2FCDA

Solution structure of n-lobe myosin light chain from saccharomices cerevisiae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain 1
publication title Structural basis for the interaction of the myosin light chain Mlc1p with the myosin V Myo2p IQ motifs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 17
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2fcdA00
4I5LB 4AOMA 1N65A 1JUOA 1SY9A 3F45A 1EJ3A 4PHJA 2LE9B 4C0KA 1KSMA 1QTXA 2L2EA 3FWCA 1NX0A 3I5HC 4P2YB 1F71A 1NX3A 4PHKA 1K9PA 3TDZA 2BBNA 5CPVA 1CTRA 1SK6D 2KQ6A 2COLB 2IS9A 1EG4A 2K7DA 4PHMA 3OB2B 3EVVA 1UUSA 4JQ0D 1JFKA 2JPTA 1L2OB 2PALA 2ZRTA 3DVJA 3TS5C 2F33A 2RGIA 1TCFA 4GGFC 1RTP1 5AERA 1RK9A 1YX7A 1TCOB 3OHMB 1BR1B 4WRIA 3AAJA 4MZJA 4D1EA 4NDCA 1QXPA 2LHLA 2FCDA 1QX5B 3BXKA 2M0RA 3KF9A 3FS7A 1CDMA 2WOSA 3AAKA 2Y1NA 1PVBA 2GGZA 1DVIA 3PATA 1MQ1A 1JSAA 3TZ1A 5DKNA 2M49B 1Y1XA 1B7TY 3I5FB 5CSFA 2CTNA 3SG7A 4YGEB 1JFJA 1IJ5A 2ZNEA 3GOFA 5TNCA 1F70A 4MRXA 2JT3A 1Y0VH 1W7IB 2LHIA 1K95A 1OSAA 2LVIA 2L50A 1Y1AA 1WDCC 1YUSA 2M3WA 3PM8A 1QLSA 3IQOA 3AKBA 1SYMA 3ZNIA 1B9AA 2KAXA 3FWBA 3D0YB 2OPOA 3D0YA 1OMRA 3QRXA 3PN7B 2WCBA 1H8BA 1Y1UA 2LCPA 1PALA 2KFGA 2KI6D 1QIVA 2CT9A 1J7OA 5HKZA 1H4BA 4Q04A 2I94A 1IGVA 2M9GA 3JTDB 1K90D 1QVIY 3RM1A 1KK8C 3SG4A 4PE7A 3LL8B 1B8CA 1L7ZA 2Y4QA 4GGNA 5G08A 3HX4A 1PVAA 1XK4A 3CS1A 1J1DA 3GK1A 1IRJA 1CM1A 5HLVA 4JWQA 1ALWA 1UWOA 2FJUB 1UHIA 2CCMA 2HETA 1UURA 1PULA 3I5IC 3PALA 1GQMA 4XYNA 1TN4A 5DKQA 2PMYA 1IWQA 2ZKMX 3CLNA 2M1UA 5HYDA 3C1VA 2KQYA 3KO0A 5CSNA 1CKKA 3TUYB 4GFTA 1YTZC 1TRFA 2MJWB 1KWOC 1DJGA 3MSEB 2BKHB 1TNPA 5FYXA 4QJ5B 4E68A 2I7AA 1KSOA 1B8RA 2G2BA 1QVIZ 3GK2A 1J7PA 3JVTC 2BE6A 3KEVA 1NX1A 2JC2A 2KI4B 3SG5A 4N5XA 1A2XA 1Q80A 2ISDA 1XA5A 1XVJA 2LP2A 1MXLC 1IQ3A 3I5GB 5GQQC 4UPGA 4ZCUA 1S6IA 1N2DA 1K8UA 2JT8A 4MVFA 3M0WA 3WHTB 4ORCB 3VROA 2AMIA 1J1EA 1KFXL 2KGBC 4MSPA 2F2PA 3HCMA 2NXQA 4U8DA 2JXLA 4M2PA 1F55A 1A29A 1DJYA 3NSIA 4CIDA 1CB1A 1SRAA 1BJFA 1N0YA 2OTGC 3VRQA 3BUMB 2KHNA 1BODA 1QX7A 4ZCVA 1NUBA 1AVSA 1YR5A 2ZN9A 2GV5A 2K7OA 1JF2A 5AANA 5KU1A 1SR6B 2QPTA 1G4YR 3O2PA 2BE4A 1YVHA 1UHHA 2LVJA 2F2OA 1LA0A 1YX8A 1XYDA 4I5NB 4OV2A 2ZRSA 1M39A 3I5HB 4QJ3B 1MHOA 2LLUA 2WC8A 2JU0A 2ZFDA 1R6PA 2ZN8A 2LMVA 2HF5A 1NSHA 1ZUZA 1SMGA 2JULA 3OB1B 1C07A 1CLBA 3DVKA 1ALVA 2NCOA 1SCMB 2BCXA 3DVMA 1KFXS 3SG6A 1AK8A 4OVNF 2SCPA 3BUNB 1NP8A 2MRDA 3KPXA 2Y1MA 3O4YA 2GGMA 3EKHA 4A4BA 3WXAA 3SG2A 1FF1A 4XJKB 2BCBA 4XJKA 2JNXA 4FTGA 2PASA 1QASA 1MF8B 2EC6B 2MHHA 2K2AA 2F8PA 2CBLA 4ORBB 1VRKA 2OS8B 4HRGA 1L2OC 4MRYA 4TNCA 4YGDB 3O6BA 4WQ3A 5IBWA 1OMVA 2KOTA 1G8IA 1PSRA 1A03A 2KAVA 1MWNA 2G9BA 2L98A 2KYCA 2KAYA 3NXAA 1KFUL 4GBAA 3K21A 1S36A 1S5GY 1DJZA 2QACA 3WNXB 4YGAA 5AXIA 5ER4X 5I2QA 2CNPA 1AJ4A 1NCZA 1B1GA 2Q4UA 4WQ2A 3PLFB 2Y5IA 1OOJA 4M2QA 5J3XA 2JQ6A 2JRFA 3I5FC 2LVVA 4BY5A 1X02A 4ICBA 1K9KA 4PE0A 1NPQA 1A4PA 1C7VA 1QV1A 1WRKA 3CZTX 1YRUB 2A4JA 1XFUO 3EVUA 1SW8A 2BL0B 1K2HA 1E8AA 2NLNA 1A75B 2L4IA 1A75A 3PN7C 3A4UB 1WLZA 1DMOA 2BCAA 1MR8A 2KBMA 2BKIB 1B7TZ 1KFUS 1YUTA 1IKUA 1WY9A 3BQ3A 1BLQA 1UP5A 2F3YA 2PVBA 2MA2A 2LP3A 3JTDC 3ICBA 4PE4A 5K89A 5ER5A 2L5XB 4CFQA 4N1FA 4DUQA 1JWDA 1XK4C 1Y6WA 2KSPA 2MBXA 4C0JA 1K96A 4GUKA 1DF0B 2O5GA 1DF0A 2EGDA 1YRTB 2BECA 1M63B 4A4CA 2M29A 1XO5A 4DRWA 1ZMZA 4FQOA 2H61A 1QS7A 4GPLB 1DJXA 3NSLA 4NDDA 1TIZA 5F6TA 5AFPA 1M45A 1TNXA 4L9MA 1WLMA 1CFDA 1OQPA 2LLSA 1PRWA 4N1GA 1QX2A 1NWDA 4MBEA 4P5OE 1KQMC 3CGAA 4PDZA 2K0JA 4MLWA 1BU3A 1FI6A 1NYAA 1AP4A 5DKRA 4DCKA 1FI5A 3PFVA 5D7FA 2K7BA 1DT7B 1DJWA 2LM5A 3H4SE 4PCWA 3LK1A 1NCXA 1ZFSA 1B47A 4QJ4B 4JPZB 4USLA 1FW4A 1CMFA 3EK8A 4DIRA 4BY4A 1SKTA 1F4OA 3SG3A 2JOJA 1NCYA 2L4HA 4IL1A 5D69A 1HT9A 5JOLA 3VGOA 4MZKA 2V53A 1F54A 2KFFA 2KI4C 1S1EA 1V1GA 2H2KA 1G33A 4PHNA 1J7RA 3IF7A 1KK7Y 1LVCD 1AHRA 3I5GC 3RLZA 3SIBA 2JWWA 1F8HA 1IH0A 1LKJA 1OE9B 1RROA 3VRNA 5AEQA 3LK0A 5I2OA 5HKWA 4NQGA 5KSZA 1BOCA 5BPJA 2JT0A 4HSZA 1RJVA 5I2LA 1QJTA 1TTXA 2KNEA 2L0PA 3D10A 2LVKA 3NSOA 1SBJA 1XFVO 1WRLA 1V1FA 2LUCA 1SR6C 4YI9A 1LA3A 1GJYA 2EHBA 2NZ0A 1B8LA 3OX5A 5B8IB 2DOQA 1M31A 1CLMA 1AJ5A 1M46A 1S6CA 2K8MB 2D8NA 1D1OA 1FPWA 3DF0B 3DF0A 3OP0A 3TS5B 2M8UA 1KK7Z 1RWYA 1J55A 1K9UA 1XFXO 4GGFA 5KTYA 4PE1A 1JF0A 1DTLA 1R2UA 2E30A 1CFFA 1S6JA 3LCPC 1BG1A 1SCMC 1TNQA 4HRHA 4AQJA 2MLFC 1EG3A 2LC5A 2M7LA 3IQQA 4CLNA 4HREE 2LMUA 3AKAA 1XFZO 3BYAA 2AUCA 2TN4A 2EC6C 1CM4A 4NDBA 2OS8C 2LLTA 1CMGA 2E6WA 4MN0A 4ETOA 5CSIA 3E3RA 2B1UA 2CXJA 1IG5A 2JTZA 2O60A 1SNLA 1GGWA 3CTNA 1BMOA 1TOPA 2I18A 3LLEA 1CDLA 2R2IA 1PSBA 4YI8A 3CR4X 1WDCB 1YVLA 2F3ZA 2LNKA 2VRGA 4C0LA 2LMTA 1MUXA 4PALA 1DJHA 1CLLA 1EXRA 3EVRA 4YRUA 2ZNDA 3OX6A 1SL9A 2NCPA 4YBHB 1DJIA 1BT6A 2BBMA 4F0ZB 2LAPA 4MZLA 2K7CA 1SL7A 1KK8B 2JNFA 4GAOA 3VRPA 1KQVA 3BUOB 1NIWA 1RECA 5HKYA 5CSJA 1C7WA 2FOTA 1ZOTB 1S5GZ 2I2RE 5I8NA 1EH2A 3O78A 2WCEA 2MAZA 2HPSA 4YGBB 3GK4X 2BL0C 2AAOA 2MLEC 3VRRA 1U5IB 2LV7A 1U5IA 3FIAA 4ORAB 2KGRA 3DD4A 3I5IB 3ZWHA 1CNPA 2FCEA 2PRUA 1FBVA 1UHNA 4OCIA 2M7NA 3NSKA 3TDUA 1F4QA 1DGVA 1ODBA 1SCVA 2KYFA 1CDNA 3EKJA 1DGUA 1OZSA 1W7JB 1QLKA 3TDIA 4CFRA 1KWOB 5HLOA 4R1EA 1QIWA 1K93D 4I5JA 3CWGA 3CR5X 1OZOA 2H61C 3TUYC 5JJGA 1CFPA 1YURA 2L51A 4AQIA 1KQMB 1S26D 1MXEA 2SASA 1EL4A 2LUXA 3JVTB 3EK7A 4MEWA 1CDPA 1RFJA 1BF5A 1B4CA 3BUWB 4M2OA 3A8RA 2KBIA 1XFYO 1QATA 1PK0D 2K2FA 4YGCB 2KFHA 2M97A 2WNDA 1QV0A 3SIAA 3PSRA 1WRZA 1SPYA 2WORA 3BOWB 1SL8A 1LINA 3BOWA 3CR2A 1BR4B 4OR9B 1XFWO 1ZACA 2JTTA 1TNWA 4CPVA 4DS7A 1OMDA 2WCFA 1GGZA 1KCYA 1J7QA 2OTGB 2KI6C 1UHKA 4GNKB 1IQ5A 1JBAA 1S3PA 2Q91A 2KDHA 3KHEA 1HQVA 2K61A 1LXFC 1AUIB 1UHJA 2LANA 4OKHA 1K94A 2P6BB 4I5KA 3EK4A 1NX2A 2HQWA 3SJSA 1YUUA 5PALA 2JZIA 2M1KB 3WHUB 2PSRA 3BUXB 1CFCA 2JXCA 2HQ8A 1JC2A 3DVEA 1IJ6A
chains in the Genus database with same CATH superfamily
4I5LB 4AOMA 1N65A 1JUOA 1SY9A 2K60A 1EJ3A 3F45A 1TUZA 4PHJA 2KLEA 2LE9B 2H8VA 1KSMA 4C0KA 1QTXA 2L2EA 3BFBA 1NX0A 1XFRA 3FWCA 3I5HC 4P2YB 1F71A 1NX3A 3PM2A 4PHKA 1K9PA 3TDZA 3R72A 2BBNA 1LS8A 5CPVA 1CTRA 1SK6D 2KQ6A 2COLB 2IS9A 1EG4A 2K7DA 4PHMA 3OB2B 3EVVA 1UUSA 4JQ0D 1JFKA 2JPTA 1L2OB 2PALA 2ZRTA 3DVJA 3TS5C 2F33A 2RGIA 1TCFA 4GGFC 1RTP1 5DICA 5AERA 1RK9A 1YX7A 1TCOB 3OHMB 1BR1B 3Q8IA 4WRIA 3AAJA 4MZJA 4D1EA 4NDCA 1QXPA 2LHLA 2FCDA 1QX5B 3BXKA 2M0RA 3KF9A 3FS7A 1CDMA 2WOSA 3D77A 3AAKA 1P28A 2Y1NA 1PVBA 2GGZA 1DVIA 3PATA 1MQ1A 1JSAA 3TZ1A 5DKNA 2M49B 1Y1XA 1B7TY 3I5FB 5CSFA 2CTNA 3SG7A 4YGEB 1JFJA 1IJ5A 2ZNEA 3GOFA 5EL2A 5TNCA 5FI6A 4MRXA 1F70A 2JT3A 1Y0VH 1W7IB 3L47A 2LHIA 1K95A 1OSAA 2LVIA 2L50A 1Y1AA 1DEKA 1WDCC 1YUSA 2M3WA 3PM8A 1QLSA 3IQOA 3AKBA 4JKTA 1SYMA 3ZNIA 3S0FA 1B9AA 2KAXA 3FWBA 3D0YB 2OPOA 3D0YA 1OMRA 3QRXA 3PN7B 2WCBA 1H8BA 1Y1UA 2LCPA 1PALA 2KFGA 2GTEA 2KI6D 3BFHA 1QIVA 1OOFA 2CT9A 2WCLA 1J7OA 5HKZA 1H4BA 4Q04A 2I94A 1IGVA 3S0DA 2M9GA 3JTDB 1K90D 2ERBA 2WCHA 1QVIY 3RM1A 1KK8C 3SG4A 1SSEB 4PE7A 3LL8B 1B8CA 1L7ZA 2Y4QA 4GGNA 5G08A 3HX4A 1PVAA 1XK4A 3CS1A 1J1DA 3GK1A 1IRJA 1CM1A 3DZTA 5HLVA 4JWQA 1ALWA 2BNXA 1UWOA 2FJUB 1UHIA 2CCMA 2HETA 1DELA 1UURA 1PULA 3I5IC 3PALA 1GQMA 4XYNA 1TN4A 5DKQA 2PMYA 1IWQA 2ZKMX 3CLNA 2M1UA 5HYDA 3C1VA 2KQYA 3KO0A 5CSNA 1CKKA 3TUYB 4GFTA 1YTZC 1TRFA 3D76A 2MJWB 1KWOC 1DJGA 3MSEB 2BKHB 3R1VA 1TNPA 5FYXA 4QJ5B 4E68A 3S0BA 2I7AA 1KSOA 1B8RA 2G2BA 1OW4A 1QVIZ 3GK2A 1J7PA 3JVTC 2BE6A 3IVTA 3KEVA 1NX1A 2JC2A 2KI4B 3L4LA 3SG5A 4N5XA 1A2XA 1Q80A 2ISDA 1XA5A 1XVJA 2LP2A 3UO9A 1MXLC 1IQ3A 3I5GB 5GQQC 4UPGA 4ZCUA 1S6IA 2WC5A 1N2DA 1K8UA 2JT8A 4MVFA 3M0WA 3WHTB 4ORCB 3VROA 2AMIA 1J1EA 1KFXL 2KGBC 4MSPA 2F2PA 3HCMA 3B87A 2NXQA 4U8DA 2JXLA 4M2PA 1F55A 1A29A 1DJYA 3NSIA 4CIDA 1CB1A 1SRAA 1BJFA 1N0YA 2OTGC 4FQTA 3VRQA 3BUMB 2KHNA 1BODA 1QX7A 4ZCVA 1NUBA 1AVSA 1YR5A 2ZN9A 2GV5A 2K7OA 1JF2A 5AANA 5KU1A 1SR6B 2QPTA 1G4YR 3O2PA 2BE4A 1YVHA 1UHHA 2LVJA 2F2OA 1LA0A 1YX8A 1XYDA 4I5NB 3R1PA 4OV2A 2ZRSA 1M39A 3I5HB 4QJ3B 1C3YA 1MHOA 2LLUA 2WC8A 2JU0A 2ZFDA 1R6PA 2ZN8A 3FE9A 2LMVA 2HF5A 3D75A 1NSHA 1ZUZA 1SMGA 2JULA 3OB1B 1C07A 1CLBA 2FJYA 3DVKA 1ALVA 2NCOA 1SCMB 2BCXA 3DVMA 1KFXS 3SG6A 1AK8A 4OVNF 2SCPA 5FI7A 3BUNB 1NP8A 2MRDA 3KPXA 2Y1MA 3O4YA 2GGMA 3EKHA 4A4BA 4PT1A 3WXAA 1OOGA 3SG2A 4XJKB 2BCBA 4XJKA 2JNXA 1FF1A 4FTGA 2PASA 1QASA 1MF8B 2EC6B 2MHHA 2K2AA 2F8PA 2CBLA 3BJHA 3D78A 1VRKA 2OS8B 4ORBB 4HRGA 1L2OC 5I94A 2PQLA 3DYEA 1OOIX 4MRYA 4TNCA 1C3ZA 2BAPA 4YGDB 3O6BA 4WQ3A 5IBWA 1OMVA 2KOTA 1TUJA 1G8IA 1PSRA 1A03A 2KAVA 1MWNA 2G9BA 2L98A 3SS4A 2KYCA 2KAYA 3NXAA 1KFUL 4GBAA 3K21A 1S36A 1S5GY 1DJZA 2QACA 3WNXB 4YGAA 1Z4HA 5AXIA 5ER4X 5I2QA 2CNPA 2JPOA 1AJ4A 1NCZA 3L4AA 1B1GA 2Q4UA 4WQ2A 3PLFB 2Y5IA 1OOJA 4M2QA 5J3XA 2JQ6A 4F7FA 2JRFA 3I5FC 2LVVA 4BY5A 1X02A 4ICBA 1K9KA 4PE0A 1NPQA 2QEOA 3NGVA 1A4PA 1C7VA 1QV1A 2KPHA 1WRKA 1OOHA 3CZTX 3OBVA 1YRUB 2A4JA 1XFUO 3EVUA 1SW8A 2BL0B 1K2HA 1E8AA 2NLNA 2QEHA 1A75B 2L4IA 1A75A 4IJ7A 3PN7C 4INWA 3A4UB 1WLZA 1DMOA 2BCAA 1MR8A 2KBMA 2BKIB 1B7TZ 1KFUS 1YUTA 1IKUA 1WY9A 3BQ3A 1BLQA 1UP5A 2F3YA 2PVBA 2MA2A 2LP3A 3JTDC 2L5YA 3O4XA 3ICBA 4PE4A 5K89A 3SS5A 5ER5A 2L5XB 4CFQA 4N1FA 4DUQA 1JWDA 1XK4C 1Y6WA 2KSPA 2MBXA 4C0JA 1K96A 4GUKA 1DF0B 2O5GA 1DF0A 2EGDA 1YRTB 2BECA 1M63B 4A4CA 2M29A 1XO5A 4DRWA 1ZMZA 4FQOA 2H61A 1QS7A 2KLDA 1DJXA 3NSLA 4GPLB 1TIZA 4NDDA 5F6TA 1M45A 5AFPA 1TNXA 4L9MA 1WLMA 1CFDA 1OQPA 2LLSA 2YGUA 3SS3A 1PRWA 4N1GA 1QX2A 1NWDA 4MBEA 4P5OE 2WCJA 1KQMC 3CGAA 4PDZA 3FE8A 1W9ZA 2K0JA 4MLWA 1BU3A 1FI6A 1NYAA 1AP4A 5DKRA 4DCKA 1FI5A 3PFVA 5D7FA 2K7BA 1DT7B 1DJWA 2LM5A 3H4SE 4PCWA 3PJIA 3LK1A 1NCXA 1ZFSA 1B47A 4QJ4B 4JPZB 4USLA 1FW4A 1CMFA 3EK8A 4DIRA 4BY4A 1SKTA 1F4OA 3SG3A 2JOJA 1NCYA 2L4HA 4IL1A 5D69A 1HT9A 5JOLA 3VGOA 4MZKA 2V53A 1F54A 3R1OA 2KFFA 2KI4C 1S1EA 3CZ1A 1V1GA 2H2KA 1G33A 4PHNA 1J7RA 3IF7A 1KK7Y 1LVCD 1AHRA 2WCKA 3I5GC 3RLZA 3SIBA 2JWWA 1F8HA 1IH0A 1LKJA 1OE9B 1RROA 3VRNA 5AEQA 3LK0A 5I2OA 5HKWA 4NQGA 5KSZA 1BOCA 5BPJA 2JT0A 4HSZA 1RJVA 5I2LA 1QJTA 2WC6A 1TTXA 1QWVA 2KNEA 2L0PA 3D10A 2LVKA 3NSOA 1IIOA 1SBJA 3CYZA 1XFVO 1WRLA 1V1FA 2LUCA 1SR6C 4YI9A 1LA3A 1GJYA 2EHBA 1ORGA 1B8LA 2NZ0A 3OX5A 3S0GA 5B8IB 2DOQA 1M31A 1CLMA 1AJ5A 1M46A 3FE6A 1S6CA 2K8MB 2D8NA 1D1OA 3DXLA 1FPWA 3DF0B 2L2CA 3DF0A 3OP0A 3TS5B 2M8UA 3B6XA 1KK7Z 1RWYA 1J55A 1K9UA 1XFXO 4GGFA 5KTYA 4PE1A 1JF0A 1DTLA 1R2UA 2E30A 1CFFA 1S6JA 3B86A 3LCPC 1BG1A 1SCMC 1TNQA 3D73A 4HRHA 4AQJA 2MLFC 5HL1A 1EG3A 2LC5A 2M7LA 3IQQA 3UNWA 4HREE 3V2LA 4CLNA 3OGNA 2LMUA 3AKAA 4KYNA 1XFZO 3BYAA 2AUCA 2TN4A 2EC6C 1CM4A 3D74A 4NDBA 2OS8C 2LLTA 1CMGA 2E6WA 4MN0A 4ETOA 5CSIA 3E3RA 2B1UA 2CXJA 3CABA 4JD9A 1IG5A 2JTZA 2O60A 1SNLA 1GGWA 3CTNA 2P70A 1BMOA 1TOPA 2I18A 3LLEA 4INXA 1CDLA 2R2IA 1PSBA 4YI8A 3CR4X 1WDCB 1YVLA 2F3ZA 3BFAA 2LNKA 2VRGA 4C0LA 2LMTA 2WCMA 3VB1A 1Z2CB 3EG5B 1MUXA 4PALA 1DJHA 1CLLA 2P71A 1EXRA 3EVRA 4YRUA 2ZNDA 4OZDA 3OX6A 5D3OA 5FI2A 1SL9A 2NCPA 4YBHB 1DJIA 2QEVA 1BT6A 2BBMA 4F0ZB 2LAPA 3CZ0A 4MZLA 2K7CA 1SL7A 1KK8B 2JNFA 4GAOA 3VRPA 1KQVA 3BUOB 1NIWA 1RECA 5HKYA 5CSJA 1C7WA 2FOTA 3RZSA 1ZOTB 1S5GZ 2I2RE 5I8NA 1EH2A 3O78A 2WCEA 2MAZA 2HPSA 4YGBB 1GM0A 3GK4X 2BL0C 2AAOA 2MLEC 3VRRA 1U5IB 2LV7A 1U5IA 3FIAA 4ORAB 2KGRA 3DD4A 3I5IB 3ZWHA 1CNPA 2FCEA 2PRUA 1FBVA 1UHNA 4OCIA 2M7NA 3NSKA 3TDUA 1F4QA 1DGVA 1ODBA 1SCVA 2KYFA 1CDNA 3EKJA 1DGUA 1OZSA 2QEBA 1W7JB 1QLKA 3K1EA 3TDIA 4CFRA 1KWOB 5HLOA 4R1EA 1QIWA 3S0EA 1K93D 4I5JA 3CWGA 3CR5X 1OZOA 2H61C 3TUYC 5JJGA 1DQEA 1YURA 2L51A 1CFPA 4AQIA 1KQMB 1S26D 1MXEA 2SASA 1EL4A 1T14A 2LUXA 3JVTB 3EK7A 1TWOA 4MEWA 1CDPA 1RFJA 3S0AA 1BF5A 1B4CA 3BUWB 4M2OA 3A8RA 2KBIA 1XFYO 1QATA 1PK0D 2K2FA 3CZ2A 2KFHA 2M97A 2WNDA 1QV0A 4YGCB 3DY9A 3PSRA 1WRZA 3SIAA 1SPYA 1DC1A 2WORA 3BOWB 1SL8A 1LINA 3BOWA 3CR2A 1BR4B 2PYQA 4OR9B 3NHIA 1XFWO 1ZACA 2JTTA 1TNWA 4CPVA 4DS7A 1OMDA 3N7HA 3NHTA 2WCFA 1GGZA 2QDIA 1KCYA 3B88A 1J7QA 2OTGB 2KI6C 1UHKA 4GNKB 1IQ5A 1JBAA 1S3PA 2Q91A 2KDHA 3KHEA 1HQVA 2K61A 1LXFC 1AUIB 1UHJA 2LANA 4OKHA 1K94A 2P6BB 3B7AA 3EK4A 4I5KA 1NX2A 2HQWA 3SJSA 1YUUA 5PALA 2JZIA 2M1KB 3CDNA 2PSRA 3QMEA 3BUXB 3WHUB 1CFCA 2JXCA 2HQ8A 1JC2A 3DVEA 1IJ6A
chains in the Genus database with same CATH topology
4I5LB 4AOMA 1N65A 1JUOA 1SY9A 3F45A 1EJ3A 4PHJA 2LE9B 4C0KA 1KSMA 1QTXA 2L2EA 3FWCA 1NX0A 3I5HC 4P2YB 1F71A 1NX3A 4PHKA 1K9PA 3TDZA 2BBNA 5CPVA 1CTRA 1SK6D 2KQ6A 2COLB 2IS9A 1EG4A 2K7DA 4PHMA 3OB2B 3EVVA 1UUSA 4JQ0D 1JFKA 2JPTA 1L2OB 2PALA 2ZRTA 3DVJA 3TS5C 2F33A 2RGIA 1TCFA 4GGFC 1RTP1 5AERA 1RK9A 1YX7A 1TCOB 3OHMB 1BR1B 4WRIA 3AAJA 4MZJA 4D1EA 4NDCA 1QXPA 2LHLA 2FCDA 1QX5B 3BXKA 2M0RA 3KF9A 3FS7A 1CDMA 2WOSA 3AAKA 2Y1NA 1PVBA 2GGZA 1DVIA 3PATA 1MQ1A 1JSAA 3TZ1A 5DKNA 2M49B 1Y1XA 1B7TY 3I5FB 5CSFA 2CTNA 3SG7A 4YGEB 1JFJA 1IJ5A 2ZNEA 3GOFA 5TNCA 1F70A 4MRXA 2JT3A 1Y0VH 1W7IB 2LHIA 1K95A 1OSAA 2LVIA 2L50A 1Y1AA 1WDCC 1YUSA 2M3WA 3PM8A 1QLSA 3IQOA 3AKBA 1SYMA 3ZNIA 1B9AA 2KAXA 3FWBA 3D0YB 2OPOA 3D0YA 1OMRA 3QRXA 3PN7B 2WCBA 1H8BA 1Y1UA 2LCPA 1PALA 2KFGA 2KI6D 1QIVA 2CT9A 1J7OA 5HKZA 1H4BA 4Q04A 2I94A 1IGVA 2M9GA 3JTDB 1K90D 1QVIY 3RM1A 1KK8C 3SG4A 4PE7A 3LL8B 1B8CA 1L7ZA 2Y4QA 4GGNA 5G08A 3HX4A 1PVAA 1XK4A 3CS1A 1J1DA 3GK1A 1IRJA 1CM1A 5HLVA 4JWQA 1ALWA 1UWOA 2FJUB 1UHIA 2CCMA 2HETA 1UURA 1PULA 3I5IC 3PALA 1GQMA 4XYNA 1TN4A 5DKQA 2PMYA 1IWQA 2ZKMX 3CLNA 2M1UA 5HYDA 3C1VA 2KQYA 3KO0A 5CSNA 1CKKA 3TUYB 4GFTA 1YTZC 1TRFA 2MJWB 1KWOC 1DJGA 3MSEB 2BKHB 1TNPA 5FYXA 4QJ5B 4E68A 2I7AA 1KSOA 1B8RA 2G2BA 1QVIZ 3GK2A 1J7PA 3JVTC 2BE6A 3KEVA 1NX1A 2JC2A 2KI4B 3SG5A 4N5XA 1A2XA 1Q80A 2ISDA 1XA5A 1XVJA 2LP2A 1MXLC 1IQ3A 3I5GB 5GQQC 4UPGA 4ZCUA 1S6IA 1N2DA 1K8UA 2JT8A 4MVFA 3M0WA 3WHTB 4ORCB 3VROA 2AMIA 1J1EA 1KFXL 2KGBC 4MSPA 2F2PA 3HCMA 2NXQA 4U8DA 2JXLA 4M2PA 1F55A 1A29A 1DJYA 3NSIA 4CIDA 1CB1A 1SRAA 1BJFA 1N0YA 2OTGC 3VRQA 3BUMB 2KHNA 1BODA 1QX7A 4ZCVA 1NUBA 1AVSA 1YR5A 2ZN9A 2GV5A 2K7OA 1JF2A 5AANA 5KU1A 1SR6B 2QPTA 1G4YR 3O2PA 2BE4A 1YVHA 1UHHA 2LVJA 2F2OA 1LA0A 1YX8A 1XYDA 4I5NB 4OV2A 2ZRSA 1M39A 3I5HB 4QJ3B 1MHOA 2LLUA 2WC8A 2JU0A 2ZFDA 1R6PA 2ZN8A 2LMVA 2HF5A 1NSHA 1ZUZA 1SMGA 2JULA 3OB1B 1C07A 1CLBA 3DVKA 1ALVA 2NCOA 1SCMB 2BCXA 3DVMA 1KFXS 3SG6A 1AK8A 4OVNF 2SCPA 3BUNB 1NP8A 2MRDA 3KPXA 2Y1MA 3O4YA 2GGMA 3EKHA 4A4BA 3WXAA 3SG2A 1FF1A 4XJKB 2BCBA 4XJKA 2JNXA 4FTGA 2PASA 1QASA 1MF8B 2EC6B 2MHHA 2K2AA 2F8PA 2CBLA 4ORBB 1VRKA 2OS8B 4HRGA 1L2OC 4MRYA 4TNCA 4YGDB 3O6BA 4WQ3A 5IBWA 1OMVA 2KOTA 1G8IA 1PSRA 1A03A 2KAVA 1MWNA 2G9BA 2L98A 2KYCA 2KAYA 3NXAA 1KFUL 4GBAA 3K21A 1S36A 1S5GY 1DJZA 2QACA 3WNXB 4YGAA 5AXIA 5ER4X 5I2QA 2CNPA 1AJ4A 1NCZA 1B1GA 2Q4UA 4WQ2A 3PLFB 2Y5IA 1OOJA 4M2QA 5J3XA 2JQ6A 2JRFA 3I5FC 2LVVA 4BY5A 1X02A 4ICBA 1K9KA 4PE0A 1NPQA 1A4PA 1C7VA 1QV1A 1WRKA 3CZTX 1YRUB 2A4JA 1XFUO 3EVUA 1SW8A 2BL0B 1K2HA 1E8AA 2NLNA 1A75B 2L4IA 1A75A 3PN7C 3A4UB 1WLZA 1DMOA 2BCAA 1MR8A 2KBMA 2BKIB 1B7TZ 1KFUS 1YUTA 1IKUA 1WY9A 3BQ3A 1BLQA 1UP5A 2F3YA 2PVBA 2MA2A 2LP3A 3JTDC 3ICBA 4PE4A 5K89A 5ER5A 2L5XB 4CFQA 4N1FA 4DUQA 1JWDA 1XK4C 1Y6WA 2KSPA 2MBXA 4C0JA 1K96A 4GUKA 1DF0B 2O5GA 1DF0A 2EGDA 1YRTB 2BECA 1M63B 4A4CA 2M29A 1XO5A 4DRWA 1ZMZA 4FQOA 2H61A 1QS7A 4GPLB 1DJXA 3NSLA 4NDDA 1TIZA 5F6TA 5AFPA 1M45A 1TNXA 4L9MA 1WLMA 1CFDA 1OQPA 2LLSA 1PRWA 4N1GA 1QX2A 1NWDA 4MBEA 4P5OE 1KQMC 3CGAA 4PDZA 2K0JA 4MLWA 1BU3A 1FI6A 1NYAA 1AP4A 5DKRA 4DCKA 1FI5A 3PFVA 5D7FA 2K7BA 1DT7B 1DJWA 2LM5A 3H4SE 4PCWA 3LK1A 1NCXA 1ZFSA 1B47A 4QJ4B 4JPZB 4USLA 1FW4A 1CMFA 3EK8A 4DIRA 4BY4A 1SKTA 1F4OA 3SG3A 2JOJA 1NCYA 2L4HA 4IL1A 5D69A 1HT9A 5JOLA 3VGOA 4MZKA 2V53A 1F54A 2KFFA 2KI4C 1S1EA 1V1GA 2H2KA 1G33A 4PHNA 1J7RA 3IF7A 1KK7Y 1LVCD 1AHRA 3I5GC 3RLZA 3SIBA 2JWWA 1F8HA 1IH0A 1LKJA 1OE9B 1RROA 3VRNA 5AEQA 3LK0A 5I2OA 5HKWA 4NQGA 5KSZA 1BOCA 5BPJA 2JT0A 4HSZA 1RJVA 5I2LA 1QJTA 1TTXA 2KNEA 2L0PA 3D10A 2LVKA 3NSOA 1SBJA 1XFVO 1WRLA 1V1FA 2LUCA 1SR6C 4YI9A 1LA3A 1GJYA 2EHBA 2NZ0A 1B8LA 3OX5A 5B8IB 2DOQA 1M31A 1CLMA 1AJ5A 1M46A 1S6CA 2K8MB 2D8NA 1D1OA 1FPWA 3DF0B 3DF0A 3OP0A 3TS5B 2M8UA 1KK7Z 1RWYA 1J55A 1K9UA 1XFXO 4GGFA 5KTYA 4PE1A 1JF0A 1DTLA 1R2UA 2E30A 1CFFA 1S6JA 3LCPC 1BG1A 1SCMC 1TNQA 4HRHA 4AQJA 2MLFC 1EG3A 2LC5A 2M7LA 3IQQA 4CLNA 4HREE 2LMUA 3AKAA 1XFZO 3BYAA 2AUCA 2TN4A 2EC6C 1CM4A 4NDBA 2OS8C 2LLTA 1CMGA 2E6WA 4MN0A 4ETOA 5CSIA 3E3RA 2B1UA 2CXJA 1IG5A 2JTZA 2O60A 1SNLA 1GGWA 3CTNA 1BMOA 1TOPA 2I18A 3LLEA 1CDLA 2R2IA 1PSBA 4YI8A 3CR4X 1WDCB 1YVLA 2F3ZA 2LNKA 2VRGA 4C0LA 2LMTA 1MUXA 4PALA 1DJHA 1CLLA 1EXRA 3EVRA 4YRUA 2ZNDA 3OX6A 1SL9A 2NCPA 4YBHB 1DJIA 1BT6A 2BBMA 4F0ZB 2LAPA 4MZLA 2K7CA 1SL7A 1KK8B 2JNFA 4GAOA 3VRPA 1KQVA 3BUOB 1NIWA 1RECA 5HKYA 5CSJA 1C7WA 2FOTA 1ZOTB 1S5GZ 2I2RE 5I8NA 1EH2A 3O78A 2WCEA 2MAZA 2HPSA 4YGBB 3GK4X 2BL0C 2AAOA 2MLEC 3VRRA 1U5IB 2LV7A 1U5IA 3FIAA 4ORAB 2KGRA 3DD4A 3I5IB 3ZWHA 1CNPA 2FCEA 2PRUA 1FBVA 1UHNA 4OCIA 2M7NA 3NSKA 3TDUA 1F4QA 1DGVA 1ODBA 1SCVA 2KYFA 1CDNA 3EKJA 1DGUA 1OZSA 1W7JB 1QLKA 3TDIA 4CFRA 1KWOB 5HLOA 4R1EA 1QIWA 1K93D 4I5JA 3CWGA 3CR5X 1OZOA 2H61C 3TUYC 5JJGA 1CFPA 1YURA 2L51A 4AQIA 1KQMB 1S26D 1MXEA 2SASA 1EL4A 2LUXA 3JVTB 3EK7A 4MEWA 1CDPA 1RFJA 1BF5A 1B4CA 3BUWB 4M2OA 3A8RA 2KBIA 1XFYO 1QATA 1PK0D 2K2FA 4YGCB 2KFHA 2M97A 2WNDA 1QV0A 3SIAA 3PSRA 1WRZA 1SPYA 2WORA 3BOWB 1SL8A 1LINA 3BOWA 3CR2A 1BR4B 4OR9B 1XFWO 1ZACA 2JTTA 1TNWA 4CPVA 4DS7A 1OMDA 2WCFA 1GGZA 1KCYA 1J7QA 2OTGB 2KI6C 1UHKA 4GNKB 1IQ5A 1JBAA 1S3PA 2Q91A 2KDHA 3KHEA 1HQVA 2K61A 1LXFC 1AUIB 1UHJA 2LANA 4OKHA 1K94A 2P6BB 4I5KA 3EK4A 1NX2A 2HQWA 3SJSA 1YUUA 5PALA 2JZIA 2M1KB 3WHUB 2PSRA 3BUXB 1CFCA 2JXCA 2HQ8A 1JC2A 3DVEA 1IJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5L B;  4AOM A;  1N65 A;  1JUO A;  1SY9 A;  3F45 A;  1EJ3 A;  4PHJ A;  2LE9 B;  4C0K A;  1KSM A;  1QTX A;  2L2E A;  3FWC A;  1NX0 A;  3I5H C;  4P2Y B;  1F71 A;  1NX3 A;  4PHK A;  1K9P A;  3TDZ A;  2BBN A;  5CPV A;  1CTR A;  1SK6 D;  2KQ6 A;  2COL B;  2IS9 A;  1EG4 A;  2K7D A;  4PHM A;  3OB2 B;  3EVV A;  1UUS A;  4JQ0 D;  1JFK A;  2JPT A;  1L2O B;  2PAL A;  2ZRT A;  3DVJ A;  3TS5 C;  2F33 A;  2RGI A;  1TCF A;  4GGF C;  1RTP 1;  5AER A;  1RK9 A;  1YX7 A;  1TCO B;  3OHM B;  1BR1 B;  4WRI A;  3AAJ A;  4MZJ A;  4D1E A;  4NDC A;  1QXP A;  2LHL A;  2FCD A;  1QX5 B;  3BXK A;  2M0R A;  3KF9 A;  3FS7 A;  1CDM A;  2WOS A;  3AAK A;  2Y1N A;  1PVB A;  2GGZ A;  1DVI A;  3PAT A;  1MQ1 A;  1JSA A;  3TZ1 A;  5DKN A;  2M49 B;  1Y1X A;  1B7T Y;  3I5F B;  5CSF A;  2CTN A;  3SG7 A;  4YGE B;  1JFJ A;  1IJ5 A;  2ZNE A;  3GOF A;  5TNC A;  1F70 A;  4MRX A;  2JT3 A;  1Y0V H;  1W7I B;  2LHI A;  1K95 A;  1OSA A;  2LVI A;  2L50 A;  1Y1A A;  1WDC C;  1YUS A;  2M3W A;  3PM8 A;  1QLS A;  3IQO A;  3AKB A;  1SYM A;  3ZNI A;  1B9A A;  2KAX A;  3FWB A;  3D0Y B;  2OPO A;  3D0Y A;  1OMR A;  3QRX A;  3PN7 B;  2WCB A;  1H8B A;  1Y1U A;  2LCP A;  1PAL A;  2KFG A;  2KI6 D;  1QIV A;  2CT9 A;  1J7O A;  5HKZ A;  1H4B A;  4Q04 A;  2I94 A;  1IGV A;  2M9G A;  3JTD B;  1K90 D;  1QVI Y;  3RM1 A;  1KK8 C;  3SG4 A;  4PE7 A;  3LL8 B;  1B8C A;  1L7Z A;  2Y4Q A;  4GGN A;  5G08 A;  3HX4 A;  1PVA A;  1XK4 A;  3CS1 A;  1J1D A;  3GK1 A;  1IRJ A;  1CM1 A;  5HLV A;  4JWQ A;  1ALW A;  1UWO A;  2FJU B;  1UHI A;  2CCM A;  2HET A;  1UUR A;  1PUL A;  3I5I C;  3PAL A;  1GQM A;  4XYN A;  1TN4 A;  5DKQ A;  2PMY A;  1IWQ A;  2ZKM X;  3CLN A;  2M1U A;  5HYD A;  3C1V A;  2KQY A;  3KO0 A;  5CSN A;  1CKK A;  3TUY B;  4GFT A;  1YTZ C;  1TRF A;  2MJW B;  1KWO C;  1DJG A;  3MSE B;  2BKH B;  1TNP A;  5FYX A;  4QJ5 B;  4E68 A;  2I7A A;  1KSO A;  1B8R A;  2G2B A;  1QVI Z;  3GK2 A;  1J7P A;  3JVT C;  2BE6 A;  3KEV A;  1NX1 A;  2JC2 A;  2KI4 B;  3SG5 A;  4N5X A;  1A2X A;  1Q80 A;  2ISD A;  1XA5 A;  1XVJ A;  2LP2 A;  1MXL C;  1IQ3 A;  3I5G B;  5GQQ C;  4UPG A;  4ZCU A;  1S6I A;  1N2D A;  1K8U A;  2JT8 A;  4MVF A;  3M0W A;  3WHT B;  4ORC B;  3VRO A;  2AMI A;  1J1E A;  1KFX L;  2KGB C;  4MSP A;  2F2P A;  3HCM A;  2NXQ A;  4U8D A;  2JXL A;  4M2P A;  1F55 A;  1A29 A;  1DJY A;  3NSI A;  4CID A;  1CB1 A;  1SRA A;  1BJF A;  1N0Y A;  2OTG C;  3VRQ A;  3BUM B;  2KHN A;  1BOD A;  1QX7 A;  4ZCV A;  1NUB A;  1AVS A;  1YR5 A;  2ZN9 A;  2GV5 A;  2K7O A;  1JF2 A;  5AAN A;  5KU1 A;  1SR6 B;  2QPT A;  1G4Y R;  3O2P A;  2BE4 A;  1YVH A;  1UHH A;  2LVJ A;  2F2O A;  1LA0 A;  1YX8 A;  1XYD A;  4I5N B;  4OV2 A;  2ZRS A;  1M39 A;  3I5H B;  4QJ3 B;  1MHO A;  2LLU A;  2WC8 A;  2JU0 A;  2ZFD A;  1R6P A;  2ZN8 A;  2LMV A;  2HF5 A;  1NSH A;  1ZUZ A;  1SMG A;  2JUL A;  3OB1 B;  1C07 A;  1CLB A;  3DVK A;  1ALV A;  2NCO A;  1SCM B;  2BCX A;  3DVM A;  1KFX S;  3SG6 A;  1AK8 A;  4OVN F;  2SCP A;  3BUN B;  1NP8 A;  2MRD A;  3KPX A;  2Y1M A;  3O4Y A;  2GGM A;  3EKH A;  4A4B A;  3WXA A;  3SG2 A;  1FF1 A;  4XJK B;  2BCB A;  4XJK A;  2JNX A;  4FTG A;  2PAS A;  1QAS A;  1MF8 B;  2EC6 B;  2MHH A;  2K2A A;  2F8P A;  2CBL A;  4ORB B;  1VRK A;  2OS8 B;  4HRG A;  1L2O C;  4MRY A;  4TNC A;  4YGD B;  3O6B A;  4WQ3 A;  5IBW A;  1OMV A;  2KOT A;  1G8I A;  1PSR A;  1A03 A;  2KAV A;  1MWN A;  2G9B A;  2L98 A;  2KYC A;  2KAY A;  3NXA A;  1KFU L;  4GBA A;  3K21 A;  1S36 A;  1S5G Y;  1DJZ A;  2QAC A;  3WNX B;  4YGA A;  5AXI A;  5ER4 X;  5I2Q A;  2CNP A;  1AJ4 A;  1NCZ A;  1B1G A;  2Q4U A;  4WQ2 A;  3PLF B;  2Y5I A;  1OOJ A;  4M2Q A;  5J3X A;  2JQ6 A;  2JRF A;  3I5F C;  2LVV A;  4BY5 A;  1X02 A;  4ICB A;  1K9K A;  4PE0 A;  1NPQ A;  1A4P A;  1C7V A;  1QV1 A;  1WRK A;  3CZT X;  1YRU B;  2A4J A;  1XFU O;  3EVU A;  1SW8 A;  2BL0 B;  1K2H A;  1E8A A;  2NLN A;  1A75 B;  2L4I A;  1A75 A;  3PN7 C;  3A4U B;  1WLZ A;  1DMO A;  2BCA A;  1MR8 A;  2KBM A;  2BKI B;  1B7T Z;  1KFU S;  1YUT A;  1IKU A;  1WY9 A;  3BQ3 A;  1BLQ A;  1UP5 A;  2F3Y A;  2PVB A;  2MA2 A;  2LP3 A;  3JTD C;  3ICB A;  4PE4 A;  5K89 A;  5ER5 A;  2L5X B;  4CFQ A;  4N1F A;  4DUQ A;  1JWD A;  1XK4 C;  1Y6W A;  2KSP A;  2MBX A;  4C0J A;  1K96 A;  4GUK A;  1DF0 B;  2O5G A;  1DF0 A;  2EGD A;  1YRT B;  2BEC A;  1M63 B;  4A4C A;  2M29 A;  1XO5 A;  4DRW A;  1ZMZ A;  4FQO A;  2H61 A;  1QS7 A;  4GPL B;  1DJX A;  3NSL A;  4NDD A;  1TIZ A;  5F6T A;  5AFP A;  1M45 A;  1TNX A;  4L9M A;  1WLM A;  1CFD A;  1OQP A;  2LLS A;  1PRW A;  4N1G A;  1QX2 A;  1NWD A;  4MBE A;  4P5O E;  1KQM C;  3CGA A;  4PDZ A;  2K0J A;  4MLW A;  1BU3 A;  1FI6 A;  1NYA A;  1AP4 A;  5DKR A;  4DCK A;  1FI5 A;  3PFV A;  5D7F A;  2K7B A;  1DT7 B;  1DJW A;  2LM5 A;  3H4S E;  4PCW A;  3LK1 A;  1NCX A;  1ZFS A;  1B47 A;  4QJ4 B;  4JPZ B;  4USL A;  1FW4 A;  1CMF A;  3EK8 A;  4DIR A;  4BY4 A;  1SKT A;  1F4O A;  3SG3 A;  2JOJ A;  1NCY A;  2L4H A;  4IL1 A;  5D69 A;  1HT9 A;  5JOL A;  3VGO A;  4MZK A;  2V53 A;  1F54 A;  2KFF A;  2KI4 C;  1S1E A;  1V1G A;  2H2K A;  1G33 A;  4PHN A;  1J7R A;  3IF7 A;  1KK7 Y;  1LVC D;  1AHR A;  3I5G C;  3RLZ A;  3SIB A;  2JWW A;  1F8H A;  1IH0 A;  1LKJ A;  1OE9 B;  1RRO A;  3VRN A;  5AEQ A;  3LK0 A;  5I2O A;  5HKW A;  4NQG A;  5KSZ A;  1BOC A;  5BPJ A;  2JT0 A;  4HSZ A;  1RJV A;  5I2L A;  1QJT A;  1TTX A;  2KNE A;  2L0P A;  3D10 A;  2LVK A;  3NSO A;  1SBJ A;  1XFV O;  1WRL A;  1V1F A;  2LUC A;  1SR6 C;  4YI9 A;  1LA3 A;  1GJY A;  2EHB A;  2NZ0 A;  1B8L A;  3OX5 A;  5B8I B;  2DOQ A;  1M31 A;  1CLM A;  1AJ5 A;  1M46 A;  1S6C A;  2K8M B;  2D8N A;  1D1O A;  1FPW A;  3DF0 B;  3DF0 A;  3OP0 A;  3TS5 B;  2M8U A;  1KK7 Z;  1RWY A;  1J55 A;  1K9U A;  1XFX O;  4GGF A;  5KTY A;  4PE1 A;  1JF0 A;  1DTL A;  1R2U A;  2E30 A;  1CFF A;  1S6J A;  3LCP C;  1BG1 A;  1SCM C;  1TNQ A;  4HRH A;  4AQJ A;  2MLF C;  1EG3 A;  2LC5 A;  2M7L A;  3IQQ A;  4CLN A;  4HRE E;  2LMU A;  3AKA A;  1XFZ O;  3BYA A;  2AUC A;  2TN4 A;  2EC6 C;  1CM4 A;  4NDB A;  2OS8 C;  2LLT A;  1CMG A;  2E6W A;  4MN0 A;  4ETO A;  5CSI A;  3E3R A;  2B1U A;  2CXJ A;  1IG5 A;  2JTZ A;  2O60 A;  1SNL A;  1GGW A;  3CTN A;  1BMO A;  1TOP A;  2I18 A;  3LLE A;  1CDL A;  2R2I A;  1PSB A;  4YI8 A;  3CR4 X;  1WDC B;  1YVL A;  2F3Z A;  2LNK A;  2VRG A;  4C0L A;  2LMT A;  1MUX A;  4PAL A;  1DJH A;  1CLL A;  1EXR A;  3EVR A;  4YRU A;  2ZND A;  3OX6 A;  1SL9 A;  2NCP A;  4YBH B;  1DJI A;  1BT6 A;  2BBM A;  4F0Z B;  2LAP A;  4MZL A;  2K7C A;  1SL7 A;  1KK8 B;  2JNF A;  4GAO A;  3VRP A;  1KQV A;  3BUO B;  1NIW A;  1REC A;  5HKY A;  5CSJ A;  1C7W A;  2FOT A;  1ZOT B;  1S5G Z;  2I2R E;  5I8N A;  1EH2 A;  3O78 A;  2WCE A;  2MAZ A;  2HPS A;  4YGB B;  3GK4 X;  2BL0 C;  2AAO A;  2MLE C;  3VRR A;  1U5I B;  2LV7 A;  1U5I A;  3FIA A;  4ORA B;  2KGR A;  3DD4 A;  3I5I B;  3ZWH A;  1CNP A;  2FCE A;  2PRU A;  1FBV A;  1UHN A;  4OCI A;  2M7N A;  3NSK A;  3TDU A;  1F4Q A;  1DGV A;  1ODB A;  1SCV A;  2KYF A;  1CDN A;  3EKJ A;  1DGU A;  1OZS A;  1W7J B;  1QLK A;  3TDI A;  4CFR A;  1KWO B;  5HLO A;  4R1E A;  1QIW A;  1K93 D;  4I5J A;  3CWG A;  3CR5 X;  1OZO A;  2H61 C;  3TUY C;  5JJG A;  1CFP A;  1YUR A;  2L51 A;  4AQI A;  1KQM B;  1S26 D;  1MXE A;  2SAS A;  1EL4 A;  2LUX A;  3JVT B;  3EK7 A;  4MEW A;  1CDP A;  1RFJ A;  1BF5 A;  1B4C A;  3BUW B;  4M2O A;  3A8R A;  2KBI A;  1XFY O;  1QAT A;  1PK0 D;  2K2F A;  4YGC B;  2KFH A;  2M97 A;  2WND A;  1QV0 A;  3SIA A;  3PSR A;  1WRZ A;  1SPY A;  2WOR A;  3BOW B;  1SL8 A;  1LIN A;  3BOW A;  3CR2 A;  1BR4 B;  4OR9 B;  1XFW O;  1ZAC A;  2JTT A;  1TNW A;  4CPV A;  4DS7 A;  1OMD A;  2WCF A;  1GGZ A;  1KCY A;  1J7Q A;  2OTG B;  2KI6 C;  1UHK A;  4GNK B;  1IQ5 A;  1JBA A;  1S3P A;  2Q91 A;  2KDH A;  3KHE A;  1HQV A;  2K61 A;  1LXF C;  1AUI B;  1UHJ A;  2LAN A;  4OKH A;  1K94 A;  2P6B B;  4I5K A;  3EK4 A;  1NX2 A;  2HQW A;  3SJS A;  1YUU A;  5PAL A;  2JZI A;  2M1K B;  3WHU B;  2PSR A;  3BUX B;  1CFC A;  2JXC A;  2HQ8 A;  1JC2 A;  3DVE A;  1IJ6 A; 
#chains in the Genus database with same CATH topology
 4I5L B;  4AOM A;  1N65 A;  1JUO A;  1SY9 A;  2K60 A;  1EJ3 A;  3F45 A;  1TUZ A;  4PHJ A;  2KLE A;  2LE9 B;  2H8V A;  1KSM A;  4C0K A;  1QTX A;  2L2E A;  3BFB A;  1NX0 A;  1XFR A;  3FWC A;  3I5H C;  4P2Y B;  1F71 A;  1NX3 A;  3PM2 A;  4PHK A;  1K9P A;  3TDZ A;  3R72 A;  2BBN A;  1LS8 A;  5CPV A;  1CTR A;  1SK6 D;  2KQ6 A;  2COL B;  2IS9 A;  1EG4 A;  2K7D A;  4PHM A;  3OB2 B;  3EVV A;  1UUS A;  4JQ0 D;  1JFK A;  2JPT A;  1L2O B;  2PAL A;  2ZRT A;  3DVJ A;  3TS5 C;  2F33 A;  2RGI A;  1TCF A;  4GGF C;  1RTP 1;  5DIC A;  5AER A;  1RK9 A;  1YX7 A;  1TCO B;  3OHM B;  1BR1 B;  3Q8I A;  4WRI A;  3AAJ A;  4MZJ A;  4D1E A;  4NDC A;  1QXP A;  2LHL A;  2FCD A;  1QX5 B;  3BXK A;  2M0R A;  3KF9 A;  3FS7 A;  1CDM A;  2WOS A;  3D77 A;  3AAK A;  1P28 A;  2Y1N A;  1PVB A;  2GGZ A;  1DVI A;  3PAT A;  1MQ1 A;  1JSA A;  3TZ1 A;  5DKN A;  2M49 B;  1Y1X A;  1B7T Y;  3I5F B;  5CSF A;  2CTN A;  3SG7 A;  4YGE B;  1JFJ A;  1IJ5 A;  2ZNE A;  3GOF A;  5EL2 A;  5TNC A;  5FI6 A;  4MRX A;  1F70 A;  2JT3 A;  1Y0V H;  1W7I B;  3L47 A;  2LHI A;  1K95 A;  1OSA A;  2LVI A;  2L50 A;  1Y1A A;  1DEK A;  1WDC C;  1YUS A;  2M3W A;  3PM8 A;  1QLS A;  3IQO A;  3AKB A;  4JKT A;  1SYM A;  3ZNI A;  3S0F A;  1B9A A;  2KAX A;  3FWB A;  3D0Y B;  2OPO A;  3D0Y A;  1OMR A;  3QRX A;  3PN7 B;  2WCB A;  1H8B A;  1Y1U A;  2LCP A;  1PAL A;  2KFG A;  2GTE A;  2KI6 D;  3BFH A;  1QIV A;  1OOF A;  2CT9 A;  2WCL A;  1J7O A;  5HKZ A;  1H4B A;  4Q04 A;  2I94 A;  1IGV A;  3S0D A;  2M9G A;  3JTD B;  1K90 D;  2ERB A;  2WCH A;  1QVI Y;  3RM1 A;  1KK8 C;  3SG4 A;  1SSE B;  4PE7 A;  3LL8 B;  1B8C A;  1L7Z A;  2Y4Q A;  4GGN A;  5G08 A;  3HX4 A;  1PVA A;  1XK4 A;  3CS1 A;  1J1D A;  3GK1 A;  1IRJ A;  1CM1 A;  3DZT A;  5HLV A;  4JWQ A;  1ALW A;  2BNX A;  1UWO A;  2FJU B;  1UHI A;  2CCM A;  2HET A;  1DEL A;  1UUR A;  1PUL A;  3I5I C;  3PAL A;  1GQM A;  4XYN A;  1TN4 A;  5DKQ A;  2PMY A;  1IWQ A;  2ZKM X;  3CLN A;  2M1U A;  5HYD A;  3C1V A;  2KQY A;  3KO0 A;  5CSN A;  1CKK A;  3TUY B;  4GFT A;  1YTZ C;  1TRF A;  3D76 A;  2MJW B;  1KWO C;  1DJG A;  3MSE B;  2BKH B;  3R1V A;  1TNP A;  5FYX A;  4QJ5 B;  4E68 A;  3S0B A;  2I7A A;  1KSO A;  1B8R A;  2G2B A;  1OW4 A;  1QVI Z;  3GK2 A;  1J7P A;  3JVT C;  2BE6 A;  3IVT A;  3KEV A;  1NX1 A;  2JC2 A;  2KI4 B;  3L4L A;  3SG5 A;  4N5X A;  1A2X A;  1Q80 A;  2ISD A;  1XA5 A;  1XVJ A;  2LP2 A;  3UO9 A;  1MXL C;  1IQ3 A;  3I5G B;  5GQQ C;  4UPG A;  4ZCU A;  1S6I A;  2WC5 A;  1N2D A;  1K8U A;  2JT8 A;  4MVF A;  3M0W A;  3WHT B;  4ORC B;  3VRO A;  2AMI A;  1J1E A;  1KFX L;  2KGB C;  4MSP A;  2F2P A;  3HCM A;  3B87 A;  2NXQ A;  4U8D A;  2JXL A;  4M2P A;  1F55 A;  1A29 A;  1DJY A;  3NSI A;  4CID A;  1CB1 A;  1SRA A;  1BJF A;  1N0Y A;  2OTG C;  4FQT A;  3VRQ A;  3BUM B;  2KHN A;  1BOD A;  1QX7 A;  4ZCV A;  1NUB A;  1AVS A;  1YR5 A;  2ZN9 A;  2GV5 A;  2K7O A;  1JF2 A;  5AAN A;  5KU1 A;  1SR6 B;  2QPT A;  1G4Y R;  3O2P A;  2BE4 A;  1YVH A;  1UHH A;  2LVJ A;  2F2O A;  1LA0 A;  1YX8 A;  1XYD A;  4I5N B;  3R1P A;  4OV2 A;  2ZRS A;  1M39 A;  3I5H B;  4QJ3 B;  1C3Y A;  1MHO A;  2LLU A;  2WC8 A;  2JU0 A;  2ZFD A;  1R6P A;  2ZN8 A;  3FE9 A;  2LMV A;  2HF5 A;  3D75 A;  1NSH A;  1ZUZ A;  1SMG A;  2JUL A;  3OB1 B;  1C07 A;  1CLB A;  2FJY A;  3DVK A;  1ALV A;  2NCO A;  1SCM B;  2BCX A;  3DVM A;  1KFX S;  3SG6 A;  1AK8 A;  4OVN F;  2SCP A;  5FI7 A;  3BUN B;  1NP8 A;  2MRD A;  3KPX A;  2Y1M A;  3O4Y A;  2GGM A;  3EKH A;  4A4B A;  4PT1 A;  3WXA A;  1OOG A;  3SG2 A;  4XJK B;  2BCB A;  4XJK A;  2JNX A;  1FF1 A;  4FTG A;  2PAS A;  1QAS A;  1MF8 B;  2EC6 B;  2MHH A;  2K2A A;  2F8P A;  2CBL A;  3BJH A;  3D78 A;  1VRK A;  2OS8 B;  4ORB B;  4HRG A;  1L2O C;  5I94 A;  2PQL A;  3DYE A;  1OOI X;  4MRY A;  4TNC A;  1C3Z A;  2BAP A;  4YGD B;  3O6B A;  4WQ3 A;  5IBW A;  1OMV A;  2KOT A;  1TUJ A;  1G8I A;  1PSR A;  1A03 A;  2KAV A;  1MWN A;  2G9B A;  2L98 A;  3SS4 A;  2KYC A;  2KAY A;  3NXA A;  1KFU L;  4GBA A;  3K21 A;  1S36 A;  1S5G Y;  1DJZ A;  2QAC A;  3WNX B;  4YGA A;  1Z4H A;  5AXI A;  5ER4 X;  5I2Q A;  2CNP A;  2JPO A;  1AJ4 A;  1NCZ A;  3L4A A;  1B1G A;  2Q4U A;  4WQ2 A;  3PLF B;  2Y5I A;  1OOJ A;  4M2Q A;  5J3X A;  2JQ6 A;  4F7F A;  2JRF A;  3I5F C;  2LVV A;  4BY5 A;  1X02 A;  4ICB A;  1K9K A;  4PE0 A;  1NPQ A;  2QEO A;  3NGV A;  1A4P A;  1C7V A;  1QV1 A;  2KPH A;  1WRK A;  1OOH A;  3CZT X;  3OBV A;  1YRU B;  2A4J A;  1XFU O;  3EVU A;  1SW8 A;  2BL0 B;  1K2H A;  1E8A A;  2NLN A;  2QEH A;  1A75 B;  2L4I A;  1A75 A;  4IJ7 A;  3PN7 C;  4INW A;  3A4U B;  1WLZ A;  1DMO A;  2BCA A;  1MR8 A;  2KBM A;  2BKI B;  1B7T Z;  1KFU S;  1YUT A;  1IKU A;  1WY9 A;  3BQ3 A;  1BLQ A;  1UP5 A;  2F3Y A;  2PVB A;  2MA2 A;  2LP3 A;  3JTD C;  2L5Y A;  3O4X A;  3ICB A;  4PE4 A;  5K89 A;  3SS5 A;  5ER5 A;  2L5X B;  4CFQ A;  4N1F A;  4DUQ A;  1JWD A;  1XK4 C;  1Y6W A;  2KSP A;  2MBX A;  4C0J A;  1K96 A;  4GUK A;  1DF0 B;  2O5G A;  1DF0 A;  2EGD A;  1YRT B;  2BEC A;  1M63 B;  4A4C A;  2M29 A;  1XO5 A;  4DRW A;  1ZMZ A;  4FQO A;  2H61 A;  1QS7 A;  2KLD A;  1DJX A;  3NSL A;  4GPL B;  1TIZ A;  4NDD A;  5F6T A;  1M45 A;  5AFP A;  1TNX A;  4L9M A;  1WLM A;  1CFD A;  1OQP A;  2LLS A;  2YGU A;  3SS3 A;  1PRW A;  4N1G A;  1QX2 A;  1NWD A;  4MBE A;  4P5O E;  2WCJ A;  1KQM C;  3CGA A;  4PDZ A;  3FE8 A;  1W9Z A;  2K0J A;  4MLW A;  1BU3 A;  1FI6 A;  1NYA A;  1AP4 A;  5DKR A;  4DCK A;  1FI5 A;  3PFV A;  5D7F A;  2K7B A;  1DT7 B;  1DJW A;  2LM5 A;  3H4S E;  4PCW A;  3PJI A;  3LK1 A;  1NCX A;  1ZFS A;  1B47 A;  4QJ4 B;  4JPZ B;  4USL A;  1FW4 A;  1CMF A;  3EK8 A;  4DIR A;  4BY4 A;  1SKT A;  1F4O A;  3SG3 A;  2JOJ A;  1NCY A;  2L4H A;  4IL1 A;  5D69 A;  1HT9 A;  5JOL A;  3VGO A;  4MZK A;  2V53 A;  1F54 A;  3R1O A;  2KFF A;  2KI4 C;  1S1E A;  3CZ1 A;  1V1G A;  2H2K A;  1G33 A;  4PHN A;  1J7R A;  3IF7 A;  1KK7 Y;  1LVC D;  1AHR A;  2WCK A;  3I5G C;  3RLZ A;  3SIB A;  2JWW A;  1F8H A;  1IH0 A;  1LKJ A;  1OE9 B;  1RRO A;  3VRN A;  5AEQ A;  3LK0 A;  5I2O A;  5HKW A;  4NQG A;  5KSZ A;  1BOC A;  5BPJ A;  2JT0 A;  4HSZ A;  1RJV A;  5I2L A;  1QJT A;  2WC6 A;  1TTX A;  1QWV A;  2KNE A;  2L0P A;  3D10 A;  2LVK A;  3NSO A;  1IIO A;  1SBJ A;  3CYZ A;  1XFV O;  1WRL A;  1V1F A;  2LUC A;  1SR6 C;  4YI9 A;  1LA3 A;  1GJY A;  2EHB A;  1ORG A;  1B8L A;  2NZ0 A;  3OX5 A;  3S0G A;  5B8I B;  2DOQ A;  1M31 A;  1CLM A;  1AJ5 A;  1M46 A;  3FE6 A;  1S6C A;  2K8M B;  2D8N A;  1D1O A;  3DXL A;  1FPW A;  3DF0 B;  2L2C A;  3DF0 A;  3OP0 A;  3TS5 B;  2M8U A;  3B6X A;  1KK7 Z;  1RWY A;  1J55 A;  1K9U A;  1XFX O;  4GGF A;  5KTY A;  4PE1 A;  1JF0 A;  1DTL A;  1R2U A;  2E30 A;  1CFF A;  1S6J A;  3B86 A;  3LCP C;  1BG1 A;  1SCM C;  1TNQ A;  3D73 A;  4HRH A;  4AQJ A;  2MLF C;  5HL1 A;  1EG3 A;  2LC5 A;  2M7L A;  3IQQ A;  3UNW A;  4HRE E;  3V2L A;  4CLN A;  3OGN A;  2LMU A;  3AKA A;  4KYN A;  1XFZ O;  3BYA A;  2AUC A;  2TN4 A;  2EC6 C;  1CM4 A;  3D74 A;  4NDB A;  2OS8 C;  2LLT A;  1CMG A;  2E6W A;  4MN0 A;  4ETO A;  5CSI A;  3E3R A;  2B1U A;  2CXJ A;  3CAB A;  4JD9 A;  1IG5 A;  2JTZ A;  2O60 A;  1SNL A;  1GGW A;  3CTN A;  2P70 A;  1BMO A;  1TOP A;  2I18 A;  3LLE A;  4INX A;  1CDL A;  2R2I A;  1PSB A;  4YI8 A;  3CR4 X;  1WDC B;  1YVL A;  2F3Z A;  3BFA A;  2LNK A;  2VRG A;  4C0L A;  2LMT A;  2WCM A;  3VB1 A;  1Z2C B;  3EG5 B;  1MUX A;  4PAL A;  1DJH A;  1CLL A;  2P71 A;  1EXR A;  3EVR A;  4YRU A;  2ZND A;  4OZD A;  3OX6 A;  5D3O A;  5FI2 A;  1SL9 A;  2NCP A;  4YBH B;  1DJI A;  2QEV A;  1BT6 A;  2BBM A;  4F0Z B;  2LAP A;  3CZ0 A;  4MZL A;  2K7C A;  1SL7 A;  1KK8 B;  2JNF A;  4GAO A;  3VRP A;  1KQV A;  3BUO B;  1NIW A;  1REC A;  5HKY A;  5CSJ A;  1C7W A;  2FOT A;  3RZS A;  1ZOT B;  1S5G Z;  2I2R E;  5I8N A;  1EH2 A;  3O78 A;  2WCE A;  2MAZ A;  2HPS A;  4YGB B;  1GM0 A;  3GK4 X;  2BL0 C;  2AAO A;  2MLE C;  3VRR A;  1U5I B;  2LV7 A;  1U5I A;  3FIA A;  4ORA B;  2KGR A;  3DD4 A;  3I5I B;  3ZWH A;  1CNP A;  2FCE A;  2PRU A;  1FBV A;  1UHN A;  4OCI A;  2M7N A;  3NSK A;  3TDU A;  1F4Q A;  1DGV A;  1ODB A;  1SCV A;  2KYF A;  1CDN A;  3EKJ A;  1DGU A;  1OZS A;  2QEB A;  1W7J B;  1QLK A;  3K1E A;  3TDI A;  4CFR A;  1KWO B;  5HLO A;  4R1E A;  1QIW A;  3S0E A;  1K93 D;  4I5J A;  3CWG A;  3CR5 X;  1OZO A;  2H61 C;  3TUY C;  5JJG A;  1DQE A;  1YUR A;  2L51 A;  1CFP A;  4AQI A;  1KQM B;  1S26 D;  1MXE A;  2SAS A;  1EL4 A;  1T14 A;  2LUX A;  3JVT B;  3EK7 A;  1TWO A;  4MEW A;  1CDP A;  1RFJ A;  3S0A A;  1BF5 A;  1B4C A;  3BUW B;  4M2O A;  3A8R A;  2KBI A;  1XFY O;  1QAT A;  1PK0 D;  2K2F A;  3CZ2 A;  2KFH A;  2M97 A;  2WND A;  1QV0 A;  4YGC B;  3DY9 A;  3PSR A;  1WRZ A;  3SIA A;  1SPY A;  1DC1 A;  2WOR A;  3BOW B;  1SL8 A;  1LIN A;  3BOW A;  3CR2 A;  1BR4 B;  2PYQ A;  4OR9 B;  3NHI A;  1XFW O;  1ZAC A;  2JTT A;  1TNW A;  4CPV A;  4DS7 A;  1OMD A;  3N7H A;  3NHT A;  2WCF A;  1GGZ A;  2QDI A;  1KCY A;  3B88 A;  1J7Q A;  2OTG B;  2KI6 C;  1UHK A;  4GNK B;  1IQ5 A;  1JBA A;  1S3P A;  2Q91 A;  2KDH A;  3KHE A;  1HQV A;  2K61 A;  1LXF C;  1AUI B;  1UHJ A;  2LAN A;  4OKH A;  1K94 A;  2P6B B;  3B7A A;  3EK4 A;  4I5K A;  1NX2 A;  2HQW A;  3SJS A;  1YUU A;  5PAL A;  2JZI A;  2M1K B;  3CDN A;  2PSR A;  3QME A;  3BUX B;  3WHU B;  1CFC A;  2JXC A;  2HQ8 A;  1JC2 A;  3DVE A;  1IJ6 A; 
#chains in the Genus database with same CATH homology
 4I5L B;  4AOM A;  1N65 A;  1JUO A;  1SY9 A;  3F45 A;  1EJ3 A;  4PHJ A;  2LE9 B;  4C0K A;  1KSM A;  1QTX A;  2L2E A;  3FWC A;  1NX0 A;  3I5H C;  4P2Y B;  1F71 A;  1NX3 A;  4PHK A;  1K9P A;  3TDZ A;  2BBN A;  5CPV A;  1CTR A;  1SK6 D;  2KQ6 A;  2COL B;  2IS9 A;  1EG4 A;  2K7D A;  4PHM A;  3OB2 B;  3EVV A;  1UUS A;  4JQ0 D;  1JFK A;  2JPT A;  1L2O B;  2PAL A;  2ZRT A;  3DVJ A;  3TS5 C;  2F33 A;  2RGI A;  1TCF A;  4GGF C;  1RTP 1;  5AER A;  1RK9 A;  1YX7 A;  1TCO B;  3OHM B;  1BR1 B;  4WRI A;  3AAJ A;  4MZJ A;  4D1E A;  4NDC A;  1QXP A;  2LHL A;  2FCD A;  1QX5 B;  3BXK A;  2M0R A;  3KF9 A;  3FS7 A;  1CDM A;  2WOS A;  3AAK A;  2Y1N A;  1PVB A;  2GGZ A;  1DVI A;  3PAT A;  1MQ1 A;  1JSA A;  3TZ1 A;  5DKN A;  2M49 B;  1Y1X A;  1B7T Y;  3I5F B;  5CSF A;  2CTN A;  3SG7 A;  4YGE B;  1JFJ A;  1IJ5 A;  2ZNE A;  3GOF A;  5TNC A;  1F70 A;  4MRX A;  2JT3 A;  1Y0V H;  1W7I B;  2LHI A;  1K95 A;  1OSA A;  2LVI A;  2L50 A;  1Y1A A;  1WDC C;  1YUS A;  2M3W A;  3PM8 A;  1QLS A;  3IQO A;  3AKB A;  1SYM A;  3ZNI A;  1B9A A;  2KAX A;  3FWB A;  3D0Y B;  2OPO A;  3D0Y A;  1OMR A;  3QRX A;  3PN7 B;  2WCB A;  1H8B A;  1Y1U A;  2LCP A;  1PAL A;  2KFG A;  2KI6 D;  1QIV A;  2CT9 A;  1J7O A;  5HKZ A;  1H4B A;  4Q04 A;  2I94 A;  1IGV A;  2M9G A;  3JTD B;  1K90 D;  1QVI Y;  3RM1 A;  1KK8 C;  3SG4 A;  4PE7 A;  3LL8 B;  1B8C A;  1L7Z A;  2Y4Q A;  4GGN A;  5G08 A;  3HX4 A;  1PVA A;  1XK4 A;  3CS1 A;  1J1D A;  3GK1 A;  1IRJ A;  1CM1 A;  5HLV A;  4JWQ A;  1ALW A;  1UWO A;  2FJU B;  1UHI A;  2CCM A;  2HET A;  1UUR A;  1PUL A;  3I5I C;  3PAL A;  1GQM A;  4XYN A;  1TN4 A;  5DKQ A;  2PMY A;  1IWQ A;  2ZKM X;  3CLN A;  2M1U A;  5HYD A;  3C1V A;  2KQY A;  3KO0 A;  5CSN A;  1CKK A;  3TUY B;  4GFT A;  1YTZ C;  1TRF A;  2MJW B;  1KWO C;  1DJG A;  3MSE B;  2BKH B;  1TNP A;  5FYX A;  4QJ5 B;  4E68 A;  2I7A A;  1KSO A;  1B8R A;  2G2B A;  1QVI Z;  3GK2 A;  1J7P A;  3JVT C;  2BE6 A;  3KEV A;  1NX1 A;  2JC2 A;  2KI4 B;  3SG5 A;  4N5X A;  1A2X A;  1Q80 A;  2ISD A;  1XA5 A;  1XVJ A;  2LP2 A;  1MXL C;  1IQ3 A;  3I5G B;  5GQQ C;  4UPG A;  4ZCU A;  1S6I A;  1N2D A;  1K8U A;  2JT8 A;  4MVF A;  3M0W A;  3WHT B;  4ORC B;  3VRO A;  2AMI A;  1J1E A;  1KFX L;  2KGB C;  4MSP A;  2F2P A;  3HCM A;  2NXQ A;  4U8D A;  2JXL A;  4M2P A;  1F55 A;  1A29 A;  1DJY A;  3NSI A;  4CID A;  1CB1 A;  1SRA A;  1BJF A;  1N0Y A;  2OTG C;  3VRQ A;  3BUM B;  2KHN A;  1BOD A;  1QX7 A;  4ZCV A;  1NUB A;  1AVS A;  1YR5 A;  2ZN9 A;  2GV5 A;  2K7O A;  1JF2 A;  5AAN A;  5KU1 A;  1SR6 B;  2QPT A;  1G4Y R;  3O2P A;  2BE4 A;  1YVH A;  1UHH A;  2LVJ A;  2F2O A;  1LA0 A;  1YX8 A;  1XYD A;  4I5N B;  4OV2 A;  2ZRS A;  1M39 A;  3I5H B;  4QJ3 B;  1MHO A;  2LLU A;  2WC8 A;  2JU0 A;  2ZFD A;  1R6P A;  2ZN8 A;  2LMV A;  2HF5 A;  1NSH A;  1ZUZ A;  1SMG A;  2JUL A;  3OB1 B;  1C07 A;  1CLB A;  3DVK A;  1ALV A;  2NCO A;  1SCM B;  2BCX A;  3DVM A;  1KFX S;  3SG6 A;  1AK8 A;  4OVN F;  2SCP A;  3BUN B;  1NP8 A;  2MRD A;  3KPX A;  2Y1M A;  3O4Y A;  2GGM A;  3EKH A;  4A4B A;  3WXA A;  3SG2 A;  1FF1 A;  4XJK B;  2BCB A;  4XJK A;  2JNX A;  4FTG A;  2PAS A;  1QAS A;  1MF8 B;  2EC6 B;  2MHH A;  2K2A A;  2F8P A;  2CBL A;  4ORB B;  1VRK A;  2OS8 B;  4HRG A;  1L2O C;  4MRY A;  4TNC A;  4YGD B;  3O6B A;  4WQ3 A;  5IBW A;  1OMV A;  2KOT A;  1G8I A;  1PSR A;  1A03 A;  2KAV A;  1MWN A;  2G9B A;  2L98 A;  2KYC A;  2KAY A;  3NXA A;  1KFU L;  4GBA A;  3K21 A;  1S36 A;  1S5G Y;  1DJZ A;  2QAC A;  3WNX B;  4YGA A;  5AXI A;  5ER4 X;  5I2Q A;  2CNP A;  1AJ4 A;  1NCZ A;  1B1G A;  2Q4U A;  4WQ2 A;  3PLF B;  2Y5I A;  1OOJ A;  4M2Q A;  5J3X A;  2JQ6 A;  2JRF A;  3I5F C;  2LVV A;  4BY5 A;  1X02 A;  4ICB A;  1K9K A;  4PE0 A;  1NPQ A;  1A4P A;  1C7V A;  1QV1 A;  1WRK A;  3CZT X;  1YRU B;  2A4J A;  1XFU O;  3EVU A;  1SW8 A;  2BL0 B;  1K2H A;  1E8A A;  2NLN A;  1A75 B;  2L4I A;  1A75 A;  3PN7 C;  3A4U B;  1WLZ A;  1DMO A;  2BCA A;  1MR8 A;  2KBM A;  2BKI B;  1B7T Z;  1KFU S;  1YUT A;  1IKU A;  1WY9 A;  3BQ3 A;  1BLQ A;  1UP5 A;  2F3Y A;  2PVB A;  2MA2 A;  2LP3 A;  3JTD C;  3ICB A;  4PE4 A;  5K89 A;  5ER5 A;  2L5X B;  4CFQ A;  4N1F A;  4DUQ A;  1JWD A;  1XK4 C;  1Y6W A;  2KSP A;  2MBX A;  4C0J A;  1K96 A;  4GUK A;  1DF0 B;  2O5G A;  1DF0 A;  2EGD A;  1YRT B;  2BEC A;  1M63 B;  4A4C A;  2M29 A;  1XO5 A;  4DRW A;  1ZMZ A;  4FQO A;  2H61 A;  1QS7 A;  4GPL B;  1DJX A;  3NSL A;  4NDD A;  1TIZ A;  5F6T A;  5AFP A;  1M45 A;  1TNX A;  4L9M A;  1WLM A;  1CFD A;  1OQP A;  2LLS A;  1PRW A;  4N1G A;  1QX2 A;  1NWD A;  4MBE A;  4P5O E;  1KQM C;  3CGA A;  4PDZ A;  2K0J A;  4MLW A;  1BU3 A;  1FI6 A;  1NYA A;  1AP4 A;  5DKR A;  4DCK A;  1FI5 A;  3PFV A;  5D7F A;  2K7B A;  1DT7 B;  1DJW A;  2LM5 A;  3H4S E;  4PCW A;  3LK1 A;  1NCX A;  1ZFS A;  1B47 A;  4QJ4 B;  4JPZ B;  4USL A;  1FW4 A;  1CMF A;  3EK8 A;  4DIR A;  4BY4 A;  1SKT A;  1F4O A;  3SG3 A;  2JOJ A;  1NCY A;  2L4H A;  4IL1 A;  5D69 A;  1HT9 A;  5JOL A;  3VGO A;  4MZK A;  2V53 A;  1F54 A;  2KFF A;  2KI4 C;  1S1E A;  1V1G A;  2H2K A;  1G33 A;  4PHN A;  1J7R A;  3IF7 A;  1KK7 Y;  1LVC D;  1AHR A;  3I5G C;  3RLZ A;  3SIB A;  2JWW A;  1F8H A;  1IH0 A;  1LKJ A;  1OE9 B;  1RRO A;  3VRN A;  5AEQ A;  3LK0 A;  5I2O A;  5HKW A;  4NQG A;  5KSZ A;  1BOC A;  5BPJ A;  2JT0 A;  4HSZ A;  1RJV A;  5I2L A;  1QJT A;  1TTX A;  2KNE A;  2L0P A;  3D10 A;  2LVK A;  3NSO A;  1SBJ A;  1XFV O;  1WRL A;  1V1F A;  2LUC A;  1SR6 C;  4YI9 A;  1LA3 A;  1GJY A;  2EHB A;  2NZ0 A;  1B8L A;  3OX5 A;  5B8I B;  2DOQ A;  1M31 A;  1CLM A;  1AJ5 A;  1M46 A;  1S6C A;  2K8M B;  2D8N A;  1D1O A;  1FPW A;  3DF0 B;  3DF0 A;  3OP0 A;  3TS5 B;  2M8U A;  1KK7 Z;  1RWY A;  1J55 A;  1K9U A;  1XFX O;  4GGF A;  5KTY A;  4PE1 A;  1JF0 A;  1DTL A;  1R2U A;  2E30 A;  1CFF A;  1S6J A;  3LCP C;  1BG1 A;  1SCM C;  1TNQ A;  4HRH A;  4AQJ A;  2MLF C;  1EG3 A;  2LC5 A;  2M7L A;  3IQQ A;  4CLN A;  4HRE E;  2LMU A;  3AKA A;  1XFZ O;  3BYA A;  2AUC A;  2TN4 A;  2EC6 C;  1CM4 A;  4NDB A;  2OS8 C;  2LLT A;  1CMG A;  2E6W A;  4MN0 A;  4ETO A;  5CSI A;  3E3R A;  2B1U A;  2CXJ A;  1IG5 A;  2JTZ A;  2O60 A;  1SNL A;  1GGW A;  3CTN A;  1BMO A;  1TOP A;  2I18 A;  3LLE A;  1CDL A;  2R2I A;  1PSB A;  4YI8 A;  3CR4 X;  1WDC B;  1YVL A;  2F3Z A;  2LNK A;  2VRG A;  4C0L A;  2LMT A;  1MUX A;  4PAL A;  1DJH A;  1CLL A;  1EXR A;  3EVR A;  4YRU A;  2ZND A;  3OX6 A;  1SL9 A;  2NCP A;  4YBH B;  1DJI A;  1BT6 A;  2BBM A;  4F0Z B;  2LAP A;  4MZL A;  2K7C A;  1SL7 A;  1KK8 B;  2JNF A;  4GAO A;  3VRP A;  1KQV A;  3BUO B;  1NIW A;  1REC A;  5HKY A;  5CSJ A;  1C7W A;  2FOT A;  1ZOT B;  1S5G Z;  2I2R E;  5I8N A;  1EH2 A;  3O78 A;  2WCE A;  2MAZ A;  2HPS A;  4YGB B;  3GK4 X;  2BL0 C;  2AAO A;  2MLE C;  3VRR A;  1U5I B;  2LV7 A;  1U5I A;  3FIA A;  4ORA B;  2KGR A;  3DD4 A;  3I5I B;  3ZWH A;  1CNP A;  2FCE A;  2PRU A;  1FBV A;  1UHN A;  4OCI A;  2M7N A;  3NSK A;  3TDU A;  1F4Q A;  1DGV A;  1ODB A;  1SCV A;  2KYF A;  1CDN A;  3EKJ A;  1DGU A;  1OZS A;  1W7J B;  1QLK A;  3TDI A;  4CFR A;  1KWO B;  5HLO A;  4R1E A;  1QIW A;  1K93 D;  4I5J A;  3CWG A;  3CR5 X;  1OZO A;  2H61 C;  3TUY C;  5JJG A;  1CFP A;  1YUR A;  2L51 A;  4AQI A;  1KQM B;  1S26 D;  1MXE A;  2SAS A;  1EL4 A;  2LUX A;  3JVT B;  3EK7 A;  4MEW A;  1CDP A;  1RFJ A;  1BF5 A;  1B4C A;  3BUW B;  4M2O A;  3A8R A;  2KBI A;  1XFY O;  1QAT A;  1PK0 D;  2K2F A;  4YGC B;  2KFH A;  2M97 A;  2WND A;  1QV0 A;  3SIA A;  3PSR A;  1WRZ A;  1SPY A;  2WOR A;  3BOW B;  1SL8 A;  1LIN A;  3BOW A;  3CR2 A;  1BR4 B;  4OR9 B;  1XFW O;  1ZAC A;  2JTT A;  1TNW A;  4CPV A;  4DS7 A;  1OMD A;  2WCF A;  1GGZ A;  1KCY A;  1J7Q A;  2OTG B;  2KI6 C;  1UHK A;  4GNK B;  1IQ5 A;  1JBA A;  1S3P A;  2Q91 A;  2KDH A;  3KHE A;  1HQV A;  2K61 A;  1LXF C;  1AUI B;  1UHJ A;  2LAN A;  4OKH A;  1K94 A;  2P6B B;  4I5K A;  3EK4 A;  1NX2 A;  2HQW A;  3SJS A;  1YUU A;  5PAL A;  2JZI A;  2M1K B;  3WHU B;  2PSR A;  3BUX B;  1CFC A;  2JXC A;  2HQ8 A;  1JC2 A;  3DVE A;  1IJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...