1K2HA

Three-dimensional solution structure of apo-s100a1.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 protein, alpha chain
publication title Three-dimensional solution structure of the calcium-signaling protein apo-S100A1 as determined by NMR.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 24
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k2hA00
2LC5A 5AERA 1K2HA 4PE1A 1SCMB 2I94A 2EHBA 5I8NA 3BXKA 5AEQA 2LUXA 1L7ZA 1F54A 3CLNA 1XK4C 3FS7A 1OSAA 1RECA 4ORCB 1J1DA 1K9UA 5G08A 2LVIA 3CTNA 1NIWA 1JBAA 4DIRA 1UHKA 2MLEC 3SG7A 2ISDA 2BL0B 3D0YA 1J7RA 1NX2A 1N0YA 2KDHA 3QRXA 4C0KA 1J7QA 3SG5A 2FCDA 1LVCD 1G4YR 2JTZA 1DJWA 2Y5IA 2KGRA 2HQ8A 3KF9A 1UHIA 1XFYO 3PATA 4PHNA 2NLNA 1YVHA 1ZFSA 2ZNEA 1K8UA 3A4UB 4NDDA 2LNKA 2L4HA 5D69A 1WDCC 3I5FC 4HRGA 1BR4B 1KFUL 2K7BA 3TDIA 1BODA 3PM8A 1XFWO 1F4QA 1YRTB 3I5GB 4PHJA 3JVTC 2Q4UA 5CSFA 4TNCA 2LVVA 1WRZA 1QX5B 1MUXA 3LL8B 4BY5A 1LXFC 2GGZA 4GPLB 2BCXA 4MRYA 1DGUA 3KO0A 1B8RA 1K94A 1XO5A 4M2OA 4MZLA 1B7TY 2COLB 1UURA 1IKUA 1J1EA 3EVRA 3PFVA 3WHUB 1MR8A 3AAKA 3O78A 1K9KA 3KEVA 1LINA 3E3RA 3JTDB 5CPVA 1M39A 5TNCA 1SMGA 2KI6D 3D0YB 2M29A 2LLUA 3TUYC 2JT3A 2M9GA 1A75B 2LCPA 1QASA 4NDCA 1W7IB 2K8MB 3OHMB 1AUIB 1UWOA 1RWYA 1KK7Z 1QLSA 1TN4A 4YGDB 4XJKB 1AVSA 2LHIA 5ER4X 2AAOA 2CTNA 3PN7C 1Q80A 2MJWB 4YGBB 2FJUB 3EKHA 2KBMA 4YGCB 3CS1A 3DVJA 1CMFA 5B8IB 4YGAA 2L51A 1CLMA 4JWQA 2DOQA 2K7OA 3BQ3A 2M8UA 2JOJA 4GBAA 2HF5A 4WQ3A 1CB1A 2ZNDA 2BECA 1A75A 3EK8A 4OKHA 5BPJA 4GNKB 4N1FA 1B8LA 4NDBA 2KGBC 1YX8A 3BOWB 4XJKA 4FTGA 1XFUO 1NCZA 1TNXA 3CGAA 3WNXB 4M2QA 2BKHB 2KFFA 1FI6A 1JUOA 3DD4A 2WCBA 4BY4A 2JWWA 4GGFA 5DKRA 3SG4A 1JFJA 2JULA 4MVFA 4WQ2A 5J3XA 4YI9A 5DKQA 3VRPA 4CFRA 2M1UA 3FWBA 2BCAA 5DKNA 1IH0A 4PE0A 2F2OA 1S6IA 4GGNA 4U8DA 2JC2A 2F8PA 3AKAA 3BOWA 4HRHA 1OE9B 2B1UA 2LVJA 3FWCA 2I7AA 1LA3A 4DRWA 1IWQA 1YRUB 1YVLA 5AANA 3VRRA 2QACA 4D1EA 1E8AA 1TNWA 2H61A 1WRLA 1TRFA 3GK2A 4HSZA 1BLQA 2GGMA 2JTTA 4P2YB 1S5GZ 2L5XB 1SBJA 5I2QA 1BF5A 2CNPA 2KYCA 2L0PA 4PALA 1TCFA 1C7WA 4ETOA 1EL4A 1DJXA 1PRWA 2LMVA 2LP2A 1RK9A 2NXQA 2EC6C 2BKIB 2TN4A 2ZRSA 1CKKA 2I18A 2L4IA 1DJIA 1XA5A 3TDUA 1UUSA 2KI4B 2KSPA 1SKTA 1RTP1 2LP3A 1NP8A 3PLFB 1EJ3A 2MHHA 1IG5A 1SL9A 2JNXA 5CSIA 1SK6D 1ZMZA 1KWOB 1YURA 2WOSA 2CBLA 2M7NA 2OS8C 5HYDA 1GQMA 3OB1B 3DVMA 1CMGA 2M7LA 1JWDA 1S3PA 3ZNIA 3IQOA 1DJZA 1PSRA 3OX5A 1SCMC 1KK7Y 5JOLA 1IJ5A 1WLZA 2BE6A 2JPTA 2VRGA 2V53A 1ALWA 1AJ4A 1ZUZA 3EVVA 3NSOA 2JXLA 4QJ3B 1QIWA 4HREE 4OV2A 1CLBA 3BUWB 1C07A 2M97A 3VRQA 4I5KA 3F45A 4L9MA 4AOMA 2BL0C 3TS5C 1X02A 1U5IB 1J55A 2MA2A 2KAVA 2K7CA 4GUKA 2JT8A 4PCWA 1BU3A 3CR2A 5AFPA 1TNPA 1A4PA 1KSOA 1DGVA 1YX7A 1CFCA 1Y1XA 2K7DA 1F70A 2Y4QA 5HLVA 1YUTA 3I5IB 1ZOTB 1L2OB 3M0WA 3SG3A 1IRJA 2ZKMX 4JQ0D 1TNQA 1D1OA 1F4OA 1IJ6A 3I5FB 1GGWA 1TOPA 3I5GC 1U5IA 2Q91A 3PSRA 1BR1B 4F0ZB 1RJVA 2Y1NA 1CDNA 2LVKA 1M45A 3NSKA 3MSEB 4N1GA 1KQMC 1QJTA 1UP5A 4CFQA 1TIZA 1H4BA 3TDZA 1MXEA 3EVUA 1LKJA 1NX1A 1V1GA 1KCYA 1AK8A 1S5GY 4DS7A 1XYDA 1PVAA 1OZSA 2GV5A 3I5HB 3CWGA 2K2AA 1QX7A 1JC2A 2KAXA 2HQWA 1OOJA 4ZCVA 5D7FA 2F2PA 1SNLA 1MWNA 3CR4X 2LAPA 3RLZA 1CFDA 1V1FA 2JQ6A 5HKZA 3TUYB 1K95A 4I5NB 1F8HA 1Y6WA 1QV1A 1H8BA 4MZJA 1DVIA 1KK8C 3SIAA 1FPWA 1K9PA 1SR6B 4AQJA 1G33A 2AMIA 1C7VA 1EH2A 3AAJA 4P5OE 4GGFC 2JRFA 1PVBA 2PMYA 1CM1A 1SY9A 1NSHA 1S36A 2R2IA 5AXIA 1UHJA 4A4BA 1Y0VH 3IF7A 3FIAA 5HKYA 1PK0D 1ZACA 2JZIA 1SL8A 2OTGB 1ALVA 1NUBA 2KQYA 2HPSA 2PASA 1BMOA 1K93D 3GOFA 1A03A 2BE4A 2PALA 1A29A 2KAYA 4GFTA 1QTXA 3EK4A 1WLMA 3A8RA 4DUQA 2WORA 1EXRA 1WRKA 2SCPA 2H61C 2PRUA 2G9BA 2SASA 4QJ5B 5I2LA 2JXCA 1CDPA 1Y1UA 3NXAA 3NSIA 1MF8B 1DF0B 5KSZA 1JF0A 4M2PA 4PDZA 1MQ1A 3GK1A 4YBHB 2L98A 2Y1MA 3KPXA 5HLOA 3DF0B 5I2OA 1N65A 4XYNA 1DJYA 1FBVA 2BCBA 2KQ6A 2WCFA 2MRDA 4I5LB 1HT9A 2BBMA 3OX6A 4MEWA 1J7PA 4FQOA 5HKWA 1UHNA 2JNFA 1EG4A 1F55A 2JT0A 4WRIA 3BUNB 1CLLA 2NCOA 2LM5A 3HX4A 1PULA 1DF0A 4DCKA 1KFXL 2HETA 3LK1A 4CPVA 3DF0A 1FF1A 1M63B 2KFGA 3OP0A 1CFPA 2M49B 1JSAA 3CZTX 3GK4X 2LLTA 1JFKA 3BUOB 3O2PA 1KWOC 1AP4A 1CDLA 1QV0A 2JU0A 4YI8A 1GGZA 3NSLA 4MRXA 1KSMA 1DTLA 1XFZO 4UPGA 3H4SE 2F3ZA 2AUCA 1Y1AA 4N5XA 1N2DA 2L2EA 1J7OA 1QATA 2CT9A 3DVEA 2WNDA 1OMRA 1GJYA 2F3YA 1KQVA 3LLEA 2M1KB 1NYAA 3C1VA 1OQPA 3BUMB 4QJ4B 1HQVA 4ZCUA 3EKJA 1JF2A 2LHLA 2PVBA 5GQQC 3KHEA 4MSPA 3WHTB 3O4YA 3TS5B 1XK4A 2O5GA 1BJFA 1VRKA 1S6JA 1OMVA 2ZN9A 1S1EA 4CLNA 1RROA 1AJ5A 1ODBA 1WDCB 1YUUA 2G2BA 3IQQA 1NCYA 4ICBA 4USLA 2FCEA 3I5IC 4PHMA 1L2OC 2K2FA 1B1GA 1M31A 1BG1A 3JVTB 1SRAA 2ZN8A 1MXLC 3EK7A 2WC8A 1K96A 3AKBA 1QVIZ 2QPTA 1IQ3A 4MZKA 1KFXS 1DT7B 3BYAA 2NCPA 1EG3A 4YGEB 4PE7A 1TTXA 2M0RA 1NX3A 2KFHA 2LUCA 1R2UA 1WY9A 2LMTA 4C0JA 3JTDC 1KQMB 1BOCA 3K21A 3VROA 4OVNF 2M3WA 1B4CA 4I5JA 2F33A 2RGIA 3I5HC 4IL1A 4R1EA 4OCIA 2PSRA 1K90D 3SG2A 1AHRA 1OZOA 2BBNA 4PE4A 2WCEA 1FI5A 3OB2B 4CIDA 1UHHA 1XFVO 1W7JB 4MN0A 1IGVA 5CSNA 3PN7B 5K89A 2K0JA 3WXAA 2KI6C 4C0LA 1CFFA 2EGDA 5ER5A 1OMDA 1F71A 3ZWHA 1R6PA 2D8NA 1YR5A 4ORAB 1MHOA 1KK8B 2OPOA 1A2XA 1SR6C 2L50A 3HCMA 3ICBA 5CSJA 4E68A 2O60A 1PALA 1QIVA 1SW8A 3VGOA 2IS9A 4YRUA 1CTRA 1NCXA 3O6BA 3VRNA 3RM1A 2KOTA 2KBIA 3LCPC 1QLKA 1SCVA 1SL7A 5F6TA 4ORBB 1B9AA 2KHNA 2E30A 2OTGC 5KU1A 3D10A 2MBXA 4OR9B 2KNEA 1BT6A 1CNPA 2LE9B 3CR5X 1CDMA 3SIBA 2A4JA 2I2RE 4PHKA 2KYFA 2LMUA 2CXJA 1KFUS 1IQ5A 5PALA 3SG6A 1YUSA 4JPZB 1B8CA 1M46A 1DMOA 1XVJA 1NPQA 1QXPA 1FW4A 3SJSA 2ZRTA 2LANA 5KTYA 1PSBA 4A4CA 1CM4A 1QS7A 4MBEA 3PALA 2H2KA 1B7TZ 1B47A 2LLSA 4NQGA 1QVIY 2P6BB 3TZ1A 2E6WA 1XFXO 1S26D 1QX2A 2MAZA 1DJGA 2NZ0A 4Q04A 4AQIA 1SYMA 1LA0A 1RFJA 2LV7A 5JJGA 2EC6B 2KI4C 1NWDA 5FYXA 2CCMA 1YTZC 1TCOB 4GAOA 1S6CA 1SPYA 2FOTA 2MLFC 1NX0A 3DVKA 4MLWA 2ZFDA 3BUXB 1DJHA 2OS8B 2K61A 3LK0A 1G8IA 5IBWA
chains in the Genus database with same CATH superfamily
2LC5A 5I94A 5AERA 1K2HA 4PE1A 1SCMB 2I94A 2EHBA 3R72A 3BXKA 5AEQA 2LUXA 5I8NA 1L7ZA 1F54A 3CLNA 1XK4C 5HL1A 3FS7A 1OSAA 1RECA 4ORCB 1J1DA 1K9UA 5G08A 2LVIA 3CTNA 2L2CA 1NIWA 3R1VA 4PT1A 1JBAA 4DIRA 1TUJA 2H8VA 1UHKA 2MLEC 3SG7A 2ISDA 2BL0B 3NHIA 3D0YA 1J7RA 1NX2A 1N0YA 2KDHA 3QRXA 4C0KA 1J7QA 3EG5B 3SG5A 2FCDA 1LVCD 1G4YR 2JTZA 1DJWA 2Y5IA 2KGRA 2HQ8A 3KF9A 1UHIA 1XFYO 3PATA 4PHNA 2NLNA 1YVHA 1ZFSA 2ZNEA 1K8UA 3A4UB 4NDDA 2LNKA 2L4HA 5D69A 1T14A 1Z4HA 1WDCC 3I5FC 3CZ0A 4HRGA 1BR4B 1KFUL 2K7BA 3TDIA 1BODA 3PM8A 2QDIA 1XFWO 1F4QA 1YRTB 3I5GB 4PHJA 3JVTC 2Q4UA 3FE6A 4TNCA 2LVVA 5CSFA 1WRZA 1DELA 1MUXA 1QX5B 3LL8B 4BY5A 1LXFC 2GGZA 4GPLB 2BCXA 4MRYA 3NHTA 1DGUA 3KO0A 1B8RA 1K94A 1XO5A 4M2OA 2WCMA 4MZLA 1B7TY 2COLB 1UURA 1IKUA 3CYZA 1J1EA 3EVRA 3PFVA 4JD9A 3WHUB 1MR8A 2QEHA 3AAKA 1K9KA 3KEVA 3O78A 1LINA 4F7FA 3E3RA 3JTDB 5CPVA 1M39A 5TNCA 1SMGA 2KI6D 3D0YB 2M29A 2LLUA 3TUYC 2JT3A 3BFAA 2M9GA 1A75B 2LCPA 2QEOA 5FI2A 1QASA 4NDCA 1W7IB 2K8MB 3OHMB 1AUIB 1UWOA 1C3ZA 1KK7Z 1QLSA 1RWYA 1TN4A 3OGNA 1AVSA 2LHIA 4XJKB 5ER4X 2AAOA 2CTNA 3PN7C 3CABA 1Q80A 2MJWB 4YGBB 2FJUB 3B7AA 3EKHA 2KBMA 4YGCB 3CS1A 3S0FA 3DVJA 1CMFA 5B8IB 4YGAA 2L51A 1CLMA 4JWQA 2QEBA 2DOQA 3D74A 2K7OA 3BQ3A 2M8UA 2JOJA 4GBAA 2HF5A 4WQ3A 1CB1A 2ZNDA 2BECA 1A75A 3EK8A 4OKHA 5BPJA 4GNKB 1XFRA 4N1FA 1C3YA 1B8LA 3L4AA 4NDBA 2KGBC 3S0EA 1YX8A 3BOWB 4XJKA 4FTGA 3BJHA 1XFUO 1NCZA 1TNXA 3CGAA 4OZDA 3WNXB 4M2QA 2BKHB 2KFFA 1FI6A 1JUOA 3DD4A 2WCBA 4BY4A 2JWWA 4GGFA 5DKRA 3SG4A 1JFJA 3DYEA 2JULA 4MVFA 4WQ2A 1OOGA 4YI9A 5DKQA 5J3XA 3VRPA 4CFRA 2M1UA 3B88A 2BCAA 3FWBA 5DKNA 1IH0A 4PE0A 2F2OA 1S6IA 4GGNA 4U8DA 2JC2A 1DEKA 2F8PA 3AKAA 3BOWA 3L4LA 4HRHA 1OE9B 2B1UA 2LVJA 3FWCA 2I7AA 1LA3A 4DRWA 2WCJA 5D3OA 1IWQA 1YRUB 1YVLA 5AANA 1Z2CB 2QACA 3VRRA 4D1EA 1E8AA 1TNWA 2H61A 1WRLA 1TRFA 3GK2A 4HSZA 1BLQA 3SS4A 2GGMA 2JTTA 2WCKA 1S5GZ 4P2YB 2L5XB 4INWA 1SBJA 5I2QA 1BF5A 2CNPA 2KYCA 2L0PA 4PALA 1OW4A 1TCFA 1C7WA 4ETOA 1EL4A 1DJXA 1PRWA 2LMVA 2LP2A 1RK9A 2NXQA 2EC6C 2BKIB 2TN4A 2ZRSA 1CKKA 2I18A 2L4IA 1DJIA 1XA5A 3TDUA 1UUSA 2KI4B 2KSPA 1SKTA 1RTP1 2LP3A 1NP8A 3DY9A 1EJ3A 2MHHA 3PLFB 1IG5A 1SL9A 4YGDB 2JNXA 5CSIA 1SK6D 1ZMZA 1KWOB 1YURA 2WOSA 2CBLA 2M7NA 2BAPA 2OS8C 1GQMA 2FJYA 3OB1B 5HYDA 3DVMA 1CMGA 2M7LA 1JWDA 3VB1A 1S3PA 3ZNIA 3IQOA 1DJZA 1PSRA 2QEVA 3OX5A 1SCMC 1KK7Y 5JOLA 1IJ5A 1WLZA 2BE6A 2WCHA 2JPTA 2VRGA 1LS8A 2V53A 1ALWA 1AJ4A 1ZUZA 3EVVA 3NSOA 2JXLA 4QJ3B 1QIWA 4HREE 4OV2A 1CLBA 3BUWB 1C07A 2M97A 3VRQA 4I5KA 3F45A 4L9MA 4AOMA 2BL0C 3TS5C 1X02A 1U5IB 1J55A 2MA2A 2KAVA 2K7CA 4GUKA 2JT8A 4PCWA 1BU3A 3CR2A 5AFPA 1TNPA 1TUZA 1A4PA 1KSOA 1DGVA 3D73A 1YX7A 1CFCA 1Y1XA 2K7DA 1F70A 2Y4QA 5HLVA 1YUTA 3I5IB 1ZOTB 1L2OB 3M0WA 3SG3A 1IRJA 2ZKMX 3FE9A 4JQ0D 2L5YA 1TNQA 1D1OA 1F4OA 1IJ6A 1ORGA 3I5FB 1GGWA 1TOPA 3I5GC 1U5IA 2Q91A 3PSRA 1BR1B 4F0ZB 1RJVA 2P70A 4FQTA 2Y1NA 1CDNA 2LVKA 1M45A 3NSKA 3MSEB 4N1GA 1KQMC 1QJTA 1UP5A 3B86A 4CFQA 1TIZA 1QWVA 1H4BA 3TDZA 1MXEA 3EVUA 3PJIA 1LKJA 1NX1A 1V1GA 3CZ2A 3D78A 1AK8A 1KCYA 1S5GY 4DS7A 1XYDA 1PVAA 1OZSA 2GV5A 3I5HB 3CWGA 2K2AA 1QX7A 1JC2A 2KAXA 2HQWA 1OOJA 4ZCVA 5D7FA 2F2PA 1SNLA 1MWNA 3SS3A 3CR4X 2LAPA 3RLZA 3R1PA 1CFDA 1V1FA 2JQ6A 5HKZA 3TUYB 1K95A 4I5NB 1F8HA 1Y6WA 1QV1A 1H8BA 4MZJA 1DVIA 1KK8C 3SIAA 1FPWA 1K9PA 3S0BA 1SR6B 4AQJA 1G33A 2AMIA 1C7VA 1EH2A 3AAJA 3O4XA 4P5OE 4GGFC 2JRFA 1PVBA 2PMYA 1CM1A 1DC1A 3OBVA 1SY9A 5FI7A 1NSHA 1S36A 2R2IA 5AXIA 1UHJA 4A4BA 1Y0VH 3IF7A 3FIAA 5HKYA 1PK0D 1ZACA 2JZIA 1SL8A 3V2LA 2OTGB 1ALVA 1NUBA 2KQYA 2HPSA 2PASA 1BMOA 1K93D 3GOFA 1A03A 2BE4A 2PALA 1A29A 2KAYA 1P28A 4GFTA 1QTXA 3EK4A 1WLMA 3A8RA 3NGVA 2WORA 4DUQA 1EXRA 1WRKA 2SCPA 2H61C 2PRUA 2G9BA 2SASA 4QJ5B 5I2LA 2JXCA 1CDPA 2P71A 1Y1UA 3NXAA 3NSIA 1MF8B 1DF0B 5KSZA 1JF0A 4M2PA 4IJ7A 1MQ1A 3GK1A 4PDZA 2KLEA 4YBHB 2L98A 2Y1MA 3KPXA 5HLOA 3DF0B 5I2OA 1N65A 4XYNA 1DJYA 1FBVA 2BCBA 3IVTA 2KQ6A 2WCFA 2MRDA 4I5LB 1HT9A 2BBMA 3OX6A 4MEWA 1J7PA 4FQOA 5HKWA 1UHNA 2JNFA 4INXA 1EG4A 1F55A 2JT0A 4WRIA 3BUNB 3CDNA 1CLLA 2NCOA 3B6XA 2LM5A 3HX4A 1PULA 1DF0A 4DCKA 1KFXL 2HETA 3LK1A 4CPVA 3DF0A 1FF1A 1M63B 2KFGA 3OP0A 3N7HA 1CFPA 2M49B 3D77A 1JSAA 1OOFA 3CZTX 2LLTA 3GK4X 2PQLA 1JFKA 3BUOB 3O2PA 1KWOC 1AP4A 1CDLA 1QV0A 2JU0A 1GM0A 4YI8A 1GGZA 2YGUA 3NSLA 4MRXA 1KSMA 1DTLA 1XFZO 4UPGA 3H4SE 2F3ZA 2AUCA 1Y1AA 4N5XA 1N2DA 2L2EA 3D75A 1J7OA 1QATA 1TWOA 2CT9A 3DVEA 2WNDA 1DQEA 3S0AA 1OMRA 1GJYA 2F3YA 1KQVA 3LLEA 3UNWA 2M1KB 1NYAA 3C1VA 1OQPA 1IIOA 3BUMB 4QJ4B 3L47A 1HQVA 4ZCUA 3EKJA 1JF2A 2LHLA 2PVBA 5GQQC 3KHEA 4MSPA 3D76A 3WHTB 3O4YA 3TS5B 1XK4A 5FI6A 2O5GA 1BJFA 1VRKA 1S6JA 1OMVA 2KLDA 2ZN9A 3DZTA 1S1EA 4CLNA 1RROA 1AJ5A 1ODBA 3RZSA 1WDCB 1YUUA 2G2BA 3IQQA 1NCYA 4ICBA 2JPOA 4USLA 2FCEA 3I5IC 4PHMA 1L2OC 2K2FA 1B1GA 2BNXA 1M31A 3B87A 3JVTB 1BG1A 1SRAA 2ZN8A 3Q8IA 1MXLC 3EK7A 2WC8A 1K96A 3AKBA 1QVIZ 2QPTA 1IQ3A 4MZKA 1KFXS 5DICA 3BYAA 2NCPA 1DT7B 1EG3A 4YGEB 4PE7A 1TTXA 2M0RA 1NX3A 2KFHA 2LUCA 1R2UA 1WY9A 2LMTA 4C0JA 3JTDC 1KQMB 1BOCA 3K21A 3VROA 4OVNF 2M3WA 1B4CA 4I5JA 2F33A 2RGIA 3I5HC 4IL1A 4R1EA 4OCIA 2PSRA 1K90D 3SG2A 1AHRA 3BFBA 2PYQA 3K1EA 1OZOA 2BBNA 4PE4A 3S0GA 2WCEA 2WC5A 1FI5A 3OB2B 4CIDA 1UHHA 1XFVO 1OOHA 1W7JB 4MN0A 1IGVA 3SS5A 5CSNA 3PN7B 5K89A 2K0JA 3WXAA 2KI6C 3PM2A 4C0LA 1CFFA 2EGDA 5ER5A 1OMDA 1F71A 3ZWHA 1R6PA 2D8NA 3BFHA 1YR5A 4ORAB 1MHOA 1KK8B 2OPOA 3QMEA 1A2XA 1SR6C 2L50A 3HCMA 3ICBA 5CSJA 4E68A 2O60A 2ERBA 1PALA 1QIVA 1SW8A 3VGOA 3CZ1A 2KPHA 2IS9A 4YRUA 1CTRA 1NCXA 3O6BA 3VRNA 3RM1A 2KOTA 2KBIA 3LCPC 1QLKA 1SCVA 1SL7A 5F6TA 4ORBB 1B9AA 2KHNA 3S0DA 2E30A 2OTGC 5KU1A 3D10A 2MBXA 4OR9B 2KNEA 1BT6A 1CNPA 2LE9B 3CR5X 1CDMA 3SIBA 2K60A 2A4JA 2I2RE 2WC6A 3FE8A 2KYFA 2LMUA 4PHKA 2CXJA 2GTEA 1KFUS 5EL2A 1IQ5A 5PALA 3SG6A 1YUSA 4JPZB 1B8CA 1M46A 1DMOA 2WCLA 1XVJA 1NPQA 1QXPA 1FW4A 1SSEB 3SJSA 2ZRTA 2LANA 3R1OA 1PSBA 4JKTA 4A4CA 1CM4A 1QS7A 4MBEA 5KTYA 3PALA 2H2KA 1B7TZ 1B47A 2LLSA 4NQGA 1QVIY 2P6BB 3TZ1A 2E6WA 1XFXO 1S26D 1QX2A 2MAZA 1DJGA 2NZ0A 4KYNA 4Q04A 3DXLA 4AQIA 1SYMA 1LA0A 1RFJA 2LV7A 5JJGA 2EC6B 2KI4C 1NWDA 5FYXA 2CCMA 1YTZC 1TCOB 4GAOA 1S6CA 1SPYA 1W9ZA 2FOTA 2MLFC 1NX0A 1OOIX 3DVKA 4MLWA 2ZFDA 3BUXB 3UO9A 1DJHA 2OS8B 2K61A 3LK0A 1G8IA 5IBWA
chains in the Genus database with same CATH topology
2LC5A 5AERA 1K2HA 4PE1A 1SCMB 2I94A 2EHBA 5I8NA 3BXKA 5AEQA 2LUXA 1L7ZA 1F54A 3CLNA 1XK4C 3FS7A 1OSAA 1RECA 4ORCB 1J1DA 1K9UA 5G08A 2LVIA 3CTNA 1NIWA 1JBAA 4DIRA 1UHKA 2MLEC 3SG7A 2ISDA 2BL0B 3D0YA 1J7RA 1NX2A 1N0YA 2KDHA 3QRXA 4C0KA 1J7QA 3SG5A 2FCDA 1LVCD 1G4YR 2JTZA 1DJWA 2Y5IA 2KGRA 2HQ8A 3KF9A 1UHIA 1XFYO 3PATA 4PHNA 2NLNA 1YVHA 1ZFSA 2ZNEA 1K8UA 3A4UB 4NDDA 2LNKA 2L4HA 5D69A 1WDCC 3I5FC 4HRGA 1BR4B 1KFUL 2K7BA 3TDIA 1BODA 3PM8A 1XFWO 1F4QA 1YRTB 3I5GB 4PHJA 3JVTC 2Q4UA 5CSFA 4TNCA 2LVVA 1WRZA 1QX5B 1MUXA 3LL8B 4BY5A 1LXFC 2GGZA 4GPLB 2BCXA 4MRYA 1DGUA 3KO0A 1B8RA 1K94A 1XO5A 4M2OA 4MZLA 1B7TY 2COLB 1UURA 1IKUA 1J1EA 3EVRA 3PFVA 3WHUB 1MR8A 3AAKA 3O78A 1K9KA 3KEVA 1LINA 3E3RA 3JTDB 5CPVA 1M39A 5TNCA 1SMGA 2KI6D 3D0YB 2M29A 2LLUA 3TUYC 2JT3A 2M9GA 1A75B 2LCPA 1QASA 4NDCA 1W7IB 2K8MB 3OHMB 1AUIB 1UWOA 1RWYA 1KK7Z 1QLSA 1TN4A 4YGDB 4XJKB 1AVSA 2LHIA 5ER4X 2AAOA 2CTNA 3PN7C 1Q80A 2MJWB 4YGBB 2FJUB 3EKHA 2KBMA 4YGCB 3CS1A 3DVJA 1CMFA 5B8IB 4YGAA 2L51A 1CLMA 4JWQA 2DOQA 2K7OA 3BQ3A 2M8UA 2JOJA 4GBAA 2HF5A 4WQ3A 1CB1A 2ZNDA 2BECA 1A75A 3EK8A 4OKHA 5BPJA 4GNKB 4N1FA 1B8LA 4NDBA 2KGBC 1YX8A 3BOWB 4XJKA 4FTGA 1XFUO 1NCZA 1TNXA 3CGAA 3WNXB 4M2QA 2BKHB 2KFFA 1FI6A 1JUOA 3DD4A 2WCBA 4BY4A 2JWWA 4GGFA 5DKRA 3SG4A 1JFJA 2JULA 4MVFA 4WQ2A 5J3XA 4YI9A 5DKQA 3VRPA 4CFRA 2M1UA 3FWBA 2BCAA 5DKNA 1IH0A 4PE0A 2F2OA 1S6IA 4GGNA 4U8DA 2JC2A 2F8PA 3AKAA 3BOWA 4HRHA 1OE9B 2B1UA 2LVJA 3FWCA 2I7AA 1LA3A 4DRWA 1IWQA 1YRUB 1YVLA 5AANA 3VRRA 2QACA 4D1EA 1E8AA 1TNWA 2H61A 1WRLA 1TRFA 3GK2A 4HSZA 1BLQA 2GGMA 2JTTA 4P2YB 1S5GZ 2L5XB 1SBJA 5I2QA 1BF5A 2CNPA 2KYCA 2L0PA 4PALA 1TCFA 1C7WA 4ETOA 1EL4A 1DJXA 1PRWA 2LMVA 2LP2A 1RK9A 2NXQA 2EC6C 2BKIB 2TN4A 2ZRSA 1CKKA 2I18A 2L4IA 1DJIA 1XA5A 3TDUA 1UUSA 2KI4B 2KSPA 1SKTA 1RTP1 2LP3A 1NP8A 3PLFB 1EJ3A 2MHHA 1IG5A 1SL9A 2JNXA 5CSIA 1SK6D 1ZMZA 1KWOB 1YURA 2WOSA 2CBLA 2M7NA 2OS8C 5HYDA 1GQMA 3OB1B 3DVMA 1CMGA 2M7LA 1JWDA 1S3PA 3ZNIA 3IQOA 1DJZA 1PSRA 3OX5A 1SCMC 1KK7Y 5JOLA 1IJ5A 1WLZA 2BE6A 2JPTA 2VRGA 2V53A 1ALWA 1AJ4A 1ZUZA 3EVVA 3NSOA 2JXLA 4QJ3B 1QIWA 4HREE 4OV2A 1CLBA 3BUWB 1C07A 2M97A 3VRQA 4I5KA 3F45A 4L9MA 4AOMA 2BL0C 3TS5C 1X02A 1U5IB 1J55A 2MA2A 2KAVA 2K7CA 4GUKA 2JT8A 4PCWA 1BU3A 3CR2A 5AFPA 1TNPA 1A4PA 1KSOA 1DGVA 1YX7A 1CFCA 1Y1XA 2K7DA 1F70A 2Y4QA 5HLVA 1YUTA 3I5IB 1ZOTB 1L2OB 3M0WA 3SG3A 1IRJA 2ZKMX 4JQ0D 1TNQA 1D1OA 1F4OA 1IJ6A 3I5FB 1GGWA 1TOPA 3I5GC 1U5IA 2Q91A 3PSRA 1BR1B 4F0ZB 1RJVA 2Y1NA 1CDNA 2LVKA 1M45A 3NSKA 3MSEB 4N1GA 1KQMC 1QJTA 1UP5A 4CFQA 1TIZA 1H4BA 3TDZA 1MXEA 3EVUA 1LKJA 1NX1A 1V1GA 1KCYA 1AK8A 1S5GY 4DS7A 1XYDA 1PVAA 1OZSA 2GV5A 3I5HB 3CWGA 2K2AA 1QX7A 1JC2A 2KAXA 2HQWA 1OOJA 4ZCVA 5D7FA 2F2PA 1SNLA 1MWNA 3CR4X 2LAPA 3RLZA 1CFDA 1V1FA 2JQ6A 5HKZA 3TUYB 1K95A 4I5NB 1F8HA 1Y6WA 1QV1A 1H8BA 4MZJA 1DVIA 1KK8C 3SIAA 1FPWA 1K9PA 1SR6B 4AQJA 1G33A 2AMIA 1C7VA 1EH2A 3AAJA 4P5OE 4GGFC 2JRFA 1PVBA 2PMYA 1CM1A 1SY9A 1NSHA 1S36A 2R2IA 5AXIA 1UHJA 4A4BA 1Y0VH 3IF7A 3FIAA 5HKYA 1PK0D 1ZACA 2JZIA 1SL8A 2OTGB 1ALVA 1NUBA 2KQYA 2HPSA 2PASA 1BMOA 1K93D 3GOFA 1A03A 2BE4A 2PALA 1A29A 2KAYA 4GFTA 1QTXA 3EK4A 1WLMA 3A8RA 4DUQA 2WORA 1EXRA 1WRKA 2SCPA 2H61C 2PRUA 2G9BA 2SASA 4QJ5B 5I2LA 2JXCA 1CDPA 1Y1UA 3NXAA 3NSIA 1MF8B 1DF0B 5KSZA 1JF0A 4M2PA 4PDZA 1MQ1A 3GK1A 4YBHB 2L98A 2Y1MA 3KPXA 5HLOA 3DF0B 5I2OA 1N65A 4XYNA 1DJYA 1FBVA 2BCBA 2KQ6A 2WCFA 2MRDA 4I5LB 1HT9A 2BBMA 3OX6A 4MEWA 1J7PA 4FQOA 5HKWA 1UHNA 2JNFA 1EG4A 1F55A 2JT0A 4WRIA 3BUNB 1CLLA 2NCOA 2LM5A 3HX4A 1PULA 1DF0A 4DCKA 1KFXL 2HETA 3LK1A 4CPVA 3DF0A 1FF1A 1M63B 2KFGA 3OP0A 1CFPA 2M49B 1JSAA 3CZTX 3GK4X 2LLTA 1JFKA 3BUOB 3O2PA 1KWOC 1AP4A 1CDLA 1QV0A 2JU0A 4YI8A 1GGZA 3NSLA 4MRXA 1KSMA 1DTLA 1XFZO 4UPGA 3H4SE 2F3ZA 2AUCA 1Y1AA 4N5XA 1N2DA 2L2EA 1J7OA 1QATA 2CT9A 3DVEA 2WNDA 1OMRA 1GJYA 2F3YA 1KQVA 3LLEA 2M1KB 1NYAA 3C1VA 1OQPA 3BUMB 4QJ4B 1HQVA 4ZCUA 3EKJA 1JF2A 2LHLA 2PVBA 5GQQC 3KHEA 4MSPA 3WHTB 3O4YA 3TS5B 1XK4A 2O5GA 1BJFA 1VRKA 1S6JA 1OMVA 2ZN9A 1S1EA 4CLNA 1RROA 1AJ5A 1ODBA 1WDCB 1YUUA 2G2BA 3IQQA 1NCYA 4ICBA 4USLA 2FCEA 3I5IC 4PHMA 1L2OC 2K2FA 1B1GA 1M31A 1BG1A 3JVTB 1SRAA 2ZN8A 1MXLC 3EK7A 2WC8A 1K96A 3AKBA 1QVIZ 2QPTA 1IQ3A 4MZKA 1KFXS 1DT7B 3BYAA 2NCPA 1EG3A 4YGEB 4PE7A 1TTXA 2M0RA 1NX3A 2KFHA 2LUCA 1R2UA 1WY9A 2LMTA 4C0JA 3JTDC 1KQMB 1BOCA 3K21A 3VROA 4OVNF 2M3WA 1B4CA 4I5JA 2F33A 2RGIA 3I5HC 4IL1A 4R1EA 4OCIA 2PSRA 1K90D 3SG2A 1AHRA 1OZOA 2BBNA 4PE4A 2WCEA 1FI5A 3OB2B 4CIDA 1UHHA 1XFVO 1W7JB 4MN0A 1IGVA 5CSNA 3PN7B 5K89A 2K0JA 3WXAA 2KI6C 4C0LA 1CFFA 2EGDA 5ER5A 1OMDA 1F71A 3ZWHA 1R6PA 2D8NA 1YR5A 4ORAB 1MHOA 1KK8B 2OPOA 1A2XA 1SR6C 2L50A 3HCMA 3ICBA 5CSJA 4E68A 2O60A 1PALA 1QIVA 1SW8A 3VGOA 2IS9A 4YRUA 1CTRA 1NCXA 3O6BA 3VRNA 3RM1A 2KOTA 2KBIA 3LCPC 1QLKA 1SCVA 1SL7A 5F6TA 4ORBB 1B9AA 2KHNA 2E30A 2OTGC 5KU1A 3D10A 2MBXA 4OR9B 2KNEA 1BT6A 1CNPA 2LE9B 3CR5X 1CDMA 3SIBA 2A4JA 2I2RE 4PHKA 2KYFA 2LMUA 2CXJA 1KFUS 1IQ5A 5PALA 3SG6A 1YUSA 4JPZB 1B8CA 1M46A 1DMOA 1XVJA 1NPQA 1QXPA 1FW4A 3SJSA 2ZRTA 2LANA 5KTYA 1PSBA 4A4CA 1CM4A 1QS7A 4MBEA 3PALA 2H2KA 1B7TZ 1B47A 2LLSA 4NQGA 1QVIY 2P6BB 3TZ1A 2E6WA 1XFXO 1S26D 1QX2A 2MAZA 1DJGA 2NZ0A 4Q04A 4AQIA 1SYMA 1LA0A 1RFJA 2LV7A 5JJGA 2EC6B 2KI4C 1NWDA 5FYXA 2CCMA 1YTZC 1TCOB 4GAOA 1S6CA 1SPYA 2FOTA 2MLFC 1NX0A 3DVKA 4MLWA 2ZFDA 3BUXB 1DJHA 2OS8B 2K61A 3LK0A 1G8IA 5IBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LC5 A;  5AER A;  1K2H A;  4PE1 A;  1SCM B;  2I94 A;  2EHB A;  5I8N A;  3BXK A;  5AEQ A;  2LUX A;  1L7Z A;  1F54 A;  3CLN A;  1XK4 C;  3FS7 A;  1OSA A;  1REC A;  4ORC B;  1J1D A;  1K9U A;  5G08 A;  2LVI A;  3CTN A;  1NIW A;  1JBA A;  4DIR A;  1UHK A;  2MLE C;  3SG7 A;  2ISD A;  2BL0 B;  3D0Y A;  1J7R A;  1NX2 A;  1N0Y A;  2KDH A;  3QRX A;  4C0K A;  1J7Q A;  3SG5 A;  2FCD A;  1LVC D;  1G4Y R;  2JTZ A;  1DJW A;  2Y5I A;  2KGR A;  2HQ8 A;  3KF9 A;  1UHI A;  1XFY O;  3PAT A;  4PHN A;  2NLN A;  1YVH A;  1ZFS A;  2ZNE A;  1K8U A;  3A4U B;  4NDD A;  2LNK A;  2L4H A;  5D69 A;  1WDC C;  3I5F C;  4HRG A;  1BR4 B;  1KFU L;  2K7B A;  3TDI A;  1BOD A;  3PM8 A;  1XFW O;  1F4Q A;  1YRT B;  3I5G B;  4PHJ A;  3JVT C;  2Q4U A;  5CSF A;  4TNC A;  2LVV A;  1WRZ A;  1QX5 B;  1MUX A;  3LL8 B;  4BY5 A;  1LXF C;  2GGZ A;  4GPL B;  2BCX A;  4MRY A;  1DGU A;  3KO0 A;  1B8R A;  1K94 A;  1XO5 A;  4M2O A;  4MZL A;  1B7T Y;  2COL B;  1UUR A;  1IKU A;  1J1E A;  3EVR A;  3PFV A;  3WHU B;  1MR8 A;  3AAK A;  3O78 A;  1K9K A;  3KEV A;  1LIN A;  3E3R A;  3JTD B;  5CPV A;  1M39 A;  5TNC A;  1SMG A;  2KI6 D;  3D0Y B;  2M29 A;  2LLU A;  3TUY C;  2JT3 A;  2M9G A;  1A75 B;  2LCP A;  1QAS A;  4NDC A;  1W7I B;  2K8M B;  3OHM B;  1AUI B;  1UWO A;  1RWY A;  1KK7 Z;  1QLS A;  1TN4 A;  4YGD B;  4XJK B;  1AVS A;  2LHI A;  5ER4 X;  2AAO A;  2CTN A;  3PN7 C;  1Q80 A;  2MJW B;  4YGB B;  2FJU B;  3EKH A;  2KBM A;  4YGC B;  3CS1 A;  3DVJ A;  1CMF A;  5B8I B;  4YGA A;  2L51 A;  1CLM A;  4JWQ A;  2DOQ A;  2K7O A;  3BQ3 A;  2M8U A;  2JOJ A;  4GBA A;  2HF5 A;  4WQ3 A;  1CB1 A;  2ZND A;  2BEC A;  1A75 A;  3EK8 A;  4OKH A;  5BPJ A;  4GNK B;  4N1F A;  1B8L A;  4NDB A;  2KGB C;  1YX8 A;  3BOW B;  4XJK A;  4FTG A;  1XFU O;  1NCZ A;  1TNX A;  3CGA A;  3WNX B;  4M2Q A;  2BKH B;  2KFF A;  1FI6 A;  1JUO A;  3DD4 A;  2WCB A;  4BY4 A;  2JWW A;  4GGF A;  5DKR A;  3SG4 A;  1JFJ A;  2JUL A;  4MVF A;  4WQ2 A;  5J3X A;  4YI9 A;  5DKQ A;  3VRP A;  4CFR A;  2M1U A;  3FWB A;  2BCA A;  5DKN A;  1IH0 A;  4PE0 A;  2F2O A;  1S6I A;  4GGN A;  4U8D A;  2JC2 A;  2F8P A;  3AKA A;  3BOW A;  4HRH A;  1OE9 B;  2B1U A;  2LVJ A;  3FWC A;  2I7A A;  1LA3 A;  4DRW A;  1IWQ A;  1YRU B;  1YVL A;  5AAN A;  3VRR A;  2QAC A;  4D1E A;  1E8A A;  1TNW A;  2H61 A;  1WRL A;  1TRF A;  3GK2 A;  4HSZ A;  1BLQ A;  2GGM A;  2JTT A;  4P2Y B;  1S5G Z;  2L5X B;  1SBJ A;  5I2Q A;  1BF5 A;  2CNP A;  2KYC A;  2L0P A;  4PAL A;  1TCF A;  1C7W A;  4ETO A;  1EL4 A;  1DJX A;  1PRW A;  2LMV A;  2LP2 A;  1RK9 A;  2NXQ A;  2EC6 C;  2BKI B;  2TN4 A;  2ZRS A;  1CKK A;  2I18 A;  2L4I A;  1DJI A;  1XA5 A;  3TDU A;  1UUS A;  2KI4 B;  2KSP A;  1SKT A;  1RTP 1;  2LP3 A;  1NP8 A;  3PLF B;  1EJ3 A;  2MHH A;  1IG5 A;  1SL9 A;  2JNX A;  5CSI A;  1SK6 D;  1ZMZ A;  1KWO B;  1YUR A;  2WOS A;  2CBL A;  2M7N A;  2OS8 C;  5HYD A;  1GQM A;  3OB1 B;  3DVM A;  1CMG A;  2M7L A;  1JWD A;  1S3P A;  3ZNI A;  3IQO A;  1DJZ A;  1PSR A;  3OX5 A;  1SCM C;  1KK7 Y;  5JOL A;  1IJ5 A;  1WLZ A;  2BE6 A;  2JPT A;  2VRG A;  2V53 A;  1ALW A;  1AJ4 A;  1ZUZ A;  3EVV A;  3NSO A;  2JXL A;  4QJ3 B;  1QIW A;  4HRE E;  4OV2 A;  1CLB A;  3BUW B;  1C07 A;  2M97 A;  3VRQ A;  4I5K A;  3F45 A;  4L9M A;  4AOM A;  2BL0 C;  3TS5 C;  1X02 A;  1U5I B;  1J55 A;  2MA2 A;  2KAV A;  2K7C A;  4GUK A;  2JT8 A;  4PCW A;  1BU3 A;  3CR2 A;  5AFP A;  1TNP A;  1A4P A;  1KSO A;  1DGV A;  1YX7 A;  1CFC A;  1Y1X A;  2K7D A;  1F70 A;  2Y4Q A;  5HLV A;  1YUT A;  3I5I B;  1ZOT B;  1L2O B;  3M0W A;  3SG3 A;  1IRJ A;  2ZKM X;  4JQ0 D;  1TNQ A;  1D1O A;  1F4O A;  1IJ6 A;  3I5F B;  1GGW A;  1TOP A;  3I5G C;  1U5I A;  2Q91 A;  3PSR A;  1BR1 B;  4F0Z B;  1RJV A;  2Y1N A;  1CDN A;  2LVK A;  1M45 A;  3NSK A;  3MSE B;  4N1G A;  1KQM C;  1QJT A;  1UP5 A;  4CFQ A;  1TIZ A;  1H4B A;  3TDZ A;  1MXE A;  3EVU A;  1LKJ A;  1NX1 A;  1V1G A;  1KCY A;  1AK8 A;  1S5G Y;  4DS7 A;  1XYD A;  1PVA A;  1OZS A;  2GV5 A;  3I5H B;  3CWG A;  2K2A A;  1QX7 A;  1JC2 A;  2KAX A;  2HQW A;  1OOJ A;  4ZCV A;  5D7F A;  2F2P A;  1SNL A;  1MWN A;  3CR4 X;  2LAP A;  3RLZ A;  1CFD A;  1V1F A;  2JQ6 A;  5HKZ A;  3TUY B;  1K95 A;  4I5N B;  1F8H A;  1Y6W A;  1QV1 A;  1H8B A;  4MZJ A;  1DVI A;  1KK8 C;  3SIA A;  1FPW A;  1K9P A;  1SR6 B;  4AQJ A;  1G33 A;  2AMI A;  1C7V A;  1EH2 A;  3AAJ A;  4P5O E;  4GGF C;  2JRF A;  1PVB A;  2PMY A;  1CM1 A;  1SY9 A;  1NSH A;  1S36 A;  2R2I A;  5AXI A;  1UHJ A;  4A4B A;  1Y0V H;  3IF7 A;  3FIA A;  5HKY A;  1PK0 D;  1ZAC A;  2JZI A;  1SL8 A;  2OTG B;  1ALV A;  1NUB A;  2KQY A;  2HPS A;  2PAS A;  1BMO A;  1K93 D;  3GOF A;  1A03 A;  2BE4 A;  2PAL A;  1A29 A;  2KAY A;  4GFT A;  1QTX A;  3EK4 A;  1WLM A;  3A8R A;  4DUQ A;  2WOR A;  1EXR A;  1WRK A;  2SCP A;  2H61 C;  2PRU A;  2G9B A;  2SAS A;  4QJ5 B;  5I2L A;  2JXC A;  1CDP A;  1Y1U A;  3NXA A;  3NSI A;  1MF8 B;  1DF0 B;  5KSZ A;  1JF0 A;  4M2P A;  4PDZ A;  1MQ1 A;  3GK1 A;  4YBH B;  2L98 A;  2Y1M A;  3KPX A;  5HLO A;  3DF0 B;  5I2O A;  1N65 A;  4XYN A;  1DJY A;  1FBV A;  2BCB A;  2KQ6 A;  2WCF A;  2MRD A;  4I5L B;  1HT9 A;  2BBM A;  3OX6 A;  4MEW A;  1J7P A;  4FQO A;  5HKW A;  1UHN A;  2JNF A;  1EG4 A;  1F55 A;  2JT0 A;  4WRI A;  3BUN B;  1CLL A;  2NCO A;  2LM5 A;  3HX4 A;  1PUL A;  1DF0 A;  4DCK A;  1KFX L;  2HET A;  3LK1 A;  4CPV A;  3DF0 A;  1FF1 A;  1M63 B;  2KFG A;  3OP0 A;  1CFP A;  2M49 B;  1JSA A;  3CZT X;  3GK4 X;  2LLT A;  1JFK A;  3BUO B;  3O2P A;  1KWO C;  1AP4 A;  1CDL A;  1QV0 A;  2JU0 A;  4YI8 A;  1GGZ A;  3NSL A;  4MRX A;  1KSM A;  1DTL A;  1XFZ O;  4UPG A;  3H4S E;  2F3Z A;  2AUC A;  1Y1A A;  4N5X A;  1N2D A;  2L2E A;  1J7O A;  1QAT A;  2CT9 A;  3DVE A;  2WND A;  1OMR A;  1GJY A;  2F3Y A;  1KQV A;  3LLE A;  2M1K B;  1NYA A;  3C1V A;  1OQP A;  3BUM B;  4QJ4 B;  1HQV A;  4ZCU A;  3EKJ A;  1JF2 A;  2LHL A;  2PVB A;  5GQQ C;  3KHE A;  4MSP A;  3WHT B;  3O4Y A;  3TS5 B;  1XK4 A;  2O5G A;  1BJF A;  1VRK A;  1S6J A;  1OMV A;  2ZN9 A;  1S1E A;  4CLN A;  1RRO A;  1AJ5 A;  1ODB A;  1WDC B;  1YUU A;  2G2B A;  3IQQ A;  1NCY A;  4ICB A;  4USL A;  2FCE A;  3I5I C;  4PHM A;  1L2O C;  2K2F A;  1B1G A;  1M31 A;  1BG1 A;  3JVT B;  1SRA A;  2ZN8 A;  1MXL C;  3EK7 A;  2WC8 A;  1K96 A;  3AKB A;  1QVI Z;  2QPT A;  1IQ3 A;  4MZK A;  1KFX S;  1DT7 B;  3BYA A;  2NCP A;  1EG3 A;  4YGE B;  4PE7 A;  1TTX A;  2M0R A;  1NX3 A;  2KFH A;  2LUC A;  1R2U A;  1WY9 A;  2LMT A;  4C0J A;  3JTD C;  1KQM B;  1BOC A;  3K21 A;  3VRO A;  4OVN F;  2M3W A;  1B4C A;  4I5J A;  2F33 A;  2RGI A;  3I5H C;  4IL1 A;  4R1E A;  4OCI A;  2PSR A;  1K90 D;  3SG2 A;  1AHR A;  1OZO A;  2BBN A;  4PE4 A;  2WCE A;  1FI5 A;  3OB2 B;  4CID A;  1UHH A;  1XFV O;  1W7J B;  4MN0 A;  1IGV A;  5CSN A;  3PN7 B;  5K89 A;  2K0J A;  3WXA A;  2KI6 C;  4C0L A;  1CFF A;  2EGD A;  5ER5 A;  1OMD A;  1F71 A;  3ZWH A;  1R6P A;  2D8N A;  1YR5 A;  4ORA B;  1MHO A;  1KK8 B;  2OPO A;  1A2X A;  1SR6 C;  2L50 A;  3HCM A;  3ICB A;  5CSJ A;  4E68 A;  2O60 A;  1PAL A;  1QIV A;  1SW8 A;  3VGO A;  2IS9 A;  4YRU A;  1CTR A;  1NCX A;  3O6B A;  3VRN A;  3RM1 A;  2KOT A;  2KBI A;  3LCP C;  1QLK A;  1SCV A;  1SL7 A;  5F6T A;  4ORB B;  1B9A A;  2KHN A;  2E30 A;  2OTG C;  5KU1 A;  3D10 A;  2MBX A;  4OR9 B;  2KNE A;  1BT6 A;  1CNP A;  2LE9 B;  3CR5 X;  1CDM A;  3SIB A;  2A4J A;  2I2R E;  4PHK A;  2KYF A;  2LMU A;  2CXJ A;  1KFU S;  1IQ5 A;  5PAL A;  3SG6 A;  1YUS A;  4JPZ B;  1B8C A;  1M46 A;  1DMO A;  1XVJ A;  1NPQ A;  1QXP A;  1FW4 A;  3SJS A;  2ZRT A;  2LAN A;  5KTY A;  1PSB A;  4A4C A;  1CM4 A;  1QS7 A;  4MBE A;  3PAL A;  2H2K A;  1B7T Z;  1B47 A;  2LLS A;  4NQG A;  1QVI Y;  2P6B B;  3TZ1 A;  2E6W A;  1XFX O;  1S26 D;  1QX2 A;  2MAZ A;  1DJG A;  2NZ0 A;  4Q04 A;  4AQI A;  1SYM A;  1LA0 A;  1RFJ A;  2LV7 A;  5JJG A;  2EC6 B;  2KI4 C;  1NWD A;  5FYX A;  2CCM A;  1YTZ C;  1TCO B;  4GAO A;  1S6C A;  1SPY A;  2FOT A;  2MLF C;  1NX0 A;  3DVK A;  4MLW A;  2ZFD A;  3BUX B;  1DJH A;  2OS8 B;  2K61 A;  3LK0 A;  1G8I A;  5IBW A; 
#chains in the Genus database with same CATH topology
 2LC5 A;  5I94 A;  5AER A;  1K2H A;  4PE1 A;  1SCM B;  2I94 A;  2EHB A;  3R72 A;  3BXK A;  5AEQ A;  2LUX A;  5I8N A;  1L7Z A;  1F54 A;  3CLN A;  1XK4 C;  5HL1 A;  3FS7 A;  1OSA A;  1REC A;  4ORC B;  1J1D A;  1K9U A;  5G08 A;  2LVI A;  3CTN A;  2L2C A;  1NIW A;  3R1V A;  4PT1 A;  1JBA A;  4DIR A;  1TUJ A;  2H8V A;  1UHK A;  2MLE C;  3SG7 A;  2ISD A;  2BL0 B;  3NHI A;  3D0Y A;  1J7R A;  1NX2 A;  1N0Y A;  2KDH A;  3QRX A;  4C0K A;  1J7Q A;  3EG5 B;  3SG5 A;  2FCD A;  1LVC D;  1G4Y R;  2JTZ A;  1DJW A;  2Y5I A;  2KGR A;  2HQ8 A;  3KF9 A;  1UHI A;  1XFY O;  3PAT A;  4PHN A;  2NLN A;  1YVH A;  1ZFS A;  2ZNE A;  1K8U A;  3A4U B;  4NDD A;  2LNK A;  2L4H A;  5D69 A;  1T14 A;  1Z4H A;  1WDC C;  3I5F C;  3CZ0 A;  4HRG A;  1BR4 B;  1KFU L;  2K7B A;  3TDI A;  1BOD A;  3PM8 A;  2QDI A;  1XFW O;  1F4Q A;  1YRT B;  3I5G B;  4PHJ A;  3JVT C;  2Q4U A;  3FE6 A;  4TNC A;  2LVV A;  5CSF A;  1WRZ A;  1DEL A;  1MUX A;  1QX5 B;  3LL8 B;  4BY5 A;  1LXF C;  2GGZ A;  4GPL B;  2BCX A;  4MRY A;  3NHT A;  1DGU A;  3KO0 A;  1B8R A;  1K94 A;  1XO5 A;  4M2O A;  2WCM A;  4MZL A;  1B7T Y;  2COL B;  1UUR A;  1IKU A;  3CYZ A;  1J1E A;  3EVR A;  3PFV A;  4JD9 A;  3WHU B;  1MR8 A;  2QEH A;  3AAK A;  1K9K A;  3KEV A;  3O78 A;  1LIN A;  4F7F A;  3E3R A;  3JTD B;  5CPV A;  1M39 A;  5TNC A;  1SMG A;  2KI6 D;  3D0Y B;  2M29 A;  2LLU A;  3TUY C;  2JT3 A;  3BFA A;  2M9G A;  1A75 B;  2LCP A;  2QEO A;  5FI2 A;  1QAS A;  4NDC A;  1W7I B;  2K8M B;  3OHM B;  1AUI B;  1UWO A;  1C3Z A;  1KK7 Z;  1QLS A;  1RWY A;  1TN4 A;  3OGN A;  1AVS A;  2LHI A;  4XJK B;  5ER4 X;  2AAO A;  2CTN A;  3PN7 C;  3CAB A;  1Q80 A;  2MJW B;  4YGB B;  2FJU B;  3B7A A;  3EKH A;  2KBM A;  4YGC B;  3CS1 A;  3S0F A;  3DVJ A;  1CMF A;  5B8I B;  4YGA A;  2L51 A;  1CLM A;  4JWQ A;  2QEB A;  2DOQ A;  3D74 A;  2K7O A;  3BQ3 A;  2M8U A;  2JOJ A;  4GBA A;  2HF5 A;  4WQ3 A;  1CB1 A;  2ZND A;  2BEC A;  1A75 A;  3EK8 A;  4OKH A;  5BPJ A;  4GNK B;  1XFR A;  4N1F A;  1C3Y A;  1B8L A;  3L4A A;  4NDB A;  2KGB C;  3S0E A;  1YX8 A;  3BOW B;  4XJK A;  4FTG A;  3BJH A;  1XFU O;  1NCZ A;  1TNX A;  3CGA A;  4OZD A;  3WNX B;  4M2Q A;  2BKH B;  2KFF A;  1FI6 A;  1JUO A;  3DD4 A;  2WCB A;  4BY4 A;  2JWW A;  4GGF A;  5DKR A;  3SG4 A;  1JFJ A;  3DYE A;  2JUL A;  4MVF A;  4WQ2 A;  1OOG A;  4YI9 A;  5DKQ A;  5J3X A;  3VRP A;  4CFR A;  2M1U A;  3B88 A;  2BCA A;  3FWB A;  5DKN A;  1IH0 A;  4PE0 A;  2F2O A;  1S6I A;  4GGN A;  4U8D A;  2JC2 A;  1DEK A;  2F8P A;  3AKA A;  3BOW A;  3L4L A;  4HRH A;  1OE9 B;  2B1U A;  2LVJ A;  3FWC A;  2I7A A;  1LA3 A;  4DRW A;  2WCJ A;  5D3O A;  1IWQ A;  1YRU B;  1YVL A;  5AAN A;  1Z2C B;  2QAC A;  3VRR A;  4D1E A;  1E8A A;  1TNW A;  2H61 A;  1WRL A;  1TRF A;  3GK2 A;  4HSZ A;  1BLQ A;  3SS4 A;  2GGM A;  2JTT A;  2WCK A;  1S5G Z;  4P2Y B;  2L5X B;  4INW A;  1SBJ A;  5I2Q A;  1BF5 A;  2CNP A;  2KYC A;  2L0P A;  4PAL A;  1OW4 A;  1TCF A;  1C7W A;  4ETO A;  1EL4 A;  1DJX A;  1PRW A;  2LMV A;  2LP2 A;  1RK9 A;  2NXQ A;  2EC6 C;  2BKI B;  2TN4 A;  2ZRS A;  1CKK A;  2I18 A;  2L4I A;  1DJI A;  1XA5 A;  3TDU A;  1UUS A;  2KI4 B;  2KSP A;  1SKT A;  1RTP 1;  2LP3 A;  1NP8 A;  3DY9 A;  1EJ3 A;  2MHH A;  3PLF B;  1IG5 A;  1SL9 A;  4YGD B;  2JNX A;  5CSI A;  1SK6 D;  1ZMZ A;  1KWO B;  1YUR A;  2WOS A;  2CBL A;  2M7N A;  2BAP A;  2OS8 C;  1GQM A;  2FJY A;  3OB1 B;  5HYD A;  3DVM A;  1CMG A;  2M7L A;  1JWD A;  3VB1 A;  1S3P A;  3ZNI A;  3IQO A;  1DJZ A;  1PSR A;  2QEV A;  3OX5 A;  1SCM C;  1KK7 Y;  5JOL A;  1IJ5 A;  1WLZ A;  2BE6 A;  2WCH A;  2JPT A;  2VRG A;  1LS8 A;  2V53 A;  1ALW A;  1AJ4 A;  1ZUZ A;  3EVV A;  3NSO A;  2JXL A;  4QJ3 B;  1QIW A;  4HRE E;  4OV2 A;  1CLB A;  3BUW B;  1C07 A;  2M97 A;  3VRQ A;  4I5K A;  3F45 A;  4L9M A;  4AOM A;  2BL0 C;  3TS5 C;  1X02 A;  1U5I B;  1J55 A;  2MA2 A;  2KAV A;  2K7C A;  4GUK A;  2JT8 A;  4PCW A;  1BU3 A;  3CR2 A;  5AFP A;  1TNP A;  1TUZ A;  1A4P A;  1KSO A;  1DGV A;  3D73 A;  1YX7 A;  1CFC A;  1Y1X A;  2K7D A;  1F70 A;  2Y4Q A;  5HLV A;  1YUT A;  3I5I B;  1ZOT B;  1L2O B;  3M0W A;  3SG3 A;  1IRJ A;  2ZKM X;  3FE9 A;  4JQ0 D;  2L5Y A;  1TNQ A;  1D1O A;  1F4O A;  1IJ6 A;  1ORG A;  3I5F B;  1GGW A;  1TOP A;  3I5G C;  1U5I A;  2Q91 A;  3PSR A;  1BR1 B;  4F0Z B;  1RJV A;  2P70 A;  4FQT A;  2Y1N A;  1CDN A;  2LVK A;  1M45 A;  3NSK A;  3MSE B;  4N1G A;  1KQM C;  1QJT A;  1UP5 A;  3B86 A;  4CFQ A;  1TIZ A;  1QWV A;  1H4B A;  3TDZ A;  1MXE A;  3EVU A;  3PJI A;  1LKJ A;  1NX1 A;  1V1G A;  3CZ2 A;  3D78 A;  1AK8 A;  1KCY A;  1S5G Y;  4DS7 A;  1XYD A;  1PVA A;  1OZS A;  2GV5 A;  3I5H B;  3CWG A;  2K2A A;  1QX7 A;  1JC2 A;  2KAX A;  2HQW A;  1OOJ A;  4ZCV A;  5D7F A;  2F2P A;  1SNL A;  1MWN A;  3SS3 A;  3CR4 X;  2LAP A;  3RLZ A;  3R1P A;  1CFD A;  1V1F A;  2JQ6 A;  5HKZ A;  3TUY B;  1K95 A;  4I5N B;  1F8H A;  1Y6W A;  1QV1 A;  1H8B A;  4MZJ A;  1DVI A;  1KK8 C;  3SIA A;  1FPW A;  1K9P A;  3S0B A;  1SR6 B;  4AQJ A;  1G33 A;  2AMI A;  1C7V A;  1EH2 A;  3AAJ A;  3O4X A;  4P5O E;  4GGF C;  2JRF A;  1PVB A;  2PMY A;  1CM1 A;  1DC1 A;  3OBV A;  1SY9 A;  5FI7 A;  1NSH A;  1S36 A;  2R2I A;  5AXI A;  1UHJ A;  4A4B A;  1Y0V H;  3IF7 A;  3FIA A;  5HKY A;  1PK0 D;  1ZAC A;  2JZI A;  1SL8 A;  3V2L A;  2OTG B;  1ALV A;  1NUB A;  2KQY A;  2HPS A;  2PAS A;  1BMO A;  1K93 D;  3GOF A;  1A03 A;  2BE4 A;  2PAL A;  1A29 A;  2KAY A;  1P28 A;  4GFT A;  1QTX A;  3EK4 A;  1WLM A;  3A8R A;  3NGV A;  2WOR A;  4DUQ A;  1EXR A;  1WRK A;  2SCP A;  2H61 C;  2PRU A;  2G9B A;  2SAS A;  4QJ5 B;  5I2L A;  2JXC A;  1CDP A;  2P71 A;  1Y1U A;  3NXA A;  3NSI A;  1MF8 B;  1DF0 B;  5KSZ A;  1JF0 A;  4M2P A;  4IJ7 A;  1MQ1 A;  3GK1 A;  4PDZ A;  2KLE A;  4YBH B;  2L98 A;  2Y1M A;  3KPX A;  5HLO A;  3DF0 B;  5I2O A;  1N65 A;  4XYN A;  1DJY A;  1FBV A;  2BCB A;  3IVT A;  2KQ6 A;  2WCF A;  2MRD A;  4I5L B;  1HT9 A;  2BBM A;  3OX6 A;  4MEW A;  1J7P A;  4FQO A;  5HKW A;  1UHN A;  2JNF A;  4INX A;  1EG4 A;  1F55 A;  2JT0 A;  4WRI A;  3BUN B;  3CDN A;  1CLL A;  2NCO A;  3B6X A;  2LM5 A;  3HX4 A;  1PUL A;  1DF0 A;  4DCK A;  1KFX L;  2HET A;  3LK1 A;  4CPV A;  3DF0 A;  1FF1 A;  1M63 B;  2KFG A;  3OP0 A;  3N7H A;  1CFP A;  2M49 B;  3D77 A;  1JSA A;  1OOF A;  3CZT X;  2LLT A;  3GK4 X;  2PQL A;  1JFK A;  3BUO B;  3O2P A;  1KWO C;  1AP4 A;  1CDL A;  1QV0 A;  2JU0 A;  1GM0 A;  4YI8 A;  1GGZ A;  2YGU A;  3NSL A;  4MRX A;  1KSM A;  1DTL A;  1XFZ O;  4UPG A;  3H4S E;  2F3Z A;  2AUC A;  1Y1A A;  4N5X A;  1N2D A;  2L2E A;  3D75 A;  1J7O A;  1QAT A;  1TWO A;  2CT9 A;  3DVE A;  2WND A;  1DQE A;  3S0A A;  1OMR A;  1GJY A;  2F3Y A;  1KQV A;  3LLE A;  3UNW A;  2M1K B;  1NYA A;  3C1V A;  1OQP A;  1IIO A;  3BUM B;  4QJ4 B;  3L47 A;  1HQV A;  4ZCU A;  3EKJ A;  1JF2 A;  2LHL A;  2PVB A;  5GQQ C;  3KHE A;  4MSP A;  3D76 A;  3WHT B;  3O4Y A;  3TS5 B;  1XK4 A;  5FI6 A;  2O5G A;  1BJF A;  1VRK A;  1S6J A;  1OMV A;  2KLD A;  2ZN9 A;  3DZT A;  1S1E A;  4CLN A;  1RRO A;  1AJ5 A;  1ODB A;  3RZS A;  1WDC B;  1YUU A;  2G2B A;  3IQQ A;  1NCY A;  4ICB A;  2JPO A;  4USL A;  2FCE A;  3I5I C;  4PHM A;  1L2O C;  2K2F A;  1B1G A;  2BNX A;  1M31 A;  3B87 A;  3JVT B;  1BG1 A;  1SRA A;  2ZN8 A;  3Q8I A;  1MXL C;  3EK7 A;  2WC8 A;  1K96 A;  3AKB A;  1QVI Z;  2QPT A;  1IQ3 A;  4MZK A;  1KFX S;  5DIC A;  3BYA A;  2NCP A;  1DT7 B;  1EG3 A;  4YGE B;  4PE7 A;  1TTX A;  2M0R A;  1NX3 A;  2KFH A;  2LUC A;  1R2U A;  1WY9 A;  2LMT A;  4C0J A;  3JTD C;  1KQM B;  1BOC A;  3K21 A;  3VRO A;  4OVN F;  2M3W A;  1B4C A;  4I5J A;  2F33 A;  2RGI A;  3I5H C;  4IL1 A;  4R1E A;  4OCI A;  2PSR A;  1K90 D;  3SG2 A;  1AHR A;  3BFB A;  2PYQ A;  3K1E A;  1OZO A;  2BBN A;  4PE4 A;  3S0G A;  2WCE A;  2WC5 A;  1FI5 A;  3OB2 B;  4CID A;  1UHH A;  1XFV O;  1OOH A;  1W7J B;  4MN0 A;  1IGV A;  3SS5 A;  5CSN A;  3PN7 B;  5K89 A;  2K0J A;  3WXA A;  2KI6 C;  3PM2 A;  4C0L A;  1CFF A;  2EGD A;  5ER5 A;  1OMD A;  1F71 A;  3ZWH A;  1R6P A;  2D8N A;  3BFH A;  1YR5 A;  4ORA B;  1MHO A;  1KK8 B;  2OPO A;  3QME A;  1A2X A;  1SR6 C;  2L50 A;  3HCM A;  3ICB A;  5CSJ A;  4E68 A;  2O60 A;  2ERB A;  1PAL A;  1QIV A;  1SW8 A;  3VGO A;  3CZ1 A;  2KPH A;  2IS9 A;  4YRU A;  1CTR A;  1NCX A;  3O6B A;  3VRN A;  3RM1 A;  2KOT A;  2KBI A;  3LCP C;  1QLK A;  1SCV A;  1SL7 A;  5F6T A;  4ORB B;  1B9A A;  2KHN A;  3S0D A;  2E30 A;  2OTG C;  5KU1 A;  3D10 A;  2MBX A;  4OR9 B;  2KNE A;  1BT6 A;  1CNP A;  2LE9 B;  3CR5 X;  1CDM A;  3SIB A;  2K60 A;  2A4J A;  2I2R E;  2WC6 A;  3FE8 A;  2KYF A;  2LMU A;  4PHK A;  2CXJ A;  2GTE A;  1KFU S;  5EL2 A;  1IQ5 A;  5PAL A;  3SG6 A;  1YUS A;  4JPZ B;  1B8C A;  1M46 A;  1DMO A;  2WCL A;  1XVJ A;  1NPQ A;  1QXP A;  1FW4 A;  1SSE B;  3SJS A;  2ZRT A;  2LAN A;  3R1O A;  1PSB A;  4JKT A;  4A4C A;  1CM4 A;  1QS7 A;  4MBE A;  5KTY A;  3PAL A;  2H2K A;  1B7T Z;  1B47 A;  2LLS A;  4NQG A;  1QVI Y;  2P6B B;  3TZ1 A;  2E6W A;  1XFX O;  1S26 D;  1QX2 A;  2MAZ A;  1DJG A;  2NZ0 A;  4KYN A;  4Q04 A;  3DXL A;  4AQI A;  1SYM A;  1LA0 A;  1RFJ A;  2LV7 A;  5JJG A;  2EC6 B;  2KI4 C;  1NWD A;  5FYX A;  2CCM A;  1YTZ C;  1TCO B;  4GAO A;  1S6C A;  1SPY A;  1W9Z A;  2FOT A;  2MLF C;  1NX0 A;  1OOI X;  3DVK A;  4MLW A;  2ZFD A;  3BUX B;  3UO9 A;  1DJH A;  2OS8 B;  2K61 A;  3LK0 A;  1G8I A;  5IBW A; 
#chains in the Genus database with same CATH homology
 2LC5 A;  5AER A;  1K2H A;  4PE1 A;  1SCM B;  2I94 A;  2EHB A;  5I8N A;  3BXK A;  5AEQ A;  2LUX A;  1L7Z A;  1F54 A;  3CLN A;  1XK4 C;  3FS7 A;  1OSA A;  1REC A;  4ORC B;  1J1D A;  1K9U A;  5G08 A;  2LVI A;  3CTN A;  1NIW A;  1JBA A;  4DIR A;  1UHK A;  2MLE C;  3SG7 A;  2ISD A;  2BL0 B;  3D0Y A;  1J7R A;  1NX2 A;  1N0Y A;  2KDH A;  3QRX A;  4C0K A;  1J7Q A;  3SG5 A;  2FCD A;  1LVC D;  1G4Y R;  2JTZ A;  1DJW A;  2Y5I A;  2KGR A;  2HQ8 A;  3KF9 A;  1UHI A;  1XFY O;  3PAT A;  4PHN A;  2NLN A;  1YVH A;  1ZFS A;  2ZNE A;  1K8U A;  3A4U B;  4NDD A;  2LNK A;  2L4H A;  5D69 A;  1WDC C;  3I5F C;  4HRG A;  1BR4 B;  1KFU L;  2K7B A;  3TDI A;  1BOD A;  3PM8 A;  1XFW O;  1F4Q A;  1YRT B;  3I5G B;  4PHJ A;  3JVT C;  2Q4U A;  5CSF A;  4TNC A;  2LVV A;  1WRZ A;  1QX5 B;  1MUX A;  3LL8 B;  4BY5 A;  1LXF C;  2GGZ A;  4GPL B;  2BCX A;  4MRY A;  1DGU A;  3KO0 A;  1B8R A;  1K94 A;  1XO5 A;  4M2O A;  4MZL A;  1B7T Y;  2COL B;  1UUR A;  1IKU A;  1J1E A;  3EVR A;  3PFV A;  3WHU B;  1MR8 A;  3AAK A;  3O78 A;  1K9K A;  3KEV A;  1LIN A;  3E3R A;  3JTD B;  5CPV A;  1M39 A;  5TNC A;  1SMG A;  2KI6 D;  3D0Y B;  2M29 A;  2LLU A;  3TUY C;  2JT3 A;  2M9G A;  1A75 B;  2LCP A;  1QAS A;  4NDC A;  1W7I B;  2K8M B;  3OHM B;  1AUI B;  1UWO A;  1RWY A;  1KK7 Z;  1QLS A;  1TN4 A;  4YGD B;  4XJK B;  1AVS A;  2LHI A;  5ER4 X;  2AAO A;  2CTN A;  3PN7 C;  1Q80 A;  2MJW B;  4YGB B;  2FJU B;  3EKH A;  2KBM A;  4YGC B;  3CS1 A;  3DVJ A;  1CMF A;  5B8I B;  4YGA A;  2L51 A;  1CLM A;  4JWQ A;  2DOQ A;  2K7O A;  3BQ3 A;  2M8U A;  2JOJ A;  4GBA A;  2HF5 A;  4WQ3 A;  1CB1 A;  2ZND A;  2BEC A;  1A75 A;  3EK8 A;  4OKH A;  5BPJ A;  4GNK B;  4N1F A;  1B8L A;  4NDB A;  2KGB C;  1YX8 A;  3BOW B;  4XJK A;  4FTG A;  1XFU O;  1NCZ A;  1TNX A;  3CGA A;  3WNX B;  4M2Q A;  2BKH B;  2KFF A;  1FI6 A;  1JUO A;  3DD4 A;  2WCB A;  4BY4 A;  2JWW A;  4GGF A;  5DKR A;  3SG4 A;  1JFJ A;  2JUL A;  4MVF A;  4WQ2 A;  5J3X A;  4YI9 A;  5DKQ A;  3VRP A;  4CFR A;  2M1U A;  3FWB A;  2BCA A;  5DKN A;  1IH0 A;  4PE0 A;  2F2O A;  1S6I A;  4GGN A;  4U8D A;  2JC2 A;  2F8P A;  3AKA A;  3BOW A;  4HRH A;  1OE9 B;  2B1U A;  2LVJ A;  3FWC A;  2I7A A;  1LA3 A;  4DRW A;  1IWQ A;  1YRU B;  1YVL A;  5AAN A;  3VRR A;  2QAC A;  4D1E A;  1E8A A;  1TNW A;  2H61 A;  1WRL A;  1TRF A;  3GK2 A;  4HSZ A;  1BLQ A;  2GGM A;  2JTT A;  4P2Y B;  1S5G Z;  2L5X B;  1SBJ A;  5I2Q A;  1BF5 A;  2CNP A;  2KYC A;  2L0P A;  4PAL A;  1TCF A;  1C7W A;  4ETO A;  1EL4 A;  1DJX A;  1PRW A;  2LMV A;  2LP2 A;  1RK9 A;  2NXQ A;  2EC6 C;  2BKI B;  2TN4 A;  2ZRS A;  1CKK A;  2I18 A;  2L4I A;  1DJI A;  1XA5 A;  3TDU A;  1UUS A;  2KI4 B;  2KSP A;  1SKT A;  1RTP 1;  2LP3 A;  1NP8 A;  3PLF B;  1EJ3 A;  2MHH A;  1IG5 A;  1SL9 A;  2JNX A;  5CSI A;  1SK6 D;  1ZMZ A;  1KWO B;  1YUR A;  2WOS A;  2CBL A;  2M7N A;  2OS8 C;  5HYD A;  1GQM A;  3OB1 B;  3DVM A;  1CMG A;  2M7L A;  1JWD A;  1S3P A;  3ZNI A;  3IQO A;  1DJZ A;  1PSR A;  3OX5 A;  1SCM C;  1KK7 Y;  5JOL A;  1IJ5 A;  1WLZ A;  2BE6 A;  2JPT A;  2VRG A;  2V53 A;  1ALW A;  1AJ4 A;  1ZUZ A;  3EVV A;  3NSO A;  2JXL A;  4QJ3 B;  1QIW A;  4HRE E;  4OV2 A;  1CLB A;  3BUW B;  1C07 A;  2M97 A;  3VRQ A;  4I5K A;  3F45 A;  4L9M A;  4AOM A;  2BL0 C;  3TS5 C;  1X02 A;  1U5I B;  1J55 A;  2MA2 A;  2KAV A;  2K7C A;  4GUK A;  2JT8 A;  4PCW A;  1BU3 A;  3CR2 A;  5AFP A;  1TNP A;  1A4P A;  1KSO A;  1DGV A;  1YX7 A;  1CFC A;  1Y1X A;  2K7D A;  1F70 A;  2Y4Q A;  5HLV A;  1YUT A;  3I5I B;  1ZOT B;  1L2O B;  3M0W A;  3SG3 A;  1IRJ A;  2ZKM X;  4JQ0 D;  1TNQ A;  1D1O A;  1F4O A;  1IJ6 A;  3I5F B;  1GGW A;  1TOP A;  3I5G C;  1U5I A;  2Q91 A;  3PSR A;  1BR1 B;  4F0Z B;  1RJV A;  2Y1N A;  1CDN A;  2LVK A;  1M45 A;  3NSK A;  3MSE B;  4N1G A;  1KQM C;  1QJT A;  1UP5 A;  4CFQ A;  1TIZ A;  1H4B A;  3TDZ A;  1MXE A;  3EVU A;  1LKJ A;  1NX1 A;  1V1G A;  1KCY A;  1AK8 A;  1S5G Y;  4DS7 A;  1XYD A;  1PVA A;  1OZS A;  2GV5 A;  3I5H B;  3CWG A;  2K2A A;  1QX7 A;  1JC2 A;  2KAX A;  2HQW A;  1OOJ A;  4ZCV A;  5D7F A;  2F2P A;  1SNL A;  1MWN A;  3CR4 X;  2LAP A;  3RLZ A;  1CFD A;  1V1F A;  2JQ6 A;  5HKZ A;  3TUY B;  1K95 A;  4I5N B;  1F8H A;  1Y6W A;  1QV1 A;  1H8B A;  4MZJ A;  1DVI A;  1KK8 C;  3SIA A;  1FPW A;  1K9P A;  1SR6 B;  4AQJ A;  1G33 A;  2AMI A;  1C7V A;  1EH2 A;  3AAJ A;  4P5O E;  4GGF C;  2JRF A;  1PVB A;  2PMY A;  1CM1 A;  1SY9 A;  1NSH A;  1S36 A;  2R2I A;  5AXI A;  1UHJ A;  4A4B A;  1Y0V H;  3IF7 A;  3FIA A;  5HKY A;  1PK0 D;  1ZAC A;  2JZI A;  1SL8 A;  2OTG B;  1ALV A;  1NUB A;  2KQY A;  2HPS A;  2PAS A;  1BMO A;  1K93 D;  3GOF A;  1A03 A;  2BE4 A;  2PAL A;  1A29 A;  2KAY A;  4GFT A;  1QTX A;  3EK4 A;  1WLM A;  3A8R A;  4DUQ A;  2WOR A;  1EXR A;  1WRK A;  2SCP A;  2H61 C;  2PRU A;  2G9B A;  2SAS A;  4QJ5 B;  5I2L A;  2JXC A;  1CDP A;  1Y1U A;  3NXA A;  3NSI A;  1MF8 B;  1DF0 B;  5KSZ A;  1JF0 A;  4M2P A;  4PDZ A;  1MQ1 A;  3GK1 A;  4YBH B;  2L98 A;  2Y1M A;  3KPX A;  5HLO A;  3DF0 B;  5I2O A;  1N65 A;  4XYN A;  1DJY A;  1FBV A;  2BCB A;  2KQ6 A;  2WCF A;  2MRD A;  4I5L B;  1HT9 A;  2BBM A;  3OX6 A;  4MEW A;  1J7P A;  4FQO A;  5HKW A;  1UHN A;  2JNF A;  1EG4 A;  1F55 A;  2JT0 A;  4WRI A;  3BUN B;  1CLL A;  2NCO A;  2LM5 A;  3HX4 A;  1PUL A;  1DF0 A;  4DCK A;  1KFX L;  2HET A;  3LK1 A;  4CPV A;  3DF0 A;  1FF1 A;  1M63 B;  2KFG A;  3OP0 A;  1CFP A;  2M49 B;  1JSA A;  3CZT X;  3GK4 X;  2LLT A;  1JFK A;  3BUO B;  3O2P A;  1KWO C;  1AP4 A;  1CDL A;  1QV0 A;  2JU0 A;  4YI8 A;  1GGZ A;  3NSL A;  4MRX A;  1KSM A;  1DTL A;  1XFZ O;  4UPG A;  3H4S E;  2F3Z A;  2AUC A;  1Y1A A;  4N5X A;  1N2D A;  2L2E A;  1J7O A;  1QAT A;  2CT9 A;  3DVE A;  2WND A;  1OMR A;  1GJY A;  2F3Y A;  1KQV A;  3LLE A;  2M1K B;  1NYA A;  3C1V A;  1OQP A;  3BUM B;  4QJ4 B;  1HQV A;  4ZCU A;  3EKJ A;  1JF2 A;  2LHL A;  2PVB A;  5GQQ C;  3KHE A;  4MSP A;  3WHT B;  3O4Y A;  3TS5 B;  1XK4 A;  2O5G A;  1BJF A;  1VRK A;  1S6J A;  1OMV A;  2ZN9 A;  1S1E A;  4CLN A;  1RRO A;  1AJ5 A;  1ODB A;  1WDC B;  1YUU A;  2G2B A;  3IQQ A;  1NCY A;  4ICB A;  4USL A;  2FCE A;  3I5I C;  4PHM A;  1L2O C;  2K2F A;  1B1G A;  1M31 A;  1BG1 A;  3JVT B;  1SRA A;  2ZN8 A;  1MXL C;  3EK7 A;  2WC8 A;  1K96 A;  3AKB A;  1QVI Z;  2QPT A;  1IQ3 A;  4MZK A;  1KFX S;  1DT7 B;  3BYA A;  2NCP A;  1EG3 A;  4YGE B;  4PE7 A;  1TTX A;  2M0R A;  1NX3 A;  2KFH A;  2LUC A;  1R2U A;  1WY9 A;  2LMT A;  4C0J A;  3JTD C;  1KQM B;  1BOC A;  3K21 A;  3VRO A;  4OVN F;  2M3W A;  1B4C A;  4I5J A;  2F33 A;  2RGI A;  3I5H C;  4IL1 A;  4R1E A;  4OCI A;  2PSR A;  1K90 D;  3SG2 A;  1AHR A;  1OZO A;  2BBN A;  4PE4 A;  2WCE A;  1FI5 A;  3OB2 B;  4CID A;  1UHH A;  1XFV O;  1W7J B;  4MN0 A;  1IGV A;  5CSN A;  3PN7 B;  5K89 A;  2K0J A;  3WXA A;  2KI6 C;  4C0L A;  1CFF A;  2EGD A;  5ER5 A;  1OMD A;  1F71 A;  3ZWH A;  1R6P A;  2D8N A;  1YR5 A;  4ORA B;  1MHO A;  1KK8 B;  2OPO A;  1A2X A;  1SR6 C;  2L50 A;  3HCM A;  3ICB A;  5CSJ A;  4E68 A;  2O60 A;  1PAL A;  1QIV A;  1SW8 A;  3VGO A;  2IS9 A;  4YRU A;  1CTR A;  1NCX A;  3O6B A;  3VRN A;  3RM1 A;  2KOT A;  2KBI A;  3LCP C;  1QLK A;  1SCV A;  1SL7 A;  5F6T A;  4ORB B;  1B9A A;  2KHN A;  2E30 A;  2OTG C;  5KU1 A;  3D10 A;  2MBX A;  4OR9 B;  2KNE A;  1BT6 A;  1CNP A;  2LE9 B;  3CR5 X;  1CDM A;  3SIB A;  2A4J A;  2I2R E;  4PHK A;  2KYF A;  2LMU A;  2CXJ A;  1KFU S;  1IQ5 A;  5PAL A;  3SG6 A;  1YUS A;  4JPZ B;  1B8C A;  1M46 A;  1DMO A;  1XVJ A;  1NPQ A;  1QXP A;  1FW4 A;  3SJS A;  2ZRT A;  2LAN A;  5KTY A;  1PSB A;  4A4C A;  1CM4 A;  1QS7 A;  4MBE A;  3PAL A;  2H2K A;  1B7T Z;  1B47 A;  2LLS A;  4NQG A;  1QVI Y;  2P6B B;  3TZ1 A;  2E6W A;  1XFX O;  1S26 D;  1QX2 A;  2MAZ A;  1DJG A;  2NZ0 A;  4Q04 A;  4AQI A;  1SYM A;  1LA0 A;  1RFJ A;  2LV7 A;  5JJG A;  2EC6 B;  2KI4 C;  1NWD A;  5FYX A;  2CCM A;  1YTZ C;  1TCO B;  4GAO A;  1S6C A;  1SPY A;  2FOT A;  2MLF C;  1NX0 A;  3DVK A;  4MLW A;  2ZFD A;  3BUX B;  1DJH A;  2OS8 B;  2K61 A;  3LK0 A;  1G8I A;  5IBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...