1K2HA

Three-dimensional solution structure of apo-s100a1.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
b'GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 protein, alpha chain
publication title Three-dimensional solution structure of the calcium-signaling protein apo-S100A1 as determined by NMR.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 24
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k2hA00
1DF0A 5HLVA 1IJ6A 4ICBA 1Q80A 2R2IA 1B7TZ 1PRWA 2JOJA 3PFVA 5AXIA 1LINA 4CLNA 1AHRA 1PK0D 3TUYB 3EK7A 3SIAA 2LHLA 4CIDA 1TCOB 3TDZA 2WCEA 1XFYO 4OR9B 1SL7A 1H4BA 1S36A 1DJIA 3FS7A 1NCYA 1S3PA 2QACA 1M39A 2ZN9A 2KYFA 2KBIA 4MZLA 1XK4C 1QX5B 1CMGA 3DVEA 4C0KA 1BODA 2PRUA 3FWCA 1JWDA 1XFVO 4NDDA 1QX2A 5IBWA 3OB1B 1TNWA 1JC2A 2M7LA 2LUXA 1DJXA 4I5JA 1FPWA 1Y0VH 1XO5A 2JT3A 2NXQA 1RROA 3ZWHA 1JBAA 2BCXA 1F71A 1AK8A 2ZN8A 1DF0B 1TRFA 4FQOA 4NQGA 3PN7B 4PHMA 2BKHB 3ZNIA 1K9PA 2MLFC 1MWNA 2H61C 1M63B 1IWQA 1OMVA 1TIZA 1B8CA 1BLQA 3AKAA 1BMOA 2I18A 1JF0A 1WLMA 3TS5C 1K96A 4XYNA 4OKHA 1EG3A 2LC5A 3KEVA 3IF7A 4GGFA 3BOWA 2LHIA 4HSZA 2PASA 4I5NB 3VRNA 1S6IA 1B4CA 1V1FA 1QV0A 2CCMA 1MXEA 1A4PA 1OMDA 2H2KA 2BECA 2JNXA 3CZTX 1JF2A 1KFXS 1IKUA 1CDLA 5DKRA 1YRUB 2K7BA 4CPVA 1LKJA 3CWGA 1QXPA 3O6BA 1PSBA 1ZMZA 4L9MA 4AQIA 3EK4A 2BE4A 3EVVA 4HRHA 1DJWA 1UHJA 3AAJA 1KWOB 4PE1A 1DJHA 1KK8C 1SY9A 2HQ8A 3BUMB 1BT6A 3BUXB 1CLLA 2M49B 4ZCVA 1NIWA 3OX6A 4ORCB 1MUXA 2F2OA 1OZSA 1S5GZ 2LMTA 1G33A 1S6CA 2LMUA 1DT7B 2KYCA 1YUUA 1DGUA 4MN0A 4PHJA 5ER4X 1CB1A 1KQMC 2JT8A 5FYXA 2K7OA 4AOMA 4P2YB 2BKIB 5AFPA 5B8IB 3SIBA 2M7NA 2K7CA 1ALVA 1CNPA 1NCZA 4N1FA 1IQ3A 2LVJA 4DIRA 3NSLA 3WXAA 2D8NA 1IRJA 4Q04A 2JTTA 2K2FA 4ETOA 1KSOA 3HCMA 1WDCC 2EHBA 4PHKA 2JXLA 1FF1A 4PCWA 1JUOA 1AUIB 1UHNA 2P6BB 3NSIA 1RECA 1K90D 1N2DA 2KNEA 2BL0B 2M8UA 1TTXA 1SCMB 3SG4A 2LE9B 3PATA 1GJYA 2JQ6A 2Y1MA 1FI6A 3LLEA 1BJFA 2MBXA 3KHEA 1YVLA 1QVIY 2KSPA 3FIAA 1HT9A 1U5IA 5DKNA 2LLTA 2IS9A 4YGBB 3DF0A 3NSOA 1C7WA 1KFUS 2OS8B 3PN7C 2F8PA 1BR4B 1BU3A 3I5GB 1LVCD 1EG4A 1PVAA 4USLA 2BCBA 2ZRSA 3D10A 4DS7A 1L2OB 1MHOA 1QATA 4UPGA 1ODBA 4M2QA 1WLZA 1CLBA 3VRQA 1LXFC 1UP5A 2LANA 1G4YR 1J1DA 2OTGC 1DTLA 4MEWA 4MBEA 3CR4X 4XJKA 4N5XA 2BE6A 4PE4A 2KBMA 4I5LB 2AAOA 3LK1A 3AAKA 1XVJA 4YI8A 4C0JA 5HYDA 2KOTA 2MAZA 1EJ3A 1U5IB 2HETA 5I2QA 1OSAA 4YI9A 1X02A 3D0YB 1KWOC 2M1KB 2LP3A 3DF0B 1XFXO 3KO0A 5GQQC 2AUCA 3K21A 2FCEA 1L7ZA 3SG6A 2F33A 1MQ1A 2KDHA 2KI6C 1YR5A 1E8AA 4MLWA 4E68A 1BF5A 1NX0A 2L0PA 2CXJA 1RK9A 3RLZA 5CSJA 3BUWB 1KK7Y 3PSRA 5CPVA 3PM8A 1A03A 4YGDB 3O2PA 4GGFC 2BCAA 3BYAA 1DJGA 4XJKB 1BG1A 1EH2A 1TN4A 2AMIA 4A4CA 2Q4UA 3VGOA 1A29A 3DVKA 2LP2A 1XFWO 4PE0A 3CR2A 1R2UA 4M2PA 5CSIA 1QS7A 5HLOA 3QRXA 4HRGA 5KSZA 1PALA 1TNXA 3NSKA 5D7FA 1NX1A 1WRKA 3IQQA 3JTDB 3SG2A 3VROA 1RWYA 2CBLA 1QTXA 2COLB 1TOPA 2KI4B 1CDNA 1YURA 1NX3A 4PDZA 2WCFA 1D1OA 3ICBA 5HKYA 5I2OA 1J1EA 2SASA 5AANA 5I8NA 4I5KA 5AEQA 1SCMC 1AP4A 1KFXL 2M9GA 1NX2A 1QLKA 2F3ZA 2KI6D 2L51A 3F45A 1MR8A 1M31A 3JVTC 4CFRA 1WRLA 3OX5A 1SL8A 3SG3A 5D69A 1C07A 3I5FC 4GBAA 2KQYA 2BBNA 1W7JB 3CGAA 1CKKA 1J55A 5DKQA 4P5OE 5G08A 2LM5A 5J3XA 2MJWB 4MZKA 1NWDA 1F4QA 2K2AA 2OS8C 3DVMA 1IJ5A 1CTRA 1SCVA 4YGAA 2MLEC 4DUQA 2LVIA 3I5IB 2M97A 3A4UB 2L50A 4YBHB 3TUYC 1ZFSA 2K61A 2KGBC 1NYAA 1SW8A 1M45A 2LUCA 1SNLA 2NLNA 4MRYA 5ER5A 5PALA 4ZCUA 2SCPA 5KU1A 1RTP1 1JSAA 5BPJA 1QASA 1SMGA 4ORAB 5HKZA 4JPZB 3E3RA 4QJ5B 2HQWA 1K93D 1QVIZ 1FI5A 1CM4A 2PMYA 2ZFDA 4WQ2A 1FBVA 1NPQA 2L4HA 1K95A 2MRDA 3MSEB 1QJTA 2KFFA 2HPSA 2LVVA 1IH0A 1PVBA 1TNPA 3DD4A 2L5XB 1PULA 4QJ3B 4YGEB 1CFCA 1MXLC 1TCFA 2B1UA 2L98A 1SPYA 1SYMA 1XFUO 1Y1AA 2ZRTA 3C1VA 2LLSA 2GGMA 3D0YA 1LA3A 2KAXA 1K94A 1GGWA 2L2EA 4CFQA 2NZ0A 1H8BA 1HQVA 2E6WA 1IGVA 1YX8A 1KQVA 2G2BA 5I2LA 1B8LA 1OMRA 1RFJA 2GV5A 1B9AA 1B47A 1JFJA 4GFTA 1KFUL 3TDUA 1NP8A 2KQ6A 1YUSA 3OB2B 1B1GA 1CFPA 1K9UA 3LK0A 1F55A 2I2RE 5KTYA 2KGRA 1KSMA 1YTZC 2QPTA 3H4SE 4GPLB 1CFDA 1N0YA 2M3WA 4F0ZB 1AJ5A 3JTDC 3NXAA 1OQPA 4WQ3A 1GGZA 3EKJA 1C7VA 3GK1A 2K0JA 1J7RA 4JQ0D 2Y5IA 5CSNA 5TNCA 2KHNA 2Y4QA 4OVNF 3VRPA 2KI4C 1GQMA 3WHTB 4QJ4B 1DVIA 3I5HB 1Y1XA 4GAOA 4N1GA 1VRKA 1ZACA 3LCPC 1BOCA 4BY5A 1KK7Z 1AVSA 1UUSA 1SBJA 2M29A 2WNDA 3BUOB 1WDCB 1NSHA 1CLMA 2LLUA 2Y1NA 2BBMA 3GOFA 1ZOTB 2GGZA 2O5GA 3O4YA 1Y1UA 3SG5A 1A75B 2DOQA 5JJGA 2LCPA 2O60A 1B7TY 3EK8A 1NUBA 3CLNA 2JNFA 1YUTA 1QX7A 4C0LA 1YX7A 2L4IA 2JULA 4OCIA 4MRXA 3IQOA 2EC6B 3TZ1A 2WOSA 1SR6B 2FOTA 1F54A 4D1EA 1XK4A 3OHMB 3GK2A 3I5IC 1R6PA 2KFGA 2V53A 3EKHA 3FWBA 2OPOA 2G9BA 2FCDA 4GUKA 2JPTA 1S26D 4PALA 3BUNB 1QV1A 1XFZO 4MZJA 1WRZA 4GGNA 3CTNA 4NDBA 1SRAA 2LAPA 1KCYA 1CFFA 2CNPA 1K8UA 1DJYA 4MSPA 4ORBB 5K89A 2KFHA 1SL9A 2BL0C 2LNKA 2MHHA 1OE9B 1PSRA 2LMVA 1YVHA 1NCXA 2EGDA 2VRGA 2ZNEA 3LL8B 3RM1A 2ISDA 2OTGB 2K7DA 1SKTA 2H61A 1J7PA 4OV2A 4AQJA 3KF9A 5AERA 3AKBA 1UURA 2WCBA 2FJUB 2M0RA 5F6TA 4BY4A 2I7AA 5JOLA 1UWOA 3PALA 1UHIA 1DGVA 3SJSA 1M46A 3I5GC 3EVRA 1RJVA 1N65A 2WORA 1DJZA 3OP0A 4TNCA 1L2OC 3A8RA 1J7OA 1S6JA 2Q91A 1ALWA 2LV7A 1YRTB 2JWWA 2M1UA 1QLSA 2MA2A 1IQ5A 1EXRA 2TN4A 2F3YA 3SG7A 3M0WA 3TDIA 1UHKA 2K8MB 3WNXB 2JZIA 1AJ4A 4YGCB 1F4OA 1FW4A 2KAYA 3BXKA 1JFKA 3BOWB 4M2OA 1S5GY 3BQ3A 3DVJA 3GK4X 4JWQA 2RGIA 3I5HC 1A2XA 3TS5B 2ZNDA 3EVUA 1WY9A 1CDPA 1K2HA 1CDMA 1QIWA 4DCKA 1XYDA 1UHHA 4PHNA 1F8HA 4PE7A 4IL1A 1S1EA 2NCOA 2PALA 2PSRA 5HKWA 4GNKB 2JT0A 1W7IB 1G8IA 4A4BA 2E30A 1J7QA 2CTNA 2A4JA 1IG5A 2I94A 1F70A 1KK8B 2NCPA 3HX4A 4NDCA 3CS1A 1A75A 3VRRA 1K9KA 2JXCA 1MF8B 1ZUZA 2EC6C 2CT9A 2JRFA 1BR1B 1SR6C 4R1EA 2F2PA 1EL4A 2PVBA 1OOJA 3JVTB 4U8DA 1Y6WA 3KPXA 3O78A 4FTGA 2KAVA 3PLFB 2ZKMX 3I5FB 1QIVA 1CM1A 1LA0A 1V1GA 1TNQA 4YRUA 1OZOA 4MVFA 2WC8A 3WHUB 1KQMB 5CSFA 2JU0A 1XA5A 4HREE 4DRWA 1CMFA 1SK6D 2JTZA 2HF5A 1B8RA 2LVKA 4WRIA 3CR5X 1DMOA 2JC2A
chains in the Genus database with same CATH superfamily
1DF0A 5HLVA 1IJ6A 4ICBA 1Q80A 2R2IA 1B7TZ 1PRWA 2JOJA 3PFVA 5AXIA 1LINA 4CLNA 1AHRA 1PK0D 3TUYB 3EK7A 3SIAA 2LHLA 4OZDA 4CIDA 1TCOB 3TDZA 2WCEA 1XFYO 1DEKA 4OR9B 1SL7A 1H4BA 1S36A 1DJIA 3FS7A 2PYQA 1NCYA 1S3PA 2QACA 1M39A 2ZN9A 2KYFA 2KBIA 4MZLA 1XK4C 1QX5B 3S0DA 1CMGA 3DVEA 4C0KA 1BODA 2PRUA 3FWCA 1JWDA 1XFVO 4NDDA 1QX2A 3NHIA 5IBWA 2L5YA 3OB1B 1TNWA 1JC2A 3PM2A 2M7LA 2LUXA 1DJXA 4I5JA 1FPWA 1Y0VH 1XO5A 2JT3A 2NXQA 2WCJA 1RROA 1P28A 3ZWHA 1JBAA 2BCXA 3K1EA 1F71A 1AK8A 2ZN8A 1DF0B 3NHTA 1TRFA 4FQOA 1IIOA 2KLDA 4NQGA 3PN7B 4PHMA 2BKHB 1QWVA 3ZNIA 5I94A 1K9PA 2MLFC 1MWNA 2H61C 1M63B 1IWQA 1OMVA 1TIZA 1B8CA 3S0AA 1BLQA 3AKAA 4JKTA 1BMOA 2I18A 1JF0A 3OBVA 1WLMA 3TS5C 1K96A 4XYNA 4OKHA 1EG3A 2LC5A 3KEVA 3IF7A 4GGFA 3BOWA 2LHIA 4HSZA 2PASA 4I5NB 3VRNA 1S6IA 1B4CA 1V1FA 1QV0A 2CCMA 1MXEA 1A4PA 1OMDA 2H2KA 2BECA 2JNXA 3CZTX 1JF2A 1KFXS 3Q8IA 2QEVA 2WC5A 3S0BA 1IKUA 1CDLA 5DKRA 1YRUB 2K7BA 4CPVA 1LKJA 3CWGA 1QXPA 3O6BA 1PSBA 1ZMZA 4L9MA 4AQIA 3EK4A 5FI2A 2BE4A 3EVVA 4HRHA 1DJWA 1UHJA 5EL2A 3AAJA 1KWOB 4PE1A 1DJHA 1KK8C 1SY9A 2HQ8A 2QEOA 3BUMB 3D74A 1TUJA 1BT6A 3BUXB 1CLLA 2M49B 4ZCVA 1NIWA 3D78A 3OX6A 1LS8A 4ORCB 1MUXA 2F2OA 1OZSA 1S5GZ 2LMTA 1G33A 1S6CA 2LMUA 1DT7B 2KYCA 1YUUA 1DGUA 3R72A 4F7FA 4MN0A 4PHJA 5ER4X 1CB1A 1KQMC 2JT8A 5FYXA 2K7OA 4AOMA 4P2YB 2BKIB 5AFPA 5B8IB 3SIBA 2M7NA 2K7CA 1ALVA 3V2LA 1CNPA 1NCZA 4N1FA 1IQ3A 2LVJA 2QEHA 4DIRA 3NSLA 3WXAA 2D8NA 1IRJA 3CABA 2JTTA 2K2FA 4Q04A 4ETOA 1KSOA 3HCMA 1WDCC 2EHBA 4PHKA 2JXLA 4IJ7A 4PCWA 1FF1A 1JUOA 3CZ0A 1AUIB 1UHNA 2P6BB 3NSIA 1RECA 1K90D 3N7HA 1N2DA 2KNEA 2BL0B 3S0GA 2M8UA 1TTXA 1SCMB 3B6XA 3SG4A 1SSEB 2LE9B 1GJYA 2JQ6A 2Y1MA 3PATA 3B86A 1FI6A 3LLEA 1BJFA 2MBXA 3KHEA 1YVLA 1QVIY 2KSPA 3FIAA 1HT9A 1U5IA 5DKNA 2LLTA 2IS9A 3S0EA 4YGBB 2P70A 3DF0A 3NSOA 1C7WA 1KFUS 2OS8B 3PN7C 2F8PA 1BR4B 1BU3A 1ORGA 3I5GB 1LVCD 1EG4A 1PVAA 3CDNA 4USLA 2BCBA 2ZRSA 3D10A 4DS7A 1L2OB 1MHOA 1QATA 4UPGA 1ODBA 4M2QA 1WLZA 1CLBA 3VRQA 1LXFC 1UP5A 2LANA 1G4YR 1J1DA 2OTGC 1DTLA 4MEWA 2FJYA 4MBEA 3CR4X 4XJKA 4N5XA 2BE6A 1DELA 2PQLA 4PE4A 2KBMA 4I5LB 1OOIX 2AAOA 3BFBA 3LK1A 3AAKA 1XVJA 2QEBA 4YI8A 4C0JA 3EG5B 3L4AA 5HYDA 2KOTA 2MAZA 3BFHA 1EJ3A 1U5IB 2HETA 1XFRA 5I2QA 1OSAA 4YI9A 1X02A 3D0YB 1KWOC 2M1KB 2LP3A 3DF0B 1XFXO 3KO0A 5GQQC 2AUCA 3K21A 2FCEA 1L7ZA 3SG6A 2F33A 1MQ1A 4INXA 3R1PA 2KDHA 2KI6C 3IVTA 1YR5A 1E8AA 4MLWA 4E68A 1BF5A 1NX0A 2L0PA 2CXJA 1RK9A 3RLZA 5CSJA 3BUWB 1KK7Y 3PSRA 5CPVA 3OGNA 3PM8A 1A03A 4YGDB 3O2PA 4GGFC 4INWA 2BCAA 3BYAA 1DJGA 4XJKB 1BG1A 1EH2A 1TN4A 2AMIA 4A4CA 3RZSA 2Q4UA 3VGOA 1A29A 3DVKA 2LP2A 1XFWO 4PE0A 3CR2A 1C3ZA 1R2UA 4M2PA 5CSIA 1QS7A 5DICA 3QRXA 5HLOA 4HRGA 5KSZA 1PALA 1TNXA 3NSKA 5D7FA 1NX1A 1WRKA 3DY9A 3IQQA 3JTDB 1DC1A 3FE9A 3SG2A 3VROA 2QDIA 1OOGA 1RWYA 2CBLA 1QTXA 2COLB 1TOPA 2KI4B 3UO9A 1CDNA 1YURA 1NX3A 4PDZA 2WCFA 1D1OA 3ICBA 5HKYA 5I2OA 1J1EA 2SASA 5AANA 5I8NA 4I5KA 5AEQA 1SCMC 1AP4A 1KFXL 2M9GA 1NX2A 1QLKA 3R1OA 2F3ZA 2KI6D 2L51A 3F45A 1MR8A 1M31A 3JVTC 4CFRA 1WRLA 3OX5A 1SL8A 3SG3A 5D69A 1C07A 3I5FC 4GBAA 1C3YA 2KQYA 3NGVA 2BBNA 1GM0A 1W7JB 3CGAA 1CKKA 1J55A 5DKQA 4P5OE 5G08A 2BAPA 2LM5A 5J3XA 2MJWB 4MZKA 1NWDA 1F4QA 2K2AA 2OS8C 3DVMA 1IJ5A 1CTRA 1SCVA 4YGAA 2MLEC 4DUQA 2LVIA 3I5IB 2M97A 3A4UB 3SS5A 2L50A 4YBHB 3TUYC 1ZFSA 2K61A 2KGBC 1NYAA 1SW8A 2KPHA 1OW4A 1M45A 2LUCA 1SNLA 2NLNA 3D76A 4MRYA 5ER5A 4ZCUA 2SCPA 5PALA 1RTP1 1JSAA 5BPJA 1QASA 1SMGA 4ORAB 5HKZA 4JPZB 5FI7A 3E3RA 4QJ5B 2HQWA 2K60A 1K93D 1TWOA 3CYZA 1QVIZ 1FI5A 3L47A 1CM4A 2PMYA 2ZFDA 4WQ2A 1FBVA 1NPQA 2L4HA 1K95A 2MRDA 3MSEB 1QJTA 2KFFA 2HPSA 2LVVA 1IH0A 1PVBA 1TNPA 3DD4A 1W9ZA 1PULA 2L5XB 4QJ3B 4YGEB 1CFCA 1MXLC 1TCFA 2B1UA 2L98A 1SPYA 1SYMA 1XFUO 1Y1AA 2ZRTA 1OOFA 3C1VA 2LLSA 2GGMA 3D0YA 1LA3A 2KAXA 1K94A 1GGWA 2L2EA 4CFQA 2NZ0A 1H8BA 1HQVA 2E6WA 1IGVA 1YX8A 1KQVA 2G2BA 2P71A 1B8LA 1OMRA 5I2LA 1RFJA 2GV5A 1B9AA 1B47A 1JFJA 4GFTA 1KFUL 3TDUA 1NP8A 2KQ6A 1YUSA 3OB2B 1B1GA 1CFPA 1K9UA 3LK0A 1F55A 2I2RE 5KTYA 2KGRA 1KSMA 3R1VA 1YTZC 2QPTA 3H4SE 4GPLB 1CFDA 1N0YA 2M3WA 4F0ZB 1AJ5A 1TUZA 3JTDC 3NXAA 1OQPA 4WQ3A 1GGZA 3EKJA 1C7VA 3GK1A 2K0JA 1J7RA 4JQ0D 2Y5IA 3D73A 5CSNA 2KHNA 5TNCA 2Y4QA 4OVNF 3VRPA 2KI4C 1GQMA 3WHTB 3SS3A 3CZ2A 4QJ4B 1DVIA 3I5HB 1Y1XA 4GAOA 4N1GA 1VRKA 1ZACA 3LCPC 1BOCA 4BY5A 1KK7Z 1AVSA 1OOHA 1SBJA 1UUSA 2M29A 2WNDA 3BUOB 1WDCB 1DQEA 1NSHA 1CLMA 2LLUA 2Y1NA 2BBMA 3GOFA 1ZOTB 2GGZA 2O5GA 3O4YA 1Y1UA 2ERBA 1A75B 2DOQA 5JJGA 2LCPA 2O60A 2WCKA 1B7TY 3EK8A 1NUBA 3CLNA 2JNFA 3B87A 3BJHA 1YUTA 1QX7A 4C0LA 1YX7A 2L4IA 2JULA 4OCIA 4MRXA 3IQOA 2EC6B 2YGUA 3TZ1A 2WOSA 1SR6B 2FOTA 1F54A 4D1EA 1XK4A 3OHMB 3GK2A 3I5IC 3DZTA 1R6PA 2KFGA 2V53A 3EKHA 3FWBA 3SG5A 3QMEA 2OPOA 2G9BA 2FCDA 3PJIA 2JPTA 4GUKA 1S26D 4PALA 5KU1A 3BUNB 2H8VA 3FE6A 1QV1A 1XFZO 4MZJA 1WRZA 4GGNA 3CTNA 4NDBA 1SRAA 1T14A 2LAPA 1CFFA 1KCYA 2CNPA 1K8UA 2JPOA 1DJYA 4MSPA 4ORBB 4FQTA 5K89A 2WCMA 5HL1A 2KFHA 1SL9A 2BL0C 2LNKA 2MHHA 1OE9B 1PSRA 2LMVA 1YVHA 1NCXA 2EGDA 2VRGA 2ZNEA 3LL8B 3RM1A 2ISDA 2OTGB 2K7DA 1SKTA 2H61A 3B7AA 1J7PA 4OV2A 2KLEA 4AQJA 3KF9A 5AERA 3AKBA 5FI6A 3D75A 1UURA 1Z4HA 2WCBA 2FJUB 2M0RA 5F6TA 4BY4A 2I7AA 5JOLA 3BFAA 3L4LA 1UWOA 3PALA 1UHIA 1DGVA 3SJSA 1M46A 3I5GC 3EVRA 1RJVA 5D3OA 1N65A 2WORA 1DJZA 3OP0A 4TNCA 1L2OC 2WCHA 3A8RA 3S0FA 1J7OA 1S6JA 2Q91A 1ALWA 2LV7A 1YRTB 2JWWA 2M1UA 1QLSA 2MA2A 1IQ5A 3O4XA 1EXRA 2TN4A 2F3YA 3SG7A 3M0WA 2WC6A 3TDIA 1UHKA 2K8MB 3WNXB 2JZIA 1AJ4A 4YGCB 1F4OA 4JD9A 1FW4A 2KAYA 3BXKA 1JFKA 3FE8A 3BOWB 3B88A 4M2OA 1S5GY 3BQ3A 3DVJA 3GK4X 4JWQA 4PT1A 2L2CA 2RGIA 3I5HC 1A2XA 3TS5B 2ZNDA 3EVUA 1WY9A 1CDPA 3DXLA 1K2HA 1CDMA 1QIWA 4DCKA 1XYDA 1UHHA 4PHNA 2WCLA 3UNWA 2GTEA 3VB1A 1F8HA 4PE7A 4IL1A 1S1EA 2NCOA 2PALA 2PSRA 5HKWA 4GNKB 2JT0A 1W7IB 1G8IA 4A4BA 1Z2CB 2E30A 1J7QA 2CTNA 2A4JA 1IG5A 2I94A 1F70A 1KK8B 2BNXA 2NCPA 3D77A 3CS1A 1A75A 3HX4A 1K9KA 2JXCA 1MF8B 4NDCA 3VRRA 3DYEA 1ZUZA 2EC6C 2CT9A 2JRFA 1BR1B 1SR6C 4R1EA 2F2PA 3SS4A 1EL4A 2PVBA 3CZ1A 1OOJA 3JVTB 4U8DA 1Y6WA 3KPXA 3O78A 4FTGA 2KAVA 3PLFB 2ZKMX 4KYNA 3I5FB 1QIVA 1CM1A 1LA0A 1V1GA 1TNQA 4YRUA 1OZOA 4MVFA 2WC8A 3WHUB 1KQMB 5CSFA 2JU0A 1XA5A 4HREE 4DRWA 1CMFA 1SK6D 2JTZA 2HF5A 1B8RA 2LVKA 4WRIA 3CR5X 1DMOA 2JC2A
chains in the Genus database with same CATH topology
1DF0A 5HLVA 1IJ6A 4ICBA 1Q80A 2R2IA 1B7TZ 1PRWA 2JOJA 3PFVA 5AXIA 1LINA 4CLNA 1AHRA 1PK0D 3TUYB 3EK7A 3SIAA 2LHLA 4CIDA 1TCOB 3TDZA 2WCEA 1XFYO 4OR9B 1SL7A 1H4BA 1S36A 1DJIA 3FS7A 1NCYA 1S3PA 2QACA 1M39A 2ZN9A 2KYFA 2KBIA 4MZLA 1XK4C 1QX5B 1CMGA 3DVEA 4C0KA 1BODA 2PRUA 3FWCA 1JWDA 1XFVO 4NDDA 1QX2A 5IBWA 3OB1B 1TNWA 1JC2A 2M7LA 2LUXA 1DJXA 4I5JA 1FPWA 1Y0VH 1XO5A 2JT3A 2NXQA 1RROA 3ZWHA 1JBAA 2BCXA 1F71A 1AK8A 2ZN8A 1DF0B 1TRFA 4FQOA 4NQGA 3PN7B 4PHMA 2BKHB 3ZNIA 1K9PA 2MLFC 1MWNA 2H61C 1M63B 1IWQA 1OMVA 1TIZA 1B8CA 1BLQA 3AKAA 1BMOA 2I18A 1JF0A 1WLMA 3TS5C 1K96A 4XYNA 4OKHA 1EG3A 2LC5A 3KEVA 3IF7A 4GGFA 3BOWA 2LHIA 4HSZA 2PASA 4I5NB 3VRNA 1S6IA 1B4CA 1V1FA 1QV0A 2CCMA 1MXEA 1A4PA 1OMDA 2H2KA 2BECA 2JNXA 3CZTX 1JF2A 1KFXS 1IKUA 1CDLA 5DKRA 1YRUB 2K7BA 4CPVA 1LKJA 3CWGA 1QXPA 3O6BA 1PSBA 1ZMZA 4L9MA 4AQIA 3EK4A 2BE4A 3EVVA 4HRHA 1DJWA 1UHJA 3AAJA 1KWOB 4PE1A 1DJHA 1KK8C 1SY9A 2HQ8A 3BUMB 1BT6A 3BUXB 1CLLA 2M49B 4ZCVA 1NIWA 3OX6A 4ORCB 1MUXA 2F2OA 1OZSA 1S5GZ 2LMTA 1G33A 1S6CA 2LMUA 1DT7B 2KYCA 1YUUA 1DGUA 4MN0A 4PHJA 5ER4X 1CB1A 1KQMC 2JT8A 5FYXA 2K7OA 4AOMA 4P2YB 2BKIB 5AFPA 5B8IB 3SIBA 2M7NA 2K7CA 1ALVA 1CNPA 1NCZA 4N1FA 1IQ3A 2LVJA 4DIRA 3NSLA 3WXAA 2D8NA 1IRJA 4Q04A 2JTTA 2K2FA 4ETOA 1KSOA 3HCMA 1WDCC 2EHBA 4PHKA 2JXLA 1FF1A 4PCWA 1JUOA 1AUIB 1UHNA 2P6BB 3NSIA 1RECA 1K90D 1N2DA 2KNEA 2BL0B 2M8UA 1TTXA 1SCMB 3SG4A 2LE9B 3PATA 1GJYA 2JQ6A 2Y1MA 1FI6A 3LLEA 1BJFA 2MBXA 3KHEA 1YVLA 1QVIY 2KSPA 3FIAA 1HT9A 1U5IA 5DKNA 2LLTA 2IS9A 4YGBB 3DF0A 3NSOA 1C7WA 1KFUS 2OS8B 3PN7C 2F8PA 1BR4B 1BU3A 3I5GB 1LVCD 1EG4A 1PVAA 4USLA 2BCBA 2ZRSA 3D10A 4DS7A 1L2OB 1MHOA 1QATA 4UPGA 1ODBA 4M2QA 1WLZA 1CLBA 3VRQA 1LXFC 1UP5A 2LANA 1G4YR 1J1DA 2OTGC 1DTLA 4MEWA 4MBEA 3CR4X 4XJKA 4N5XA 2BE6A 4PE4A 2KBMA 4I5LB 2AAOA 3LK1A 3AAKA 1XVJA 4YI8A 4C0JA 5HYDA 2KOTA 2MAZA 1EJ3A 1U5IB 2HETA 5I2QA 1OSAA 4YI9A 1X02A 3D0YB 1KWOC 2M1KB 2LP3A 3DF0B 1XFXO 3KO0A 5GQQC 2AUCA 3K21A 2FCEA 1L7ZA 3SG6A 2F33A 1MQ1A 2KDHA 2KI6C 1YR5A 1E8AA 4MLWA 4E68A 1BF5A 1NX0A 2L0PA 2CXJA 1RK9A 3RLZA 5CSJA 3BUWB 1KK7Y 3PSRA 5CPVA 3PM8A 1A03A 4YGDB 3O2PA 4GGFC 2BCAA 3BYAA 1DJGA 4XJKB 1BG1A 1EH2A 1TN4A 2AMIA 4A4CA 2Q4UA 3VGOA 1A29A 3DVKA 2LP2A 1XFWO 4PE0A 3CR2A 1R2UA 4M2PA 5CSIA 1QS7A 5HLOA 3QRXA 4HRGA 5KSZA 1PALA 1TNXA 3NSKA 5D7FA 1NX1A 1WRKA 3IQQA 3JTDB 3SG2A 3VROA 1RWYA 2CBLA 1QTXA 2COLB 1TOPA 2KI4B 1CDNA 1YURA 1NX3A 4PDZA 2WCFA 1D1OA 3ICBA 5HKYA 5I2OA 1J1EA 2SASA 5AANA 5I8NA 4I5KA 5AEQA 1SCMC 1AP4A 1KFXL 2M9GA 1NX2A 1QLKA 2F3ZA 2KI6D 2L51A 3F45A 1MR8A 1M31A 3JVTC 4CFRA 1WRLA 3OX5A 1SL8A 3SG3A 5D69A 1C07A 3I5FC 4GBAA 2KQYA 2BBNA 1W7JB 3CGAA 1CKKA 1J55A 5DKQA 4P5OE 5G08A 2LM5A 5J3XA 2MJWB 4MZKA 1NWDA 1F4QA 2K2AA 2OS8C 3DVMA 1IJ5A 1CTRA 1SCVA 4YGAA 2MLEC 4DUQA 2LVIA 3I5IB 2M97A 3A4UB 2L50A 4YBHB 3TUYC 1ZFSA 2K61A 2KGBC 1NYAA 1SW8A 1M45A 2LUCA 1SNLA 2NLNA 4MRYA 5ER5A 5PALA 4ZCUA 2SCPA 5KU1A 1RTP1 1JSAA 5BPJA 1QASA 1SMGA 4ORAB 5HKZA 4JPZB 3E3RA 4QJ5B 2HQWA 1K93D 1QVIZ 1FI5A 1CM4A 2PMYA 2ZFDA 4WQ2A 1FBVA 1NPQA 2L4HA 1K95A 2MRDA 3MSEB 1QJTA 2KFFA 2HPSA 2LVVA 1IH0A 1PVBA 1TNPA 3DD4A 2L5XB 1PULA 4QJ3B 4YGEB 1CFCA 1MXLC 1TCFA 2B1UA 2L98A 1SPYA 1SYMA 1XFUO 1Y1AA 2ZRTA 3C1VA 2LLSA 2GGMA 3D0YA 1LA3A 2KAXA 1K94A 1GGWA 2L2EA 4CFQA 2NZ0A 1H8BA 1HQVA 2E6WA 1IGVA 1YX8A 1KQVA 2G2BA 5I2LA 1B8LA 1OMRA 1RFJA 2GV5A 1B9AA 1B47A 1JFJA 4GFTA 1KFUL 3TDUA 1NP8A 2KQ6A 1YUSA 3OB2B 1B1GA 1CFPA 1K9UA 3LK0A 1F55A 2I2RE 5KTYA 2KGRA 1KSMA 1YTZC 2QPTA 3H4SE 4GPLB 1CFDA 1N0YA 2M3WA 4F0ZB 1AJ5A 3JTDC 3NXAA 1OQPA 4WQ3A 1GGZA 3EKJA 1C7VA 3GK1A 2K0JA 1J7RA 4JQ0D 2Y5IA 5CSNA 5TNCA 2KHNA 2Y4QA 4OVNF 3VRPA 2KI4C 1GQMA 3WHTB 4QJ4B 1DVIA 3I5HB 1Y1XA 4GAOA 4N1GA 1VRKA 1ZACA 3LCPC 1BOCA 4BY5A 1KK7Z 1AVSA 1UUSA 1SBJA 2M29A 2WNDA 3BUOB 1WDCB 1NSHA 1CLMA 2LLUA 2Y1NA 2BBMA 3GOFA 1ZOTB 2GGZA 2O5GA 3O4YA 1Y1UA 3SG5A 1A75B 2DOQA 5JJGA 2LCPA 2O60A 1B7TY 3EK8A 1NUBA 3CLNA 2JNFA 1YUTA 1QX7A 4C0LA 1YX7A 2L4IA 2JULA 4OCIA 4MRXA 3IQOA 2EC6B 3TZ1A 2WOSA 1SR6B 2FOTA 1F54A 4D1EA 1XK4A 3OHMB 3GK2A 3I5IC 1R6PA 2KFGA 2V53A 3EKHA 3FWBA 2OPOA 2G9BA 2FCDA 4GUKA 2JPTA 1S26D 4PALA 3BUNB 1QV1A 1XFZO 4MZJA 1WRZA 4GGNA 3CTNA 4NDBA 1SRAA 2LAPA 1KCYA 1CFFA 2CNPA 1K8UA 1DJYA 4MSPA 4ORBB 5K89A 2KFHA 1SL9A 2BL0C 2LNKA 2MHHA 1OE9B 1PSRA 2LMVA 1YVHA 1NCXA 2EGDA 2VRGA 2ZNEA 3LL8B 3RM1A 2ISDA 2OTGB 2K7DA 1SKTA 2H61A 1J7PA 4OV2A 4AQJA 3KF9A 5AERA 3AKBA 1UURA 2WCBA 2FJUB 2M0RA 5F6TA 4BY4A 2I7AA 5JOLA 1UWOA 3PALA 1UHIA 1DGVA 3SJSA 1M46A 3I5GC 3EVRA 1RJVA 1N65A 2WORA 1DJZA 3OP0A 4TNCA 1L2OC 3A8RA 1J7OA 1S6JA 2Q91A 1ALWA 2LV7A 1YRTB 2JWWA 2M1UA 1QLSA 2MA2A 1IQ5A 1EXRA 2TN4A 2F3YA 3SG7A 3M0WA 3TDIA 1UHKA 2K8MB 3WNXB 2JZIA 1AJ4A 4YGCB 1F4OA 1FW4A 2KAYA 3BXKA 1JFKA 3BOWB 4M2OA 1S5GY 3BQ3A 3DVJA 3GK4X 4JWQA 2RGIA 3I5HC 1A2XA 3TS5B 2ZNDA 3EVUA 1WY9A 1CDPA 1K2HA 1CDMA 1QIWA 4DCKA 1XYDA 1UHHA 4PHNA 1F8HA 4PE7A 4IL1A 1S1EA 2NCOA 2PALA 2PSRA 5HKWA 4GNKB 2JT0A 1W7IB 1G8IA 4A4BA 2E30A 1J7QA 2CTNA 2A4JA 1IG5A 2I94A 1F70A 1KK8B 2NCPA 3HX4A 4NDCA 3CS1A 1A75A 3VRRA 1K9KA 2JXCA 1MF8B 1ZUZA 2EC6C 2CT9A 2JRFA 1BR1B 1SR6C 4R1EA 2F2PA 1EL4A 2PVBA 1OOJA 3JVTB 4U8DA 1Y6WA 3KPXA 3O78A 4FTGA 2KAVA 3PLFB 2ZKMX 3I5FB 1QIVA 1CM1A 1LA0A 1V1GA 1TNQA 4YRUA 1OZOA 4MVFA 2WC8A 3WHUB 1KQMB 5CSFA 2JU0A 1XA5A 4HREE 4DRWA 1CMFA 1SK6D 2JTZA 2HF5A 1B8RA 2LVKA 4WRIA 3CR5X 1DMOA 2JC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF0 A;  5HLV A;  1IJ6 A;  4ICB A;  1Q80 A;  2R2I A;  1B7T Z;  1PRW A;  2JOJ A;  3PFV A;  5AXI A;  1LIN A;  4CLN A;  1AHR A;  1PK0 D;  3TUY B;  3EK7 A;  3SIA A;  2LHL A;  4CID A;  1TCO B;  3TDZ A;  2WCE A;  1XFY O;  4OR9 B;  1SL7 A;  1H4B A;  1S36 A;  1DJI A;  3FS7 A;  1NCY A;  1S3P A;  2QAC A;  1M39 A;  2ZN9 A;  2KYF A;  2KBI A;  4MZL A;  1XK4 C;  1QX5 B;  1CMG A;  3DVE A;  4C0K A;  1BOD A;  2PRU A;  3FWC A;  1JWD A;  1XFV O;  4NDD A;  1QX2 A;  5IBW A;  3OB1 B;  1TNW A;  1JC2 A;  2M7L A;  2LUX A;  1DJX A;  4I5J A;  1FPW A;  1Y0V H;  1XO5 A;  2JT3 A;  2NXQ A;  1RRO A;  3ZWH A;  1JBA A;  2BCX A;  1F71 A;  1AK8 A;  2ZN8 A;  1DF0 B;  1TRF A;  4FQO A;  4NQG A;  3PN7 B;  4PHM A;  2BKH B;  3ZNI A;  1K9P A;  2MLF C;  1MWN A;  2H61 C;  1M63 B;  1IWQ A;  1OMV A;  1TIZ A;  1B8C A;  1BLQ A;  3AKA A;  1BMO A;  2I18 A;  1JF0 A;  1WLM A;  3TS5 C;  1K96 A;  4XYN A;  4OKH A;  1EG3 A;  2LC5 A;  3KEV A;  3IF7 A;  4GGF A;  3BOW A;  2LHI A;  4HSZ A;  2PAS A;  4I5N B;  3VRN A;  1S6I A;  1B4C A;  1V1F A;  1QV0 A;  2CCM A;  1MXE A;  1A4P A;  1OMD A;  2H2K A;  2BEC A;  2JNX A;  3CZT X;  1JF2 A;  1KFX S;  1IKU A;  1CDL A;  5DKR A;  1YRU B;  2K7B A;  4CPV A;  1LKJ A;  3CWG A;  1QXP A;  3O6B A;  1PSB A;  1ZMZ A;  4L9M A;  4AQI A;  3EK4 A;  2BE4 A;  3EVV A;  4HRH A;  1DJW A;  1UHJ A;  3AAJ A;  1KWO B;  4PE1 A;  1DJH A;  1KK8 C;  1SY9 A;  2HQ8 A;  3BUM B;  1BT6 A;  3BUX B;  1CLL A;  2M49 B;  4ZCV A;  1NIW A;  3OX6 A;  4ORC B;  1MUX A;  2F2O A;  1OZS A;  1S5G Z;  2LMT A;  1G33 A;  1S6C A;  2LMU A;  1DT7 B;  2KYC A;  1YUU A;  1DGU A;  4MN0 A;  4PHJ A;  5ER4 X;  1CB1 A;  1KQM C;  2JT8 A;  5FYX A;  2K7O A;  4AOM A;  4P2Y B;  2BKI B;  5AFP A;  5B8I B;  3SIB A;  2M7N A;  2K7C A;  1ALV A;  1CNP A;  1NCZ A;  4N1F A;  1IQ3 A;  2LVJ A;  4DIR A;  3NSL A;  3WXA A;  2D8N A;  1IRJ A;  4Q04 A;  2JTT A;  2K2F A;  4ETO A;  1KSO A;  3HCM A;  1WDC C;  2EHB A;  4PHK A;  2JXL A;  1FF1 A;  4PCW A;  1JUO A;  1AUI B;  1UHN A;  2P6B B;  3NSI A;  1REC A;  1K90 D;  1N2D A;  2KNE A;  2BL0 B;  2M8U A;  1TTX A;  1SCM B;  3SG4 A;  2LE9 B;  3PAT A;  1GJY A;  2JQ6 A;  2Y1M A;  1FI6 A;  3LLE A;  1BJF A;  2MBX A;  3KHE A;  1YVL A;  1QVI Y;  2KSP A;  3FIA A;  1HT9 A;  1U5I A;  5DKN A;  2LLT A;  2IS9 A;  4YGB B;  3DF0 A;  3NSO A;  1C7W A;  1KFU S;  2OS8 B;  3PN7 C;  2F8P A;  1BR4 B;  1BU3 A;  3I5G B;  1LVC D;  1EG4 A;  1PVA A;  4USL A;  2BCB A;  2ZRS A;  3D10 A;  4DS7 A;  1L2O B;  1MHO A;  1QAT A;  4UPG A;  1ODB A;  4M2Q A;  1WLZ A;  1CLB A;  3VRQ A;  1LXF C;  1UP5 A;  2LAN A;  1G4Y R;  1J1D A;  2OTG C;  1DTL A;  4MEW A;  4MBE A;  3CR4 X;  4XJK A;  4N5X A;  2BE6 A;  4PE4 A;  2KBM A;  4I5L B;  2AAO A;  3LK1 A;  3AAK A;  1XVJ A;  4YI8 A;  4C0J A;  5HYD A;  2KOT A;  2MAZ A;  1EJ3 A;  1U5I B;  2HET A;  5I2Q A;  1OSA A;  4YI9 A;  1X02 A;  3D0Y B;  1KWO C;  2M1K B;  2LP3 A;  3DF0 B;  1XFX O;  3KO0 A;  5GQQ C;  2AUC A;  3K21 A;  2FCE A;  1L7Z A;  3SG6 A;  2F33 A;  1MQ1 A;  2KDH A;  2KI6 C;  1YR5 A;  1E8A A;  4MLW A;  4E68 A;  1BF5 A;  1NX0 A;  2L0P A;  2CXJ A;  1RK9 A;  3RLZ A;  5CSJ A;  3BUW B;  1KK7 Y;  3PSR A;  5CPV A;  3PM8 A;  1A03 A;  4YGD B;  3O2P A;  4GGF C;  2BCA A;  3BYA A;  1DJG A;  4XJK B;  1BG1 A;  1EH2 A;  1TN4 A;  2AMI A;  4A4C A;  2Q4U A;  3VGO A;  1A29 A;  3DVK A;  2LP2 A;  1XFW O;  4PE0 A;  3CR2 A;  1R2U A;  4M2P A;  5CSI A;  1QS7 A;  5HLO A;  3QRX A;  4HRG A;  5KSZ A;  1PAL A;  1TNX A;  3NSK A;  5D7F A;  1NX1 A;  1WRK A;  3IQQ A;  3JTD B;  3SG2 A;  3VRO A;  1RWY A;  2CBL A;  1QTX A;  2COL B;  1TOP A;  2KI4 B;  1CDN A;  1YUR A;  1NX3 A;  4PDZ A;  2WCF A;  1D1O A;  3ICB A;  5HKY A;  5I2O A;  1J1E A;  2SAS A;  5AAN A;  5I8N A;  4I5K A;  5AEQ A;  1SCM C;  1AP4 A;  1KFX L;  2M9G A;  1NX2 A;  1QLK A;  2F3Z A;  2KI6 D;  2L51 A;  3F45 A;  1MR8 A;  1M31 A;  3JVT C;  4CFR A;  1WRL A;  3OX5 A;  1SL8 A;  3SG3 A;  5D69 A;  1C07 A;  3I5F C;  4GBA A;  2KQY A;  2BBN A;  1W7J B;  3CGA A;  1CKK A;  1J55 A;  5DKQ A;  4P5O E;  5G08 A;  2LM5 A;  5J3X A;  2MJW B;  4MZK A;  1NWD A;  1F4Q A;  2K2A A;  2OS8 C;  3DVM A;  1IJ5 A;  1CTR A;  1SCV A;  4YGA A;  2MLE C;  4DUQ A;  2LVI A;  3I5I B;  2M97 A;  3A4U B;  2L50 A;  4YBH B;  3TUY C;  1ZFS A;  2K61 A;  2KGB C;  1NYA A;  1SW8 A;  1M45 A;  2LUC A;  1SNL A;  2NLN A;  4MRY A;  5ER5 A;  5PAL A;  4ZCU A;  2SCP A;  5KU1 A;  1RTP 1;  1JSA A;  5BPJ A;  1QAS A;  1SMG A;  4ORA B;  5HKZ A;  4JPZ B;  3E3R A;  4QJ5 B;  2HQW A;  1K93 D;  1QVI Z;  1FI5 A;  1CM4 A;  2PMY A;  2ZFD A;  4WQ2 A;  1FBV A;  1NPQ A;  2L4H A;  1K95 A;  2MRD A;  3MSE B;  1QJT A;  2KFF A;  2HPS A;  2LVV A;  1IH0 A;  1PVB A;  1TNP A;  3DD4 A;  2L5X B;  1PUL A;  4QJ3 B;  4YGE B;  1CFC A;  1MXL C;  1TCF A;  2B1U A;  2L98 A;  1SPY A;  1SYM A;  1XFU O;  1Y1A A;  2ZRT A;  3C1V A;  2LLS A;  2GGM A;  3D0Y A;  1LA3 A;  2KAX A;  1K94 A;  1GGW A;  2L2E A;  4CFQ A;  2NZ0 A;  1H8B A;  1HQV A;  2E6W A;  1IGV A;  1YX8 A;  1KQV A;  2G2B A;  5I2L A;  1B8L A;  1OMR A;  1RFJ A;  2GV5 A;  1B9A A;  1B47 A;  1JFJ A;  4GFT A;  1KFU L;  3TDU A;  1NP8 A;  2KQ6 A;  1YUS A;  3OB2 B;  1B1G A;  1CFP A;  1K9U A;  3LK0 A;  1F55 A;  2I2R E;  5KTY A;  2KGR A;  1KSM A;  1YTZ C;  2QPT A;  3H4S E;  4GPL B;  1CFD A;  1N0Y A;  2M3W A;  4F0Z B;  1AJ5 A;  3JTD C;  3NXA A;  1OQP A;  4WQ3 A;  1GGZ A;  3EKJ A;  1C7V A;  3GK1 A;  2K0J A;  1J7R A;  4JQ0 D;  2Y5I A;  5CSN A;  5TNC A;  2KHN A;  2Y4Q A;  4OVN F;  3VRP A;  2KI4 C;  1GQM A;  3WHT B;  4QJ4 B;  1DVI A;  3I5H B;  1Y1X A;  4GAO A;  4N1G A;  1VRK A;  1ZAC A;  3LCP C;  1BOC A;  4BY5 A;  1KK7 Z;  1AVS A;  1UUS A;  1SBJ A;  2M29 A;  2WND A;  3BUO B;  1WDC B;  1NSH A;  1CLM A;  2LLU A;  2Y1N A;  2BBM A;  3GOF A;  1ZOT B;  2GGZ A;  2O5G A;  3O4Y A;  1Y1U A;  3SG5 A;  1A75 B;  2DOQ A;  5JJG A;  2LCP A;  2O60 A;  1B7T Y;  3EK8 A;  1NUB A;  3CLN A;  2JNF A;  1YUT A;  1QX7 A;  4C0L A;  1YX7 A;  2L4I A;  2JUL A;  4OCI A;  4MRX A;  3IQO A;  2EC6 B;  3TZ1 A;  2WOS A;  1SR6 B;  2FOT A;  1F54 A;  4D1E A;  1XK4 A;  3OHM B;  3GK2 A;  3I5I C;  1R6P A;  2KFG A;  2V53 A;  3EKH A;  3FWB A;  2OPO A;  2G9B A;  2FCD A;  4GUK A;  2JPT A;  1S26 D;  4PAL A;  3BUN B;  1QV1 A;  1XFZ O;  4MZJ A;  1WRZ A;  4GGN A;  3CTN A;  4NDB A;  1SRA A;  2LAP A;  1KCY A;  1CFF A;  2CNP A;  1K8U A;  1DJY A;  4MSP A;  4ORB B;  5K89 A;  2KFH A;  1SL9 A;  2BL0 C;  2LNK A;  2MHH A;  1OE9 B;  1PSR A;  2LMV A;  1YVH A;  1NCX A;  2EGD A;  2VRG A;  2ZNE A;  3LL8 B;  3RM1 A;  2ISD A;  2OTG B;  2K7D A;  1SKT A;  2H61 A;  1J7P A;  4OV2 A;  4AQJ A;  3KF9 A;  5AER A;  3AKB A;  1UUR A;  2WCB A;  2FJU B;  2M0R A;  5F6T A;  4BY4 A;  2I7A A;  5JOL A;  1UWO A;  3PAL A;  1UHI A;  1DGV A;  3SJS A;  1M46 A;  3I5G C;  3EVR A;  1RJV A;  1N65 A;  2WOR A;  1DJZ A;  3OP0 A;  4TNC A;  1L2O C;  3A8R A;  1J7O A;  1S6J A;  2Q91 A;  1ALW A;  2LV7 A;  1YRT B;  2JWW A;  2M1U A;  1QLS A;  2MA2 A;  1IQ5 A;  1EXR A;  2TN4 A;  2F3Y A;  3SG7 A;  3M0W A;  3TDI A;  1UHK A;  2K8M B;  3WNX B;  2JZI A;  1AJ4 A;  4YGC B;  1F4O A;  1FW4 A;  2KAY A;  3BXK A;  1JFK A;  3BOW B;  4M2O A;  1S5G Y;  3BQ3 A;  3DVJ A;  3GK4 X;  4JWQ A;  2RGI A;  3I5H C;  1A2X A;  3TS5 B;  2ZND A;  3EVU A;  1WY9 A;  1CDP A;  1K2H A;  1CDM A;  1QIW A;  4DCK A;  1XYD A;  1UHH A;  4PHN A;  1F8H A;  4PE7 A;  4IL1 A;  1S1E A;  2NCO A;  2PAL A;  2PSR A;  5HKW A;  4GNK B;  2JT0 A;  1W7I B;  1G8I A;  4A4B A;  2E30 A;  1J7Q A;  2CTN A;  2A4J A;  1IG5 A;  2I94 A;  1F70 A;  1KK8 B;  2NCP A;  3HX4 A;  4NDC A;  3CS1 A;  1A75 A;  3VRR A;  1K9K A;  2JXC A;  1MF8 B;  1ZUZ A;  2EC6 C;  2CT9 A;  2JRF A;  1BR1 B;  1SR6 C;  4R1E A;  2F2P A;  1EL4 A;  2PVB A;  1OOJ A;  3JVT B;  4U8D A;  1Y6W A;  3KPX A;  3O78 A;  4FTG A;  2KAV A;  3PLF B;  2ZKM X;  3I5F B;  1QIV A;  1CM1 A;  1LA0 A;  1V1G A;  1TNQ A;  4YRU A;  1OZO A;  4MVF A;  2WC8 A;  3WHU B;  1KQM B;  5CSF A;  2JU0 A;  1XA5 A;  4HRE E;  4DRW A;  1CMF A;  1SK6 D;  2JTZ A;  2HF5 A;  1B8R A;  2LVK A;  4WRI A;  3CR5 X;  1DMO A;  2JC2 A; 
#chains in the Genus database with same CATH topology
 1DF0 A;  5HLV A;  1IJ6 A;  4ICB A;  1Q80 A;  2R2I A;  1B7T Z;  1PRW A;  2JOJ A;  3PFV A;  5AXI A;  1LIN A;  4CLN A;  1AHR A;  1PK0 D;  3TUY B;  3EK7 A;  3SIA A;  2LHL A;  4OZD A;  4CID A;  1TCO B;  3TDZ A;  2WCE A;  1XFY O;  1DEK A;  4OR9 B;  1SL7 A;  1H4B A;  1S36 A;  1DJI A;  3FS7 A;  2PYQ A;  1NCY A;  1S3P A;  2QAC A;  1M39 A;  2ZN9 A;  2KYF A;  2KBI A;  4MZL A;  1XK4 C;  1QX5 B;  3S0D A;  1CMG A;  3DVE A;  4C0K A;  1BOD A;  2PRU A;  3FWC A;  1JWD A;  1XFV O;  4NDD A;  1QX2 A;  3NHI A;  5IBW A;  2L5Y A;  3OB1 B;  1TNW A;  1JC2 A;  3PM2 A;  2M7L A;  2LUX A;  1DJX A;  4I5J A;  1FPW A;  1Y0V H;  1XO5 A;  2JT3 A;  2NXQ A;  2WCJ A;  1RRO A;  1P28 A;  3ZWH A;  1JBA A;  2BCX A;  3K1E A;  1F71 A;  1AK8 A;  2ZN8 A;  1DF0 B;  3NHT A;  1TRF A;  4FQO A;  1IIO A;  2KLD A;  4NQG A;  3PN7 B;  4PHM A;  2BKH B;  1QWV A;  3ZNI A;  5I94 A;  1K9P A;  2MLF C;  1MWN A;  2H61 C;  1M63 B;  1IWQ A;  1OMV A;  1TIZ A;  1B8C A;  3S0A A;  1BLQ A;  3AKA A;  4JKT A;  1BMO A;  2I18 A;  1JF0 A;  3OBV A;  1WLM A;  3TS5 C;  1K96 A;  4XYN A;  4OKH A;  1EG3 A;  2LC5 A;  3KEV A;  3IF7 A;  4GGF A;  3BOW A;  2LHI A;  4HSZ A;  2PAS A;  4I5N B;  3VRN A;  1S6I A;  1B4C A;  1V1F A;  1QV0 A;  2CCM A;  1MXE A;  1A4P A;  1OMD A;  2H2K A;  2BEC A;  2JNX A;  3CZT X;  1JF2 A;  1KFX S;  3Q8I A;  2QEV A;  2WC5 A;  3S0B A;  1IKU A;  1CDL A;  5DKR A;  1YRU B;  2K7B A;  4CPV A;  1LKJ A;  3CWG A;  1QXP A;  3O6B A;  1PSB A;  1ZMZ A;  4L9M A;  4AQI A;  3EK4 A;  5FI2 A;  2BE4 A;  3EVV A;  4HRH A;  1DJW A;  1UHJ A;  5EL2 A;  3AAJ A;  1KWO B;  4PE1 A;  1DJH A;  1KK8 C;  1SY9 A;  2HQ8 A;  2QEO A;  3BUM B;  3D74 A;  1TUJ A;  1BT6 A;  3BUX B;  1CLL A;  2M49 B;  4ZCV A;  1NIW A;  3D78 A;  3OX6 A;  1LS8 A;  4ORC B;  1MUX A;  2F2O A;  1OZS A;  1S5G Z;  2LMT A;  1G33 A;  1S6C A;  2LMU A;  1DT7 B;  2KYC A;  1YUU A;  1DGU A;  3R72 A;  4F7F A;  4MN0 A;  4PHJ A;  5ER4 X;  1CB1 A;  1KQM C;  2JT8 A;  5FYX A;  2K7O A;  4AOM A;  4P2Y B;  2BKI B;  5AFP A;  5B8I B;  3SIB A;  2M7N A;  2K7C A;  1ALV A;  3V2L A;  1CNP A;  1NCZ A;  4N1F A;  1IQ3 A;  2LVJ A;  2QEH A;  4DIR A;  3NSL A;  3WXA A;  2D8N A;  1IRJ A;  3CAB A;  2JTT A;  2K2F A;  4Q04 A;  4ETO A;  1KSO A;  3HCM A;  1WDC C;  2EHB A;  4PHK A;  2JXL A;  4IJ7 A;  4PCW A;  1FF1 A;  1JUO A;  3CZ0 A;  1AUI B;  1UHN A;  2P6B B;  3NSI A;  1REC A;  1K90 D;  3N7H A;  1N2D A;  2KNE A;  2BL0 B;  3S0G A;  2M8U A;  1TTX A;  1SCM B;  3B6X A;  3SG4 A;  1SSE B;  2LE9 B;  1GJY A;  2JQ6 A;  2Y1M A;  3PAT A;  3B86 A;  1FI6 A;  3LLE A;  1BJF A;  2MBX A;  3KHE A;  1YVL A;  1QVI Y;  2KSP A;  3FIA A;  1HT9 A;  1U5I A;  5DKN A;  2LLT A;  2IS9 A;  3S0E A;  4YGB B;  2P70 A;  3DF0 A;  3NSO A;  1C7W A;  1KFU S;  2OS8 B;  3PN7 C;  2F8P A;  1BR4 B;  1BU3 A;  1ORG A;  3I5G B;  1LVC D;  1EG4 A;  1PVA A;  3CDN A;  4USL A;  2BCB A;  2ZRS A;  3D10 A;  4DS7 A;  1L2O B;  1MHO A;  1QAT A;  4UPG A;  1ODB A;  4M2Q A;  1WLZ A;  1CLB A;  3VRQ A;  1LXF C;  1UP5 A;  2LAN A;  1G4Y R;  1J1D A;  2OTG C;  1DTL A;  4MEW A;  2FJY A;  4MBE A;  3CR4 X;  4XJK A;  4N5X A;  2BE6 A;  1DEL A;  2PQL A;  4PE4 A;  2KBM A;  4I5L B;  1OOI X;  2AAO A;  3BFB A;  3LK1 A;  3AAK A;  1XVJ A;  2QEB A;  4YI8 A;  4C0J A;  3EG5 B;  3L4A A;  5HYD A;  2KOT A;  2MAZ A;  3BFH A;  1EJ3 A;  1U5I B;  2HET A;  1XFR A;  5I2Q A;  1OSA A;  4YI9 A;  1X02 A;  3D0Y B;  1KWO C;  2M1K B;  2LP3 A;  3DF0 B;  1XFX O;  3KO0 A;  5GQQ C;  2AUC A;  3K21 A;  2FCE A;  1L7Z A;  3SG6 A;  2F33 A;  1MQ1 A;  4INX A;  3R1P A;  2KDH A;  2KI6 C;  3IVT A;  1YR5 A;  1E8A A;  4MLW A;  4E68 A;  1BF5 A;  1NX0 A;  2L0P A;  2CXJ A;  1RK9 A;  3RLZ A;  5CSJ A;  3BUW B;  1KK7 Y;  3PSR A;  5CPV A;  3OGN A;  3PM8 A;  1A03 A;  4YGD B;  3O2P A;  4GGF C;  4INW A;  2BCA A;  3BYA A;  1DJG A;  4XJK B;  1BG1 A;  1EH2 A;  1TN4 A;  2AMI A;  4A4C A;  3RZS A;  2Q4U A;  3VGO A;  1A29 A;  3DVK A;  2LP2 A;  1XFW O;  4PE0 A;  3CR2 A;  1C3Z A;  1R2U A;  4M2P A;  5CSI A;  1QS7 A;  5DIC A;  3QRX A;  5HLO A;  4HRG A;  5KSZ A;  1PAL A;  1TNX A;  3NSK A;  5D7F A;  1NX1 A;  1WRK A;  3DY9 A;  3IQQ A;  3JTD B;  1DC1 A;  3FE9 A;  3SG2 A;  3VRO A;  2QDI A;  1OOG A;  1RWY A;  2CBL A;  1QTX A;  2COL B;  1TOP A;  2KI4 B;  3UO9 A;  1CDN A;  1YUR A;  1NX3 A;  4PDZ A;  2WCF A;  1D1O A;  3ICB A;  5HKY A;  5I2O A;  1J1E A;  2SAS A;  5AAN A;  5I8N A;  4I5K A;  5AEQ A;  1SCM C;  1AP4 A;  1KFX L;  2M9G A;  1NX2 A;  1QLK A;  3R1O A;  2F3Z A;  2KI6 D;  2L51 A;  3F45 A;  1MR8 A;  1M31 A;  3JVT C;  4CFR A;  1WRL A;  3OX5 A;  1SL8 A;  3SG3 A;  5D69 A;  1C07 A;  3I5F C;  4GBA A;  1C3Y A;  2KQY A;  3NGV A;  2BBN A;  1GM0 A;  1W7J B;  3CGA A;  1CKK A;  1J55 A;  5DKQ A;  4P5O E;  5G08 A;  2BAP A;  2LM5 A;  5J3X A;  2MJW B;  4MZK A;  1NWD A;  1F4Q A;  2K2A A;  2OS8 C;  3DVM A;  1IJ5 A;  1CTR A;  1SCV A;  4YGA A;  2MLE C;  4DUQ A;  2LVI A;  3I5I B;  2M97 A;  3A4U B;  3SS5 A;  2L50 A;  4YBH B;  3TUY C;  1ZFS A;  2K61 A;  2KGB C;  1NYA A;  1SW8 A;  2KPH A;  1OW4 A;  1M45 A;  2LUC A;  1SNL A;  2NLN A;  3D76 A;  4MRY A;  5ER5 A;  4ZCU A;  2SCP A;  5PAL A;  1RTP 1;  1JSA A;  5BPJ A;  1QAS A;  1SMG A;  4ORA B;  5HKZ A;  4JPZ B;  5FI7 A;  3E3R A;  4QJ5 B;  2HQW A;  2K60 A;  1K93 D;  1TWO A;  3CYZ A;  1QVI Z;  1FI5 A;  3L47 A;  1CM4 A;  2PMY A;  2ZFD A;  4WQ2 A;  1FBV A;  1NPQ A;  2L4H A;  1K95 A;  2MRD A;  3MSE B;  1QJT A;  2KFF A;  2HPS A;  2LVV A;  1IH0 A;  1PVB A;  1TNP A;  3DD4 A;  1W9Z A;  1PUL A;  2L5X B;  4QJ3 B;  4YGE B;  1CFC A;  1MXL C;  1TCF A;  2B1U A;  2L98 A;  1SPY A;  1SYM A;  1XFU O;  1Y1A A;  2ZRT A;  1OOF A;  3C1V A;  2LLS A;  2GGM A;  3D0Y A;  1LA3 A;  2KAX A;  1K94 A;  1GGW A;  2L2E A;  4CFQ A;  2NZ0 A;  1H8B A;  1HQV A;  2E6W A;  1IGV A;  1YX8 A;  1KQV A;  2G2B A;  2P71 A;  1B8L A;  1OMR A;  5I2L A;  1RFJ A;  2GV5 A;  1B9A A;  1B47 A;  1JFJ A;  4GFT A;  1KFU L;  3TDU A;  1NP8 A;  2KQ6 A;  1YUS A;  3OB2 B;  1B1G A;  1CFP A;  1K9U A;  3LK0 A;  1F55 A;  2I2R E;  5KTY A;  2KGR A;  1KSM A;  3R1V A;  1YTZ C;  2QPT A;  3H4S E;  4GPL B;  1CFD A;  1N0Y A;  2M3W A;  4F0Z B;  1AJ5 A;  1TUZ A;  3JTD C;  3NXA A;  1OQP A;  4WQ3 A;  1GGZ A;  3EKJ A;  1C7V A;  3GK1 A;  2K0J A;  1J7R A;  4JQ0 D;  2Y5I A;  3D73 A;  5CSN A;  2KHN A;  5TNC A;  2Y4Q A;  4OVN F;  3VRP A;  2KI4 C;  1GQM A;  3WHT B;  3SS3 A;  3CZ2 A;  4QJ4 B;  1DVI A;  3I5H B;  1Y1X A;  4GAO A;  4N1G A;  1VRK A;  1ZAC A;  3LCP C;  1BOC A;  4BY5 A;  1KK7 Z;  1AVS A;  1OOH A;  1SBJ A;  1UUS A;  2M29 A;  2WND A;  3BUO B;  1WDC B;  1DQE A;  1NSH A;  1CLM A;  2LLU A;  2Y1N A;  2BBM A;  3GOF A;  1ZOT B;  2GGZ A;  2O5G A;  3O4Y A;  1Y1U A;  2ERB A;  1A75 B;  2DOQ A;  5JJG A;  2LCP A;  2O60 A;  2WCK A;  1B7T Y;  3EK8 A;  1NUB A;  3CLN A;  2JNF A;  3B87 A;  3BJH A;  1YUT A;  1QX7 A;  4C0L A;  1YX7 A;  2L4I A;  2JUL A;  4OCI A;  4MRX A;  3IQO A;  2EC6 B;  2YGU A;  3TZ1 A;  2WOS A;  1SR6 B;  2FOT A;  1F54 A;  4D1E A;  1XK4 A;  3OHM B;  3GK2 A;  3I5I C;  3DZT A;  1R6P A;  2KFG A;  2V53 A;  3EKH A;  3FWB A;  3SG5 A;  3QME A;  2OPO A;  2G9B A;  2FCD A;  3PJI A;  2JPT A;  4GUK A;  1S26 D;  4PAL A;  5KU1 A;  3BUN B;  2H8V A;  3FE6 A;  1QV1 A;  1XFZ O;  4MZJ A;  1WRZ A;  4GGN A;  3CTN A;  4NDB A;  1SRA A;  1T14 A;  2LAP A;  1CFF A;  1KCY A;  2CNP A;  1K8U A;  2JPO A;  1DJY A;  4MSP A;  4ORB B;  4FQT A;  5K89 A;  2WCM A;  5HL1 A;  2KFH A;  1SL9 A;  2BL0 C;  2LNK A;  2MHH A;  1OE9 B;  1PSR A;  2LMV A;  1YVH A;  1NCX A;  2EGD A;  2VRG A;  2ZNE A;  3LL8 B;  3RM1 A;  2ISD A;  2OTG B;  2K7D A;  1SKT A;  2H61 A;  3B7A A;  1J7P A;  4OV2 A;  2KLE A;  4AQJ A;  3KF9 A;  5AER A;  3AKB A;  5FI6 A;  3D75 A;  1UUR A;  1Z4H A;  2WCB A;  2FJU B;  2M0R A;  5F6T A;  4BY4 A;  2I7A A;  5JOL A;  3BFA A;  3L4L A;  1UWO A;  3PAL A;  1UHI A;  1DGV A;  3SJS A;  1M46 A;  3I5G C;  3EVR A;  1RJV A;  5D3O A;  1N65 A;  2WOR A;  1DJZ A;  3OP0 A;  4TNC A;  1L2O C;  2WCH A;  3A8R A;  3S0F A;  1J7O A;  1S6J A;  2Q91 A;  1ALW A;  2LV7 A;  1YRT B;  2JWW A;  2M1U A;  1QLS A;  2MA2 A;  1IQ5 A;  3O4X A;  1EXR A;  2TN4 A;  2F3Y A;  3SG7 A;  3M0W A;  2WC6 A;  3TDI A;  1UHK A;  2K8M B;  3WNX B;  2JZI A;  1AJ4 A;  4YGC B;  1F4O A;  4JD9 A;  1FW4 A;  2KAY A;  3BXK A;  1JFK A;  3FE8 A;  3BOW B;  3B88 A;  4M2O A;  1S5G Y;  3BQ3 A;  3DVJ A;  3GK4 X;  4JWQ A;  4PT1 A;  2L2C A;  2RGI A;  3I5H C;  1A2X A;  3TS5 B;  2ZND A;  3EVU A;  1WY9 A;  1CDP A;  3DXL A;  1K2H A;  1CDM A;  1QIW A;  4DCK A;  1XYD A;  1UHH A;  4PHN A;  2WCL A;  3UNW A;  2GTE A;  3VB1 A;  1F8H A;  4PE7 A;  4IL1 A;  1S1E A;  2NCO A;  2PAL A;  2PSR A;  5HKW A;  4GNK B;  2JT0 A;  1W7I B;  1G8I A;  4A4B A;  1Z2C B;  2E30 A;  1J7Q A;  2CTN A;  2A4J A;  1IG5 A;  2I94 A;  1F70 A;  1KK8 B;  2BNX A;  2NCP A;  3D77 A;  3CS1 A;  1A75 A;  3HX4 A;  1K9K A;  2JXC A;  1MF8 B;  4NDC A;  3VRR A;  3DYE A;  1ZUZ A;  2EC6 C;  2CT9 A;  2JRF A;  1BR1 B;  1SR6 C;  4R1E A;  2F2P A;  3SS4 A;  1EL4 A;  2PVB A;  3CZ1 A;  1OOJ A;  3JVT B;  4U8D A;  1Y6W A;  3KPX A;  3O78 A;  4FTG A;  2KAV A;  3PLF B;  2ZKM X;  4KYN A;  3I5F B;  1QIV A;  1CM1 A;  1LA0 A;  1V1G A;  1TNQ A;  4YRU A;  1OZO A;  4MVF A;  2WC8 A;  3WHU B;  1KQM B;  5CSF A;  2JU0 A;  1XA5 A;  4HRE E;  4DRW A;  1CMF A;  1SK6 D;  2JTZ A;  2HF5 A;  1B8R A;  2LVK A;  4WRI A;  3CR5 X;  1DMO A;  2JC2 A; 
#chains in the Genus database with same CATH homology
 1DF0 A;  5HLV A;  1IJ6 A;  4ICB A;  1Q80 A;  2R2I A;  1B7T Z;  1PRW A;  2JOJ A;  3PFV A;  5AXI A;  1LIN A;  4CLN A;  1AHR A;  1PK0 D;  3TUY B;  3EK7 A;  3SIA A;  2LHL A;  4CID A;  1TCO B;  3TDZ A;  2WCE A;  1XFY O;  4OR9 B;  1SL7 A;  1H4B A;  1S36 A;  1DJI A;  3FS7 A;  1NCY A;  1S3P A;  2QAC A;  1M39 A;  2ZN9 A;  2KYF A;  2KBI A;  4MZL A;  1XK4 C;  1QX5 B;  1CMG A;  3DVE A;  4C0K A;  1BOD A;  2PRU A;  3FWC A;  1JWD A;  1XFV O;  4NDD A;  1QX2 A;  5IBW A;  3OB1 B;  1TNW A;  1JC2 A;  2M7L A;  2LUX A;  1DJX A;  4I5J A;  1FPW A;  1Y0V H;  1XO5 A;  2JT3 A;  2NXQ A;  1RRO A;  3ZWH A;  1JBA A;  2BCX A;  1F71 A;  1AK8 A;  2ZN8 A;  1DF0 B;  1TRF A;  4FQO A;  4NQG A;  3PN7 B;  4PHM A;  2BKH B;  3ZNI A;  1K9P A;  2MLF C;  1MWN A;  2H61 C;  1M63 B;  1IWQ A;  1OMV A;  1TIZ A;  1B8C A;  1BLQ A;  3AKA A;  1BMO A;  2I18 A;  1JF0 A;  1WLM A;  3TS5 C;  1K96 A;  4XYN A;  4OKH A;  1EG3 A;  2LC5 A;  3KEV A;  3IF7 A;  4GGF A;  3BOW A;  2LHI A;  4HSZ A;  2PAS A;  4I5N B;  3VRN A;  1S6I A;  1B4C A;  1V1F A;  1QV0 A;  2CCM A;  1MXE A;  1A4P A;  1OMD A;  2H2K A;  2BEC A;  2JNX A;  3CZT X;  1JF2 A;  1KFX S;  1IKU A;  1CDL A;  5DKR A;  1YRU B;  2K7B A;  4CPV A;  1LKJ A;  3CWG A;  1QXP A;  3O6B A;  1PSB A;  1ZMZ A;  4L9M A;  4AQI A;  3EK4 A;  2BE4 A;  3EVV A;  4HRH A;  1DJW A;  1UHJ A;  3AAJ A;  1KWO B;  4PE1 A;  1DJH A;  1KK8 C;  1SY9 A;  2HQ8 A;  3BUM B;  1BT6 A;  3BUX B;  1CLL A;  2M49 B;  4ZCV A;  1NIW A;  3OX6 A;  4ORC B;  1MUX A;  2F2O A;  1OZS A;  1S5G Z;  2LMT A;  1G33 A;  1S6C A;  2LMU A;  1DT7 B;  2KYC A;  1YUU A;  1DGU A;  4MN0 A;  4PHJ A;  5ER4 X;  1CB1 A;  1KQM C;  2JT8 A;  5FYX A;  2K7O A;  4AOM A;  4P2Y B;  2BKI B;  5AFP A;  5B8I B;  3SIB A;  2M7N A;  2K7C A;  1ALV A;  1CNP A;  1NCZ A;  4N1F A;  1IQ3 A;  2LVJ A;  4DIR A;  3NSL A;  3WXA A;  2D8N A;  1IRJ A;  4Q04 A;  2JTT A;  2K2F A;  4ETO A;  1KSO A;  3HCM A;  1WDC C;  2EHB A;  4PHK A;  2JXL A;  1FF1 A;  4PCW A;  1JUO A;  1AUI B;  1UHN A;  2P6B B;  3NSI A;  1REC A;  1K90 D;  1N2D A;  2KNE A;  2BL0 B;  2M8U A;  1TTX A;  1SCM B;  3SG4 A;  2LE9 B;  3PAT A;  1GJY A;  2JQ6 A;  2Y1M A;  1FI6 A;  3LLE A;  1BJF A;  2MBX A;  3KHE A;  1YVL A;  1QVI Y;  2KSP A;  3FIA A;  1HT9 A;  1U5I A;  5DKN A;  2LLT A;  2IS9 A;  4YGB B;  3DF0 A;  3NSO A;  1C7W A;  1KFU S;  2OS8 B;  3PN7 C;  2F8P A;  1BR4 B;  1BU3 A;  3I5G B;  1LVC D;  1EG4 A;  1PVA A;  4USL A;  2BCB A;  2ZRS A;  3D10 A;  4DS7 A;  1L2O B;  1MHO A;  1QAT A;  4UPG A;  1ODB A;  4M2Q A;  1WLZ A;  1CLB A;  3VRQ A;  1LXF C;  1UP5 A;  2LAN A;  1G4Y R;  1J1D A;  2OTG C;  1DTL A;  4MEW A;  4MBE A;  3CR4 X;  4XJK A;  4N5X A;  2BE6 A;  4PE4 A;  2KBM A;  4I5L B;  2AAO A;  3LK1 A;  3AAK A;  1XVJ A;  4YI8 A;  4C0J A;  5HYD A;  2KOT A;  2MAZ A;  1EJ3 A;  1U5I B;  2HET A;  5I2Q A;  1OSA A;  4YI9 A;  1X02 A;  3D0Y B;  1KWO C;  2M1K B;  2LP3 A;  3DF0 B;  1XFX O;  3KO0 A;  5GQQ C;  2AUC A;  3K21 A;  2FCE A;  1L7Z A;  3SG6 A;  2F33 A;  1MQ1 A;  2KDH A;  2KI6 C;  1YR5 A;  1E8A A;  4MLW A;  4E68 A;  1BF5 A;  1NX0 A;  2L0P A;  2CXJ A;  1RK9 A;  3RLZ A;  5CSJ A;  3BUW B;  1KK7 Y;  3PSR A;  5CPV A;  3PM8 A;  1A03 A;  4YGD B;  3O2P A;  4GGF C;  2BCA A;  3BYA A;  1DJG A;  4XJK B;  1BG1 A;  1EH2 A;  1TN4 A;  2AMI A;  4A4C A;  2Q4U A;  3VGO A;  1A29 A;  3DVK A;  2LP2 A;  1XFW O;  4PE0 A;  3CR2 A;  1R2U A;  4M2P A;  5CSI A;  1QS7 A;  5HLO A;  3QRX A;  4HRG A;  5KSZ A;  1PAL A;  1TNX A;  3NSK A;  5D7F A;  1NX1 A;  1WRK A;  3IQQ A;  3JTD B;  3SG2 A;  3VRO A;  1RWY A;  2CBL A;  1QTX A;  2COL B;  1TOP A;  2KI4 B;  1CDN A;  1YUR A;  1NX3 A;  4PDZ A;  2WCF A;  1D1O A;  3ICB A;  5HKY A;  5I2O A;  1J1E A;  2SAS A;  5AAN A;  5I8N A;  4I5K A;  5AEQ A;  1SCM C;  1AP4 A;  1KFX L;  2M9G A;  1NX2 A;  1QLK A;  2F3Z A;  2KI6 D;  2L51 A;  3F45 A;  1MR8 A;  1M31 A;  3JVT C;  4CFR A;  1WRL A;  3OX5 A;  1SL8 A;  3SG3 A;  5D69 A;  1C07 A;  3I5F C;  4GBA A;  2KQY A;  2BBN A;  1W7J B;  3CGA A;  1CKK A;  1J55 A;  5DKQ A;  4P5O E;  5G08 A;  2LM5 A;  5J3X A;  2MJW B;  4MZK A;  1NWD A;  1F4Q A;  2K2A A;  2OS8 C;  3DVM A;  1IJ5 A;  1CTR A;  1SCV A;  4YGA A;  2MLE C;  4DUQ A;  2LVI A;  3I5I B;  2M97 A;  3A4U B;  2L50 A;  4YBH B;  3TUY C;  1ZFS A;  2K61 A;  2KGB C;  1NYA A;  1SW8 A;  1M45 A;  2LUC A;  1SNL A;  2NLN A;  4MRY A;  5ER5 A;  5PAL A;  4ZCU A;  2SCP A;  5KU1 A;  1RTP 1;  1JSA A;  5BPJ A;  1QAS A;  1SMG A;  4ORA B;  5HKZ A;  4JPZ B;  3E3R A;  4QJ5 B;  2HQW A;  1K93 D;  1QVI Z;  1FI5 A;  1CM4 A;  2PMY A;  2ZFD A;  4WQ2 A;  1FBV A;  1NPQ A;  2L4H A;  1K95 A;  2MRD A;  3MSE B;  1QJT A;  2KFF A;  2HPS A;  2LVV A;  1IH0 A;  1PVB A;  1TNP A;  3DD4 A;  2L5X B;  1PUL A;  4QJ3 B;  4YGE B;  1CFC A;  1MXL C;  1TCF A;  2B1U A;  2L98 A;  1SPY A;  1SYM A;  1XFU O;  1Y1A A;  2ZRT A;  3C1V A;  2LLS A;  2GGM A;  3D0Y A;  1LA3 A;  2KAX A;  1K94 A;  1GGW A;  2L2E A;  4CFQ A;  2NZ0 A;  1H8B A;  1HQV A;  2E6W A;  1IGV A;  1YX8 A;  1KQV A;  2G2B A;  5I2L A;  1B8L A;  1OMR A;  1RFJ A;  2GV5 A;  1B9A A;  1B47 A;  1JFJ A;  4GFT A;  1KFU L;  3TDU A;  1NP8 A;  2KQ6 A;  1YUS A;  3OB2 B;  1B1G A;  1CFP A;  1K9U A;  3LK0 A;  1F55 A;  2I2R E;  5KTY A;  2KGR A;  1KSM A;  1YTZ C;  2QPT A;  3H4S E;  4GPL B;  1CFD A;  1N0Y A;  2M3W A;  4F0Z B;  1AJ5 A;  3JTD C;  3NXA A;  1OQP A;  4WQ3 A;  1GGZ A;  3EKJ A;  1C7V A;  3GK1 A;  2K0J A;  1J7R A;  4JQ0 D;  2Y5I A;  5CSN A;  5TNC A;  2KHN A;  2Y4Q A;  4OVN F;  3VRP A;  2KI4 C;  1GQM A;  3WHT B;  4QJ4 B;  1DVI A;  3I5H B;  1Y1X A;  4GAO A;  4N1G A;  1VRK A;  1ZAC A;  3LCP C;  1BOC A;  4BY5 A;  1KK7 Z;  1AVS A;  1UUS A;  1SBJ A;  2M29 A;  2WND A;  3BUO B;  1WDC B;  1NSH A;  1CLM A;  2LLU A;  2Y1N A;  2BBM A;  3GOF A;  1ZOT B;  2GGZ A;  2O5G A;  3O4Y A;  1Y1U A;  3SG5 A;  1A75 B;  2DOQ A;  5JJG A;  2LCP A;  2O60 A;  1B7T Y;  3EK8 A;  1NUB A;  3CLN A;  2JNF A;  1YUT A;  1QX7 A;  4C0L A;  1YX7 A;  2L4I A;  2JUL A;  4OCI A;  4MRX A;  3IQO A;  2EC6 B;  3TZ1 A;  2WOS A;  1SR6 B;  2FOT A;  1F54 A;  4D1E A;  1XK4 A;  3OHM B;  3GK2 A;  3I5I C;  1R6P A;  2KFG A;  2V53 A;  3EKH A;  3FWB A;  2OPO A;  2G9B A;  2FCD A;  4GUK A;  2JPT A;  1S26 D;  4PAL A;  3BUN B;  1QV1 A;  1XFZ O;  4MZJ A;  1WRZ A;  4GGN A;  3CTN A;  4NDB A;  1SRA A;  2LAP A;  1KCY A;  1CFF A;  2CNP A;  1K8U A;  1DJY A;  4MSP A;  4ORB B;  5K89 A;  2KFH A;  1SL9 A;  2BL0 C;  2LNK A;  2MHH A;  1OE9 B;  1PSR A;  2LMV A;  1YVH A;  1NCX A;  2EGD A;  2VRG A;  2ZNE A;  3LL8 B;  3RM1 A;  2ISD A;  2OTG B;  2K7D A;  1SKT A;  2H61 A;  1J7P A;  4OV2 A;  4AQJ A;  3KF9 A;  5AER A;  3AKB A;  1UUR A;  2WCB A;  2FJU B;  2M0R A;  5F6T A;  4BY4 A;  2I7A A;  5JOL A;  1UWO A;  3PAL A;  1UHI A;  1DGV A;  3SJS A;  1M46 A;  3I5G C;  3EVR A;  1RJV A;  1N65 A;  2WOR A;  1DJZ A;  3OP0 A;  4TNC A;  1L2O C;  3A8R A;  1J7O A;  1S6J A;  2Q91 A;  1ALW A;  2LV7 A;  1YRT B;  2JWW A;  2M1U A;  1QLS A;  2MA2 A;  1IQ5 A;  1EXR A;  2TN4 A;  2F3Y A;  3SG7 A;  3M0W A;  3TDI A;  1UHK A;  2K8M B;  3WNX B;  2JZI A;  1AJ4 A;  4YGC B;  1F4O A;  1FW4 A;  2KAY A;  3BXK A;  1JFK A;  3BOW B;  4M2O A;  1S5G Y;  3BQ3 A;  3DVJ A;  3GK4 X;  4JWQ A;  2RGI A;  3I5H C;  1A2X A;  3TS5 B;  2ZND A;  3EVU A;  1WY9 A;  1CDP A;  1K2H A;  1CDM A;  1QIW A;  4DCK A;  1XYD A;  1UHH A;  4PHN A;  1F8H A;  4PE7 A;  4IL1 A;  1S1E A;  2NCO A;  2PAL A;  2PSR A;  5HKW A;  4GNK B;  2JT0 A;  1W7I B;  1G8I A;  4A4B A;  2E30 A;  1J7Q A;  2CTN A;  2A4J A;  1IG5 A;  2I94 A;  1F70 A;  1KK8 B;  2NCP A;  3HX4 A;  4NDC A;  3CS1 A;  1A75 A;  3VRR A;  1K9K A;  2JXC A;  1MF8 B;  1ZUZ A;  2EC6 C;  2CT9 A;  2JRF A;  1BR1 B;  1SR6 C;  4R1E A;  2F2P A;  1EL4 A;  2PVB A;  1OOJ A;  3JVT B;  4U8D A;  1Y6W A;  3KPX A;  3O78 A;  4FTG A;  2KAV A;  3PLF B;  2ZKM X;  3I5F B;  1QIV A;  1CM1 A;  1LA0 A;  1V1G A;  1TNQ A;  4YRU A;  1OZO A;  4MVF A;  2WC8 A;  3WHU B;  1KQM B;  5CSF A;  2JU0 A;  1XA5 A;  4HRE E;  4DRW A;  1CMF A;  1SK6 D;  2JTZ A;  2HF5 A;  1B8R A;  2LVK A;  4WRI A;  3CR5 X;  1DMO A;  2JC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...