1KCYA

Nmr solution structure of apo calbindin d9k (f36g + p43m mutant)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEGPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The EF-hand domain: a globally cooperative structural unit.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords calbindin D9k
total genus 25
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kcyA00
1JBAA 2SASA 3BUOB 3PFVA 1F70A 3WHUB 5DKNA 1B8CA 2BE4A 4XYNA 3WXAA 1FPWA 2BL0C 2LE9B 2LANA 2HQ8A 1DT7B 1IH0A 4P2YB 3GK1A 4DIRA 2K7CA 2NZ0A 1ZACA 1J7PA 1DJGA 3EK4A 1KFXL 1QIWA 3CS1A 2LP3A 2Y1MA 2K61A 1MQ1A 2LVKA 2M3WA 4AQJA 2L0PA 5DKRA 5KTYA 1NPQA 2CNPA 1LA0A 3JTDB 3WNXB 2CCMA 3JTDC 1N2DA 2BBMA 3CTNA 2MHHA 2Y1NA 2LM5A 2KYCA 5GQQC 1PK0D 4GGFA 1JUOA 2JNXA 4I5LB 1NUBA 2GGMA 2L5XB 1OMDA 2VRGA 3PSRA 1NWDA 1JC2A 2D8NA 2LAPA 1BR4B 2I94A 1JWDA 3I5FB 5K89A 4ICBA 1XFYO 1OMVA 2ZRTA 4USLA 1VRKA 2L4IA 3NXAA 1YVLA 3PALA 4DCKA 5I2QA 1SR6B 1J7QA 4HRHA 3O6BA 1A2XA 1DF0B 1TTXA 2SCPA 4GAOA 4GNKB 1N0YA 1S36A 3VRPA 1ALWA 1FI5A 1J7RA 2H61A 3SG4A 1BT6A 1OE9B 2OS8C 3JVTC 1KQMB 1BJFA 1QX5B 2WCEA 2IS9A 3DVKA 2LHIA 3AAKA 3GOFA 1CNPA 2ZRSA 1TRFA 1EJ3A 4CPVA 1Y1XA 2JTTA 2HQWA 2KGRA 2JRFA 1SCVA 1Y1AA 2JXCA 1NX1A 2AAOA 4GBAA 2ZNDA 1CFFA 2K2AA 2WOSA 1ALVA 1FBVA 4CFRA 1OZSA 2M7NA 5HKWA 1KK7Y 2BBNA 5CSJA 1JF2A 3MSEB 2LCPA 2WORA 2PALA 1B47A 2G2BA 1CLMA 1QJTA 1IQ3A 1PSBA 1QATA 1SKTA 1IQ5A 1SL8A 2KFHA 2JQ6A 3CR4X 3HCMA 2QPTA 3CR5X 1UHNA 1WRLA 4U8DA 4QJ5B 1FF1A 4ORCB 1WRKA 5KSZA 4C0JA 3M0WA 1S26D 4C0KA 3A4UB 3PLFB 4I5JA 4OCIA 3OX6A 3RLZA 1MXEA 1KCYA 2NLNA 1SL9A 1UHHA 3PN7B 4YBHB 4E68A 1RJVA 2BCAA 1DTLA 1K95A 1K8UA 2BKIB 2CTNA 5I8NA 4YGEB 2LHLA 3BOWA 3OB1B 2BCXA 2QACA 2FCDA 1MXLC 4PALA 2NCPA 3BUMB 1XFVO 3PN7C 3EKHA 4F0ZB 1IGVA 1A75B 2KI6C 2KQYA 1XVJA 1L2OC 3OP0A 1UP5A 1BMOA 1KK8C 4JQ0D 1CTRA 1NCXA 5BPJA 4FQOA 4MSPA 5PALA 1LINA 2JT3A 3EVRA 4UPGA 4JPZB 1S6JA 2ZN8A 2AMIA 5G08A 1KFXS 3TDIA 3TZ1A 1IWQA 3CZTX 4GPLB 2M97A 3HX4A 2KAYA 2FOTA 1CDPA 2MBXA 2KGBC 2MA2A 2H61C 4XJKB 1BLQA 1CB1A 1A29A 3LL8B 1QX2A 4M2QA 3BXKA 2ZN9A 5I2LA 3LK1A 1SBJA 1YRUB 1M63B 1DVIA 2LMUA 1AJ5A 2HETA 1B8LA 1KFUL 3EVVA 1H4BA 2LC5A 4YGBB 1QIVA 3AKAA 3TDZA 2OS8B 1BR1B 3H4SE 3NSLA 3VRQA 3BUXB 1RWYA 2M8UA 2K7OA 1W7JB 2KBIA 4BY5A 4R1EA 1M46A 1QASA 1B7TY 1TNQA 2K7BA 1JFKA 3DD4A 1MHOA 1ZUZA 3KEVA 4HRGA 2L4HA 3EK7A 2ZFDA 2P6BB 3TS5C 1SYMA 1WRZA 2LVVA 4OKHA 1LVCD 2KAVA 3JVTB 5CSNA 5HKYA 1YX8A 1QVIZ 3O2PA 1GGWA 1U5IB 2KHNA 1CMFA 1AP4A 1SCMB 4N5XA 2LP2A 1XFZO 5AFPA 3VGOA 2L51A 4OV2A 5I2OA 1KFUS 2I7AA 1EG3A 2ZNEA 1KWOB 2JC2A 1BG1A 3CR2A 2LV7A 3NSKA 4N1FA 1NX0A 5AEQA 4ZCUA 3WHTB 4DRWA 2M1KB 4GFTA 1YR5A 3GK2A 1K94A 1J55A 3K21A 5CSIA 2B1UA 1MUXA 1MWNA 1AUIB 3C1VA 1TNPA 3PATA 1PVBA 5B8IB 2BECA 4A4BA 3NSIA 1AK8A 1DJYA 2F3YA 1CFCA 2WC8A 2E6WA 1E8AA 4YRUA 1B8RA 1FI6A 1KK7Z 1KSOA 1PRWA 1S6CA 2M29A 2NCOA 3D10A 4MEWA 1XFWO 1B1GA 3GK4X 5DKQA 1MR8A 3OX5A 4CIDA 5HLVA 1K9PA 2O60A 1TNXA 1RECA 4NDCA 1CDLA 2M0RA 1CDNA 1PALA 3TUYB 1BOCA 1NX3A 1F55A 2EC6C 1B9AA 5ER5A 5TNCA 3TS5B 2F2OA 1W7IB 1RK9A 2OPOA 4DS7A 1XO5A 2KFFA 4MRXA 4P5OE 2LLTA 1FW4A 2NXQA 1KWOC 2Y5IA 1S3PA 1EXRA 1PVAA 2M1UA 2HF5A 1CKKA 3E3RA 1TIZA 2M49B 5D69A 1J1DA 2HPSA 1QS7A 1F4QA 3I5IC 3SJSA 1B4CA 1JFJA 4I5NB 1BF5A 1K90D 3TUYC 3O78A 1QLKA 1YUSA 2EGDA 4MRYA 1A03A 4MVFA 3LK0A 1K9UA 2OTGB 2KI6D 2JPTA 5JOLA 1K9KA 2PMYA 1D1OA 3AAJA 1IG5A 2F2PA 2LMVA 2WCFA 2WNDA 3AKBA 2BL0B 4MBEA 4MZJA 3FIAA 2JU0A 1F71A 1YRTB 4TNCA 1V1FA 3BUWB 1OSAA 3ZNIA 2Q91A 2ZKMX 4NDDA 1AVSA 4BY4A 1WDCB 1Q80A 1XK4A 2KAXA 2TN4A 4A4CA 1NIWA 1MF8B 2PSRA 1UWOA 1CM4A 2JULA 4Q04A 1R6PA 2H2KA 3SIBA 1LA3A 1NYAA 1EL4A 2BE6A 1SK6D 1NSHA 3BYAA 5KU1A 2V53A 2MLEC 1XYDA 1EG4A 1CFDA 2CT9A 4ORBB 5HKZA 4AOMA 1CDMA 1C7VA 2LLSA 1SW8A 1OZOA 2LLUA 2O5GA 1QX7A 3ZWHA 1XFUO 1M31A 1YUUA 2G9BA 3QRXA 1SRAA 4AQIA 1SL7A 5FYXA 1TN4A 2KDHA 4D1EA 1K93D 2K7DA 3D0YB 1L2OB 4XJKA 1KQVA 3DF0A 1K2HA 4QJ3B 2MRDA 5J3XA 2Q4UA 3BQ3A 1JSAA 1UUSA 2WCBA 4WQ3A 1S1EA 1V1GA 2R2IA 1JF0A 2LVIA 2PASA 3FWBA 3SG5A 2PRUA 2KFGA 1GGZA 1RTP1 2K0JA 4L9MA 1QV1A 4PHMA 2OTGC 1GJYA 1Y0VH 4YGDB 1CM1A 1GQMA 1NP8A 5AERA 3PM8A 4OR9B 4MLWA 4PE4A 3LLEA 1A75A 1OQPA 4PHJA 1TNWA 1PULA 3VRNA 1UHIA 4YI9A 1U5IA 3OHMB 5IBWA 1WLZA 3BOWB 3NSOA 4NQGA 2F33A 5JJGA 1DMOA 4DUQA 4PDZA 2KI4C 1SPYA 1LKJA 1YUTA 2KI4B 1QXPA 1S5GY 4GUKA 3KF9A 1TCFA 2KBMA 1RROA 2A4JA 3KPXA 3SG6A 4HREE 1BODA 1QLSA 5CPVA 1IJ6A 4I5KA 5F6TA 3DF0B 2COLB 2I18A 4CLNA 1XK4C 3EK8A 2BCBA 1WY9A 1S6IA 3TDUA 5D7FA 1CMGA 2EHBA 1TOPA 1DGUA 1KQMC 2L98A 3SG2A 1A4PA 2ISDA 1H8BA 3EKJA 4PCWA 2MAZA 3VROA 1KSMA 1ZFSA 2LVJA 1NCYA 2M7LA 3I5HB 3DVJA 1QV0A 1YX7A 1DJZA 1LXFC 2LUXA 4N1GA 1YVHA 3SIAA 1SY9A 4YGCB 5AANA 1ZOTB 2JOJA 1F4OA 2K8MB 2GV5A 1IRJA 2JXLA 1PSRA 2JNFA 4OVNF 1G4YR 2FCEA 1WLMA 2JTZA 1ZMZA 1DGVA 3I5HC 4JWQA 1G8IA 4ORAB 1RFJA 2PVBA 1DF0A 2Y4QA 1Y1UA 4MN0A 3OB2B 3F45A 1SR6C 2L2EA 2KSPA 4FTGA 1S5GZ 2JT8A 4YGAA 4ZCVA 1QTXA 2MLFC 4NDBA 3DVEA 2FJUB 1M45A 1N65A 1KK8B 4WRIA 1CLLA 3IF7A 2CXJA 4MZLA 5HLOA 5ER4X 1YTZC 2DOQA 3CWGA 1HT9A 1SCMC 4MZKA 2LNKA 1J7OA 2CBLA 1L7ZA 1SMGA 1XFXO 3ICBA 1NX2A 4M2PA 1J1EA 2KNEA 3O4YA 4GGNA 4GGFC 1DJXA 1UURA 4IL1A 3A8RA 1C7WA 1F54A 4QJ4B 3KHEA 2JT0A 4HSZA 4M2OA 3BUNB 1F8HA 1M39A 1XA5A 2I2RE 2K2FA 2E30A 1Y6WA 2EC6B 2KQ6A 1B7TZ 1WDCC 3FS7A 1SNLA 2JWWA 1UHKA 3I5GB 4PE1A 1OOJA 3KO0A 3DVMA 2AUCA 2GGZA 1C07A 1NCZA 2MJWB 3IQOA 4PHNA 4YI8A 3IQQA 1QVIY 2BKHB 2JZIA 3SG3A 3CGAA 1K96A 5HYDA 4ETOA 4C0LA 2RGIA 2LMTA 4WQ2A 1G33A 1TCOB 2M9GA 3RM1A 1BU3A 1DJWA 2KOTA 3I5GC 2L50A 1HQVA 2KYFA 3FWCA 2F3ZA 3D0YA 4PE0A 5CSFA 3VRRA 1IKUA 3CLNA 3I5IB 1UHJA 4PE7A 2F8PA 4CFQA 5AXIA 2LUCA 3I5FC 1IJ5A 1R2UA 1OMRA 3EVUA 1X02A 3SG7A 1CFPA 1ODBA 1AHRA 1DJIA 4PHKA 1YURA 3LCPC 1EH2A 1DJHA 1AJ4A 1CLBA
chains in the Genus database with same CATH superfamily
1JBAA 2SASA 3BUOB 3PFVA 1F70A 3WHUB 5DKNA 1B8CA 2BE4A 4XYNA 3WXAA 1FPWA 5HL1A 2BL0C 2LE9B 2LANA 2HQ8A 1DT7B 1IH0A 3IVTA 4P2YB 3GK1A 4DIRA 2K7CA 2NZ0A 1ZACA 1J7PA 1DJGA 3S0EA 3EK4A 1KFXL 1QIWA 3CS1A 1OOFA 3R1VA 3B6XA 2LP3A 3SS3A 3S0BA 2Y1MA 3OBVA 2K61A 1MQ1A 2LVKA 2M3WA 4AQJA 2L0PA 1C3ZA 5DKRA 5KTYA 1NPQA 2CNPA 5DICA 1LA0A 3JTDB 3WNXB 3S0AA 2CCMA 4JD9A 3JTDC 1N2DA 2BBMA 2BAPA 2MHHA 3CTNA 2Y1NA 2LM5A 2KYCA 5GQQC 1PK0D 4GGFA 1JUOA 2JNXA 4I5LB 1NUBA 2GGMA 2L5XB 1OMDA 2VRGA 3PSRA 1NWDA 1JC2A 2D8NA 2LAPA 1BR4B 2I94A 1JWDA 3I5FB 5K89A 4ICBA 1XFYO 1OMVA 2ZRTA 4USLA 3R1PA 1VRKA 2L4IA 3NXAA 1YVLA 3PALA 4DCKA 5I2QA 1SR6B 1J7QA 4HRHA 3O6BA 1A2XA 1DF0B 1TTXA 2SCPA 3D73A 4GAOA 4GNKB 1N0YA 1S36A 3VRPA 1ALWA 1FI5A 2K60A 5D3OA 1J7RA 2H61A 3SG4A 3B7AA 1BT6A 1OE9B 2OS8C 3JVTC 1KQMB 1BJFA 1ORGA 1QX5B 2WCEA 2IS9A 3DVKA 2LHIA 3AAKA 3GOFA 1CNPA 5EL2A 2ZRSA 3BFBA 1TRFA 1EJ3A 3B88A 3R72A 1Y1XA 4CPVA 2JTTA 2HQWA 2KGRA 2JRFA 3FE8A 1SCVA 1Y1AA 2JXCA 2WCLA 1NX1A 2AAOA 3L47A 4GBAA 2ZNDA 1CFFA 2K2AA 1DQEA 1TUJA 3PM2A 2WOSA 1ALVA 1FBVA 4CFRA 1OZSA 2M7NA 5HKWA 1KK7Y 2BBNA 5CSJA 1JF2A 3MSEB 2LCPA 2WORA 2PALA 1B47A 2G2BA 1CLMA 3SS4A 1QJTA 1IQ3A 1PSBA 1QATA 1SKTA 1IQ5A 1SL8A 2KFHA 2JQ6A 3CR4X 3HCMA 2QPTA 3CR5X 1UHNA 1WRLA 1C3YA 4U8DA 4QJ5B 1FF1A 4ORCB 1WRKA 5KSZA 4C0JA 3M0WA 1S26D 4C0KA 3A4UB 3PLFB 1SSEB 4I5JA 4OCIA 3OX6A 3RLZA 1MXEA 2WCKA 2NLNA 1SL9A 1KCYA 1W9ZA 1UHHA 2ERBA 3PN7B 2FJYA 3RZSA 4YBHB 4E68A 1RJVA 2BCAA 2L5YA 1DTLA 1K95A 1K8UA 2BKIB 2CTNA 5I8NA 2PQLA 4YGEB 2LHLA 3BOWA 3OB1B 2BCXA 2QACA 2FCDA 1MXLC 4PALA 2NCPA 3BUMB 1XFVO 3PN7C 3EKHA 4F0ZB 5FI2A 1IGVA 1A75B 2KI6C 2KQYA 1XVJA 1L2OC 3OP0A 1UP5A 1BMOA 1KK8C 2GTEA 4JQ0D 1CTRA 1NCXA 5BPJA 4FQOA 4MSPA 5PALA 1LINA 2JT3A 3EVRA 4UPGA 4JPZB 1S6JA 2ZN8A 2AMIA 5G08A 1KFXS 4INWA 3TDIA 3TZ1A 1IWQA 1QWVA 3CZTX 4GPLB 2M97A 3HX4A 2KAYA 2FOTA 1CDPA 2MBXA 2KGBC 2MA2A 2H61C 4XJKB 1BLQA 1CB1A 1A29A 3LL8B 1QX2A 4M2QA 3BXKA 2ZN9A 5I2LA 3LK1A 2WC5A 3K1EA 1SBJA 1YRUB 1M63B 1DVIA 2LMUA 3S0GA 1AJ5A 2HETA 1B8LA 1KFUL 3EVVA 1H4BA 2LC5A 4YGBB 1QIVA 3AKAA 3TDZA 2WCMA 2OS8B 1BR1B 3H4SE 3NSLA 3VRQA 3BUXB 1RWYA 2M8UA 2QDIA 2K7OA 1W7JB 2KBIA 4BY5A 4R1EA 1M46A 1QASA 1B7TY 1TNQA 2K7BA 1JFKA 3DD4A 1MHOA 1ZUZA 3KEVA 4HRGA 2L4HA 3EK7A 2QEVA 2ZFDA 2P6BB 3TS5C 1SYMA 1WRZA 2LVVA 4OKHA 3CABA 1LVCD 2KAVA 3JVTB 4OZDA 5CSNA 1YX8A 2YGUA 1QVIZ 3O2PA 4IJ7A 5HKYA 3DZTA 1GGWA 1U5IB 2KHNA 1CMFA 1AP4A 1SCMB 4N5XA 2LP2A 1XFZO 5AFPA 3VGOA 2L51A 2PYQA 4OV2A 5I2OA 1TUZA 1KFUS 2I7AA 1EG3A 2ZNEA 3EG5B 1DEKA 1KWOB 2JC2A 3CR2A 2LV7A 3NSKA 4N1FA 1BG1A 1NX0A 5AEQA 4ZCUA 3WHTB 4DRWA 2M1KB 5FI6A 4GFTA 1YR5A 3GK2A 1DC1A 1K94A 1J55A 3K21A 3R1OA 2B1UA 5CSIA 3S0DA 1MUXA 1MWNA 1AUIB 2WCJA 3C1VA 1TNPA 3PATA 1PVBA 5B8IB 2BECA 4A4BA 3NSIA 1AK8A 1DJYA 2F3YA 1CFCA 2WC8A 2E6WA 3NHIA 1E8AA 4YRUA 1B8RA 1FI6A 1KK7Z 1KSOA 1PRWA 1S6CA 2M29A 2NCOA 3D10A 4MEWA 1XFWO 1B1GA 3GK4X 5DKQA 1MR8A 3OX5A 4CIDA 5HLVA 1K9PA 3FE9A 2O60A 1TNXA 1RECA 4NDCA 1CDLA 2M0RA 1Z4HA 1CDNA 1PALA 3TUYB 1BOCA 1NX3A 1F55A 2EC6C 1B9AA 5ER5A 5TNCA 1T14A 2F2OA 3TS5B 1W7IB 1RK9A 2OPOA 4DS7A 1XO5A 2KFFA 4MRXA 2H8VA 4P5OE 2LLTA 1FW4A 2NXQA 1KWOC 2Y5IA 1S3PA 1EXRA 1Z2CB 1PVAA 2M1UA 2HF5A 1CKKA 3E3RA 1TIZA 2M49B 2QEHA 3FE6A 5D69A 1J1DA 2HPSA 1QS7A 1F4QA 3I5IC 3SJSA 1B4CA 1JFJA 4I5NB 1BF5A 1K90D 3TUYC 3O78A 1QLKA 1YUSA 2EGDA 3D74A 4MRYA 1A03A 4MVFA 3LK0A 1K9UA 2OTGB 2KI6D 2JPTA 5JOLA 1K9KA 2PMYA 1D1OA 3AAJA 1IG5A 2F2PA 2LMVA 2WCFA 2WNDA 2WCHA 3AKBA 2BL0B 4MBEA 4MZJA 4FQTA 3FIAA 2JU0A 1F71A 1YRTB 4TNCA 1V1FA 2JPOA 1OSAA 3BUWB 3ZNIA 3NGVA 2Q91A 2ZKMX 4NDDA 1AVSA 4BY4A 1WDCB 1Q80A 1XK4A 2KAXA 2TN4A 4KYNA 4A4CA 1NIWA 1MF8B 2PSRA 1UWOA 1CM4A 2JULA 4Q04A 1R6PA 2H2KA 3SIBA 1LA3A 3NHTA 1NYAA 1EL4A 2BE6A 1SK6D 2QEBA 3V2LA 1NSHA 3UNWA 4F7FA 1OOIX 2KPHA 3BYAA 5KU1A 2V53A 2MLEC 1XYDA 1EG4A 1CFDA 2CT9A 3CZ1A 4ORBB 5HKZA 4AOMA 1CDMA 1C7VA 2LLSA 1SW8A 3CDNA 1OZOA 2LLUA 2O5GA 3CYZA 1QX7A 3ZWHA 1XFUO 1M31A 1YUUA 2G9BA 3QRXA 1SRAA 4AQIA 1SL7A 3BFAA 5FYXA 1TN4A 2KDHA 4D1EA 1K93D 2K7DA 3D0YB 1L2OB 2KLDA 1P28A 3DF0A 4XJKA 1KQVA 1K2HA 4QJ3B 2MRDA 3N7HA 5J3XA 2Q4UA 3BQ3A 1JSAA 1UUSA 2WCBA 4WQ3A 1S1EA 1V1GA 2R2IA 3DYEA 1JF0A 2LVIA 2PASA 3FWBA 3SG5A 2PRUA 2KFGA 1GGZA 1RTP1 2K0JA 4L9MA 1QV1A 4PHMA 2OTGC 1GJYA 1Y0VH 4YGDB 5I94A 1TWOA 3O4XA 1CM1A 1GQMA 2QEOA 1NP8A 3VB1A 5AERA 3PM8A 4OR9B 4MLWA 4PE4A 3LLEA 1A75A 1OQPA 4PHJA 1TNWA 1PULA 3VRNA 1UHIA 4YI9A 1U5IA 3OHMB 5IBWA 2WC6A 1WLZA 3BOWB 3D76A 3NSOA 2F33A 4NQGA 3UO9A 5JJGA 1DMOA 4DUQA 4PDZA 2KI4C 1SPYA 1LKJA 3L4AA 1YUTA 2KI4B 1QXPA 1S5GY 3L4LA 4GUKA 3KF9A 1TCFA 2KBMA 1RROA 2A4JA 3KPXA 3SG6A 4HREE 1BODA 1QLSA 5CPVA 1IJ6A 4I5KA 5F6TA 3DF0B 4PT1A 1OOHA 2COLB 2P71A 2I18A 4CLNA 1XK4C 3EK8A 3B87A 2BCBA 1WY9A 1S6IA 3TDUA 4JKTA 5D7FA 1CMGA 1GM0A 2EHBA 1TOPA 1DGUA 1KQMC 2L98A 3SG2A 1A4PA 2ISDA 1H8BA 3EKJA 4PCWA 3DXLA 2MAZA 3VROA 1KSMA 1ZFSA 1OOGA 2LVJA 1NCYA 2M7LA 3I5HB 3DVJA 1QV0A 1YX7A 1DJZA 3D77A 1LXFC 3D75A 2LUXA 4N1GA 1YVHA 3CZ0A 3S0FA 3SIAA 1SY9A 4YGCB 5AANA 1ZOTB 2JOJA 1F4OA 2K8MB 1LS8A 2GV5A 1IRJA 2JXLA 1PSRA 1XFRA 2JNFA 4OVNF 1G4YR 1OW4A 2FCEA 1WLMA 2JTZA 1ZMZA 1DGVA 3I5HC 4JWQA 1G8IA 3BFHA 4ORAB 1IIOA 1RFJA 2PVBA 1DF0A 2Y4QA 1Y1UA 4MN0A 3OB2B 3F45A 3PJIA 1SR6C 2L2EA 2KSPA 4FTGA 1S5GZ 2JT8A 4YGAA 4ZCVA 1QTXA 2MLFC 3B86A 4NDBA 3DVEA 2FJUB 1M45A 1N65A 3D78A 1KK8B 4WRIA 1CLLA 3IF7A 2CXJA 4MZLA 5HLOA 5ER4X 1YTZC 2DOQA 3CWGA 1HT9A 3OGNA 1SCMC 4MZKA 2LNKA 1J7OA 2CBLA 1L7ZA 1SMGA 1XFXO 3ICBA 1NX2A 4M2PA 1J1EA 2KNEA 3BJHA 3O4YA 3SS5A 4GGNA 4GGFC 1DJXA 1UURA 4IL1A 3A8RA 1C7WA 1F54A 2P70A 4QJ4B 3KHEA 2JT0A 4HSZA 4M2OA 3BUNB 1F8HA 1M39A 1XA5A 2I2RE 1DELA 2BNXA 2K2FA 2E30A 1Y6WA 2EC6B 2KQ6A 1B7TZ 1WDCC 3FS7A 1SNLA 2JWWA 1UHKA 3I5GB 4PE1A 1OOJA 3KO0A 3DVMA 2AUCA 2GGZA 1C07A 1NCZA 2MJWB 3IQOA 4PHNA 4YI8A 3IQQA 1QVIY 2L2CA 2BKHB 2JZIA 3SG3A 3CGAA 3DY9A 1K96A 5HYDA 4ETOA 4C0LA 2RGIA 3CZ2A 2LMTA 4WQ2A 1G33A 1TCOB 2M9GA 3RM1A 1BU3A 1DJWA 2KLEA 2KOTA 3I5GC 2L50A 1HQVA 2KYFA 3FWCA 2F3ZA 3D0YA 4PE0A 5CSFA 3VRRA 1IKUA 3CLNA 3I5IB 1UHJA 3Q8IA 4PE7A 2F8PA 4CFQA 5AXIA 2LUCA 3QMEA 3I5FC 1IJ5A 1R2UA 1OMRA 3EVUA 4INXA 1X02A 3SG7A 1CFPA 1ODBA 1AHRA 1DJIA 4PHKA 5FI7A 1YURA 3LCPC 1EH2A 1DJHA 1AJ4A 1CLBA
chains in the Genus database with same CATH topology
1JBAA 2SASA 3BUOB 3PFVA 1F70A 3WHUB 5DKNA 1B8CA 2BE4A 4XYNA 3WXAA 1FPWA 2BL0C 2LE9B 2LANA 2HQ8A 1DT7B 1IH0A 4P2YB 3GK1A 4DIRA 2K7CA 2NZ0A 1ZACA 1J7PA 1DJGA 3EK4A 1KFXL 1QIWA 3CS1A 2LP3A 2Y1MA 2K61A 1MQ1A 2LVKA 2M3WA 4AQJA 2L0PA 5DKRA 5KTYA 1NPQA 2CNPA 1LA0A 3JTDB 3WNXB 2CCMA 3JTDC 1N2DA 2BBMA 3CTNA 2MHHA 2Y1NA 2LM5A 2KYCA 5GQQC 1PK0D 4GGFA 1JUOA 2JNXA 4I5LB 1NUBA 2GGMA 2L5XB 1OMDA 2VRGA 3PSRA 1NWDA 1JC2A 2D8NA 2LAPA 1BR4B 2I94A 1JWDA 3I5FB 5K89A 4ICBA 1XFYO 1OMVA 2ZRTA 4USLA 1VRKA 2L4IA 3NXAA 1YVLA 3PALA 4DCKA 5I2QA 1SR6B 1J7QA 4HRHA 3O6BA 1A2XA 1DF0B 1TTXA 2SCPA 4GAOA 4GNKB 1N0YA 1S36A 3VRPA 1ALWA 1FI5A 1J7RA 2H61A 3SG4A 1BT6A 1OE9B 2OS8C 3JVTC 1KQMB 1BJFA 1QX5B 2WCEA 2IS9A 3DVKA 2LHIA 3AAKA 3GOFA 1CNPA 2ZRSA 1TRFA 1EJ3A 4CPVA 1Y1XA 2JTTA 2HQWA 2KGRA 2JRFA 1SCVA 1Y1AA 2JXCA 1NX1A 2AAOA 4GBAA 2ZNDA 1CFFA 2K2AA 2WOSA 1ALVA 1FBVA 4CFRA 1OZSA 2M7NA 5HKWA 1KK7Y 2BBNA 5CSJA 1JF2A 3MSEB 2LCPA 2WORA 2PALA 1B47A 2G2BA 1CLMA 1QJTA 1IQ3A 1PSBA 1QATA 1SKTA 1IQ5A 1SL8A 2KFHA 2JQ6A 3CR4X 3HCMA 2QPTA 3CR5X 1UHNA 1WRLA 4U8DA 4QJ5B 1FF1A 4ORCB 1WRKA 5KSZA 4C0JA 3M0WA 1S26D 4C0KA 3A4UB 3PLFB 4I5JA 4OCIA 3OX6A 3RLZA 1MXEA 1KCYA 2NLNA 1SL9A 1UHHA 3PN7B 4YBHB 4E68A 1RJVA 2BCAA 1DTLA 1K95A 1K8UA 2BKIB 2CTNA 5I8NA 4YGEB 2LHLA 3BOWA 3OB1B 2BCXA 2QACA 2FCDA 1MXLC 4PALA 2NCPA 3BUMB 1XFVO 3PN7C 3EKHA 4F0ZB 1IGVA 1A75B 2KI6C 2KQYA 1XVJA 1L2OC 3OP0A 1UP5A 1BMOA 1KK8C 4JQ0D 1CTRA 1NCXA 5BPJA 4FQOA 4MSPA 5PALA 1LINA 2JT3A 3EVRA 4UPGA 4JPZB 1S6JA 2ZN8A 2AMIA 5G08A 1KFXS 3TDIA 3TZ1A 1IWQA 3CZTX 4GPLB 2M97A 3HX4A 2KAYA 2FOTA 1CDPA 2MBXA 2KGBC 2MA2A 2H61C 4XJKB 1BLQA 1CB1A 1A29A 3LL8B 1QX2A 4M2QA 3BXKA 2ZN9A 5I2LA 3LK1A 1SBJA 1YRUB 1M63B 1DVIA 2LMUA 1AJ5A 2HETA 1B8LA 1KFUL 3EVVA 1H4BA 2LC5A 4YGBB 1QIVA 3AKAA 3TDZA 2OS8B 1BR1B 3H4SE 3NSLA 3VRQA 3BUXB 1RWYA 2M8UA 2K7OA 1W7JB 2KBIA 4BY5A 4R1EA 1M46A 1QASA 1B7TY 1TNQA 2K7BA 1JFKA 3DD4A 1MHOA 1ZUZA 3KEVA 4HRGA 2L4HA 3EK7A 2ZFDA 2P6BB 3TS5C 1SYMA 1WRZA 2LVVA 4OKHA 1LVCD 2KAVA 3JVTB 5CSNA 5HKYA 1YX8A 1QVIZ 3O2PA 1GGWA 1U5IB 2KHNA 1CMFA 1AP4A 1SCMB 4N5XA 2LP2A 1XFZO 5AFPA 3VGOA 2L51A 4OV2A 5I2OA 1KFUS 2I7AA 1EG3A 2ZNEA 1KWOB 2JC2A 1BG1A 3CR2A 2LV7A 3NSKA 4N1FA 1NX0A 5AEQA 4ZCUA 3WHTB 4DRWA 2M1KB 4GFTA 1YR5A 3GK2A 1K94A 1J55A 3K21A 5CSIA 2B1UA 1MUXA 1MWNA 1AUIB 3C1VA 1TNPA 3PATA 1PVBA 5B8IB 2BECA 4A4BA 3NSIA 1AK8A 1DJYA 2F3YA 1CFCA 2WC8A 2E6WA 1E8AA 4YRUA 1B8RA 1FI6A 1KK7Z 1KSOA 1PRWA 1S6CA 2M29A 2NCOA 3D10A 4MEWA 1XFWO 1B1GA 3GK4X 5DKQA 1MR8A 3OX5A 4CIDA 5HLVA 1K9PA 2O60A 1TNXA 1RECA 4NDCA 1CDLA 2M0RA 1CDNA 1PALA 3TUYB 1BOCA 1NX3A 1F55A 2EC6C 1B9AA 5ER5A 5TNCA 3TS5B 2F2OA 1W7IB 1RK9A 2OPOA 4DS7A 1XO5A 2KFFA 4MRXA 4P5OE 2LLTA 1FW4A 2NXQA 1KWOC 2Y5IA 1S3PA 1EXRA 1PVAA 2M1UA 2HF5A 1CKKA 3E3RA 1TIZA 2M49B 5D69A 1J1DA 2HPSA 1QS7A 1F4QA 3I5IC 3SJSA 1B4CA 1JFJA 4I5NB 1BF5A 1K90D 3TUYC 3O78A 1QLKA 1YUSA 2EGDA 4MRYA 1A03A 4MVFA 3LK0A 1K9UA 2OTGB 2KI6D 2JPTA 5JOLA 1K9KA 2PMYA 1D1OA 3AAJA 1IG5A 2F2PA 2LMVA 2WCFA 2WNDA 3AKBA 2BL0B 4MBEA 4MZJA 3FIAA 2JU0A 1F71A 1YRTB 4TNCA 1V1FA 3BUWB 1OSAA 3ZNIA 2Q91A 2ZKMX 4NDDA 1AVSA 4BY4A 1WDCB 1Q80A 1XK4A 2KAXA 2TN4A 4A4CA 1NIWA 1MF8B 2PSRA 1UWOA 1CM4A 2JULA 4Q04A 1R6PA 2H2KA 3SIBA 1LA3A 1NYAA 1EL4A 2BE6A 1SK6D 1NSHA 3BYAA 5KU1A 2V53A 2MLEC 1XYDA 1EG4A 1CFDA 2CT9A 4ORBB 5HKZA 4AOMA 1CDMA 1C7VA 2LLSA 1SW8A 1OZOA 2LLUA 2O5GA 1QX7A 3ZWHA 1XFUO 1M31A 1YUUA 2G9BA 3QRXA 1SRAA 4AQIA 1SL7A 5FYXA 1TN4A 2KDHA 4D1EA 1K93D 2K7DA 3D0YB 1L2OB 4XJKA 1KQVA 3DF0A 1K2HA 4QJ3B 2MRDA 5J3XA 2Q4UA 3BQ3A 1JSAA 1UUSA 2WCBA 4WQ3A 1S1EA 1V1GA 2R2IA 1JF0A 2LVIA 2PASA 3FWBA 3SG5A 2PRUA 2KFGA 1GGZA 1RTP1 2K0JA 4L9MA 1QV1A 4PHMA 2OTGC 1GJYA 1Y0VH 4YGDB 1CM1A 1GQMA 1NP8A 5AERA 3PM8A 4OR9B 4MLWA 4PE4A 3LLEA 1A75A 1OQPA 4PHJA 1TNWA 1PULA 3VRNA 1UHIA 4YI9A 1U5IA 3OHMB 5IBWA 1WLZA 3BOWB 3NSOA 4NQGA 2F33A 5JJGA 1DMOA 4DUQA 4PDZA 2KI4C 1SPYA 1LKJA 1YUTA 2KI4B 1QXPA 1S5GY 4GUKA 3KF9A 1TCFA 2KBMA 1RROA 2A4JA 3KPXA 3SG6A 4HREE 1BODA 1QLSA 5CPVA 1IJ6A 4I5KA 5F6TA 3DF0B 2COLB 2I18A 4CLNA 1XK4C 3EK8A 2BCBA 1WY9A 1S6IA 3TDUA 5D7FA 1CMGA 2EHBA 1TOPA 1DGUA 1KQMC 2L98A 3SG2A 1A4PA 2ISDA 1H8BA 3EKJA 4PCWA 2MAZA 3VROA 1KSMA 1ZFSA 2LVJA 1NCYA 2M7LA 3I5HB 3DVJA 1QV0A 1YX7A 1DJZA 1LXFC 2LUXA 4N1GA 1YVHA 3SIAA 1SY9A 4YGCB 5AANA 1ZOTB 2JOJA 1F4OA 2K8MB 2GV5A 1IRJA 2JXLA 1PSRA 2JNFA 4OVNF 1G4YR 2FCEA 1WLMA 2JTZA 1ZMZA 1DGVA 3I5HC 4JWQA 1G8IA 4ORAB 1RFJA 2PVBA 1DF0A 2Y4QA 1Y1UA 4MN0A 3OB2B 3F45A 1SR6C 2L2EA 2KSPA 4FTGA 1S5GZ 2JT8A 4YGAA 4ZCVA 1QTXA 2MLFC 4NDBA 3DVEA 2FJUB 1M45A 1N65A 1KK8B 4WRIA 1CLLA 3IF7A 2CXJA 4MZLA 5HLOA 5ER4X 1YTZC 2DOQA 3CWGA 1HT9A 1SCMC 4MZKA 2LNKA 1J7OA 2CBLA 1L7ZA 1SMGA 1XFXO 3ICBA 1NX2A 4M2PA 1J1EA 2KNEA 3O4YA 4GGNA 4GGFC 1DJXA 1UURA 4IL1A 3A8RA 1C7WA 1F54A 4QJ4B 3KHEA 2JT0A 4HSZA 4M2OA 3BUNB 1F8HA 1M39A 1XA5A 2I2RE 2K2FA 2E30A 1Y6WA 2EC6B 2KQ6A 1B7TZ 1WDCC 3FS7A 1SNLA 2JWWA 1UHKA 3I5GB 4PE1A 1OOJA 3KO0A 3DVMA 2AUCA 2GGZA 1C07A 1NCZA 2MJWB 3IQOA 4PHNA 4YI8A 3IQQA 1QVIY 2BKHB 2JZIA 3SG3A 3CGAA 1K96A 5HYDA 4ETOA 4C0LA 2RGIA 2LMTA 4WQ2A 1G33A 1TCOB 2M9GA 3RM1A 1BU3A 1DJWA 2KOTA 3I5GC 2L50A 1HQVA 2KYFA 3FWCA 2F3ZA 3D0YA 4PE0A 5CSFA 3VRRA 1IKUA 3CLNA 3I5IB 1UHJA 4PE7A 2F8PA 4CFQA 5AXIA 2LUCA 3I5FC 1IJ5A 1R2UA 1OMRA 3EVUA 1X02A 3SG7A 1CFPA 1ODBA 1AHRA 1DJIA 4PHKA 1YURA 3LCPC 1EH2A 1DJHA 1AJ4A 1CLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBA A;  2SAS A;  3BUO B;  3PFV A;  1F70 A;  3WHU B;  5DKN A;  1B8C A;  2BE4 A;  4XYN A;  3WXA A;  1FPW A;  2BL0 C;  2LE9 B;  2LAN A;  2HQ8 A;  1DT7 B;  1IH0 A;  4P2Y B;  3GK1 A;  4DIR A;  2K7C A;  2NZ0 A;  1ZAC A;  1J7P A;  1DJG A;  3EK4 A;  1KFX L;  1QIW A;  3CS1 A;  2LP3 A;  2Y1M A;  2K61 A;  1MQ1 A;  2LVK A;  2M3W A;  4AQJ A;  2L0P A;  5DKR A;  5KTY A;  1NPQ A;  2CNP A;  1LA0 A;  3JTD B;  3WNX B;  2CCM A;  3JTD C;  1N2D A;  2BBM A;  3CTN A;  2MHH A;  2Y1N A;  2LM5 A;  2KYC A;  5GQQ C;  1PK0 D;  4GGF A;  1JUO A;  2JNX A;  4I5L B;  1NUB A;  2GGM A;  2L5X B;  1OMD A;  2VRG A;  3PSR A;  1NWD A;  1JC2 A;  2D8N A;  2LAP A;  1BR4 B;  2I94 A;  1JWD A;  3I5F B;  5K89 A;  4ICB A;  1XFY O;  1OMV A;  2ZRT A;  4USL A;  1VRK A;  2L4I A;  3NXA A;  1YVL A;  3PAL A;  4DCK A;  5I2Q A;  1SR6 B;  1J7Q A;  4HRH A;  3O6B A;  1A2X A;  1DF0 B;  1TTX A;  2SCP A;  4GAO A;  4GNK B;  1N0Y A;  1S36 A;  3VRP A;  1ALW A;  1FI5 A;  1J7R A;  2H61 A;  3SG4 A;  1BT6 A;  1OE9 B;  2OS8 C;  3JVT C;  1KQM B;  1BJF A;  1QX5 B;  2WCE A;  2IS9 A;  3DVK A;  2LHI A;  3AAK A;  3GOF A;  1CNP A;  2ZRS A;  1TRF A;  1EJ3 A;  4CPV A;  1Y1X A;  2JTT A;  2HQW A;  2KGR A;  2JRF A;  1SCV A;  1Y1A A;  2JXC A;  1NX1 A;  2AAO A;  4GBA A;  2ZND A;  1CFF A;  2K2A A;  2WOS A;  1ALV A;  1FBV A;  4CFR A;  1OZS A;  2M7N A;  5HKW A;  1KK7 Y;  2BBN A;  5CSJ A;  1JF2 A;  3MSE B;  2LCP A;  2WOR A;  2PAL A;  1B47 A;  2G2B A;  1CLM A;  1QJT A;  1IQ3 A;  1PSB A;  1QAT A;  1SKT A;  1IQ5 A;  1SL8 A;  2KFH A;  2JQ6 A;  3CR4 X;  3HCM A;  2QPT A;  3CR5 X;  1UHN A;  1WRL A;  4U8D A;  4QJ5 B;  1FF1 A;  4ORC B;  1WRK A;  5KSZ A;  4C0J A;  3M0W A;  1S26 D;  4C0K A;  3A4U B;  3PLF B;  4I5J A;  4OCI A;  3OX6 A;  3RLZ A;  1MXE A;  1KCY A;  2NLN A;  1SL9 A;  1UHH A;  3PN7 B;  4YBH B;  4E68 A;  1RJV A;  2BCA A;  1DTL A;  1K95 A;  1K8U A;  2BKI B;  2CTN A;  5I8N A;  4YGE B;  2LHL A;  3BOW A;  3OB1 B;  2BCX A;  2QAC A;  2FCD A;  1MXL C;  4PAL A;  2NCP A;  3BUM B;  1XFV O;  3PN7 C;  3EKH A;  4F0Z B;  1IGV A;  1A75 B;  2KI6 C;  2KQY A;  1XVJ A;  1L2O C;  3OP0 A;  1UP5 A;  1BMO A;  1KK8 C;  4JQ0 D;  1CTR A;  1NCX A;  5BPJ A;  4FQO A;  4MSP A;  5PAL A;  1LIN A;  2JT3 A;  3EVR A;  4UPG A;  4JPZ B;  1S6J A;  2ZN8 A;  2AMI A;  5G08 A;  1KFX S;  3TDI A;  3TZ1 A;  1IWQ A;  3CZT X;  4GPL B;  2M97 A;  3HX4 A;  2KAY A;  2FOT A;  1CDP A;  2MBX A;  2KGB C;  2MA2 A;  2H61 C;  4XJK B;  1BLQ A;  1CB1 A;  1A29 A;  3LL8 B;  1QX2 A;  4M2Q A;  3BXK A;  2ZN9 A;  5I2L A;  3LK1 A;  1SBJ A;  1YRU B;  1M63 B;  1DVI A;  2LMU A;  1AJ5 A;  2HET A;  1B8L A;  1KFU L;  3EVV A;  1H4B A;  2LC5 A;  4YGB B;  1QIV A;  3AKA A;  3TDZ A;  2OS8 B;  1BR1 B;  3H4S E;  3NSL A;  3VRQ A;  3BUX B;  1RWY A;  2M8U A;  2K7O A;  1W7J B;  2KBI A;  4BY5 A;  4R1E A;  1M46 A;  1QAS A;  1B7T Y;  1TNQ A;  2K7B A;  1JFK A;  3DD4 A;  1MHO A;  1ZUZ A;  3KEV A;  4HRG A;  2L4H A;  3EK7 A;  2ZFD A;  2P6B B;  3TS5 C;  1SYM A;  1WRZ A;  2LVV A;  4OKH A;  1LVC D;  2KAV A;  3JVT B;  5CSN A;  5HKY A;  1YX8 A;  1QVI Z;  3O2P A;  1GGW A;  1U5I B;  2KHN A;  1CMF A;  1AP4 A;  1SCM B;  4N5X A;  2LP2 A;  1XFZ O;  5AFP A;  3VGO A;  2L51 A;  4OV2 A;  5I2O A;  1KFU S;  2I7A A;  1EG3 A;  2ZNE A;  1KWO B;  2JC2 A;  1BG1 A;  3CR2 A;  2LV7 A;  3NSK A;  4N1F A;  1NX0 A;  5AEQ A;  4ZCU A;  3WHT B;  4DRW A;  2M1K B;  4GFT A;  1YR5 A;  3GK2 A;  1K94 A;  1J55 A;  3K21 A;  5CSI A;  2B1U A;  1MUX A;  1MWN A;  1AUI B;  3C1V A;  1TNP A;  3PAT A;  1PVB A;  5B8I B;  2BEC A;  4A4B A;  3NSI A;  1AK8 A;  1DJY A;  2F3Y A;  1CFC A;  2WC8 A;  2E6W A;  1E8A A;  4YRU A;  1B8R A;  1FI6 A;  1KK7 Z;  1KSO A;  1PRW A;  1S6C A;  2M29 A;  2NCO A;  3D10 A;  4MEW A;  1XFW O;  1B1G A;  3GK4 X;  5DKQ A;  1MR8 A;  3OX5 A;  4CID A;  5HLV A;  1K9P A;  2O60 A;  1TNX A;  1REC A;  4NDC A;  1CDL A;  2M0R A;  1CDN A;  1PAL A;  3TUY B;  1BOC A;  1NX3 A;  1F55 A;  2EC6 C;  1B9A A;  5ER5 A;  5TNC A;  3TS5 B;  2F2O A;  1W7I B;  1RK9 A;  2OPO A;  4DS7 A;  1XO5 A;  2KFF A;  4MRX A;  4P5O E;  2LLT A;  1FW4 A;  2NXQ A;  1KWO C;  2Y5I A;  1S3P A;  1EXR A;  1PVA A;  2M1U A;  2HF5 A;  1CKK A;  3E3R A;  1TIZ A;  2M49 B;  5D69 A;  1J1D A;  2HPS A;  1QS7 A;  1F4Q A;  3I5I C;  3SJS A;  1B4C A;  1JFJ A;  4I5N B;  1BF5 A;  1K90 D;  3TUY C;  3O78 A;  1QLK A;  1YUS A;  2EGD A;  4MRY A;  1A03 A;  4MVF A;  3LK0 A;  1K9U A;  2OTG B;  2KI6 D;  2JPT A;  5JOL A;  1K9K A;  2PMY A;  1D1O A;  3AAJ A;  1IG5 A;  2F2P A;  2LMV A;  2WCF A;  2WND A;  3AKB A;  2BL0 B;  4MBE A;  4MZJ A;  3FIA A;  2JU0 A;  1F71 A;  1YRT B;  4TNC A;  1V1F A;  3BUW B;  1OSA A;  3ZNI A;  2Q91 A;  2ZKM X;  4NDD A;  1AVS A;  4BY4 A;  1WDC B;  1Q80 A;  1XK4 A;  2KAX A;  2TN4 A;  4A4C A;  1NIW A;  1MF8 B;  2PSR A;  1UWO A;  1CM4 A;  2JUL A;  4Q04 A;  1R6P A;  2H2K A;  3SIB A;  1LA3 A;  1NYA A;  1EL4 A;  2BE6 A;  1SK6 D;  1NSH A;  3BYA A;  5KU1 A;  2V53 A;  2MLE C;  1XYD A;  1EG4 A;  1CFD A;  2CT9 A;  4ORB B;  5HKZ A;  4AOM A;  1CDM A;  1C7V A;  2LLS A;  1SW8 A;  1OZO A;  2LLU A;  2O5G A;  1QX7 A;  3ZWH A;  1XFU O;  1M31 A;  1YUU A;  2G9B A;  3QRX A;  1SRA A;  4AQI A;  1SL7 A;  5FYX A;  1TN4 A;  2KDH A;  4D1E A;  1K93 D;  2K7D A;  3D0Y B;  1L2O B;  4XJK A;  1KQV A;  3DF0 A;  1K2H A;  4QJ3 B;  2MRD A;  5J3X A;  2Q4U A;  3BQ3 A;  1JSA A;  1UUS A;  2WCB A;  4WQ3 A;  1S1E A;  1V1G A;  2R2I A;  1JF0 A;  2LVI A;  2PAS A;  3FWB A;  3SG5 A;  2PRU A;  2KFG A;  1GGZ A;  1RTP 1;  2K0J A;  4L9M A;  1QV1 A;  4PHM A;  2OTG C;  1GJY A;  1Y0V H;  4YGD B;  1CM1 A;  1GQM A;  1NP8 A;  5AER A;  3PM8 A;  4OR9 B;  4MLW A;  4PE4 A;  3LLE A;  1A75 A;  1OQP A;  4PHJ A;  1TNW A;  1PUL A;  3VRN A;  1UHI A;  4YI9 A;  1U5I A;  3OHM B;  5IBW A;  1WLZ A;  3BOW B;  3NSO A;  4NQG A;  2F33 A;  5JJG A;  1DMO A;  4DUQ A;  4PDZ A;  2KI4 C;  1SPY A;  1LKJ A;  1YUT A;  2KI4 B;  1QXP A;  1S5G Y;  4GUK A;  3KF9 A;  1TCF A;  2KBM A;  1RRO A;  2A4J A;  3KPX A;  3SG6 A;  4HRE E;  1BOD A;  1QLS A;  5CPV A;  1IJ6 A;  4I5K A;  5F6T A;  3DF0 B;  2COL B;  2I18 A;  4CLN A;  1XK4 C;  3EK8 A;  2BCB A;  1WY9 A;  1S6I A;  3TDU A;  5D7F A;  1CMG A;  2EHB A;  1TOP A;  1DGU A;  1KQM C;  2L98 A;  3SG2 A;  1A4P A;  2ISD A;  1H8B A;  3EKJ A;  4PCW A;  2MAZ A;  3VRO A;  1KSM A;  1ZFS A;  2LVJ A;  1NCY A;  2M7L A;  3I5H B;  3DVJ A;  1QV0 A;  1YX7 A;  1DJZ A;  1LXF C;  2LUX A;  4N1G A;  1YVH A;  3SIA A;  1SY9 A;  4YGC B;  5AAN A;  1ZOT B;  2JOJ A;  1F4O A;  2K8M B;  2GV5 A;  1IRJ A;  2JXL A;  1PSR A;  2JNF A;  4OVN F;  1G4Y R;  2FCE A;  1WLM A;  2JTZ A;  1ZMZ A;  1DGV A;  3I5H C;  4JWQ A;  1G8I A;  4ORA B;  1RFJ A;  2PVB A;  1DF0 A;  2Y4Q A;  1Y1U A;  4MN0 A;  3OB2 B;  3F45 A;  1SR6 C;  2L2E A;  2KSP A;  4FTG A;  1S5G Z;  2JT8 A;  4YGA A;  4ZCV A;  1QTX A;  2MLF C;  4NDB A;  3DVE A;  2FJU B;  1M45 A;  1N65 A;  1KK8 B;  4WRI A;  1CLL A;  3IF7 A;  2CXJ A;  4MZL A;  5HLO A;  5ER4 X;  1YTZ C;  2DOQ A;  3CWG A;  1HT9 A;  1SCM C;  4MZK A;  2LNK A;  1J7O A;  2CBL A;  1L7Z A;  1SMG A;  1XFX O;  3ICB A;  1NX2 A;  4M2P A;  1J1E A;  2KNE A;  3O4Y A;  4GGN A;  4GGF C;  1DJX A;  1UUR A;  4IL1 A;  3A8R A;  1C7W A;  1F54 A;  4QJ4 B;  3KHE A;  2JT0 A;  4HSZ A;  4M2O A;  3BUN B;  1F8H A;  1M39 A;  1XA5 A;  2I2R E;  2K2F A;  2E30 A;  1Y6W A;  2EC6 B;  2KQ6 A;  1B7T Z;  1WDC C;  3FS7 A;  1SNL A;  2JWW A;  1UHK A;  3I5G B;  4PE1 A;  1OOJ A;  3KO0 A;  3DVM A;  2AUC A;  2GGZ A;  1C07 A;  1NCZ A;  2MJW B;  3IQO A;  4PHN A;  4YI8 A;  3IQQ A;  1QVI Y;  2BKH B;  2JZI A;  3SG3 A;  3CGA A;  1K96 A;  5HYD A;  4ETO A;  4C0L A;  2RGI A;  2LMT A;  4WQ2 A;  1G33 A;  1TCO B;  2M9G A;  3RM1 A;  1BU3 A;  1DJW A;  2KOT A;  3I5G C;  2L50 A;  1HQV A;  2KYF A;  3FWC A;  2F3Z A;  3D0Y A;  4PE0 A;  5CSF A;  3VRR A;  1IKU A;  3CLN A;  3I5I B;  1UHJ A;  4PE7 A;  2F8P A;  4CFQ A;  5AXI A;  2LUC A;  3I5F C;  1IJ5 A;  1R2U A;  1OMR A;  3EVU A;  1X02 A;  3SG7 A;  1CFP A;  1ODB A;  1AHR A;  1DJI A;  4PHK A;  1YUR A;  3LCP C;  1EH2 A;  1DJH A;  1AJ4 A;  1CLB A; 
#chains in the Genus database with same CATH topology
 1JBA A;  2SAS A;  3BUO B;  3PFV A;  1F70 A;  3WHU B;  5DKN A;  1B8C A;  2BE4 A;  4XYN A;  3WXA A;  1FPW A;  5HL1 A;  2BL0 C;  2LE9 B;  2LAN A;  2HQ8 A;  1DT7 B;  1IH0 A;  3IVT A;  4P2Y B;  3GK1 A;  4DIR A;  2K7C A;  2NZ0 A;  1ZAC A;  1J7P A;  1DJG A;  3S0E A;  3EK4 A;  1KFX L;  1QIW A;  3CS1 A;  1OOF A;  3R1V A;  3B6X A;  2LP3 A;  3SS3 A;  3S0B A;  2Y1M A;  3OBV A;  2K61 A;  1MQ1 A;  2LVK A;  2M3W A;  4AQJ A;  2L0P A;  1C3Z A;  5DKR A;  5KTY A;  1NPQ A;  2CNP A;  5DIC A;  1LA0 A;  3JTD B;  3WNX B;  3S0A A;  2CCM A;  4JD9 A;  3JTD C;  1N2D A;  2BBM A;  2BAP A;  2MHH A;  3CTN A;  2Y1N A;  2LM5 A;  2KYC A;  5GQQ C;  1PK0 D;  4GGF A;  1JUO A;  2JNX A;  4I5L B;  1NUB A;  2GGM A;  2L5X B;  1OMD A;  2VRG A;  3PSR A;  1NWD A;  1JC2 A;  2D8N A;  2LAP A;  1BR4 B;  2I94 A;  1JWD A;  3I5F B;  5K89 A;  4ICB A;  1XFY O;  1OMV A;  2ZRT A;  4USL A;  3R1P A;  1VRK A;  2L4I A;  3NXA A;  1YVL A;  3PAL A;  4DCK A;  5I2Q A;  1SR6 B;  1J7Q A;  4HRH A;  3O6B A;  1A2X A;  1DF0 B;  1TTX A;  2SCP A;  3D73 A;  4GAO A;  4GNK B;  1N0Y A;  1S36 A;  3VRP A;  1ALW A;  1FI5 A;  2K60 A;  5D3O A;  1J7R A;  2H61 A;  3SG4 A;  3B7A A;  1BT6 A;  1OE9 B;  2OS8 C;  3JVT C;  1KQM B;  1BJF A;  1ORG A;  1QX5 B;  2WCE A;  2IS9 A;  3DVK A;  2LHI A;  3AAK A;  3GOF A;  1CNP A;  5EL2 A;  2ZRS A;  3BFB A;  1TRF A;  1EJ3 A;  3B88 A;  3R72 A;  1Y1X A;  4CPV A;  2JTT A;  2HQW A;  2KGR A;  2JRF A;  3FE8 A;  1SCV A;  1Y1A A;  2JXC A;  2WCL A;  1NX1 A;  2AAO A;  3L47 A;  4GBA A;  2ZND A;  1CFF A;  2K2A A;  1DQE A;  1TUJ A;  3PM2 A;  2WOS A;  1ALV A;  1FBV A;  4CFR A;  1OZS A;  2M7N A;  5HKW A;  1KK7 Y;  2BBN A;  5CSJ A;  1JF2 A;  3MSE B;  2LCP A;  2WOR A;  2PAL A;  1B47 A;  2G2B A;  1CLM A;  3SS4 A;  1QJT A;  1IQ3 A;  1PSB A;  1QAT A;  1SKT A;  1IQ5 A;  1SL8 A;  2KFH A;  2JQ6 A;  3CR4 X;  3HCM A;  2QPT A;  3CR5 X;  1UHN A;  1WRL A;  1C3Y A;  4U8D A;  4QJ5 B;  1FF1 A;  4ORC B;  1WRK A;  5KSZ A;  4C0J A;  3M0W A;  1S26 D;  4C0K A;  3A4U B;  3PLF B;  1SSE B;  4I5J A;  4OCI A;  3OX6 A;  3RLZ A;  1MXE A;  2WCK A;  2NLN A;  1SL9 A;  1KCY A;  1W9Z A;  1UHH A;  2ERB A;  3PN7 B;  2FJY A;  3RZS A;  4YBH B;  4E68 A;  1RJV A;  2BCA A;  2L5Y A;  1DTL A;  1K95 A;  1K8U A;  2BKI B;  2CTN A;  5I8N A;  2PQL A;  4YGE B;  2LHL A;  3BOW A;  3OB1 B;  2BCX A;  2QAC A;  2FCD A;  1MXL C;  4PAL A;  2NCP A;  3BUM B;  1XFV O;  3PN7 C;  3EKH A;  4F0Z B;  5FI2 A;  1IGV A;  1A75 B;  2KI6 C;  2KQY A;  1XVJ A;  1L2O C;  3OP0 A;  1UP5 A;  1BMO A;  1KK8 C;  2GTE A;  4JQ0 D;  1CTR A;  1NCX A;  5BPJ A;  4FQO A;  4MSP A;  5PAL A;  1LIN A;  2JT3 A;  3EVR A;  4UPG A;  4JPZ B;  1S6J A;  2ZN8 A;  2AMI A;  5G08 A;  1KFX S;  4INW A;  3TDI A;  3TZ1 A;  1IWQ A;  1QWV A;  3CZT X;  4GPL B;  2M97 A;  3HX4 A;  2KAY A;  2FOT A;  1CDP A;  2MBX A;  2KGB C;  2MA2 A;  2H61 C;  4XJK B;  1BLQ A;  1CB1 A;  1A29 A;  3LL8 B;  1QX2 A;  4M2Q A;  3BXK A;  2ZN9 A;  5I2L A;  3LK1 A;  2WC5 A;  3K1E A;  1SBJ A;  1YRU B;  1M63 B;  1DVI A;  2LMU A;  3S0G A;  1AJ5 A;  2HET A;  1B8L A;  1KFU L;  3EVV A;  1H4B A;  2LC5 A;  4YGB B;  1QIV A;  3AKA A;  3TDZ A;  2WCM A;  2OS8 B;  1BR1 B;  3H4S E;  3NSL A;  3VRQ A;  3BUX B;  1RWY A;  2M8U A;  2QDI A;  2K7O A;  1W7J B;  2KBI A;  4BY5 A;  4R1E A;  1M46 A;  1QAS A;  1B7T Y;  1TNQ A;  2K7B A;  1JFK A;  3DD4 A;  1MHO A;  1ZUZ A;  3KEV A;  4HRG A;  2L4H A;  3EK7 A;  2QEV A;  2ZFD A;  2P6B B;  3TS5 C;  1SYM A;  1WRZ A;  2LVV A;  4OKH A;  3CAB A;  1LVC D;  2KAV A;  3JVT B;  4OZD A;  5CSN A;  1YX8 A;  2YGU A;  1QVI Z;  3O2P A;  4IJ7 A;  5HKY A;  3DZT A;  1GGW A;  1U5I B;  2KHN A;  1CMF A;  1AP4 A;  1SCM B;  4N5X A;  2LP2 A;  1XFZ O;  5AFP A;  3VGO A;  2L51 A;  2PYQ A;  4OV2 A;  5I2O A;  1TUZ A;  1KFU S;  2I7A A;  1EG3 A;  2ZNE A;  3EG5 B;  1DEK A;  1KWO B;  2JC2 A;  3CR2 A;  2LV7 A;  3NSK A;  4N1F A;  1BG1 A;  1NX0 A;  5AEQ A;  4ZCU A;  3WHT B;  4DRW A;  2M1K B;  5FI6 A;  4GFT A;  1YR5 A;  3GK2 A;  1DC1 A;  1K94 A;  1J55 A;  3K21 A;  3R1O A;  2B1U A;  5CSI A;  3S0D A;  1MUX A;  1MWN A;  1AUI B;  2WCJ A;  3C1V A;  1TNP A;  3PAT A;  1PVB A;  5B8I B;  2BEC A;  4A4B A;  3NSI A;  1AK8 A;  1DJY A;  2F3Y A;  1CFC A;  2WC8 A;  2E6W A;  3NHI A;  1E8A A;  4YRU A;  1B8R A;  1FI6 A;  1KK7 Z;  1KSO A;  1PRW A;  1S6C A;  2M29 A;  2NCO A;  3D10 A;  4MEW A;  1XFW O;  1B1G A;  3GK4 X;  5DKQ A;  1MR8 A;  3OX5 A;  4CID A;  5HLV A;  1K9P A;  3FE9 A;  2O60 A;  1TNX A;  1REC A;  4NDC A;  1CDL A;  2M0R A;  1Z4H A;  1CDN A;  1PAL A;  3TUY B;  1BOC A;  1NX3 A;  1F55 A;  2EC6 C;  1B9A A;  5ER5 A;  5TNC A;  1T14 A;  2F2O A;  3TS5 B;  1W7I B;  1RK9 A;  2OPO A;  4DS7 A;  1XO5 A;  2KFF A;  4MRX A;  2H8V A;  4P5O E;  2LLT A;  1FW4 A;  2NXQ A;  1KWO C;  2Y5I A;  1S3P A;  1EXR A;  1Z2C B;  1PVA A;  2M1U A;  2HF5 A;  1CKK A;  3E3R A;  1TIZ A;  2M49 B;  2QEH A;  3FE6 A;  5D69 A;  1J1D A;  2HPS A;  1QS7 A;  1F4Q A;  3I5I C;  3SJS A;  1B4C A;  1JFJ A;  4I5N B;  1BF5 A;  1K90 D;  3TUY C;  3O78 A;  1QLK A;  1YUS A;  2EGD A;  3D74 A;  4MRY A;  1A03 A;  4MVF A;  3LK0 A;  1K9U A;  2OTG B;  2KI6 D;  2JPT A;  5JOL A;  1K9K A;  2PMY A;  1D1O A;  3AAJ A;  1IG5 A;  2F2P A;  2LMV A;  2WCF A;  2WND A;  2WCH A;  3AKB A;  2BL0 B;  4MBE A;  4MZJ A;  4FQT A;  3FIA A;  2JU0 A;  1F71 A;  1YRT B;  4TNC A;  1V1F A;  2JPO A;  1OSA A;  3BUW B;  3ZNI A;  3NGV A;  2Q91 A;  2ZKM X;  4NDD A;  1AVS A;  4BY4 A;  1WDC B;  1Q80 A;  1XK4 A;  2KAX A;  2TN4 A;  4KYN A;  4A4C A;  1NIW A;  1MF8 B;  2PSR A;  1UWO A;  1CM4 A;  2JUL A;  4Q04 A;  1R6P A;  2H2K A;  3SIB A;  1LA3 A;  3NHT A;  1NYA A;  1EL4 A;  2BE6 A;  1SK6 D;  2QEB A;  3V2L A;  1NSH A;  3UNW A;  4F7F A;  1OOI X;  2KPH A;  3BYA A;  5KU1 A;  2V53 A;  2MLE C;  1XYD A;  1EG4 A;  1CFD A;  2CT9 A;  3CZ1 A;  4ORB B;  5HKZ A;  4AOM A;  1CDM A;  1C7V A;  2LLS A;  1SW8 A;  3CDN A;  1OZO A;  2LLU A;  2O5G A;  3CYZ A;  1QX7 A;  3ZWH A;  1XFU O;  1M31 A;  1YUU A;  2G9B A;  3QRX A;  1SRA A;  4AQI A;  1SL7 A;  3BFA A;  5FYX A;  1TN4 A;  2KDH A;  4D1E A;  1K93 D;  2K7D A;  3D0Y B;  1L2O B;  2KLD A;  1P28 A;  3DF0 A;  4XJK A;  1KQV A;  1K2H A;  4QJ3 B;  2MRD A;  3N7H A;  5J3X A;  2Q4U A;  3BQ3 A;  1JSA A;  1UUS A;  2WCB A;  4WQ3 A;  1S1E A;  1V1G A;  2R2I A;  3DYE A;  1JF0 A;  2LVI A;  2PAS A;  3FWB A;  3SG5 A;  2PRU A;  2KFG A;  1GGZ A;  1RTP 1;  2K0J A;  4L9M A;  1QV1 A;  4PHM A;  2OTG C;  1GJY A;  1Y0V H;  4YGD B;  5I94 A;  1TWO A;  3O4X A;  1CM1 A;  1GQM A;  2QEO A;  1NP8 A;  3VB1 A;  5AER A;  3PM8 A;  4OR9 B;  4MLW A;  4PE4 A;  3LLE A;  1A75 A;  1OQP A;  4PHJ A;  1TNW A;  1PUL A;  3VRN A;  1UHI A;  4YI9 A;  1U5I A;  3OHM B;  5IBW A;  2WC6 A;  1WLZ A;  3BOW B;  3D76 A;  3NSO A;  2F33 A;  4NQG A;  3UO9 A;  5JJG A;  1DMO A;  4DUQ A;  4PDZ A;  2KI4 C;  1SPY A;  1LKJ A;  3L4A A;  1YUT A;  2KI4 B;  1QXP A;  1S5G Y;  3L4L A;  4GUK A;  3KF9 A;  1TCF A;  2KBM A;  1RRO A;  2A4J A;  3KPX A;  3SG6 A;  4HRE E;  1BOD A;  1QLS A;  5CPV A;  1IJ6 A;  4I5K A;  5F6T A;  3DF0 B;  4PT1 A;  1OOH A;  2COL B;  2P71 A;  2I18 A;  4CLN A;  1XK4 C;  3EK8 A;  3B87 A;  2BCB A;  1WY9 A;  1S6I A;  3TDU A;  4JKT A;  5D7F A;  1CMG A;  1GM0 A;  2EHB A;  1TOP A;  1DGU A;  1KQM C;  2L98 A;  3SG2 A;  1A4P A;  2ISD A;  1H8B A;  3EKJ A;  4PCW A;  3DXL A;  2MAZ A;  3VRO A;  1KSM A;  1ZFS A;  1OOG A;  2LVJ A;  1NCY A;  2M7L A;  3I5H B;  3DVJ A;  1QV0 A;  1YX7 A;  1DJZ A;  3D77 A;  1LXF C;  3D75 A;  2LUX A;  4N1G A;  1YVH A;  3CZ0 A;  3S0F A;  3SIA A;  1SY9 A;  4YGC B;  5AAN A;  1ZOT B;  2JOJ A;  1F4O A;  2K8M B;  1LS8 A;  2GV5 A;  1IRJ A;  2JXL A;  1PSR A;  1XFR A;  2JNF A;  4OVN F;  1G4Y R;  1OW4 A;  2FCE A;  1WLM A;  2JTZ A;  1ZMZ A;  1DGV A;  3I5H C;  4JWQ A;  1G8I A;  3BFH A;  4ORA B;  1IIO A;  1RFJ A;  2PVB A;  1DF0 A;  2Y4Q A;  1Y1U A;  4MN0 A;  3OB2 B;  3F45 A;  3PJI A;  1SR6 C;  2L2E A;  2KSP A;  4FTG A;  1S5G Z;  2JT8 A;  4YGA A;  4ZCV A;  1QTX A;  2MLF C;  3B86 A;  4NDB A;  3DVE A;  2FJU B;  1M45 A;  1N65 A;  3D78 A;  1KK8 B;  4WRI A;  1CLL A;  3IF7 A;  2CXJ A;  4MZL A;  5HLO A;  5ER4 X;  1YTZ C;  2DOQ A;  3CWG A;  1HT9 A;  3OGN A;  1SCM C;  4MZK A;  2LNK A;  1J7O A;  2CBL A;  1L7Z A;  1SMG A;  1XFX O;  3ICB A;  1NX2 A;  4M2P A;  1J1E A;  2KNE A;  3BJH A;  3O4Y A;  3SS5 A;  4GGN A;  4GGF C;  1DJX A;  1UUR A;  4IL1 A;  3A8R A;  1C7W A;  1F54 A;  2P70 A;  4QJ4 B;  3KHE A;  2JT0 A;  4HSZ A;  4M2O A;  3BUN B;  1F8H A;  1M39 A;  1XA5 A;  2I2R E;  1DEL A;  2BNX A;  2K2F A;  2E30 A;  1Y6W A;  2EC6 B;  2KQ6 A;  1B7T Z;  1WDC C;  3FS7 A;  1SNL A;  2JWW A;  1UHK A;  3I5G B;  4PE1 A;  1OOJ A;  3KO0 A;  3DVM A;  2AUC A;  2GGZ A;  1C07 A;  1NCZ A;  2MJW B;  3IQO A;  4PHN A;  4YI8 A;  3IQQ A;  1QVI Y;  2L2C A;  2BKH B;  2JZI A;  3SG3 A;  3CGA A;  3DY9 A;  1K96 A;  5HYD A;  4ETO A;  4C0L A;  2RGI A;  3CZ2 A;  2LMT A;  4WQ2 A;  1G33 A;  1TCO B;  2M9G A;  3RM1 A;  1BU3 A;  1DJW A;  2KLE A;  2KOT A;  3I5G C;  2L50 A;  1HQV A;  2KYF A;  3FWC A;  2F3Z A;  3D0Y A;  4PE0 A;  5CSF A;  3VRR A;  1IKU A;  3CLN A;  3I5I B;  1UHJ A;  3Q8I A;  4PE7 A;  2F8P A;  4CFQ A;  5AXI A;  2LUC A;  3QME A;  3I5F C;  1IJ5 A;  1R2U A;  1OMR A;  3EVU A;  4INX A;  1X02 A;  3SG7 A;  1CFP A;  1ODB A;  1AHR A;  1DJI A;  4PHK A;  5FI7 A;  1YUR A;  3LCP C;  1EH2 A;  1DJH A;  1AJ4 A;  1CLB A; 
#chains in the Genus database with same CATH homology
 1JBA A;  2SAS A;  3BUO B;  3PFV A;  1F70 A;  3WHU B;  5DKN A;  1B8C A;  2BE4 A;  4XYN A;  3WXA A;  1FPW A;  2BL0 C;  2LE9 B;  2LAN A;  2HQ8 A;  1DT7 B;  1IH0 A;  4P2Y B;  3GK1 A;  4DIR A;  2K7C A;  2NZ0 A;  1ZAC A;  1J7P A;  1DJG A;  3EK4 A;  1KFX L;  1QIW A;  3CS1 A;  2LP3 A;  2Y1M A;  2K61 A;  1MQ1 A;  2LVK A;  2M3W A;  4AQJ A;  2L0P A;  5DKR A;  5KTY A;  1NPQ A;  2CNP A;  1LA0 A;  3JTD B;  3WNX B;  2CCM A;  3JTD C;  1N2D A;  2BBM A;  3CTN A;  2MHH A;  2Y1N A;  2LM5 A;  2KYC A;  5GQQ C;  1PK0 D;  4GGF A;  1JUO A;  2JNX A;  4I5L B;  1NUB A;  2GGM A;  2L5X B;  1OMD A;  2VRG A;  3PSR A;  1NWD A;  1JC2 A;  2D8N A;  2LAP A;  1BR4 B;  2I94 A;  1JWD A;  3I5F B;  5K89 A;  4ICB A;  1XFY O;  1OMV A;  2ZRT A;  4USL A;  1VRK A;  2L4I A;  3NXA A;  1YVL A;  3PAL A;  4DCK A;  5I2Q A;  1SR6 B;  1J7Q A;  4HRH A;  3O6B A;  1A2X A;  1DF0 B;  1TTX A;  2SCP A;  4GAO A;  4GNK B;  1N0Y A;  1S36 A;  3VRP A;  1ALW A;  1FI5 A;  1J7R A;  2H61 A;  3SG4 A;  1BT6 A;  1OE9 B;  2OS8 C;  3JVT C;  1KQM B;  1BJF A;  1QX5 B;  2WCE A;  2IS9 A;  3DVK A;  2LHI A;  3AAK A;  3GOF A;  1CNP A;  2ZRS A;  1TRF A;  1EJ3 A;  4CPV A;  1Y1X A;  2JTT A;  2HQW A;  2KGR A;  2JRF A;  1SCV A;  1Y1A A;  2JXC A;  1NX1 A;  2AAO A;  4GBA A;  2ZND A;  1CFF A;  2K2A A;  2WOS A;  1ALV A;  1FBV A;  4CFR A;  1OZS A;  2M7N A;  5HKW A;  1KK7 Y;  2BBN A;  5CSJ A;  1JF2 A;  3MSE B;  2LCP A;  2WOR A;  2PAL A;  1B47 A;  2G2B A;  1CLM A;  1QJT A;  1IQ3 A;  1PSB A;  1QAT A;  1SKT A;  1IQ5 A;  1SL8 A;  2KFH A;  2JQ6 A;  3CR4 X;  3HCM A;  2QPT A;  3CR5 X;  1UHN A;  1WRL A;  4U8D A;  4QJ5 B;  1FF1 A;  4ORC B;  1WRK A;  5KSZ A;  4C0J A;  3M0W A;  1S26 D;  4C0K A;  3A4U B;  3PLF B;  4I5J A;  4OCI A;  3OX6 A;  3RLZ A;  1MXE A;  1KCY A;  2NLN A;  1SL9 A;  1UHH A;  3PN7 B;  4YBH B;  4E68 A;  1RJV A;  2BCA A;  1DTL A;  1K95 A;  1K8U A;  2BKI B;  2CTN A;  5I8N A;  4YGE B;  2LHL A;  3BOW A;  3OB1 B;  2BCX A;  2QAC A;  2FCD A;  1MXL C;  4PAL A;  2NCP A;  3BUM B;  1XFV O;  3PN7 C;  3EKH A;  4F0Z B;  1IGV A;  1A75 B;  2KI6 C;  2KQY A;  1XVJ A;  1L2O C;  3OP0 A;  1UP5 A;  1BMO A;  1KK8 C;  4JQ0 D;  1CTR A;  1NCX A;  5BPJ A;  4FQO A;  4MSP A;  5PAL A;  1LIN A;  2JT3 A;  3EVR A;  4UPG A;  4JPZ B;  1S6J A;  2ZN8 A;  2AMI A;  5G08 A;  1KFX S;  3TDI A;  3TZ1 A;  1IWQ A;  3CZT X;  4GPL B;  2M97 A;  3HX4 A;  2KAY A;  2FOT A;  1CDP A;  2MBX A;  2KGB C;  2MA2 A;  2H61 C;  4XJK B;  1BLQ A;  1CB1 A;  1A29 A;  3LL8 B;  1QX2 A;  4M2Q A;  3BXK A;  2ZN9 A;  5I2L A;  3LK1 A;  1SBJ A;  1YRU B;  1M63 B;  1DVI A;  2LMU A;  1AJ5 A;  2HET A;  1B8L A;  1KFU L;  3EVV A;  1H4B A;  2LC5 A;  4YGB B;  1QIV A;  3AKA A;  3TDZ A;  2OS8 B;  1BR1 B;  3H4S E;  3NSL A;  3VRQ A;  3BUX B;  1RWY A;  2M8U A;  2K7O A;  1W7J B;  2KBI A;  4BY5 A;  4R1E A;  1M46 A;  1QAS A;  1B7T Y;  1TNQ A;  2K7B A;  1JFK A;  3DD4 A;  1MHO A;  1ZUZ A;  3KEV A;  4HRG A;  2L4H A;  3EK7 A;  2ZFD A;  2P6B B;  3TS5 C;  1SYM A;  1WRZ A;  2LVV A;  4OKH A;  1LVC D;  2KAV A;  3JVT B;  5CSN A;  5HKY A;  1YX8 A;  1QVI Z;  3O2P A;  1GGW A;  1U5I B;  2KHN A;  1CMF A;  1AP4 A;  1SCM B;  4N5X A;  2LP2 A;  1XFZ O;  5AFP A;  3VGO A;  2L51 A;  4OV2 A;  5I2O A;  1KFU S;  2I7A A;  1EG3 A;  2ZNE A;  1KWO B;  2JC2 A;  1BG1 A;  3CR2 A;  2LV7 A;  3NSK A;  4N1F A;  1NX0 A;  5AEQ A;  4ZCU A;  3WHT B;  4DRW A;  2M1K B;  4GFT A;  1YR5 A;  3GK2 A;  1K94 A;  1J55 A;  3K21 A;  5CSI A;  2B1U A;  1MUX A;  1MWN A;  1AUI B;  3C1V A;  1TNP A;  3PAT A;  1PVB A;  5B8I B;  2BEC A;  4A4B A;  3NSI A;  1AK8 A;  1DJY A;  2F3Y A;  1CFC A;  2WC8 A;  2E6W A;  1E8A A;  4YRU A;  1B8R A;  1FI6 A;  1KK7 Z;  1KSO A;  1PRW A;  1S6C A;  2M29 A;  2NCO A;  3D10 A;  4MEW A;  1XFW O;  1B1G A;  3GK4 X;  5DKQ A;  1MR8 A;  3OX5 A;  4CID A;  5HLV A;  1K9P A;  2O60 A;  1TNX A;  1REC A;  4NDC A;  1CDL A;  2M0R A;  1CDN A;  1PAL A;  3TUY B;  1BOC A;  1NX3 A;  1F55 A;  2EC6 C;  1B9A A;  5ER5 A;  5TNC A;  3TS5 B;  2F2O A;  1W7I B;  1RK9 A;  2OPO A;  4DS7 A;  1XO5 A;  2KFF A;  4MRX A;  4P5O E;  2LLT A;  1FW4 A;  2NXQ A;  1KWO C;  2Y5I A;  1S3P A;  1EXR A;  1PVA A;  2M1U A;  2HF5 A;  1CKK A;  3E3R A;  1TIZ A;  2M49 B;  5D69 A;  1J1D A;  2HPS A;  1QS7 A;  1F4Q A;  3I5I C;  3SJS A;  1B4C A;  1JFJ A;  4I5N B;  1BF5 A;  1K90 D;  3TUY C;  3O78 A;  1QLK A;  1YUS A;  2EGD A;  4MRY A;  1A03 A;  4MVF A;  3LK0 A;  1K9U A;  2OTG B;  2KI6 D;  2JPT A;  5JOL A;  1K9K A;  2PMY A;  1D1O A;  3AAJ A;  1IG5 A;  2F2P A;  2LMV A;  2WCF A;  2WND A;  3AKB A;  2BL0 B;  4MBE A;  4MZJ A;  3FIA A;  2JU0 A;  1F71 A;  1YRT B;  4TNC A;  1V1F A;  3BUW B;  1OSA A;  3ZNI A;  2Q91 A;  2ZKM X;  4NDD A;  1AVS A;  4BY4 A;  1WDC B;  1Q80 A;  1XK4 A;  2KAX A;  2TN4 A;  4A4C A;  1NIW A;  1MF8 B;  2PSR A;  1UWO A;  1CM4 A;  2JUL A;  4Q04 A;  1R6P A;  2H2K A;  3SIB A;  1LA3 A;  1NYA A;  1EL4 A;  2BE6 A;  1SK6 D;  1NSH A;  3BYA A;  5KU1 A;  2V53 A;  2MLE C;  1XYD A;  1EG4 A;  1CFD A;  2CT9 A;  4ORB B;  5HKZ A;  4AOM A;  1CDM A;  1C7V A;  2LLS A;  1SW8 A;  1OZO A;  2LLU A;  2O5G A;  1QX7 A;  3ZWH A;  1XFU O;  1M31 A;  1YUU A;  2G9B A;  3QRX A;  1SRA A;  4AQI A;  1SL7 A;  5FYX A;  1TN4 A;  2KDH A;  4D1E A;  1K93 D;  2K7D A;  3D0Y B;  1L2O B;  4XJK A;  1KQV A;  3DF0 A;  1K2H A;  4QJ3 B;  2MRD A;  5J3X A;  2Q4U A;  3BQ3 A;  1JSA A;  1UUS A;  2WCB A;  4WQ3 A;  1S1E A;  1V1G A;  2R2I A;  1JF0 A;  2LVI A;  2PAS A;  3FWB A;  3SG5 A;  2PRU A;  2KFG A;  1GGZ A;  1RTP 1;  2K0J A;  4L9M A;  1QV1 A;  4PHM A;  2OTG C;  1GJY A;  1Y0V H;  4YGD B;  1CM1 A;  1GQM A;  1NP8 A;  5AER A;  3PM8 A;  4OR9 B;  4MLW A;  4PE4 A;  3LLE A;  1A75 A;  1OQP A;  4PHJ A;  1TNW A;  1PUL A;  3VRN A;  1UHI A;  4YI9 A;  1U5I A;  3OHM B;  5IBW A;  1WLZ A;  3BOW B;  3NSO A;  4NQG A;  2F33 A;  5JJG A;  1DMO A;  4DUQ A;  4PDZ A;  2KI4 C;  1SPY A;  1LKJ A;  1YUT A;  2KI4 B;  1QXP A;  1S5G Y;  4GUK A;  3KF9 A;  1TCF A;  2KBM A;  1RRO A;  2A4J A;  3KPX A;  3SG6 A;  4HRE E;  1BOD A;  1QLS A;  5CPV A;  1IJ6 A;  4I5K A;  5F6T A;  3DF0 B;  2COL B;  2I18 A;  4CLN A;  1XK4 C;  3EK8 A;  2BCB A;  1WY9 A;  1S6I A;  3TDU A;  5D7F A;  1CMG A;  2EHB A;  1TOP A;  1DGU A;  1KQM C;  2L98 A;  3SG2 A;  1A4P A;  2ISD A;  1H8B A;  3EKJ A;  4PCW A;  2MAZ A;  3VRO A;  1KSM A;  1ZFS A;  2LVJ A;  1NCY A;  2M7L A;  3I5H B;  3DVJ A;  1QV0 A;  1YX7 A;  1DJZ A;  1LXF C;  2LUX A;  4N1G A;  1YVH A;  3SIA A;  1SY9 A;  4YGC B;  5AAN A;  1ZOT B;  2JOJ A;  1F4O A;  2K8M B;  2GV5 A;  1IRJ A;  2JXL A;  1PSR A;  2JNF A;  4OVN F;  1G4Y R;  2FCE A;  1WLM A;  2JTZ A;  1ZMZ A;  1DGV A;  3I5H C;  4JWQ A;  1G8I A;  4ORA B;  1RFJ A;  2PVB A;  1DF0 A;  2Y4Q A;  1Y1U A;  4MN0 A;  3OB2 B;  3F45 A;  1SR6 C;  2L2E A;  2KSP A;  4FTG A;  1S5G Z;  2JT8 A;  4YGA A;  4ZCV A;  1QTX A;  2MLF C;  4NDB A;  3DVE A;  2FJU B;  1M45 A;  1N65 A;  1KK8 B;  4WRI A;  1CLL A;  3IF7 A;  2CXJ A;  4MZL A;  5HLO A;  5ER4 X;  1YTZ C;  2DOQ A;  3CWG A;  1HT9 A;  1SCM C;  4MZK A;  2LNK A;  1J7O A;  2CBL A;  1L7Z A;  1SMG A;  1XFX O;  3ICB A;  1NX2 A;  4M2P A;  1J1E A;  2KNE A;  3O4Y A;  4GGN A;  4GGF C;  1DJX A;  1UUR A;  4IL1 A;  3A8R A;  1C7W A;  1F54 A;  4QJ4 B;  3KHE A;  2JT0 A;  4HSZ A;  4M2O A;  3BUN B;  1F8H A;  1M39 A;  1XA5 A;  2I2R E;  2K2F A;  2E30 A;  1Y6W A;  2EC6 B;  2KQ6 A;  1B7T Z;  1WDC C;  3FS7 A;  1SNL A;  2JWW A;  1UHK A;  3I5G B;  4PE1 A;  1OOJ A;  3KO0 A;  3DVM A;  2AUC A;  2GGZ A;  1C07 A;  1NCZ A;  2MJW B;  3IQO A;  4PHN A;  4YI8 A;  3IQQ A;  1QVI Y;  2BKH B;  2JZI A;  3SG3 A;  3CGA A;  1K96 A;  5HYD A;  4ETO A;  4C0L A;  2RGI A;  2LMT A;  4WQ2 A;  1G33 A;  1TCO B;  2M9G A;  3RM1 A;  1BU3 A;  1DJW A;  2KOT A;  3I5G C;  2L50 A;  1HQV A;  2KYF A;  3FWC A;  2F3Z A;  3D0Y A;  4PE0 A;  5CSF A;  3VRR A;  1IKU A;  3CLN A;  3I5I B;  1UHJ A;  4PE7 A;  2F8P A;  4CFQ A;  5AXI A;  2LUC A;  3I5F C;  1IJ5 A;  1R2U A;  1OMR A;  3EVU A;  1X02 A;  3SG7 A;  1CFP A;  1ODB A;  1AHR A;  1DJI A;  4PHK A;  1YUR A;  3LCP C;  1EH2 A;  1DJH A;  1AJ4 A;  1CLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...