2FCDA

Solution structure of n-lobe myosin light chain from saccharomices cerevisiae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the interaction of the myosin light chain Mlc1p with the myosin V Myo2p IQ motifs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords Myosin light chain 1
total genus 17
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2fcdA00
1JFKA 1LA0A 1SK6D 3A4UB 1DF0A 2LLUA 5IBWA 1ZMZA 1Y1UA 3PALA 1ALWA 1R6PA 2L50A 4YGEB 1KK7Y 3TUYC 1GQMA 4ETOA 4CIDA 2M3WA 1YURA 1LXFC 2L4IA 2L5XB 2FCDA 1WLZA 3OX5A 2P6BB 1OMRA 2BBNA 2CBLA 1BU3A 4YI8A 3PFVA 4YI9A 2Q4UA 1OMVA 5DKNA 2KGBC 2KSPA 3FIAA 4PCWA 1DJXA 1MWNA 3PSRA 2WC8A 2EGDA 1U5IA 5PALA 1S6CA 3BUOB 5CPVA 2JT3A 4L9MA 1KCYA 2M8UA 1B7TZ 1QTXA 2BL0C 1PRWA 2ZKMX 1K9KA 2L51A 1A4PA 1DJHA 5DKQA 1QS7A 2LVJA 1YUTA 1SL9A 1YUUA 2K2AA 3QRXA 2BKIB 2NCOA 4JWQA 1NWDA 2AMIA 2JWWA 2BL0B 1UUSA 4AQIA 3SJSA 2K7CA 3EKHA 4MBEA 1DMOA 2MLFC 1QV0A 1BR4B 1OZOA 1RK9A 1QXPA 1RECA 2E6WA 5KTYA 3VRQA 1DGUA 3CR4X 4YGBB 3CWGA 2ZFDA 3CS1A 2AUCA 1WLMA 1TNPA 3H4SE 1SKTA 2BECA 4XJKB 1CFDA 1M45A 4MRXA 1RWYA 2GGZA 3PM8A 2M49B 3BUNB 1W7JB 1KFXS 2LVKA 4BY5A 1S5GZ 4HREE 2KFHA 1F4QA 1M31A 1CDPA 2G2BA 2EHBA 3BUMB 5G08A 1BODA 1DT7B 1AUIB 3DVKA 3EK4A 2KI6C 3WHUB 1SYMA 1PALA 2IS9A 4E68A 5AANA 3JTDC 2JPTA 4D1EA 4QJ4B 2M1UA 1B4CA 4MZJA 1EJ3A 2KAYA 1K93D 2LC5A 5I2OA 3DD4A 2LHIA 5AERA 4PE7A 4HSZA 4MZLA 2NCPA 5J3XA 1SPYA 3CTNA 1M46A 2L0PA 4QJ5B 3HCMA 1CM4A 1W7IB 2I94A 4ORCB 1KQMC 1SL8A 3SIAA 3O6BA 1F71A 3TS5C 1IRJA 1XFXO 1SW8A 1UHNA 1ZFSA 4UPGA 2LCPA 4TNCA 1CTRA 1TNWA 2TN4A 2WNDA 1KSMA 2Y1NA 1BF5A 1JBAA 4WQ2A 3NSIA 1TIZA 3ICBA 1KK8C 4DIRA 1S36A 1Q80A 3O78A 1KFUL 3NSOA 4MZKA 3A8RA 1MQ1A 1OOJA 2LMTA 2CTNA 1PK0D 2JNFA 1EG3A 5FYXA 5CSNA 2JXCA 2LNKA 1SCVA 2KI6D 3IQQA 4YGCB 1QASA 4JQ0D 1XVJA 2H61C 2Y5IA 1TN4A 2H2KA 2R2IA 1JWDA 1TTXA 1K2HA 1FF1A 1QV1A 2A4JA 3SG6A 1RTP1 3VRPA 3SG7A 3VRNA 1BT6A 1L7ZA 1VRKA 3F45A 4M2PA 2CXJA 3GK1A 3CLNA 1WDCC 4MSPA 1NCZA 2WCFA 5D7FA 1BR1B 1IJ6A 1D1OA 3LK1A 1S5GY 1M39A 3WNXB 3I5GB 1HT9A 2M0RA 3BOWA 1NUBA 1F70A 2KBMA 1TRFA 2ZN9A 1CNPA 1PVBA 2MRDA 3O4YA 2K7DA 2OTGB 4NDBA 5DKRA 1A2XA 3DF0B 4C0KA 1CFCA 1H8BA 1DJZA 2K8MB 1B8CA 2LP3A 3RM1A 4C0JA 1KQVA 1F8HA 3BXKA 1XK4C 4FQOA 4NQGA 1CFPA 2BCAA 2MLEC 2KFGA 2PALA 2F3ZA 2WCEA 4GBAA 1MUXA 1TNQA 1K90D 4PE4A 4MRYA 1SNLA 3AKBA 4ZCVA 1B8LA 1IJ5A 1KFXL 1JSAA 1J7RA 1F4OA 2BE4A 2F2PA 2V53A 4I5LB 4NDDA 1AK8A 1TCOB 5I2QA 1JUOA 4OR9B 3DVJA 1PSRA 4PDZA 2KHNA 2KYFA 5KSZA 1QIVA 1SCMC 1RROA 1MXLC 5JJGA 3IQOA 1ZUZA 1BMOA 2LANA 2KQYA 3FS7A 1B47A 1UHJA 2ZNEA 1BG1A 3BYAA 2GV5A 1QLSA 1TNXA 2LE9B 1YTZC 4F0ZB 2OS8B 1YRTB 3SG3A 2JRFA 5TNCA 1QX5B 2Y4QA 3SIBA 5CSFA 5B8IB 1K95A 3I5IC 4FTGA 2I2RE 2KNEA 5HLVA 4QJ3B 3BUXB 1XO5A 1A29A 1QX7A 1CLMA 3GOFA 4U8DA 3CR2A 1A75A 3TDUA 1YVHA 1F54A 3KF9A 2CT9A 1CMGA 1OZSA 1AJ4A 3NXAA 1SBJA 1XFYO 1S6JA 2JNXA 1S3PA 2F3YA 2WOSA 1JC2A 1CDNA 4ORBB 1OMDA 1Y6WA 3LL8B 3OB1B 3EVRA 2ZRTA 2LM5A 1YRUB 1U5IB 1NX3A 3JVTC 1XFZO 3D10A 4OKHA 4P2YB 4CPVA 2KI4C 2LVVA 3EVVA 4NDCA 2KFFA 4XJKA 1B8RA 2KI4B 2I18A 3K21A 2LLTA 4M2QA 3WHTB 2COLB 3PN7B 1XFUO 4DS7A 2H61A 2RGIA 4N1FA 2BCBA 4BY4A 3BUWB 4AOMA 1IQ5A 1Y0VH 2LHLA 1KK8B 1DTLA 1M63B 2L4HA 2LVIA 2K0JA 1KFUS 2LUCA 2KOTA 2JOJA 1NPQA 3ZWHA 1DF0B 4ZCUA 2BCXA 1DVIA 2PMYA 5I8NA 2OPOA 3RLZA 1JF0A 2DOQA 1SMGA 1YX8A 4GUKA 3SG4A 2LMVA 4PHJA 3VRRA 4PHMA 5BPJA 3PATA 4PE0A 2PASA 1C7WA 2F8PA 2M7LA 3IF7A 1QVIY 2KYCA 1WRLA 2CCMA 4DRWA 1XK4A 1CM1A 2KAXA 3GK2A 2PRUA 3EVUA 2JT8A 2MAZA 4YGAA 3LLEA 2O5GA 1YX7A 5HKWA 2LMUA 2CNPA 3E3RA 1CDLA 1KWOB 1PVAA 2WORA 4PHKA 5F6TA 2E30A 2M1KB 1BOCA 4I5JA 1FI5A 1CB1A 2JULA 1BLQA 1DGVA 2BKHB 1E8AA 2F33A 4N5XA 1WY9A 1CDMA 5CSJA 2HQWA 1AVSA 1NYAA 1K9PA 2HPSA 2LP2A 2VRGA 3JVTB 2JU0A 1CMFA 1MF8B 4OVNF 3SG2A 1ZACA 2BE6A 2K2FA 1AJ5A 2JTZA 2O60A 1WRKA 4GFTA 4GGNA 4JPZB 4P5OE 3VROA 1FI6A 2GGMA 1NP8A 4XYNA 5I2LA 4A4BA 2HQ8A 2G9BA 2MA2A 1ODBA 2JQ6A 5GQQC 1UURA 1YUSA 3CZTX 5AFPA 3EKJA 3LK0A 3PLFB 4IL1A 2JXLA 1QX2A 3NSLA 1XA5A 3HX4A 1EL4A 2PVBA 1GGWA 4Q04A 1F55A 2M97A 3VGOA 3ZNIA 3AAKA 5HYDA 3AKAA 3I5IB 1ZOTB 1HQVA 3CR5X 3DVMA 1OE9B 2D8NA 3SG5A 5ER4X 1FPWA 3EK7A 3PN7C 5KU1A 3BQ3A 1NCYA 3TZ1A 1J1DA 1G33A 1LVCD 4A4CA 2LAPA 1J55A 1XYDA 1SR6B 1TCFA 3BOWB 2FOTA 5ER5A 3FWCA 4GPLB 1G4YR 1SY9A 1IQ3A 2FCEA 1DJYA 1EG4A 1AP4A 2L98A 3M0WA 1B1GA 4I5KA 1UP5A 2ZN8A 1DJWA 1DJIA 2JTTA 3I5HB 3OP0A 1B9AA 1UWOA 2EC6B 1EH2A 1H4BA 2Y1MA 4GGFC 1CKKA 2B1UA 1IWQA 1J7OA 4PE1A 4MN0A 1WRZA 3O2PA 2Q91A 3OHMB 2EC6C 3CGAA 4C0LA 4GGFA 3NSKA 1NCXA 2NLNA 1C7VA 1KWOC 2M9GA 3TS5B 1Y1XA 2KBIA 3D0YB 1JFJA 2MHHA 1A75B 4HRHA 3I5FB 1MHOA 2M7NA 1G8IA 1K8UA 5HKZA 4I5NB 1EXRA 1MR8A 5AXIA 3KO0A 4PALA 1SR6C 1MXEA 4USLA 5D69A 1CLBA 1QIWA 4OV2A 3KPXA 2OTGC 1N65A 4WQ3A 3C1VA 1ALVA 2OS8C 4DUQA 1L2OC 4CFRA 2PSRA 1KSOA 4GAOA 1UHHA 1XFVO 4YBHB 1V1GA 4MLWA 1FW4A 2QACA 4CLNA 1DJGA 3EK8A 3I5FC 1QATA 2LLSA 5AEQA 2KQ6A 3KEVA 1S1EA 2JC2A 1IGVA 1BJFA 2I7AA 2KDHA 4M2OA 2SASA 1Y1AA 3MSEB 4PHNA 2AAOA 1IG5A 1LKJA 3FWBA 1KQMB 1S6IA 2K7OA 4OCIA 1L2OB 4ICBA 2ZRSA 1JF2A 4R1EA 1S26D 1QVIZ 1CFFA 2ISDA 4YGDB 1IKUA 2M29A 3TDIA 1B7TY 2BBMA 4MVFA 5HKYA 1SCMB 1RFJA 2HF5A 1FBVA 1GGZA 2KGRA 4N1GA 1C07A 3TUYB 3OB2B 1J7QA 4ORAB 1PULA 3DVEA 2WCBA 1TOPA 1A03A 5JOLA 2ZNDA 1OSAA 4WRIA 3DF0A 1NSHA 4DCKA 2HETA 1K9UA 2JT0A 1R2UA 1CLLA 1RJVA 3I5HC 2QPTA 1IH0A 3AAJA 2K7BA 4HRGA 1NIWA 1KK7Z 1PSBA 1YR5A 3OX6A 3I5GC 1K96A 1LINA 3WXAA 1NX0A 1QJTA 3GK4X 2F2OA 1NX1A 1J7PA 1N0YA 2K61A 3LCPC 4YRUA 2JZIA 1SL7A 2NZ0A 4AQJA 2FJUB 1J1EA 1GJYA 1OQPA 1QLKA 1AHRA 1UHKA 1NX2A 1V1FA 2MJWB 2NXQA 4GNKB 3D0YA 5CSIA 2KAVA 1UHIA 2L2EA 5K89A 1LA3A 2MBXA 4CFQA 1XFWO 2LUXA 1X02A 2LV7A 3JTDB 3KHEA 1K94A 1SRAA 4MEWA 2SCPA 1YVLA 5HLOA 3TDZA 1N2DA 1WDCB
chains in the Genus database with same CATH superfamily
1JFKA 1LA0A 1SK6D 3A4UB 2L2CA 1DF0A 2LLUA 1OOGA 5IBWA 1ZMZA 1Y1UA 3PALA 1ALWA 3Q8IA 1R6PA 2L50A 4YGEB 1KK7Y 3TUYC 1GQMA 4ETOA 4CIDA 1TUZA 2M3WA 1YURA 1LXFC 2L4IA 2L5XB 2FCDA 1WLZA 3OX5A 2P6BB 3S0GA 1OMRA 2BBNA 2JPOA 2CBLA 1BU3A 3DY9A 4YI8A 3PFVA 4YI9A 2Q4UA 3BFBA 1OMVA 5DKNA 2KGBC 2KSPA 3FIAA 4PCWA 1DJXA 4IJ7A 1MWNA 3PSRA 2WC8A 2EGDA 1U5IA 5PALA 1S6CA 3BUOB 5CPVA 2JT3A 1OOIX 4L9MA 1KCYA 2M8UA 1B7TZ 1QTXA 2BL0C 4OZDA 3S0DA 1PRWA 3R72A 2ZKMX 1K9KA 2L51A 1A4PA 1DJHA 5DKQA 1QS7A 2LVJA 1YUTA 1SL9A 1YUUA 1TUJA 2K2AA 3QRXA 2BKIB 2NCOA 4JWQA 1NWDA 2AMIA 2JWWA 2BL0B 1UUSA 3SS5A 4AQIA 3SJSA 2K7CA 5FI2A 3EKHA 4MBEA 1DMOA 2MLFC 1QV0A 1BR4B 3R1OA 1OZOA 1RK9A 5I94A 1LS8A 1QXPA 1RECA 2E6WA 5KTYA 1OOHA 3VRQA 1DGUA 3DXLA 3CR4X 4YGBB 3CWGA 2ZFDA 3CS1A 2AUCA 1WLMA 1TNPA 2QDIA 3H4SE 1SKTA 2BECA 2FJYA 4XJKB 1CFDA 1M45A 4MRXA 1RWYA 2GGZA 3PM8A 2M49B 3BUNB 3L4LA 1W7JB 1KFXS 2LVKA 4BY5A 1S5GZ 4HREE 2KFHA 1F4QA 1M31A 1CDPA 2G2BA 2EHBA 3BUMB 5G08A 1BODA 1DT7B 1AUIB 3DVKA 3EK4A 2KI6C 3WHUB 1SYMA 1PALA 2IS9A 4E68A 1W9ZA 2YGUA 2WC5A 5AANA 3JTDC 2JPTA 4D1EA 4QJ4B 2M1UA 2WC6A 1B4CA 4MZJA 1EJ3A 2KAYA 1K93D 2LC5A 4JD9A 3VB1A 3D77A 5I2OA 3DD4A 2LHIA 5AERA 3B87A 4PE7A 3FE8A 4HSZA 4MZLA 2NCPA 5J3XA 1SPYA 3CTNA 1M46A 2L0PA 4QJ5B 3HCMA 1CM4A 1W7IB 2I94A 4ORCB 1KQMC 1SL8A 3SIAA 3O6BA 1F71A 3TS5C 1IRJA 1XFXO 1SW8A 3IVTA 1UHNA 1ZFSA 4UPGA 2LCPA 4TNCA 1CTRA 1TNWA 2TN4A 2WNDA 1KSMA 2Y1NA 1BF5A 1JBAA 4WQ2A 3NSIA 1TIZA 3ICBA 1KK8C 4DIRA 1S36A 1DQEA 1TWOA 1Q80A 3O78A 5EL2A 1KFUL 3NSOA 4MZKA 3A8RA 1MQ1A 1OOJA 2LMTA 2CTNA 4F7FA 1PK0D 2JNFA 1EG3A 5FYXA 5CSNA 2JXCA 2LNKA 1SCVA 2KI6D 3IQQA 4YGCB 1QASA 4JQ0D 1XVJA 2H61C 2Y5IA 1TN4A 2H2KA 2R2IA 2WCMA 1TTXA 3NHIA 1JWDA 1K2HA 1FF1A 3S0FA 1QV1A 2A4JA 3SG6A 1RTP1 3B86A 3VRPA 3SG7A 3VRNA 1GM0A 1BT6A 1L7ZA 1VRKA 3F45A 4M2PA 2CXJA 3GK1A 3CLNA 1OW4A 1WDCC 3NGVA 4MSPA 1NCZA 2WCFA 5D7FA 1BR1B 1IJ6A 1D1OA 5D3OA 3LK1A 1S5GY 1M39A 3WNXB 2H8VA 3I5GB 1HT9A 2M0RA 3BOWA 1NUBA 1F70A 2KBMA 1TRFA 2ZN9A 2BNXA 1CNPA 1PVBA 2MRDA 3CZ0A 3O4YA 2K7DA 2OTGB 4NDBA 5DKRA 1A2XA 3BFAA 3OGNA 3DF0B 4C0KA 1CFCA 1H8BA 1DJZA 2K8MB 1B8CA 2LP3A 3SS3A 3RM1A 4C0JA 1KQVA 1F8HA 3BXKA 1XK4C 4FQOA 4NQGA 1CFPA 2BCAA 2MLEC 2KFGA 1XFRA 2F3ZA 2PALA 2WCEA 4GBAA 1MUXA 1TNQA 1K90D 4PE4A 4MRYA 1SNLA 3RZSA 3AKBA 4ZCVA 1B8LA 1IJ5A 1KFXL 1JSAA 1J7RA 1F4OA 2BE4A 2F2PA 2V53A 4I5LB 4FQTA 4NDDA 1AK8A 3O4XA 1TCOB 5I2QA 1JUOA 4OR9B 3DVJA 1PSRA 4PDZA 2KHNA 2KYFA 5KSZA 1QIVA 1SCMC 1RROA 1MXLC 5JJGA 3IQOA 1ZUZA 1BMOA 2LANA 2KQYA 3FS7A 1B47A 1UHJA 2KPHA 2ZNEA 1BG1A 3BYAA 3R1PA 2GV5A 1QLSA 1TNXA 2LE9B 1YTZC 4F0ZB 2OS8B 1YRTB 3SG3A 2JRFA 5TNCA 1QX5B 2Y4QA 3SIBA 5CSFA 5B8IB 2WCJA 1K95A 2WCKA 3I5IC 2I2RE 4FTGA 5FI7A 2KNEA 5HLVA 4QJ3B 3BUXB 1XO5A 1A29A 2QEHA 1QX7A 3DZTA 1CLMA 3GOFA 4U8DA 3CR2A 1A75A 3TDUA 1YVHA 1F54A 3KF9A 2CT9A 1CMGA 1OZSA 2PYQA 1AJ4A 3NXAA 5FI6A 1SBJA 1XFYO 1S6JA 2JNXA 1S3PA 2F3YA 2WOSA 1JC2A 1CDNA 4ORBB 1OMDA 1Y6WA 3LL8B 3OB1B 3EVRA 2ZRTA 2LM5A 3CZ2A 1YRUB 1U5IB 1NX3A 3JVTC 1XFZO 3D10A 4OKHA 4P2YB 4CPVA 2KI4C 2LVVA 3EVVA 4NDCA 2KFFA 3FE9A 4XJKA 1B8RA 2KI4B 2I18A 3K21A 2LLTA 3BJHA 4M2QA 2COLB 3PN7B 3WHTB 1XFUO 4DS7A 2H61A 2RGIA 4N1FA 2BCBA 4BY4A 3BUWB 4AOMA 1IQ5A 1P28A 1DC1A 1Y0VH 2LHLA 1ORGA 3S0BA 1KK8B 1DTLA 1M63B 2L4HA 2LVIA 2K0JA 1KFUS 2LUCA 3TDZA 2KOTA 2JOJA 1NPQA 3ZWHA 1DF0B 4ZCUA 2BCXA 1DVIA 2PMYA 5HL1A 5I8NA 2OPOA 3RLZA 1JF0A 2DOQA 1SMGA 1YX8A 4GUKA 3V2LA 3SG4A 2LMVA 4PHJA 3VRRA 4PHMA 5BPJA 2QEBA 3PATA 3B88A 4PE0A 2PASA 1C7WA 2F8PA 3EG5B 1DEKA 2M7LA 3IF7A 3S0EA 1QVIY 2KYCA 5DICA 1WRLA 2CCMA 4DRWA 1XK4A 1CM1A 2KAXA 3GK2A 2PRUA 3EVUA 2JT8A 2MAZA 4YGAA 3D74A 3LLEA 2O5GA 1YX7A 5HKWA 2LMUA 2CNPA 3E3RA 1CDLA 1KWOB 1PVAA 2WORA 4PHKA 2KLDA 2WCHA 5F6TA 2E30A 2M1KB 1BOCA 4I5JA 1FI5A 1CB1A 2JULA 1BLQA 1DGVA 2BKHB 1E8AA 2F33A 3PM2A 4N5XA 1WY9A 1CDMA 5CSJA 2HQWA 1AVSA 1NYAA 1K9PA 2HPSA 2LP2A 2VRGA 3JVTB 2JU0A 1T14A 3L4AA 3SS4A 1MF8B 1CMFA 4OVNF 3UO9A 3SG2A 1ZACA 2BE6A 2K2FA 1AJ5A 2JTZA 2O60A 1WRKA 4GFTA 4GGNA 4JPZB 4P5OE 3VROA 1FI6A 2GGMA 1NP8A 2QEVA 3CDNA 4XYNA 5I2LA 4A4BA 2HQ8A 2G9BA 2MA2A 1ODBA 2JQ6A 5GQQC 1UURA 1YUSA 3CZTX 5AFPA 3EKJA 3LK0A 3PLFB 4IL1A 2JXLA 1QX2A 3NSLA 1XA5A 3HX4A 1EL4A 2PVBA 1GGWA 4Q04A 1F55A 2M97A 3D78A 3VGOA 3ZNIA 3AAKA 5HYDA 3AKAA 3I5IB 1ZOTB 1HQVA 3CR5X 3NHTA 3DVMA 3FE6A 1OE9B 2D8NA 2P71A 3SG5A 5ER4X 1FPWA 3EK7A 3PN7C 5KU1A 3BQ3A 1NCYA 3TZ1A 1J1DA 1G33A 1LVCD 4A4CA 2LAPA 1J55A 1XYDA 1SR6B 1TCFA 3BOWB 2FOTA 5ER5A 3FWCA 2PQLA 4GPLB 1G4YR 1SY9A 1IQ3A 2FCEA 1DJYA 1EG4A 2QEOA 1AP4A 2L98A 3M0WA 1B1GA 4I5KA 1UP5A 2ZN8A 4JKTA 1DJWA 1DJIA 3B6XA 2JTTA 3I5HB 3OP0A 1B9AA 1UWOA 1IIOA 2EC6B 1EH2A 1H4BA 2Y1MA 4GGFC 1CKKA 2B1UA 1IWQA 1J7OA 4PE1A 4MN0A 1WRZA 3O2PA 2Q91A 3OHMB 2EC6C 3CGAA 4C0LA 4GGFA 2P70A 1Z4HA 1NCXA 2BAPA 2NLNA 3K1EA 3NSKA 1KWOC 1C7VA 2M9GA 3TS5B 1Y1XA 2KBIA 3D0YB 1JFJA 1OOFA 2MHHA 1A75B 4HRHA 4INXA 3I5FB 1MHOA 2M7NA 1G8IA 1K8UA 5HKZA 4I5NB 1EXRA 1MR8A 3CZ1A 5AXIA 3KO0A 4PALA 1SR6C 1MXEA 4USLA 5D69A 1CLBA 1QIWA 4OV2A 3KPXA 2OTGC 1N65A 4WQ3A 3C1VA 1ALVA 2OS8C 4DUQA 1L2OC 4KYNA 4CFRA 2PSRA 1KSOA 4GAOA 4PT1A 1UHHA 1XFVO 4YBHB 1V1GA 4MLWA 1FW4A 3OBVA 2QACA 4CLNA 1DJGA 3D75A 3EK8A 1SSEB 3I5FC 1QATA 2LLSA 5AEQA 2KQ6A 3KEVA 1S1EA 2JC2A 1IGVA 1BJFA 2I7AA 2KDHA 4M2OA 2SASA 1Y1AA 3MSEB 4PHNA 2AAOA 1IG5A 1LKJA 3FWBA 1KQMB 1S6IA 3PJIA 2K7OA 4OCIA 1L2OB 4ICBA 3CABA 2ZRSA 1JF2A 4R1EA 1S26D 1QVIZ 1CFFA 2ISDA 4YGDB 1IKUA 2M29A 3CYZA 1B7TY 3TDIA 2BBMA 4MVFA 5HKYA 1SCMB 1RFJA 2HF5A 1FBVA 3R1VA 1GGZA 2KGRA 3DYEA 4N1GA 1C07A 1C3YA 3TUYB 3BFHA 3OB2B 1J7QA 4ORAB 1PULA 3DVEA 2WCBA 1TOPA 1A03A 5JOLA 1DELA 2ZNDA 1OSAA 4WRIA 3DF0A 1NSHA 4DCKA 2HETA 1K9UA 2JT0A 1R2UA 1CLLA 1RJVA 3I5HC 2QPTA 2L5YA 3QMEA 1IH0A 3AAJA 1QWVA 2K7BA 4HRGA 1NIWA 1C3ZA 1KK7Z 1PSBA 1YR5A 2K60A 3OX6A 2ERBA 3I5GC 1K96A 1LINA 3WXAA 1NX0A 1QJTA 3GK4X 2F2OA 1NX1A 2WCLA 1N0YA 2K61A 1J7PA 3LCPC 4YRUA 2JZIA 1SL7A 2NZ0A 3D76A 2KLEA 4AQJA 2FJUB 3L47A 1J1EA 1GJYA 1OQPA 1QLKA 1AHRA 1UHKA 1NX2A 3UNWA 1V1FA 2MJWB 2NXQA 4GNKB 3D0YA 5CSIA 2KAVA 1UHIA 2L2EA 4INWA 5K89A 1LA3A 3N7HA 2GTEA 2MBXA 1XFWO 2LUXA 4CFQA 1X02A 2LV7A 3JTDB 3B7AA 3KHEA 1K94A 1SRAA 4MEWA 3S0AA 2SCPA 1YVLA 5HLOA 3D73A 1N2DA 1WDCB 1Z2CB
chains in the Genus database with same CATH topology
1JFKA 1LA0A 1SK6D 3A4UB 1DF0A 2LLUA 5IBWA 1ZMZA 1Y1UA 3PALA 1ALWA 1R6PA 2L50A 4YGEB 1KK7Y 3TUYC 1GQMA 4ETOA 4CIDA 2M3WA 1YURA 1LXFC 2L4IA 2L5XB 2FCDA 1WLZA 3OX5A 2P6BB 1OMRA 2BBNA 2CBLA 1BU3A 4YI8A 3PFVA 4YI9A 2Q4UA 1OMVA 5DKNA 2KGBC 2KSPA 3FIAA 4PCWA 1DJXA 1MWNA 3PSRA 2WC8A 2EGDA 1U5IA 5PALA 1S6CA 3BUOB 5CPVA 2JT3A 4L9MA 1KCYA 2M8UA 1B7TZ 1QTXA 2BL0C 1PRWA 2ZKMX 1K9KA 2L51A 1A4PA 1DJHA 5DKQA 1QS7A 2LVJA 1YUTA 1SL9A 1YUUA 2K2AA 3QRXA 2BKIB 2NCOA 4JWQA 1NWDA 2AMIA 2JWWA 2BL0B 1UUSA 4AQIA 3SJSA 2K7CA 3EKHA 4MBEA 1DMOA 2MLFC 1QV0A 1BR4B 1OZOA 1RK9A 1QXPA 1RECA 2E6WA 5KTYA 3VRQA 1DGUA 3CR4X 4YGBB 3CWGA 2ZFDA 3CS1A 2AUCA 1WLMA 1TNPA 3H4SE 1SKTA 2BECA 4XJKB 1CFDA 1M45A 4MRXA 1RWYA 2GGZA 3PM8A 2M49B 3BUNB 1W7JB 1KFXS 2LVKA 4BY5A 1S5GZ 4HREE 2KFHA 1F4QA 1M31A 1CDPA 2G2BA 2EHBA 3BUMB 5G08A 1BODA 1DT7B 1AUIB 3DVKA 3EK4A 2KI6C 3WHUB 1SYMA 1PALA 2IS9A 4E68A 5AANA 3JTDC 2JPTA 4D1EA 4QJ4B 2M1UA 1B4CA 4MZJA 1EJ3A 2KAYA 1K93D 2LC5A 5I2OA 3DD4A 2LHIA 5AERA 4PE7A 4HSZA 4MZLA 2NCPA 5J3XA 1SPYA 3CTNA 1M46A 2L0PA 4QJ5B 3HCMA 1CM4A 1W7IB 2I94A 4ORCB 1KQMC 1SL8A 3SIAA 3O6BA 1F71A 3TS5C 1IRJA 1XFXO 1SW8A 1UHNA 1ZFSA 4UPGA 2LCPA 4TNCA 1CTRA 1TNWA 2TN4A 2WNDA 1KSMA 2Y1NA 1BF5A 1JBAA 4WQ2A 3NSIA 1TIZA 3ICBA 1KK8C 4DIRA 1S36A 1Q80A 3O78A 1KFUL 3NSOA 4MZKA 3A8RA 1MQ1A 1OOJA 2LMTA 2CTNA 1PK0D 2JNFA 1EG3A 5FYXA 5CSNA 2JXCA 2LNKA 1SCVA 2KI6D 3IQQA 4YGCB 1QASA 4JQ0D 1XVJA 2H61C 2Y5IA 1TN4A 2H2KA 2R2IA 1JWDA 1TTXA 1K2HA 1FF1A 1QV1A 2A4JA 3SG6A 1RTP1 3VRPA 3SG7A 3VRNA 1BT6A 1L7ZA 1VRKA 3F45A 4M2PA 2CXJA 3GK1A 3CLNA 1WDCC 4MSPA 1NCZA 2WCFA 5D7FA 1BR1B 1IJ6A 1D1OA 3LK1A 1S5GY 1M39A 3WNXB 3I5GB 1HT9A 2M0RA 3BOWA 1NUBA 1F70A 2KBMA 1TRFA 2ZN9A 1CNPA 1PVBA 2MRDA 3O4YA 2K7DA 2OTGB 4NDBA 5DKRA 1A2XA 3DF0B 4C0KA 1CFCA 1H8BA 1DJZA 2K8MB 1B8CA 2LP3A 3RM1A 4C0JA 1KQVA 1F8HA 3BXKA 1XK4C 4FQOA 4NQGA 1CFPA 2BCAA 2MLEC 2KFGA 2PALA 2F3ZA 2WCEA 4GBAA 1MUXA 1TNQA 1K90D 4PE4A 4MRYA 1SNLA 3AKBA 4ZCVA 1B8LA 1IJ5A 1KFXL 1JSAA 1J7RA 1F4OA 2BE4A 2F2PA 2V53A 4I5LB 4NDDA 1AK8A 1TCOB 5I2QA 1JUOA 4OR9B 3DVJA 1PSRA 4PDZA 2KHNA 2KYFA 5KSZA 1QIVA 1SCMC 1RROA 1MXLC 5JJGA 3IQOA 1ZUZA 1BMOA 2LANA 2KQYA 3FS7A 1B47A 1UHJA 2ZNEA 1BG1A 3BYAA 2GV5A 1QLSA 1TNXA 2LE9B 1YTZC 4F0ZB 2OS8B 1YRTB 3SG3A 2JRFA 5TNCA 1QX5B 2Y4QA 3SIBA 5CSFA 5B8IB 1K95A 3I5IC 4FTGA 2I2RE 2KNEA 5HLVA 4QJ3B 3BUXB 1XO5A 1A29A 1QX7A 1CLMA 3GOFA 4U8DA 3CR2A 1A75A 3TDUA 1YVHA 1F54A 3KF9A 2CT9A 1CMGA 1OZSA 1AJ4A 3NXAA 1SBJA 1XFYO 1S6JA 2JNXA 1S3PA 2F3YA 2WOSA 1JC2A 1CDNA 4ORBB 1OMDA 1Y6WA 3LL8B 3OB1B 3EVRA 2ZRTA 2LM5A 1YRUB 1U5IB 1NX3A 3JVTC 1XFZO 3D10A 4OKHA 4P2YB 4CPVA 2KI4C 2LVVA 3EVVA 4NDCA 2KFFA 4XJKA 1B8RA 2KI4B 2I18A 3K21A 2LLTA 4M2QA 3WHTB 2COLB 3PN7B 1XFUO 4DS7A 2H61A 2RGIA 4N1FA 2BCBA 4BY4A 3BUWB 4AOMA 1IQ5A 1Y0VH 2LHLA 1KK8B 1DTLA 1M63B 2L4HA 2LVIA 2K0JA 1KFUS 2LUCA 2KOTA 2JOJA 1NPQA 3ZWHA 1DF0B 4ZCUA 2BCXA 1DVIA 2PMYA 5I8NA 2OPOA 3RLZA 1JF0A 2DOQA 1SMGA 1YX8A 4GUKA 3SG4A 2LMVA 4PHJA 3VRRA 4PHMA 5BPJA 3PATA 4PE0A 2PASA 1C7WA 2F8PA 2M7LA 3IF7A 1QVIY 2KYCA 1WRLA 2CCMA 4DRWA 1XK4A 1CM1A 2KAXA 3GK2A 2PRUA 3EVUA 2JT8A 2MAZA 4YGAA 3LLEA 2O5GA 1YX7A 5HKWA 2LMUA 2CNPA 3E3RA 1CDLA 1KWOB 1PVAA 2WORA 4PHKA 5F6TA 2E30A 2M1KB 1BOCA 4I5JA 1FI5A 1CB1A 2JULA 1BLQA 1DGVA 2BKHB 1E8AA 2F33A 4N5XA 1WY9A 1CDMA 5CSJA 2HQWA 1AVSA 1NYAA 1K9PA 2HPSA 2LP2A 2VRGA 3JVTB 2JU0A 1CMFA 1MF8B 4OVNF 3SG2A 1ZACA 2BE6A 2K2FA 1AJ5A 2JTZA 2O60A 1WRKA 4GFTA 4GGNA 4JPZB 4P5OE 3VROA 1FI6A 2GGMA 1NP8A 4XYNA 5I2LA 4A4BA 2HQ8A 2G9BA 2MA2A 1ODBA 2JQ6A 5GQQC 1UURA 1YUSA 3CZTX 5AFPA 3EKJA 3LK0A 3PLFB 4IL1A 2JXLA 1QX2A 3NSLA 1XA5A 3HX4A 1EL4A 2PVBA 1GGWA 4Q04A 1F55A 2M97A 3VGOA 3ZNIA 3AAKA 5HYDA 3AKAA 3I5IB 1ZOTB 1HQVA 3CR5X 3DVMA 1OE9B 2D8NA 3SG5A 5ER4X 1FPWA 3EK7A 3PN7C 5KU1A 3BQ3A 1NCYA 3TZ1A 1J1DA 1G33A 1LVCD 4A4CA 2LAPA 1J55A 1XYDA 1SR6B 1TCFA 3BOWB 2FOTA 5ER5A 3FWCA 4GPLB 1G4YR 1SY9A 1IQ3A 2FCEA 1DJYA 1EG4A 1AP4A 2L98A 3M0WA 1B1GA 4I5KA 1UP5A 2ZN8A 1DJWA 1DJIA 2JTTA 3I5HB 3OP0A 1B9AA 1UWOA 2EC6B 1EH2A 1H4BA 2Y1MA 4GGFC 1CKKA 2B1UA 1IWQA 1J7OA 4PE1A 4MN0A 1WRZA 3O2PA 2Q91A 3OHMB 2EC6C 3CGAA 4C0LA 4GGFA 3NSKA 1NCXA 2NLNA 1C7VA 1KWOC 2M9GA 3TS5B 1Y1XA 2KBIA 3D0YB 1JFJA 2MHHA 1A75B 4HRHA 3I5FB 1MHOA 2M7NA 1G8IA 1K8UA 5HKZA 4I5NB 1EXRA 1MR8A 5AXIA 3KO0A 4PALA 1SR6C 1MXEA 4USLA 5D69A 1CLBA 1QIWA 4OV2A 3KPXA 2OTGC 1N65A 4WQ3A 3C1VA 1ALVA 2OS8C 4DUQA 1L2OC 4CFRA 2PSRA 1KSOA 4GAOA 1UHHA 1XFVO 4YBHB 1V1GA 4MLWA 1FW4A 2QACA 4CLNA 1DJGA 3EK8A 3I5FC 1QATA 2LLSA 5AEQA 2KQ6A 3KEVA 1S1EA 2JC2A 1IGVA 1BJFA 2I7AA 2KDHA 4M2OA 2SASA 1Y1AA 3MSEB 4PHNA 2AAOA 1IG5A 1LKJA 3FWBA 1KQMB 1S6IA 2K7OA 4OCIA 1L2OB 4ICBA 2ZRSA 1JF2A 4R1EA 1S26D 1QVIZ 1CFFA 2ISDA 4YGDB 1IKUA 2M29A 3TDIA 1B7TY 2BBMA 4MVFA 5HKYA 1SCMB 1RFJA 2HF5A 1FBVA 1GGZA 2KGRA 4N1GA 1C07A 3TUYB 3OB2B 1J7QA 4ORAB 1PULA 3DVEA 2WCBA 1TOPA 1A03A 5JOLA 2ZNDA 1OSAA 4WRIA 3DF0A 1NSHA 4DCKA 2HETA 1K9UA 2JT0A 1R2UA 1CLLA 1RJVA 3I5HC 2QPTA 1IH0A 3AAJA 2K7BA 4HRGA 1NIWA 1KK7Z 1PSBA 1YR5A 3OX6A 3I5GC 1K96A 1LINA 3WXAA 1NX0A 1QJTA 3GK4X 2F2OA 1NX1A 1J7PA 1N0YA 2K61A 3LCPC 4YRUA 2JZIA 1SL7A 2NZ0A 4AQJA 2FJUB 1J1EA 1GJYA 1OQPA 1QLKA 1AHRA 1UHKA 1NX2A 1V1FA 2MJWB 2NXQA 4GNKB 3D0YA 5CSIA 2KAVA 1UHIA 2L2EA 5K89A 1LA3A 2MBXA 4CFQA 1XFWO 2LUXA 1X02A 2LV7A 3JTDB 3KHEA 1K94A 1SRAA 4MEWA 2SCPA 1YVLA 5HLOA 3TDZA 1N2DA 1WDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFK A;  1LA0 A;  1SK6 D;  3A4U B;  1DF0 A;  2LLU A;  5IBW A;  1ZMZ A;  1Y1U A;  3PAL A;  1ALW A;  1R6P A;  2L50 A;  4YGE B;  1KK7 Y;  3TUY C;  1GQM A;  4ETO A;  4CID A;  2M3W A;  1YUR A;  1LXF C;  2L4I A;  2L5X B;  2FCD A;  1WLZ A;  3OX5 A;  2P6B B;  1OMR A;  2BBN A;  2CBL A;  1BU3 A;  4YI8 A;  3PFV A;  4YI9 A;  2Q4U A;  1OMV A;  5DKN A;  2KGB C;  2KSP A;  3FIA A;  4PCW A;  1DJX A;  1MWN A;  3PSR A;  2WC8 A;  2EGD A;  1U5I A;  5PAL A;  1S6C A;  3BUO B;  5CPV A;  2JT3 A;  4L9M A;  1KCY A;  2M8U A;  1B7T Z;  1QTX A;  2BL0 C;  1PRW A;  2ZKM X;  1K9K A;  2L51 A;  1A4P A;  1DJH A;  5DKQ A;  1QS7 A;  2LVJ A;  1YUT A;  1SL9 A;  1YUU A;  2K2A A;  3QRX A;  2BKI B;  2NCO A;  4JWQ A;  1NWD A;  2AMI A;  2JWW A;  2BL0 B;  1UUS A;  4AQI A;  3SJS A;  2K7C A;  3EKH A;  4MBE A;  1DMO A;  2MLF C;  1QV0 A;  1BR4 B;  1OZO A;  1RK9 A;  1QXP A;  1REC A;  2E6W A;  5KTY A;  3VRQ A;  1DGU A;  3CR4 X;  4YGB B;  3CWG A;  2ZFD A;  3CS1 A;  2AUC A;  1WLM A;  1TNP A;  3H4S E;  1SKT A;  2BEC A;  4XJK B;  1CFD A;  1M45 A;  4MRX A;  1RWY A;  2GGZ A;  3PM8 A;  2M49 B;  3BUN B;  1W7J B;  1KFX S;  2LVK A;  4BY5 A;  1S5G Z;  4HRE E;  2KFH A;  1F4Q A;  1M31 A;  1CDP A;  2G2B A;  2EHB A;  3BUM B;  5G08 A;  1BOD A;  1DT7 B;  1AUI B;  3DVK A;  3EK4 A;  2KI6 C;  3WHU B;  1SYM A;  1PAL A;  2IS9 A;  4E68 A;  5AAN A;  3JTD C;  2JPT A;  4D1E A;  4QJ4 B;  2M1U A;  1B4C A;  4MZJ A;  1EJ3 A;  2KAY A;  1K93 D;  2LC5 A;  5I2O A;  3DD4 A;  2LHI A;  5AER A;  4PE7 A;  4HSZ A;  4MZL A;  2NCP A;  5J3X A;  1SPY A;  3CTN A;  1M46 A;  2L0P A;  4QJ5 B;  3HCM A;  1CM4 A;  1W7I B;  2I94 A;  4ORC B;  1KQM C;  1SL8 A;  3SIA A;  3O6B A;  1F71 A;  3TS5 C;  1IRJ A;  1XFX O;  1SW8 A;  1UHN A;  1ZFS A;  4UPG A;  2LCP A;  4TNC A;  1CTR A;  1TNW A;  2TN4 A;  2WND A;  1KSM A;  2Y1N A;  1BF5 A;  1JBA A;  4WQ2 A;  3NSI A;  1TIZ A;  3ICB A;  1KK8 C;  4DIR A;  1S36 A;  1Q80 A;  3O78 A;  1KFU L;  3NSO A;  4MZK A;  3A8R A;  1MQ1 A;  1OOJ A;  2LMT A;  2CTN A;  1PK0 D;  2JNF A;  1EG3 A;  5FYX A;  5CSN A;  2JXC A;  2LNK A;  1SCV A;  2KI6 D;  3IQQ A;  4YGC B;  1QAS A;  4JQ0 D;  1XVJ A;  2H61 C;  2Y5I A;  1TN4 A;  2H2K A;  2R2I A;  1JWD A;  1TTX A;  1K2H A;  1FF1 A;  1QV1 A;  2A4J A;  3SG6 A;  1RTP 1;  3VRP A;  3SG7 A;  3VRN A;  1BT6 A;  1L7Z A;  1VRK A;  3F45 A;  4M2P A;  2CXJ A;  3GK1 A;  3CLN A;  1WDC C;  4MSP A;  1NCZ A;  2WCF A;  5D7F A;  1BR1 B;  1IJ6 A;  1D1O A;  3LK1 A;  1S5G Y;  1M39 A;  3WNX B;  3I5G B;  1HT9 A;  2M0R A;  3BOW A;  1NUB A;  1F70 A;  2KBM A;  1TRF A;  2ZN9 A;  1CNP A;  1PVB A;  2MRD A;  3O4Y A;  2K7D A;  2OTG B;  4NDB A;  5DKR A;  1A2X A;  3DF0 B;  4C0K A;  1CFC A;  1H8B A;  1DJZ A;  2K8M B;  1B8C A;  2LP3 A;  3RM1 A;  4C0J A;  1KQV A;  1F8H A;  3BXK A;  1XK4 C;  4FQO A;  4NQG A;  1CFP A;  2BCA A;  2MLE C;  2KFG A;  2PAL A;  2F3Z A;  2WCE A;  4GBA A;  1MUX A;  1TNQ A;  1K90 D;  4PE4 A;  4MRY A;  1SNL A;  3AKB A;  4ZCV A;  1B8L A;  1IJ5 A;  1KFX L;  1JSA A;  1J7R A;  1F4O A;  2BE4 A;  2F2P A;  2V53 A;  4I5L B;  4NDD A;  1AK8 A;  1TCO B;  5I2Q A;  1JUO A;  4OR9 B;  3DVJ A;  1PSR A;  4PDZ A;  2KHN A;  2KYF A;  5KSZ A;  1QIV A;  1SCM C;  1RRO A;  1MXL C;  5JJG A;  3IQO A;  1ZUZ A;  1BMO A;  2LAN A;  2KQY A;  3FS7 A;  1B47 A;  1UHJ A;  2ZNE A;  1BG1 A;  3BYA A;  2GV5 A;  1QLS A;  1TNX A;  2LE9 B;  1YTZ C;  4F0Z B;  2OS8 B;  1YRT B;  3SG3 A;  2JRF A;  5TNC A;  1QX5 B;  2Y4Q A;  3SIB A;  5CSF A;  5B8I B;  1K95 A;  3I5I C;  4FTG A;  2I2R E;  2KNE A;  5HLV A;  4QJ3 B;  3BUX B;  1XO5 A;  1A29 A;  1QX7 A;  1CLM A;  3GOF A;  4U8D A;  3CR2 A;  1A75 A;  3TDU A;  1YVH A;  1F54 A;  3KF9 A;  2CT9 A;  1CMG A;  1OZS A;  1AJ4 A;  3NXA A;  1SBJ A;  1XFY O;  1S6J A;  2JNX A;  1S3P A;  2F3Y A;  2WOS A;  1JC2 A;  1CDN A;  4ORB B;  1OMD A;  1Y6W A;  3LL8 B;  3OB1 B;  3EVR A;  2ZRT A;  2LM5 A;  1YRU B;  1U5I B;  1NX3 A;  3JVT C;  1XFZ O;  3D10 A;  4OKH A;  4P2Y B;  4CPV A;  2KI4 C;  2LVV A;  3EVV A;  4NDC A;  2KFF A;  4XJK A;  1B8R A;  2KI4 B;  2I18 A;  3K21 A;  2LLT A;  4M2Q A;  3WHT B;  2COL B;  3PN7 B;  1XFU O;  4DS7 A;  2H61 A;  2RGI A;  4N1F A;  2BCB A;  4BY4 A;  3BUW B;  4AOM A;  1IQ5 A;  1Y0V H;  2LHL A;  1KK8 B;  1DTL A;  1M63 B;  2L4H A;  2LVI A;  2K0J A;  1KFU S;  2LUC A;  2KOT A;  2JOJ A;  1NPQ A;  3ZWH A;  1DF0 B;  4ZCU A;  2BCX A;  1DVI A;  2PMY A;  5I8N A;  2OPO A;  3RLZ A;  1JF0 A;  2DOQ A;  1SMG A;  1YX8 A;  4GUK A;  3SG4 A;  2LMV A;  4PHJ A;  3VRR A;  4PHM A;  5BPJ A;  3PAT A;  4PE0 A;  2PAS A;  1C7W A;  2F8P A;  2M7L A;  3IF7 A;  1QVI Y;  2KYC A;  1WRL A;  2CCM A;  4DRW A;  1XK4 A;  1CM1 A;  2KAX A;  3GK2 A;  2PRU A;  3EVU A;  2JT8 A;  2MAZ A;  4YGA A;  3LLE A;  2O5G A;  1YX7 A;  5HKW A;  2LMU A;  2CNP A;  3E3R A;  1CDL A;  1KWO B;  1PVA A;  2WOR A;  4PHK A;  5F6T A;  2E30 A;  2M1K B;  1BOC A;  4I5J A;  1FI5 A;  1CB1 A;  2JUL A;  1BLQ A;  1DGV A;  2BKH B;  1E8A A;  2F33 A;  4N5X A;  1WY9 A;  1CDM A;  5CSJ A;  2HQW A;  1AVS A;  1NYA A;  1K9P A;  2HPS A;  2LP2 A;  2VRG A;  3JVT B;  2JU0 A;  1CMF A;  1MF8 B;  4OVN F;  3SG2 A;  1ZAC A;  2BE6 A;  2K2F A;  1AJ5 A;  2JTZ A;  2O60 A;  1WRK A;  4GFT A;  4GGN A;  4JPZ B;  4P5O E;  3VRO A;  1FI6 A;  2GGM A;  1NP8 A;  4XYN A;  5I2L A;  4A4B A;  2HQ8 A;  2G9B A;  2MA2 A;  1ODB A;  2JQ6 A;  5GQQ C;  1UUR A;  1YUS A;  3CZT X;  5AFP A;  3EKJ A;  3LK0 A;  3PLF B;  4IL1 A;  2JXL A;  1QX2 A;  3NSL A;  1XA5 A;  3HX4 A;  1EL4 A;  2PVB A;  1GGW A;  4Q04 A;  1F55 A;  2M97 A;  3VGO A;  3ZNI A;  3AAK A;  5HYD A;  3AKA A;  3I5I B;  1ZOT B;  1HQV A;  3CR5 X;  3DVM A;  1OE9 B;  2D8N A;  3SG5 A;  5ER4 X;  1FPW A;  3EK7 A;  3PN7 C;  5KU1 A;  3BQ3 A;  1NCY A;  3TZ1 A;  1J1D A;  1G33 A;  1LVC D;  4A4C A;  2LAP A;  1J55 A;  1XYD A;  1SR6 B;  1TCF A;  3BOW B;  2FOT A;  5ER5 A;  3FWC A;  4GPL B;  1G4Y R;  1SY9 A;  1IQ3 A;  2FCE A;  1DJY A;  1EG4 A;  1AP4 A;  2L98 A;  3M0W A;  1B1G A;  4I5K A;  1UP5 A;  2ZN8 A;  1DJW A;  1DJI A;  2JTT A;  3I5H B;  3OP0 A;  1B9A A;  1UWO A;  2EC6 B;  1EH2 A;  1H4B A;  2Y1M A;  4GGF C;  1CKK A;  2B1U A;  1IWQ A;  1J7O A;  4PE1 A;  4MN0 A;  1WRZ A;  3O2P A;  2Q91 A;  3OHM B;  2EC6 C;  3CGA A;  4C0L A;  4GGF A;  3NSK A;  1NCX A;  2NLN A;  1C7V A;  1KWO C;  2M9G A;  3TS5 B;  1Y1X A;  2KBI A;  3D0Y B;  1JFJ A;  2MHH A;  1A75 B;  4HRH A;  3I5F B;  1MHO A;  2M7N A;  1G8I A;  1K8U A;  5HKZ A;  4I5N B;  1EXR A;  1MR8 A;  5AXI A;  3KO0 A;  4PAL A;  1SR6 C;  1MXE A;  4USL A;  5D69 A;  1CLB A;  1QIW A;  4OV2 A;  3KPX A;  2OTG C;  1N65 A;  4WQ3 A;  3C1V A;  1ALV A;  2OS8 C;  4DUQ A;  1L2O C;  4CFR A;  2PSR A;  1KSO A;  4GAO A;  1UHH A;  1XFV O;  4YBH B;  1V1G A;  4MLW A;  1FW4 A;  2QAC A;  4CLN A;  1DJG A;  3EK8 A;  3I5F C;  1QAT A;  2LLS A;  5AEQ A;  2KQ6 A;  3KEV A;  1S1E A;  2JC2 A;  1IGV A;  1BJF A;  2I7A A;  2KDH A;  4M2O A;  2SAS A;  1Y1A A;  3MSE B;  4PHN A;  2AAO A;  1IG5 A;  1LKJ A;  3FWB A;  1KQM B;  1S6I A;  2K7O A;  4OCI A;  1L2O B;  4ICB A;  2ZRS A;  1JF2 A;  4R1E A;  1S26 D;  1QVI Z;  1CFF A;  2ISD A;  4YGD B;  1IKU A;  2M29 A;  3TDI A;  1B7T Y;  2BBM A;  4MVF A;  5HKY A;  1SCM B;  1RFJ A;  2HF5 A;  1FBV A;  1GGZ A;  2KGR A;  4N1G A;  1C07 A;  3TUY B;  3OB2 B;  1J7Q A;  4ORA B;  1PUL A;  3DVE A;  2WCB A;  1TOP A;  1A03 A;  5JOL A;  2ZND A;  1OSA A;  4WRI A;  3DF0 A;  1NSH A;  4DCK A;  2HET A;  1K9U A;  2JT0 A;  1R2U A;  1CLL A;  1RJV A;  3I5H C;  2QPT A;  1IH0 A;  3AAJ A;  2K7B A;  4HRG A;  1NIW A;  1KK7 Z;  1PSB A;  1YR5 A;  3OX6 A;  3I5G C;  1K96 A;  1LIN A;  3WXA A;  1NX0 A;  1QJT A;  3GK4 X;  2F2O A;  1NX1 A;  1J7P A;  1N0Y A;  2K61 A;  3LCP C;  4YRU A;  2JZI A;  1SL7 A;  2NZ0 A;  4AQJ A;  2FJU B;  1J1E A;  1GJY A;  1OQP A;  1QLK A;  1AHR A;  1UHK A;  1NX2 A;  1V1F A;  2MJW B;  2NXQ A;  4GNK B;  3D0Y A;  5CSI A;  2KAV A;  1UHI A;  2L2E A;  5K89 A;  1LA3 A;  2MBX A;  4CFQ A;  1XFW O;  2LUX A;  1X02 A;  2LV7 A;  3JTD B;  3KHE A;  1K94 A;  1SRA A;  4MEW A;  2SCP A;  1YVL A;  5HLO A;  3TDZ A;  1N2D A;  1WDC B; 
#chains in the Genus database with same CATH topology
 1JFK A;  1LA0 A;  1SK6 D;  3A4U B;  2L2C A;  1DF0 A;  2LLU A;  1OOG A;  5IBW A;  1ZMZ A;  1Y1U A;  3PAL A;  1ALW A;  3Q8I A;  1R6P A;  2L50 A;  4YGE B;  1KK7 Y;  3TUY C;  1GQM A;  4ETO A;  4CID A;  1TUZ A;  2M3W A;  1YUR A;  1LXF C;  2L4I A;  2L5X B;  2FCD A;  1WLZ A;  3OX5 A;  2P6B B;  3S0G A;  1OMR A;  2BBN A;  2JPO A;  2CBL A;  1BU3 A;  3DY9 A;  4YI8 A;  3PFV A;  4YI9 A;  2Q4U A;  3BFB A;  1OMV A;  5DKN A;  2KGB C;  2KSP A;  3FIA A;  4PCW A;  1DJX A;  4IJ7 A;  1MWN A;  3PSR A;  2WC8 A;  2EGD A;  1U5I A;  5PAL A;  1S6C A;  3BUO B;  5CPV A;  2JT3 A;  1OOI X;  4L9M A;  1KCY A;  2M8U A;  1B7T Z;  1QTX A;  2BL0 C;  4OZD A;  3S0D A;  1PRW A;  3R72 A;  2ZKM X;  1K9K A;  2L51 A;  1A4P A;  1DJH A;  5DKQ A;  1QS7 A;  2LVJ A;  1YUT A;  1SL9 A;  1YUU A;  1TUJ A;  2K2A A;  3QRX A;  2BKI B;  2NCO A;  4JWQ A;  1NWD A;  2AMI A;  2JWW A;  2BL0 B;  1UUS A;  3SS5 A;  4AQI A;  3SJS A;  2K7C A;  5FI2 A;  3EKH A;  4MBE A;  1DMO A;  2MLF C;  1QV0 A;  1BR4 B;  3R1O A;  1OZO A;  1RK9 A;  5I94 A;  1LS8 A;  1QXP A;  1REC A;  2E6W A;  5KTY A;  1OOH A;  3VRQ A;  1DGU A;  3DXL A;  3CR4 X;  4YGB B;  3CWG A;  2ZFD A;  3CS1 A;  2AUC A;  1WLM A;  1TNP A;  2QDI A;  3H4S E;  1SKT A;  2BEC A;  2FJY A;  4XJK B;  1CFD A;  1M45 A;  4MRX A;  1RWY A;  2GGZ A;  3PM8 A;  2M49 B;  3BUN B;  3L4L A;  1W7J B;  1KFX S;  2LVK A;  4BY5 A;  1S5G Z;  4HRE E;  2KFH A;  1F4Q A;  1M31 A;  1CDP A;  2G2B A;  2EHB A;  3BUM B;  5G08 A;  1BOD A;  1DT7 B;  1AUI B;  3DVK A;  3EK4 A;  2KI6 C;  3WHU B;  1SYM A;  1PAL A;  2IS9 A;  4E68 A;  1W9Z A;  2YGU A;  2WC5 A;  5AAN A;  3JTD C;  2JPT A;  4D1E A;  4QJ4 B;  2M1U A;  2WC6 A;  1B4C A;  4MZJ A;  1EJ3 A;  2KAY A;  1K93 D;  2LC5 A;  4JD9 A;  3VB1 A;  3D77 A;  5I2O A;  3DD4 A;  2LHI A;  5AER A;  3B87 A;  4PE7 A;  3FE8 A;  4HSZ A;  4MZL A;  2NCP A;  5J3X A;  1SPY A;  3CTN A;  1M46 A;  2L0P A;  4QJ5 B;  3HCM A;  1CM4 A;  1W7I B;  2I94 A;  4ORC B;  1KQM C;  1SL8 A;  3SIA A;  3O6B A;  1F71 A;  3TS5 C;  1IRJ A;  1XFX O;  1SW8 A;  3IVT A;  1UHN A;  1ZFS A;  4UPG A;  2LCP A;  4TNC A;  1CTR A;  1TNW A;  2TN4 A;  2WND A;  1KSM A;  2Y1N A;  1BF5 A;  1JBA A;  4WQ2 A;  3NSI A;  1TIZ A;  3ICB A;  1KK8 C;  4DIR A;  1S36 A;  1DQE A;  1TWO A;  1Q80 A;  3O78 A;  5EL2 A;  1KFU L;  3NSO A;  4MZK A;  3A8R A;  1MQ1 A;  1OOJ A;  2LMT A;  2CTN A;  4F7F A;  1PK0 D;  2JNF A;  1EG3 A;  5FYX A;  5CSN A;  2JXC A;  2LNK A;  1SCV A;  2KI6 D;  3IQQ A;  4YGC B;  1QAS A;  4JQ0 D;  1XVJ A;  2H61 C;  2Y5I A;  1TN4 A;  2H2K A;  2R2I A;  2WCM A;  1TTX A;  3NHI A;  1JWD A;  1K2H A;  1FF1 A;  3S0F A;  1QV1 A;  2A4J A;  3SG6 A;  1RTP 1;  3B86 A;  3VRP A;  3SG7 A;  3VRN A;  1GM0 A;  1BT6 A;  1L7Z A;  1VRK A;  3F45 A;  4M2P A;  2CXJ A;  3GK1 A;  3CLN A;  1OW4 A;  1WDC C;  3NGV A;  4MSP A;  1NCZ A;  2WCF A;  5D7F A;  1BR1 B;  1IJ6 A;  1D1O A;  5D3O A;  3LK1 A;  1S5G Y;  1M39 A;  3WNX B;  2H8V A;  3I5G B;  1HT9 A;  2M0R A;  3BOW A;  1NUB A;  1F70 A;  2KBM A;  1TRF A;  2ZN9 A;  2BNX A;  1CNP A;  1PVB A;  2MRD A;  3CZ0 A;  3O4Y A;  2K7D A;  2OTG B;  4NDB A;  5DKR A;  1A2X A;  3BFA A;  3OGN A;  3DF0 B;  4C0K A;  1CFC A;  1H8B A;  1DJZ A;  2K8M B;  1B8C A;  2LP3 A;  3SS3 A;  3RM1 A;  4C0J A;  1KQV A;  1F8H A;  3BXK A;  1XK4 C;  4FQO A;  4NQG A;  1CFP A;  2BCA A;  2MLE C;  2KFG A;  1XFR A;  2F3Z A;  2PAL A;  2WCE A;  4GBA A;  1MUX A;  1TNQ A;  1K90 D;  4PE4 A;  4MRY A;  1SNL A;  3RZS A;  3AKB A;  4ZCV A;  1B8L A;  1IJ5 A;  1KFX L;  1JSA A;  1J7R A;  1F4O A;  2BE4 A;  2F2P A;  2V53 A;  4I5L B;  4FQT A;  4NDD A;  1AK8 A;  3O4X A;  1TCO B;  5I2Q A;  1JUO A;  4OR9 B;  3DVJ A;  1PSR A;  4PDZ A;  2KHN A;  2KYF A;  5KSZ A;  1QIV A;  1SCM C;  1RRO A;  1MXL C;  5JJG A;  3IQO A;  1ZUZ A;  1BMO A;  2LAN A;  2KQY A;  3FS7 A;  1B47 A;  1UHJ A;  2KPH A;  2ZNE A;  1BG1 A;  3BYA A;  3R1P A;  2GV5 A;  1QLS A;  1TNX A;  2LE9 B;  1YTZ C;  4F0Z B;  2OS8 B;  1YRT B;  3SG3 A;  2JRF A;  5TNC A;  1QX5 B;  2Y4Q A;  3SIB A;  5CSF A;  5B8I B;  2WCJ A;  1K95 A;  2WCK A;  3I5I C;  2I2R E;  4FTG A;  5FI7 A;  2KNE A;  5HLV A;  4QJ3 B;  3BUX B;  1XO5 A;  1A29 A;  2QEH A;  1QX7 A;  3DZT A;  1CLM A;  3GOF A;  4U8D A;  3CR2 A;  1A75 A;  3TDU A;  1YVH A;  1F54 A;  3KF9 A;  2CT9 A;  1CMG A;  1OZS A;  2PYQ A;  1AJ4 A;  3NXA A;  5FI6 A;  1SBJ A;  1XFY O;  1S6J A;  2JNX A;  1S3P A;  2F3Y A;  2WOS A;  1JC2 A;  1CDN A;  4ORB B;  1OMD A;  1Y6W A;  3LL8 B;  3OB1 B;  3EVR A;  2ZRT A;  2LM5 A;  3CZ2 A;  1YRU B;  1U5I B;  1NX3 A;  3JVT C;  1XFZ O;  3D10 A;  4OKH A;  4P2Y B;  4CPV A;  2KI4 C;  2LVV A;  3EVV A;  4NDC A;  2KFF A;  3FE9 A;  4XJK A;  1B8R A;  2KI4 B;  2I18 A;  3K21 A;  2LLT A;  3BJH A;  4M2Q A;  2COL B;  3PN7 B;  3WHT B;  1XFU O;  4DS7 A;  2H61 A;  2RGI A;  4N1F A;  2BCB A;  4BY4 A;  3BUW B;  4AOM A;  1IQ5 A;  1P28 A;  1DC1 A;  1Y0V H;  2LHL A;  1ORG A;  3S0B A;  1KK8 B;  1DTL A;  1M63 B;  2L4H A;  2LVI A;  2K0J A;  1KFU S;  2LUC A;  3TDZ A;  2KOT A;  2JOJ A;  1NPQ A;  3ZWH A;  1DF0 B;  4ZCU A;  2BCX A;  1DVI A;  2PMY A;  5HL1 A;  5I8N A;  2OPO A;  3RLZ A;  1JF0 A;  2DOQ A;  1SMG A;  1YX8 A;  4GUK A;  3V2L A;  3SG4 A;  2LMV A;  4PHJ A;  3VRR A;  4PHM A;  5BPJ A;  2QEB A;  3PAT A;  3B88 A;  4PE0 A;  2PAS A;  1C7W A;  2F8P A;  3EG5 B;  1DEK A;  2M7L A;  3IF7 A;  3S0E A;  1QVI Y;  2KYC A;  5DIC A;  1WRL A;  2CCM A;  4DRW A;  1XK4 A;  1CM1 A;  2KAX A;  3GK2 A;  2PRU A;  3EVU A;  2JT8 A;  2MAZ A;  4YGA A;  3D74 A;  3LLE A;  2O5G A;  1YX7 A;  5HKW A;  2LMU A;  2CNP A;  3E3R A;  1CDL A;  1KWO B;  1PVA A;  2WOR A;  4PHK A;  2KLD A;  2WCH A;  5F6T A;  2E30 A;  2M1K B;  1BOC A;  4I5J A;  1FI5 A;  1CB1 A;  2JUL A;  1BLQ A;  1DGV A;  2BKH B;  1E8A A;  2F33 A;  3PM2 A;  4N5X A;  1WY9 A;  1CDM A;  5CSJ A;  2HQW A;  1AVS A;  1NYA A;  1K9P A;  2HPS A;  2LP2 A;  2VRG A;  3JVT B;  2JU0 A;  1T14 A;  3L4A A;  3SS4 A;  1MF8 B;  1CMF A;  4OVN F;  3UO9 A;  3SG2 A;  1ZAC A;  2BE6 A;  2K2F A;  1AJ5 A;  2JTZ A;  2O60 A;  1WRK A;  4GFT A;  4GGN A;  4JPZ B;  4P5O E;  3VRO A;  1FI6 A;  2GGM A;  1NP8 A;  2QEV A;  3CDN A;  4XYN A;  5I2L A;  4A4B A;  2HQ8 A;  2G9B A;  2MA2 A;  1ODB A;  2JQ6 A;  5GQQ C;  1UUR A;  1YUS A;  3CZT X;  5AFP A;  3EKJ A;  3LK0 A;  3PLF B;  4IL1 A;  2JXL A;  1QX2 A;  3NSL A;  1XA5 A;  3HX4 A;  1EL4 A;  2PVB A;  1GGW A;  4Q04 A;  1F55 A;  2M97 A;  3D78 A;  3VGO A;  3ZNI A;  3AAK A;  5HYD A;  3AKA A;  3I5I B;  1ZOT B;  1HQV A;  3CR5 X;  3NHT A;  3DVM A;  3FE6 A;  1OE9 B;  2D8N A;  2P71 A;  3SG5 A;  5ER4 X;  1FPW A;  3EK7 A;  3PN7 C;  5KU1 A;  3BQ3 A;  1NCY A;  3TZ1 A;  1J1D A;  1G33 A;  1LVC D;  4A4C A;  2LAP A;  1J55 A;  1XYD A;  1SR6 B;  1TCF A;  3BOW B;  2FOT A;  5ER5 A;  3FWC A;  2PQL A;  4GPL B;  1G4Y R;  1SY9 A;  1IQ3 A;  2FCE A;  1DJY A;  1EG4 A;  2QEO A;  1AP4 A;  2L98 A;  3M0W A;  1B1G A;  4I5K A;  1UP5 A;  2ZN8 A;  4JKT A;  1DJW A;  1DJI A;  3B6X A;  2JTT A;  3I5H B;  3OP0 A;  1B9A A;  1UWO A;  1IIO A;  2EC6 B;  1EH2 A;  1H4B A;  2Y1M A;  4GGF C;  1CKK A;  2B1U A;  1IWQ A;  1J7O A;  4PE1 A;  4MN0 A;  1WRZ A;  3O2P A;  2Q91 A;  3OHM B;  2EC6 C;  3CGA A;  4C0L A;  4GGF A;  2P70 A;  1Z4H A;  1NCX A;  2BAP A;  2NLN A;  3K1E A;  3NSK A;  1KWO C;  1C7V A;  2M9G A;  3TS5 B;  1Y1X A;  2KBI A;  3D0Y B;  1JFJ A;  1OOF A;  2MHH A;  1A75 B;  4HRH A;  4INX A;  3I5F B;  1MHO A;  2M7N A;  1G8I A;  1K8U A;  5HKZ A;  4I5N B;  1EXR A;  1MR8 A;  3CZ1 A;  5AXI A;  3KO0 A;  4PAL A;  1SR6 C;  1MXE A;  4USL A;  5D69 A;  1CLB A;  1QIW A;  4OV2 A;  3KPX A;  2OTG C;  1N65 A;  4WQ3 A;  3C1V A;  1ALV A;  2OS8 C;  4DUQ A;  1L2O C;  4KYN A;  4CFR A;  2PSR A;  1KSO A;  4GAO A;  4PT1 A;  1UHH A;  1XFV O;  4YBH B;  1V1G A;  4MLW A;  1FW4 A;  3OBV A;  2QAC A;  4CLN A;  1DJG A;  3D75 A;  3EK8 A;  1SSE B;  3I5F C;  1QAT A;  2LLS A;  5AEQ A;  2KQ6 A;  3KEV A;  1S1E A;  2JC2 A;  1IGV A;  1BJF A;  2I7A A;  2KDH A;  4M2O A;  2SAS A;  1Y1A A;  3MSE B;  4PHN A;  2AAO A;  1IG5 A;  1LKJ A;  3FWB A;  1KQM B;  1S6I A;  3PJI A;  2K7O A;  4OCI A;  1L2O B;  4ICB A;  3CAB A;  2ZRS A;  1JF2 A;  4R1E A;  1S26 D;  1QVI Z;  1CFF A;  2ISD A;  4YGD B;  1IKU A;  2M29 A;  3CYZ A;  1B7T Y;  3TDI A;  2BBM A;  4MVF A;  5HKY A;  1SCM B;  1RFJ A;  2HF5 A;  1FBV A;  3R1V A;  1GGZ A;  2KGR A;  3DYE A;  4N1G A;  1C07 A;  1C3Y A;  3TUY B;  3BFH A;  3OB2 B;  1J7Q A;  4ORA B;  1PUL A;  3DVE A;  2WCB A;  1TOP A;  1A03 A;  5JOL A;  1DEL A;  2ZND A;  1OSA A;  4WRI A;  3DF0 A;  1NSH A;  4DCK A;  2HET A;  1K9U A;  2JT0 A;  1R2U A;  1CLL A;  1RJV A;  3I5H C;  2QPT A;  2L5Y A;  3QME A;  1IH0 A;  3AAJ A;  1QWV A;  2K7B A;  4HRG A;  1NIW A;  1C3Z A;  1KK7 Z;  1PSB A;  1YR5 A;  2K60 A;  3OX6 A;  2ERB A;  3I5G C;  1K96 A;  1LIN A;  3WXA A;  1NX0 A;  1QJT A;  3GK4 X;  2F2O A;  1NX1 A;  2WCL A;  1N0Y A;  2K61 A;  1J7P A;  3LCP C;  4YRU A;  2JZI A;  1SL7 A;  2NZ0 A;  3D76 A;  2KLE A;  4AQJ A;  2FJU B;  3L47 A;  1J1E A;  1GJY A;  1OQP A;  1QLK A;  1AHR A;  1UHK A;  1NX2 A;  3UNW A;  1V1F A;  2MJW B;  2NXQ A;  4GNK B;  3D0Y A;  5CSI A;  2KAV A;  1UHI A;  2L2E A;  4INW A;  5K89 A;  1LA3 A;  3N7H A;  2GTE A;  2MBX A;  1XFW O;  2LUX A;  4CFQ A;  1X02 A;  2LV7 A;  3JTD B;  3B7A A;  3KHE A;  1K94 A;  1SRA A;  4MEW A;  3S0A A;  2SCP A;  1YVL A;  5HLO A;  3D73 A;  1N2D A;  1WDC B;  1Z2C B; 
#chains in the Genus database with same CATH homology
 1JFK A;  1LA0 A;  1SK6 D;  3A4U B;  1DF0 A;  2LLU A;  5IBW A;  1ZMZ A;  1Y1U A;  3PAL A;  1ALW A;  1R6P A;  2L50 A;  4YGE B;  1KK7 Y;  3TUY C;  1GQM A;  4ETO A;  4CID A;  2M3W A;  1YUR A;  1LXF C;  2L4I A;  2L5X B;  2FCD A;  1WLZ A;  3OX5 A;  2P6B B;  1OMR A;  2BBN A;  2CBL A;  1BU3 A;  4YI8 A;  3PFV A;  4YI9 A;  2Q4U A;  1OMV A;  5DKN A;  2KGB C;  2KSP A;  3FIA A;  4PCW A;  1DJX A;  1MWN A;  3PSR A;  2WC8 A;  2EGD A;  1U5I A;  5PAL A;  1S6C A;  3BUO B;  5CPV A;  2JT3 A;  4L9M A;  1KCY A;  2M8U A;  1B7T Z;  1QTX A;  2BL0 C;  1PRW A;  2ZKM X;  1K9K A;  2L51 A;  1A4P A;  1DJH A;  5DKQ A;  1QS7 A;  2LVJ A;  1YUT A;  1SL9 A;  1YUU A;  2K2A A;  3QRX A;  2BKI B;  2NCO A;  4JWQ A;  1NWD A;  2AMI A;  2JWW A;  2BL0 B;  1UUS A;  4AQI A;  3SJS A;  2K7C A;  3EKH A;  4MBE A;  1DMO A;  2MLF C;  1QV0 A;  1BR4 B;  1OZO A;  1RK9 A;  1QXP A;  1REC A;  2E6W A;  5KTY A;  3VRQ A;  1DGU A;  3CR4 X;  4YGB B;  3CWG A;  2ZFD A;  3CS1 A;  2AUC A;  1WLM A;  1TNP A;  3H4S E;  1SKT A;  2BEC A;  4XJK B;  1CFD A;  1M45 A;  4MRX A;  1RWY A;  2GGZ A;  3PM8 A;  2M49 B;  3BUN B;  1W7J B;  1KFX S;  2LVK A;  4BY5 A;  1S5G Z;  4HRE E;  2KFH A;  1F4Q A;  1M31 A;  1CDP A;  2G2B A;  2EHB A;  3BUM B;  5G08 A;  1BOD A;  1DT7 B;  1AUI B;  3DVK A;  3EK4 A;  2KI6 C;  3WHU B;  1SYM A;  1PAL A;  2IS9 A;  4E68 A;  5AAN A;  3JTD C;  2JPT A;  4D1E A;  4QJ4 B;  2M1U A;  1B4C A;  4MZJ A;  1EJ3 A;  2KAY A;  1K93 D;  2LC5 A;  5I2O A;  3DD4 A;  2LHI A;  5AER A;  4PE7 A;  4HSZ A;  4MZL A;  2NCP A;  5J3X A;  1SPY A;  3CTN A;  1M46 A;  2L0P A;  4QJ5 B;  3HCM A;  1CM4 A;  1W7I B;  2I94 A;  4ORC B;  1KQM C;  1SL8 A;  3SIA A;  3O6B A;  1F71 A;  3TS5 C;  1IRJ A;  1XFX O;  1SW8 A;  1UHN A;  1ZFS A;  4UPG A;  2LCP A;  4TNC A;  1CTR A;  1TNW A;  2TN4 A;  2WND A;  1KSM A;  2Y1N A;  1BF5 A;  1JBA A;  4WQ2 A;  3NSI A;  1TIZ A;  3ICB A;  1KK8 C;  4DIR A;  1S36 A;  1Q80 A;  3O78 A;  1KFU L;  3NSO A;  4MZK A;  3A8R A;  1MQ1 A;  1OOJ A;  2LMT A;  2CTN A;  1PK0 D;  2JNF A;  1EG3 A;  5FYX A;  5CSN A;  2JXC A;  2LNK A;  1SCV A;  2KI6 D;  3IQQ A;  4YGC B;  1QAS A;  4JQ0 D;  1XVJ A;  2H61 C;  2Y5I A;  1TN4 A;  2H2K A;  2R2I A;  1JWD A;  1TTX A;  1K2H A;  1FF1 A;  1QV1 A;  2A4J A;  3SG6 A;  1RTP 1;  3VRP A;  3SG7 A;  3VRN A;  1BT6 A;  1L7Z A;  1VRK A;  3F45 A;  4M2P A;  2CXJ A;  3GK1 A;  3CLN A;  1WDC C;  4MSP A;  1NCZ A;  2WCF A;  5D7F A;  1BR1 B;  1IJ6 A;  1D1O A;  3LK1 A;  1S5G Y;  1M39 A;  3WNX B;  3I5G B;  1HT9 A;  2M0R A;  3BOW A;  1NUB A;  1F70 A;  2KBM A;  1TRF A;  2ZN9 A;  1CNP A;  1PVB A;  2MRD A;  3O4Y A;  2K7D A;  2OTG B;  4NDB A;  5DKR A;  1A2X A;  3DF0 B;  4C0K A;  1CFC A;  1H8B A;  1DJZ A;  2K8M B;  1B8C A;  2LP3 A;  3RM1 A;  4C0J A;  1KQV A;  1F8H A;  3BXK A;  1XK4 C;  4FQO A;  4NQG A;  1CFP A;  2BCA A;  2MLE C;  2KFG A;  2PAL A;  2F3Z A;  2WCE A;  4GBA A;  1MUX A;  1TNQ A;  1K90 D;  4PE4 A;  4MRY A;  1SNL A;  3AKB A;  4ZCV A;  1B8L A;  1IJ5 A;  1KFX L;  1JSA A;  1J7R A;  1F4O A;  2BE4 A;  2F2P A;  2V53 A;  4I5L B;  4NDD A;  1AK8 A;  1TCO B;  5I2Q A;  1JUO A;  4OR9 B;  3DVJ A;  1PSR A;  4PDZ A;  2KHN A;  2KYF A;  5KSZ A;  1QIV A;  1SCM C;  1RRO A;  1MXL C;  5JJG A;  3IQO A;  1ZUZ A;  1BMO A;  2LAN A;  2KQY A;  3FS7 A;  1B47 A;  1UHJ A;  2ZNE A;  1BG1 A;  3BYA A;  2GV5 A;  1QLS A;  1TNX A;  2LE9 B;  1YTZ C;  4F0Z B;  2OS8 B;  1YRT B;  3SG3 A;  2JRF A;  5TNC A;  1QX5 B;  2Y4Q A;  3SIB A;  5CSF A;  5B8I B;  1K95 A;  3I5I C;  4FTG A;  2I2R E;  2KNE A;  5HLV A;  4QJ3 B;  3BUX B;  1XO5 A;  1A29 A;  1QX7 A;  1CLM A;  3GOF A;  4U8D A;  3CR2 A;  1A75 A;  3TDU A;  1YVH A;  1F54 A;  3KF9 A;  2CT9 A;  1CMG A;  1OZS A;  1AJ4 A;  3NXA A;  1SBJ A;  1XFY O;  1S6J A;  2JNX A;  1S3P A;  2F3Y A;  2WOS A;  1JC2 A;  1CDN A;  4ORB B;  1OMD A;  1Y6W A;  3LL8 B;  3OB1 B;  3EVR A;  2ZRT A;  2LM5 A;  1YRU B;  1U5I B;  1NX3 A;  3JVT C;  1XFZ O;  3D10 A;  4OKH A;  4P2Y B;  4CPV A;  2KI4 C;  2LVV A;  3EVV A;  4NDC A;  2KFF A;  4XJK A;  1B8R A;  2KI4 B;  2I18 A;  3K21 A;  2LLT A;  4M2Q A;  3WHT B;  2COL B;  3PN7 B;  1XFU O;  4DS7 A;  2H61 A;  2RGI A;  4N1F A;  2BCB A;  4BY4 A;  3BUW B;  4AOM A;  1IQ5 A;  1Y0V H;  2LHL A;  1KK8 B;  1DTL A;  1M63 B;  2L4H A;  2LVI A;  2K0J A;  1KFU S;  2LUC A;  2KOT A;  2JOJ A;  1NPQ A;  3ZWH A;  1DF0 B;  4ZCU A;  2BCX A;  1DVI A;  2PMY A;  5I8N A;  2OPO A;  3RLZ A;  1JF0 A;  2DOQ A;  1SMG A;  1YX8 A;  4GUK A;  3SG4 A;  2LMV A;  4PHJ A;  3VRR A;  4PHM A;  5BPJ A;  3PAT A;  4PE0 A;  2PAS A;  1C7W A;  2F8P A;  2M7L A;  3IF7 A;  1QVI Y;  2KYC A;  1WRL A;  2CCM A;  4DRW A;  1XK4 A;  1CM1 A;  2KAX A;  3GK2 A;  2PRU A;  3EVU A;  2JT8 A;  2MAZ A;  4YGA A;  3LLE A;  2O5G A;  1YX7 A;  5HKW A;  2LMU A;  2CNP A;  3E3R A;  1CDL A;  1KWO B;  1PVA A;  2WOR A;  4PHK A;  5F6T A;  2E30 A;  2M1K B;  1BOC A;  4I5J A;  1FI5 A;  1CB1 A;  2JUL A;  1BLQ A;  1DGV A;  2BKH B;  1E8A A;  2F33 A;  4N5X A;  1WY9 A;  1CDM A;  5CSJ A;  2HQW A;  1AVS A;  1NYA A;  1K9P A;  2HPS A;  2LP2 A;  2VRG A;  3JVT B;  2JU0 A;  1CMF A;  1MF8 B;  4OVN F;  3SG2 A;  1ZAC A;  2BE6 A;  2K2F A;  1AJ5 A;  2JTZ A;  2O60 A;  1WRK A;  4GFT A;  4GGN A;  4JPZ B;  4P5O E;  3VRO A;  1FI6 A;  2GGM A;  1NP8 A;  4XYN A;  5I2L A;  4A4B A;  2HQ8 A;  2G9B A;  2MA2 A;  1ODB A;  2JQ6 A;  5GQQ C;  1UUR A;  1YUS A;  3CZT X;  5AFP A;  3EKJ A;  3LK0 A;  3PLF B;  4IL1 A;  2JXL A;  1QX2 A;  3NSL A;  1XA5 A;  3HX4 A;  1EL4 A;  2PVB A;  1GGW A;  4Q04 A;  1F55 A;  2M97 A;  3VGO A;  3ZNI A;  3AAK A;  5HYD A;  3AKA A;  3I5I B;  1ZOT B;  1HQV A;  3CR5 X;  3DVM A;  1OE9 B;  2D8N A;  3SG5 A;  5ER4 X;  1FPW A;  3EK7 A;  3PN7 C;  5KU1 A;  3BQ3 A;  1NCY A;  3TZ1 A;  1J1D A;  1G33 A;  1LVC D;  4A4C A;  2LAP A;  1J55 A;  1XYD A;  1SR6 B;  1TCF A;  3BOW B;  2FOT A;  5ER5 A;  3FWC A;  4GPL B;  1G4Y R;  1SY9 A;  1IQ3 A;  2FCE A;  1DJY A;  1EG4 A;  1AP4 A;  2L98 A;  3M0W A;  1B1G A;  4I5K A;  1UP5 A;  2ZN8 A;  1DJW A;  1DJI A;  2JTT A;  3I5H B;  3OP0 A;  1B9A A;  1UWO A;  2EC6 B;  1EH2 A;  1H4B A;  2Y1M A;  4GGF C;  1CKK A;  2B1U A;  1IWQ A;  1J7O A;  4PE1 A;  4MN0 A;  1WRZ A;  3O2P A;  2Q91 A;  3OHM B;  2EC6 C;  3CGA A;  4C0L A;  4GGF A;  3NSK A;  1NCX A;  2NLN A;  1C7V A;  1KWO C;  2M9G A;  3TS5 B;  1Y1X A;  2KBI A;  3D0Y B;  1JFJ A;  2MHH A;  1A75 B;  4HRH A;  3I5F B;  1MHO A;  2M7N A;  1G8I A;  1K8U A;  5HKZ A;  4I5N B;  1EXR A;  1MR8 A;  5AXI A;  3KO0 A;  4PAL A;  1SR6 C;  1MXE A;  4USL A;  5D69 A;  1CLB A;  1QIW A;  4OV2 A;  3KPX A;  2OTG C;  1N65 A;  4WQ3 A;  3C1V A;  1ALV A;  2OS8 C;  4DUQ A;  1L2O C;  4CFR A;  2PSR A;  1KSO A;  4GAO A;  1UHH A;  1XFV O;  4YBH B;  1V1G A;  4MLW A;  1FW4 A;  2QAC A;  4CLN A;  1DJG A;  3EK8 A;  3I5F C;  1QAT A;  2LLS A;  5AEQ A;  2KQ6 A;  3KEV A;  1S1E A;  2JC2 A;  1IGV A;  1BJF A;  2I7A A;  2KDH A;  4M2O A;  2SAS A;  1Y1A A;  3MSE B;  4PHN A;  2AAO A;  1IG5 A;  1LKJ A;  3FWB A;  1KQM B;  1S6I A;  2K7O A;  4OCI A;  1L2O B;  4ICB A;  2ZRS A;  1JF2 A;  4R1E A;  1S26 D;  1QVI Z;  1CFF A;  2ISD A;  4YGD B;  1IKU A;  2M29 A;  3TDI A;  1B7T Y;  2BBM A;  4MVF A;  5HKY A;  1SCM B;  1RFJ A;  2HF5 A;  1FBV A;  1GGZ A;  2KGR A;  4N1G A;  1C07 A;  3TUY B;  3OB2 B;  1J7Q A;  4ORA B;  1PUL A;  3DVE A;  2WCB A;  1TOP A;  1A03 A;  5JOL A;  2ZND A;  1OSA A;  4WRI A;  3DF0 A;  1NSH A;  4DCK A;  2HET A;  1K9U A;  2JT0 A;  1R2U A;  1CLL A;  1RJV A;  3I5H C;  2QPT A;  1IH0 A;  3AAJ A;  2K7B A;  4HRG A;  1NIW A;  1KK7 Z;  1PSB A;  1YR5 A;  3OX6 A;  3I5G C;  1K96 A;  1LIN A;  3WXA A;  1NX0 A;  1QJT A;  3GK4 X;  2F2O A;  1NX1 A;  1J7P A;  1N0Y A;  2K61 A;  3LCP C;  4YRU A;  2JZI A;  1SL7 A;  2NZ0 A;  4AQJ A;  2FJU B;  1J1E A;  1GJY A;  1OQP A;  1QLK A;  1AHR A;  1UHK A;  1NX2 A;  1V1F A;  2MJW B;  2NXQ A;  4GNK B;  3D0Y A;  5CSI A;  2KAV A;  1UHI A;  2L2E A;  5K89 A;  1LA3 A;  2MBX A;  4CFQ A;  1XFW O;  2LUX A;  1X02 A;  2LV7 A;  3JTD B;  3KHE A;  1K94 A;  1SRA A;  4MEW A;  2SCP A;  1YVL A;  5HLO A;  3TDZ A;  1N2D A;  1WDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...