4DIRA

2.6 angstrom x-ray structure of human ca(2+)-s100a5
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
78
Chain Sequence
TPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A5
publication title Target-binding to S100A5 changes Ca(2+)-binding affinity and dynamics.
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 78
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dirA00
1Y1XA 4ICBA 3NSKA 2GGMA 2LHLA 2LMTA 1TIZA 2Y5IA 1J1DA 2MAZA 3SG3A 1OZOA 1H8BA 2KQYA 3H4SE 2K7CA 1A75B 2MLEC 2QPTA 3LK1A 1ZFSA 1ALVA 1K9PA 3KEVA 3VGOA 2ZNEA 1EG3A 1TTXA 1S6CA 1TNXA 1N2DA 5DKRA 3FWCA 5HYDA 1F8HA 3NSOA 1NCYA 2JT8A 4YGAA 4GAOA 3OB2B 1XK4A 3SG4A 3TS5B 1B4CA 4N1FA 5AXIA 1AUIB 2OTGB 1RROA 2BBNA 3O78A 2H2KA 1WDCC 1BF5A 3BXKA 1B7TZ 1EXRA 1YUTA 1NPQA 2KAXA 2KI6C 2WNDA 5ER5A 3SG5A 4ORCB 1E8AA 1S26D 3ZWHA 2OTGC 1Y1UA 4MZKA 2F3YA 3EVVA 4AQJA 1LA3A 2M7LA 3FWBA 1Y0VH 1G8IA 2M1UA 3BYAA 4C0KA 1JWDA 4CFRA 1SYMA 1MF8B 1RFJA 1LINA 3OX6A 1IRJA 1QS7A 1TNQA 1NCXA 1QIWA 1BLQA 2Q91A 1B9AA 1OMRA 4ORAB 4PHMA 4PDZA 5JJGA 5DKNA 1CMFA 2BL0C 3IQOA 1TRFA 5CSIA 4PALA 4L9MA 1J7QA 5KSZA 5DKQA 4PE7A 4PE4A 1IH0A 1PULA 2EHBA 2L4IA 2L2EA 2MJWB 3BQ3A 3PALA 3PATA 4GPLB 1M39A 1XFXO 1QATA 4OV2A 4YBHB 1XFWO 2LCPA 2M9GA 1JFJA 4MRXA 4DIRA 2LP3A 2R2IA 1YR5A 2COLB 1BJFA 3FS7A 4UPGA 1BMOA 2M0RA 4PE0A 4HREE 3BOWA 2LLTA 2F33A 1W7IB 1AP4A 1PVAA 2FCDA 3WHUB 2JPTA 2K2FA 5CSJA 1DF0B 3AAKA 2K2AA 2LVVA 3PFVA 1F4OA 4MVFA 2HQ8A 1AJ4A 1SBJA 4AOMA 4CIDA 3DVKA 1YX7A 3PLFB 1QASA 1EL4A 2H61A 1DT7B 3WXAA 1NYAA 1XFVO 1CFDA 2B1UA 1RK9A 1QIVA 2KI4B 2LP2A 1F70A 1ZOTB 4OKHA 5IBWA 2GGZA 2FJUB 1B8RA 2KNEA 1TN4A 1NX2A 2KI4C 2JULA 4OR9B 1PSRA 2OPOA 3CLNA 1OMDA 1SW8A 1F54A 1IQ5A 1DJXA 1B47A 2A4JA 3D0YB 4N5XA 2Y4QA 2JTTA 5I2LA 4MLWA 2WCBA 2WC8A 1SL7A 3MSEB 1ZACA 2M3WA 1KFXS 2E30A 4M2PA 5G08A 1V1GA 1NX1A 2O5GA 1OOJA 2JWWA 2JXLA 1VRKA 2KSPA 1IGVA 1KK8B 3EKHA 3TUYB 1MWNA 1S36A 2P6BB 3JTDB 1PSBA 4GFTA 3BUOB 2F3ZA 1OQPA 3OP0A 4HRHA 1YURA 1PVBA 1WLMA 4N1GA 1KK8C 4YGBB 1KQMB 1J7PA 1RTP1 1B8CA 2M49B 1CFFA 3JTDC 2K7DA 1SKTA 3KHEA 4MRYA 4PE1A 1NSHA 1WRKA 1SL9A 1KQMC 1LA0A 2HPSA 2JNXA 3BUNB 3PM8A 5PALA 1TOPA 2I18A 1JBAA 1ALWA 1S5GZ 4DCKA 1WLZA 4P5OE 2QACA 4ZCUA 1CDNA 3AKBA 4OVNF 4GNKB 1SRAA 4YI9A 3EVRA 2LM5A 2GV5A 3SG2A 3O6BA 2O60A 1N65A 2JZIA 3EVUA 1NIWA 1B7TY 1IWQA 2HF5A 2LHIA 3QRXA 1S3PA 5CPVA 2CTNA 1KK7Z 3KO0A 3O2PA 3GK2A 1KFXL 2ZNDA 5JOLA 2LV7A 4BY4A 1SL8A 3CWGA 1WDCB 2KOTA 2LE9B 4CPVA 2NXQA 3VRRA 5AFPA 4GUKA 1F4QA 2ZFDA 2M1KB 1HQVA 2EC6C 2CCMA 2KBIA 1K9KA 1CKKA 3I5HB 1CLBA 1K94A 4QJ4B 1CDMA 1NUBA 4I5KA 2JNFA 3A4UB 4GGFC 4PHJA 4XYNA 3BUWB 4GBAA 3I5HC 5J3XA 2AUCA 1AJ5A 1QX7A 4R1EA 1JF2A 3VROA 4C0JA 1BT6A 4TNCA 4DRWA 3I5FB 1QTXA 4I5JA 2JQ6A 1JUOA 2FOTA 3SIAA 1QLKA 3JVTB 1CLLA 2K8MB 2KFFA 2KYCA 5ER4X 5AEQA 3CS1A 3I5FC 3DF0B 1FW4A 1N0YA 2TN4A 2BL0B 4ETOA 3DVMA 2PVBA 1GJYA 2RGIA 2F2OA 3JVTC 4YI8A 1M45A 3CR5X 3LL8B 4GGNA 1L7ZA 1LVCD 2BCAA 3WHTB 1J1EA 2KQ6A 1JF0A 3DVJA 2MLFC 4YGDB 5HLOA 2L51A 1NWDA 2KGBC 1OE9B 3SG6A 2CNPA 1KWOB 1IKUA 1SPYA 3NXAA 1YRTB 1PK0D 1K90D 1IJ6A 1UURA 2BBMA 1A4PA 1JC2A 4CFQA 3OB1B 1EH2A 1TNPA 1TNWA 1X02A 2BKHB 1IJ5A 1UHKA 2K0JA 3EK8A 3KPXA 1AK8A 1KWOC 4JWQA 2ZN9A 5D69A 1NCZA 1LKJA 3CGAA 1BR1B 2PMYA 1CB1A 2L0PA 4WRIA 2CT9A 2MA2A 1BOCA 4XJKA 3HX4A 1CDLA 3BUMB 5D7FA 1QJTA 5CSFA 1FI5A 5HLVA 2LMVA 1SMGA 1CMGA 1S6JA 3CZTX 1EG4A 1U5IA 1XK4C 1L2OB 2D8NA 1YUSA 1SR6B 1QV0A 1IG5A 3SJSA 2LUCA 1UHIA 4OCIA 2G2BA 3D10A 1CM4A 1L2OC 2M8UA 1YVHA 1FI6A 1FPWA 4F0ZB 1SR6C 3EK7A 4MZLA 1OZSA 2L5XB 3BUXB 4I5LB 1J7OA 1H4BA 1KFUS 3A8RA 4WQ2A 2CBLA 1A75A 1BR4B 2MRDA 2BKIB 1J7RA 4HSZA 4PCWA 4MEWA 1XO5A 3HCMA 4YGCB 1RJVA 1YTZC 4BY5A 1DMOA 1MQ1A 3ZNIA 2LAPA 3VRNA 2ZKMX 2KBMA 2DOQA 3EK4A 5F6TA 5CSNA 4QJ5B 1NX3A 5KTYA 2JRFA 1DJIA 2FCEA 2IS9A 1S1EA 2F2PA 3ICBA 1V1FA 1ZMZA 2KYFA 3CTNA 3TDIA 1Q80A 2BCXA 3RM1A 1JSAA 2LMUA 2JU0A 4PHNA 1DTLA 2MHHA 2CXJA 5HKYA 1SCMB 1GGWA 3DVEA 2KDHA 3DD4A 3I5GB 3PN7B 2JOJA 4YRUA 1C7WA 3BOWB 1CFCA 1UUSA 1SCMC 2ISDA 1DJWA 1YRUB 1KK7Y 3E3RA 3I5GC 3PN7C 1M63B 4ORBB 1BODA 4C0LA 1KFUL 2LVKA 3VRQA 1S6IA 2KAYA 1C7VA 1AVSA 2MBXA 1QLSA 2NCOA 2ZRSA 2L4HA 2H61C 3SG7A 1R2UA 1YX8A 3SIBA 1D1OA 1DJHA 1K8UA 1OMVA 2EC6B 2KGRA 1A2XA 3CR4X 1GQMA 4A4CA 1NX0A 1PRWA 2NZ0A 1OSAA 4ZCVA 3AKAA 1QVIZ 2BCBA 4I5NB 1GGZA 1DGVA 1CFPA 2AMIA 2I94A 3LLEA 2OS8B 5B8IB 2PRUA 2Q4UA 1KSMA 1YUUA 4MZJA 2JT3A 1CLMA 1WRLA 1MXEA 2OS8C 4JQ0D 1HT9A 1DF0A 5I2QA 3I5IB 1B8LA 3GK4X 2E6WA 5GQQC 4USLA 3OX5A 2K7BA 1DJGA 2JTZA 4FQOA 1UWOA 4NDCA 3I5IC 2JC2A 1YVLA 3TS5C 1DVIA 1KSOA 2L50A 4U8DA 5AERA 1CNPA 3PSRA 1A03A 1XFUO 5I8NA 1K96A 1SY9A 2WORA 1ODBA 3F45A 3VRPA 5I2OA 1MUXA 3NSIA 3D0YA 2HETA 1EJ3A 2M29A 1G4YR 3M0WA 2KAVA 3TDZA 1AHRA 2KHNA 4Q04A 2PASA 1XA5A 1QV1A 1WY9A 1IQ3A 1B1GA 1QX5B 1SK6D 1TCOB 3EKJA 5HKZA 3C1VA 1JFKA 1MR8A 1XFZO 1LXFC 2F8PA 3K21A 4M2OA 4PHKA 5AANA 5K89A 1Y1AA 1K9UA 2KFHA 5KU1A 1K2HA 2I2RE 4NDDA 4DS7A 1FF1A 1G33A 1TCFA 1CTRA 1UHHA 1DGUA 2L98A 2LANA 4P2YB 4IL1A 2AAOA 1BU3A 1M31A 2VRGA 1XYDA 2SCPA 1FBVA 4MSPA 5TNCA 3TZ1A 4CLNA 2JT0A 3OHMB 1XFYO 2LLSA 3CR2A 1K95A 1RECA 1QX2A 1SNLA 3FIAA 1CM1A 2M7NA 1A29A 1F71A 2I7AA 1RWYA 1Y6WA 1CDPA 2KFGA 4MN0A 4YGEB 4M2QA 1K93D 5HKWA 1PALA 2BECA 4DUQA 2PSRA 3IQQA 2PALA 4MBEA 2ZN8A 2V53A 4QJ3B 4AQIA 1DJYA 2JXCA 2BE4A 3NSLA 1XVJA 2LUXA 3GOFA 2WCFA 2LVJA 3GK1A 1MXLC 2K61A 1C07A 1KCYA 3IF7A 2NLNA 4GGFA 1S5GY 3AAJA 1J55A 4NDBA 3WNXB 1UHJA 5BPJA 2NCPA 5FYXA 1WRZA 3TDUA 1ZUZA 4WQ3A 2BE6A 1BG1A 1W7JB 3O4YA 1UHNA 3LCPC 2WOSA 1UP5A 4HRGA 2Y1MA 1KQVA 2LNKA 2LVIA 4E68A 4XJKB 1QXPA 3LK0A 2SASA 4FTGA 2LC5A 4D1EA 2M97A 4NQGA 2ZRTA 3DF0A 1M46A 3RLZA 1SCVA 1DJZA 2Y1NA 1U5IB 2LLUA 3TUYC 2HQWA 3KF9A 2KI6D 1NP8A 2G9BA 2WCEA 2K7OA 4JPZB 1MHOA 1R6PA 1QVIY 2EGDA 4A4BA 1F55A
chains in the Genus database with same CATH superfamily
1Y1XA 4ICBA 3NSKA 2GGMA 2LHLA 2LMTA 1TIZA 2KPHA 1J1DA 1Z2CB 2Y5IA 2MAZA 3SG3A 1OZOA 1H8BA 2KQYA 3H4SE 2K7CA 1A75B 2MLEC 2QPTA 3LK1A 1ZFSA 1ALVA 1K9PA 3KEVA 3VGOA 2ERBA 2ZNEA 1EG3A 1TTXA 2FJYA 1S6CA 1TNXA 1N2DA 5DKRA 3FWCA 5HYDA 1F8HA 3NSOA 1NCYA 2JT8A 1TUJA 4YGAA 4GAOA 3NHIA 3OB2B 1XK4A 1OOIX 3CZ1A 3IVTA 3SG4A 4N1FA 3TS5B 5AXIA 3UO9A 3PJIA 1B4CA 3RZSA 1AUIB 2OTGB 1QWVA 1RROA 2BBNA 3O78A 2H2KA 1WDCC 1BF5A 3BXKA 1B7TZ 1EXRA 1YUTA 1NPQA 2KAXA 2KI6C 2WNDA 5ER5A 3SG5A 4ORCB 1E8AA 1S26D 3ZWHA 2OTGC 1Y1UA 4MZKA 2F3YA 3EVVA 4AQJA 1LA3A 2M7LA 3FWBA 1Y0VH 1G8IA 2M1UA 3BYAA 4C0KA 1JWDA 4CFRA 1SYMA 1MF8B 1RFJA 1LINA 3OX6A 1IRJA 1QS7A 4JD9A 2WC6A 1TNQA 1NCXA 1QIWA 1BLQA 2Q91A 1B9AA 1OMRA 4ORAB 4PHMA 2QEOA 4PDZA 5JJGA 1GM0A 5DKNA 1CMFA 2BL0C 3IQOA 1TRFA 5CSIA 4PALA 4L9MA 1J7QA 5KSZA 5DKQA 4PE7A 4PE4A 1IH0A 1PULA 2EHBA 2L4IA 2L2EA 2MJWB 3BQ3A 3DXLA 3PALA 3PATA 4GPLB 1M39A 1XFXO 1QATA 4OV2A 4YBHB 1XFWO 2LCPA 2M9GA 1JFJA 4MRXA 4DIRA 2LP3A 2R2IA 1YR5A 2COLB 1BJFA 3CDNA 3FS7A 4UPGA 1BMOA 2M0RA 4PE0A 4HREE 3BOWA 2LLTA 2F33A 3D77A 1W7IB 1AP4A 1PVAA 2FCDA 3WHUB 2JPTA 2K2FA 5CSJA 1DF0B 3AAKA 3NHTA 2K2AA 2LVVA 3PFVA 1F4OA 4MVFA 2HQ8A 1AJ4A 1SBJA 4AOMA 4CIDA 3DVKA 1YX7A 3PLFB 1QASA 1EL4A 2H61A 1DT7B 3WXAA 1NYAA 1XFVO 1CFDA 1RK9A 2B1UA 1QIVA 3D75A 2KI4B 2LP2A 4YGBB 1F70A 1ZOTB 4OKHA 1C3ZA 5IBWA 2GGZA 2FJUB 1B8RA 2KNEA 1TN4A 1NX2A 2KI4C 2JULA 4OR9B 1PSRA 2OPOA 3CLNA 1OMDA 1SW8A 1F54A 1IQ5A 1DJXA 1B47A 2A4JA 2L2CA 3D0YB 4N5XA 2Y4QA 2JTTA 5I2LA 4MLWA 2WCBA 2WC8A 1SL7A 3MSEB 1ZACA 2M3WA 1KFXS 2E30A 2L5YA 4M2PA 5G08A 1V1GA 1NX1A 2O5GA 1OOJA 2JWWA 3S0EA 2JXLA 1VRKA 2KSPA 1IGVA 1KK8B 3EKHA 3TUYB 1MWNA 1S36A 2P6BB 1DQEA 3JTDB 1PSBA 4GFTA 3BUOB 1SSEB 2F3ZA 1OQPA 3OP0A 4HRHA 1YURA 1PVBA 1W9ZA 1WLMA 1KK8C 3N7HA 1KQMB 4N1GA 1RTP1 1B8CA 2M49B 3B87A 3SS5A 1J7PA 1CFFA 3JTDC 2K7DA 5FI2A 1SKTA 3KHEA 4MRYA 4PE1A 1NSHA 1WRKA 1SL9A 1KQMC 1LA0A 2HPSA 2JNXA 3BUNB 3PM8A 5PALA 1TOPA 3CZ2A 3B6XA 2I18A 1JBAA 1ALWA 1S5GZ 4DCKA 1WLZA 2K60A 4P5OE 2QACA 1Z4HA 4ZCUA 1CDNA 3AKBA 4OVNF 4GNKB 1SRAA 1TUZA 2WCHA 3S0BA 4YI9A 3EVRA 2LM5A 2GV5A 3SG2A 3O6BA 2O60A 1N65A 2JZIA 3EVUA 1NIWA 1B7TY 1IWQA 2HF5A 2LHIA 3QRXA 1S3PA 5CPVA 2CTNA 1KK7Z 3KO0A 3O2PA 3GK2A 1KFXL 2ZNDA 5JOLA 2LV7A 4BY4A 1SL8A 3CWGA 1WDCB 2KOTA 2LE9B 4CPVA 2NXQA 3VRRA 3VB1A 1C3YA 5AFPA 4GUKA 1F4QA 2GTEA 2ZFDA 2M1KB 1HQVA 2EC6C 2CCMA 2KBIA 1K9KA 1CKKA 3I5HB 1CLBA 1K94A 4QJ4B 1CDMA 1NUBA 4I5KA 2JNFA 3A4UB 4GGFC 4PHJA 4XYNA 3BUWB 4GBAA 3I5HC 4INXA 1TWOA 5J3XA 2AUCA 1AJ5A 1QX7A 4R1EA 1JF2A 3VROA 4C0JA 1BT6A 3K1EA 4TNCA 4DRWA 3I5FB 1QTXA 4I5JA 2JQ6A 1JUOA 1LS8A 2FOTA 3CYZA 3SIAA 1QLKA 3JVTB 3UNWA 1CLLA 2K8MB 2KFFA 2KYCA 3L4AA 5ER4X 5AEQA 3CS1A 3I5FC 3DF0B 1FW4A 1N0YA 2TN4A 2BL0B 4ETOA 3DVMA 2PVBA 1GJYA 2RGIA 2F2OA 3JVTC 4YI8A 1M45A 3CR5X 3LL8B 4GGNA 5HL1A 2WCLA 1L7ZA 1LVCD 2BCAA 3WHTB 1J1EA 2KQ6A 1JF0A 3DVJA 2MLFC 4YGDB 5HLOA 2L51A 1NWDA 2KGBC 1OE9B 3SG6A 2CNPA 1KWOB 2PQLA 1IKUA 1SPYA 3NXAA 1YRTB 1PK0D 1K90D 1IJ6A 1UURA 1XFRA 1A4PA 2BBMA 4CFQA 1JC2A 3OB1B 1EH2A 1TNPA 1TNWA 1X02A 2BKHB 1IJ5A 1UHKA 2K0JA 3B7AA 3EK8A 3KPXA 1AK8A 1KWOC 4JWQA 2ZN9A 5D69A 1NCZA 1LKJA 3CGAA 1BR1B 2PMYA 1CB1A 2L0PA 2QEBA 4FQTA 4WRIA 1T14A 2CT9A 2MA2A 1BOCA 4XJKA 3HX4A 1CDLA 3BUMB 5D7FA 1QJTA 5CSFA 1FI5A 5HLVA 2LMVA 1SMGA 3S0FA 1CMGA 1P28A 1S6JA 2P71A 3CZTX 1EG4A 1ORGA 1U5IA 1XK4C 1L2OB 2D8NA 1YUSA 1SR6B 2BNXA 1QV0A 3OBVA 1IG5A 3D74A 3SJSA 2LUCA 3SS3A 1UHIA 4JKTA 4OCIA 2G2BA 3D10A 1CM4A 1L2OC 2M8UA 3DYEA 3S0AA 1YVHA 1FI6A 1FPWA 4F0ZB 1SR6C 3EK7A 4MZLA 1OZSA 2L5XB 3BUXB 4I5LB 1J7OA 1H4BA 1KFUS 3A8RA 4WQ2A 2CBLA 1A75A 3DY9A 1BR4B 2MRDA 2QEVA 3BFAA 2BKIB 1J7RA 3FE8A 4HSZA 4PCWA 4MEWA 1XO5A 3HCMA 3FE9A 1IIOA 4YGCB 3D78A 1RJVA 1YTZC 4BY5A 1DMOA 1MQ1A 2BAPA 1OOGA 4IJ7A 3ZNIA 2LAPA 1OOFA 3VRNA 2ZKMX 3O4XA 2KBMA 2DOQA 3EK4A 5F6TA 5CSNA 4QJ5B 1NX3A 5KTYA 2JRFA 1DJIA 2FCEA 2IS9A 1S1EA 2QDIA 2F2PA 3ICBA 1V1FA 1ZMZA 2KYFA 3CTNA 3CZ0A 3TDIA 1Q80A 2BCXA 3RM1A 1JSAA 2LMUA 2JU0A 4PHNA 1DTLA 2MHHA 2CXJA 5HKYA 3NGVA 1SCMB 4PT1A 1GGWA 3DVEA 2KDHA 3DD4A 3I5GB 3PN7B 2JOJA 4OZDA 4YRUA 1C7WA 2KLDA 3BOWB 1CFCA 1UUSA 1SCMC 2ISDA 1DJWA 1YRUB 1KK7Y 3E3RA 3I5GC 3PN7C 1M63B 1OW4A 4ORBB 1BODA 4C0LA 1KFUL 2LVKA 3VRQA 1S6IA 2KAYA 1C7VA 1AVSA 2MBXA 1QLSA 2NCOA 3R1VA 2ZRSA 2L4HA 2H61C 3SG7A 1R2UA 1YX8A 3SIBA 1D1OA 1DJHA 3S0GA 1K8UA 3L4LA 3OGNA 1OMVA 2EC6B 2KGRA 1A2XA 3CR4X 1GQMA 3QMEA 4A4CA 1NX0A 1PRWA 2NZ0A 1OSAA 5DICA 4ZCVA 3AKAA 2H8VA 1QVIZ 2BCBA 4I5NB 1GGZA 1DGVA 1CFPA 2AMIA 2I94A 3LLEA 2OS8B 5B8IB 2PRUA 2Q4UA 3R72A 1KSMA 1YUUA 4MZJA 2JT3A 1CLMA 3FE6A 1WRLA 1MXEA 2OS8C 4JQ0D 1HT9A 1DF0A 5I2QA 3R1OA 3I5IB 1B8LA 3GK4X 2E6WA 5GQQC 3CABA 3OX5A 2K7BA 1DJGA 2JTZA 2PYQA 1UWOA 4FQOA 4NDCA 4USLA 5EL2A 3I5IC 2JC2A 1YVLA 3TS5C 1DVIA 1KSOA 2L50A 4U8DA 5AERA 1CNPA 1DELA 3PSRA 1A03A 1XFUO 5I8NA 1K96A 1SY9A 2WORA 1ODBA 3F45A 3VRPA 5I2OA 1MUXA 3NSIA 3D0YA 2HETA 1EJ3A 3BFBA 2M29A 1G4YR 3M0WA 2KAVA 3TDZA 1AHRA 2KHNA 4Q04A 2PASA 1XA5A 1QV1A 1WY9A 1IQ3A 4KYNA 2WCKA 3L47A 1B1GA 1QX5B 3DZTA 1SK6D 1TCOB 3EKJA 5HKZA 3C1VA 1JFKA 1MR8A 1XFZO 1LXFC 2F8PA 3K21A 4M2OA 4PHKA 5AANA 3SS4A 5K89A 1Y1AA 3PM2A 3EG5B 5FI6A 1K9UA 1DEKA 2KFHA 5KU1A 1K2HA 2I2RE 5FI7A 5I94A 2P70A 4NDDA 4DS7A 1G33A 1FF1A 1TCFA 1CTRA 1UHHA 1DGUA 2L98A 2QEHA 2LANA 4P2YB 4IL1A 2AAOA 3BFHA 2WCJA 1BU3A 1M31A 2VRGA 1XYDA 3D76A 2SCPA 1FBVA 4MSPA 5TNCA 3TZ1A 2KLEA 4CLNA 3B88A 3D73A 2JT0A 3OHMB 3B86A 3S0DA 1XFYO 2LLSA 3CR2A 1K95A 1RECA 2YGUA 1QX2A 1SNLA 3FIAA 1CM1A 2M7NA 1A29A 1F71A 2I7AA 1RWYA 1Y6WA 1CDPA 2KFGA 4MN0A 4YGEB 5D3OA 1OOHA 4M2QA 1K93D 5HKWA 1PALA 2BECA 4DUQA 2PSRA 3IQQA 2PALA 3Q8IA 4MBEA 3R1PA 2ZN8A 2V53A 4QJ3B 4AQIA 1DJYA 2JXCA 2BE4A 3NSLA 1XVJA 2LUXA 3GOFA 2WCFA 2LVJA 3GK1A 1MXLC 2K61A 1C07A 1KCYA 3IF7A 2NLNA 4GGFA 1S5GY 3AAJA 1J55A 4NDBA 3WNXB 1UHJA 5BPJA 2NCPA 5FYXA 1WRZA 3TDUA 1ZUZA 4WQ3A 2BE6A 1BG1A 1W7JB 3O4YA 1UHNA 3LCPC 2WOSA 1UP5A 4HRGA 2Y1MA 1KQVA 2LNKA 2LVIA 4E68A 4XJKB 4F7FA 2WC5A 1QXPA 3LK0A 2SASA 4FTGA 3V2LA 2LC5A 4D1EA 2M97A 4NQGA 2ZRTA 2JPOA 3DF0A 1M46A 3RLZA 1SCVA 1DJZA 2Y1NA 1U5IB 2WCMA 2LLUA 3TUYC 2HQWA 3BJHA 3KF9A 2KI6D 1NP8A 2G9BA 2WCEA 2K7OA 4JPZB 1MHOA 4INWA 1DC1A 1R6PA 1QVIY 2EGDA 4A4BA 1F55A
chains in the Genus database with same CATH topology
1Y1XA 4ICBA 3NSKA 2GGMA 2LHLA 2LMTA 1TIZA 2Y5IA 1J1DA 2MAZA 3SG3A 1OZOA 1H8BA 2KQYA 3H4SE 2K7CA 1A75B 2MLEC 2QPTA 3LK1A 1ZFSA 1ALVA 1K9PA 3KEVA 3VGOA 2ZNEA 1EG3A 1TTXA 1S6CA 1TNXA 1N2DA 5DKRA 3FWCA 5HYDA 1F8HA 3NSOA 1NCYA 2JT8A 4YGAA 4GAOA 3OB2B 1XK4A 3SG4A 3TS5B 1B4CA 4N1FA 5AXIA 1AUIB 2OTGB 1RROA 2BBNA 3O78A 2H2KA 1WDCC 1BF5A 3BXKA 1B7TZ 1EXRA 1YUTA 1NPQA 2KAXA 2KI6C 2WNDA 5ER5A 3SG5A 4ORCB 1E8AA 1S26D 3ZWHA 2OTGC 1Y1UA 4MZKA 2F3YA 3EVVA 4AQJA 1LA3A 2M7LA 3FWBA 1Y0VH 1G8IA 2M1UA 3BYAA 4C0KA 1JWDA 4CFRA 1SYMA 1MF8B 1RFJA 1LINA 3OX6A 1IRJA 1QS7A 1TNQA 1NCXA 1QIWA 1BLQA 2Q91A 1B9AA 1OMRA 4ORAB 4PHMA 4PDZA 5JJGA 5DKNA 1CMFA 2BL0C 3IQOA 1TRFA 5CSIA 4PALA 4L9MA 1J7QA 5KSZA 5DKQA 4PE7A 4PE4A 1IH0A 1PULA 2EHBA 2L4IA 2L2EA 2MJWB 3BQ3A 3PALA 3PATA 4GPLB 1M39A 1XFXO 1QATA 4OV2A 4YBHB 1XFWO 2LCPA 2M9GA 1JFJA 4MRXA 4DIRA 2LP3A 2R2IA 1YR5A 2COLB 1BJFA 3FS7A 4UPGA 1BMOA 2M0RA 4PE0A 4HREE 3BOWA 2LLTA 2F33A 1W7IB 1AP4A 1PVAA 2FCDA 3WHUB 2JPTA 2K2FA 5CSJA 1DF0B 3AAKA 2K2AA 2LVVA 3PFVA 1F4OA 4MVFA 2HQ8A 1AJ4A 1SBJA 4AOMA 4CIDA 3DVKA 1YX7A 3PLFB 1QASA 1EL4A 2H61A 1DT7B 3WXAA 1NYAA 1XFVO 1CFDA 2B1UA 1RK9A 1QIVA 2KI4B 2LP2A 1F70A 1ZOTB 4OKHA 5IBWA 2GGZA 2FJUB 1B8RA 2KNEA 1TN4A 1NX2A 2KI4C 2JULA 4OR9B 1PSRA 2OPOA 3CLNA 1OMDA 1SW8A 1F54A 1IQ5A 1DJXA 1B47A 2A4JA 3D0YB 4N5XA 2Y4QA 2JTTA 5I2LA 4MLWA 2WCBA 2WC8A 1SL7A 3MSEB 1ZACA 2M3WA 1KFXS 2E30A 4M2PA 5G08A 1V1GA 1NX1A 2O5GA 1OOJA 2JWWA 2JXLA 1VRKA 2KSPA 1IGVA 1KK8B 3EKHA 3TUYB 1MWNA 1S36A 2P6BB 3JTDB 1PSBA 4GFTA 3BUOB 2F3ZA 1OQPA 3OP0A 4HRHA 1YURA 1PVBA 1WLMA 4N1GA 1KK8C 4YGBB 1KQMB 1J7PA 1RTP1 1B8CA 2M49B 1CFFA 3JTDC 2K7DA 1SKTA 3KHEA 4MRYA 4PE1A 1NSHA 1WRKA 1SL9A 1KQMC 1LA0A 2HPSA 2JNXA 3BUNB 3PM8A 5PALA 1TOPA 2I18A 1JBAA 1ALWA 1S5GZ 4DCKA 1WLZA 4P5OE 2QACA 4ZCUA 1CDNA 3AKBA 4OVNF 4GNKB 1SRAA 4YI9A 3EVRA 2LM5A 2GV5A 3SG2A 3O6BA 2O60A 1N65A 2JZIA 3EVUA 1NIWA 1B7TY 1IWQA 2HF5A 2LHIA 3QRXA 1S3PA 5CPVA 2CTNA 1KK7Z 3KO0A 3O2PA 3GK2A 1KFXL 2ZNDA 5JOLA 2LV7A 4BY4A 1SL8A 3CWGA 1WDCB 2KOTA 2LE9B 4CPVA 2NXQA 3VRRA 5AFPA 4GUKA 1F4QA 2ZFDA 2M1KB 1HQVA 2EC6C 2CCMA 2KBIA 1K9KA 1CKKA 3I5HB 1CLBA 1K94A 4QJ4B 1CDMA 1NUBA 4I5KA 2JNFA 3A4UB 4GGFC 4PHJA 4XYNA 3BUWB 4GBAA 3I5HC 5J3XA 2AUCA 1AJ5A 1QX7A 4R1EA 1JF2A 3VROA 4C0JA 1BT6A 4TNCA 4DRWA 3I5FB 1QTXA 4I5JA 2JQ6A 1JUOA 2FOTA 3SIAA 1QLKA 3JVTB 1CLLA 2K8MB 2KFFA 2KYCA 5ER4X 5AEQA 3CS1A 3I5FC 3DF0B 1FW4A 1N0YA 2TN4A 2BL0B 4ETOA 3DVMA 2PVBA 1GJYA 2RGIA 2F2OA 3JVTC 4YI8A 1M45A 3CR5X 3LL8B 4GGNA 1L7ZA 1LVCD 2BCAA 3WHTB 1J1EA 2KQ6A 1JF0A 3DVJA 2MLFC 4YGDB 5HLOA 2L51A 1NWDA 2KGBC 1OE9B 3SG6A 2CNPA 1KWOB 1IKUA 1SPYA 3NXAA 1YRTB 1PK0D 1K90D 1IJ6A 1UURA 2BBMA 1A4PA 1JC2A 4CFQA 3OB1B 1EH2A 1TNPA 1TNWA 1X02A 2BKHB 1IJ5A 1UHKA 2K0JA 3EK8A 3KPXA 1AK8A 1KWOC 4JWQA 2ZN9A 5D69A 1NCZA 1LKJA 3CGAA 1BR1B 2PMYA 1CB1A 2L0PA 4WRIA 2CT9A 2MA2A 1BOCA 4XJKA 3HX4A 1CDLA 3BUMB 5D7FA 1QJTA 5CSFA 1FI5A 5HLVA 2LMVA 1SMGA 1CMGA 1S6JA 3CZTX 1EG4A 1U5IA 1XK4C 1L2OB 2D8NA 1YUSA 1SR6B 1QV0A 1IG5A 3SJSA 2LUCA 1UHIA 4OCIA 2G2BA 3D10A 1CM4A 1L2OC 2M8UA 1YVHA 1FI6A 1FPWA 4F0ZB 1SR6C 3EK7A 4MZLA 1OZSA 2L5XB 3BUXB 4I5LB 1J7OA 1H4BA 1KFUS 3A8RA 4WQ2A 2CBLA 1A75A 1BR4B 2MRDA 2BKIB 1J7RA 4HSZA 4PCWA 4MEWA 1XO5A 3HCMA 4YGCB 1RJVA 1YTZC 4BY5A 1DMOA 1MQ1A 3ZNIA 2LAPA 3VRNA 2ZKMX 2KBMA 2DOQA 3EK4A 5F6TA 5CSNA 4QJ5B 1NX3A 5KTYA 2JRFA 1DJIA 2FCEA 2IS9A 1S1EA 2F2PA 3ICBA 1V1FA 1ZMZA 2KYFA 3CTNA 3TDIA 1Q80A 2BCXA 3RM1A 1JSAA 2LMUA 2JU0A 4PHNA 1DTLA 2MHHA 2CXJA 5HKYA 1SCMB 1GGWA 3DVEA 2KDHA 3DD4A 3I5GB 3PN7B 2JOJA 4YRUA 1C7WA 3BOWB 1CFCA 1UUSA 1SCMC 2ISDA 1DJWA 1YRUB 1KK7Y 3E3RA 3I5GC 3PN7C 1M63B 4ORBB 1BODA 4C0LA 1KFUL 2LVKA 3VRQA 1S6IA 2KAYA 1C7VA 1AVSA 2MBXA 1QLSA 2NCOA 2ZRSA 2L4HA 2H61C 3SG7A 1R2UA 1YX8A 3SIBA 1D1OA 1DJHA 1K8UA 1OMVA 2EC6B 2KGRA 1A2XA 3CR4X 1GQMA 4A4CA 1NX0A 1PRWA 2NZ0A 1OSAA 4ZCVA 3AKAA 1QVIZ 2BCBA 4I5NB 1GGZA 1DGVA 1CFPA 2AMIA 2I94A 3LLEA 2OS8B 5B8IB 2PRUA 2Q4UA 1KSMA 1YUUA 4MZJA 2JT3A 1CLMA 1WRLA 1MXEA 2OS8C 4JQ0D 1HT9A 1DF0A 5I2QA 3I5IB 1B8LA 3GK4X 2E6WA 5GQQC 4USLA 3OX5A 2K7BA 1DJGA 2JTZA 4FQOA 1UWOA 4NDCA 3I5IC 2JC2A 1YVLA 3TS5C 1DVIA 1KSOA 2L50A 4U8DA 5AERA 1CNPA 3PSRA 1A03A 1XFUO 5I8NA 1K96A 1SY9A 2WORA 1ODBA 3F45A 3VRPA 5I2OA 1MUXA 3NSIA 3D0YA 2HETA 1EJ3A 2M29A 1G4YR 3M0WA 2KAVA 3TDZA 1AHRA 2KHNA 4Q04A 2PASA 1XA5A 1QV1A 1WY9A 1IQ3A 1B1GA 1QX5B 1SK6D 1TCOB 3EKJA 5HKZA 3C1VA 1JFKA 1MR8A 1XFZO 1LXFC 2F8PA 3K21A 4M2OA 4PHKA 5AANA 5K89A 1Y1AA 1K9UA 2KFHA 5KU1A 1K2HA 2I2RE 4NDDA 4DS7A 1FF1A 1G33A 1TCFA 1CTRA 1UHHA 1DGUA 2L98A 2LANA 4P2YB 4IL1A 2AAOA 1BU3A 1M31A 2VRGA 1XYDA 2SCPA 1FBVA 4MSPA 5TNCA 3TZ1A 4CLNA 2JT0A 3OHMB 1XFYO 2LLSA 3CR2A 1K95A 1RECA 1QX2A 1SNLA 3FIAA 1CM1A 2M7NA 1A29A 1F71A 2I7AA 1RWYA 1Y6WA 1CDPA 2KFGA 4MN0A 4YGEB 4M2QA 1K93D 5HKWA 1PALA 2BECA 4DUQA 2PSRA 3IQQA 2PALA 4MBEA 2ZN8A 2V53A 4QJ3B 4AQIA 1DJYA 2JXCA 2BE4A 3NSLA 1XVJA 2LUXA 3GOFA 2WCFA 2LVJA 3GK1A 1MXLC 2K61A 1C07A 1KCYA 3IF7A 2NLNA 4GGFA 1S5GY 3AAJA 1J55A 4NDBA 3WNXB 1UHJA 5BPJA 2NCPA 5FYXA 1WRZA 3TDUA 1ZUZA 4WQ3A 2BE6A 1BG1A 1W7JB 3O4YA 1UHNA 3LCPC 2WOSA 1UP5A 4HRGA 2Y1MA 1KQVA 2LNKA 2LVIA 4E68A 4XJKB 1QXPA 3LK0A 2SASA 4FTGA 2LC5A 4D1EA 2M97A 4NQGA 2ZRTA 3DF0A 1M46A 3RLZA 1SCVA 1DJZA 2Y1NA 1U5IB 2LLUA 3TUYC 2HQWA 3KF9A 2KI6D 1NP8A 2G9BA 2WCEA 2K7OA 4JPZB 1MHOA 1R6PA 1QVIY 2EGDA 4A4BA 1F55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1X A;  4ICB A;  3NSK A;  2GGM A;  2LHL A;  2LMT A;  1TIZ A;  2Y5I A;  1J1D A;  2MAZ A;  3SG3 A;  1OZO A;  1H8B A;  2KQY A;  3H4S E;  2K7C A;  1A75 B;  2MLE C;  2QPT A;  3LK1 A;  1ZFS A;  1ALV A;  1K9P A;  3KEV A;  3VGO A;  2ZNE A;  1EG3 A;  1TTX A;  1S6C A;  1TNX A;  1N2D A;  5DKR A;  3FWC A;  5HYD A;  1F8H A;  3NSO A;  1NCY A;  2JT8 A;  4YGA A;  4GAO A;  3OB2 B;  1XK4 A;  3SG4 A;  3TS5 B;  1B4C A;  4N1F A;  5AXI A;  1AUI B;  2OTG B;  1RRO A;  2BBN A;  3O78 A;  2H2K A;  1WDC C;  1BF5 A;  3BXK A;  1B7T Z;  1EXR A;  1YUT A;  1NPQ A;  2KAX A;  2KI6 C;  2WND A;  5ER5 A;  3SG5 A;  4ORC B;  1E8A A;  1S26 D;  3ZWH A;  2OTG C;  1Y1U A;  4MZK A;  2F3Y A;  3EVV A;  4AQJ A;  1LA3 A;  2M7L A;  3FWB A;  1Y0V H;  1G8I A;  2M1U A;  3BYA A;  4C0K A;  1JWD A;  4CFR A;  1SYM A;  1MF8 B;  1RFJ A;  1LIN A;  3OX6 A;  1IRJ A;  1QS7 A;  1TNQ A;  1NCX A;  1QIW A;  1BLQ A;  2Q91 A;  1B9A A;  1OMR A;  4ORA B;  4PHM A;  4PDZ A;  5JJG A;  5DKN A;  1CMF A;  2BL0 C;  3IQO A;  1TRF A;  5CSI A;  4PAL A;  4L9M A;  1J7Q A;  5KSZ A;  5DKQ A;  4PE7 A;  4PE4 A;  1IH0 A;  1PUL A;  2EHB A;  2L4I A;  2L2E A;  2MJW B;  3BQ3 A;  3PAL A;  3PAT A;  4GPL B;  1M39 A;  1XFX O;  1QAT A;  4OV2 A;  4YBH B;  1XFW O;  2LCP A;  2M9G A;  1JFJ A;  4MRX A;  4DIR A;  2LP3 A;  2R2I A;  1YR5 A;  2COL B;  1BJF A;  3FS7 A;  4UPG A;  1BMO A;  2M0R A;  4PE0 A;  4HRE E;  3BOW A;  2LLT A;  2F33 A;  1W7I B;  1AP4 A;  1PVA A;  2FCD A;  3WHU B;  2JPT A;  2K2F A;  5CSJ A;  1DF0 B;  3AAK A;  2K2A A;  2LVV A;  3PFV A;  1F4O A;  4MVF A;  2HQ8 A;  1AJ4 A;  1SBJ A;  4AOM A;  4CID A;  3DVK A;  1YX7 A;  3PLF B;  1QAS A;  1EL4 A;  2H61 A;  1DT7 B;  3WXA A;  1NYA A;  1XFV O;  1CFD A;  2B1U A;  1RK9 A;  1QIV A;  2KI4 B;  2LP2 A;  1F70 A;  1ZOT B;  4OKH A;  5IBW A;  2GGZ A;  2FJU B;  1B8R A;  2KNE A;  1TN4 A;  1NX2 A;  2KI4 C;  2JUL A;  4OR9 B;  1PSR A;  2OPO A;  3CLN A;  1OMD A;  1SW8 A;  1F54 A;  1IQ5 A;  1DJX A;  1B47 A;  2A4J A;  3D0Y B;  4N5X A;  2Y4Q A;  2JTT A;  5I2L A;  4MLW A;  2WCB A;  2WC8 A;  1SL7 A;  3MSE B;  1ZAC A;  2M3W A;  1KFX S;  2E30 A;  4M2P A;  5G08 A;  1V1G A;  1NX1 A;  2O5G A;  1OOJ A;  2JWW A;  2JXL A;  1VRK A;  2KSP A;  1IGV A;  1KK8 B;  3EKH A;  3TUY B;  1MWN A;  1S36 A;  2P6B B;  3JTD B;  1PSB A;  4GFT A;  3BUO B;  2F3Z A;  1OQP A;  3OP0 A;  4HRH A;  1YUR A;  1PVB A;  1WLM A;  4N1G A;  1KK8 C;  4YGB B;  1KQM B;  1J7P A;  1RTP 1;  1B8C A;  2M49 B;  1CFF A;  3JTD C;  2K7D A;  1SKT A;  3KHE A;  4MRY A;  4PE1 A;  1NSH A;  1WRK A;  1SL9 A;  1KQM C;  1LA0 A;  2HPS A;  2JNX A;  3BUN B;  3PM8 A;  5PAL A;  1TOP A;  2I18 A;  1JBA A;  1ALW A;  1S5G Z;  4DCK A;  1WLZ A;  4P5O E;  2QAC A;  4ZCU A;  1CDN A;  3AKB A;  4OVN F;  4GNK B;  1SRA A;  4YI9 A;  3EVR A;  2LM5 A;  2GV5 A;  3SG2 A;  3O6B A;  2O60 A;  1N65 A;  2JZI A;  3EVU A;  1NIW A;  1B7T Y;  1IWQ A;  2HF5 A;  2LHI A;  3QRX A;  1S3P A;  5CPV A;  2CTN A;  1KK7 Z;  3KO0 A;  3O2P A;  3GK2 A;  1KFX L;  2ZND A;  5JOL A;  2LV7 A;  4BY4 A;  1SL8 A;  3CWG A;  1WDC B;  2KOT A;  2LE9 B;  4CPV A;  2NXQ A;  3VRR A;  5AFP A;  4GUK A;  1F4Q A;  2ZFD A;  2M1K B;  1HQV A;  2EC6 C;  2CCM A;  2KBI A;  1K9K A;  1CKK A;  3I5H B;  1CLB A;  1K94 A;  4QJ4 B;  1CDM A;  1NUB A;  4I5K A;  2JNF A;  3A4U B;  4GGF C;  4PHJ A;  4XYN A;  3BUW B;  4GBA A;  3I5H C;  5J3X A;  2AUC A;  1AJ5 A;  1QX7 A;  4R1E A;  1JF2 A;  3VRO A;  4C0J A;  1BT6 A;  4TNC A;  4DRW A;  3I5F B;  1QTX A;  4I5J A;  2JQ6 A;  1JUO A;  2FOT A;  3SIA A;  1QLK A;  3JVT B;  1CLL A;  2K8M B;  2KFF A;  2KYC A;  5ER4 X;  5AEQ A;  3CS1 A;  3I5F C;  3DF0 B;  1FW4 A;  1N0Y A;  2TN4 A;  2BL0 B;  4ETO A;  3DVM A;  2PVB A;  1GJY A;  2RGI A;  2F2O A;  3JVT C;  4YI8 A;  1M45 A;  3CR5 X;  3LL8 B;  4GGN A;  1L7Z A;  1LVC D;  2BCA A;  3WHT B;  1J1E A;  2KQ6 A;  1JF0 A;  3DVJ A;  2MLF C;  4YGD B;  5HLO A;  2L51 A;  1NWD A;  2KGB C;  1OE9 B;  3SG6 A;  2CNP A;  1KWO B;  1IKU A;  1SPY A;  3NXA A;  1YRT B;  1PK0 D;  1K90 D;  1IJ6 A;  1UUR A;  2BBM A;  1A4P A;  1JC2 A;  4CFQ A;  3OB1 B;  1EH2 A;  1TNP A;  1TNW A;  1X02 A;  2BKH B;  1IJ5 A;  1UHK A;  2K0J A;  3EK8 A;  3KPX A;  1AK8 A;  1KWO C;  4JWQ A;  2ZN9 A;  5D69 A;  1NCZ A;  1LKJ A;  3CGA A;  1BR1 B;  2PMY A;  1CB1 A;  2L0P A;  4WRI A;  2CT9 A;  2MA2 A;  1BOC A;  4XJK A;  3HX4 A;  1CDL A;  3BUM B;  5D7F A;  1QJT A;  5CSF A;  1FI5 A;  5HLV A;  2LMV A;  1SMG A;  1CMG A;  1S6J A;  3CZT X;  1EG4 A;  1U5I A;  1XK4 C;  1L2O B;  2D8N A;  1YUS A;  1SR6 B;  1QV0 A;  1IG5 A;  3SJS A;  2LUC A;  1UHI A;  4OCI A;  2G2B A;  3D10 A;  1CM4 A;  1L2O C;  2M8U A;  1YVH A;  1FI6 A;  1FPW A;  4F0Z B;  1SR6 C;  3EK7 A;  4MZL A;  1OZS A;  2L5X B;  3BUX B;  4I5L B;  1J7O A;  1H4B A;  1KFU S;  3A8R A;  4WQ2 A;  2CBL A;  1A75 A;  1BR4 B;  2MRD A;  2BKI B;  1J7R A;  4HSZ A;  4PCW A;  4MEW A;  1XO5 A;  3HCM A;  4YGC B;  1RJV A;  1YTZ C;  4BY5 A;  1DMO A;  1MQ1 A;  3ZNI A;  2LAP A;  3VRN A;  2ZKM X;  2KBM A;  2DOQ A;  3EK4 A;  5F6T A;  5CSN A;  4QJ5 B;  1NX3 A;  5KTY A;  2JRF A;  1DJI A;  2FCE A;  2IS9 A;  1S1E A;  2F2P A;  3ICB A;  1V1F A;  1ZMZ A;  2KYF A;  3CTN A;  3TDI A;  1Q80 A;  2BCX A;  3RM1 A;  1JSA A;  2LMU A;  2JU0 A;  4PHN A;  1DTL A;  2MHH A;  2CXJ A;  5HKY A;  1SCM B;  1GGW A;  3DVE A;  2KDH A;  3DD4 A;  3I5G B;  3PN7 B;  2JOJ A;  4YRU A;  1C7W A;  3BOW B;  1CFC A;  1UUS A;  1SCM C;  2ISD A;  1DJW A;  1YRU B;  1KK7 Y;  3E3R A;  3I5G C;  3PN7 C;  1M63 B;  4ORB B;  1BOD A;  4C0L A;  1KFU L;  2LVK A;  3VRQ A;  1S6I A;  2KAY A;  1C7V A;  1AVS A;  2MBX A;  1QLS A;  2NCO A;  2ZRS A;  2L4H A;  2H61 C;  3SG7 A;  1R2U A;  1YX8 A;  3SIB A;  1D1O A;  1DJH A;  1K8U A;  1OMV A;  2EC6 B;  2KGR A;  1A2X A;  3CR4 X;  1GQM A;  4A4C A;  1NX0 A;  1PRW A;  2NZ0 A;  1OSA A;  4ZCV A;  3AKA A;  1QVI Z;  2BCB A;  4I5N B;  1GGZ A;  1DGV A;  1CFP A;  2AMI A;  2I94 A;  3LLE A;  2OS8 B;  5B8I B;  2PRU A;  2Q4U A;  1KSM A;  1YUU A;  4MZJ A;  2JT3 A;  1CLM A;  1WRL A;  1MXE A;  2OS8 C;  4JQ0 D;  1HT9 A;  1DF0 A;  5I2Q A;  3I5I B;  1B8L A;  3GK4 X;  2E6W A;  5GQQ C;  4USL A;  3OX5 A;  2K7B A;  1DJG A;  2JTZ A;  4FQO A;  1UWO A;  4NDC A;  3I5I C;  2JC2 A;  1YVL A;  3TS5 C;  1DVI A;  1KSO A;  2L50 A;  4U8D A;  5AER A;  1CNP A;  3PSR A;  1A03 A;  1XFU O;  5I8N A;  1K96 A;  1SY9 A;  2WOR A;  1ODB A;  3F45 A;  3VRP A;  5I2O A;  1MUX A;  3NSI A;  3D0Y A;  2HET A;  1EJ3 A;  2M29 A;  1G4Y R;  3M0W A;  2KAV A;  3TDZ A;  1AHR A;  2KHN A;  4Q04 A;  2PAS A;  1XA5 A;  1QV1 A;  1WY9 A;  1IQ3 A;  1B1G A;  1QX5 B;  1SK6 D;  1TCO B;  3EKJ A;  5HKZ A;  3C1V A;  1JFK A;  1MR8 A;  1XFZ O;  1LXF C;  2F8P A;  3K21 A;  4M2O A;  4PHK A;  5AAN A;  5K89 A;  1Y1A A;  1K9U A;  2KFH A;  5KU1 A;  1K2H A;  2I2R E;  4NDD A;  4DS7 A;  1FF1 A;  1G33 A;  1TCF A;  1CTR A;  1UHH A;  1DGU A;  2L98 A;  2LAN A;  4P2Y B;  4IL1 A;  2AAO A;  1BU3 A;  1M31 A;  2VRG A;  1XYD A;  2SCP A;  1FBV A;  4MSP A;  5TNC A;  3TZ1 A;  4CLN A;  2JT0 A;  3OHM B;  1XFY O;  2LLS A;  3CR2 A;  1K95 A;  1REC A;  1QX2 A;  1SNL A;  3FIA A;  1CM1 A;  2M7N A;  1A29 A;  1F71 A;  2I7A A;  1RWY A;  1Y6W A;  1CDP A;  2KFG A;  4MN0 A;  4YGE B;  4M2Q A;  1K93 D;  5HKW A;  1PAL A;  2BEC A;  4DUQ A;  2PSR A;  3IQQ A;  2PAL A;  4MBE A;  2ZN8 A;  2V53 A;  4QJ3 B;  4AQI A;  1DJY A;  2JXC A;  2BE4 A;  3NSL A;  1XVJ A;  2LUX A;  3GOF A;  2WCF A;  2LVJ A;  3GK1 A;  1MXL C;  2K61 A;  1C07 A;  1KCY A;  3IF7 A;  2NLN A;  4GGF A;  1S5G Y;  3AAJ A;  1J55 A;  4NDB A;  3WNX B;  1UHJ A;  5BPJ A;  2NCP A;  5FYX A;  1WRZ A;  3TDU A;  1ZUZ A;  4WQ3 A;  2BE6 A;  1BG1 A;  1W7J B;  3O4Y A;  1UHN A;  3LCP C;  2WOS A;  1UP5 A;  4HRG A;  2Y1M A;  1KQV A;  2LNK A;  2LVI A;  4E68 A;  4XJK B;  1QXP A;  3LK0 A;  2SAS A;  4FTG A;  2LC5 A;  4D1E A;  2M97 A;  4NQG A;  2ZRT A;  3DF0 A;  1M46 A;  3RLZ A;  1SCV A;  1DJZ A;  2Y1N A;  1U5I B;  2LLU A;  3TUY C;  2HQW A;  3KF9 A;  2KI6 D;  1NP8 A;  2G9B A;  2WCE A;  2K7O A;  4JPZ B;  1MHO A;  1R6P A;  1QVI Y;  2EGD A;  4A4B A;  1F55 A; 
#chains in the Genus database with same CATH topology
 1Y1X A;  4ICB A;  3NSK A;  2GGM A;  2LHL A;  2LMT A;  1TIZ A;  2KPH A;  1J1D A;  1Z2C B;  2Y5I A;  2MAZ A;  3SG3 A;  1OZO A;  1H8B A;  2KQY A;  3H4S E;  2K7C A;  1A75 B;  2MLE C;  2QPT A;  3LK1 A;  1ZFS A;  1ALV A;  1K9P A;  3KEV A;  3VGO A;  2ERB A;  2ZNE A;  1EG3 A;  1TTX A;  2FJY A;  1S6C A;  1TNX A;  1N2D A;  5DKR A;  3FWC A;  5HYD A;  1F8H A;  3NSO A;  1NCY A;  2JT8 A;  1TUJ A;  4YGA A;  4GAO A;  3NHI A;  3OB2 B;  1XK4 A;  1OOI X;  3CZ1 A;  3IVT A;  3SG4 A;  4N1F A;  3TS5 B;  5AXI A;  3UO9 A;  3PJI A;  1B4C A;  3RZS A;  1AUI B;  2OTG B;  1QWV A;  1RRO A;  2BBN A;  3O78 A;  2H2K A;  1WDC C;  1BF5 A;  3BXK A;  1B7T Z;  1EXR A;  1YUT A;  1NPQ A;  2KAX A;  2KI6 C;  2WND A;  5ER5 A;  3SG5 A;  4ORC B;  1E8A A;  1S26 D;  3ZWH A;  2OTG C;  1Y1U A;  4MZK A;  2F3Y A;  3EVV A;  4AQJ A;  1LA3 A;  2M7L A;  3FWB A;  1Y0V H;  1G8I A;  2M1U A;  3BYA A;  4C0K A;  1JWD A;  4CFR A;  1SYM A;  1MF8 B;  1RFJ A;  1LIN A;  3OX6 A;  1IRJ A;  1QS7 A;  4JD9 A;  2WC6 A;  1TNQ A;  1NCX A;  1QIW A;  1BLQ A;  2Q91 A;  1B9A A;  1OMR A;  4ORA B;  4PHM A;  2QEO A;  4PDZ A;  5JJG A;  1GM0 A;  5DKN A;  1CMF A;  2BL0 C;  3IQO A;  1TRF A;  5CSI A;  4PAL A;  4L9M A;  1J7Q A;  5KSZ A;  5DKQ A;  4PE7 A;  4PE4 A;  1IH0 A;  1PUL A;  2EHB A;  2L4I A;  2L2E A;  2MJW B;  3BQ3 A;  3DXL A;  3PAL A;  3PAT A;  4GPL B;  1M39 A;  1XFX O;  1QAT A;  4OV2 A;  4YBH B;  1XFW O;  2LCP A;  2M9G A;  1JFJ A;  4MRX A;  4DIR A;  2LP3 A;  2R2I A;  1YR5 A;  2COL B;  1BJF A;  3CDN A;  3FS7 A;  4UPG A;  1BMO A;  2M0R A;  4PE0 A;  4HRE E;  3BOW A;  2LLT A;  2F33 A;  3D77 A;  1W7I B;  1AP4 A;  1PVA A;  2FCD A;  3WHU B;  2JPT A;  2K2F A;  5CSJ A;  1DF0 B;  3AAK A;  3NHT A;  2K2A A;  2LVV A;  3PFV A;  1F4O A;  4MVF A;  2HQ8 A;  1AJ4 A;  1SBJ A;  4AOM A;  4CID A;  3DVK A;  1YX7 A;  3PLF B;  1QAS A;  1EL4 A;  2H61 A;  1DT7 B;  3WXA A;  1NYA A;  1XFV O;  1CFD A;  1RK9 A;  2B1U A;  1QIV A;  3D75 A;  2KI4 B;  2LP2 A;  4YGB B;  1F70 A;  1ZOT B;  4OKH A;  1C3Z A;  5IBW A;  2GGZ A;  2FJU B;  1B8R A;  2KNE A;  1TN4 A;  1NX2 A;  2KI4 C;  2JUL A;  4OR9 B;  1PSR A;  2OPO A;  3CLN A;  1OMD A;  1SW8 A;  1F54 A;  1IQ5 A;  1DJX A;  1B47 A;  2A4J A;  2L2C A;  3D0Y B;  4N5X A;  2Y4Q A;  2JTT A;  5I2L A;  4MLW A;  2WCB A;  2WC8 A;  1SL7 A;  3MSE B;  1ZAC A;  2M3W A;  1KFX S;  2E30 A;  2L5Y A;  4M2P A;  5G08 A;  1V1G A;  1NX1 A;  2O5G A;  1OOJ A;  2JWW A;  3S0E A;  2JXL A;  1VRK A;  2KSP A;  1IGV A;  1KK8 B;  3EKH A;  3TUY B;  1MWN A;  1S36 A;  2P6B B;  1DQE A;  3JTD B;  1PSB A;  4GFT A;  3BUO B;  1SSE B;  2F3Z A;  1OQP A;  3OP0 A;  4HRH A;  1YUR A;  1PVB A;  1W9Z A;  1WLM A;  1KK8 C;  3N7H A;  1KQM B;  4N1G A;  1RTP 1;  1B8C A;  2M49 B;  3B87 A;  3SS5 A;  1J7P A;  1CFF A;  3JTD C;  2K7D A;  5FI2 A;  1SKT A;  3KHE A;  4MRY A;  4PE1 A;  1NSH A;  1WRK A;  1SL9 A;  1KQM C;  1LA0 A;  2HPS A;  2JNX A;  3BUN B;  3PM8 A;  5PAL A;  1TOP A;  3CZ2 A;  3B6X A;  2I18 A;  1JBA A;  1ALW A;  1S5G Z;  4DCK A;  1WLZ A;  2K60 A;  4P5O E;  2QAC A;  1Z4H A;  4ZCU A;  1CDN A;  3AKB A;  4OVN F;  4GNK B;  1SRA A;  1TUZ A;  2WCH A;  3S0B A;  4YI9 A;  3EVR A;  2LM5 A;  2GV5 A;  3SG2 A;  3O6B A;  2O60 A;  1N65 A;  2JZI A;  3EVU A;  1NIW A;  1B7T Y;  1IWQ A;  2HF5 A;  2LHI A;  3QRX A;  1S3P A;  5CPV A;  2CTN A;  1KK7 Z;  3KO0 A;  3O2P A;  3GK2 A;  1KFX L;  2ZND A;  5JOL A;  2LV7 A;  4BY4 A;  1SL8 A;  3CWG A;  1WDC B;  2KOT A;  2LE9 B;  4CPV A;  2NXQ A;  3VRR A;  3VB1 A;  1C3Y A;  5AFP A;  4GUK A;  1F4Q A;  2GTE A;  2ZFD A;  2M1K B;  1HQV A;  2EC6 C;  2CCM A;  2KBI A;  1K9K A;  1CKK A;  3I5H B;  1CLB A;  1K94 A;  4QJ4 B;  1CDM A;  1NUB A;  4I5K A;  2JNF A;  3A4U B;  4GGF C;  4PHJ A;  4XYN A;  3BUW B;  4GBA A;  3I5H C;  4INX A;  1TWO A;  5J3X A;  2AUC A;  1AJ5 A;  1QX7 A;  4R1E A;  1JF2 A;  3VRO A;  4C0J A;  1BT6 A;  3K1E A;  4TNC A;  4DRW A;  3I5F B;  1QTX A;  4I5J A;  2JQ6 A;  1JUO A;  1LS8 A;  2FOT A;  3CYZ A;  3SIA A;  1QLK A;  3JVT B;  3UNW A;  1CLL A;  2K8M B;  2KFF A;  2KYC A;  3L4A A;  5ER4 X;  5AEQ A;  3CS1 A;  3I5F C;  3DF0 B;  1FW4 A;  1N0Y A;  2TN4 A;  2BL0 B;  4ETO A;  3DVM A;  2PVB A;  1GJY A;  2RGI A;  2F2O A;  3JVT C;  4YI8 A;  1M45 A;  3CR5 X;  3LL8 B;  4GGN A;  5HL1 A;  2WCL A;  1L7Z A;  1LVC D;  2BCA A;  3WHT B;  1J1E A;  2KQ6 A;  1JF0 A;  3DVJ A;  2MLF C;  4YGD B;  5HLO A;  2L51 A;  1NWD A;  2KGB C;  1OE9 B;  3SG6 A;  2CNP A;  1KWO B;  2PQL A;  1IKU A;  1SPY A;  3NXA A;  1YRT B;  1PK0 D;  1K90 D;  1IJ6 A;  1UUR A;  1XFR A;  1A4P A;  2BBM A;  4CFQ A;  1JC2 A;  3OB1 B;  1EH2 A;  1TNP A;  1TNW A;  1X02 A;  2BKH B;  1IJ5 A;  1UHK A;  2K0J A;  3B7A A;  3EK8 A;  3KPX A;  1AK8 A;  1KWO C;  4JWQ A;  2ZN9 A;  5D69 A;  1NCZ A;  1LKJ A;  3CGA A;  1BR1 B;  2PMY A;  1CB1 A;  2L0P A;  2QEB A;  4FQT A;  4WRI A;  1T14 A;  2CT9 A;  2MA2 A;  1BOC A;  4XJK A;  3HX4 A;  1CDL A;  3BUM B;  5D7F A;  1QJT A;  5CSF A;  1FI5 A;  5HLV A;  2LMV A;  1SMG A;  3S0F A;  1CMG A;  1P28 A;  1S6J A;  2P71 A;  3CZT X;  1EG4 A;  1ORG A;  1U5I A;  1XK4 C;  1L2O B;  2D8N A;  1YUS A;  1SR6 B;  2BNX A;  1QV0 A;  3OBV A;  1IG5 A;  3D74 A;  3SJS A;  2LUC A;  3SS3 A;  1UHI A;  4JKT A;  4OCI A;  2G2B A;  3D10 A;  1CM4 A;  1L2O C;  2M8U A;  3DYE A;  3S0A A;  1YVH A;  1FI6 A;  1FPW A;  4F0Z B;  1SR6 C;  3EK7 A;  4MZL A;  1OZS A;  2L5X B;  3BUX B;  4I5L B;  1J7O A;  1H4B A;  1KFU S;  3A8R A;  4WQ2 A;  2CBL A;  1A75 A;  3DY9 A;  1BR4 B;  2MRD A;  2QEV A;  3BFA A;  2BKI B;  1J7R A;  3FE8 A;  4HSZ A;  4PCW A;  4MEW A;  1XO5 A;  3HCM A;  3FE9 A;  1IIO A;  4YGC B;  3D78 A;  1RJV A;  1YTZ C;  4BY5 A;  1DMO A;  1MQ1 A;  2BAP A;  1OOG A;  4IJ7 A;  3ZNI A;  2LAP A;  1OOF A;  3VRN A;  2ZKM X;  3O4X A;  2KBM A;  2DOQ A;  3EK4 A;  5F6T A;  5CSN A;  4QJ5 B;  1NX3 A;  5KTY A;  2JRF A;  1DJI A;  2FCE A;  2IS9 A;  1S1E A;  2QDI A;  2F2P A;  3ICB A;  1V1F A;  1ZMZ A;  2KYF A;  3CTN A;  3CZ0 A;  3TDI A;  1Q80 A;  2BCX A;  3RM1 A;  1JSA A;  2LMU A;  2JU0 A;  4PHN A;  1DTL A;  2MHH A;  2CXJ A;  5HKY A;  3NGV A;  1SCM B;  4PT1 A;  1GGW A;  3DVE A;  2KDH A;  3DD4 A;  3I5G B;  3PN7 B;  2JOJ A;  4OZD A;  4YRU A;  1C7W A;  2KLD A;  3BOW B;  1CFC A;  1UUS A;  1SCM C;  2ISD A;  1DJW A;  1YRU B;  1KK7 Y;  3E3R A;  3I5G C;  3PN7 C;  1M63 B;  1OW4 A;  4ORB B;  1BOD A;  4C0L A;  1KFU L;  2LVK A;  3VRQ A;  1S6I A;  2KAY A;  1C7V A;  1AVS A;  2MBX A;  1QLS A;  2NCO A;  3R1V A;  2ZRS A;  2L4H A;  2H61 C;  3SG7 A;  1R2U A;  1YX8 A;  3SIB A;  1D1O A;  1DJH A;  3S0G A;  1K8U A;  3L4L A;  3OGN A;  1OMV A;  2EC6 B;  2KGR A;  1A2X A;  3CR4 X;  1GQM A;  3QME A;  4A4C A;  1NX0 A;  1PRW A;  2NZ0 A;  1OSA A;  5DIC A;  4ZCV A;  3AKA A;  2H8V A;  1QVI Z;  2BCB A;  4I5N B;  1GGZ A;  1DGV A;  1CFP A;  2AMI A;  2I94 A;  3LLE A;  2OS8 B;  5B8I B;  2PRU A;  2Q4U A;  3R72 A;  1KSM A;  1YUU A;  4MZJ A;  2JT3 A;  1CLM A;  3FE6 A;  1WRL A;  1MXE A;  2OS8 C;  4JQ0 D;  1HT9 A;  1DF0 A;  5I2Q A;  3R1O A;  3I5I B;  1B8L A;  3GK4 X;  2E6W A;  5GQQ C;  3CAB A;  3OX5 A;  2K7B A;  1DJG A;  2JTZ A;  2PYQ A;  1UWO A;  4FQO A;  4NDC A;  4USL A;  5EL2 A;  3I5I C;  2JC2 A;  1YVL A;  3TS5 C;  1DVI A;  1KSO A;  2L50 A;  4U8D A;  5AER A;  1CNP A;  1DEL A;  3PSR A;  1A03 A;  1XFU O;  5I8N A;  1K96 A;  1SY9 A;  2WOR A;  1ODB A;  3F45 A;  3VRP A;  5I2O A;  1MUX A;  3NSI A;  3D0Y A;  2HET A;  1EJ3 A;  3BFB A;  2M29 A;  1G4Y R;  3M0W A;  2KAV A;  3TDZ A;  1AHR A;  2KHN A;  4Q04 A;  2PAS A;  1XA5 A;  1QV1 A;  1WY9 A;  1IQ3 A;  4KYN A;  2WCK A;  3L47 A;  1B1G A;  1QX5 B;  3DZT A;  1SK6 D;  1TCO B;  3EKJ A;  5HKZ A;  3C1V A;  1JFK A;  1MR8 A;  1XFZ O;  1LXF C;  2F8P A;  3K21 A;  4M2O A;  4PHK A;  5AAN A;  3SS4 A;  5K89 A;  1Y1A A;  3PM2 A;  3EG5 B;  5FI6 A;  1K9U A;  1DEK A;  2KFH A;  5KU1 A;  1K2H A;  2I2R E;  5FI7 A;  5I94 A;  2P70 A;  4NDD A;  4DS7 A;  1G33 A;  1FF1 A;  1TCF A;  1CTR A;  1UHH A;  1DGU A;  2L98 A;  2QEH A;  2LAN A;  4P2Y B;  4IL1 A;  2AAO A;  3BFH A;  2WCJ A;  1BU3 A;  1M31 A;  2VRG A;  1XYD A;  3D76 A;  2SCP A;  1FBV A;  4MSP A;  5TNC A;  3TZ1 A;  2KLE A;  4CLN A;  3B88 A;  3D73 A;  2JT0 A;  3OHM B;  3B86 A;  3S0D A;  1XFY O;  2LLS A;  3CR2 A;  1K95 A;  1REC A;  2YGU A;  1QX2 A;  1SNL A;  3FIA A;  1CM1 A;  2M7N A;  1A29 A;  1F71 A;  2I7A A;  1RWY A;  1Y6W A;  1CDP A;  2KFG A;  4MN0 A;  4YGE B;  5D3O A;  1OOH A;  4M2Q A;  1K93 D;  5HKW A;  1PAL A;  2BEC A;  4DUQ A;  2PSR A;  3IQQ A;  2PAL A;  3Q8I A;  4MBE A;  3R1P A;  2ZN8 A;  2V53 A;  4QJ3 B;  4AQI A;  1DJY A;  2JXC A;  2BE4 A;  3NSL A;  1XVJ A;  2LUX A;  3GOF A;  2WCF A;  2LVJ A;  3GK1 A;  1MXL C;  2K61 A;  1C07 A;  1KCY A;  3IF7 A;  2NLN A;  4GGF A;  1S5G Y;  3AAJ A;  1J55 A;  4NDB A;  3WNX B;  1UHJ A;  5BPJ A;  2NCP A;  5FYX A;  1WRZ A;  3TDU A;  1ZUZ A;  4WQ3 A;  2BE6 A;  1BG1 A;  1W7J B;  3O4Y A;  1UHN A;  3LCP C;  2WOS A;  1UP5 A;  4HRG A;  2Y1M A;  1KQV A;  2LNK A;  2LVI A;  4E68 A;  4XJK B;  4F7F A;  2WC5 A;  1QXP A;  3LK0 A;  2SAS A;  4FTG A;  3V2L A;  2LC5 A;  4D1E A;  2M97 A;  4NQG A;  2ZRT A;  2JPO A;  3DF0 A;  1M46 A;  3RLZ A;  1SCV A;  1DJZ A;  2Y1N A;  1U5I B;  2WCM A;  2LLU A;  3TUY C;  2HQW A;  3BJH A;  3KF9 A;  2KI6 D;  1NP8 A;  2G9B A;  2WCE A;  2K7O A;  4JPZ B;  1MHO A;  4INW A;  1DC1 A;  1R6P A;  1QVI Y;  2EGD A;  4A4B A;  1F55 A; 
#chains in the Genus database with same CATH homology
 1Y1X A;  4ICB A;  3NSK A;  2GGM A;  2LHL A;  2LMT A;  1TIZ A;  2Y5I A;  1J1D A;  2MAZ A;  3SG3 A;  1OZO A;  1H8B A;  2KQY A;  3H4S E;  2K7C A;  1A75 B;  2MLE C;  2QPT A;  3LK1 A;  1ZFS A;  1ALV A;  1K9P A;  3KEV A;  3VGO A;  2ZNE A;  1EG3 A;  1TTX A;  1S6C A;  1TNX A;  1N2D A;  5DKR A;  3FWC A;  5HYD A;  1F8H A;  3NSO A;  1NCY A;  2JT8 A;  4YGA A;  4GAO A;  3OB2 B;  1XK4 A;  3SG4 A;  3TS5 B;  1B4C A;  4N1F A;  5AXI A;  1AUI B;  2OTG B;  1RRO A;  2BBN A;  3O78 A;  2H2K A;  1WDC C;  1BF5 A;  3BXK A;  1B7T Z;  1EXR A;  1YUT A;  1NPQ A;  2KAX A;  2KI6 C;  2WND A;  5ER5 A;  3SG5 A;  4ORC B;  1E8A A;  1S26 D;  3ZWH A;  2OTG C;  1Y1U A;  4MZK A;  2F3Y A;  3EVV A;  4AQJ A;  1LA3 A;  2M7L A;  3FWB A;  1Y0V H;  1G8I A;  2M1U A;  3BYA A;  4C0K A;  1JWD A;  4CFR A;  1SYM A;  1MF8 B;  1RFJ A;  1LIN A;  3OX6 A;  1IRJ A;  1QS7 A;  1TNQ A;  1NCX A;  1QIW A;  1BLQ A;  2Q91 A;  1B9A A;  1OMR A;  4ORA B;  4PHM A;  4PDZ A;  5JJG A;  5DKN A;  1CMF A;  2BL0 C;  3IQO A;  1TRF A;  5CSI A;  4PAL A;  4L9M A;  1J7Q A;  5KSZ A;  5DKQ A;  4PE7 A;  4PE4 A;  1IH0 A;  1PUL A;  2EHB A;  2L4I A;  2L2E A;  2MJW B;  3BQ3 A;  3PAL A;  3PAT A;  4GPL B;  1M39 A;  1XFX O;  1QAT A;  4OV2 A;  4YBH B;  1XFW O;  2LCP A;  2M9G A;  1JFJ A;  4MRX A;  4DIR A;  2LP3 A;  2R2I A;  1YR5 A;  2COL B;  1BJF A;  3FS7 A;  4UPG A;  1BMO A;  2M0R A;  4PE0 A;  4HRE E;  3BOW A;  2LLT A;  2F33 A;  1W7I B;  1AP4 A;  1PVA A;  2FCD A;  3WHU B;  2JPT A;  2K2F A;  5CSJ A;  1DF0 B;  3AAK A;  2K2A A;  2LVV A;  3PFV A;  1F4O A;  4MVF A;  2HQ8 A;  1AJ4 A;  1SBJ A;  4AOM A;  4CID A;  3DVK A;  1YX7 A;  3PLF B;  1QAS A;  1EL4 A;  2H61 A;  1DT7 B;  3WXA A;  1NYA A;  1XFV O;  1CFD A;  2B1U A;  1RK9 A;  1QIV A;  2KI4 B;  2LP2 A;  1F70 A;  1ZOT B;  4OKH A;  5IBW A;  2GGZ A;  2FJU B;  1B8R A;  2KNE A;  1TN4 A;  1NX2 A;  2KI4 C;  2JUL A;  4OR9 B;  1PSR A;  2OPO A;  3CLN A;  1OMD A;  1SW8 A;  1F54 A;  1IQ5 A;  1DJX A;  1B47 A;  2A4J A;  3D0Y B;  4N5X A;  2Y4Q A;  2JTT A;  5I2L A;  4MLW A;  2WCB A;  2WC8 A;  1SL7 A;  3MSE B;  1ZAC A;  2M3W A;  1KFX S;  2E30 A;  4M2P A;  5G08 A;  1V1G A;  1NX1 A;  2O5G A;  1OOJ A;  2JWW A;  2JXL A;  1VRK A;  2KSP A;  1IGV A;  1KK8 B;  3EKH A;  3TUY B;  1MWN A;  1S36 A;  2P6B B;  3JTD B;  1PSB A;  4GFT A;  3BUO B;  2F3Z A;  1OQP A;  3OP0 A;  4HRH A;  1YUR A;  1PVB A;  1WLM A;  4N1G A;  1KK8 C;  4YGB B;  1KQM B;  1J7P A;  1RTP 1;  1B8C A;  2M49 B;  1CFF A;  3JTD C;  2K7D A;  1SKT A;  3KHE A;  4MRY A;  4PE1 A;  1NSH A;  1WRK A;  1SL9 A;  1KQM C;  1LA0 A;  2HPS A;  2JNX A;  3BUN B;  3PM8 A;  5PAL A;  1TOP A;  2I18 A;  1JBA A;  1ALW A;  1S5G Z;  4DCK A;  1WLZ A;  4P5O E;  2QAC A;  4ZCU A;  1CDN A;  3AKB A;  4OVN F;  4GNK B;  1SRA A;  4YI9 A;  3EVR A;  2LM5 A;  2GV5 A;  3SG2 A;  3O6B A;  2O60 A;  1N65 A;  2JZI A;  3EVU A;  1NIW A;  1B7T Y;  1IWQ A;  2HF5 A;  2LHI A;  3QRX A;  1S3P A;  5CPV A;  2CTN A;  1KK7 Z;  3KO0 A;  3O2P A;  3GK2 A;  1KFX L;  2ZND A;  5JOL A;  2LV7 A;  4BY4 A;  1SL8 A;  3CWG A;  1WDC B;  2KOT A;  2LE9 B;  4CPV A;  2NXQ A;  3VRR A;  5AFP A;  4GUK A;  1F4Q A;  2ZFD A;  2M1K B;  1HQV A;  2EC6 C;  2CCM A;  2KBI A;  1K9K A;  1CKK A;  3I5H B;  1CLB A;  1K94 A;  4QJ4 B;  1CDM A;  1NUB A;  4I5K A;  2JNF A;  3A4U B;  4GGF C;  4PHJ A;  4XYN A;  3BUW B;  4GBA A;  3I5H C;  5J3X A;  2AUC A;  1AJ5 A;  1QX7 A;  4R1E A;  1JF2 A;  3VRO A;  4C0J A;  1BT6 A;  4TNC A;  4DRW A;  3I5F B;  1QTX A;  4I5J A;  2JQ6 A;  1JUO A;  2FOT A;  3SIA A;  1QLK A;  3JVT B;  1CLL A;  2K8M B;  2KFF A;  2KYC A;  5ER4 X;  5AEQ A;  3CS1 A;  3I5F C;  3DF0 B;  1FW4 A;  1N0Y A;  2TN4 A;  2BL0 B;  4ETO A;  3DVM A;  2PVB A;  1GJY A;  2RGI A;  2F2O A;  3JVT C;  4YI8 A;  1M45 A;  3CR5 X;  3LL8 B;  4GGN A;  1L7Z A;  1LVC D;  2BCA A;  3WHT B;  1J1E A;  2KQ6 A;  1JF0 A;  3DVJ A;  2MLF C;  4YGD B;  5HLO A;  2L51 A;  1NWD A;  2KGB C;  1OE9 B;  3SG6 A;  2CNP A;  1KWO B;  1IKU A;  1SPY A;  3NXA A;  1YRT B;  1PK0 D;  1K90 D;  1IJ6 A;  1UUR A;  2BBM A;  1A4P A;  1JC2 A;  4CFQ A;  3OB1 B;  1EH2 A;  1TNP A;  1TNW A;  1X02 A;  2BKH B;  1IJ5 A;  1UHK A;  2K0J A;  3EK8 A;  3KPX A;  1AK8 A;  1KWO C;  4JWQ A;  2ZN9 A;  5D69 A;  1NCZ A;  1LKJ A;  3CGA A;  1BR1 B;  2PMY A;  1CB1 A;  2L0P A;  4WRI A;  2CT9 A;  2MA2 A;  1BOC A;  4XJK A;  3HX4 A;  1CDL A;  3BUM B;  5D7F A;  1QJT A;  5CSF A;  1FI5 A;  5HLV A;  2LMV A;  1SMG A;  1CMG A;  1S6J A;  3CZT X;  1EG4 A;  1U5I A;  1XK4 C;  1L2O B;  2D8N A;  1YUS A;  1SR6 B;  1QV0 A;  1IG5 A;  3SJS A;  2LUC A;  1UHI A;  4OCI A;  2G2B A;  3D10 A;  1CM4 A;  1L2O C;  2M8U A;  1YVH A;  1FI6 A;  1FPW A;  4F0Z B;  1SR6 C;  3EK7 A;  4MZL A;  1OZS A;  2L5X B;  3BUX B;  4I5L B;  1J7O A;  1H4B A;  1KFU S;  3A8R A;  4WQ2 A;  2CBL A;  1A75 A;  1BR4 B;  2MRD A;  2BKI B;  1J7R A;  4HSZ A;  4PCW A;  4MEW A;  1XO5 A;  3HCM A;  4YGC B;  1RJV A;  1YTZ C;  4BY5 A;  1DMO A;  1MQ1 A;  3ZNI A;  2LAP A;  3VRN A;  2ZKM X;  2KBM A;  2DOQ A;  3EK4 A;  5F6T A;  5CSN A;  4QJ5 B;  1NX3 A;  5KTY A;  2JRF A;  1DJI A;  2FCE A;  2IS9 A;  1S1E A;  2F2P A;  3ICB A;  1V1F A;  1ZMZ A;  2KYF A;  3CTN A;  3TDI A;  1Q80 A;  2BCX A;  3RM1 A;  1JSA A;  2LMU A;  2JU0 A;  4PHN A;  1DTL A;  2MHH A;  2CXJ A;  5HKY A;  1SCM B;  1GGW A;  3DVE A;  2KDH A;  3DD4 A;  3I5G B;  3PN7 B;  2JOJ A;  4YRU A;  1C7W A;  3BOW B;  1CFC A;  1UUS A;  1SCM C;  2ISD A;  1DJW A;  1YRU B;  1KK7 Y;  3E3R A;  3I5G C;  3PN7 C;  1M63 B;  4ORB B;  1BOD A;  4C0L A;  1KFU L;  2LVK A;  3VRQ A;  1S6I A;  2KAY A;  1C7V A;  1AVS A;  2MBX A;  1QLS A;  2NCO A;  2ZRS A;  2L4H A;  2H61 C;  3SG7 A;  1R2U A;  1YX8 A;  3SIB A;  1D1O A;  1DJH A;  1K8U A;  1OMV A;  2EC6 B;  2KGR A;  1A2X A;  3CR4 X;  1GQM A;  4A4C A;  1NX0 A;  1PRW A;  2NZ0 A;  1OSA A;  4ZCV A;  3AKA A;  1QVI Z;  2BCB A;  4I5N B;  1GGZ A;  1DGV A;  1CFP A;  2AMI A;  2I94 A;  3LLE A;  2OS8 B;  5B8I B;  2PRU A;  2Q4U A;  1KSM A;  1YUU A;  4MZJ A;  2JT3 A;  1CLM A;  1WRL A;  1MXE A;  2OS8 C;  4JQ0 D;  1HT9 A;  1DF0 A;  5I2Q A;  3I5I B;  1B8L A;  3GK4 X;  2E6W A;  5GQQ C;  4USL A;  3OX5 A;  2K7B A;  1DJG A;  2JTZ A;  4FQO A;  1UWO A;  4NDC A;  3I5I C;  2JC2 A;  1YVL A;  3TS5 C;  1DVI A;  1KSO A;  2L50 A;  4U8D A;  5AER A;  1CNP A;  3PSR A;  1A03 A;  1XFU O;  5I8N A;  1K96 A;  1SY9 A;  2WOR A;  1ODB A;  3F45 A;  3VRP A;  5I2O A;  1MUX A;  3NSI A;  3D0Y A;  2HET A;  1EJ3 A;  2M29 A;  1G4Y R;  3M0W A;  2KAV A;  3TDZ A;  1AHR A;  2KHN A;  4Q04 A;  2PAS A;  1XA5 A;  1QV1 A;  1WY9 A;  1IQ3 A;  1B1G A;  1QX5 B;  1SK6 D;  1TCO B;  3EKJ A;  5HKZ A;  3C1V A;  1JFK A;  1MR8 A;  1XFZ O;  1LXF C;  2F8P A;  3K21 A;  4M2O A;  4PHK A;  5AAN A;  5K89 A;  1Y1A A;  1K9U A;  2KFH A;  5KU1 A;  1K2H A;  2I2R E;  4NDD A;  4DS7 A;  1FF1 A;  1G33 A;  1TCF A;  1CTR A;  1UHH A;  1DGU A;  2L98 A;  2LAN A;  4P2Y B;  4IL1 A;  2AAO A;  1BU3 A;  1M31 A;  2VRG A;  1XYD A;  2SCP A;  1FBV A;  4MSP A;  5TNC A;  3TZ1 A;  4CLN A;  2JT0 A;  3OHM B;  1XFY O;  2LLS A;  3CR2 A;  1K95 A;  1REC A;  1QX2 A;  1SNL A;  3FIA A;  1CM1 A;  2M7N A;  1A29 A;  1F71 A;  2I7A A;  1RWY A;  1Y6W A;  1CDP A;  2KFG A;  4MN0 A;  4YGE B;  4M2Q A;  1K93 D;  5HKW A;  1PAL A;  2BEC A;  4DUQ A;  2PSR A;  3IQQ A;  2PAL A;  4MBE A;  2ZN8 A;  2V53 A;  4QJ3 B;  4AQI A;  1DJY A;  2JXC A;  2BE4 A;  3NSL A;  1XVJ A;  2LUX A;  3GOF A;  2WCF A;  2LVJ A;  3GK1 A;  1MXL C;  2K61 A;  1C07 A;  1KCY A;  3IF7 A;  2NLN A;  4GGF A;  1S5G Y;  3AAJ A;  1J55 A;  4NDB A;  3WNX B;  1UHJ A;  5BPJ A;  2NCP A;  5FYX A;  1WRZ A;  3TDU A;  1ZUZ A;  4WQ3 A;  2BE6 A;  1BG1 A;  1W7J B;  3O4Y A;  1UHN A;  3LCP C;  2WOS A;  1UP5 A;  4HRG A;  2Y1M A;  1KQV A;  2LNK A;  2LVI A;  4E68 A;  4XJK B;  1QXP A;  3LK0 A;  2SAS A;  4FTG A;  2LC5 A;  4D1E A;  2M97 A;  4NQG A;  2ZRT A;  3DF0 A;  1M46 A;  3RLZ A;  1SCV A;  1DJZ A;  2Y1N A;  1U5I B;  2LLU A;  3TUY C;  2HQW A;  3KF9 A;  2KI6 D;  1NP8 A;  2G9B A;  2WCE A;  2K7O A;  4JPZ B;  1MHO A;  1R6P A;  1QVI Y;  2EGD A;  4A4B A;  1F55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...