OTG C;  3O4Y A;  2JZI A;  1BOD A;  4GGN A;  1OZO A;  3BUX B;  1J1D A;  1E8A A;  3A4U B;  3BXK A;  2KNE A;  1DT7 B;  1K90 D;  2KQY A;  4N1F A;  1NYA A;  4MRY A;  4ORC B;  1LIN A;  4JPZ B;  1IG5 A;  3SG6 A;  2O5G A;  1TNX A;  1XFX O;  2M1K B;  4GFT A;  1A29 A;  1BLQ A;  1PAL A;  3TDZ A;  1SW8 A;  2O60 A;  4JQ0 D;  2WOR A;  2MBX A;  1LVC D;  2ZNE A;  2MJW B;  1UUS A;  4YGC B;  3KO0 A;  5G08 A;  1IGV A;  2R2I A;  4MRX A;  2LUC A;  4ZCV A;  2M7L A;  2LLT A;  2CBL A;  3TS5 B;  4YI9 A;  3D0Y B;  2BL0 B;  3FS7 A;  2HQ8 A;  2KI4 C;  3CZT X;  4I5L B;  4TNC A;  3FIA A;  3JVT B;  4M2Q A;  2JOJ A;  4MZL A;  2M49 B;  1C7V A;  3NSK A;  4PHJ A;  1S6J A;  2M9G A;  2L2E A;  4F0Z B;  2VRG A;  1JC2 A;  1B7T Y;  2AMI A;  1OOJ A;  3KHE A;  3SG3 A;  1TNP A;  2G9B A;  3CS1 A;  2CNP A;  5B8I B;  1CDM A;  3PAT A;  3I5G C;  1JF2 A;  3OX5 A;  2FOT A;  1DJZ A;  3TDI A;  4YRU A;  3VGO A;  1K9K A;  1AJ4 A;  1B47 A;  4JWQ A;  3I5H B;  3PAL A;  2P6B B;  3LK1 A;  1SR6 B;  5CSJ A;  1QAS A;  4WQ3 A;  4C0L A;  1H8B A;  1UWO A;  1QIW A;  3WXA A;  1HQV A;  1SPY A;  2FJU B;  1PK0 D;  2EC6 C;  3CR5 X;  1K96 A;  1KQV A;  4MLW A;  2K7B A;  1QJT A;  5F6T A;  3CR2 A;  3PN7 B;  4OCI A;  4E68 A;  1CLM A;  3DVM A;  3FWB A;  1SMG A;  1BG1 A;  1OSA A;  1QAT A;  1GGZ A;  3VRQ A;  2E6W A;  1D1O A;  3A8R A;  1DF0 B;  5KSZ A;  1DJG A;  1EG4 A;  1AK8 A;  3SIB A;  2FCE A;  4DCK A;  3SIA A;  3WHT B;  3BOW B;  3C1V A;  3CR4 X;  2KGR A;  5PAL A;  2JC2 A;  2LAP A;  5BPJ A;  1EL4 A;  2JNF A;  2BE4 A;  4PE4 A;  3TS5 C;  1NX2 A;  2BL0 C;  5FYX A;  1IRJ A;  1XO5 A;  1WRK A;  2M3W A;  5HKZ A;  1UHI A;  3H4S E;  4ORA B;  1BOC A;  1NUB A;  4M2O A;  1KK7 Z;  3I5I B;  2LHL A;  4AQI A;  3BUM B;  2Q91 A;  2MAZ A;  1B1G A;  3DVJ A;  1K93 D;  4I5K A;  1R2U A;  1AJ5 A;  2WCE A;  2K0J A;  1ZOT B;  1CDP A;  2V53 A;  1U5I A;  2K7O A;  4USL A;  1DGV A;  1L7Z A;  3LLE A;  4PCW A;  1F55 A;  4C0J A;  1NX0 A;  1YRT B;  4NQG A;  4GAO A;  1PUL A;  2H61 A;  2BCX A;  2LMT A;  2LVK A;  1YVL A;  3FWC A;  2JTT A;  1SBJ A;  2JQ6 A;  5I2Q A;  2DOQ A;  1KK8 C;  3HX4 A;  2KQ6 A;  5I8N A;  3VRP A;  4OVN F;  3PM8 A;  2PAS A;  1QVI Z;  1B4C A;  1NWD A;  1RWY A;  3EVV A;  1S1E A;  1UP5 A;  3EK8 A;  1SCM B;  3PN7 C;  2I7A A;  1SYM A;  3DF0 A;  4M2P A;  4HRE E;  1EXR A;  5DKQ A;  4UPG A;  1B8L A;  3LK0 A;  4NDC A;  1WY9 A;  1Y1X A;  2BCB A;  3WNX B;  1JFJ A;  3EKJ A;  4CFR A;  1RFJ A;  5DKN A;  1KFX S;  1M63 B;  3IF7 A;  5JOL A;  1LXF C;  4QJ5 B;  5HKW A;  1A03 A;  1ZAC A;  1K94 A;  1BJF A;  2BKI B;  2LP2 A;  1C07 A;  1XVJ A;  2EHB A;  1YTZ C;  1FI5 A;  3TZ1 A;  1Q80 A;  2QAC A;  2KSP A;  4DIR A;  3EVR A;  2F33 A;  2JUL A;  3I5I C;  1NX3 A;  1XK4 C;  1ALW A;  1F70 A;  3EKH A;  3BUN B;  1V1F A;  4YGA A;  1DGU A;  2D8N A;  1B8C A;  4HSZ A;  4MZK A;  2GGZ A;  1CM1 A;  1M46 A;  1DJW A;  1N65 A;  5AEQ A;  1TNW A;  1IJ6 A;  1TCO B;  2BKH B;  2Y4Q A;  1TTX A;  4P5O E;  2M7N A;  2LCP A;  3DVE A;  3JTD B;  2KOT A;  1X02 A;  1SKT A;  2KI6 D;  1Y0V H;  5J3X A;  1TIZ A;  1TRF A;  1KFU S;  2GV5 A;  1PVA A;  4ICB A;  1SCV A;  2I2R E;  2MHH A;  2KFF A;  2L0P A;  3BYA A;  3AKA A;  5CSF A;  1V1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...