2M7NA

C-terminal structure of (y81f)-ehcabp1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
GQDLSDDKIGLKVLFKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calcium-binding protein
publication title Functional Manipulation of a Calcium-binding Protein from Entamoeba histolytica Guided by Paramagnetic NMR.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 17
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m7nA00
1PSBA 1TNXA 3JVTB 3FWCA 1SCMB 2TN4A 5KSZA 1SCVA 1A75A 5J3XA 2KQ6A 1NX1A 4PHJA 1W7IB 4R1EA 1NX0A 3NSOA 1QX2A 1CMFA 1IH0A 3SG2A 3TDZA 5I2OA 2WCBA 2JTZA 4PE4A 1KK8B 4C0LA 1AP4A 4GAOA 2I94A 1YVHA 3BUWB 1SMGA 3IQOA 1GJYA 1DF0A 2MHHA 3WHUB 1QLSA 1CM1A 1V1GA 2ZN8A 1SRAA 1RWYA 2QACA 2F2OA 1B8RA 1UHHA 2BE6A 2HF5A 4TNCA 2AMIA 4A4CA 5I8NA 2LLTA 2PMYA 3ICBA 1SCMC 1K96A 2BCBA 3ZWHA 1C7VA 2M29A 1K8UA 1PALA 2LLSA 1MUXA 2OS8B 1SW8A 3C1VA 4MRXA 4ORAB 1XYDA 3MSEB 2KFGA 1J7PA 4M2PA 1JBAA 4GGFC 4JWQA 2L5XB 1B7TY 2LVIA 1PVBA 1DJYA 3TDIA 1AUIB 3GK4X 4CIDA 2KGRA 1KQMC 1JWDA 2Q91A 1SNLA 2P6BB 1C07A 4YGCB 3PLFB 1CMGA 2KI4C 2HQWA 3VRPA 1EG4A 4MZLA 1XFXO 1QTXA 2JXLA 3BYAA 1AJ5A 2PRUA 4FTGA 1NYAA 3WNXB 3GK2A 3PN7C 2AAOA 1KSOA 1E8AA 4NQGA 5HYDA 2F3YA 2COLB 3CR4X 4N1GA 5HKZA 1K2HA 4MRYA 1VRKA 2JNXA 2NZ0A 4MN0A 1CFDA 2CBLA 4I5NB 1RTP1 1XFZO 1NWDA 3CLNA 2ZKMX 1B9AA 1MXLC 1DJGA 2K7OA 4PCWA 4CPVA 1MQ1A 1YVLA 1OZSA 3EK4A 3EVRA 4HREE 1KK7Z 3OB2B 1IQ5A 4XJKB 4P2YB 2EC6C 1AHRA 1IKUA 3DVEA 1UHJA 1DGUA 3DVKA 1SL9A 4M2OA 3RLZA 3WXAA 1WLMA 2L0PA 4NDCA 1SYMA 2KYCA 3I5GB 3FS7A 1CFPA 1XFVO 2Y1MA 2FJUB 2GV5A 1SR6B 1ALWA 1Y0VH 5ER4X 3EVUA 2KBIA 1OZOA 3LK0A 1WRZA 5HKYA 3QRXA 3O78A 2V53A 5DKQA 1G8IA 1SL7A 2JWWA 1LXFC 2CNPA 4ORCB 2MLEC 5G08A 1B4CA 1DJWA 1WDCC 1NCYA 1FPWA 1AJ4A 2LC5A 4DS7A 5I2QA 1QIVA 1KQVA 1F4OA 4QJ3B 3NXAA 1YUUA 3IQQA 4GGNA 4WRIA 4CFRA 1B47A 1EH2A 2KYFA 3ZNIA 1S3PA 1DMOA 2F33A 4PHMA 1IGVA 4HSZA 4NDBA 1TTXA 2K7CA 1UHNA 1YR5A 2ZRTA 1UP5A 3CS1A 1SY9A 4PE0A 1W7JB 5DKNA 3H4SE 2K7DA 4OCIA 2D8NA 3D0YA 2SCPA 1WY9A 1GGZA 1B7TZ 2L4IA 3I5IB 2JT0A 2OTGB 1IWQA 3KEVA 5KU1A 2JOJA 1PRWA 3CWGA 1S5GY 3D10A 1MHOA 2L51A 1YUTA 1CKKA 1J7QA 2ZRSA 2K0JA 1JC2A 1DGVA 1KWOB 3WHTB 1R2UA 1CNPA 1J7OA 1JFJA 2JT8A 4HRGA 1G4YR 4MEWA 1L2OC 4YRUA 2BBMA 4GUKA 4OV2A 4OR9B 4GFTA 4ETOA 4CLNA 1KFXS 1F8HA 1F55A 2FCDA 1UHKA 2KFHA 1OOJA 3JVTC 1FF1A 3DD4A 1MR8A 5AANA 1S36A 3HX4A 2KI6D 1S6IA 1TIZA 1XFWO 1QVIZ 1XFUO 2LUCA 4PHNA 5HLOA 1OSAA 1CDLA 3I5FB 2I2RE 1KK8C 1CFCA 1UUSA 1MXEA 1OQPA 4MZJA 1ZMZA 2F2PA 3PALA 4I5LB 2MRDA 2FCEA 5PALA 1BT6A 2LHLA 1H8BA 1XFYO 2KAYA 4MZKA 3I5HB 3O4YA 1KCYA 3O2PA 2BCXA 3JTDB 2QPTA 2KAXA 2JZIA 3DF0B 2JXCA 1K90D 2KHNA 2Y4QA 4PHKA 3A4UB 1BG1A 2ZNEA 3VGOA 4YGEB 2MJWB 4L9MA 3BXKA 3SG6A 2OS8C 4JPZB 4WQ2A 1HT9A 4XYNA 2M3WA 2M1KB 3M0WA 4M2QA 4DUQA 1S1EA 2LVKA 1Y6WA 1NUBA 1QLKA 4ZCVA 3KPXA 3SIAA 1ZUZA 4USLA 4OKHA 4MLWA 4ORBB 5BPJA 1YURA 3DVMA 1U5IB 4P5OE 1BU3A 4MBEA 1RECA 1KFXL 1TCOB 1PULA 2JC2A 2JRFA 1QV0A 2LE9B 4YGDB 2LMUA 2NLNA 2KI6C 1CFFA 1CDPA 1WRLA 1A29A 2FOTA 4ICBA 3DF0A 1RK9A 1JF0A 2KAVA 2LLUA 1YRTB 4N5XA 3SJSA 4AQJA 1NCXA 4E68A 2EGDA 1A2XA 4FQOA 1J55A 2M7NA 1BJFA 4DCKA 2OPOA 5F6TA 1EG3A 5CSJA 3O6BA 1K9PA 3NSKA 4AQIA 1XK4A 2I18A 2ZFDA 1QJTA 1DT7B 2BECA 2JULA 1GQMA 3TDUA 1EL4A 2H61A 2F3ZA 3AAJA 1MF8B 4GBAA 4IL1A 3TUYB 2M8UA 1F54A 1IRJA 1S5GZ 1BOCA 3LLEA 3OB1B 1S6JA 1DJXA 3OX6A 4XJKA 1ODBA 2PVBA 4YI9A 1CTRA 5DKRA 2M49B 4CFQA 2F8PA 3HCMA 3TS5B 5JJGA 5I2LA 3BUNB 1FI5A 2WORA 3I5GC 1DJHA 5IBWA 2KOTA 1RROA 1CDMA 1SR6C 1KFUS 2BL0B 5CSFA 1EXRA 1LKJA 5ER5A 2JPTA 2Y1NA 4OVNF 2LNKA 4HRHA 1A75B 5KTYA 2LM5A 1ZACA 1TNPA 2RGIA 1KK7Y 1TOPA 2MLFC 1SK6D 2MAZA 2CTNA 1CLBA 1DVIA 1XO5A 1YTZC 2L50A 2M9GA 1SKTA 2CCMA 1DF0B 4D1EA 1UWOA 5CSIA 5CPVA 2JTTA 4MSPA 1CLLA 1BR1B 2LUXA 1AVSA 2KGBC 5JOLA 1BF5A 1A4PA 1FW4A 1M45A 1QX5B 1K9UA 1Y1AA 1OMRA 3SIBA 4C0JA 2M97A 5CSNA 5AFPA 1M31A 1IQ3A 2K8MB 1F71A 1CDNA 2PSRA 2L2EA 2BBNA 3EK8A 3PATA 1MWNA 1J1EA 3CR5X 4ZCUA 1UHIA 1DJZA 1DTLA 2KBMA 1LINA 2KQYA 2LCPA 5K89A 1S6CA 1SL8A 3BQ3A 3DVJA 1JFKA 1SPYA 3RM1A 3I5IC 1F4QA 1Y1XA 2OTGC 2LVVA 2K2AA 5B8IB 4MVFA 2BKIB 2LV7A 2AUCA 3AKBA 1PK0D 1V1FA 4JQ0D 1J1DA 1KQMB 4AOMA 5TNCA 1KFUL 3A8RA 4YGBB 5FYXA 4U8DA 2KI4B 3AAKA 1KWOC 3FWBA 2DOQA 2I7AA 4I5JA 1QIWA 1H4BA 2ZNDA 3PN7B 3EKJA 1NSHA 2MA2A 1ZOTB 1QV1A 1SBJA 1B8CA 2NCPA 2KDHA 3LL8B 3VRNA 1D1OA 1NX2A 2BE4A 1N2DA 4YBHB 1CM4A 2JT3A 3BUOB 4GGFA 1ZFSA 1IG5A 2WNDA 1NX3A 2LANA 3I5FC 2HPSA 2IS9A 1CLMA 1FBVA 2K7BA 1UURA 2LHIA 4N1FA 2ZN9A 4GNKB 1RJVA 1QXPA 3CTNA 2HETA 3NSLA 2MBXA 4BY5A 2EC6B 1A03A 1R6PA 4C0KA 3I5HC 1Q80A 3NSIA 1OMDA 1CB1A 1NIWA 2K61A 1PSRA 1BMOA 3JTDC 4WQ3A 1TN4A 1ALVA 1C7WA 2B1UA 5GQQC 4A4BA 1LA3A 3VRRA 1K95A 3E3RA 1XA5A 1TNQA 1YRUB 3K21A 3KO0A 4F0ZB 2ISDA 1TCFA 2L98A 2LMTA 3PM8A 4YGAA 1G33A 3TZ1A 1KSMA 1NP8A 1B8LA 5AERA 1LA0A 2Y5IA 2WCFA 2H2KA 2WOSA 1L7ZA 1WLZA 1QVIY 5AEQA 2PASA 4PDZA 1XK4C 4Q04A 3SG7A 3CR2A 3BOWB 4NDDA 1M46A 1WDCB 3SG4A 1HQVA 2H61C 3AKAA 3SG3A 1B1GA 2G2BA 1N65A 2M7LA 1IJ5A 1GGWA 2CT9A 1S26D 2LP3A 2VRGA 3LCPC 1JF2A 4PE1A 1U5IA 2WCEA 3EVVA 2LVJA 1BLQA 1JSAA 4PE7A 1OMVA 1JUOA 2L4HA 4DRWA 1QASA 4YI8A 1F70A 2SASA 1BODA 1XVJA 2R2IA 2NXQA 1M63B 2KNEA 2JNFA 2GGMA 5D7FA 2Q4UA 3IF7A 3PFVA 1J7RA 2BCAA 3OP0A 4QJ5B 3GK1A 1QATA 1M39A 1YUSA 3KF9A 3OX5A 4PALA 1K94A 2K2FA 1FI6A 1TRFA 1EJ3A 3D0YB 5HLVA 1X02A 3EKHA 3FIAA 3BOWA 2BKHB 1BR4B 2M0RA 3VRQA 3PSRA 5HKWA 1TNWA 2E30A 1YX7A 3TUYC 1DJIA 2JQ6A 3GOFA 3KHEA 1K9KA 2KFFA 4I5KA 2GGZA 2LP2A 1WRKA 1OE9B 2EHBA 3TS5C 1QS7A 4UPGA 2A4JA 2O60A 5D69A 2LMVA 1PVAA 1NCZA 2CXJA 2HQ8A 2PALA 3EK7A 3OHMB 1AK8A 1N0YA 1NPQA 3CZTX 1K93D 4GPLB 2E6WA 2NCOA 3F45A 3SG5A 2O5GA 3CGAA 1LVCD 2WC8A 4QJ4B 1QX7A 2M1UA 1L2OB 2BL0C 3LK1A 4DIRA 1Y1UA 1IJ6A 2KSPA 3BUXB 5AXIA 4BY4A 2LAPA 1RFJA 3VROA 3BUMB 2JU0A 2G9BA 1YX8A
chains in the Genus database with same CATH superfamily
1PSBA 1TNXA 3JVTB 3FWCA 1SCMB 1Z2CB 2TN4A 1SCVA 1A75A 4JD9A 5J3XA 5KSZA 2KQ6A 1NX1A 4PHJA 1W7IB 2ERBA 4R1EA 1NX0A 3NSOA 1QX2A 1CMFA 1IH0A 3SG2A 1LS8A 3TDZA 2WCMA 2P70A 2WCBA 2JTZA 4PE4A 1KK8B 4C0LA 5I2OA 4GAOA 2I94A 1AP4A 1YVHA 1DC1A 3BUWB 1SMGA 3IQOA 1GJYA 1DF0A 2MHHA 3BFHA 3WHUB 1QLSA 1CM1A 4KYNA 1V1GA 2ZN8A 1SRAA 3B86A 1RWYA 2QACA 2F2OA 1B8RA 1UHHA 2BE6A 2HF5A 4TNCA 2AMIA 4A4CA 3OBVA 2LLTA 2PMYA 5I8NA 3ICBA 1SCMC 1K96A 2BCBA 3ZWHA 1C7VA 2M29A 1K8UA 1PALA 2LLSA 1MUXA 2OS8B 4F7FA 1SW8A 3C1VA 4MRXA 4ORAB 1XYDA 3MSEB 1DEKA 2KFGA 1J7PA 4M2PA 1JBAA 4GGFC 4JWQA 2L5XB 1B7TY 2LVIA 1PVBA 1DJYA 3TDIA 1AUIB 3GK4X 4CIDA 2KGRA 1KQMC 1JWDA 2Q91A 1SNLA 2P6BB 4INXA 1C07A 4YGCB 3PLFB 1CMGA 2KI4C 2HQWA 4FQTA 1EG4A 3R1OA 4MZLA 3VRPA 1XFXO 1QTXA 2JXLA 3BYAA 1AJ5A 2PRUA 4FTGA 1NYAA 3WNXB 1DELA 3GK2A 2AAOA 3PN7C 1KSOA 1E8AA 4NQGA 2QEBA 5HYDA 2F3YA 2COLB 3CR4X 4N1GA 5HKZA 3B6XA 1K2HA 4MRYA 2H8VA 1VRKA 2JNXA 2NZ0A 4MN0A 1CFDA 3RZSA 2CBLA 4I5NB 1RTP1 1XFZO 1NWDA 3CLNA 2ZKMX 1B9AA 1MXLC 1DJGA 3D73A 2K7OA 4PCWA 4CPVA 1MQ1A 1YVLA 1OZSA 3EK4A 3EVRA 4HREE 1KK7Z 3OB2B 1IQ5A 4INWA 3SS5A 3CZ0A 4XJKB 3S0FA 4P2YB 2EC6C 1AHRA 1IKUA 3DVEA 1UHJA 1DGUA 5FI7A 3DVKA 1SL9A 4M2OA 3RLZA 3WXAA 1WLMA 3D75A 3B87A 2WCHA 2L0PA 3S0AA 4NDCA 1SYMA 2KYCA 3I5GB 3FS7A 1CFPA 1XFVO 2Y1MA 2FJUB 2GV5A 1SR6B 1ALWA 1Y0VH 5ER4X 1Z4HA 3EVUA 2KBIA 1OZOA 3LK0A 3SS3A 1WRZA 5HKYA 3QRXA 3O78A 3UNWA 3CYZA 2V53A 5DKQA 3L4LA 1G8IA 1SL7A 2JWWA 1LXFC 2CNPA 4ORCB 2MLEC 5G08A 1B4CA 1DJWA 4JKTA 1WDCC 1NCYA 1FPWA 1AJ4A 2LC5A 4DS7A 5I2QA 1QIVA 1KQVA 1F4OA 4QJ3B 3NXAA 3DXLA 1YUUA 3IQQA 4GGNA 4WRIA 4CFRA 1B47A 1EH2A 2KYFA 3ZNIA 1S3PA 1DMOA 3DY9A 2F33A 4PHMA 1IGVA 4HSZA 4NDBA 1TTXA 2K7CA 3B7AA 1UHNA 1YR5A 2ZRTA 1UP5A 3CS1A 1SY9A 4PE0A 3O4XA 1W7JB 5DKNA 3H4SE 2K7DA 4OCIA 2D8NA 3D0YA 2SCPA 1WY9A 1GGZA 1B7TZ 2L4IA 3I5IB 2JT0A 2OTGB 3CABA 1IWQA 3KEVA 5KU1A 3FE9A 2JOJA 1PRWA 3CWGA 1S5GY 3D10A 1MHOA 2L51A 1YUTA 1CKKA 1J7QA 2ZRSA 2K0JA 1JC2A 1DGVA 1KWOB 3WHTB 3SS4A 1R2UA 4PT1A 1CNPA 1J7OA 1JFJA 2JT8A 4HRGA 1G4YR 4MEWA 1L2OC 4YRUA 2BBMA 4GUKA 4OV2A 4OR9B 4GFTA 4ETOA 4CLNA 1KFXS 1F8HA 1F55A 2FCDA 1UHKA 2KFHA 1OOFA 1OOJA 2KPHA 3JVTC 3CZ2A 1FF1A 3DD4A 1MR8A 5AANA 1S36A 3HX4A 2KI6D 1S6IA 1TIZA 1XFWO 1QVIZ 1XFUO 3FE6A 2LUCA 4PHNA 5HLOA 2WCKA 1QWVA 1OSAA 1CDLA 3I5FB 2I2RE 1KK8C 2WC6A 3D76A 1CFCA 1UUSA 1MXEA 1OQPA 4MZJA 1ZMZA 2F2PA 3PALA 4I5LB 2MRDA 2FCEA 5PALA 1BT6A 2LHLA 1H8BA 1XFYO 2KAYA 2KLEA 3I5HB 3L47A 3O4YA 4MZKA 2BAPA 3OGNA 3O2PA 1XFRA 1KCYA 3S0GA 2BCXA 3JTDB 2QPTA 3L4AA 2KAXA 2JZIA 3DF0B 2JXCA 1K90D 2KHNA 2Y4QA 3FE8A 4PHKA 1W9ZA 3A4UB 3S0DA 1BG1A 2ZNEA 3VGOA 4YGEB 2MJWB 4L9MA 3BXKA 3SG6A 2OS8C 4JPZB 4WQ2A 1HT9A 4XYNA 2P71A 2M3WA 2M1KB 3M0WA 4M2QA 4DUQA 1S1EA 2LVKA 1Y6WA 1NUBA 1QLKA 4ZCVA 3KPXA 3SIAA 1ZUZA 4USLA 4OKHA 4MLWA 4ORBB 5BPJA 1YURA 3DVMA 1U5IB 4P5OE 1BU3A 3R72A 4MBEA 2FJYA 1RECA 1KFXL 1TCOB 1PULA 2JC2A 2JRFA 1QV0A 2LE9B 4YGDB 2LMUA 2NLNA 2KLDA 2KI6C 1CFFA 1GM0A 2WC5A 1CDPA 1WRLA 1A29A 2FOTA 4ICBA 3DF0A 1RK9A 1JF0A 2KAVA 2LLUA 1YRTB 4N5XA 5FI2A 3SJSA 4AQJA 4QJ4B 2L5YA 1NCXA 4E68A 2EGDA 1A2XA 4FQOA 1J55A 2M7NA 1BJFA 4DCKA 2OPOA 5F6TA 1EG3A 5CSJA 3O6BA 1K9PA 3NSKA 4AQIA 1XK4A 2I18A 2ZFDA 1QJTA 1DT7B 2BECA 2JULA 1IIOA 1GQMA 3TDUA 1EL4A 2H61A 2F3ZA 3AAJA 1MF8B 3D74A 4GBAA 4IL1A 1OOIX 2PQLA 2QDIA 3TUYB 2M8UA 1F54A 3EG5B 1IRJA 1S5GZ 1BOCA 3LLEA 3OB1B 1S6JA 1DJXA 3OX6A 4XJKA 5HL1A 1ODBA 2PVBA 4YI9A 1CTRA 5DKRA 2M49B 2L2CA 4CFQA 2F8PA 3HCMA 1DQEA 3TS5B 5I2LA 5JJGA 3BUNB 1FI5A 2WORA 3I5GC 1DJHA 5IBWA 3BJHA 2KOTA 1RROA 1CDMA 1SR6C 1KFUS 3R1PA 2BL0B 5CSFA 3Q8IA 1EXRA 1LKJA 5ER5A 2JPTA 2Y1NA 3V2LA 4OVNF 2LNKA 4HRHA 1A75B 5KTYA 2LM5A 1ZACA 1TNPA 2RGIA 1KK7Y 1TOPA 2MLFC 5D3OA 1SK6D 2MAZA 2CTNA 1CLBA 1DVIA 1XO5A 1YTZC 2L50A 2M9GA 1SKTA 3B88A 2CCMA 1DF0B 3D78A 4D1EA 1UWOA 2WCLA 5CSIA 5CPVA 3S0BA 2JTTA 1OW4A 4MSPA 1CLLA 1BR1B 2LUXA 1AVSA 2KGBC 5JOLA 1BF5A 1A4PA 1FW4A 1M45A 1QX5B 1K9UA 1Y1AA 1OMRA 5EL2A 3SIBA 4C0JA 2M97A 5CSNA 5AFPA 1M31A 1IQ3A 2K8MB 1F71A 1CDNA 2PSRA 2L2EA 2BBNA 3EK8A 3S0EA 3PATA 1MWNA 1J1EA 3CR5X 4ZCUA 1UHIA 1DJZA 1DTLA 2KBMA 1LINA 2KQYA 3CZ1A 2WCJA 2LCPA 5K89A 1S6CA 1SL8A 3IVTA 1T14A 3BQ3A 1JFKA 1SPYA 3DVJA 3I5IC 3RM1A 1C3ZA 1F4QA 1Y1XA 2BNXA 1TUZA 2OTGC 2LVVA 2K2AA 5B8IB 4MVFA 2BKIB 2LV7A 2AUCA 3AKBA 1PK0D 1TUJA 1V1FA 4JQ0D 1J1DA 2QEHA 1KQMB 2GTEA 4AOMA 5TNCA 1KFUL 3A8RA 1TWOA 4YGBB 5FYXA 4U8DA 2KI4B 3AAKA 1KWOC 3NGVA 3FWBA 3NHIA 2DOQA 2I7AA 4I5JA 1OOHA 1QIWA 1H4BA 4OZDA 2ZNDA 3PN7B 3EKJA 1NSHA 2MA2A 1ZOTB 3DZTA 1QV1A 1SBJA 5I94A 3BFBA 1B8CA 2NCPA 2KDHA 3NHTA 3LL8B 3VRNA 1D1OA 1NX2A 2YGUA 3VB1A 2BE4A 1N2DA 4YBHB 1CM4A 2JT3A 3BUOB 4GGFA 1ZFSA 1IG5A 2WNDA 1NX3A 2LANA 3I5FC 2HPSA 2IS9A 1CLMA 1FBVA 2K7BA 1UURA 2LHIA 4N1FA 2ZN9A 4GNKB 1RJVA 1QXPA 3CTNA 2HETA 3NSLA 2MBXA 4BY5A 2EC6B 1A03A 1R6PA 4C0KA 3I5HC 1Q80A 3NSIA 1OMDA 1CB1A 1NIWA 2K61A 1PSRA 1BMOA 3JTDC 4WQ3A 1TN4A 1ALVA 1C7WA 2B1UA 3R1VA 5GQQC 1LA3A 4A4BA 3VRRA 1K95A 3E3RA 1XA5A 1TNQA 1YRUB 3K21A 3KO0A 4F0ZB 2ISDA 1TCFA 3DYEA 2L98A 2LMTA 3PM8A 4YGAA 1G33A 3TZ1A 1KSMA 1NP8A 1B8LA 5AERA 1LA0A 2Y5IA 2WCFA 2H2KA 2WOSA 2K60A 1L7ZA 1WLZA 1QVIY 5AEQA 3PM2A 2PASA 4PDZA 1XK4C 1SSEB 3D77A 4Q04A 3SG7A 3CR2A 3BOWB 4NDDA 1M46A 1WDCB 3SG4A 1C3YA 1HQVA 2H61C 3AKAA 3SG3A 1B1GA 2G2BA 1OOGA 1N65A 2M7LA 3PJIA 1IJ5A 1GGWA 2CT9A 1S26D 2LP3A 2VRGA 3LCPC 1JF2A 2PYQA 4PE1A 1U5IA 2WCEA 3EVVA 2LVJA 1BLQA 1JSAA 4PE7A 1OMVA 2QEVA 1JUOA 2L4HA 4DRWA 1QASA 4YI8A 1F70A 2SASA 1BODA 1XVJA 2R2IA 2NXQA 1M63B 2KNEA 2JNFA 2GGMA 5D7FA 2Q4UA 5DICA 3QMEA 3IF7A 3PFVA 1J7RA 2BCAA 3BFAA 3OP0A 4QJ5B 3GK1A 1QATA 1M39A 1YUSA 3KF9A 3OX5A 4PALA 1K94A 3UO9A 2K2FA 1FI6A 1TRFA 1EJ3A 3D0YB 5HLVA 1X02A 3EKHA 3FIAA 3BOWA 2BKHB 1BR4B 1P28A 2M0RA 3VRQA 3PSRA 5HKWA 1TNWA 2E30A 1YX7A 3TUYC 1DJIA 3CDNA 2JQ6A 3GOFA 2QEOA 1K9KA 2KFFA 3KHEA 4I5KA 2GGZA 2LP2A 3N7HA 1WRKA 1OE9B 2EHBA 3TS5C 1QS7A 4UPGA 2A4JA 2O60A 5D69A 2LMVA 1PVAA 1NCZA 2CXJA 2HQ8A 2PALA 3EK7A 3K1EA 3OHMB 1N0YA 1AK8A 1NPQA 3CZTX 1K93D 4GPLB 4IJ7A 2E6WA 2JPOA 2NCOA 3F45A 5FI6A 2O5GA 3CGAA 1LVCD 2WC8A 3SG5A 1QX7A 2M1UA 1L2OB 2BL0C 3LK1A 4DIRA 1Y1UA 1IJ6A 2KSPA 1ORGA 3BUXB 5AXIA 4BY4A 2LAPA 1RFJA 3VROA 3BUMB 2JU0A 2G9BA 1YX8A
chains in the Genus database with same CATH topology
1PSBA 1TNXA 3JVTB 3FWCA 1SCMB 2TN4A 5KSZA 1SCVA 1A75A 5J3XA 2KQ6A 1NX1A 4PHJA 1W7IB 4R1EA 1NX0A 3NSOA 1QX2A 1CMFA 1IH0A 3SG2A 3TDZA 5I2OA 2WCBA 2JTZA 4PE4A 1KK8B 4C0LA 1AP4A 4GAOA 2I94A 1YVHA 3BUWB 1SMGA 3IQOA 1GJYA 1DF0A 2MHHA 3WHUB 1QLSA 1CM1A 1V1GA 2ZN8A 1SRAA 1RWYA 2QACA 2F2OA 1B8RA 1UHHA 2BE6A 2HF5A 4TNCA 2AMIA 4A4CA 5I8NA 2LLTA 2PMYA 3ICBA 1SCMC 1K96A 2BCBA 3ZWHA 1C7VA 2M29A 1K8UA 1PALA 2LLSA 1MUXA 2OS8B 1SW8A 3C1VA 4MRXA 4ORAB 1XYDA 3MSEB 2KFGA 1J7PA 4M2PA 1JBAA 4GGFC 4JWQA 2L5XB 1B7TY 2LVIA 1PVBA 1DJYA 3TDIA 1AUIB 3GK4X 4CIDA 2KGRA 1KQMC 1JWDA 2Q91A 1SNLA 2P6BB 1C07A 4YGCB 3PLFB 1CMGA 2KI4C 2HQWA 3VRPA 1EG4A 4MZLA 1XFXO 1QTXA 2JXLA 3BYAA 1AJ5A 2PRUA 4FTGA 1NYAA 3WNXB 3GK2A 3PN7C 2AAOA 1KSOA 1E8AA 4NQGA 5HYDA 2F3YA 2COLB 3CR4X 4N1GA 5HKZA 1K2HA 4MRYA 1VRKA 2JNXA 2NZ0A 4MN0A 1CFDA 2CBLA 4I5NB 1RTP1 1XFZO 1NWDA 3CLNA 2ZKMX 1B9AA 1MXLC 1DJGA 2K7OA 4PCWA 4CPVA 1MQ1A 1YVLA 1OZSA 3EK4A 3EVRA 4HREE 1KK7Z 3OB2B 1IQ5A 4XJKB 4P2YB 2EC6C 1AHRA 1IKUA 3DVEA 1UHJA 1DGUA 3DVKA 1SL9A 4M2OA 3RLZA 3WXAA 1WLMA 2L0PA 4NDCA 1SYMA 2KYCA 3I5GB 3FS7A 1CFPA 1XFVO 2Y1MA 2FJUB 2GV5A 1SR6B 1ALWA 1Y0VH 5ER4X 3EVUA 2KBIA 1OZOA 3LK0A 1WRZA 5HKYA 3QRXA 3O78A 2V53A 5DKQA 1G8IA 1SL7A 2JWWA 1LXFC 2CNPA 4ORCB 2MLEC 5G08A 1B4CA 1DJWA 1WDCC 1NCYA 1FPWA 1AJ4A 2LC5A 4DS7A 5I2QA 1QIVA 1KQVA 1F4OA 4QJ3B 3NXAA 1YUUA 3IQQA 4GGNA 4WRIA 4CFRA 1B47A 1EH2A 2KYFA 3ZNIA 1S3PA 1DMOA 2F33A 4PHMA 1IGVA 4HSZA 4NDBA 1TTXA 2K7CA 1UHNA 1YR5A 2ZRTA 1UP5A 3CS1A 1SY9A 4PE0A 1W7JB 5DKNA 3H4SE 2K7DA 4OCIA 2D8NA 3D0YA 2SCPA 1WY9A 1GGZA 1B7TZ 2L4IA 3I5IB 2JT0A 2OTGB 1IWQA 3KEVA 5KU1A 2JOJA 1PRWA 3CWGA 1S5GY 3D10A 1MHOA 2L51A 1YUTA 1CKKA 1J7QA 2ZRSA 2K0JA 1JC2A 1DGVA 1KWOB 3WHTB 1R2UA 1CNPA 1J7OA 1JFJA 2JT8A 4HRGA 1G4YR 4MEWA 1L2OC 4YRUA 2BBMA 4GUKA 4OV2A 4OR9B 4GFTA 4ETOA 4CLNA 1KFXS 1F8HA 1F55A 2FCDA 1UHKA 2KFHA 1OOJA 3JVTC 1FF1A 3DD4A 1MR8A 5AANA 1S36A 3HX4A 2KI6D 1S6IA 1TIZA 1XFWO 1QVIZ 1XFUO 2LUCA 4PHNA 5HLOA 1OSAA 1CDLA 3I5FB 2I2RE 1KK8C 1CFCA 1UUSA 1MXEA 1OQPA 4MZJA 1ZMZA 2F2PA 3PALA 4I5LB 2MRDA 2FCEA 5PALA 1BT6A 2LHLA 1H8BA 1XFYO 2KAYA 4MZKA 3I5HB 3O4YA 1KCYA 3O2PA 2BCXA 3JTDB 2QPTA 2KAXA 2JZIA 3DF0B 2JXCA 1K90D 2KHNA 2Y4QA 4PHKA 3A4UB 1BG1A 2ZNEA 3VGOA 4YGEB 2MJWB 4L9MA 3BXKA 3SG6A 2OS8C 4JPZB 4WQ2A 1HT9A 4XYNA 2M3WA 2M1KB 3M0WA 4M2QA 4DUQA 1S1EA 2LVKA 1Y6WA 1NUBA 1QLKA 4ZCVA 3KPXA 3SIAA 1ZUZA 4USLA 4OKHA 4MLWA 4ORBB 5BPJA 1YURA 3DVMA 1U5IB 4P5OE 1BU3A 4MBEA 1RECA 1KFXL 1TCOB 1PULA 2JC2A 2JRFA 1QV0A 2LE9B 4YGDB 2LMUA 2NLNA 2KI6C 1CFFA 1CDPA 1WRLA 1A29A 2FOTA 4ICBA 3DF0A 1RK9A 1JF0A 2KAVA 2LLUA 1YRTB 4N5XA 3SJSA 4AQJA 1NCXA 4E68A 2EGDA 1A2XA 4FQOA 1J55A 2M7NA 1BJFA 4DCKA 2OPOA 5F6TA 1EG3A 5CSJA 3O6BA 1K9PA 3NSKA 4AQIA 1XK4A 2I18A 2ZFDA 1QJTA 1DT7B 2BECA 2JULA 1GQMA 3TDUA 1EL4A 2H61A 2F3ZA 3AAJA 1MF8B 4GBAA 4IL1A 3TUYB 2M8UA 1F54A 1IRJA 1S5GZ 1BOCA 3LLEA 3OB1B 1S6JA 1DJXA 3OX6A 4XJKA 1ODBA 2PVBA 4YI9A 1CTRA 5DKRA 2M49B 4CFQA 2F8PA 3HCMA 3TS5B 5JJGA 5I2LA 3BUNB 1FI5A 2WORA 3I5GC 1DJHA 5IBWA 2KOTA 1RROA 1CDMA 1SR6C 1KFUS 2BL0B 5CSFA 1EXRA 1LKJA 5ER5A 2JPTA 2Y1NA 4OVNF 2LNKA 4HRHA 1A75B 5KTYA 2LM5A 1ZACA 1TNPA 2RGIA 1KK7Y 1TOPA 2MLFC 1SK6D 2MAZA 2CTNA 1CLBA 1DVIA 1XO5A 1YTZC 2L50A 2M9GA 1SKTA 2CCMA 1DF0B 4D1EA 1UWOA 5CSIA 5CPVA 2JTTA 4MSPA 1CLLA 1BR1B 2LUXA 1AVSA 2KGBC 5JOLA 1BF5A 1A4PA 1FW4A 1M45A 1QX5B 1K9UA 1Y1AA 1OMRA 3SIBA 4C0JA 2M97A 5CSNA 5AFPA 1M31A 1IQ3A 2K8MB 1F71A 1CDNA 2PSRA 2L2EA 2BBNA 3EK8A 3PATA 1MWNA 1J1EA 3CR5X 4ZCUA 1UHIA 1DJZA 1DTLA 2KBMA 1LINA 2KQYA 2LCPA 5K89A 1S6CA 1SL8A 3BQ3A 3DVJA 1JFKA 1SPYA 3RM1A 3I5IC 1F4QA 1Y1XA 2OTGC 2LVVA 2K2AA 5B8IB 4MVFA 2BKIB 2LV7A 2AUCA 3AKBA 1PK0D 1V1FA 4JQ0D 1J1DA 1KQMB 4AOMA 5TNCA 1KFUL 3A8RA 4YGBB 5FYXA 4U8DA 2KI4B 3AAKA 1KWOC 3FWBA 2DOQA 2I7AA 4I5JA 1QIWA 1H4BA 2ZNDA 3PN7B 3EKJA 1NSHA 2MA2A 1ZOTB 1QV1A 1SBJA 1B8CA 2NCPA 2KDHA 3LL8B 3VRNA 1D1OA 1NX2A 2BE4A 1N2DA 4YBHB 1CM4A 2JT3A 3BUOB 4GGFA 1ZFSA 1IG5A 2WNDA 1NX3A 2LANA 3I5FC 2HPSA 2IS9A 1CLMA 1FBVA 2K7BA 1UURA 2LHIA 4N1FA 2ZN9A 4GNKB 1RJVA 1QXPA 3CTNA 2HETA 3NSLA 2MBXA 4BY5A 2EC6B 1A03A 1R6PA 4C0KA 3I5HC 1Q80A 3NSIA 1OMDA 1CB1A 1NIWA 2K61A 1PSRA 1BMOA 3JTDC 4WQ3A 1TN4A 1ALVA 1C7WA 2B1UA 5GQQC 4A4BA 1LA3A 3VRRA 1K95A 3E3RA 1XA5A 1TNQA 1YRUB 3K21A 3KO0A 4F0ZB 2ISDA 1TCFA 2L98A 2LMTA 3PM8A 4YGAA 1G33A 3TZ1A 1KSMA 1NP8A 1B8LA 5AERA 1LA0A 2Y5IA 2WCFA 2H2KA 2WOSA 1L7ZA 1WLZA 1QVIY 5AEQA 2PASA 4PDZA 1XK4C 4Q04A 3SG7A 3CR2A 3BOWB 4NDDA 1M46A 1WDCB 3SG4A 1HQVA 2H61C 3AKAA 3SG3A 1B1GA 2G2BA 1N65A 2M7LA 1IJ5A 1GGWA 2CT9A 1S26D 2LP3A 2VRGA 3LCPC 1JF2A 4PE1A 1U5IA 2WCEA 3EVVA 2LVJA 1BLQA 1JSAA 4PE7A 1OMVA 1JUOA 2L4HA 4DRWA 1QASA 4YI8A 1F70A 2SASA 1BODA 1XVJA 2R2IA 2NXQA 1M63B 2KNEA 2JNFA 2GGMA 5D7FA 2Q4UA 3IF7A 3PFVA 1J7RA 2BCAA 3OP0A 4QJ5B 3GK1A 1QATA 1M39A 1YUSA 3KF9A 3OX5A 4PALA 1K94A 2K2FA 1FI6A 1TRFA 1EJ3A 3D0YB 5HLVA 1X02A 3EKHA 3FIAA 3BOWA 2BKHB 1BR4B 2M0RA 3VRQA 3PSRA 5HKWA 1TNWA 2E30A 1YX7A 3TUYC 1DJIA 2JQ6A 3GOFA 3KHEA 1K9KA 2KFFA 4I5KA 2GGZA 2LP2A 1WRKA 1OE9B 2EHBA 3TS5C 1QS7A 4UPGA 2A4JA 2O60A 5D69A 2LMVA 1PVAA 1NCZA 2CXJA 2HQ8A 2PALA 3EK7A 3OHMB 1AK8A 1N0YA 1NPQA 3CZTX 1K93D 4GPLB 2E6WA 2NCOA 3F45A 3SG5A 2O5GA 3CGAA 1LVCD 2WC8A 4QJ4B 1QX7A 2M1UA 1L2OB 2BL0C 3LK1A 4DIRA 1Y1UA 1IJ6A 2KSPA 3BUXB 5AXIA 4BY4A 2LAPA 1RFJA 3VROA 3BUMB 2JU0A 2G9BA 1YX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PSB A;  1TNX A;  3JVT B;  3FWC A;  1SCM B;  2TN4 A;  5KSZ A;  1SCV A;  1A75 A;  5J3X A;  2KQ6 A;  1NX1 A;  4PHJ A;  1W7I B;  4R1E A;  1NX0 A;  3NSO A;  1QX2 A;  1CMF A;  1IH0 A;  3SG2 A;  3TDZ A;  5I2O A;  2WCB A;  2JTZ A;  4PE4 A;  1KK8 B;  4C0L A;  1AP4 A;  4GAO A;  2I94 A;  1YVH A;  3BUW B;  1SMG A;  3IQO A;  1GJY A;  1DF0 A;  2MHH A;  3WHU B;  1QLS A;  1CM1 A;  1V1G A;  2ZN8 A;  1SRA A;  1RWY A;  2QAC A;  2F2O A;  1B8R A;  1UHH A;  2BE6 A;  2HF5 A;  4TNC A;  2AMI A;  4A4C A;  5I8N A;  2LLT A;  2PMY A;  3ICB A;  1SCM C;  1K96 A;  2BCB A;  3ZWH A;  1C7V A;  2M29 A;  1K8U A;  1PAL A;  2LLS A;  1MUX A;  2OS8 B;  1SW8 A;  3C1V A;  4MRX A;  4ORA B;  1XYD A;  3MSE B;  2KFG A;  1J7P A;  4M2P A;  1JBA A;  4GGF C;  4JWQ A;  2L5X B;  1B7T Y;  2LVI A;  1PVB A;  1DJY A;  3TDI A;  1AUI B;  3GK4 X;  4CID A;  2KGR A;  1KQM C;  1JWD A;  2Q91 A;  1SNL A;  2P6B B;  1C07 A;  4YGC B;  3PLF B;  1CMG A;  2KI4 C;  2HQW A;  3VRP A;  1EG4 A;  4MZL A;  1XFX O;  1QTX A;  2JXL A;  3BYA A;  1AJ5 A;  2PRU A;  4FTG A;  1NYA A;  3WNX B;  3GK2 A;  3PN7 C;  2AAO A;  1KSO A;  1E8A A;  4NQG A;  5HYD A;  2F3Y A;  2COL B;  3CR4 X;  4N1G A;  5HKZ A;  1K2H A;  4MRY A;  1VRK A;  2JNX A;  2NZ0 A;  4MN0 A;  1CFD A;  2CBL A;  4I5N B;  1RTP 1;  1XFZ O;  1NWD A;  3CLN A;  2ZKM X;  1B9A A;  1MXL C;  1DJG A;  2K7O A;  4PCW A;  4CPV A;  1MQ1 A;  1YVL A;  1OZS A;  3EK4 A;  3EVR A;  4HRE E;  1KK7 Z;  3OB2 B;  1IQ5 A;  4XJK B;  4P2Y B;  2EC6 C;  1AHR A;  1IKU A;  3DVE A;  1UHJ A;  1DGU A;  3DVK A;  1SL9 A;  4M2O A;  3RLZ A;  3WXA A;  1WLM A;  2L0P A;  4NDC A;  1SYM A;  2KYC A;  3I5G B;  3FS7 A;  1CFP A;  1XFV O;  2Y1M A;  2FJU B;  2GV5 A;  1SR6 B;  1ALW A;  1Y0V H;  5ER4 X;  3EVU A;  2KBI A;  1OZO A;  3LK0 A;  1WRZ A;  5HKY A;  3QRX A;  3O78 A;  2V53 A;  5DKQ A;  1G8I A;  1SL7 A;  2JWW A;  1LXF C;  2CNP A;  4ORC B;  2MLE C;  5G08 A;  1B4C A;  1DJW A;  1WDC C;  1NCY A;  1FPW A;  1AJ4 A;  2LC5 A;  4DS7 A;  5I2Q A;  1QIV A;  1KQV A;  1F4O A;  4QJ3 B;  3NXA A;  1YUU A;  3IQQ A;  4GGN A;  4WRI A;  4CFR A;  1B47 A;  1EH2 A;  2KYF A;  3ZNI A;  1S3P A;  1DMO A;  2F33 A;  4PHM A;  1IGV A;  4HSZ A;  4NDB A;  1TTX A;  2K7C A;  1UHN A;  1YR5 A;  2ZRT A;  1UP5 A;  3CS1 A;  1SY9 A;  4PE0 A;  1W7J B;  5DKN A;  3H4S E;  2K7D A;  4OCI A;  2D8N A;  3D0Y A;  2SCP A;  1WY9 A;  1GGZ A;  1B7T Z;  2L4I A;  3I5I B;  2JT0 A;  2OTG B;  1IWQ A;  3KEV A;  5KU1 A;  2JOJ A;  1PRW A;  3CWG A;  1S5G Y;  3D10 A;  1MHO A;  2L51 A;  1YUT A;  1CKK A;  1J7Q A;  2ZRS A;  2K0J A;  1JC2 A;  1DGV A;  1KWO B;  3WHT B;  1R2U A;  1CNP A;  1J7O A;  1JFJ A;  2JT8 A;  4HRG A;  1G4Y R;  4MEW A;  1L2O C;  4YRU A;  2BBM A;  4GUK A;  4OV2 A;  4OR9 B;  4GFT A;  4ETO A;  4CLN A;  1KFX S;  1F8H A;  1F55 A;  2FCD A;  1UHK A;  2KFH A;  1OOJ A;  3JVT C;  1FF1 A;  3DD4 A;  1MR8 A;  5AAN A;  1S36 A;  3HX4 A;  2KI6 D;  1S6I A;  1TIZ A;  1XFW O;  1QVI Z;  1XFU O;  2LUC A;  4PHN A;  5HLO A;  1OSA A;  1CDL A;  3I5F B;  2I2R E;  1KK8 C;  1CFC A;  1UUS A;  1MXE A;  1OQP A;  4MZJ A;  1ZMZ A;  2F2P A;  3PAL A;  4I5L B;  2MRD A;  2FCE A;  5PAL A;  1BT6 A;  2LHL A;  1H8B A;  1XFY O;  2KAY A;  4MZK A;  3I5H B;  3O4Y A;  1KCY A;  3O2P A;  2BCX A;  3JTD B;  2QPT A;  2KAX A;  2JZI A;  3DF0 B;  2JXC A;  1K90 D;  2KHN A;  2Y4Q A;  4PHK A;  3A4U B;  1BG1 A;  2ZNE A;  3VGO A;  4YGE B;  2MJW B;  4L9M A;  3BXK A;  3SG6 A;  2OS8 C;  4JPZ B;  4WQ2 A;  1HT9 A;  4XYN A;  2M3W A;  2M1K B;  3M0W A;  4M2Q A;  4DUQ A;  1S1E A;  2LVK A;  1Y6W A;  1NUB A;  1QLK A;  4ZCV A;  3KPX A;  3SIA A;  1ZUZ A;  4USL A;  4OKH A;  4MLW A;  4ORB B;  5BPJ A;  1YUR A;  3DVM A;  1U5I B;  4P5O E;  1BU3 A;  4MBE A;  1REC A;  1KFX L;  1TCO B;  1PUL A;  2JC2 A;  2JRF A;  1QV0 A;  2LE9 B;  4YGD B;  2LMU A;  2NLN A;  2KI6 C;  1CFF A;  1CDP A;  1WRL A;  1A29 A;  2FOT A;  4ICB A;  3DF0 A;  1RK9 A;  1JF0 A;  2KAV A;  2LLU A;  1YRT B;  4N5X A;  3SJS A;  4AQJ A;  1NCX A;  4E68 A;  2EGD A;  1A2X A;  4FQO A;  1J55 A;  2M7N A;  1BJF A;  4DCK A;  2OPO A;  5F6T A;  1EG3 A;  5CSJ A;  3O6B A;  1K9P A;  3NSK A;  4AQI A;  1XK4 A;  2I18 A;  2ZFD A;  1QJT A;  1DT7 B;  2BEC A;  2JUL A;  1GQM A;  3TDU A;  1EL4 A;  2H61 A;  2F3Z A;  3AAJ A;  1MF8 B;  4GBA A;  4IL1 A;  3TUY B;  2M8U A;  1F54 A;  1IRJ A;  1S5G Z;  1BOC A;  3LLE A;  3OB1 B;  1S6J A;  1DJX A;  3OX6 A;  4XJK A;  1ODB A;  2PVB A;  4YI9 A;  1CTR A;  5DKR A;  2M49 B;  4CFQ A;  2F8P A;  3HCM A;  3TS5 B;  5JJG A;  5I2L A;  3BUN B;  1FI5 A;  2WOR A;  3I5G C;  1DJH A;  5IBW A;  2KOT A;  1RRO A;  1CDM A;  1SR6 C;  1KFU S;  2BL0 B;  5CSF A;  1EXR A;  1LKJ A;  5ER5 A;  2JPT A;  2Y1N A;  4OVN F;  2LNK A;  4HRH A;  1A75 B;  5KTY A;  2LM5 A;  1ZAC A;  1TNP A;  2RGI A;  1KK7 Y;  1TOP A;  2MLF C;  1SK6 D;  2MAZ A;  2CTN A;  1CLB A;  1DVI A;  1XO5 A;  1YTZ C;  2L50 A;  2M9G A;  1SKT A;  2CCM A;  1DF0 B;  4D1E A;  1UWO A;  5CSI A;  5CPV A;  2JTT A;  4MSP A;  1CLL A;  1BR1 B;  2LUX A;  1AVS A;  2KGB C;  5JOL A;  1BF5 A;  1A4P A;  1FW4 A;  1M45 A;  1QX5 B;  1K9U A;  1Y1A A;  1OMR A;  3SIB A;  4C0J A;  2M97 A;  5CSN A;  5AFP A;  1M31 A;  1IQ3 A;  2K8M B;  1F71 A;  1CDN A;  2PSR A;  2L2E A;  2BBN A;  3EK8 A;  3PAT A;  1MWN A;  1J1E A;  3CR5 X;  4ZCU A;  1UHI A;  1DJZ A;  1DTL A;  2KBM A;  1LIN A;  2KQY A;  2LCP A;  5K89 A;  1S6C A;  1SL8 A;  3BQ3 A;  3DVJ A;  1JFK A;  1SPY A;  3RM1 A;  3I5I C;  1F4Q A;  1Y1X A;  2OTG C;  2LVV A;  2K2A A;  5B8I B;  4MVF A;  2BKI B;  2LV7 A;  2AUC A;  3AKB A;  1PK0 D;  1V1F A;  4JQ0 D;  1J1D A;  1KQM B;  4AOM A;  5TNC A;  1KFU L;  3A8R A;  4YGB B;  5FYX A;  4U8D A;  2KI4 B;  3AAK A;  1KWO C;  3FWB A;  2DOQ A;  2I7A A;  4I5J A;  1QIW A;  1H4B A;  2ZND A;  3PN7 B;  3EKJ A;  1NSH A;  2MA2 A;  1ZOT B;  1QV1 A;  1SBJ A;  1B8C A;  2NCP A;  2KDH A;  3LL8 B;  3VRN A;  1D1O A;  1NX2 A;  2BE4 A;  1N2D A;  4YBH B;  1CM4 A;  2JT3 A;  3BUO B;  4GGF A;  1ZFS A;  1IG5 A;  2WND A;  1NX3 A;  2LAN A;  3I5F C;  2HPS A;  2IS9 A;  1CLM A;  1FBV A;  2K7B A;  1UUR A;  2LHI A;  4N1F A;  2ZN9 A;  4GNK B;  1RJV A;  1QXP A;  3CTN A;  2HET A;  3NSL A;  2MBX A;  4BY5 A;  2EC6 B;  1A03 A;  1R6P A;  4C0K A;  3I5H C;  1Q80 A;  3NSI A;  1OMD A;  1CB1 A;  1NIW A;  2K61 A;  1PSR A;  1BMO A;  3JTD C;  4WQ3 A;  1TN4 A;  1ALV A;  1C7W A;  2B1U A;  5GQQ C;  4A4B A;  1LA3 A;  3VRR A;  1K95 A;  3E3R A;  1XA5 A;  1TNQ A;  1YRU B;  3K21 A;  3KO0 A;  4F0Z B;  2ISD A;  1TCF A;  2L98 A;  2LMT A;  3PM8 A;  4YGA A;  1G33 A;  3TZ1 A;  1KSM A;  1NP8 A;  1B8L A;  5AER A;  1LA0 A;  2Y5I A;  2WCF A;  2H2K A;  2WOS A;  1L7Z A;  1WLZ A;  1QVI Y;  5AEQ A;  2PAS A;  4PDZ A;  1XK4 C;  4Q04 A;  3SG7 A;  3CR2 A;  3BOW B;  4NDD A;  1M46 A;  1WDC B;  3SG4 A;  1HQV A;  2H61 C;  3AKA A;  3SG3 A;  1B1G A;  2G2B A;  1N65 A;  2M7L A;  1IJ5 A;  1GGW A;  2CT9 A;  1S26 D;  2LP3 A;  2VRG A;  3LCP C;  1JF2 A;  4PE1 A;  1U5I A;  2WCE A;  3EVV A;  2LVJ A;  1BLQ A;  1JSA A;  4PE7 A;  1OMV A;  1JUO A;  2L4H A;  4DRW A;  1QAS A;  4YI8 A;  1F70 A;  2SAS A;  1BOD A;  1XVJ A;  2R2I A;  2NXQ A;  1M63 B;  2KNE A;  2JNF A;  2GGM A;  5D7F A;  2Q4U A;  3IF7 A;  3PFV A;  1J7R A;  2BCA A;  3OP0 A;  4QJ5 B;  3GK1 A;  1QAT A;  1M39 A;  1YUS A;  3KF9 A;  3OX5 A;  4PAL A;  1K94 A;  2K2F A;  1FI6 A;  1TRF A;  1EJ3 A;  3D0Y B;  5HLV A;  1X02 A;  3EKH A;  3FIA A;  3BOW A;  2BKH B;  1BR4 B;  2M0R A;  3VRQ A;  3PSR A;  5HKW A;  1TNW A;  2E30 A;  1YX7 A;  3TUY C;  1DJI A;  2JQ6 A;  3GOF A;  3KHE A;  1K9K A;  2KFF A;  4I5K A;  2GGZ A;  2LP2 A;  1WRK A;  1OE9 B;  2EHB A;  3TS5 C;  1QS7 A;  4UPG A;  2A4J A;  2O60 A;  5D69 A;  2LMV A;  1PVA A;  1NCZ A;  2CXJ A;  2HQ8 A;  2PAL A;  3EK7 A;  3OHM B;  1AK8 A;  1N0Y A;  1NPQ A;  3CZT X;  1K93 D;  4GPL B;  2E6W A;  2NCO A;  3F45 A;  3SG5 A;  2O5G A;  3CGA A;  1LVC D;  2WC8 A;  4QJ4 B;  1QX7 A;  2M1U A;  1L2O B;  2BL0 C;  3LK1 A;  4DIR A;  1Y1U A;  1IJ6 A;  2KSP A;  3BUX B;  5AXI A;  4BY4 A;  2LAP A;  1RFJ A;  3VRO A;  3BUM B;  2JU0 A;  2G9B A;  1YX8 A; 
#chains in the Genus database with same CATH topology
 1PSB A;  1TNX A;  3JVT B;  3FWC A;  1SCM B;  1Z2C B;  2TN4 A;  1SCV A;  1A75 A;  4JD9 A;  5J3X A;  5KSZ A;  2KQ6 A;  1NX1 A;  4PHJ A;  1W7I B;  2ERB A;  4R1E A;  1NX0 A;  3NSO A;  1QX2 A;  1CMF A;  1IH0 A;  3SG2 A;  1LS8 A;  3TDZ A;  2WCM A;  2P70 A;  2WCB A;  2JTZ A;  4PE4 A;  1KK8 B;  4C0L A;  5I2O A;  4GAO A;  2I94 A;  1AP4 A;  1YVH A;  1DC1 A;  3BUW B;  1SMG A;  3IQO A;  1GJY A;  1DF0 A;  2MHH A;  3BFH A;  3WHU B;  1QLS A;  1CM1 A;  4KYN A;  1V1G A;  2ZN8 A;  1SRA A;  3B86 A;  1RWY A;  2QAC A;  2F2O A;  1B8R A;  1UHH A;  2BE6 A;  2HF5 A;  4TNC A;  2AMI A;  4A4C A;  3OBV A;  2LLT A;  2PMY A;  5I8N A;  3ICB A;  1SCM C;  1K96 A;  2BCB A;  3ZWH A;  1C7V A;  2M29 A;  1K8U A;  1PAL A;  2LLS A;  1MUX A;  2OS8 B;  4F7F A;  1SW8 A;  3C1V A;  4MRX A;  4ORA B;  1XYD A;  3MSE B;  1DEK A;  2KFG A;  1J7P A;  4M2P A;  1JBA A;  4GGF C;  4JWQ A;  2L5X B;  1B7T Y;  2LVI A;  1PVB A;  1DJY A;  3TDI A;  1AUI B;  3GK4 X;  4CID A;  2KGR A;  1KQM C;  1JWD A;  2Q91 A;  1SNL A;  2P6B B;  4INX A;  1C07 A;  4YGC B;  3PLF B;  1CMG A;  2KI4 C;  2HQW A;  4FQT A;  1EG4 A;  3R1O A;  4MZL A;  3VRP A;  1XFX O;  1QTX A;  2JXL A;  3BYA A;  1AJ5 A;  2PRU A;  4FTG A;  1NYA A;  3WNX B;  1DEL A;  3GK2 A;  2AAO A;  3PN7 C;  1KSO A;  1E8A A;  4NQG A;  2QEB A;  5HYD A;  2F3Y A;  2COL B;  3CR4 X;  4N1G A;  5HKZ A;  3B6X A;  1K2H A;  4MRY A;  2H8V A;  1VRK A;  2JNX A;  2NZ0 A;  4MN0 A;  1CFD A;  3RZS A;  2CBL A;  4I5N B;  1RTP 1;  1XFZ O;  1NWD A;  3CLN A;  2ZKM X;  1B9A A;  1MXL C;  1DJG A;  3D73 A;  2K7O A;  4PCW A;  4CPV A;  1MQ1 A;  1YVL A;  1OZS A;  3EK4 A;  3EVR A;  4HRE E;  1KK7 Z;  3OB2 B;  1IQ5 A;  4INW A;  3SS5 A;  3CZ0 A;  4XJK B;  3S0F A;  4P2Y B;  2EC6 C;  1AHR A;  1IKU A;  3DVE A;  1UHJ A;  1DGU A;  5FI7 A;  3DVK A;  1SL9 A;  4M2O A;  3RLZ A;  3WXA A;  1WLM A;  3D75 A;  3B87 A;  2WCH A;  2L0P A;  3S0A A;  4NDC A;  1SYM A;  2KYC A;  3I5G B;  3FS7 A;  1CFP A;  1XFV O;  2Y1M A;  2FJU B;  2GV5 A;  1SR6 B;  1ALW A;  1Y0V H;  5ER4 X;  1Z4H A;  3EVU A;  2KBI A;  1OZO A;  3LK0 A;  3SS3 A;  1WRZ A;  5HKY A;  3QRX A;  3O78 A;  3UNW A;  3CYZ A;  2V53 A;  5DKQ A;  3L4L A;  1G8I A;  1SL7 A;  2JWW A;  1LXF C;  2CNP A;  4ORC B;  2MLE C;  5G08 A;  1B4C A;  1DJW A;  4JKT A;  1WDC C;  1NCY A;  1FPW A;  1AJ4 A;  2LC5 A;  4DS7 A;  5I2Q A;  1QIV A;  1KQV A;  1F4O A;  4QJ3 B;  3NXA A;  3DXL A;  1YUU A;  3IQQ A;  4GGN A;  4WRI A;  4CFR A;  1B47 A;  1EH2 A;  2KYF A;  3ZNI A;  1S3P A;  1DMO A;  3DY9 A;  2F33 A;  4PHM A;  1IGV A;  4HSZ A;  4NDB A;  1TTX A;  2K7C A;  3B7A A;  1UHN A;  1YR5 A;  2ZRT A;  1UP5 A;  3CS1 A;  1SY9 A;  4PE0 A;  3O4X A;  1W7J B;  5DKN A;  3H4S E;  2K7D A;  4OCI A;  2D8N A;  3D0Y A;  2SCP A;  1WY9 A;  1GGZ A;  1B7T Z;  2L4I A;  3I5I B;  2JT0 A;  2OTG B;  3CAB A;  1IWQ A;  3KEV A;  5KU1 A;  3FE9 A;  2JOJ A;  1PRW A;  3CWG A;  1S5G Y;  3D10 A;  1MHO A;  2L51 A;  1YUT A;  1CKK A;  1J7Q A;  2ZRS A;  2K0J A;  1JC2 A;  1DGV A;  1KWO B;  3WHT B;  3SS4 A;  1R2U A;  4PT1 A;  1CNP A;  1J7O A;  1JFJ A;  2JT8 A;  4HRG A;  1G4Y R;  4MEW A;  1L2O C;  4YRU A;  2BBM A;  4GUK A;  4OV2 A;  4OR9 B;  4GFT A;  4ETO A;  4CLN A;  1KFX S;  1F8H A;  1F55 A;  2FCD A;  1UHK A;  2KFH A;  1OOF A;  1OOJ A;  2KPH A;  3JVT C;  3CZ2 A;  1FF1 A;  3DD4 A;  1MR8 A;  5AAN A;  1S36 A;  3HX4 A;  2KI6 D;  1S6I A;  1TIZ A;  1XFW O;  1QVI Z;  1XFU O;  3FE6 A;  2LUC A;  4PHN A;  5HLO A;  2WCK A;  1QWV A;  1OSA A;  1CDL A;  3I5F B;  2I2R E;  1KK8 C;  2WC6 A;  3D76 A;  1CFC A;  1UUS A;  1MXE A;  1OQP A;  4MZJ A;  1ZMZ A;  2F2P A;  3PAL A;  4I5L B;  2MRD A;  2FCE A;  5PAL A;  1BT6 A;  2LHL A;  1H8B A;  1XFY O;  2KAY A;  2KLE A;  3I5H B;  3L47 A;  3O4Y A;  4MZK A;  2BAP A;  3OGN A;  3O2P A;  1XFR A;  1KCY A;  3S0G A;  2BCX A;  3JTD B;  2QPT A;  3L4A A;  2KAX A;  2JZI A;  3DF0 B;  2JXC A;  1K90 D;  2KHN A;  2Y4Q A;  3FE8 A;  4PHK A;  1W9Z A;  3A4U B;  3S0D A;  1BG1 A;  2ZNE A;  3VGO A;  4YGE B;  2MJW B;  4L9M A;  3BXK A;  3SG6 A;  2OS8 C;  4JPZ B;  4WQ2 A;  1HT9 A;  4XYN A;  2P71 A;  2M3W A;  2M1K B;  3M0W A;  4M2Q A;  4DUQ A;  1S1E A;  2LVK A;  1Y6W A;  1NUB A;  1QLK A;  4ZCV A;  3KPX A;  3SIA A;  1ZUZ A;  4USL A;  4OKH A;  4MLW A;  4ORB B;  5BPJ A;  1YUR A;  3DVM A;  1U5I B;  4P5O E;  1BU3 A;  3R72 A;  4MBE A;  2FJY A;  1REC A;  1KFX L;  1TCO B;  1PUL A;  2JC2 A;  2JRF A;  1QV0 A;  2LE9 B;  4YGD B;  2LMU A;  2NLN A;  2KLD A;  2KI6 C;  1CFF A;  1GM0 A;  2WC5 A;  1CDP A;  1WRL A;  1A29 A;  2FOT A;  4ICB A;  3DF0 A;  1RK9 A;  1JF0 A;  2KAV A;  2LLU A;  1YRT B;  4N5X A;  5FI2 A;  3SJS A;  4AQJ A;  4QJ4 B;  2L5Y A;  1NCX A;  4E68 A;  2EGD A;  1A2X A;  4FQO A;  1J55 A;  2M7N A;  1BJF A;  4DCK A;  2OPO A;  5F6T A;  1EG3 A;  5CSJ A;  3O6B A;  1K9P A;  3NSK A;  4AQI A;  1XK4 A;  2I18 A;  2ZFD A;  1QJT A;  1DT7 B;  2BEC A;  2JUL A;  1IIO A;  1GQM A;  3TDU A;  1EL4 A;  2H61 A;  2F3Z A;  3AAJ A;  1MF8 B;  3D74 A;  4GBA A;  4IL1 A;  1OOI X;  2PQL A;  2QDI A;  3TUY B;  2M8U A;  1F54 A;  3EG5 B;  1IRJ A;  1S5G Z;  1BOC A;  3LLE A;  3OB1 B;  1S6J A;  1DJX A;  3OX6 A;  4XJK A;  5HL1 A;  1ODB A;  2PVB A;  4YI9 A;  1CTR A;  5DKR A;  2M49 B;  2L2C A;  4CFQ A;  2F8P A;  3HCM A;  1DQE A;  3TS5 B;  5I2L A;  5JJG A;  3BUN B;  1FI5 A;  2WOR A;  3I5G C;  1DJH A;  5IBW A;  3BJH A;  2KOT A;  1RRO A;  1CDM A;  1SR6 C;  1KFU S;  3R1P A;  2BL0 B;  5CSF A;  3Q8I A;  1EXR A;  1LKJ A;  5ER5 A;  2JPT A;  2Y1N A;  3V2L A;  4OVN F;  2LNK A;  4HRH A;  1A75 B;  5KTY A;  2LM5 A;  1ZAC A;  1TNP A;  2RGI A;  1KK7 Y;  1TOP A;  2MLF C;  5D3O A;  1SK6 D;  2MAZ A;  2CTN A;  1CLB A;  1DVI A;  1XO5 A;  1YTZ C;  2L50 A;  2M9G A;  1SKT A;  3B88 A;  2CCM A;  1DF0 B;  3D78 A;  4D1E A;  1UWO A;  2WCL A;  5CSI A;  5CPV A;  3S0B A;  2JTT A;  1OW4 A;  4MSP A;  1CLL A;  1BR1 B;  2LUX A;  1AVS A;  2KGB C;  5JOL A;  1BF5 A;  1A4P A;  1FW4 A;  1M45 A;  1QX5 B;  1K9U A;  1Y1A A;  1OMR A;  5EL2 A;  3SIB A;  4C0J A;  2M97 A;  5CSN A;  5AFP A;  1M31 A;  1IQ3 A;  2K8M B;  1F71 A;  1CDN A;  2PSR A;  2L2E A;  2BBN A;  3EK8 A;  3S0E A;  3PAT A;  1MWN A;  1J1E A;  3CR5 X;  4ZCU A;  1UHI A;  1DJZ A;  1DTL A;  2KBM A;  1LIN A;  2KQY A;  3CZ1 A;  2WCJ A;  2LCP A;  5K89 A;  1S6C A;  1SL8 A;  3IVT A;  1T14 A;  3BQ3 A;  1JFK A;  1SPY A;  3DVJ A;  3I5I C;  3RM1 A;  1C3Z A;  1F4Q A;  1Y1X A;  2BNX A;  1TUZ A;  2OTG C;  2LVV A;  2K2A A;  5B8I B;  4MVF A;  2BKI B;  2LV7 A;  2AUC A;  3AKB A;  1PK0 D;  1TUJ A;  1V1F A;  4JQ0 D;  1J1D A;  2QEH A;  1KQM B;  2GTE A;  4AOM A;  5TNC A;  1KFU L;  3A8R A;  1TWO A;  4YGB B;  5FYX A;  4U8D A;  2KI4 B;  3AAK A;  1KWO C;  3NGV A;  3FWB A;  3NHI A;  2DOQ A;  2I7A A;  4I5J A;  1OOH A;  1QIW A;  1H4B A;  4OZD A;  2ZND A;  3PN7 B;  3EKJ A;  1NSH A;  2MA2 A;  1ZOT B;  3DZT A;  1QV1 A;  1SBJ A;  5I94 A;  3BFB A;  1B8C A;  2NCP A;  2KDH A;  3NHT A;  3LL8 B;  3VRN A;  1D1O A;  1NX2 A;  2YGU A;  3VB1 A;  2BE4 A;  1N2D A;  4YBH B;  1CM4 A;  2JT3 A;  3BUO B;  4GGF A;  1ZFS A;  1IG5 A;  2WND A;  1NX3 A;  2LAN A;  3I5F C;  2HPS A;  2IS9 A;  1CLM A;  1FBV A;  2K7B A;  1UUR A;  2LHI A;  4N1F A;  2ZN9 A;  4GNK B;  1RJV A;  1QXP A;  3CTN A;  2HET A;  3NSL A;  2MBX A;  4BY5 A;  2EC6 B;  1A03 A;  1R6P A;  4C0K A;  3I5H C;  1Q80 A;  3NSI A;  1OMD A;  1CB1 A;  1NIW A;  2K61 A;  1PSR A;  1BMO A;  3JTD C;  4WQ3 A;  1TN4 A;  1ALV A;  1C7W A;  2B1U A;  3R1V A;  5GQQ C;  1LA3 A;  4A4B A;  3VRR A;  1K95 A;  3E3R A;  1XA5 A;  1TNQ A;  1YRU B;  3K21 A;  3KO0 A;  4F0Z B;  2ISD A;  1TCF A;  3DYE A;  2L98 A;  2LMT A;  3PM8 A;  4YGA A;  1G33 A;  3TZ1 A;  1KSM A;  1NP8 A;  1B8L A;  5AER A;  1LA0 A;  2Y5I A;  2WCF A;  2H2K A;  2WOS A;  2K60 A;  1L7Z A;  1WLZ A;  1QVI Y;  5AEQ A;  3PM2 A;  2PAS A;  4PDZ A;  1XK4 C;  1SSE B;  3D77 A;  4Q04 A;  3SG7 A;  3CR2 A;  3BOW B;  4NDD A;  1M46 A;  1WDC B;  3SG4 A;  1C3Y A;  1HQV A;  2H61 C;  3AKA A;  3SG3 A;  1B1G A;  2G2B A;  1OOG A;  1N65 A;  2M7L A;  3PJI A;  1IJ5 A;  1GGW A;  2CT9 A;  1S26 D;  2LP3 A;  2VRG A;  3LCP C;  1JF2 A;  2PYQ A;  4PE1 A;  1U5I A;  2WCE A;  3EVV A;  2LVJ A;  1BLQ A;  1JSA A;  4PE7 A;  1OMV A;  2QEV A;  1JUO A;  2L4H A;  4DRW A;  1QAS A;  4YI8 A;  1F70 A;  2SAS A;  1BOD A;  1XVJ A;  2R2I A;  2NXQ A;  1M63 B;  2KNE A;  2JNF A;  2GGM A;  5D7F A;  2Q4U A;  5DIC A;  3QME A;  3IF7 A;  3PFV A;  1J7R A;  2BCA A;  3BFA A;  3OP0 A;  4QJ5 B;  3GK1 A;  1QAT A;  1M39 A;  1YUS A;  3KF9 A;  3OX5 A;  4PAL A;  1K94 A;  3UO9 A;  2K2F A;  1FI6 A;  1TRF A;  1EJ3 A;  3D0Y B;  5HLV A;  1X02 A;  3EKH A;  3FIA A;  3BOW A;  2BKH B;  1BR4 B;  1P28 A;  2M0R A;  3VRQ A;  3PSR A;  5HKW A;  1TNW A;  2E30 A;  1YX7 A;  3TUY C;  1DJI A;  3CDN A;  2JQ6 A;  3GOF A;  2QEO A;  1K9K A;  2KFF A;  3KHE A;  4I5K A;  2GGZ A;  2LP2 A;  3N7H A;  1WRK A;  1OE9 B;  2EHB A;  3TS5 C;  1QS7 A;  4UPG A;  2A4J A;  2O60 A;  5D69 A;  2LMV A;  1PVA A;  1NCZ A;  2CXJ A;  2HQ8 A;  2PAL A;  3EK7 A;  3K1E A;  3OHM B;  1N0Y A;  1AK8 A;  1NPQ A;  3CZT X;  1K93 D;  4GPL B;  4IJ7 A;  2E6W A;  2JPO A;  2NCO A;  3F45 A;  5FI6 A;  2O5G A;  3CGA A;  1LVC D;  2WC8 A;  3SG5 A;  1QX7 A;  2M1U A;  1L2O B;  2BL0 C;  3LK1 A;  4DIR A;  1Y1U A;  1IJ6 A;  2KSP A;  1ORG A;  3BUX B;  5AXI A;  4BY4 A;  2LAP A;  1RFJ A;  3VRO A;  3BUM B;  2JU0 A;  2G9B A;  1YX8 A; 
#chains in the Genus database with same CATH homology
 1PSB A;  1TNX A;  3JVT B;  3FWC A;  1SCM B;  2TN4 A;  5KSZ A;  1SCV A;  1A75 A;  5J3X A;  2KQ6 A;  1NX1 A;  4PHJ A;  1W7I B;  4R1E A;  1NX0 A;  3NSO A;  1QX2 A;  1CMF A;  1IH0 A;  3SG2 A;  3TDZ A;  5I2O A;  2WCB A;  2JTZ A;  4PE4 A;  1KK8 B;  4C0L A;  1AP4 A;  4GAO A;  2I94 A;  1YVH A;  3BUW B;  1SMG A;  3IQO A;  1GJY A;  1DF0 A;  2MHH A;  3WHU B;  1QLS A;  1CM1 A;  1V1G A;  2ZN8 A;  1SRA A;  1RWY A;  2QAC A;  2F2O A;  1B8R A;  1UHH A;  2BE6 A;  2HF5 A;  4TNC A;  2AMI A;  4A4C A;  5I8N A;  2LLT A;  2PMY A;  3ICB A;  1SCM C;  1K96 A;  2BCB A;  3ZWH A;  1C7V A;  2M29 A;  1K8U A;  1PAL A;  2LLS A;  1MUX A;  2OS8 B;  1SW8 A;  3C1V A;  4MRX A;  4ORA B;  1XYD A;  3MSE B;  2KFG A;  1J7P A;  4M2P A;  1JBA A;  4GGF C;  4JWQ A;  2L5X B;  1B7T Y;  2LVI A;  1PVB A;  1DJY A;  3TDI A;  1AUI B;  3GK4 X;  4CID A;  2KGR A;  1KQM C;  1JWD A;  2Q91 A;  1SNL A;  2P6B B;  1C07 A;  4YGC B;  3PLF B;  1CMG A;  2KI4 C;  2HQW A;  3VRP A;  1EG4 A;  4MZL A;  1XFX O;  1QTX A;  2JXL A;  3BYA A;  1AJ5 A;  2PRU A;  4FTG A;  1NYA A;  3WNX B;  3GK2 A;  3PN7 C;  2AAO A;  1KSO A;  1E8A A;  4NQG A;  5HYD A;  2F3Y A;  2COL B;  3CR4 X;  4N1G A;  5HKZ A;  1K2H A;  4MRY A;  1VRK A;  2JNX A;  2NZ0 A;  4MN0 A;  1CFD A;  2CBL A;  4I5N B;  1RTP 1;  1XFZ O;  1NWD A;  3CLN A;  2ZKM X;  1B9A A;  1MXL C;  1DJG A;  2K7O A;  4PCW A;  4CPV A;  1MQ1 A;  1YVL A;  1OZS A;  3EK4 A;  3EVR A;  4HRE E;  1KK7 Z;  3OB2 B;  1IQ5 A;  4XJK B;  4P2Y B;  2EC6 C;  1AHR A;  1IKU A;  3DVE A;  1UHJ A;  1DGU A;  3DVK A;  1SL9 A;  4M2O A;  3RLZ A;  3WXA A;  1WLM A;  2L0P A;  4NDC A;  1SYM A;  2KYC A;  3I5G B;  3FS7 A;  1CFP A;  1XFV O;  2Y1M A;  2FJU B;  2GV5 A;  1SR6 B;  1ALW A;  1Y0V H;  5ER4 X;  3EVU A;  2KBI A;  1OZO A;  3LK0 A;  1WRZ A;  5HKY A;  3QRX A;  3O78 A;  2V53 A;  5DKQ A;  1G8I A;  1SL7 A;  2JWW A;  1LXF C;  2CNP A;  4ORC B;  2MLE C;  5G08 A;  1B4C A;  1DJW A;  1WDC C;  1NCY A;  1FPW A;  1AJ4 A;  2LC5 A;  4DS7 A;  5I2Q A;  1QIV A;  1KQV A;  1F4O A;  4QJ3 B;  3NXA A;  1YUU A;  3IQQ A;  4GGN A;  4WRI A;  4CFR A;  1B47 A;  1EH2 A;  2KYF A;  3ZNI A;  1S3P A;  1DMO A;  2F33 A;  4PHM A;  1IGV A;  4HSZ A;  4NDB A;  1TTX A;  2K7C A;  1UHN A;  1YR5 A;  2ZRT A;  1UP5 A;  3CS1 A;  1SY9 A;  4PE0 A;  1W7J B;  5DKN A;  3H4S E;  2K7D A;  4OCI A;  2D8N A;  3D0Y A;  2SCP A;  1WY9 A;  1GGZ A;  1B7T Z;  2L4I A;  3I5I B;  2JT0 A;  2OTG B;  1IWQ A;  3KEV A;  5KU1 A;  2JOJ A;  1PRW A;  3CWG A;  1S5G Y;  3D10 A;  1MHO A;  2L51 A;  1YUT A;  1CKK A;  1J7Q A;  2ZRS A;  2K0J A;  1JC2 A;  1DGV A;  1KWO B;  3WHT B;  1R2U A;  1CNP A;  1J7O A;  1JFJ A;  2JT8 A;  4HRG A;  1G4Y R;  4MEW A;  1L2O C;  4YRU A;  2BBM A;  4GUK A;  4OV2 A;  4OR9 B;  4GFT A;  4ETO A;  4CLN A;  1KFX S;  1F8H A;  1F55 A;  2FCD A;  1UHK A;  2KFH A;  1OOJ A;  3JVT C;  1FF1 A;  3DD4 A;  1MR8 A;  5AAN A;  1S36 A;  3HX4 A;  2KI6 D;  1S6I A;  1TIZ A;  1XFW O;  1QVI Z;  1XFU O;  2LUC A;  4PHN A;  5HLO A;  1OSA A;  1CDL A;  3I5F B;  2I2R E;  1KK8 C;  1CFC A;  1UUS A;  1MXE A;  1OQP A;  4MZJ A;  1ZMZ A;  2F2P A;  3PAL A;  4I5L B;  2MRD A;  2FCE A;  5PAL A;  1BT6 A;  2LHL A;  1H8B A;  1XFY O;  2KAY A;  4MZK A;  3I5H B;  3O4Y A;  1KCY A;  3O2P A;  2BCX A;  3JTD B;  2QPT A;  2KAX A;  2JZI A;  3DF0 B;  2JXC A;  1K90 D;  2KHN A;  2Y4Q A;  4PHK A;  3A4U B;  1BG1 A;  2ZNE A;  3VGO A;  4YGE B;  2MJW B;  4L9M A;  3BXK A;  3SG6 A;  2OS8 C;  4JPZ B;  4WQ2 A;  1HT9 A;  4XYN A;  2M3W A;  2M1K B;  3M0W A;  4M2Q A;  4DUQ A;  1S1E A;  2LVK A;  1Y6W A;  1NUB A;  1QLK A;  4ZCV A;  3KPX A;  3SIA A;  1ZUZ A;  4USL A;  4OKH A;  4MLW A;  4ORB B;  5BPJ A;  1YUR A;  3DVM A;  1U5I B;  4P5O E;  1BU3 A;  4MBE A;  1REC A;  1KFX L;  1TCO B;  1PUL A;  2JC2 A;  2JRF A;  1QV0 A;  2LE9 B;  4YGD B;  2LMU A;  2NLN A;  2KI6 C;  1CFF A;  1CDP A;  1WRL A;  1A29 A;  2FOT A;  4ICB A;  3DF0 A;  1RK9 A;  1JF0 A;  2KAV A;  2LLU A;  1YRT B;  4N5X A;  3SJS A;  4AQJ A;  1NCX A;  4E68 A;  2EGD A;  1A2X A;  4FQO A;  1J55 A;  2M7N A;  1BJF A;  4DCK A;  2OPO A;  5F6T A;  1EG3 A;  5CSJ A;  3O6B A;  1K9P A;  3NSK A;  4AQI A;  1XK4 A;  2I18 A;  2ZFD A;  1QJT A;  1DT7 B;  2BEC A;  2JUL A;  1GQM A;  3TDU A;  1EL4 A;  2H61 A;  2F3Z A;  3AAJ A;  1MF8 B;  4GBA A;  4IL1 A;  3TUY B;  2M8U A;  1F54 A;  1IRJ A;  1S5G Z;  1BOC A;  3LLE A;  3OB1 B;  1S6J A;  1DJX A;  3OX6 A;  4XJK A;  1ODB A;  2PVB A;  4YI9 A;  1CTR A;  5DKR A;  2M49 B;  4CFQ A;  2F8P A;  3HCM A;  3TS5 B;  5JJG A;  5I2L A;  3BUN B;  1FI5 A;  2WOR A;  3I5G C;  1DJH A;  5IBW A;  2KOT A;  1RRO A;  1CDM A;  1SR6 C;  1KFU S;  2BL0 B;  5CSF A;  1EXR A;  1LKJ A;  5ER5 A;  2JPT A;  2Y1N A;  4OVN F;  2LNK A;  4HRH A;  1A75 B;  5KTY A;  2LM5 A;  1ZAC A;  1TNP A;  2RGI A;  1KK7 Y;  1TOP A;  2MLF C;  1SK6 D;  2MAZ A;  2CTN A;  1CLB A;  1DVI A;  1XO5 A;  1YTZ C;  2L50 A;  2M9G A;  1SKT A;  2CCM A;  1DF0 B;  4D1E A;  1UWO A;  5CSI A;  5CPV A;  2JTT A;  4MSP A;  1CLL A;  1BR1 B;  2LUX A;  1AVS A;  2KGB C;  5JOL A;  1BF5 A;  1A4P A;  1FW4 A;  1M45 A;  1QX5 B;  1K9U A;  1Y1A A;  1OMR A;  3SIB A;  4C0J A;  2M97 A;  5CSN A;  5AFP A;  1M31 A;  1IQ3 A;  2K8M B;  1F71 A;  1CDN A;  2PSR A;  2L2E A;  2BBN A;  3EK8 A;  3PAT A;  1MWN A;  1J1E A;  3CR5 X;  4ZCU A;  1UHI A;  1DJZ A;  1DTL A;  2KBM A;  1LIN A;  2KQY A;  2LCP A;  5K89 A;  1S6C A;  1SL8 A;  3BQ3 A;  3DVJ A;  1JFK A;  1SPY A;  3RM1 A;  3I5I C;  1F4Q A;  1Y1X A;  2OTG C;  2LVV A;  2K2A A;  5B8I B;  4MVF A;  2BKI B;  2LV7 A;  2AUC A;  3AKB A;  1PK0 D;  1V1F A;  4JQ0 D;  1J1D A;  1KQM B;  4AOM A;  5TNC A;  1KFU L;  3A8R A;  4YGB B;  5FYX A;  4U8D A;  2KI4 B;  3AAK A;  1KWO C;  3FWB A;  2DOQ A;  2I7A A;  4I5J A;  1QIW A;  1H4B A;  2ZND A;  3PN7 B;  3EKJ A;  1NSH A;  2MA2 A;  1ZOT B;  1QV1 A;  1SBJ A;  1B8C A;  2NCP A;  2KDH A;  3LL8 B;  3VRN A;  1D1O A;  1NX2 A;  2BE4 A;  1N2D A;  4YBH B;  1CM4 A;  2JT3 A;  3BUO B;  4GGF A;  1ZFS A;  1IG5 A;  2WND A;  1NX3 A;  2LAN A;  3I5F C;  2HPS A;  2IS9 A;  1CLM A;  1FBV A;  2K7B A;  1UUR A;  2LHI A;  4N1F A;  2ZN9 A;  4GNK B;  1RJV A;  1QXP A;  3CTN A;  2HET A;  3NSL A;  2MBX A;  4BY5 A;  2EC6 B;  1A03 A;  1R6P A;  4C0K A;  3I5H C;  1Q80 A;  3NSI A;  1OMD A;  1CB1 A;  1NIW A;  2K61 A;  1PSR A;  1BMO A;  3JTD C;  4WQ3 A;  1TN4 A;  1ALV A;  1C7W A;  2B1U A;  5GQQ C;  4A4B A;  1LA3 A;  3VRR A;  1K95 A;  3E3R A;  1XA5 A;  1TNQ A;  1YRU B;  3K21 A;  3KO0 A;  4F0Z B;  2ISD A;  1TCF A;  2L98 A;  2LMT A;  3PM8 A;  4YGA A;  1G33 A;  3TZ1 A;  1KSM A;  1NP8 A;  1B8L A;  5AER A;  1LA0 A;  2Y5I A;  2WCF A;  2H2K A;  2WOS A;  1L7Z A;  1WLZ A;  1QVI Y;  5AEQ A;  2PAS A;  4PDZ A;  1XK4 C;  4Q04 A;  3SG7 A;  3CR2 A;  3BOW B;  4NDD A;  1M46 A;  1WDC B;  3SG4 A;  1HQV A;  2H61 C;  3AKA A;  3SG3 A;  1B1G A;  2G2B A;  1N65 A;  2M7L A;  1IJ5 A;  1GGW A;  2CT9 A;  1S26 D;  2LP3 A;  2VRG A;  3LCP C;  1JF2 A;  4PE1 A;  1U5I A;  2WCE A;  3EVV A;  2LVJ A;  1BLQ A;  1JSA A;  4PE7 A;  1OMV A;  1JUO A;  2L4H A;  4DRW A;  1QAS A;  4YI8 A;  1F70 A;  2SAS A;  1BOD A;  1XVJ A;  2R2I A;  2NXQ A;  1M63 B;  2KNE A;  2JNF A;  2GGM A;  5D7F A;  2Q4U A;  3IF7 A;  3PFV A;  1J7R A;  2BCA A;  3OP0 A;  4QJ5 B;  3GK1 A;  1QAT A;  1M39 A;  1YUS A;  3KF9 A;  3OX5 A;  4PAL A;  1K94 A;  2K2F A;  1FI6 A;  1TRF A;  1EJ3 A;  3D0Y B;  5HLV A;  1X02 A;  3EKH A;  3FIA A;  3BOW A;  2BKH B;  1BR4 B;  2M0R A;  3VRQ A;  3PSR A;  5HKW A;  1TNW A;  2E30 A;  1YX7 A;  3TUY C;  1DJI A;  2JQ6 A;  3GOF A;  3KHE A;  1K9K A;  2KFF A;  4I5K A;  2GGZ A;  2LP2 A;  1WRK A;  1OE9 B;  2EHB A;  3TS5 C;  1QS7 A;  4UPG A;  2A4J A;  2O60 A;  5D69 A;  2LMV A;  1PVA A;  1NCZ A;  2CXJ A;  2HQ8 A;  2PAL A;  3EK7 A;  3OHM B;  1AK8 A;  1N0Y A;  1NPQ A;  3CZT X;  1K93 D;  4GPL B;  2E6W A;  2NCO A;  3F45 A;  3SG5 A;  2O5G A;  3CGA A;  1LVC D;  2WC8 A;  4QJ4 B;  1QX7 A;  2M1U A;  1L2O B;  2BL0 C;  3LK1 A;  4DIR A;  1Y1U A;  1IJ6 A;  2KSP A;  3BUX B;  5AXI A;  4BY4 A;  2LAP A;  1RFJ A;  3VRO A;  3BUM B;  2JU0 A;  2G9B A;  1YX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...