2FCDA

Solution structure of n-lobe myosin light chain from saccharomices cerevisiae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain 1
publication title Structural basis for the interaction of the myosin light chain Mlc1p with the myosin V Myo2p IQ motifs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 17
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2fcdA00
2AUCA 1DVIA 1M31A 2ZKMX 2JT3A 2FJUB 2KOTA 2GGZA 3CR2A 1Y1XA 3FWBA 1W7JB 2CXJA 1A03A 3DD4A 4XJKA 4I5NB 4YGAA 1B8CA 2LCPA 1JWDA 2KGRA 2JPTA 2K7DA 1QV1A 1WRKA 2F8PA 3BUMB 2K2FA 1U5IB 1F70A 1L2OC 3I5GB 2HPSA 4XYNA 1TTXA 2KQ6A 1GGWA 2GV5A 2SASA 1IQ3A 1PSRA 1J7RA 3VROA 1CB1A 2P6BB 1GGZA 1TOPA 5HYDA 1RFJA 1SCVA 1X02A 5TNCA 3I5FB 2LMUA 3O78A 3O6BA 2M97A 3VRNA 2MLEC 3LLEA 4C0LA 2F33A 1TNQA 1F54A 2HQWA 1FBVA 1SL9A 2L2EA 2K7CA 4PE4A 4CIDA 3E3RA 1KQVA 1OSAA 2KGBC 4YBHB 1BJFA 1YX7A 1KFUL 1RWYA 1DF0B 1MUXA 2KAXA 3JVTC 2H61C 3PSRA 1SL8A 1SK6D 2BBMA 1A75B 2JWWA 2LC5A 5KSZA 2ZRTA 1LA0A 2L98A 1FW4A 1EG4A 3CLNA 4N1FA 1OMDA 1QXPA 2I18A 1PULA 1ZFSA 2DOQA 1M63B 2V53A 3CR5X 1S3PA 3FWCA 1Y1UA 2KBMA 1JUOA 4DIRA 3CR4X 2FCEA 1BMOA 5AEQA 1NX0A 1EH2A 2LUCA 3SG7A 2MLFC 3WXAA 1CFCA 3RLZA 2EGDA 4MVFA 1SPYA 2F3YA 4TNCA 1V1GA 3PATA 2LNKA 1WLZA 1K8UA 4WQ3A 1DJXA 1OE9B 1YVLA 3PM8A 1KWOC 3TUYC 1N2DA 3SG2A 3NSLA 2K2AA 2L50A 4N5XA 1SW8A 4GPLB 2M1UA 2CT9A 2I7AA 1DJWA 4MRXA 4USLA 2BL0B 1WY9A 1CM1A 3OP0A 2M7NA 1HT9A 4ORAB 1M45A 5KU1A 1F71A 1F55A 2OS8C 2PRUA 1S6JA 2LUXA 3DF0A 1WDCC 4PHJA 1J7QA 2H61A 2Y4QA 3EK4A 5JOLA 1R6PA 3GOFA 1KK8B 1KCYA 1W7IB 1S6CA 1YUSA 3EVRA 1ALVA 1WRLA 1DJYA 1B7TZ 5D7FA 1JFJA 1QX7A 1QJTA 3PN7B 2ZN9A 2NCOA 2EC6B 2KSPA 1MXLC 1XFZO 4HREE 4R1EA 2LAPA 1SCMC 1SNLA 2AAOA 2COLB 2JQ6A 1TN4A 1TNWA 4AOMA 1QASA 2LVIA 2OTGC 2ZRSA 3WHTB 1S36A 3TDIA 2VRGA 1S1EA 2WCEA 3LK0A 1LXFC 3BOWA 1CMFA 2LV7A 1KQMB 2JU0A 2LVKA 3LK1A 1NX3A 3JTDB 1ZOTB 4HRGA 1PVAA 2KI4C 3EK7A 1ZUZA 1IH0A 4HRHA 1F8HA 2EHBA 4MBEA 1S6IA 1QIWA 1VRKA 1CM4A 5I2OA 2KI6D 2PSRA 2ISDA 1SKTA 1EL4A 2FOTA 4U8DA 1RROA 3F45A 4GFTA 3SG6A 1IG5A 4C0JA 1TNXA 5D69A 2PASA 1DGUA 3CS1A 4P2YB 2HQ8A 3D10A 4UPGA 1SYMA 2HF5A 1YVHA 3WHUB 2R2IA 1QIVA 1WLMA 2KFHA 2CNPA 2LVJA 1AJ4A 4YGBB 1PK0D 2MA2A 3D0YA 1CTRA 4MZJA 2KBIA 1AJ5A 1CLMA 1RECA 1CDPA 2LP2A 4MSPA 1PRWA 3HCMA 2BKHB 4DUQA 3SIBA 5CSJA 4AQJA 1NX2A 2JOJA 3BQ3A 2JULA 4YI9A 1BG1A 1F4OA 3AKBA 3OX6A 2MRDA 2LVVA 3PLFB 3A8RA 4FTGA 3OB2B 5AANA 1LVCD 1IJ6A 3K21A 2KHNA 4Q04A 2M29A 1EJ3A 4PALA 1TRFA 3CZTX 1C7VA 2LP3A 1L2OB 2L0PA 5I8NA 3EVUA 1BOCA 1NPQA 2PVBA 5PALA 3SG3A 1PALA 5F6TA 4GGNA 1UHKA 1UURA 2Q91A 1UHNA 4CFRA 5GQQC 2BCBA 1K94A 3BUXB 3VRPA 3NSKA 4I5KA 3DVJA 2M8UA 1M39A 4GAOA 3C1VA 1QLKA 2KYCA 2JZIA 2JXCA 1EXRA 2B1UA 1KFXL 2LHIA 3PALA 2WCFA 4QJ3B 3IQOA 5I2LA 3TS5C 4C0KA 1CNPA 3CTNA 1G33A 2MHHA 3AKAA 2LLTA 4YGDB 1UUSA 2O5GA 4L9MA 4OV2A 1XA5A 3JVTB 3BUOB 4PHNA 2LMTA 3TZ1A 1E8AA 1K9KA 1Y0VH 4CPVA 2G2BA 1H4BA 3O2PA 3WNXB 3TDUA 1U5IA 4GBAA 1LINA 2I2RE 3A4UB 2MAZA 4I5JA 3I5IB 1CMGA 1NIWA 3KO0A 1A2XA 2JXLA 1K90D 1OQPA 2CCMA 3IF7A 1IRJA 4YGCB 5DKQA 1UHJA 5I2QA 1QATA 1IWQA 3LL8B 1DJZA 1D1OA 1G4YR 2BE4A 3VRQA 1XFUO 3CWGA 2BE6A 2L51A 1TNPA 1NCZA 2BL0C 2K8MB 5CSFA 1K9PA 4MN0A 1NSHA 2LANA 1BODA 1S5GY 1DF0A 4DRWA 2ZN8A 2LLUA 5HLOA 1NCXA 4OCIA 1SL7A 1YUUA 2MBXA 1CLLA 4NDCA 2NLNA 1JC2A 1JSAA 1DT7B 1KWOB 3I5HC 3TUYB 1KK8C 1A75A 2KAYA 1FPWA 4QJ4B 1SR6C 2E30A 1FI5A 5HKWA 3EVVA 2Y1MA 4XJKB 1FI6A 2SCPA 2EC6C 2JRFA 1A4PA 1MQ1A 4GUKA 5HKYA 1CDLA 5CSIA 1KK7Y 2OS8B 5BPJA 1BR1B 1KFUS 3VRRA 1WDCB 3D0YB 5HKZA 2KYFA 1G8IA 1YUTA 2KAVA 4N1GA 1NWDA 4MEWA 1Y6WA 2HETA 2L5XB 2M1KB 2KQYA 2KNEA 3ZWHA 2KFGA 4DS7A 3FS7A 4PDZA 5HLVA 1LA3A 1K2HA 3LCPC 1SCMB 3NXAA 2BECA 4NDBA 1C7WA 1AHRA 3ICBA 4GGFA 5KTYA 4PE7A 1OZSA 1KFXS 2OTGB 2LLSA 3O4YA 1CFFA 4NDDA 2WOSA 3AAKA 1BR4B 3SG4A 2M3WA 2QACA 3NSOA 5DKRA 2BKIB 2ZNEA 4P5OE 5CSNA 2CBLA 3H4SE 1N65A 1BF5A 1B47A 1R2UA 3TDZA 5AERA 1RTP1 1XFYO 3GK4X 2KI4B 1XO5A 3OB1B 4M2OA 1SY9A 1AUIB 4YI8A 4DCKA 1YRUB 2NZ0A 2Y1NA 3BXKA 1TCOB 1B7TY 2Y5IA 3I5GC 1DMOA 2LE9B 3EKJA 3IQQA 1K95A 2TN4A 1A29A 1DJHA 3I5FC 1LKJA 3EKHA 2F2PA 4YRUA 1NCYA 4WQ2A 1YTZC 1B8LA 1J55A 3EK8A 2KDHA 1J7PA 1PSBA 2KI6C 2I94A 2E6WA 2RGIA 2WORA 1QVIY 1Y1AA 1JBAA 1TIZA 1B1GA 1SBJA 1YURA 2JC2A 3GK1A 4CFQA 1WRZA 1DJIA 1HQVA 1M46A 1SMGA 1B4CA 3BYAA 2JTZA 3OX5A 1AK8A 1ZMZA 4JWQA 1J1EA 4HSZA 1K93D 2A4JA 3QRXA 1K96A 4M2PA 1N0YA 5AXIA 1EG3A 1IJ5A 4A4CA 4OKHA 4I5LB 1CFPA 1XK4C 1C07A 1NYAA 2FCDA 2MJWB 1RJVA 2BBNA 1Q80A 3SIAA 1MR8A 3DF0B 1UWOA 1BLQA 2LMVA 1IKUA 2OPOA 4OR9B 1MF8B 1XFVO 2AMIA 1IGVA 5K89A 1S5GZ 4D1EA 5ER4X 1V1FA 2M0RA 5ER5A 3M0WA 2WNDA 5G08A 1CKKA 3SG5A 2K61A 1J7OA 1MXEA 1OOJA 1BU3A 1PVBA 2BCXA 3I5IC 2O60A 4JPZB 3TS5B 2ZFDA 1MHOA 4GGFC 5IBWA 3KHEA 2ZNDA 3RM1A 4MLWA 1DGVA 4ORCB 4MZLA 4NQGA 3DVEA 1ALWA 4YGEB 1B8RA 4GNKB 1NX1A 4AQIA 4BY5A 1QS7A 1KK7Z 4MRYA 1JF2A 1QTXA 3BUNB 4CLNA 3BOWB 5J3XA 3SJSA 4ZCVA 1S26D 1SRAA 4ORBB 1OZOA 2D8NA 2G9BA 3GK2A 1XVJA 2F3ZA 5JJGA 4E68A 4PHMA 2K7BA 4M2QA 2LHLA 1UHHA 2IS9A 4QJ5B 2L4IA 2M49B 1L7ZA 5B8IB 1AP4A 1ODBA 4PE0A 1YRTB 2PALA 1QX5B 2JT8A 3PN7C 2JNXA 4A4BA 3MSEB 1XK4A 1ZACA 4ICBA 1YR5A 2LM5A 1B9AA 1CLBA 1QX2A 1YX8A 2JTTA 1CDNA 5DKNA 1TCFA 3KEVA 1IQ5A 2K0JA 3ZNIA 4PCWA 4FQOA 2WC8A 1QLSA 1GJYA 3I5HB 1JFKA 5AFPA 1BT6A 2F2OA 1SR6B 1FF1A 1UP5A 3CGAA 2CTNA 2GGMA 4PHKA 1XYDA 1RK9A 2JT0A 3VGOA 1KQMC 2L4HA 2PMYA 2QPTA 3DVKA 4MZKA 3JTDC 3HX4A 1DJGA 3FIAA 1NP8A 3PFVA 5FYXA 4ZCUA 2KFFA 3DVMA 1OMRA 3KPXA 3AAJA 1F4QA 1XFXO 2BCAA 2M7LA 1GQMA 4BY4A 3KF9A 1H8BA 2Q4UA 1KSMA 1XFWO 1CFDA 4JQ0D 1OMVA 1JF0A 1DTLA 1AVSA 2WCBA 3OHMB 1UHIA 4WRIA 1QVIZ 1KSOA 1QV0A 5CPVA 1MWNA 2H2KA 1CDMA 4ETOA 1J1DA 2JNFA 4PE1A 3NSIA 2M9GA 2NXQA 2NCPA 4IL1A 3BUWB 4F0ZB 1K9UA 1NUBA 2K7OA 4OVNF
chains in the Genus database with same CATH superfamily
2AUCA 1DVIA 1M31A 2ZKMX 2JT3A 2L2CA 3DYEA 2FJUB 2KOTA 2GGZA 3CR2A 1Y1XA 3FWBA 1W7JB 2CXJA 1A03A 3DD4A 2WCKA 5FI6A 4XJKA 2KLDA 4I5NB 4YGAA 1C3YA 1IIOA 1B8CA 2LCPA 1P28A 1JWDA 2KGRA 5D3OA 2JPTA 2K7DA 1QV1A 1WRKA 2F8PA 3BUMB 3D76A 3PM2A 2K2FA 1OW4A 1U5IB 1F70A 1L2OC 3I5GB 2HPSA 4XYNA 1TTXA 2KQ6A 1GGWA 2GV5A 2SASA 1IQ3A 1PSRA 1J7RA 3VROA 1CB1A 2P6BB 1GGZA 1TOPA 5HYDA 1RFJA 1SCVA 1TUJA 1X02A 5TNCA 3I5FB 2LMUA 3O78A 3O6BA 2M97A 3VRNA 2MLEC 3LLEA 4C0LA 2F33A 1TNQA 1F54A 2HQWA 1FBVA 1SL9A 2L2EA 2K7CA 3B86A 4PE4A 3E3RA 4CIDA 5I94A 3BJHA 1OSAA 2KGBC 4YBHB 1BJFA 2QEBA 4INXA 1YX7A 1KFUL 2K60A 4KYNA 1RWYA 1DF0B 1MUXA 2KAXA 3EG5B 3K1EA 2QEVA 2QEHA 3JVTC 2H61C 3PSRA 1SL8A 1SK6D 2BBMA 1A75B 2JWWA 2LC5A 5KSZA 2ZRTA 1LA0A 3CABA 2L98A 1FW4A 1EG4A 3CLNA 4N1FA 1OMDA 1QXPA 2I18A 1PULA 1ZFSA 2DOQA 1M63B 2V53A 3CR5X 1S3PA 3FWCA 1Y1UA 2KBMA 1JUOA 3B88A 4DIRA 3CR4X 2FCEA 1BMOA 5AEQA 1NX0A 3L47A 2LUCA 4OZDA 1EH2A 3SG7A 2MLFC 3WXAA 2WCMA 1CFCA 3RLZA 2EGDA 4MVFA 1SPYA 3SS5A 2F3YA 4TNCA 2P71A 1V1GA 3PATA 2LNKA 1WLZA 1K8UA 4WQ3A 1DJXA 1OE9B 1YVLA 3IVTA 3PM8A 2WC5A 1KWOC 3TUYC 1N2DA 3SG2A 3R1VA 3NSLA 2K2AA 2ERBA 2L50A 4N5XA 1SW8A 4GPLB 2M1UA 2CT9A 2I7AA 2PYQA 1DJWA 4MRXA 4USLA 2BL0B 1WY9A 1CM1A 3OP0A 2M7NA 1HT9A 4ORAB 1M45A 5KU1A 1Z2CB 3S0BA 1F71A 1F55A 4JKTA 2OS8C 3B87A 2PRUA 1S6JA 2LUXA 3DF0A 2WCHA 1WDCC 4PHJA 1J7QA 2H61A 2Y4QA 3EK4A 5JOLA 1R6PA 3GOFA 1KK8B 3BFBA 3FE8A 1KCYA 1W7IB 1S6CA 1YUSA 3EVRA 1ALVA 3PJIA 1WRLA 1DJYA 1B7TZ 3D74A 5D7FA 1JFJA 1QX7A 1QJTA 3PN7B 2ZN9A 2NCOA 2EC6B 2KSPA 1MXLC 1XFZO 4HREE 4R1EA 2LAPA 1SCMC 4FQTA 1SNLA 2AAOA 2COLB 2JQ6A 1TN4A 1TNWA 4AOMA 1QASA 2LVIA 2OTGC 2ZRSA 3WHTB 3V2LA 1S36A 3TDIA 2VRGA 1S1EA 1Z4HA 3D78A 2WCEA 3LK0A 1LXFC 3BOWA 1CMFA 2LV7A 1KQMB 2JU0A 2LVKA 3LK1A 1NX3A 3JTDB 1ZOTB 4HRGA 2BNXA 1PVAA 2P70A 2KI4C 3EK7A 1ZUZA 1IH0A 4HRHA 1F8HA 2EHBA 4MBEA 1S6IA 1QIWA 1VRKA 1CM4A 5I2OA 2KI6D 2PSRA 2ISDA 1SKTA 1EL4A 2FOTA 4U8DA 1RROA 3F45A 4GFTA 3SG6A 1IG5A 4C0JA 1TNXA 5D69A 2PASA 1DGUA 1OOFA 3CS1A 4P2YB 2HQ8A 3D10A 4UPGA 1SYMA 2HF5A 1YVHA 3WHUB 2R2IA 1W9ZA 1QIVA 1WLMA 2KFHA 2CNPA 2LVJA 1AJ4A 4YGBB 3SS4A 1PK0D 2MA2A 3D0YA 3FE6A 3UNWA 1CTRA 4MZJA 2KBIA 1AJ5A 3SS3A 1CLMA 1RECA 3OBVA 1CDPA 2LP2A 4MSPA 1PRWA 3HCMA 2BKHB 4DUQA 3SIBA 5CSJA 4AQJA 1NX2A 2JOJA 3BQ3A 2JULA 3Q8IA 3UO9A 4YI9A 1BG1A 1F4OA 3AKBA 3OX6A 1TWOA 2MRDA 2LVVA 3PLFB 3A8RA 4FTGA 3OB2B 5AANA 1LVCD 1IJ6A 3K21A 2KHNA 4Q04A 2M29A 1EJ3A 3S0GA 4PALA 1TRFA 3O4XA 3CZTX 1C7VA 2LP3A 3D77A 1L2OB 2L0PA 5FI2A 5I8NA 3EVUA 3RZSA 1BOCA 1NPQA 2PVBA 5PALA 3SG3A 1OOIX 1PALA 5F6TA 4GGNA 1UHKA 1UURA 2Q91A 1UHNA 1C3ZA 4CFRA 5GQQC 2BCBA 1K94A 3BUXB 3VRPA 3CZ2A 3NSKA 2FJYA 4I5KA 3L4LA 3D73A 3DVJA 2M8UA 1M39A 4GAOA 3C1VA 1QLKA 2KYCA 2JZIA 2JXCA 1EXRA 2B1UA 1KFXL 2LHIA 3PALA 2WCFA 4QJ3B 3IQOA 5I2LA 3TS5C 4C0KA 1CNPA 3CTNA 1G33A 2MHHA 3AKAA 2LLTA 4YGDB 1UUSA 2O5GA 4L9MA 4OV2A 1XA5A 3JVTB 3BUOB 4PHNA 2LMTA 3TZ1A 1E8AA 3BFAA 3B6XA 1K9KA 1Y0VH 4CPVA 2G2BA 1H4BA 3O2PA 3WNXB 3TDUA 1U5IA 3R1PA 4GBAA 1LINA 2I2RE 3A4UB 2MAZA 4I5JA 1SSEB 3I5IB 1CMGA 1NIWA 3KO0A 1A2XA 2JXLA 1K90D 1OQPA 2CCMA 3IF7A 1IRJA 4YGCB 5DKQA 1UHJA 5I2QA 1QATA 1IWQA 3LL8B 1DJZA 1D1OA 1G4YR 2BE4A 3VRQA 1XFUO 3CWGA 2BE6A 2L51A 1TNPA 1NCZA 2BL0C 5HL1A 1OOHA 2K8MB 4F7FA 5CSFA 1K9PA 4MN0A 1NSHA 2LANA 1BODA 1S5GY 1DF0A 4DRWA 2ZN8A 2LLUA 5HLOA 1NCXA 4OCIA 1SL7A 1YUUA 2MBXA 1CLLA 4NDCA 2NLNA 1JC2A 1JSAA 3S0EA 1DT7B 1KWOB 3I5HC 3TUYB 1KK8C 1A75A 2KAYA 2GTEA 2QEOA 1FPWA 4QJ4B 1SR6C 2E30A 4INWA 1FI5A 5HKWA 3EVVA 2Y1MA 4XJKB 1FI6A 3CYZA 2SCPA 2EC6C 2JRFA 1A4PA 1MQ1A 4GUKA 5HKYA 1CDLA 5CSIA 1KK7Y 2OS8B 5DICA 5BPJA 1DQEA 4PT1A 1BR1B 1KFUS 3VRRA 1WDCB 3D0YB 5HKZA 2KYFA 1G8IA 1YUTA 2KAVA 3FE9A 4N1GA 1NWDA 4MEWA 1Y6WA 2HETA 2L5XB 2M1KB 2KQYA 1KQVA 2KNEA 1XFRA 3ZWHA 2KFGA 2YGUA 4DS7A 3FS7A 4PDZA 5HLVA 1LA3A 1K2HA 3LCPC 1SCMB 3NXAA 3R1OA 2BECA 3QMEA 4NDBA 1C7WA 1AHRA 3ICBA 1ORGA 4GGFA 5KTYA 2WCLA 4PE7A 1OZSA 1KFXS 2OTGB 2LLSA 3L4AA 3O4YA 2KPHA 1CFFA 4NDDA 2WOSA 3AAKA 1BR4B 3SG4A 2M3WA 2QACA 3NSOA 5DKRA 2BKIB 2ZNEA 4P5OE 5CSNA 2CBLA 3H4SE 1N65A 1BF5A 1B47A 1R2UA 3TDZA 5AERA 1RTP1 1XFYO 3GK4X 2KI4B 1XO5A 3OB1B 4M2OA 1SY9A 1AUIB 4YI8A 4DCKA 1YRUB 2NZ0A 2Y1NA 3BXKA 1TCOB 1B7TY 2Y5IA 3I5GC 1DMOA 2LE9B 3EKJA 3IQQA 1K95A 2TN4A 3VB1A 1A29A 2WCJA 1DJHA 3I5FC 1LKJA 3EKHA 2F2PA 4YRUA 1NCYA 4WQ2A 1YTZC 1B8LA 1J55A 3B7AA 3NGVA 4IJ7A 3EK8A 2KDHA 1J7PA 3DY9A 1PSBA 2KI6C 2I94A 2E6WA 3BFHA 2RGIA 2WORA 1QVIY 1Y1AA 1JBAA 1TIZA 1B1GA 1SBJA 2H8VA 1YURA 2JC2A 3GK1A 4CFQA 1WRZA 1DJIA 1HQVA 1M46A 1SMGA 1B4CA 3BYAA 2JTZA 3OX5A 2QDIA 1AK8A 1ZMZA 1GM0A 4JWQA 1J1EA 4HSZA 2L5YA 1K93D 2A4JA 3QRXA 1K96A 2KLEA 3CDNA 1N0YA 4M2PA 5AXIA 1EG3A 1IJ5A 3CZ1A 4A4CA 4OKHA 3D75A 3N7HA 4I5LB 1CFPA 1XK4C 1C07A 1NYAA 2FCDA 2MJWB 1RJVA 2BBNA 1Q80A 3SIAA 1MR8A 3DF0B 1UWOA 1BLQA 2LMVA 1IKUA 2OPOA 4OR9B 1MF8B 1XFVO 2AMIA 1IGVA 5K89A 1QWVA 1S5GZ 4D1EA 5ER4X 1V1FA 2M0RA 5ER5A 1DELA 4JD9A 3M0WA 2WNDA 1OOGA 5G08A 1CKKA 3SG5A 2K61A 1J7OA 1MXEA 1OOJA 1BU3A 1PVBA 2BCXA 3I5IC 2O60A 4JPZB 3CZ0A 3TS5B 2ZFDA 1MHOA 4GGFC 5IBWA 3DZTA 3KHEA 2ZNDA 3RM1A 4MLWA 1DGVA 4ORCB 4MZLA 4NQGA 3DVEA 1ALWA 4YGEB 1B8RA 4GNKB 1NX1A 4AQIA 4BY5A 1QS7A 1KK7Z 4MRYA 1JF2A 1QTXA 3BUNB 4CLNA 3BOWB 3NHIA 5J3XA 3SJSA 4ZCVA 1S26D 1SRAA 4ORBB 1OZOA 1DC1A 2D8NA 2G9BA 3GK2A 1XVJA 2F3ZA 5JJGA 4E68A 4PHMA 2K7BA 4M2QA 2LHLA 1UHHA 2IS9A 5FI7A 4QJ5B 2L4IA 2M49B 1L7ZA 5B8IB 1AP4A 1ODBA 4PE0A 2WC6A 1YRTB 2PALA 1QX5B 2JT8A 3PN7C 2JNXA 4A4BA 3MSEB 1XK4A 1ZACA 4ICBA 1YR5A 2LM5A 3S0DA 1B9AA 1CLBA 1QX2A 1T14A 1YX8A 2JTTA 1CDNA 5DKNA 1TCFA 3KEVA 1IQ5A 2K0JA 3ZNIA 4PCWA 4FQOA 2WC8A 2BAPA 1QLSA 1GJYA 3I5HB 1JFKA 5AFPA 1BT6A 2F2OA 5EL2A 1SR6B 3NHTA 1FF1A 1UP5A 1LS8A 2CTNA 2GGMA 3CGAA 4PHKA 1XYDA 1RK9A 2JT0A 3VGOA 1KQMC 2L4HA 2PMYA 2QPTA 3DVKA 4MZKA 3JTDC 3HX4A 1DJGA 3FIAA 1NP8A 3PFVA 5FYXA 4ZCUA 2KFFA 3DVMA 1OMRA 3KPXA 3AAJA 1TUZA 1F4QA 3R72A 1XFXO 1DEKA 2BCAA 1GQMA 2M7LA 3KF9A 4BY4A 2PQLA 2Q4UA 1KSMA 1XFWO 1CFDA 4JQ0D 3S0AA 1H8BA 1OMVA 1JF0A 1DTLA 1AVSA 2WCBA 3DXLA 3OHMB 1UHIA 3S0FA 4WRIA 1QVIZ 1KSOA 1QV0A 3OGNA 5CPVA 1MWNA 2H2KA 1CDMA 4ETOA 1J1DA 2JNFA 4PE1A 3NSIA 2M9GA 2NXQA 2NCPA 4IL1A 3BUWB 2JPOA 4F0ZB 1K9UA 1NUBA 2K7OA 4OVNF
chains in the Genus database with same CATH topology
2AUCA 1DVIA 1M31A 2ZKMX 2JT3A 2FJUB 2KOTA 2GGZA 3CR2A 1Y1XA 3FWBA 1W7JB 2CXJA 1A03A 3DD4A 4XJKA 4I5NB 4YGAA 1B8CA 2LCPA 1JWDA 2KGRA 2JPTA 2K7DA 1QV1A 1WRKA 2F8PA 3BUMB 2K2FA 1U5IB 1F70A 1L2OC 3I5GB 2HPSA 4XYNA 1TTXA 2KQ6A 1GGWA 2GV5A 2SASA 1IQ3A 1PSRA 1J7RA 3VROA 1CB1A 2P6BB 1GGZA 1TOPA 5HYDA 1RFJA 1SCVA 1X02A 5TNCA 3I5FB 2LMUA 3O78A 3O6BA 2M97A 3VRNA 2MLEC 3LLEA 4C0LA 2F33A 1TNQA 1F54A 2HQWA 1FBVA 1SL9A 2L2EA 2K7CA 4PE4A 4CIDA 3E3RA 1KQVA 1OSAA 2KGBC 4YBHB 1BJFA 1YX7A 1KFUL 1RWYA 1DF0B 1MUXA 2KAXA 3JVTC 2H61C 3PSRA 1SL8A 1SK6D 2BBMA 1A75B 2JWWA 2LC5A 5KSZA 2ZRTA 1LA0A 2L98A 1FW4A 1EG4A 3CLNA 4N1FA 1OMDA 1QXPA 2I18A 1PULA 1ZFSA 2DOQA 1M63B 2V53A 3CR5X 1S3PA 3FWCA 1Y1UA 2KBMA 1JUOA 4DIRA 3CR4X 2FCEA 1BMOA 5AEQA 1NX0A 1EH2A 2LUCA 3SG7A 2MLFC 3WXAA 1CFCA 3RLZA 2EGDA 4MVFA 1SPYA 2F3YA 4TNCA 1V1GA 3PATA 2LNKA 1WLZA 1K8UA 4WQ3A 1DJXA 1OE9B 1YVLA 3PM8A 1KWOC 3TUYC 1N2DA 3SG2A 3NSLA 2K2AA 2L50A 4N5XA 1SW8A 4GPLB 2M1UA 2CT9A 2I7AA 1DJWA 4MRXA 4USLA 2BL0B 1WY9A 1CM1A 3OP0A 2M7NA 1HT9A 4ORAB 1M45A 5KU1A 1F71A 1F55A 2OS8C 2PRUA 1S6JA 2LUXA 3DF0A 1WDCC 4PHJA 1J7QA 2H61A 2Y4QA 3EK4A 5JOLA 1R6PA 3GOFA 1KK8B 1KCYA 1W7IB 1S6CA 1YUSA 3EVRA 1ALVA 1WRLA 1DJYA 1B7TZ 5D7FA 1JFJA 1QX7A 1QJTA 3PN7B 2ZN9A 2NCOA 2EC6B 2KSPA 1MXLC 1XFZO 4HREE 4R1EA 2LAPA 1SCMC 1SNLA 2AAOA 2COLB 2JQ6A 1TN4A 1TNWA 4AOMA 1QASA 2LVIA 2OTGC 2ZRSA 3WHTB 1S36A 3TDIA 2VRGA 1S1EA 2WCEA 3LK0A 1LXFC 3BOWA 1CMFA 2LV7A 1KQMB 2JU0A 2LVKA 3LK1A 1NX3A 3JTDB 1ZOTB 4HRGA 1PVAA 2KI4C 3EK7A 1ZUZA 1IH0A 4HRHA 1F8HA 2EHBA 4MBEA 1S6IA 1QIWA 1VRKA 1CM4A 5I2OA 2KI6D 2PSRA 2ISDA 1SKTA 1EL4A 2FOTA 4U8DA 1RROA 3F45A 4GFTA 3SG6A 1IG5A 4C0JA 1TNXA 5D69A 2PASA 1DGUA 3CS1A 4P2YB 2HQ8A 3D10A 4UPGA 1SYMA 2HF5A 1YVHA 3WHUB 2R2IA 1QIVA 1WLMA 2KFHA 2CNPA 2LVJA 1AJ4A 4YGBB 1PK0D 2MA2A 3D0YA 1CTRA 4MZJA 2KBIA 1AJ5A 1CLMA 1RECA 1CDPA 2LP2A 4MSPA 1PRWA 3HCMA 2BKHB 4DUQA 3SIBA 5CSJA 4AQJA 1NX2A 2JOJA 3BQ3A 2JULA 4YI9A 1BG1A 1F4OA 3AKBA 3OX6A 2MRDA 2LVVA 3PLFB 3A8RA 4FTGA 3OB2B 5AANA 1LVCD 1IJ6A 3K21A 2KHNA 4Q04A 2M29A 1EJ3A 4PALA 1TRFA 3CZTX 1C7VA 2LP3A 1L2OB 2L0PA 5I8NA 3EVUA 1BOCA 1NPQA 2PVBA 5PALA 3SG3A 1PALA 5F6TA 4GGNA 1UHKA 1UURA 2Q91A 1UHNA 4CFRA 5GQQC 2BCBA 1K94A 3BUXB 3VRPA 3NSKA 4I5KA 3DVJA 2M8UA 1M39A 4GAOA 3C1VA 1QLKA 2KYCA 2JZIA 2JXCA 1EXRA 2B1UA 1KFXL 2LHIA 3PALA 2WCFA 4QJ3B 3IQOA 5I2LA 3TS5C 4C0KA 1CNPA 3CTNA 1G33A 2MHHA 3AKAA 2LLTA 4YGDB 1UUSA 2O5GA 4L9MA 4OV2A 1XA5A 3JVTB 3BUOB 4PHNA 2LMTA 3TZ1A 1E8AA 1K9KA 1Y0VH 4CPVA 2G2BA 1H4BA 3O2PA 3WNXB 3TDUA 1U5IA 4GBAA 1LINA 2I2RE 3A4UB 2MAZA 4I5JA 3I5IB 1CMGA 1NIWA 3KO0A 1A2XA 2JXLA 1K90D 1OQPA 2CCMA 3IF7A 1IRJA 4YGCB 5DKQA 1UHJA 5I2QA 1QATA 1IWQA 3LL8B 1DJZA 1D1OA 1G4YR 2BE4A 3VRQA 1XFUO 3CWGA 2BE6A 2L51A 1TNPA 1NCZA 2BL0C 2K8MB 5CSFA 1K9PA 4MN0A 1NSHA 2LANA 1BODA 1S5GY 1DF0A 4DRWA 2ZN8A 2LLUA 5HLOA 1NCXA 4OCIA 1SL7A 1YUUA 2MBXA 1CLLA 4NDCA 2NLNA 1JC2A 1JSAA 1DT7B 1KWOB 3I5HC 3TUYB 1KK8C 1A75A 2KAYA 1FPWA 4QJ4B 1SR6C 2E30A 1FI5A 5HKWA 3EVVA 2Y1MA 4XJKB 1FI6A 2SCPA 2EC6C 2JRFA 1A4PA 1MQ1A 4GUKA 5HKYA 1CDLA 5CSIA 1KK7Y 2OS8B 5BPJA 1BR1B 1KFUS 3VRRA 1WDCB 3D0YB 5HKZA 2KYFA 1G8IA 1YUTA 2KAVA 4N1GA 1NWDA 4MEWA 1Y6WA 2HETA 2L5XB 2M1KB 2KQYA 2KNEA 3ZWHA 2KFGA 4DS7A 3FS7A 4PDZA 5HLVA 1LA3A 1K2HA 3LCPC 1SCMB 3NXAA 2BECA 4NDBA 1C7WA 1AHRA 3ICBA 4GGFA 5KTYA 4PE7A 1OZSA 1KFXS 2OTGB 2LLSA 3O4YA 1CFFA 4NDDA 2WOSA 3AAKA 1BR4B 3SG4A 2M3WA 2QACA 3NSOA 5DKRA 2BKIB 2ZNEA 4P5OE 5CSNA 2CBLA 3H4SE 1N65A 1BF5A 1B47A 1R2UA 3TDZA 5AERA 1RTP1 1XFYO 3GK4X 2KI4B 1XO5A 3OB1B 4M2OA 1SY9A 1AUIB 4YI8A 4DCKA 1YRUB 2NZ0A 2Y1NA 3BXKA 1TCOB 1B7TY 2Y5IA 3I5GC 1DMOA 2LE9B 3EKJA 3IQQA 1K95A 2TN4A 1A29A 1DJHA 3I5FC 1LKJA 3EKHA 2F2PA 4YRUA 1NCYA 4WQ2A 1YTZC 1B8LA 1J55A 3EK8A 2KDHA 1J7PA 1PSBA 2KI6C 2I94A 2E6WA 2RGIA 2WORA 1QVIY 1Y1AA 1JBAA 1TIZA 1B1GA 1SBJA 1YURA 2JC2A 3GK1A 4CFQA 1WRZA 1DJIA 1HQVA 1M46A 1SMGA 1B4CA 3BYAA 2JTZA 3OX5A 1AK8A 1ZMZA 4JWQA 1J1EA 4HSZA 1K93D 2A4JA 3QRXA 1K96A 4M2PA 1N0YA 5AXIA 1EG3A 1IJ5A 4A4CA 4OKHA 4I5LB 1CFPA 1XK4C 1C07A 1NYAA 2FCDA 2MJWB 1RJVA 2BBNA 1Q80A 3SIAA 1MR8A 3DF0B 1UWOA 1BLQA 2LMVA 1IKUA 2OPOA 4OR9B 1MF8B 1XFVO 2AMIA 1IGVA 5K89A 1S5GZ 4D1EA 5ER4X 1V1FA 2M0RA 5ER5A 3M0WA 2WNDA 5G08A 1CKKA 3SG5A 2K61A 1J7OA 1MXEA 1OOJA 1BU3A 1PVBA 2BCXA 3I5IC 2O60A 4JPZB 3TS5B 2ZFDA 1MHOA 4GGFC 5IBWA 3KHEA 2ZNDA 3RM1A 4MLWA 1DGVA 4ORCB 4MZLA 4NQGA 3DVEA 1ALWA 4YGEB 1B8RA 4GNKB 1NX1A 4AQIA 4BY5A 1QS7A 1KK7Z 4MRYA 1JF2A 1QTXA 3BUNB 4CLNA 3BOWB 5J3XA 3SJSA 4ZCVA 1S26D 1SRAA 4ORBB 1OZOA 2D8NA 2G9BA 3GK2A 1XVJA 2F3ZA 5JJGA 4E68A 4PHMA 2K7BA 4M2QA 2LHLA 1UHHA 2IS9A 4QJ5B 2L4IA 2M49B 1L7ZA 5B8IB 1AP4A 1ODBA 4PE0A 1YRTB 2PALA 1QX5B 2JT8A 3PN7C 2JNXA 4A4BA 3MSEB 1XK4A 1ZACA 4ICBA 1YR5A 2LM5A 1B9AA 1CLBA 1QX2A 1YX8A 2JTTA 1CDNA 5DKNA 1TCFA 3KEVA 1IQ5A 2K0JA 3ZNIA 4PCWA 4FQOA 2WC8A 1QLSA 1GJYA 3I5HB 1JFKA 5AFPA 1BT6A 2F2OA 1SR6B 1FF1A 1UP5A 3CGAA 2CTNA 2GGMA 4PHKA 1XYDA 1RK9A 2JT0A 3VGOA 1KQMC 2L4HA 2PMYA 2QPTA 3DVKA 4MZKA 3JTDC 3HX4A 1DJGA 3FIAA 1NP8A 3PFVA 5FYXA 4ZCUA 2KFFA 3DVMA 1OMRA 3KPXA 3AAJA 1F4QA 1XFXO 2BCAA 2M7LA 1GQMA 4BY4A 3KF9A 1H8BA 2Q4UA 1KSMA 1XFWO 1CFDA 4JQ0D 1OMVA 1JF0A 1DTLA 1AVSA 2WCBA 3OHMB 1UHIA 4WRIA 1QVIZ 1KSOA 1QV0A 5CPVA 1MWNA 2H2KA 1CDMA 4ETOA 1J1DA 2JNFA 4PE1A 3NSIA 2M9GA 2NXQA 2NCPA 4IL1A 3BUWB 4F0ZB 1K9UA 1NUBA 2K7OA 4OVNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUC A;  1DVI A;  1M31 A;  2ZKM X;  2JT3 A;  2FJU B;  2KOT A;  2GGZ A;  3CR2 A;  1Y1X A;  3FWB A;  1W7J B;  2CXJ A;  1A03 A;  3DD4 A;  4XJK A;  4I5N B;  4YGA A;  1B8C A;  2LCP A;  1JWD A;  2KGR A;  2JPT A;  2K7D A;  1QV1 A;  1WRK A;  2F8P A;  3BUM B;  2K2F A;  1U5I B;  1F70 A;  1L2O C;  3I5G B;  2HPS A;  4XYN A;  1TTX A;  2KQ6 A;  1GGW A;  2GV5 A;  2SAS A;  1IQ3 A;  1PSR A;  1J7R A;  3VRO A;  1CB1 A;  2P6B B;  1GGZ A;  1TOP A;  5HYD A;  1RFJ A;  1SCV A;  1X02 A;  5TNC A;  3I5F B;  2LMU A;  3O78 A;  3O6B A;  2M97 A;  3VRN A;  2MLE C;  3LLE A;  4C0L A;  2F33 A;  1TNQ A;  1F54 A;  2HQW A;  1FBV A;  1SL9 A;  2L2E A;  2K7C A;  4PE4 A;  4CID A;  3E3R A;  1KQV A;  1OSA A;  2KGB C;  4YBH B;  1BJF A;  1YX7 A;  1KFU L;  1RWY A;  1DF0 B;  1MUX A;  2KAX A;  3JVT C;  2H61 C;  3PSR A;  1SL8 A;  1SK6 D;  2BBM A;  1A75 B;  2JWW A;  2LC5 A;  5KSZ A;  2ZRT A;  1LA0 A;  2L98 A;  1FW4 A;  1EG4 A;  3CLN A;  4N1F A;  1OMD A;  1QXP A;  2I18 A;  1PUL A;  1ZFS A;  2DOQ A;  1M63 B;  2V53 A;  3CR5 X;  1S3P A;  3FWC A;  1Y1U A;  2KBM A;  1JUO A;  4DIR A;  3CR4 X;  2FCE A;  1BMO A;  5AEQ A;  1NX0 A;  1EH2 A;  2LUC A;  3SG7 A;  2MLF C;  3WXA A;  1CFC A;  3RLZ A;  2EGD A;  4MVF A;  1SPY A;  2F3Y A;  4TNC A;  1V1G A;  3PAT A;  2LNK A;  1WLZ A;  1K8U A;  4WQ3 A;  1DJX A;  1OE9 B;  1YVL A;  3PM8 A;  1KWO C;  3TUY C;  1N2D A;  3SG2 A;  3NSL A;  2K2A A;  2L50 A;  4N5X A;  1SW8 A;  4GPL B;  2M1U A;  2CT9 A;  2I7A A;  1DJW A;  4MRX A;  4USL A;  2BL0 B;  1WY9 A;  1CM1 A;  3OP0 A;  2M7N A;  1HT9 A;  4ORA B;  1M45 A;  5KU1 A;  1F71 A;  1F55 A;  2OS8 C;  2PRU A;  1S6J A;  2LUX A;  3DF0 A;  1WDC C;  4PHJ A;  1J7Q A;  2H61 A;  2Y4Q A;  3EK4 A;  5JOL A;  1R6P A;  3GOF A;  1KK8 B;  1KCY A;  1W7I B;  1S6C A;  1YUS A;  3EVR A;  1ALV A;  1WRL A;  1DJY A;  1B7T Z;  5D7F A;  1JFJ A;  1QX7 A;  1QJT A;  3PN7 B;  2ZN9 A;  2NCO A;  2EC6 B;  2KSP A;  1MXL C;  1XFZ O;  4HRE E;  4R1E A;  2LAP A;  1SCM C;  1SNL A;  2AAO A;  2COL B;  2JQ6 A;  1TN4 A;  1TNW A;  4AOM A;  1QAS A;  2LVI A;  2OTG C;  2ZRS A;  3WHT B;  1S36 A;  3TDI A;  2VRG A;  1S1E A;  2WCE A;  3LK0 A;  1LXF C;  3BOW A;  1CMF A;  2LV7 A;  1KQM B;  2JU0 A;  2LVK A;  3LK1 A;  1NX3 A;  3JTD B;  1ZOT B;  4HRG A;  1PVA A;  2KI4 C;  3EK7 A;  1ZUZ A;  1IH0 A;  4HRH A;  1F8H A;  2EHB A;  4MBE A;  1S6I A;  1QIW A;  1VRK A;  1CM4 A;  5I2O A;  2KI6 D;  2PSR A;  2ISD A;  1SKT A;  1EL4 A;  2FOT A;  4U8D A;  1RRO A;  3F45 A;  4GFT A;  3SG6 A;  1IG5 A;  4C0J A;  1TNX A;  5D69 A;  2PAS A;  1DGU A;  3CS1 A;  4P2Y B;  2HQ8 A;  3D10 A;  4UPG A;  1SYM A;  2HF5 A;  1YVH A;  3WHU B;  2R2I A;  1QIV A;  1WLM A;  2KFH A;  2CNP A;  2LVJ A;  1AJ4 A;  4YGB B;  1PK0 D;  2MA2 A;  3D0Y A;  1CTR A;  4MZJ A;  2KBI A;  1AJ5 A;  1CLM A;  1REC A;  1CDP A;  2LP2 A;  4MSP A;  1PRW A;  3HCM A;  2BKH B;  4DUQ A;  3SIB A;  5CSJ A;  4AQJ A;  1NX2 A;  2JOJ A;  3BQ3 A;  2JUL A;  4YI9 A;  1BG1 A;  1F4O A;  3AKB A;  3OX6 A;  2MRD A;  2LVV A;  3PLF B;  3A8R A;  4FTG A;  3OB2 B;  5AAN A;  1LVC D;  1IJ6 A;  3K21 A;  2KHN A;  4Q04 A;  2M29 A;  1EJ3 A;  4PAL A;  1TRF A;  3CZT X;  1C7V A;  2LP3 A;  1L2O B;  2L0P A;  5I8N A;  3EVU A;  1BOC A;  1NPQ A;  2PVB A;  5PAL A;  3SG3 A;  1PAL A;  5F6T A;  4GGN A;  1UHK A;  1UUR A;  2Q91 A;  1UHN A;  4CFR A;  5GQQ C;  2BCB A;  1K94 A;  3BUX B;  3VRP A;  3NSK A;  4I5K A;  3DVJ A;  2M8U A;  1M39 A;  4GAO A;  3C1V A;  1QLK A;  2KYC A;  2JZI A;  2JXC A;  1EXR A;  2B1U A;  1KFX L;  2LHI A;  3PAL A;  2WCF A;  4QJ3 B;  3IQO A;  5I2L A;  3TS5 C;  4C0K A;  1CNP A;  3CTN A;  1G33 A;  2MHH A;  3AKA A;  2LLT A;  4YGD B;  1UUS A;  2O5G A;  4L9M A;  4OV2 A;  1XA5 A;  3JVT B;  3BUO B;  4PHN A;  2LMT A;  3TZ1 A;  1E8A A;  1K9K A;  1Y0V H;  4CPV A;  2G2B A;  1H4B A;  3O2P A;  3WNX B;  3TDU A;  1U5I A;  4GBA A;  1LIN A;  2I2R E;  3A4U B;  2MAZ A;  4I5J A;  3I5I B;  1CMG A;  1NIW A;  3KO0 A;  1A2X A;  2JXL A;  1K90 D;  1OQP A;  2CCM A;  3IF7 A;  1IRJ A;  4YGC B;  5DKQ A;  1UHJ A;  5I2Q A;  1QAT A;  1IWQ A;  3LL8 B;  1DJZ A;  1D1O A;  1G4Y R;  2BE4 A;  3VRQ A;  1XFU O;  3CWG A;  2BE6 A;  2L51 A;  1TNP A;  1NCZ A;  2BL0 C;  2K8M B;  5CSF A;  1K9P A;  4MN0 A;  1NSH A;  2LAN A;  1BOD A;  1S5G Y;  1DF0 A;  4DRW A;  2ZN8 A;  2LLU A;  5HLO A;  1NCX A;  4OCI A;  1SL7 A;  1YUU A;  2MBX A;  1CLL A;  4NDC A;  2NLN A;  1JC2 A;  1JSA A;  1DT7 B;  1KWO B;  3I5H C;  3TUY B;  1KK8 C;  1A75 A;  2KAY A;  1FPW A;  4QJ4 B;  1SR6 C;  2E30 A;  1FI5 A;  5HKW A;  3EVV A;  2Y1M A;  4XJK B;  1FI6 A;  2SCP A;  2EC6 C;  2JRF A;  1A4P A;  1MQ1 A;  4GUK A;  5HKY A;  1CDL A;  5CSI A;  1KK7 Y;  2OS8 B;  5BPJ A;  1BR1 B;  1KFU S;  3VRR A;  1WDC B;  3D0Y B;  5HKZ A;  2KYF A;  1G8I A;  1YUT A;  2KAV A;  4N1G A;  1NWD A;  4MEW A;  1Y6W A;  2HET A;  2L5X B;  2M1K B;  2KQY A;  2KNE A;  3ZWH A;  2KFG A;  4DS7 A;  3FS7 A;  4PDZ A;  5HLV A;  1LA3 A;  1K2H A;  3LCP C;  1SCM B;  3NXA A;  2BEC A;  4NDB A;  1C7W A;  1AHR A;  3ICB A;  4GGF A;  5KTY A;  4PE7 A;  1OZS A;  1KFX S;  2OTG B;  2LLS A;  3O4Y A;  1CFF A;  4NDD A;  2WOS A;  3AAK A;  1BR4 B;  3SG4 A;  2M3W A;  2QAC A;  3NSO A;  5DKR A;  2BKI B;  2ZNE A;  4P5O E;  5CSN A;  2CBL A;  3H4S E;  1N65 A;  1BF5 A;  1B47 A;  1R2U A;  3TDZ A;  5AER A;  1RTP 1;  1XFY O;  3GK4 X;  2KI4 B;  1XO5 A;  3OB1 B;  4M2O A;  1SY9 A;  1AUI B;  4YI8 A;  4DCK A;  1YRU B;  2NZ0 A;  2Y1N A;  3BXK A;  1TCO B;  1B7T Y;  2Y5I A;  3I5G C;  1DMO A;  2LE9 B;  3EKJ A;  3IQQ A;  1K95 A;  2TN4 A;  1A29 A;  1DJH A;  3I5F C;  1LKJ A;  3EKH A;  2F2P A;  4YRU A;  1NCY A;  4WQ2 A;  1YTZ C;  1B8L A;  1J55 A;  3EK8 A;  2KDH A;  1J7P A;  1PSB A;  2KI6 C;  2I94 A;  2E6W A;  2RGI A;  2WOR A;  1QVI Y;  1Y1A A;  1JBA A;  1TIZ A;  1B1G A;  1SBJ A;  1YUR A;  2JC2 A;  3GK1 A;  4CFQ A;  1WRZ A;  1DJI A;  1HQV A;  1M46 A;  1SMG A;  1B4C A;  3BYA A;  2JTZ A;  3OX5 A;  1AK8 A;  1ZMZ A;  4JWQ A;  1J1E A;  4HSZ A;  1K93 D;  2A4J A;  3QRX A;  1K96 A;  4M2P A;  1N0Y A;  5AXI A;  1EG3 A;  1IJ5 A;  4A4C A;  4OKH A;  4I5L B;  1CFP A;  1XK4 C;  1C07 A;  1NYA A;  2FCD A;  2MJW B;  1RJV A;  2BBN A;  1Q80 A;  3SIA A;  1MR8 A;  3DF0 B;  1UWO A;  1BLQ A;  2LMV A;  1IKU A;  2OPO A;  4OR9 B;  1MF8 B;  1XFV O;  2AMI A;  1IGV A;  5K89 A;  1S5G Z;  4D1E A;  5ER4 X;  1V1F A;  2M0R A;  5ER5 A;  3M0W A;  2WND A;  5G08 A;  1CKK A;  3SG5 A;  2K61 A;  1J7O A;  1MXE A;  1OOJ A;  1BU3 A;  1PVB A;  2BCX A;  3I5I C;  2O60 A;  4JPZ B;  3TS5 B;  2ZFD A;  1MHO A;  4GGF C;  5IBW A;  3KHE A;  2ZND A;  3RM1 A;  4MLW A;  1DGV A;  4ORC B;  4MZL A;  4NQG A;  3DVE A;  1ALW A;  4YGE B;  1B8R A;  4GNK B;  1NX1 A;  4AQI A;  4BY5 A;  1QS7 A;  1KK7 Z;  4MRY A;  1JF2 A;  1QTX A;  3BUN B;  4CLN A;  3BOW B;  5J3X A;  3SJS A;  4ZCV A;  1S26 D;  1SRA A;  4ORB B;  1OZO A;  2D8N A;  2G9B A;  3GK2 A;  1XVJ A;  2F3Z A;  5JJG A;  4E68 A;  4PHM A;  2K7B A;  4M2Q A;  2LHL A;  1UHH A;  2IS9 A;  4QJ5 B;  2L4I A;  2M49 B;  1L7Z A;  5B8I B;  1AP4 A;  1ODB A;  4PE0 A;  1YRT B;  2PAL A;  1QX5 B;  2JT8 A;  3PN7 C;  2JNX A;  4A4B A;  3MSE B;  1XK4 A;  1ZAC A;  4ICB A;  1YR5 A;  2LM5 A;  1B9A A;  1CLB A;  1QX2 A;  1YX8 A;  2JTT A;  1CDN A;  5DKN A;  1TCF A;  3KEV A;  1IQ5 A;  2K0J A;  3ZNI A;  4PCW A;  4FQO A;  2WC8 A;  1QLS A;  1GJY A;  3I5H B;  1JFK A;  5AFP A;  1BT6 A;  2F2O A;  1SR6 B;  1FF1 A;  1UP5 A;  3CGA A;  2CTN A;  2GGM A;  4PHK A;  1XYD A;  1RK9 A;  2JT0 A;  3VGO A;  1KQM C;  2L4H A;  2PMY A;  2QPT A;  3DVK A;  4MZK A;  3JTD C;  3HX4 A;  1DJG A;  3FIA A;  1NP8 A;  3PFV A;  5FYX A;  4ZCU A;  2KFF A;  3DVM A;  1OMR A;  3KPX A;  3AAJ A;  1F4Q A;  1XFX O;  2BCA A;  2M7L A;  1GQM A;  4BY4 A;  3KF9 A;  1H8B A;  2Q4U A;  1KSM A;  1XFW O;  1CFD A;  4JQ0 D;  1OMV A;  1JF0 A;  1DTL A;  1AVS A;  2WCB A;  3OHM B;  1UHI A;  4WRI A;  1QVI Z;  1KSO A;  1QV0 A;  5CPV A;  1MWN A;  2H2K A;  1CDM A;  4ETO A;  1J1D A;  2JNF A;  4PE1 A;  3NSI A;  2M9G A;  2NXQ A;  2NCP A;  4IL1 A;  3BUW B;  4F0Z B;  1K9U A;  1NUB A;  2K7O A;  4OVN F; 
#chains in the Genus database with same CATH topology
 2AUC A;  1DVI A;  1M31 A;  2ZKM X;  2JT3 A;  2L2C A;  3DYE A;  2FJU B;  2KOT A;  2GGZ A;  3CR2 A;  1Y1X A;  3FWB A;  1W7J B;  2CXJ A;  1A03 A;  3DD4 A;  2WCK A;  5FI6 A;  4XJK A;  2KLD A;  4I5N B;  4YGA A;  1C3Y A;  1IIO A;  1B8C A;  2LCP A;  1P28 A;  1JWD A;  2KGR A;  5D3O A;  2JPT A;  2K7D A;  1QV1 A;  1WRK A;  2F8P A;  3BUM B;  3D76 A;  3PM2 A;  2K2F A;  1OW4 A;  1U5I B;  1F70 A;  1L2O C;  3I5G B;  2HPS A;  4XYN A;  1TTX A;  2KQ6 A;  1GGW A;  2GV5 A;  2SAS A;  1IQ3 A;  1PSR A;  1J7R A;  3VRO A;  1CB1 A;  2P6B B;  1GGZ A;  1TOP A;  5HYD A;  1RFJ A;  1SCV A;  1TUJ A;  1X02 A;  5TNC A;  3I5F B;  2LMU A;  3O78 A;  3O6B A;  2M97 A;  3VRN A;  2MLE C;  3LLE A;  4C0L A;  2F33 A;  1TNQ A;  1F54 A;  2HQW A;  1FBV A;  1SL9 A;  2L2E A;  2K7C A;  3B86 A;  4PE4 A;  3E3R A;  4CID A;  5I94 A;  3BJH A;  1OSA A;  2KGB C;  4YBH B;  1BJF A;  2QEB A;  4INX A;  1YX7 A;  1KFU L;  2K60 A;  4KYN A;  1RWY A;  1DF0 B;  1MUX A;  2KAX A;  3EG5 B;  3K1E A;  2QEV A;  2QEH A;  3JVT C;  2H61 C;  3PSR A;  1SL8 A;  1SK6 D;  2BBM A;  1A75 B;  2JWW A;  2LC5 A;  5KSZ A;  2ZRT A;  1LA0 A;  3CAB A;  2L98 A;  1FW4 A;  1EG4 A;  3CLN A;  4N1F A;  1OMD A;  1QXP A;  2I18 A;  1PUL A;  1ZFS A;  2DOQ A;  1M63 B;  2V53 A;  3CR5 X;  1S3P A;  3FWC A;  1Y1U A;  2KBM A;  1JUO A;  3B88 A;  4DIR A;  3CR4 X;  2FCE A;  1BMO A;  5AEQ A;  1NX0 A;  3L47 A;  2LUC A;  4OZD A;  1EH2 A;  3SG7 A;  2MLF C;  3WXA A;  2WCM A;  1CFC A;  3RLZ A;  2EGD A;  4MVF A;  1SPY A;  3SS5 A;  2F3Y A;  4TNC A;  2P71 A;  1V1G A;  3PAT A;  2LNK A;  1WLZ A;  1K8U A;  4WQ3 A;  1DJX A;  1OE9 B;  1YVL A;  3IVT A;  3PM8 A;  2WC5 A;  1KWO C;  3TUY C;  1N2D A;  3SG2 A;  3R1V A;  3NSL A;  2K2A A;  2ERB A;  2L50 A;  4N5X A;  1SW8 A;  4GPL B;  2M1U A;  2CT9 A;  2I7A A;  2PYQ A;  1DJW A;  4MRX A;  4USL A;  2BL0 B;  1WY9 A;  1CM1 A;  3OP0 A;  2M7N A;  1HT9 A;  4ORA B;  1M45 A;  5KU1 A;  1Z2C B;  3S0B A;  1F71 A;  1F55 A;  4JKT A;  2OS8 C;  3B87 A;  2PRU A;  1S6J A;  2LUX A;  3DF0 A;  2WCH A;  1WDC C;  4PHJ A;  1J7Q A;  2H61 A;  2Y4Q A;  3EK4 A;  5JOL A;  1R6P A;  3GOF A;  1KK8 B;  3BFB A;  3FE8 A;  1KCY A;  1W7I B;  1S6C A;  1YUS A;  3EVR A;  1ALV A;  3PJI A;  1WRL A;  1DJY A;  1B7T Z;  3D74 A;  5D7F A;  1JFJ A;  1QX7 A;  1QJT A;  3PN7 B;  2ZN9 A;  2NCO A;  2EC6 B;  2KSP A;  1MXL C;  1XFZ O;  4HRE E;  4R1E A;  2LAP A;  1SCM C;  4FQT A;  1SNL A;  2AAO A;  2COL B;  2JQ6 A;  1TN4 A;  1TNW A;  4AOM A;  1QAS A;  2LVI A;  2OTG C;  2ZRS A;  3WHT B;  3V2L A;  1S36 A;  3TDI A;  2VRG A;  1S1E A;  1Z4H A;  3D78 A;  2WCE A;  3LK0 A;  1LXF C;  3BOW A;  1CMF A;  2LV7 A;  1KQM B;  2JU0 A;  2LVK A;  3LK1 A;  1NX3 A;  3JTD B;  1ZOT B;  4HRG A;  2BNX A;  1PVA A;  2P70 A;  2KI4 C;  3EK7 A;  1ZUZ A;  1IH0 A;  4HRH A;  1F8H A;  2EHB A;  4MBE A;  1S6I A;  1QIW A;  1VRK A;  1CM4 A;  5I2O A;  2KI6 D;  2PSR A;  2ISD A;  1SKT A;  1EL4 A;  2FOT A;  4U8D A;  1RRO A;  3F45 A;  4GFT A;  3SG6 A;  1IG5 A;  4C0J A;  1TNX A;  5D69 A;  2PAS A;  1DGU A;  1OOF A;  3CS1 A;  4P2Y B;  2HQ8 A;  3D10 A;  4UPG A;  1SYM A;  2HF5 A;  1YVH A;  3WHU B;  2R2I A;  1W9Z A;  1QIV A;  1WLM A;  2KFH A;  2CNP A;  2LVJ A;  1AJ4 A;  4YGB B;  3SS4 A;  1PK0 D;  2MA2 A;  3D0Y A;  3FE6 A;  3UNW A;  1CTR A;  4MZJ A;  2KBI A;  1AJ5 A;  3SS3 A;  1CLM A;  1REC A;  3OBV A;  1CDP A;  2LP2 A;  4MSP A;  1PRW A;  3HCM A;  2BKH B;  4DUQ A;  3SIB A;  5CSJ A;  4AQJ A;  1NX2 A;  2JOJ A;  3BQ3 A;  2JUL A;  3Q8I A;  3UO9 A;  4YI9 A;  1BG1 A;  1F4O A;  3AKB A;  3OX6 A;  1TWO A;  2MRD A;  2LVV A;  3PLF B;  3A8R A;  4FTG A;  3OB2 B;  5AAN A;  1LVC D;  1IJ6 A;  3K21 A;  2KHN A;  4Q04 A;  2M29 A;  1EJ3 A;  3S0G A;  4PAL A;  1TRF A;  3O4X A;  3CZT X;  1C7V A;  2LP3 A;  3D77 A;  1L2O B;  2L0P A;  5FI2 A;  5I8N A;  3EVU A;  3RZS A;  1BOC A;  1NPQ A;  2PVB A;  5PAL A;  3SG3 A;  1OOI X;  1PAL A;  5F6T A;  4GGN A;  1UHK A;  1UUR A;  2Q91 A;  1UHN A;  1C3Z A;  4CFR A;  5GQQ C;  2BCB A;  1K94 A;  3BUX B;  3VRP A;  3CZ2 A;  3NSK A;  2FJY A;  4I5K A;  3L4L A;  3D73 A;  3DVJ A;  2M8U A;  1M39 A;  4GAO A;  3C1V A;  1QLK A;  2KYC A;  2JZI A;  2JXC A;  1EXR A;  2B1U A;  1KFX L;  2LHI A;  3PAL A;  2WCF A;  4QJ3 B;  3IQO A;  5I2L A;  3TS5 C;  4C0K A;  1CNP A;  3CTN A;  1G33 A;  2MHH A;  3AKA A;  2LLT A;  4YGD B;  1UUS A;  2O5G A;  4L9M A;  4OV2 A;  1XA5 A;  3JVT B;  3BUO B;  4PHN A;  2LMT A;  3TZ1 A;  1E8A A;  3BFA A;  3B6X A;  1K9K A;  1Y0V H;  4CPV A;  2G2B A;  1H4B A;  3O2P A;  3WNX B;  3TDU A;  1U5I A;  3R1P A;  4GBA A;  1LIN A;  2I2R E;  3A4U B;  2MAZ A;  4I5J A;  1SSE B;  3I5I B;  1CMG A;  1NIW A;  3KO0 A;  1A2X A;  2JXL A;  1K90 D;  1OQP A;  2CCM A;  3IF7 A;  1IRJ A;  4YGC B;  5DKQ A;  1UHJ A;  5I2Q A;  1QAT A;  1IWQ A;  3LL8 B;  1DJZ A;  1D1O A;  1G4Y R;  2BE4 A;  3VRQ A;  1XFU O;  3CWG A;  2BE6 A;  2L51 A;  1TNP A;  1NCZ A;  2BL0 C;  5HL1 A;  1OOH A;  2K8M B;  4F7F A;  5CSF A;  1K9P A;  4MN0 A;  1NSH A;  2LAN A;  1BOD A;  1S5G Y;  1DF0 A;  4DRW A;  2ZN8 A;  2LLU A;  5HLO A;  1NCX A;  4OCI A;  1SL7 A;  1YUU A;  2MBX A;  1CLL A;  4NDC A;  2NLN A;  1JC2 A;  1JSA A;  3S0E A;  1DT7 B;  1KWO B;  3I5H C;  3TUY B;  1KK8 C;  1A75 A;  2KAY A;  2GTE A;  2QEO A;  1FPW A;  4QJ4 B;  1SR6 C;  2E30 A;  4INW A;  1FI5 A;  5HKW A;  3EVV A;  2Y1M A;  4XJK B;  1FI6 A;  3CYZ A;  2SCP A;  2EC6 C;  2JRF A;  1A4P A;  1MQ1 A;  4GUK A;  5HKY A;  1CDL A;  5CSI A;  1KK7 Y;  2OS8 B;  5DIC A;  5BPJ A;  1DQE A;  4PT1 A;  1BR1 B;  1KFU S;  3VRR A;  1WDC B;  3D0Y B;  5HKZ A;  2KYF A;  1G8I A;  1YUT A;  2KAV A;  3FE9 A;  4N1G A;  1NWD A;  4MEW A;  1Y6W A;  2HET A;  2L5X B;  2M1K B;  2KQY A;  1KQV A;  2KNE A;  1XFR A;  3ZWH A;  2KFG A;  2YGU A;  4DS7 A;  3FS7 A;  4PDZ A;  5HLV A;  1LA3 A;  1K2H A;  3LCP C;  1SCM B;  3NXA A;  3R1O A;  2BEC A;  3QME A;  4NDB A;  1C7W A;  1AHR A;  3ICB A;  1ORG A;  4GGF A;  5KTY A;  2WCL A;  4PE7 A;  1OZS A;  1KFX S;  2OTG B;  2LLS A;  3L4A A;  3O4Y A;  2KPH A;  1CFF A;  4NDD A;  2WOS A;  3AAK A;  1BR4 B;  3SG4 A;  2M3W A;  2QAC A;  3NSO A;  5DKR A;  2BKI B;  2ZNE A;  4P5O E;  5CSN A;  2CBL A;  3H4S E;  1N65 A;  1BF5 A;  1B47 A;  1R2U A;  3TDZ A;  5AER A;  1RTP 1;  1XFY O;  3GK4 X;  2KI4 B;  1XO5 A;  3OB1 B;  4M2O A;  1SY9 A;  1AUI B;  4YI8 A;  4DCK A;  1YRU B;  2NZ0 A;  2Y1N A;  3BXK A;  1TCO B;  1B7T Y;  2Y5I A;  3I5G C;  1DMO A;  2LE9 B;  3EKJ A;  3IQQ A;  1K95 A;  2TN4 A;  3VB1 A;  1A29 A;  2WCJ A;  1DJH A;  3I5F C;  1LKJ A;  3EKH A;  2F2P A;  4YRU A;  1NCY A;  4WQ2 A;  1YTZ C;  1B8L A;  1J55 A;  3B7A A;  3NGV A;  4IJ7 A;  3EK8 A;  2KDH A;  1J7P A;  3DY9 A;  1PSB A;  2KI6 C;  2I94 A;  2E6W A;  3BFH A;  2RGI A;  2WOR A;  1QVI Y;  1Y1A A;  1JBA A;  1TIZ A;  1B1G A;  1SBJ A;  2H8V A;  1YUR A;  2JC2 A;  3GK1 A;  4CFQ A;  1WRZ A;  1DJI A;  1HQV A;  1M46 A;  1SMG A;  1B4C A;  3BYA A;  2JTZ A;  3OX5 A;  2QDI A;  1AK8 A;  1ZMZ A;  1GM0 A;  4JWQ A;  1J1E A;  4HSZ A;  2L5Y A;  1K93 D;  2A4J A;  3QRX A;  1K96 A;  2KLE A;  3CDN A;  1N0Y A;  4M2P A;  5AXI A;  1EG3 A;  1IJ5 A;  3CZ1 A;  4A4C A;  4OKH A;  3D75 A;  3N7H A;  4I5L B;  1CFP A;  1XK4 C;  1C07 A;  1NYA A;  2FCD A;  2MJW B;  1RJV A;  2BBN A;  1Q80 A;  3SIA A;  1MR8 A;  3DF0 B;  1UWO A;  1BLQ A;  2LMV A;  1IKU A;  2OPO A;  4OR9 B;  1MF8 B;  1XFV O;  2AMI A;  1IGV A;  5K89 A;  1QWV A;  1S5G Z;  4D1E A;  5ER4 X;  1V1F A;  2M0R A;  5ER5 A;  1DEL A;  4JD9 A;  3M0W A;  2WND A;  1OOG A;  5G08 A;  1CKK A;  3SG5 A;  2K61 A;  1J7O A;  1MXE A;  1OOJ A;  1BU3 A;  1PVB A;  2BCX A;  3I5I C;  2O60 A;  4JPZ B;  3CZ0 A;  3TS5 B;  2ZFD A;  1MHO A;  4GGF C;  5IBW A;  3DZT A;  3KHE A;  2ZND A;  3RM1 A;  4MLW A;  1DGV A;  4ORC B;  4MZL A;  4NQG A;  3DVE A;  1ALW A;  4YGE B;  1B8R A;  4GNK B;  1NX1 A;  4AQI A;  4BY5 A;  1QS7 A;  1KK7 Z;  4MRY A;  1JF2 A;  1QTX A;  3BUN B;  4CLN A;  3BOW B;  3NHI A;  5J3X A;  3SJS A;  4ZCV A;  1S26 D;  1SRA A;  4ORB B;  1OZO A;  1DC1 A;  2D8N A;  2G9B A;  3GK2 A;  1XVJ A;  2F3Z A;  5JJG A;  4E68 A;  4PHM A;  2K7B A;  4M2Q A;  2LHL A;  1UHH A;  2IS9 A;  5FI7 A;  4QJ5 B;  2L4I A;  2M49 B;  1L7Z A;  5B8I B;  1AP4 A;  1ODB A;  4PE0 A;  2WC6 A;  1YRT B;  2PAL A;  1QX5 B;  2JT8 A;  3PN7 C;  2JNX A;  4A4B A;  3MSE B;  1XK4 A;  1ZAC A;  4ICB A;  1YR5 A;  2LM5 A;  3S0D A;  1B9A A;  1CLB A;  1QX2 A;  1T14 A;  1YX8 A;  2JTT A;  1CDN A;  5DKN A;  1TCF A;  3KEV A;  1IQ5 A;  2K0J A;  3ZNI A;  4PCW A;  4FQO A;  2WC8 A;  2BAP A;  1QLS A;  1GJY A;  3I5H B;  1JFK A;  5AFP A;  1BT6 A;  2F2O A;  5EL2 A;  1SR6 B;  3NHT A;  1FF1 A;  1UP5 A;  1LS8 A;  2CTN A;  2GGM A;  3CGA A;  4PHK A;  1XYD A;  1RK9 A;  2JT0 A;  3VGO A;  1KQM C;  2L4H A;  2PMY A;  2QPT A;  3DVK A;  4MZK A;  3JTD C;  3HX4 A;  1DJG A;  3FIA A;  1NP8 A;  3PFV A;  5FYX A;  4ZCU A;  2KFF A;  3DVM A;  1OMR A;  3KPX A;  3AAJ A;  1TUZ A;  1F4Q A;  3R72 A;  1XFX O;  1DEK A;  2BCA A;  1GQM A;  2M7L A;  3KF9 A;  4BY4 A;  2PQL A;  2Q4U A;  1KSM A;  1XFW O;  1CFD A;  4JQ0 D;  3S0A A;  1H8B A;  1OMV A;  1JF0 A;  1DTL A;  1AVS A;  2WCB A;  3DXL A;  3OHM B;  1UHI A;  3S0F A;  4WRI A;  1QVI Z;  1KSO A;  1QV0 A;  3OGN A;  5CPV A;  1MWN A;  2H2K A;  1CDM A;  4ETO A;  1J1D A;  2JNF A;  4PE1 A;  3NSI A;  2M9G A;  2NXQ A;  2NCP A;  4IL1 A;  3BUW B;  2JPO A;  4F0Z B;  1K9U A;  1NUB A;  2K7O A;  4OVN F; 
#chains in the Genus database with same CATH homology
 2AUC A;  1DVI A;  1M31 A;  2ZKM X;  2JT3 A;  2FJU B;  2KOT A;  2GGZ A;  3CR2 A;  1Y1X A;  3FWB A;  1W7J B;  2CXJ A;  1A03 A;  3DD4 A;  4XJK A;  4I5N B;  4YGA A;  1B8C A;  2LCP A;  1JWD A;  2KGR A;  2JPT A;  2K7D A;  1QV1 A;  1WRK A;  2F8P A;  3BUM B;  2K2F A;  1U5I B;  1F70 A;  1L2O C;  3I5G B;  2HPS A;  4XYN A;  1TTX A;  2KQ6 A;  1GGW A;  2GV5 A;  2SAS A;  1IQ3 A;  1PSR A;  1J7R A;  3VRO A;  1CB1 A;  2P6B B;  1GGZ A;  1TOP A;  5HYD A;  1RFJ A;  1SCV A;  1X02 A;  5TNC A;  3I5F B;  2LMU A;  3O78 A;  3O6B A;  2M97 A;  3VRN A;  2MLE C;  3LLE A;  4C0L A;  2F33 A;  1TNQ A;  1F54 A;  2HQW A;  1FBV A;  1SL9 A;  2L2E A;  2K7C A;  4PE4 A;  4CID A;  3E3R A;  1KQV A;  1OSA A;  2KGB C;  4YBH B;  1BJF A;  1YX7 A;  1KFU L;  1RWY A;  1DF0 B;  1MUX A;  2KAX A;  3JVT C;  2H61 C;  3PSR A;  1SL8 A;  1SK6 D;  2BBM A;  1A75 B;  2JWW A;  2LC5 A;  5KSZ A;  2ZRT A;  1LA0 A;  2L98 A;  1FW4 A;  1EG4 A;  3CLN A;  4N1F A;  1OMD A;  1QXP A;  2I18 A;  1PUL A;  1ZFS A;  2DOQ A;  1M63 B;  2V53 A;  3CR5 X;  1S3P A;  3FWC A;  1Y1U A;  2KBM A;  1JUO A;  4DIR A;  3CR4 X;  2FCE A;  1BMO A;  5AEQ A;  1NX0 A;  1EH2 A;  2LUC A;  3SG7 A;  2MLF C;  3WXA A;  1CFC A;  3RLZ A;  2EGD A;  4MVF A;  1SPY A;  2F3Y A;  4TNC A;  1V1G A;  3PAT A;  2LNK A;  1WLZ A;  1K8U A;  4WQ3 A;  1DJX A;  1OE9 B;  1YVL A;  3PM8 A;  1KWO C;  3TUY C;  1N2D A;  3SG2 A;  3NSL A;  2K2A A;  2L50 A;  4N5X A;  1SW8 A;  4GPL B;  2M1U A;  2CT9 A;  2I7A A;  1DJW A;  4MRX A;  4USL A;  2BL0 B;  1WY9 A;  1CM1 A;  3OP0 A;  2M7N A;  1HT9 A;  4ORA B;  1M45 A;  5KU1 A;  1F71 A;  1F55 A;  2OS8 C;  2PRU A;  1S6J A;  2LUX A;  3DF0 A;  1WDC C;  4PHJ A;  1J7Q A;  2H61 A;  2Y4Q A;  3EK4 A;  5JOL A;  1R6P A;  3GOF A;  1KK8 B;  1KCY A;  1W7I B;  1S6C A;  1YUS A;  3EVR A;  1ALV A;  1WRL A;  1DJY A;  1B7T Z;  5D7F A;  1JFJ A;  1QX7 A;  1QJT A;  3PN7 B;  2ZN9 A;  2NCO A;  2EC6 B;  2KSP A;  1MXL C;  1XFZ O;  4HRE E;  4R1E A;  2LAP A;  1SCM C;  1SNL A;  2AAO A;  2COL B;  2JQ6 A;  1TN4 A;  1TNW A;  4AOM A;  1QAS A;  2LVI A;  2OTG C;  2ZRS A;  3WHT B;  1S36 A;  3TDI A;  2VRG A;  1S1E A;  2WCE A;  3LK0 A;  1LXF C;  3BOW A;  1CMF A;  2LV7 A;  1KQM B;  2JU0 A;  2LVK A;  3LK1 A;  1NX3 A;  3JTD B;  1ZOT B;  4HRG A;  1PVA A;  2KI4 C;  3EK7 A;  1ZUZ A;  1IH0 A;  4HRH A;  1F8H A;  2EHB A;  4MBE A;  1S6I A;  1QIW A;  1VRK A;  1CM4 A;  5I2O A;  2KI6 D;  2PSR A;  2ISD A;  1SKT A;  1EL4 A;  2FOT A;  4U8D A;  1RRO A;  3F45 A;  4GFT A;  3SG6 A;  1IG5 A;  4C0J A;  1TNX A;  5D69 A;  2PAS A;  1DGU A;  3CS1 A;  4P2Y B;  2HQ8 A;  3D10 A;  4UPG A;  1SYM A;  2HF5 A;  1YVH A;  3WHU B;  2R2I A;  1QIV A;  1WLM A;  2KFH A;  2CNP A;  2LVJ A;  1AJ4 A;  4YGB B;  1PK0 D;  2MA2 A;  3D0Y A;  1CTR A;  4MZJ A;  2KBI A;  1AJ5 A;  1CLM A;  1REC A;  1CDP A;  2LP2 A;  4MSP A;  1PRW A;  3HCM A;  2BKH B;  4DUQ A;  3SIB A;  5CSJ A;  4AQJ A;  1NX2 A;  2JOJ A;  3BQ3 A;  2JUL A;  4YI9 A;  1BG1 A;  1F4O A;  3AKB A;  3OX6 A;  2MRD A;  2LVV A;  3PLF B;  3A8R A;  4FTG A;  3OB2 B;  5AAN A;  1LVC D;  1IJ6 A;  3K21 A;  2KHN A;  4Q04 A;  2M29 A;  1EJ3 A;  4PAL A;  1TRF A;  3CZT X;  1C7V A;  2LP3 A;  1L2O B;  2L0P A;  5I8N A;  3EVU A;  1BOC A;  1NPQ A;  2PVB A;  5PAL A;  3SG3 A;  1PAL A;  5F6T A;  4GGN A;  1UHK A;  1UUR A;  2Q91 A;  1UHN A;  4CFR A;  5GQQ C;  2BCB A;  1K94 A;  3BUX B;  3VRP A;  3NSK A;  4I5K A;  3DVJ A;  2M8U A;  1M39 A;  4GAO A;  3C1V A;  1QLK A;  2KYC A;  2JZI A;  2JXC A;  1EXR A;  2B1U A;  1KFX L;  2LHI A;  3PAL A;  2WCF A;  4QJ3 B;  3IQO A;  5I2L A;  3TS5 C;  4C0K A;  1CNP A;  3CTN A;  1G33 A;  2MHH A;  3AKA A;  2LLT A;  4YGD B;  1UUS A;  2O5G A;  4L9M A;  4OV2 A;  1XA5 A;  3JVT B;  3BUO B;  4PHN A;  2LMT A;  3TZ1 A;  1E8A A;  1K9K A;  1Y0V H;  4CPV A;  2G2B A;  1H4B A;  3O2P A;  3WNX B;  3TDU A;  1U5I A;  4GBA A;  1LIN A;  2I2R E;  3A4U B;  2MAZ A;  4I5J A;  3I5I B;  1CMG A;  1NIW A;  3KO0 A;  1A2X A;  2JXL A;  1K90 D;  1OQP A;  2CCM A;  3IF7 A;  1IRJ A;  4YGC B;  5DKQ A;  1UHJ A;  5I2Q A;  1QAT A;  1IWQ A;  3LL8 B;  1DJZ A;  1D1O A;  1G4Y R;  2BE4 A;  3VRQ A;  1XFU O;  3CWG A;  2BE6 A;  2L51 A;  1TNP A;  1NCZ A;  2BL0 C;  2K8M B;  5CSF A;  1K9P A;  4MN0 A;  1NSH A;  2LAN A;  1BOD A;  1S5G Y;  1DF0 A;  4DRW A;  2ZN8 A;  2LLU A;  5HLO A;  1NCX A;  4OCI A;  1SL7 A;  1YUU A;  2MBX A;  1CLL A;  4NDC A;  2NLN A;  1JC2 A;  1JSA A;  1DT7 B;  1KWO B;  3I5H C;  3TUY B;  1KK8 C;  1A75 A;  2KAY A;  1FPW A;  4QJ4 B;  1SR6 C;  2E30 A;  1FI5 A;  5HKW A;  3EVV A;  2Y1M A;  4XJK B;  1FI6 A;  2SCP A;  2EC6 C;  2JRF A;  1A4P A;  1MQ1 A;  4GUK A;  5HKY A;  1CDL A;  5CSI A;  1KK7 Y;  2OS8 B;  5BPJ A;  1BR1 B;  1KFU S;  3VRR A;  1WDC B;  3D0Y B;  5HKZ A;  2KYF A;  1G8I A;  1YUT A;  2KAV A;  4N1G A;  1NWD A;  4MEW A;  1Y6W A;  2HET A;  2L5X B;  2M1K B;  2KQY A;  2KNE A;  3ZWH A;  2KFG A;  4DS7 A;  3FS7 A;  4PDZ A;  5HLV A;  1LA3 A;  1K2H A;  3LCP C;  1SCM B;  3NXA A;  2BEC A;  4NDB A;  1C7W A;  1AHR A;  3ICB A;  4GGF A;  5KTY A;  4PE7 A;  1OZS A;  1KFX S;  2OTG B;  2LLS A;  3O4Y A;  1CFF A;  4NDD A;  2WOS A;  3AAK A;  1BR4 B;  3SG4 A;  2M3W A;  2QAC A;  3NSO A;  5DKR A;  2BKI B;  2ZNE A;  4P5O E;  5CSN A;  2CBL A;  3H4S E;  1N65 A;  1BF5 A;  1B47 A;  1R2U A;  3TDZ A;  5AER A;  1RTP 1;  1XFY O;  3GK4 X;  2KI4 B;  1XO5 A;  3OB1 B;  4M2O A;  1SY9 A;  1AUI B;  4YI8 A;  4DCK A;  1YRU B;  2NZ0 A;  2Y1N A;  3BXK A;  1TCO B;  1B7T Y;  2Y5I A;  3I5G C;  1DMO A;  2LE9 B;  3EKJ A;  3IQQ A;  1K95 A;  2TN4 A;  1A29 A;  1DJH A;  3I5F C;  1LKJ A;  3EKH A;  2F2P A;  4YRU A;  1NCY A;  4WQ2 A;  1YTZ C;  1B8L A;  1J55 A;  3EK8 A;  2KDH A;  1J7P A;  1PSB A;  2KI6 C;  2I94 A;  2E6W A;  2RGI A;  2WOR A;  1QVI Y;  1Y1A A;  1JBA A;  1TIZ A;  1B1G A;  1SBJ A;  1YUR A;  2JC2 A;  3GK1 A;  4CFQ A;  1WRZ A;  1DJI A;  1HQV A;  1M46 A;  1SMG A;  1B4C A;  3BYA A;  2JTZ A;  3OX5 A;  1AK8 A;  1ZMZ A;  4JWQ A;  1J1E A;  4HSZ A;  1K93 D;  2A4J A;  3QRX A;  1K96 A;  4M2P A;  1N0Y A;  5AXI A;  1EG3 A;  1IJ5 A;  4A4C A;  4OKH A;  4I5L B;  1CFP A;  1XK4 C;  1C07 A;  1NYA A;  2FCD A;  2MJW B;  1RJV A;  2BBN A;  1Q80 A;  3SIA A;  1MR8 A;  3DF0 B;  1UWO A;  1BLQ A;  2LMV A;  1IKU A;  2OPO A;  4OR9 B;  1MF8 B;  1XFV O;  2AMI A;  1IGV A;  5K89 A;  1S5G Z;  4D1E A;  5ER4 X;  1V1F A;  2M0R A;  5ER5 A;  3M0W A;  2WND A;  5G08 A;  1CKK A;  3SG5 A;  2K61 A;  1J7O A;  1MXE A;  1OOJ A;  1BU3 A;  1PVB A;  2BCX A;  3I5I C;  2O60 A;  4JPZ B;  3TS5 B;  2ZFD A;  1MHO A;  4GGF C;  5IBW A;  3KHE A;  2ZND A;  3RM1 A;  4MLW A;  1DGV A;  4ORC B;  4MZL A;  4NQG A;  3DVE A;  1ALW A;  4YGE B;  1B8R A;  4GNK B;  1NX1 A;  4AQI A;  4BY5 A;  1QS7 A;  1KK7 Z;  4MRY A;  1JF2 A;  1QTX A;  3BUN B;  4CLN A;  3BOW B;  5J3X A;  3SJS A;  4ZCV A;  1S26 D;  1SRA A;  4ORB B;  1OZO A;  2D8N A;  2G9B A;  3GK2 A;  1XVJ A;  2F3Z A;  5JJG A;  4E68 A;  4PHM A;  2K7B A;  4M2Q A;  2LHL A;  1UHH A;  2IS9 A;  4QJ5 B;  2L4I A;  2M49 B;  1L7Z A;  5B8I B;  1AP4 A;  1ODB A;  4PE0 A;  1YRT B;  2PAL A;  1QX5 B;  2JT8 A;  3PN7 C;  2JNX A;  4A4B A;  3MSE B;  1XK4 A;  1ZAC A;  4ICB A;  1YR5 A;  2LM5 A;  1B9A A;  1CLB A;  1QX2 A;  1YX8 A;  2JTT A;  1CDN A;  5DKN A;  1TCF A;  3KEV A;  1IQ5 A;  2K0J A;  3ZNI A;  4PCW A;  4FQO A;  2WC8 A;  1QLS A;  1GJY A;  3I5H B;  1JFK A;  5AFP A;  1BT6 A;  2F2O A;  1SR6 B;  1FF1 A;  1UP5 A;  3CGA A;  2CTN A;  2GGM A;  4PHK A;  1XYD A;  1RK9 A;  2JT0 A;  3VGO A;  1KQM C;  2L4H A;  2PMY A;  2QPT A;  3DVK A;  4MZK A;  3JTD C;  3HX4 A;  1DJG A;  3FIA A;  1NP8 A;  3PFV A;  5FYX A;  4ZCU A;  2KFF A;  3DVM A;  1OMR A;  3KPX A;  3AAJ A;  1F4Q A;  1XFX O;  2BCA A;  2M7L A;  1GQM A;  4BY4 A;  3KF9 A;  1H8B A;  2Q4U A;  1KSM A;  1XFW O;  1CFD A;  4JQ0 D;  1OMV A;  1JF0 A;  1DTL A;  1AVS A;  2WCB A;  3OHM B;  1UHI A;  4WRI A;  1QVI Z;  1KSO A;  1QV0 A;  5CPV A;  1MWN A;  2H2K A;  1CDM A;  4ETO A;  1J1D A;  2JNF A;  4PE1 A;  3NSI A;  2M9G A;  2NXQ A;  2NCP A;  4IL1 A;  3BUW B;  4F0Z B;  1K9U A;  1NUB A;  2K7O A;  4OVN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...