2FCDA

Solution structure of n-lobe myosin light chain from saccharomices cerevisiae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
b'SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain 1
publication title Structural basis for the interaction of the myosin light chain Mlc1p with the myosin V Myo2p IQ motifs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 17
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2fcdA00
3I5FC 1A75A 2R2IA 3DVEA 4CFQA 3PSRA 3SG7A 2GGZA 1PVAA 4YGBB 1DF0A 3SG6A 1PK0D 4DCKA 2L98A 4XYNA 1EL4A 4NDDA 1DT7B 3KHEA 3BQ3A 2BECA 2JPTA 3EVRA 4MZLA 1BMOA 2KQYA 2MA2A 2PVBA 1MQ1A 2JTTA 2L51A 1MHOA 1Q80A 4MSPA 1SY9A 1PSRA 1VRKA 1BODA 4BY4A 1XFXO 1NX1A 1F4QA 1Y1AA 4WQ2A 5ER5A 1QV1A 2BCBA 1A2XA 1LA0A 2WCFA 1CDPA 1SBJA 2LMVA 2EC6B 4MBEA 1V1GA 3EKJA 3NXAA 1V1FA 1Y1XA 2Q91A 3D0YB 3GK4X 1Y0VH 1JC2A 3SG5A 4GNKB 4MRXA 1E8AA 2MJWB 1SL7A 2KOTA 1QTXA 1SR6B 2LVIA 4M2QA 2KNEA 1ZACA 3GOFA 3O6BA 3PATA 5B8IB 2JOJA 1M39A 4HRHA 1HT9A 2BE6A 2JT8A 1DVIA 1BG1A 4OV2A 2F3ZA 5I2QA 2GGMA 3OHMB 2MLEC 4P2YB 1DJYA 1J7OA 1S6JA 5D69A 2ZRTA 5HKZA 3LK0A 5KTYA 1QIVA 1WY9A 1MR8A 2KAYA 4PHJA 2I94A 2JU0A 4XJKB 1BR1B 1CLLA 3WHUB 1KWOC 4QJ4B 2TN4A 2WORA 2KGRA 1UUSA 1ODBA 2FCEA 1NUBA 3WHTB 2OS8B 1ZMZA 2H2KA 3IF7A 5DKNA 1DJWA 1SCMC 2M49B 4GGFA 1B1GA 5HLVA 3TZ1A 1JF2A 2LV7A 2JNFA 1KSOA 2KHNA 4ZCVA 1XO5A 2KDHA 4PE7A 4N1FA 4Q04A 4QJ3B 1CDMA 1XYDA 2K7DA 4N1GA 4GUKA 1B4CA 4PE1A 3FWCA 1UWOA 3O4YA 4E68A 2EC6C 3JVTC 2K2FA 4JWQA 2CTNA 3FS7A 4WQ3A 1ZOTB 1J1EA 5DKRA 1EH2A 1WDCB 1XFYO 2EHBA 4I5KA 3KO0A 5AANA 1CLMA 2HQWA 1DJZA 1IQ5A 4OVNF 4C0LA 1BU3A 1SR6C 1OZOA 2L2EA 3AAJA 4I5NB 2G9BA 5FYXA 2PALA 4CFRA 4YI9A 2LANA 1S5GZ 1EG3A 2BBMA 4AQIA 3BUXB 3VRPA 4MLWA 1CMFA 1YURA 2LMTA 1ZUZA 3CLNA 1F8HA 1SCVA 1OMRA 1OZSA 2Y5IA 2M1UA 3H4SE 1BJFA 1CDLA 2NLNA 2QACA 5AFPA 1YUTA 1NCXA 1JWDA 3DF0B 1B8LA 1IQ3A 2FCDA 2O60A 4JQ0D 3JTDB 2BCXA 1K90D 2Y1MA 1OE9B 1M45A 1TIZA 1B47A 3OP0A 4FTGA 5J3XA 5KSZA 1IJ6A 3D10A 1MXLC 1QV0A 2OS8C 3DVMA 1ALVA 2FJUB 3A4UB 1IJ5A 2KI4B 2I18A 2AUCA 1J1DA 3EKHA 1C7WA 3FWBA 3TDIA 1CM1A 1UHIA 2COLB 4CIDA 2LC5A 3NSLA 2ZRSA 2KBIA 1U5IA 4YGAA 1A75B 4A4BA 1XFWO 2LVJA 3SG3A 1TNPA 1KQMB 1KK7Y 3CR4X 4OCIA 2D8NA 2HF5A 1KK8B 2MBXA 2K7BA 3F45A 1B8CA 1M31A 5I2OA 1WLZA 3HX4A 1RJVA 3NSOA 1K9UA 1RECA 3BUMB 4HREE 3TUYB 1JFKA 3C1VA 2WCBA 1A29A 1WDCC 1UHHA 1RK9A 5DKQA 3DVKA 1J55A 3CTNA 1NSHA 2SASA 1KFXS 2M29A 2MAZA 2FOTA 2ZKMX 3KEVA 5CPVA 2ZNDA 1SK6D 4YRUA 2CT9A 4MZKA 1XA5A 5CSJA 4DIRA 2VRGA 2LHIA 4HSZA 3MSEB 2HQ8A 2MLFC 1S26D 2B1UA 2NZ0A 5I8NA 1R2UA 1G8IA 2JC2A 1XK4A 3BOWB 1IRJA 1H4BA 2NXQA 2L4HA 1RWYA 3BUWB 1AK8A 4R1EA 1AUIB 2BL0B 2V53A 1XFZO 2LLSA 3D0YA 3EK4A 3JTDC 1W7IB 3CR5X 2F2PA 2LP2A 1SMGA 1A03A 3TDUA 2KQ6A 4YGEB 1S6CA 1DGVA 4NDBA 1YTZC 2KYCA 2Q4UA 1IWQA 1SW8A 1X02A 2KI4C 4GGNA 1QLSA 4M2PA 1K9PA 1GGWA 2F3YA 1SKTA 2LUCA 3PALA 1TNQA 1LA3A 3KPXA 2GV5A 3AKAA 2JTZA 1MF8B 2ZN9A 2JQ6A 4GBAA 3AAKA 1KQMC 3GK1A 2JULA 1L2OB 4PE4A 1CNPA 3EVUA 5HKWA 5AERA 5IBWA 1J7PA 1SRAA 1PVBA 4XJKA 1NYAA 3NSKA 3I5HB 1KFUL 1UP5A 3CWGA 1B7TZ 2KYFA 1G33A 1PSBA 2LP3A 5HYDA 4C0JA 5D7FA 1BLQA 1S1EA 4BY5A 3I5GB 2H61C 1DJXA 1WRKA 2G2BA 1BOCA 2WC8A 3SIAA 1NWDA 3TDZA 2MRDA 1BR4B 4YBHB 2M0RA 1QLKA 3PM8A 2LCPA 1OOJA 4U8DA 2BE4A 2CNPA 3I5FB 3PFVA 1M46A 2WCEA 1CLBA 4GAOA 1IG5A 1K95A 1J7RA 3OX6A 1OMVA 2BCAA 1FPWA 4PHNA 4WRIA 2BL0C 2M3WA 3SG2A 5GQQC 1DGUA 3LK1A 1N65A 1S6IA 2EGDA 4PHKA 4PDZA 2M7LA 1F54A 3BUOB 1TCOB 2NCPA 5CSNA 1RROA 1UHNA 1B9AA 3IQQA 4CLNA 1NX3A 2K7CA 1AJ5A 3CGAA 2KBMA 5TNCA 3CR2A 4ORCB 1LINA 3LL8B 1QVIZ 1LKJA 2K8MB 3DVJA 1OMDA 3GK2A 5CSIA 3DD4A 3VRNA 2KI6D 2BBNA 2BKIB 1K94A 1S5GY 1IGVA 3ZWHA 1K8UA 4MRYA 3IQOA 1S3PA 1L2OC 1QX5B 2LLTA 2HPSA 2P6BB 3DF0A 1K9KA 3QRXA 1U5IB 3I5HC 1Y6WA 5I2LA 1DF0B 4PHMA 1PALA 2DOQA 4MVFA 2F2OA 2L5XB 2LLUA 3RM1A 1K93D 2K0JA 1S36A 1BT6A 1YX8A 5G08A 2KSPA 3O78A 1N0YA 1YUUA 4L9MA 5KU1A 1N2DA 2K7OA 2O5GA 4UPGA 1YRTB 1JF0A 2MHHA 1NX0A 1FF1A 1FI6A 1IH0A 2LUXA 2OTGB 1BF5A 1AHRA 1A4PA 3VRRA 1SCMB 5ER4X 1AJ4A 2CBLA 1C07A 4F0ZB 5K89A 1H8BA 2BKHB 1R6PA 3SJSA 3A8RA 2JRFA 4C0KA 2PASA 1FI5A 2L50A 3BUNB 2JNXA 1CKKA 2NCOA 3TS5B 2H61A 1KCYA 1KFXL 4QJ5B 3SG4A 4ETOA 1B8RA 2AMIA 4GPLB 1JBAA 4DS7A 2E6WA 3RLZA 2HETA 3JVTB 2LM5A 4YGDB 1OSAA 2SCPA 2JZIA 1JFJA 4I5JA 5F6TA 1NX2A 4TNCA 1L7ZA 2LMUA 2JXLA 3VROA 4AOMA 3OB2B 3I5IB 1XFVO 3EK8A 3LLEA 3M0WA 2LAPA 2QPTA 1DJIA 1NP8A 3EK7A 2PSRA 3OX5A 5BPJA 3BOWA 1CFPA 1QASA 1RTP1 2JT3A 3K21A 1SYMA 2JT0A 2JWWA 1J7QA 3CZTX 1TTXA 1UURA 2M97A 1WRZA 3NSIA 1XVJA 4NDCA 1QS7A 4OKHA 2KFFA 1TRFA 1FW4A 1KK8C 1OQPA 2ZNEA 4M2OA 1Y1UA 2WNDA 3PN7B 4JPZB 2LNKA 4FQOA 3WXAA 2RGIA 3ZNIA 3TUYC 1JSAA 1EXRA 1WRLA 1AVSA 2LVKA 1KFUS 2ZN8A 3HCMA 1C7VA 3AKBA 3EVVA 4CPVA 2CCMA 2E30A 4PE0A 1CFFA 5JJGA 2I2RE 4MZJA 2OTGC 5CSFA 1ZFSA 1QX7A 1PULA 1UHKA 4I5LB 1MWNA 3BYAA 1TOPA 1NCZA 4ORAB 4PALA 1F55A 1IKUA 2LHLA 1KSMA 2PMYA 4YGCB 1XFUO 4HRGA 4N5XA 3O2PA 2AAOA 5AXIA 2Y1NA 1TCFA 1NIWA 5PALA 3TS5C 2KGBC 1XK4C 1TNWA 1DMOA 1CDNA 2F33A 1K96A 2KAVA 1B7TY 2KI6C 1YVLA 1SNLA 2A4JA 1GGZA 5AEQA 4A4CA 1DTLA 3LCPC 4NQGA 1QX2A 2M7NA 3OB1B 1KQVA 2CXJA 4DUQA 2K61A 2ZFDA 1DJGA 1CM4A 1QJTA 1GJYA 4PCWA 1FBVA 1GQMA 2L0PA 1MXEA 1G4YR 2LE9B 1TNXA 3I5IC 5HLOA 2WOSA 1QATA 1YR5A 1K2HA 4DRWA 2M8UA 4YI8A 3PLFB 1JUOA 2KAXA 2JXCA 1SPYA 3BXKA 4USLA 2KFHA 2ISDA 1QXPA 1SL8A 1WLMA 4GFTA 3ICBA 1YRUB 1LXFC 1CTRA 1QIWA 1DJHA 2IS9A 1ALWA 5JOLA 1CFDA 1YUSA 4IL1A 1TN4A 2M1KB 4GGFC 1KK7Z 2PRUA 2M9GA 3PN7C 1F4OA 2K2AA 4P5OE 3FIAA 2KFGA 1CFCA 2L4IA 3SIBA 1RFJA 2F8PA 4OR9B 3VGOA 1AP4A 1CMGA 1PRWA 1YX7A 3VRQA 2Y4QA 1EJ3A 1F71A 1UHJA 3E3RA 1NCYA 2I7AA 3I5GC 4ICBA 1CB1A 1EG4A 1W7JB 5HKYA 1QVIY 1YVHA 2OPOA 4MN0A 1D1OA 1SL9A 4MEWA 3CS1A 1LVCD 1KWOB 1MUXA 3WNXB 1M63B 2LVVA 3KF9A 4ZCUA 4D1EA 1F70A 4AQJA 1HQVA 4ORBB 1NPQA
chains in the Genus database with same CATH superfamily
3I5FC 1A75A 2R2IA 5FI2A 3DVEA 1TUJA 4CFQA 3PSRA 4OZDA 2GGZA 3SG7A 1PVAA 4YGBB 1DF0A 3SG6A 1PK0D 4DCKA 2L98A 4XYNA 2P70A 1EL4A 4NDDA 4INWA 3KHEA 1DT7B 3BQ3A 2BECA 2JPTA 1TWOA 3EVRA 1BMOA 2KQYA 2MA2A 2PVBA 1MQ1A 2JTTA 2L51A 1MHOA 1Q80A 4MSPA 1SY9A 1PSRA 1VRKA 1BODA 4BY4A 1XFXO 1NX1A 1F4QA 1Y1AA 4WQ2A 5ER5A 1QV1A 2KPHA 2BCBA 1A2XA 1LA0A 2WCFA 1CDPA 1SBJA 2LMVA 2EC6B 1OOIX 4MBEA 1V1GA 3EKJA 3NXAA 1V1FA 3D76A 3DXLA 1Y1XA 2Q91A 3D0YB 3GK4X 2WCMA 5FI6A 1Y0VH 1JC2A 3SG5A 4GNKB 4MRXA 1E8AA 2MJWB 1SL7A 2KOTA 1QTXA 1SR6B 2LVIA 4M2QA 2KNEA 1ZACA 3GOFA 3O6BA 3PATA 5B8IB 3SS5A 2JOJA 1M39A 4HRHA 5D3OA 4IJ7A 1HT9A 2BE6A 2JT8A 1DVIA 3UO9A 4OV2A 2F3ZA 3R1OA 5I2QA 2GGMA 1DC1A 1BG1A 3OHMB 2MLEC 3FE8A 4P2YB 1DJYA 1J7OA 1S6JA 5D69A 2ZRTA 5HKZA 3LK0A 5KTYA 1QIVA 1WY9A 1MR8A 2KAYA 4PHJA 2QEOA 2I94A 2JU0A 4XJKB 1BR1B 1CLLA 3WHUB 1KWOC 4QJ4B 2TN4A 2WORA 2KGRA 1UUSA 1ODBA 2FCEA 3CABA 1NUBA 3WHTB 2OS8B 1ZMZA 2H2KA 3IF7A 5DKNA 1DJWA 1SCMC 2M49B 4GGFA 1B1GA 5HLVA 3TZ1A 1JF2A 2LV7A 2JNFA 1QWVA 1KSOA 2KHNA 4ZCVA 1XO5A 2KDHA 4PE7A 4N1FA 4Q04A 4QJ3B 3CZ1A 1GM0A 1CDMA 3S0FA 1XYDA 2K7DA 4N1GA 4GUKA 1B4CA 4PE1A 1P28A 3FWCA 1UWOA 3O4YA 4E68A 2EC6C 3JVTC 2K2FA 4JWQA 2CTNA 3FS7A 3O4XA 4WQ3A 1ZOTB 1J1EA 5DKRA 2PYQA 1EH2A 1WDCB 1W9ZA 1XFYO 2EHBA 4I5KA 3KO0A 5AANA 1CLMA 2HQWA 1DJZA 1IQ5A 4OVNF 4C0LA 1BU3A 1SR6C 1OZOA 3NGVA 2L2EA 3AAJA 4I5NB 2G9BA 5FYXA 2PALA 4CFRA 4YI9A 2LANA 1S5GZ 1EG3A 2BBMA 4AQIA 3BUXB 3VRPA 4MLWA 1CMFA 1YURA 2LMTA 1ZUZA 3CLNA 2BNXA 3BFHA 1F8HA 1SCVA 1OMRA 1OZSA 2KLEA 2M1UA 2Y5IA 3H4SE 1BJFA 1CDLA 2NLNA 4FQTA 2QACA 5AFPA 1YUTA 1NCXA 1JWDA 3DF0B 1B8LA 2PQLA 1IQ3A 2FCDA 2O60A 4JQ0D 3JTDB 2BCXA 1K90D 2Y1MA 1OE9B 1M45A 1TIZA 1B47A 2QEVA 3OP0A 1T14A 4FTGA 5J3XA 5KSZA 3S0AA 2WCHA 1IJ6A 3CZ2A 2QEHA 3D10A 2WCJA 1MXLC 1QV0A 2OS8C 3DVMA 1ALVA 2FJUB 3A4UB 1IJ5A 2KI4B 2I18A 2AUCA 1J1DA 2WCLA 3EKHA 1C7WA 2QDIA 3FWBA 3TDIA 1CM1A 1UHIA 2COLB 4CIDA 2LC5A 2BAPA 2ZRSA 3NSLA 2KBIA 1U5IA 4YGAA 1A75B 4A4BA 5I94A 1DQEA 1XFWO 2LVJA 3SG3A 1TNPA 1KQMB 1KK7Y 3CR4X 4OCIA 2D8NA 3BJHA 5HL1A 2HF5A 1KK8B 2MBXA 2K7BA 3CZ0A 1B8CA 1M31A 3F45A 5I2OA 1WLZA 3HX4A 4MZLA 1RJVA 3NSOA 1K9UA 1RECA 3BUMB 4HREE 3TUYB 1JFKA 3C1VA 2WCBA 1A29A 1WDCC 1UHHA 1RK9A 5DKQA 3DVKA 1J55A 3CTNA 1NSHA 2SASA 1KFXS 2M29A 2MAZA 2FOTA 2ZKMX 3KEVA 5CPVA 2ZNDA 3PJIA 1SK6D 4YRUA 2CT9A 4MZKA 3B87A 1XA5A 5CSJA 4PT1A 4DIRA 2VRGA 2LHIA 2GTEA 2FJYA 4HSZA 3MSEB 2HQ8A 2MLFC 1S26D 2B1UA 2NZ0A 5I8NA 1R2UA 1G8IA 2JC2A 1XK4A 3BOWB 1IRJA 1H4BA 2NXQA 2L4HA 1RWYA 3BUWB 1AK8A 4R1EA 1AUIB 2BL0B 2V53A 2K60A 1XFZO 2LLSA 3D0YA 3EK4A 3JTDC 1W7IB 3CR5X 2F2PA 2LP2A 1SMGA 1A03A 3TDUA 4F7FA 2KQ6A 4YGEB 1S6CA 1DGVA 4NDBA 1YTZC 2KYCA 2Q4UA 1IWQA 1SW8A 1SSEB 1X02A 2KI4C 3IVTA 4GGNA 1QLSA 3R72A 4INXA 4M2PA 1K9PA 1GGWA 2F3YA 1SKTA 2LUCA 2YGUA 3PALA 3B6XA 2ERBA 1TNQA 1LA3A 3KPXA 2GV5A 3AKAA 2JTZA 1MF8B 3B88A 2ZN9A 2JQ6A 4GBAA 3AAKA 1KQMC 3GK1A 2L5YA 2P71A 2JULA 1L2OB 4PE4A 1CNPA 3EVUA 3NHTA 5HKWA 5AERA 5IBWA 1J7PA 1SRAA 1PVBA 4XJKA 1NYAA 3NSKA 3I5HB 1KFUL 1UP5A 3CWGA 1B7TZ 2KYFA 1G33A 1PSBA 2LP3A 5HYDA 4C0JA 5D7FA 1ORGA 1BLQA 1S1EA 4BY5A 3I5GB 2H61C 1DJXA 1WRKA 2G2BA 1BOCA 1LS8A 2WC8A 1DEKA 3SIAA 1NWDA 3TDZA 2MRDA 1BR4B 4YBHB 2M0RA 3D77A 1QLKA 3PM8A 2LCPA 1OOJA 4U8DA 2BE4A 2CNPA 3I5FB 3PFVA 1M46A 2WCEA 3K1EA 1CLBA 4GAOA 1IG5A 1K95A 2WCKA 1J7RA 3OX6A 1OMVA 2BCAA 1FPWA 4PHNA 4WRIA 2BL0C 2L2CA 2M3WA 3PM2A 3SG2A 5GQQC 1DGUA 3UNWA 3LK1A 1N65A 1S6IA 2EGDA 4PHKA 4PDZA 5DICA 2M7LA 1F54A 3BUOB 3CDNA 1TCOB 2NCPA 5CSNA 1RROA 1UHNA 1B9AA 3B86A 3IQQA 4CLNA 1NX3A 2K7CA 1AJ5A 3CGAA 2KBMA 5TNCA 3CR2A 3L4LA 4ORCB 1LINA 3LL8B 1QVIZ 1LKJA 2K8MB 3DVJA 3VB1A 1OMDA 3GK2A 1OOFA 5CSIA 3DD4A 3VRNA 2QEBA 2KI6D 2BBNA 2BKIB 1K94A 1S5GY 1IGVA 3BFAA 3L47A 3ZWHA 3DYEA 1K8UA 4MRYA 3IQOA 1S3PA 1L2OC 1QX5B 2LLTA 2HPSA 2P6BB 1XFRA 3DF0A 1K9KA 3QRXA 1U5IB 3I5HC 1OW4A 1Y6WA 5I2LA 1DF0B 4PHMA 1PALA 2DOQA 4MVFA 1OOGA 2F2OA 2L5XB 2LLUA 3RM1A 1K93D 2K0JA 1S36A 3QMEA 1BT6A 1YX8A 5G08A 2KSPA 3O78A 1N0YA 1YUUA 4L9MA 5KU1A 3L4AA 3D78A 4KYNA 1N2DA 2K7OA 2O5GA 5FI7A 4UPGA 1YRTB 1JF0A 2MHHA 3SS3A 1NX0A 1FF1A 1FI6A 1IH0A 2LUXA 2OTGB 1BF5A 1AHRA 1A4PA 3VRRA 1SCMB 5ER4X 1AJ4A 2CBLA 1C07A 4F0ZB 5K89A 1H8BA 3B7AA 2BKHB 1R6PA 3SJSA 3A8RA 2JRFA 4C0KA 2PASA 1FI5A 2L50A 3BUNB 2JNXA 1CKKA 2NCOA 1DELA 3TS5B 2H61A 1KCYA 1KFXL 4QJ5B 3SG4A 4ETOA 1B8RA 2AMIA 4GPLB 5EL2A 3RZSA 3V2LA 4DS7A 1JBAA 2E6WA 3RLZA 2HETA 3JVTB 2LM5A 3OGNA 3R1PA 1OSAA 2SCPA 2JZIA 3NHIA 4I5JA 4YGDB 1JFJA 4JKTA 5F6TA 1NX2A 4TNCA 1L7ZA 2LMUA 2JXLA 3VROA 4AOMA 1OOHA 3OB2B 3I5IB 1XFVO 3EK8A 3LLEA 3M0WA 2LAPA 2QPTA 1DJIA 1NP8A 3EK7A 2PSRA 3OX5A 5BPJA 3BOWA 1CFPA 1QASA 1RTP1 2JT3A 2WC5A 3K21A 1SYMA 2JT0A 3R1VA 2JWWA 1J7QA 3CZTX 1TTXA 1UURA 2M97A 3Q8IA 1WRZA 3DY9A 3NSIA 1XVJA 4NDCA 1QS7A 4OKHA 2KFFA 1TRFA 1FW4A 1KK8C 1OQPA 3D75A 2ZNEA 4M2OA 1Y1UA 2WNDA 1Z4HA 3PN7B 4JPZB 2LNKA 4FQOA 3WXAA 2RGIA 3ZNIA 3TUYC 1JSAA 1EXRA 1WRLA 3DZTA 1IIOA 1AVSA 2LVKA 1KFUS 2ZN8A 3D73A 3HCMA 1C7VA 2KLDA 3AKBA 3EVVA 4CPVA 1C3YA 2CCMA 2E30A 1C3ZA 4PE0A 1CFFA 5JJGA 2I2RE 3S0BA 3D74A 3SS4A 4MZJA 2OTGC 5CSFA 1ZFSA 1QX7A 1PULA 1UHKA 4I5LB 1MWNA 3BYAA 1TOPA 1NCZA 4ORAB 4PALA 1F55A 1IKUA 2LHLA 1KSMA 2PMYA 4YGCB 1XFUO 4HRGA 4N5XA 3O2PA 2AAOA 5AXIA 3EG5B 2Y1NA 1TCFA 1NIWA 5PALA 3TS5C 2KGBC 1XK4C 1TNWA 1DMOA 1CDNA 2F33A 1K96A 3BFBA 2KAVA 1B7TY 2KI6C 1YVLA 1SNLA 2A4JA 1GGZA 5AEQA 4A4CA 1DTLA 1TUZA 3LCPC 4NQGA 1QX2A 2M7NA 3OB1B 1KQVA 2CXJA 4DUQA 2K61A 2ZFDA 1DJGA 1CM4A 1QJTA 1GJYA 4PCWA 1FBVA 1GQMA 2L0PA 1MXEA 1G4YR 2WC6A 2LE9B 1TNXA 3I5IC 3FE6A 5HLOA 2WOSA 3CYZA 1QATA 1YR5A 1K2HA 4DRWA 2M8UA 4YI8A 3PLFB 1JUOA 2KAXA 3N7HA 2JXCA 1SPYA 3BXKA 3FE9A 4USLA 2KFHA 2ISDA 3S0GA 1QXPA 1SL8A 1WLMA 4GFTA 3ICBA 1YRUB 1LXFC 1CTRA 1QIWA 1DJHA 2IS9A 2H8VA 1ALWA 4JD9A 1CFDA 1YUSA 5JOLA 4IL1A 1TN4A 2M1KB 4GGFC 1KK7Z 2PRUA 2M9GA 3PN7C 1F4OA 2K2AA 4P5OE 3FIAA 2KFGA 3S0EA 1CFCA 2L4IA 3SIBA 1RFJA 2F8PA 4OR9B 3VGOA 1AP4A 1CMGA 1PRWA 1YX7A 3VRQA 2Y4QA 1EJ3A 1F71A 1UHJA 3E3RA 2JPOA 3S0DA 1NCYA 2I7AA 3I5GC 4ICBA 1CB1A 1EG4A 1W7JB 5HKYA 1QVIY 1YVHA 2OPOA 3OBVA 4MN0A 1D1OA 1SL9A 4MEWA 3CS1A 1LVCD 1KWOB 1MUXA 3WNXB 1M63B 2LVVA 3KF9A 4ZCUA 4D1EA 1Z2CB 1F70A 4AQJA 1HQVA 4ORBB 1NPQA
chains in the Genus database with same CATH topology
3I5FC 1A75A 2R2IA 3DVEA 4CFQA 3PSRA 3SG7A 2GGZA 1PVAA 4YGBB 1DF0A 3SG6A 1PK0D 4DCKA 2L98A 4XYNA 1EL4A 4NDDA 1DT7B 3KHEA 3BQ3A 2BECA 2JPTA 3EVRA 4MZLA 1BMOA 2KQYA 2MA2A 2PVBA 1MQ1A 2JTTA 2L51A 1MHOA 1Q80A 4MSPA 1SY9A 1PSRA 1VRKA 1BODA 4BY4A 1XFXO 1NX1A 1F4QA 1Y1AA 4WQ2A 5ER5A 1QV1A 2BCBA 1A2XA 1LA0A 2WCFA 1CDPA 1SBJA 2LMVA 2EC6B 4MBEA 1V1GA 3EKJA 3NXAA 1V1FA 1Y1XA 2Q91A 3D0YB 3GK4X 1Y0VH 1JC2A 3SG5A 4GNKB 4MRXA 1E8AA 2MJWB 1SL7A 2KOTA 1QTXA 1SR6B 2LVIA 4M2QA 2KNEA 1ZACA 3GOFA 3O6BA 3PATA 5B8IB 2JOJA 1M39A 4HRHA 1HT9A 2BE6A 2JT8A 1DVIA 1BG1A 4OV2A 2F3ZA 5I2QA 2GGMA 3OHMB 2MLEC 4P2YB 1DJYA 1J7OA 1S6JA 5D69A 2ZRTA 5HKZA 3LK0A 5KTYA 1QIVA 1WY9A 1MR8A 2KAYA 4PHJA 2I94A 2JU0A 4XJKB 1BR1B 1CLLA 3WHUB 1KWOC 4QJ4B 2TN4A 2WORA 2KGRA 1UUSA 1ODBA 2FCEA 1NUBA 3WHTB 2OS8B 1ZMZA 2H2KA 3IF7A 5DKNA 1DJWA 1SCMC 2M49B 4GGFA 1B1GA 5HLVA 3TZ1A 1JF2A 2LV7A 2JNFA 1KSOA 2KHNA 4ZCVA 1XO5A 2KDHA 4PE7A 4N1FA 4Q04A 4QJ3B 1CDMA 1XYDA 2K7DA 4N1GA 4GUKA 1B4CA 4PE1A 3FWCA 1UWOA 3O4YA 4E68A 2EC6C 3JVTC 2K2FA 4JWQA 2CTNA 3FS7A 4WQ3A 1ZOTB 1J1EA 5DKRA 1EH2A 1WDCB 1XFYO 2EHBA 4I5KA 3KO0A 5AANA 1CLMA 2HQWA 1DJZA 1IQ5A 4OVNF 4C0LA 1BU3A 1SR6C 1OZOA 2L2EA 3AAJA 4I5NB 2G9BA 5FYXA 2PALA 4CFRA 4YI9A 2LANA 1S5GZ 1EG3A 2BBMA 4AQIA 3BUXB 3VRPA 4MLWA 1CMFA 1YURA 2LMTA 1ZUZA 3CLNA 1F8HA 1SCVA 1OMRA 1OZSA 2Y5IA 2M1UA 3H4SE 1BJFA 1CDLA 2NLNA 2QACA 5AFPA 1YUTA 1NCXA 1JWDA 3DF0B 1B8LA 1IQ3A 2FCDA 2O60A 4JQ0D 3JTDB 2BCXA 1K90D 2Y1MA 1OE9B 1M45A 1TIZA 1B47A 3OP0A 4FTGA 5J3XA 5KSZA 1IJ6A 3D10A 1MXLC 1QV0A 2OS8C 3DVMA 1ALVA 2FJUB 3A4UB 1IJ5A 2KI4B 2I18A 2AUCA 1J1DA 3EKHA 1C7WA 3FWBA 3TDIA 1CM1A 1UHIA 2COLB 4CIDA 2LC5A 3NSLA 2ZRSA 2KBIA 1U5IA 4YGAA 1A75B 4A4BA 1XFWO 2LVJA 3SG3A 1TNPA 1KQMB 1KK7Y 3CR4X 4OCIA 2D8NA 2HF5A 1KK8B 2MBXA 2K7BA 3F45A 1B8CA 1M31A 5I2OA 1WLZA 3HX4A 1RJVA 3NSOA 1K9UA 1RECA 3BUMB 4HREE 3TUYB 1JFKA 3C1VA 2WCBA 1A29A 1WDCC 1UHHA 1RK9A 5DKQA 3DVKA 1J55A 3CTNA 1NSHA 2SASA 1KFXS 2M29A 2MAZA 2FOTA 2ZKMX 3KEVA 5CPVA 2ZNDA 1SK6D 4YRUA 2CT9A 4MZKA 1XA5A 5CSJA 4DIRA 2VRGA 2LHIA 4HSZA 3MSEB 2HQ8A 2MLFC 1S26D 2B1UA 2NZ0A 5I8NA 1R2UA 1G8IA 2JC2A 1XK4A 3BOWB 1IRJA 1H4BA 2NXQA 2L4HA 1RWYA 3BUWB 1AK8A 4R1EA 1AUIB 2BL0B 2V53A 1XFZO 2LLSA 3D0YA 3EK4A 3JTDC 1W7IB 3CR5X 2F2PA 2LP2A 1SMGA 1A03A 3TDUA 2KQ6A 4YGEB 1S6CA 1DGVA 4NDBA 1YTZC 2KYCA 2Q4UA 1IWQA 1SW8A 1X02A 2KI4C 4GGNA 1QLSA 4M2PA 1K9PA 1GGWA 2F3YA 1SKTA 2LUCA 3PALA 1TNQA 1LA3A 3KPXA 2GV5A 3AKAA 2JTZA 1MF8B 2ZN9A 2JQ6A 4GBAA 3AAKA 1KQMC 3GK1A 2JULA 1L2OB 4PE4A 1CNPA 3EVUA 5HKWA 5AERA 5IBWA 1J7PA 1SRAA 1PVBA 4XJKA 1NYAA 3NSKA 3I5HB 1KFUL 1UP5A 3CWGA 1B7TZ 2KYFA 1G33A 1PSBA 2LP3A 5HYDA 4C0JA 5D7FA 1BLQA 1S1EA 4BY5A 3I5GB 2H61C 1DJXA 1WRKA 2G2BA 1BOCA 2WC8A 3SIAA 1NWDA 3TDZA 2MRDA 1BR4B 4YBHB 2M0RA 1QLKA 3PM8A 2LCPA 1OOJA 4U8DA 2BE4A 2CNPA 3I5FB 3PFVA 1M46A 2WCEA 1CLBA 4GAOA 1IG5A 1K95A 1J7RA 3OX6A 1OMVA 2BCAA 1FPWA 4PHNA 4WRIA 2BL0C 2M3WA 3SG2A 5GQQC 1DGUA 3LK1A 1N65A 1S6IA 2EGDA 4PHKA 4PDZA 2M7LA 1F54A 3BUOB 1TCOB 2NCPA 5CSNA 1RROA 1UHNA 1B9AA 3IQQA 4CLNA 1NX3A 2K7CA 1AJ5A 3CGAA 2KBMA 5TNCA 3CR2A 4ORCB 1LINA 3LL8B 1QVIZ 1LKJA 2K8MB 3DVJA 1OMDA 3GK2A 5CSIA 3DD4A 3VRNA 2KI6D 2BBNA 2BKIB 1K94A 1S5GY 1IGVA 3ZWHA 1K8UA 4MRYA 3IQOA 1S3PA 1L2OC 1QX5B 2LLTA 2HPSA 2P6BB 3DF0A 1K9KA 3QRXA 1U5IB 3I5HC 1Y6WA 5I2LA 1DF0B 4PHMA 1PALA 2DOQA 4MVFA 2F2OA 2L5XB 2LLUA 3RM1A 1K93D 2K0JA 1S36A 1BT6A 1YX8A 5G08A 2KSPA 3O78A 1N0YA 1YUUA 4L9MA 5KU1A 1N2DA 2K7OA 2O5GA 4UPGA 1YRTB 1JF0A 2MHHA 1NX0A 1FF1A 1FI6A 1IH0A 2LUXA 2OTGB 1BF5A 1AHRA 1A4PA 3VRRA 1SCMB 5ER4X 1AJ4A 2CBLA 1C07A 4F0ZB 5K89A 1H8BA 2BKHB 1R6PA 3SJSA 3A8RA 2JRFA 4C0KA 2PASA 1FI5A 2L50A 3BUNB 2JNXA 1CKKA 2NCOA 3TS5B 2H61A 1KCYA 1KFXL 4QJ5B 3SG4A 4ETOA 1B8RA 2AMIA 4GPLB 1JBAA 4DS7A 2E6WA 3RLZA 2HETA 3JVTB 2LM5A 4YGDB 1OSAA 2SCPA 2JZIA 1JFJA 4I5JA 5F6TA 1NX2A 4TNCA 1L7ZA 2LMUA 2JXLA 3VROA 4AOMA 3OB2B 3I5IB 1XFVO 3EK8A 3LLEA 3M0WA 2LAPA 2QPTA 1DJIA 1NP8A 3EK7A 2PSRA 3OX5A 5BPJA 3BOWA 1CFPA 1QASA 1RTP1 2JT3A 3K21A 1SYMA 2JT0A 2JWWA 1J7QA 3CZTX 1TTXA 1UURA 2M97A 1WRZA 3NSIA 1XVJA 4NDCA 1QS7A 4OKHA 2KFFA 1TRFA 1FW4A 1KK8C 1OQPA 2ZNEA 4M2OA 1Y1UA 2WNDA 3PN7B 4JPZB 2LNKA 4FQOA 3WXAA 2RGIA 3ZNIA 3TUYC 1JSAA 1EXRA 1WRLA 1AVSA 2LVKA 1KFUS 2ZN8A 3HCMA 1C7VA 3AKBA 3EVVA 4CPVA 2CCMA 2E30A 4PE0A 1CFFA 5JJGA 2I2RE 4MZJA 2OTGC 5CSFA 1ZFSA 1QX7A 1PULA 1UHKA 4I5LB 1MWNA 3BYAA 1TOPA 1NCZA 4ORAB 4PALA 1F55A 1IKUA 2LHLA 1KSMA 2PMYA 4YGCB 1XFUO 4HRGA 4N5XA 3O2PA 2AAOA 5AXIA 2Y1NA 1TCFA 1NIWA 5PALA 3TS5C 2KGBC 1XK4C 1TNWA 1DMOA 1CDNA 2F33A 1K96A 2KAVA 1B7TY 2KI6C 1YVLA 1SNLA 2A4JA 1GGZA 5AEQA 4A4CA 1DTLA 3LCPC 4NQGA 1QX2A 2M7NA 3OB1B 1KQVA 2CXJA 4DUQA 2K61A 2ZFDA 1DJGA 1CM4A 1QJTA 1GJYA 4PCWA 1FBVA 1GQMA 2L0PA 1MXEA 1G4YR 2LE9B 1TNXA 3I5IC 5HLOA 2WOSA 1QATA 1YR5A 1K2HA 4DRWA 2M8UA 4YI8A 3PLFB 1JUOA 2KAXA 2JXCA 1SPYA 3BXKA 4USLA 2KFHA 2ISDA 1QXPA 1SL8A 1WLMA 4GFTA 3ICBA 1YRUB 1LXFC 1CTRA 1QIWA 1DJHA 2IS9A 1ALWA 5JOLA 1CFDA 1YUSA 4IL1A 1TN4A 2M1KB 4GGFC 1KK7Z 2PRUA 2M9GA 3PN7C 1F4OA 2K2AA 4P5OE 3FIAA 2KFGA 1CFCA 2L4IA 3SIBA 1RFJA 2F8PA 4OR9B 3VGOA 1AP4A 1CMGA 1PRWA 1YX7A 3VRQA 2Y4QA 1EJ3A 1F71A 1UHJA 3E3RA 1NCYA 2I7AA 3I5GC 4ICBA 1CB1A 1EG4A 1W7JB 5HKYA 1QVIY 1YVHA 2OPOA 4MN0A 1D1OA 1SL9A 4MEWA 3CS1A 1LVCD 1KWOB 1MUXA 3WNXB 1M63B 2LVVA 3KF9A 4ZCUA 4D1EA 1F70A 4AQJA 1HQVA 4ORBB 1NPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5F C;  1A75 A;  2R2I A;  3DVE A;  4CFQ A;  3PSR A;  3SG7 A;  2GGZ A;  1PVA A;  4YGB B;  1DF0 A;  3SG6 A;  1PK0 D;  4DCK A;  2L98 A;  4XYN A;  1EL4 A;  4NDD A;  1DT7 B;  3KHE A;  3BQ3 A;  2BEC A;  2JPT A;  3EVR A;  4MZL A;  1BMO A;  2KQY A;  2MA2 A;  2PVB A;  1MQ1 A;  2JTT A;  2L51 A;  1MHO A;  1Q80 A;  4MSP A;  1SY9 A;  1PSR A;  1VRK A;  1BOD A;  4BY4 A;  1XFX O;  1NX1 A;  1F4Q A;  1Y1A A;  4WQ2 A;  5ER5 A;  1QV1 A;  2BCB A;  1A2X A;  1LA0 A;  2WCF A;  1CDP A;  1SBJ A;  2LMV A;  2EC6 B;  4MBE A;  1V1G A;  3EKJ A;  3NXA A;  1V1F A;  1Y1X A;  2Q91 A;  3D0Y B;  3GK4 X;  1Y0V H;  1JC2 A;  3SG5 A;  4GNK B;  4MRX A;  1E8A A;  2MJW B;  1SL7 A;  2KOT A;  1QTX A;  1SR6 B;  2LVI A;  4M2Q A;  2KNE A;  1ZAC A;  3GOF A;  3O6B A;  3PAT A;  5B8I B;  2JOJ A;  1M39 A;  4HRH A;  1HT9 A;  2BE6 A;  2JT8 A;  1DVI A;  1BG1 A;  4OV2 A;  2F3Z A;  5I2Q A;  2GGM A;  3OHM B;  2MLE C;  4P2Y B;  1DJY A;  1J7O A;  1S6J A;  5D69 A;  2ZRT A;  5HKZ A;  3LK0 A;  5KTY A;  1QIV A;  1WY9 A;  1MR8 A;  2KAY A;  4PHJ A;  2I94 A;  2JU0 A;  4XJK B;  1BR1 B;  1CLL A;  3WHU B;  1KWO C;  4QJ4 B;  2TN4 A;  2WOR A;  2KGR A;  1UUS A;  1ODB A;  2FCE A;  1NUB A;  3WHT B;  2OS8 B;  1ZMZ A;  2H2K A;  3IF7 A;  5DKN A;  1DJW A;  1SCM C;  2M49 B;  4GGF A;  1B1G A;  5HLV A;  3TZ1 A;  1JF2 A;  2LV7 A;  2JNF A;  1KSO A;  2KHN A;  4ZCV A;  1XO5 A;  2KDH A;  4PE7 A;  4N1F A;  4Q04 A;  4QJ3 B;  1CDM A;  1XYD A;  2K7D A;  4N1G A;  4GUK A;  1B4C A;  4PE1 A;  3FWC A;  1UWO A;  3O4Y A;  4E68 A;  2EC6 C;  3JVT C;  2K2F A;  4JWQ A;  2CTN A;  3FS7 A;  4WQ3 A;  1ZOT B;  1J1E A;  5DKR A;  1EH2 A;  1WDC B;  1XFY O;  2EHB A;  4I5K A;  3KO0 A;  5AAN A;  1CLM A;  2HQW A;  1DJZ A;  1IQ5 A;  4OVN F;  4C0L A;  1BU3 A;  1SR6 C;  1OZO A;  2L2E A;  3AAJ A;  4I5N B;  2G9B A;  5FYX A;  2PAL A;  4CFR A;  4YI9 A;  2LAN A;  1S5G Z;  1EG3 A;  2BBM A;  4AQI A;  3BUX B;  3VRP A;  4MLW A;  1CMF A;  1YUR A;  2LMT A;  1ZUZ A;  3CLN A;  1F8H A;  1SCV A;  1OMR A;  1OZS A;  2Y5I A;  2M1U A;  3H4S E;  1BJF A;  1CDL A;  2NLN A;  2QAC A;  5AFP A;  1YUT A;  1NCX A;  1JWD A;  3DF0 B;  1B8L A;  1IQ3 A;  2FCD A;  2O60 A;  4JQ0 D;  3JTD B;  2BCX A;  1K90 D;  2Y1M A;  1OE9 B;  1M45 A;  1TIZ A;  1B47 A;  3OP0 A;  4FTG A;  5J3X A;  5KSZ A;  1IJ6 A;  3D10 A;  1MXL C;  1QV0 A;  2OS8 C;  3DVM A;  1ALV A;  2FJU B;  3A4U B;  1IJ5 A;  2KI4 B;  2I18 A;  2AUC A;  1J1D A;  3EKH A;  1C7W A;  3FWB A;  3TDI A;  1CM1 A;  1UHI A;  2COL B;  4CID A;  2LC5 A;  3NSL A;  2ZRS A;  2KBI A;  1U5I A;  4YGA A;  1A75 B;  4A4B A;  1XFW O;  2LVJ A;  3SG3 A;  1TNP A;  1KQM B;  1KK7 Y;  3CR4 X;  4OCI A;  2D8N A;  2HF5 A;  1KK8 B;  2MBX A;  2K7B A;  3F45 A;  1B8C A;  1M31 A;  5I2O A;  1WLZ A;  3HX4 A;  1RJV A;  3NSO A;  1K9U A;  1REC A;  3BUM B;  4HRE E;  3TUY B;  1JFK A;  3C1V A;  2WCB A;  1A29 A;  1WDC C;  1UHH A;  1RK9 A;  5DKQ A;  3DVK A;  1J55 A;  3CTN A;  1NSH A;  2SAS A;  1KFX S;  2M29 A;  2MAZ A;  2FOT A;  2ZKM X;  3KEV A;  5CPV A;  2ZND A;  1SK6 D;  4YRU A;  2CT9 A;  4MZK A;  1XA5 A;  5CSJ A;  4DIR A;  2VRG A;  2LHI A;  4HSZ A;  3MSE B;  2HQ8 A;  2MLF C;  1S26 D;  2B1U A;  2NZ0 A;  5I8N A;  1R2U A;  1G8I A;  2JC2 A;  1XK4 A;  3BOW B;  1IRJ A;  1H4B A;  2NXQ A;  2L4H A;  1RWY A;  3BUW B;  1AK8 A;  4R1E A;  1AUI B;  2BL0 B;  2V53 A;  1XFZ O;  2LLS A;  3D0Y A;  3EK4 A;  3JTD C;  1W7I B;  3CR5 X;  2F2P A;  2LP2 A;  1SMG A;  1A03 A;  3TDU A;  2KQ6 A;  4YGE B;  1S6C A;  1DGV A;  4NDB A;  1YTZ C;  2KYC A;  2Q4U A;  1IWQ A;  1SW8 A;  1X02 A;  2KI4 C;  4GGN A;  1QLS A;  4M2P A;  1K9P A;  1GGW A;  2F3Y A;  1SKT A;  2LUC A;  3PAL A;  1TNQ A;  1LA3 A;  3KPX A;  2GV5 A;  3AKA A;  2JTZ A;  1MF8 B;  2ZN9 A;  2JQ6 A;  4GBA A;  3AAK A;  1KQM C;  3GK1 A;  2JUL A;  1L2O B;  4PE4 A;  1CNP A;  3EVU A;  5HKW A;  5AER A;  5IBW A;  1J7P A;  1SRA A;  1PVB A;  4XJK A;  1NYA A;  3NSK A;  3I5H B;  1KFU L;  1UP5 A;  3CWG A;  1B7T Z;  2KYF A;  1G33 A;  1PSB A;  2LP3 A;  5HYD A;  4C0J A;  5D7F A;  1BLQ A;  1S1E A;  4BY5 A;  3I5G B;  2H61 C;  1DJX A;  1WRK A;  2G2B A;  1BOC A;  2WC8 A;  3SIA A;  1NWD A;  3TDZ A;  2MRD A;  1BR4 B;  4YBH B;  2M0R A;  1QLK A;  3PM8 A;  2LCP A;  1OOJ A;  4U8D A;  2BE4 A;  2CNP A;  3I5F B;  3PFV A;  1M46 A;  2WCE A;  1CLB A;  4GAO A;  1IG5 A;  1K95 A;  1J7R A;  3OX6 A;  1OMV A;  2BCA A;  1FPW A;  4PHN A;  4WRI A;  2BL0 C;  2M3W A;  3SG2 A;  5GQQ C;  1DGU A;  3LK1 A;  1N65 A;  1S6I A;  2EGD A;  4PHK A;  4PDZ A;  2M7L A;  1F54 A;  3BUO B;  1TCO B;  2NCP A;  5CSN A;  1RRO A;  1UHN A;  1B9A A;  3IQQ A;  4CLN A;  1NX3 A;  2K7C A;  1AJ5 A;  3CGA A;  2KBM A;  5TNC A;  3CR2 A;  4ORC B;  1LIN A;  3LL8 B;  1QVI Z;  1LKJ A;  2K8M B;  3DVJ A;  1OMD A;  3GK2 A;  5CSI A;  3DD4 A;  3VRN A;  2KI6 D;  2BBN A;  2BKI B;  1K94 A;  1S5G Y;  1IGV A;  3ZWH A;  1K8U A;  4MRY A;  3IQO A;  1S3P A;  1L2O C;  1QX5 B;  2LLT A;  2HPS A;  2P6B B;  3DF0 A;  1K9K A;  3QRX A;  1U5I B;  3I5H C;  1Y6W A;  5I2L A;  1DF0 B;  4PHM A;  1PAL A;  2DOQ A;  4MVF A;  2F2O A;  2L5X B;  2LLU A;  3RM1 A;  1K93 D;  2K0J A;  1S36 A;  1BT6 A;  1YX8 A;  5G08 A;  2KSP A;  3O78 A;  1N0Y A;  1YUU A;  4L9M A;  5KU1 A;  1N2D A;  2K7O A;  2O5G A;  4UPG A;  1YRT B;  1JF0 A;  2MHH A;  1NX0 A;  1FF1 A;  1FI6 A;  1IH0 A;  2LUX A;  2OTG B;  1BF5 A;  1AHR A;  1A4P A;  3VRR A;  1SCM B;  5ER4 X;  1AJ4 A;  2CBL A;  1C07 A;  4F0Z B;  5K89 A;  1H8B A;  2BKH B;  1R6P A;  3SJS A;  3A8R A;  2JRF A;  4C0K A;  2PAS A;  1FI5 A;  2L50 A;  3BUN B;  2JNX A;  1CKK A;  2NCO A;  3TS5 B;  2H61 A;  1KCY A;  1KFX L;  4QJ5 B;  3SG4 A;  4ETO A;  1B8R A;  2AMI A;  4GPL B;  1JBA A;  4DS7 A;  2E6W A;  3RLZ A;  2HET A;  3JVT B;  2LM5 A;  4YGD B;  1OSA A;  2SCP A;  2JZI A;  1JFJ A;  4I5J A;  5F6T A;  1NX2 A;  4TNC A;  1L7Z A;  2LMU A;  2JXL A;  3VRO A;  4AOM A;  3OB2 B;  3I5I B;  1XFV O;  3EK8 A;  3LLE A;  3M0W A;  2LAP A;  2QPT A;  1DJI A;  1NP8 A;  3EK7 A;  2PSR A;  3OX5 A;  5BPJ A;  3BOW A;  1CFP A;  1QAS A;  1RTP 1;  2JT3 A;  3K21 A;  1SYM A;  2JT0 A;  2JWW A;  1J7Q A;  3CZT X;  1TTX A;  1UUR A;  2M97 A;  1WRZ A;  3NSI A;  1XVJ A;  4NDC A;  1QS7 A;  4OKH A;  2KFF A;  1TRF A;  1FW4 A;  1KK8 C;  1OQP A;  2ZNE A;  4M2O A;  1Y1U A;  2WND A;  3PN7 B;  4JPZ B;  2LNK A;  4FQO A;  3WXA A;  2RGI A;  3ZNI A;  3TUY C;  1JSA A;  1EXR A;  1WRL A;  1AVS A;  2LVK A;  1KFU S;  2ZN8 A;  3HCM A;  1C7V A;  3AKB A;  3EVV A;  4CPV A;  2CCM A;  2E30 A;  4PE0 A;  1CFF A;  5JJG A;  2I2R E;  4MZJ A;  2OTG C;  5CSF A;  1ZFS A;  1QX7 A;  1PUL A;  1UHK A;  4I5L B;  1MWN A;  3BYA A;  1TOP A;  1NCZ A;  4ORA B;  4PAL A;  1F55 A;  1IKU A;  2LHL A;  1KSM A;  2PMY A;  4YGC B;  1XFU O;  4HRG A;  4N5X A;  3O2P A;  2AAO A;  5AXI A;  2Y1N A;  1TCF A;  1NIW A;  5PAL A;  3TS5 C;  2KGB C;  1XK4 C;  1TNW A;  1DMO A;  1CDN A;  2F33 A;  1K96 A;  2KAV A;  1B7T Y;  2KI6 C;  1YVL A;  1SNL A;  2A4J A;  1GGZ A;  5AEQ A;  4A4C A;  1DTL A;  3LCP C;  4NQG A;  1QX2 A;  2M7N A;  3OB1 B;  1KQV A;  2CXJ A;  4DUQ A;  2K61 A;  2ZFD A;  1DJG A;  1CM4 A;  1QJT A;  1GJY A;  4PCW A;  1FBV A;  1GQM A;  2L0P A;  1MXE A;  1G4Y R;  2LE9 B;  1TNX A;  3I5I C;  5HLO A;  2WOS A;  1QAT A;  1YR5 A;  1K2H A;  4DRW A;  2M8U A;  4YI8 A;  3PLF B;  1JUO A;  2KAX A;  2JXC A;  1SPY A;  3BXK A;  4USL A;  2KFH A;  2ISD A;  1QXP A;  1SL8 A;  1WLM A;  4GFT A;  3ICB A;  1YRU B;  1LXF C;  1CTR A;  1QIW A;  1DJH A;  2IS9 A;  1ALW A;  5JOL A;  1CFD A;  1YUS A;  4IL1 A;  1TN4 A;  2M1K B;  4GGF C;  1KK7 Z;  2PRU A;  2M9G A;  3PN7 C;  1F4O A;  2K2A A;  4P5O E;  3FIA A;  2KFG A;  1CFC A;  2L4I A;  3SIB A;  1RFJ A;  2F8P A;  4OR9 B;  3VGO A;  1AP4 A;  1CMG A;  1PRW A;  1YX7 A;  3VRQ A;  2Y4Q A;  1EJ3 A;  1F71 A;  1UHJ A;  3E3R A;  1NCY A;  2I7A A;  3I5G C;  4ICB A;  1CB1 A;  1EG4 A;  1W7J B;  5HKY A;  1QVI Y;  1YVH A;  2OPO A;  4MN0 A;  1D1O A;  1SL9 A;  4MEW A;  3CS1 A;  1LVC D;  1KWO B;  1MUX A;  3WNX B;  1M63 B;  2LVV A;  3KF9 A;  4ZCU A;  4D1E A;  1F70 A;  4AQJ A;  1HQV A;  4ORB B;  1NPQ A; 
#chains in the Genus database with same CATH topology
 3I5F C;  1A75 A;  2R2I A;  5FI2 A;  3DVE A;  1TUJ A;  4CFQ A;  3PSR A;  4OZD A;  2GGZ A;  3SG7 A;  1PVA A;  4YGB B;  1DF0 A;  3SG6 A;  1PK0 D;  4DCK A;  2L98 A;  4XYN A;  2P70 A;  1EL4 A;  4NDD A;  4INW A;  3KHE A;  1DT7 B;  3BQ3 A;  2BEC A;  2JPT A;  1TWO A;  3EVR A;  1BMO A;  2KQY A;  2MA2 A;  2PVB A;  1MQ1 A;  2JTT A;  2L51 A;  1MHO A;  1Q80 A;  4MSP A;  1SY9 A;  1PSR A;  1VRK A;  1BOD A;  4BY4 A;  1XFX O;  1NX1 A;  1F4Q A;  1Y1A A;  4WQ2 A;  5ER5 A;  1QV1 A;  2KPH A;  2BCB A;  1A2X A;  1LA0 A;  2WCF A;  1CDP A;  1SBJ A;  2LMV A;  2EC6 B;  1OOI X;  4MBE A;  1V1G A;  3EKJ A;  3NXA A;  1V1F A;  3D76 A;  3DXL A;  1Y1X A;  2Q91 A;  3D0Y B;  3GK4 X;  2WCM A;  5FI6 A;  1Y0V H;  1JC2 A;  3SG5 A;  4GNK B;  4MRX A;  1E8A A;  2MJW B;  1SL7 A;  2KOT A;  1QTX A;  1SR6 B;  2LVI A;  4M2Q A;  2KNE A;  1ZAC A;  3GOF A;  3O6B A;  3PAT A;  5B8I B;  3SS5 A;  2JOJ A;  1M39 A;  4HRH A;  5D3O A;  4IJ7 A;  1HT9 A;  2BE6 A;  2JT8 A;  1DVI A;  3UO9 A;  4OV2 A;  2F3Z A;  3R1O A;  5I2Q A;  2GGM A;  1DC1 A;  1BG1 A;  3OHM B;  2MLE C;  3FE8 A;  4P2Y B;  1DJY A;  1J7O A;  1S6J A;  5D69 A;  2ZRT A;  5HKZ A;  3LK0 A;  5KTY A;  1QIV A;  1WY9 A;  1MR8 A;  2KAY A;  4PHJ A;  2QEO A;  2I94 A;  2JU0 A;  4XJK B;  1BR1 B;  1CLL A;  3WHU B;  1KWO C;  4QJ4 B;  2TN4 A;  2WOR A;  2KGR A;  1UUS A;  1ODB A;  2FCE A;  3CAB A;  1NUB A;  3WHT B;  2OS8 B;  1ZMZ A;  2H2K A;  3IF7 A;  5DKN A;  1DJW A;  1SCM C;  2M49 B;  4GGF A;  1B1G A;  5HLV A;  3TZ1 A;  1JF2 A;  2LV7 A;  2JNF A;  1QWV A;  1KSO A;  2KHN A;  4ZCV A;  1XO5 A;  2KDH A;  4PE7 A;  4N1F A;  4Q04 A;  4QJ3 B;  3CZ1 A;  1GM0 A;  1CDM A;  3S0F A;  1XYD A;  2K7D A;  4N1G A;  4GUK A;  1B4C A;  4PE1 A;  1P28 A;  3FWC A;  1UWO A;  3O4Y A;  4E68 A;  2EC6 C;  3JVT C;  2K2F A;  4JWQ A;  2CTN A;  3FS7 A;  3O4X A;  4WQ3 A;  1ZOT B;  1J1E A;  5DKR A;  2PYQ A;  1EH2 A;  1WDC B;  1W9Z A;  1XFY O;  2EHB A;  4I5K A;  3KO0 A;  5AAN A;  1CLM A;  2HQW A;  1DJZ A;  1IQ5 A;  4OVN F;  4C0L A;  1BU3 A;  1SR6 C;  1OZO A;  3NGV A;  2L2E A;  3AAJ A;  4I5N B;  2G9B A;  5FYX A;  2PAL A;  4CFR A;  4YI9 A;  2LAN A;  1S5G Z;  1EG3 A;  2BBM A;  4AQI A;  3BUX B;  3VRP A;  4MLW A;  1CMF A;  1YUR A;  2LMT A;  1ZUZ A;  3CLN A;  2BNX A;  3BFH A;  1F8H A;  1SCV A;  1OMR A;  1OZS A;  2KLE A;  2M1U A;  2Y5I A;  3H4S E;  1BJF A;  1CDL A;  2NLN A;  4FQT A;  2QAC A;  5AFP A;  1YUT A;  1NCX A;  1JWD A;  3DF0 B;  1B8L A;  2PQL A;  1IQ3 A;  2FCD A;  2O60 A;  4JQ0 D;  3JTD B;  2BCX A;  1K90 D;  2Y1M A;  1OE9 B;  1M45 A;  1TIZ A;  1B47 A;  2QEV A;  3OP0 A;  1T14 A;  4FTG A;  5J3X A;  5KSZ A;  3S0A A;  2WCH A;  1IJ6 A;  3CZ2 A;  2QEH A;  3D10 A;  2WCJ A;  1MXL C;  1QV0 A;  2OS8 C;  3DVM A;  1ALV A;  2FJU B;  3A4U B;  1IJ5 A;  2KI4 B;  2I18 A;  2AUC A;  1J1D A;  2WCL A;  3EKH A;  1C7W A;  2QDI A;  3FWB A;  3TDI A;  1CM1 A;  1UHI A;  2COL B;  4CID A;  2LC5 A;  2BAP A;  2ZRS A;  3NSL A;  2KBI A;  1U5I A;  4YGA A;  1A75 B;  4A4B A;  5I94 A;  1DQE A;  1XFW O;  2LVJ A;  3SG3 A;  1TNP A;  1KQM B;  1KK7 Y;  3CR4 X;  4OCI A;  2D8N A;  3BJH A;  5HL1 A;  2HF5 A;  1KK8 B;  2MBX A;  2K7B A;  3CZ0 A;  1B8C A;  1M31 A;  3F45 A;  5I2O A;  1WLZ A;  3HX4 A;  4MZL A;  1RJV A;  3NSO A;  1K9U A;  1REC A;  3BUM B;  4HRE E;  3TUY B;  1JFK A;  3C1V A;  2WCB A;  1A29 A;  1WDC C;  1UHH A;  1RK9 A;  5DKQ A;  3DVK A;  1J55 A;  3CTN A;  1NSH A;  2SAS A;  1KFX S;  2M29 A;  2MAZ A;  2FOT A;  2ZKM X;  3KEV A;  5CPV A;  2ZND A;  3PJI A;  1SK6 D;  4YRU A;  2CT9 A;  4MZK A;  3B87 A;  1XA5 A;  5CSJ A;  4PT1 A;  4DIR A;  2VRG A;  2LHI A;  2GTE A;  2FJY A;  4HSZ A;  3MSE B;  2HQ8 A;  2MLF C;  1S26 D;  2B1U A;  2NZ0 A;  5I8N A;  1R2U A;  1G8I A;  2JC2 A;  1XK4 A;  3BOW B;  1IRJ A;  1H4B A;  2NXQ A;  2L4H A;  1RWY A;  3BUW B;  1AK8 A;  4R1E A;  1AUI B;  2BL0 B;  2V53 A;  2K60 A;  1XFZ O;  2LLS A;  3D0Y A;  3EK4 A;  3JTD C;  1W7I B;  3CR5 X;  2F2P A;  2LP2 A;  1SMG A;  1A03 A;  3TDU A;  4F7F A;  2KQ6 A;  4YGE B;  1S6C A;  1DGV A;  4NDB A;  1YTZ C;  2KYC A;  2Q4U A;  1IWQ A;  1SW8 A;  1SSE B;  1X02 A;  2KI4 C;  3IVT A;  4GGN A;  1QLS A;  3R72 A;  4INX A;  4M2P A;  1K9P A;  1GGW A;  2F3Y A;  1SKT A;  2LUC A;  2YGU A;  3PAL A;  3B6X A;  2ERB A;  1TNQ A;  1LA3 A;  3KPX A;  2GV5 A;  3AKA A;  2JTZ A;  1MF8 B;  3B88 A;  2ZN9 A;  2JQ6 A;  4GBA A;  3AAK A;  1KQM C;  3GK1 A;  2L5Y A;  2P71 A;  2JUL A;  1L2O B;  4PE4 A;  1CNP A;  3EVU A;  3NHT A;  5HKW A;  5AER A;  5IBW A;  1J7P A;  1SRA A;  1PVB A;  4XJK A;  1NYA A;  3NSK A;  3I5H B;  1KFU L;  1UP5 A;  3CWG A;  1B7T Z;  2KYF A;  1G33 A;  1PSB A;  2LP3 A;  5HYD A;  4C0J A;  5D7F A;  1ORG A;  1BLQ A;  1S1E A;  4BY5 A;  3I5G B;  2H61 C;  1DJX A;  1WRK A;  2G2B A;  1BOC A;  1LS8 A;  2WC8 A;  1DEK A;  3SIA A;  1NWD A;  3TDZ A;  2MRD A;  1BR4 B;  4YBH B;  2M0R A;  3D77 A;  1QLK A;  3PM8 A;  2LCP A;  1OOJ A;  4U8D A;  2BE4 A;  2CNP A;  3I5F B;  3PFV A;  1M46 A;  2WCE A;  3K1E A;  1CLB A;  4GAO A;  1IG5 A;  1K95 A;  2WCK A;  1J7R A;  3OX6 A;  1OMV A;  2BCA A;  1FPW A;  4PHN A;  4WRI A;  2BL0 C;  2L2C A;  2M3W A;  3PM2 A;  3SG2 A;  5GQQ C;  1DGU A;  3UNW A;  3LK1 A;  1N65 A;  1S6I A;  2EGD A;  4PHK A;  4PDZ A;  5DIC A;  2M7L A;  1F54 A;  3BUO B;  3CDN A;  1TCO B;  2NCP A;  5CSN A;  1RRO A;  1UHN A;  1B9A A;  3B86 A;  3IQQ A;  4CLN A;  1NX3 A;  2K7C A;  1AJ5 A;  3CGA A;  2KBM A;  5TNC A;  3CR2 A;  3L4L A;  4ORC B;  1LIN A;  3LL8 B;  1QVI Z;  1LKJ A;  2K8M B;  3DVJ A;  3VB1 A;  1OMD A;  3GK2 A;  1OOF A;  5CSI A;  3DD4 A;  3VRN A;  2QEB A;  2KI6 D;  2BBN A;  2BKI B;  1K94 A;  1S5G Y;  1IGV A;  3BFA A;  3L47 A;  3ZWH A;  3DYE A;  1K8U A;  4MRY A;  3IQO A;  1S3P A;  1L2O C;  1QX5 B;  2LLT A;  2HPS A;  2P6B B;  1XFR A;  3DF0 A;  1K9K A;  3QRX A;  1U5I B;  3I5H C;  1OW4 A;  1Y6W A;  5I2L A;  1DF0 B;  4PHM A;  1PAL A;  2DOQ A;  4MVF A;  1OOG A;  2F2O A;  2L5X B;  2LLU A;  3RM1 A;  1K93 D;  2K0J A;  1S36 A;  3QME A;  1BT6 A;  1YX8 A;  5G08 A;  2KSP A;  3O78 A;  1N0Y A;  1YUU A;  4L9M A;  5KU1 A;  3L4A A;  3D78 A;  4KYN A;  1N2D A;  2K7O A;  2O5G A;  5FI7 A;  4UPG A;  1YRT B;  1JF0 A;  2MHH A;  3SS3 A;  1NX0 A;  1FF1 A;  1FI6 A;  1IH0 A;  2LUX A;  2OTG B;  1BF5 A;  1AHR A;  1A4P A;  3VRR A;  1SCM B;  5ER4 X;  1AJ4 A;  2CBL A;  1C07 A;  4F0Z B;  5K89 A;  1H8B A;  3B7A A;  2BKH B;  1R6P A;  3SJS A;  3A8R A;  2JRF A;  4C0K A;  2PAS A;  1FI5 A;  2L50 A;  3BUN B;  2JNX A;  1CKK A;  2NCO A;  1DEL A;  3TS5 B;  2H61 A;  1KCY A;  1KFX L;  4QJ5 B;  3SG4 A;  4ETO A;  1B8R A;  2AMI A;  4GPL B;  5EL2 A;  3RZS A;  3V2L A;  4DS7 A;  1JBA A;  2E6W A;  3RLZ A;  2HET A;  3JVT B;  2LM5 A;  3OGN A;  3R1P A;  1OSA A;  2SCP A;  2JZI A;  3NHI A;  4I5J A;  4YGD B;  1JFJ A;  4JKT A;  5F6T A;  1NX2 A;  4TNC A;  1L7Z A;  2LMU A;  2JXL A;  3VRO A;  4AOM A;  1OOH A;  3OB2 B;  3I5I B;  1XFV O;  3EK8 A;  3LLE A;  3M0W A;  2LAP A;  2QPT A;  1DJI A;  1NP8 A;  3EK7 A;  2PSR A;  3OX5 A;  5BPJ A;  3BOW A;  1CFP A;  1QAS A;  1RTP 1;  2JT3 A;  2WC5 A;  3K21 A;  1SYM A;  2JT0 A;  3R1V A;  2JWW A;  1J7Q A;  3CZT X;  1TTX A;  1UUR A;  2M97 A;  3Q8I A;  1WRZ A;  3DY9 A;  3NSI A;  1XVJ A;  4NDC A;  1QS7 A;  4OKH A;  2KFF A;  1TRF A;  1FW4 A;  1KK8 C;  1OQP A;  3D75 A;  2ZNE A;  4M2O A;  1Y1U A;  2WND A;  1Z4H A;  3PN7 B;  4JPZ B;  2LNK A;  4FQO A;  3WXA A;  2RGI A;  3ZNI A;  3TUY C;  1JSA A;  1EXR A;  1WRL A;  3DZT A;  1IIO A;  1AVS A;  2LVK A;  1KFU S;  2ZN8 A;  3D73 A;  3HCM A;  1C7V A;  2KLD A;  3AKB A;  3EVV A;  4CPV A;  1C3Y A;  2CCM A;  2E30 A;  1C3Z A;  4PE0 A;  1CFF A;  5JJG A;  2I2R E;  3S0B A;  3D74 A;  3SS4 A;  4MZJ A;  2OTG C;  5CSF A;  1ZFS A;  1QX7 A;  1PUL A;  1UHK A;  4I5L B;  1MWN A;  3BYA A;  1TOP A;  1NCZ A;  4ORA B;  4PAL A;  1F55 A;  1IKU A;  2LHL A;  1KSM A;  2PMY A;  4YGC B;  1XFU O;  4HRG A;  4N5X A;  3O2P A;  2AAO A;  5AXI A;  3EG5 B;  2Y1N A;  1TCF A;  1NIW A;  5PAL A;  3TS5 C;  2KGB C;  1XK4 C;  1TNW A;  1DMO A;  1CDN A;  2F33 A;  1K96 A;  3BFB A;  2KAV A;  1B7T Y;  2KI6 C;  1YVL A;  1SNL A;  2A4J A;  1GGZ A;  5AEQ A;  4A4C A;  1DTL A;  1TUZ A;  3LCP C;  4NQG A;  1QX2 A;  2M7N A;  3OB1 B;  1KQV A;  2CXJ A;  4DUQ A;  2K61 A;  2ZFD A;  1DJG A;  1CM4 A;  1QJT A;  1GJY A;  4PCW A;  1FBV A;  1GQM A;  2L0P A;  1MXE A;  1G4Y R;  2WC6 A;  2LE9 B;  1TNX A;  3I5I C;  3FE6 A;  5HLO A;  2WOS A;  3CYZ A;  1QAT A;  1YR5 A;  1K2H A;  4DRW A;  2M8U A;  4YI8 A;  3PLF B;  1JUO A;  2KAX A;  3N7H A;  2JXC A;  1SPY A;  3BXK A;  3FE9 A;  4USL A;  2KFH A;  2ISD A;  3S0G A;  1QXP A;  1SL8 A;  1WLM A;  4GFT A;  3ICB A;  1YRU B;  1LXF C;  1CTR A;  1QIW A;  1DJH A;  2IS9 A;  2H8V A;  1ALW A;  4JD9 A;  1CFD A;  1YUS A;  5JOL A;  4IL1 A;  1TN4 A;  2M1K B;  4GGF C;  1KK7 Z;  2PRU A;  2M9G A;  3PN7 C;  1F4O A;  2K2A A;  4P5O E;  3FIA A;  2KFG A;  3S0E A;  1CFC A;  2L4I A;  3SIB A;  1RFJ A;  2F8P A;  4OR9 B;  3VGO A;  1AP4 A;  1CMG A;  1PRW A;  1YX7 A;  3VRQ A;  2Y4Q A;  1EJ3 A;  1F71 A;  1UHJ A;  3E3R A;  2JPO A;  3S0D A;  1NCY A;  2I7A A;  3I5G C;  4ICB A;  1CB1 A;  1EG4 A;  1W7J B;  5HKY A;  1QVI Y;  1YVH A;  2OPO A;  3OBV A;  4MN0 A;  1D1O A;  1SL9 A;  4MEW A;  3CS1 A;  1LVC D;  1KWO B;  1MUX A;  3WNX B;  1M63 B;  2LVV A;  3KF9 A;  4ZCU A;  4D1E A;  1Z2C B;  1F70 A;  4AQJ A;  1HQV A;  4ORB B;  1NPQ A; 
#chains in the Genus database with same CATH homology
 3I5F C;  1A75 A;  2R2I A;  3DVE A;  4CFQ A;  3PSR A;  3SG7 A;  2GGZ A;  1PVA A;  4YGB B;  1DF0 A;  3SG6 A;  1PK0 D;  4DCK A;  2L98 A;  4XYN A;  1EL4 A;  4NDD A;  1DT7 B;  3KHE A;  3BQ3 A;  2BEC A;  2JPT A;  3EVR A;  4MZL A;  1BMO A;  2KQY A;  2MA2 A;  2PVB A;  1MQ1 A;  2JTT A;  2L51 A;  1MHO A;  1Q80 A;  4MSP A;  1SY9 A;  1PSR A;  1VRK A;  1BOD A;  4BY4 A;  1XFX O;  1NX1 A;  1F4Q A;  1Y1A A;  4WQ2 A;  5ER5 A;  1QV1 A;  2BCB A;  1A2X A;  1LA0 A;  2WCF A;  1CDP A;  1SBJ A;  2LMV A;  2EC6 B;  4MBE A;  1V1G A;  3EKJ A;  3NXA A;  1V1F A;  1Y1X A;  2Q91 A;  3D0Y B;  3GK4 X;  1Y0V H;  1JC2 A;  3SG5 A;  4GNK B;  4MRX A;  1E8A A;  2MJW B;  1SL7 A;  2KOT A;  1QTX A;  1SR6 B;  2LVI A;  4M2Q A;  2KNE A;  1ZAC A;  3GOF A;  3O6B A;  3PAT A;  5B8I B;  2JOJ A;  1M39 A;  4HRH A;  1HT9 A;  2BE6 A;  2JT8 A;  1DVI A;  1BG1 A;  4OV2 A;  2F3Z A;  5I2Q A;  2GGM A;  3OHM B;  2MLE C;  4P2Y B;  1DJY A;  1J7O A;  1S6J A;  5D69 A;  2ZRT A;  5HKZ A;  3LK0 A;  5KTY A;  1QIV A;  1WY9 A;  1MR8 A;  2KAY A;  4PHJ A;  2I94 A;  2JU0 A;  4XJK B;  1BR1 B;  1CLL A;  3WHU B;  1KWO C;  4QJ4 B;  2TN4 A;  2WOR A;  2KGR A;  1UUS A;  1ODB A;  2FCE A;  1NUB A;  3WHT B;  2OS8 B;  1ZMZ A;  2H2K A;  3IF7 A;  5DKN A;  1DJW A;  1SCM C;  2M49 B;  4GGF A;  1B1G A;  5HLV A;  3TZ1 A;  1JF2 A;  2LV7 A;  2JNF A;  1KSO A;  2KHN A;  4ZCV A;  1XO5 A;  2KDH A;  4PE7 A;  4N1F A;  4Q04 A;  4QJ3 B;  1CDM A;  1XYD A;  2K7D A;  4N1G A;  4GUK A;  1B4C A;  4PE1 A;  3FWC A;  1UWO A;  3O4Y A;  4E68 A;  2EC6 C;  3JVT C;  2K2F A;  4JWQ A;  2CTN A;  3FS7 A;  4WQ3 A;  1ZOT B;  1J1E A;  5DKR A;  1EH2 A;  1WDC B;  1XFY O;  2EHB A;  4I5K A;  3KO0 A;  5AAN A;  1CLM A;  2HQW A;  1DJZ A;  1IQ5 A;  4OVN F;  4C0L A;  1BU3 A;  1SR6 C;  1OZO A;  2L2E A;  3AAJ A;  4I5N B;  2G9B A;  5FYX A;  2PAL A;  4CFR A;  4YI9 A;  2LAN A;  1S5G Z;  1EG3 A;  2BBM A;  4AQI A;  3BUX B;  3VRP A;  4MLW A;  1CMF A;  1YUR A;  2LMT A;  1ZUZ A;  3CLN A;  1F8H A;  1SCV A;  1OMR A;  1OZS A;  2Y5I A;  2M1U A;  3H4S E;  1BJF A;  1CDL A;  2NLN A;  2QAC A;  5AFP A;  1YUT A;  1NCX A;  1JWD A;  3DF0 B;  1B8L A;  1IQ3 A;  2FCD A;  2O60 A;  4JQ0 D;  3JTD B;  2BCX A;  1K90 D;  2Y1M A;  1OE9 B;  1M45 A;  1TIZ A;  1B47 A;  3OP0 A;  4FTG A;  5J3X A;  5KSZ A;  1IJ6 A;  3D10 A;  1MXL C;  1QV0 A;  2OS8 C;  3DVM A;  1ALV A;  2FJU B;  3A4U B;  1IJ5 A;  2KI4 B;  2I18 A;  2AUC A;  1J1D A;  3EKH A;  1C7W A;  3FWB A;  3TDI A;  1CM1 A;  1UHI A;  2COL B;  4CID A;  2LC5 A;  3NSL A;  2ZRS A;  2KBI A;  1U5I A;  4YGA A;  1A75 B;  4A4B A;  1XFW O;  2LVJ A;  3SG3 A;  1TNP A;  1KQM B;  1KK7 Y;  3CR4 X;  4OCI A;  2D8N A;  2HF5 A;  1KK8 B;  2MBX A;  2K7B A;  3F45 A;  1B8C A;  1M31 A;  5I2O A;  1WLZ A;  3HX4 A;  1RJV A;  3NSO A;  1K9U A;  1REC A;  3BUM B;  4HRE E;  3TUY B;  1JFK A;  3C1V A;  2WCB A;  1A29 A;  1WDC C;  1UHH A;  1RK9 A;  5DKQ A;  3DVK A;  1J55 A;  3CTN A;  1NSH A;  2SAS A;  1KFX S;  2M29 A;  2MAZ A;  2FOT A;  2ZKM X;  3KEV A;  5CPV A;  2ZND A;  1SK6 D;  4YRU A;  2CT9 A;  4MZK A;  1XA5 A;  5CSJ A;  4DIR A;  2VRG A;  2LHI A;  4HSZ A;  3MSE B;  2HQ8 A;  2MLF C;  1S26 D;  2B1U A;  2NZ0 A;  5I8N A;  1R2U A;  1G8I A;  2JC2 A;  1XK4 A;  3BOW B;  1IRJ A;  1H4B A;  2NXQ A;  2L4H A;  1RWY A;  3BUW B;  1AK8 A;  4R1E A;  1AUI B;  2BL0 B;  2V53 A;  1XFZ O;  2LLS A;  3D0Y A;  3EK4 A;  3JTD C;  1W7I B;  3CR5 X;  2F2P A;  2LP2 A;  1SMG A;  1A03 A;  3TDU A;  2KQ6 A;  4YGE B;  1S6C A;  1DGV A;  4NDB A;  1YTZ C;  2KYC A;  2Q4U A;  1IWQ A;  1SW8 A;  1X02 A;  2KI4 C;  4GGN A;  1QLS A;  4M2P A;  1K9P A;  1GGW A;  2F3Y A;  1SKT A;  2LUC A;  3PAL A;  1TNQ A;  1LA3 A;  3KPX A;  2GV5 A;  3AKA A;  2JTZ A;  1MF8 B;  2ZN9 A;  2JQ6 A;  4GBA A;  3AAK A;  1KQM C;  3GK1 A;  2JUL A;  1L2O B;  4PE4 A;  1CNP A;  3EVU A;  5HKW A;  5AER A;  5IBW A;  1J7P A;  1SRA A;  1PVB A;  4XJK A;  1NYA A;  3NSK A;  3I5H B;  1KFU L;  1UP5 A;  3CWG A;  1B7T Z;  2KYF A;  1G33 A;  1PSB A;  2LP3 A;  5HYD A;  4C0J A;  5D7F A;  1BLQ A;  1S1E A;  4BY5 A;  3I5G B;  2H61 C;  1DJX A;  1WRK A;  2G2B A;  1BOC A;  2WC8 A;  3SIA A;  1NWD A;  3TDZ A;  2MRD A;  1BR4 B;  4YBH B;  2M0R A;  1QLK A;  3PM8 A;  2LCP A;  1OOJ A;  4U8D A;  2BE4 A;  2CNP A;  3I5F B;  3PFV A;  1M46 A;  2WCE A;  1CLB A;  4GAO A;  1IG5 A;  1K95 A;  1J7R A;  3OX6 A;  1OMV A;  2BCA A;  1FPW A;  4PHN A;  4WRI A;  2BL0 C;  2M3W A;  3SG2 A;  5GQQ C;  1DGU A;  3LK1 A;  1N65 A;  1S6I A;  2EGD A;  4PHK A;  4PDZ A;  2M7L A;  1F54 A;  3BUO B;  1TCO B;  2NCP A;  5CSN A;  1RRO A;  1UHN A;  1B9A A;  3IQQ A;  4CLN A;  1NX3 A;  2K7C A;  1AJ5 A;  3CGA A;  2KBM A;  5TNC A;  3CR2 A;  4ORC B;  1LIN A;  3LL8 B;  1QVI Z;  1LKJ A;  2K8M B;  3DVJ A;  1OMD A;  3GK2 A;  5CSI A;  3DD4 A;  3VRN A;  2KI6 D;  2BBN A;  2BKI B;  1K94 A;  1S5G Y;  1IGV A;  3ZWH A;  1K8U A;  4MRY A;  3IQO A;  1S3P A;  1L2O C;  1QX5 B;  2LLT A;  2HPS A;  2P6B B;  3DF0 A;  1K9K A;  3QRX A;  1U5I B;  3I5H C;  1Y6W A;  5I2L A;  1DF0 B;  4PHM A;  1PAL A;  2DOQ A;  4MVF A;  2F2O A;  2L5X B;  2LLU A;  3RM1 A;  1K93 D;  2K0J A;  1S36 A;  1BT6 A;  1YX8 A;  5G08 A;  2KSP A;  3O78 A;  1N0Y A;  1YUU A;  4L9M A;  5KU1 A;  1N2D A;  2K7O A;  2O5G A;  4UPG A;  1YRT B;  1JF0 A;  2MHH A;  1NX0 A;  1FF1 A;  1FI6 A;  1IH0 A;  2LUX A;  2OTG B;  1BF5 A;  1AHR A;  1A4P A;  3VRR A;  1SCM B;  5ER4 X;  1AJ4 A;  2CBL A;  1C07 A;  4F0Z B;  5K89 A;  1H8B A;  2BKH B;  1R6P A;  3SJS A;  3A8R A;  2JRF A;  4C0K A;  2PAS A;  1FI5 A;  2L50 A;  3BUN B;  2JNX A;  1CKK A;  2NCO A;  3TS5 B;  2H61 A;  1KCY A;  1KFX L;  4QJ5 B;  3SG4 A;  4ETO A;  1B8R A;  2AMI A;  4GPL B;  1JBA A;  4DS7 A;  2E6W A;  3RLZ A;  2HET A;  3JVT B;  2LM5 A;  4YGD B;  1OSA A;  2SCP A;  2JZI A;  1JFJ A;  4I5J A;  5F6T A;  1NX2 A;  4TNC A;  1L7Z A;  2LMU A;  2JXL A;  3VRO A;  4AOM A;  3OB2 B;  3I5I B;  1XFV O;  3EK8 A;  3LLE A;  3M0W A;  2LAP A;  2QPT A;  1DJI A;  1NP8 A;  3EK7 A;  2PSR A;  3OX5 A;  5BPJ A;  3BOW A;  1CFP A;  1QAS A;  1RTP 1;  2JT3 A;  3K21 A;  1SYM A;  2JT0 A;  2JWW A;  1J7Q A;  3CZT X;  1TTX A;  1UUR A;  2M97 A;  1WRZ A;  3NSI A;  1XVJ A;  4NDC A;  1QS7 A;  4OKH A;  2KFF A;  1TRF A;  1FW4 A;  1KK8 C;  1OQP A;  2ZNE A;  4M2O A;  1Y1U A;  2WND A;  3PN7 B;  4JPZ B;  2LNK A;  4FQO A;  3WXA A;  2RGI A;  3ZNI A;  3TUY C;  1JSA A;  1EXR A;  1WRL A;  1AVS A;  2LVK A;  1KFU S;  2ZN8 A;  3HCM A;  1C7V A;  3AKB A;  3EVV A;  4CPV A;  2CCM A;  2E30 A;  4PE0 A;  1CFF A;  5JJG A;  2I2R E;  4MZJ A;  2OTG C;  5CSF A;  1ZFS A;  1QX7 A;  1PUL A;  1UHK A;  4I5L B;  1MWN A;  3BYA A;  1TOP A;  1NCZ A;  4ORA B;  4PAL A;  1F55 A;  1IKU A;  2LHL A;  1KSM A;  2PMY A;  4YGC B;  1XFU O;  4HRG A;  4N5X A;  3O2P A;  2AAO A;  5AXI A;  2Y1N A;  1TCF A;  1NIW A;  5PAL A;  3TS5 C;  2KGB C;  1XK4 C;  1TNW A;  1DMO A;  1CDN A;  2F33 A;  1K96 A;  2KAV A;  1B7T Y;  2KI6 C;  1YVL A;  1SNL A;  2A4J A;  1GGZ A;  5AEQ A;  4A4C A;  1DTL A;  3LCP C;  4NQG A;  1QX2 A;  2M7N A;  3OB1 B;  1KQV A;  2CXJ A;  4DUQ A;  2K61 A;  2ZFD A;  1DJG A;  1CM4 A;  1QJT A;  1GJY A;  4PCW A;  1FBV A;  1GQM A;  2L0P A;  1MXE A;  1G4Y R;  2LE9 B;  1TNX A;  3I5I C;  5HLO A;  2WOS A;  1QAT A;  1YR5 A;  1K2H A;  4DRW A;  2M8U A;  4YI8 A;  3PLF B;  1JUO A;  2KAX A;  2JXC A;  1SPY A;  3BXK A;  4USL A;  2KFH A;  2ISD A;  1QXP A;  1SL8 A;  1WLM A;  4GFT A;  3ICB A;  1YRU B;  1LXF C;  1CTR A;  1QIW A;  1DJH A;  2IS9 A;  1ALW A;  5JOL A;  1CFD A;  1YUS A;  4IL1 A;  1TN4 A;  2M1K B;  4GGF C;  1KK7 Z;  2PRU A;  2M9G A;  3PN7 C;  1F4O A;  2K2A A;  4P5O E;  3FIA A;  2KFG A;  1CFC A;  2L4I A;  3SIB A;  1RFJ A;  2F8P A;  4OR9 B;  3VGO A;  1AP4 A;  1CMG A;  1PRW A;  1YX7 A;  3VRQ A;  2Y4Q A;  1EJ3 A;  1F71 A;  1UHJ A;  3E3R A;  1NCY A;  2I7A A;  3I5G C;  4ICB A;  1CB1 A;  1EG4 A;  1W7J B;  5HKY A;  1QVI Y;  1YVH A;  2OPO A;  4MN0 A;  1D1O A;  1SL9 A;  4MEW A;  3CS1 A;  1LVC D;  1KWO B;  1MUX A;  3WNX B;  1M63 B;  2LVV A;  3KF9 A;  4ZCU A;  4D1E A;  1F70 A;  4AQJ A;  1HQV A;  4ORB B;  1NPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...