4DIRA

2.6 angstrom x-ray structure of human ca(2+)-s100a5
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
78
Chain Sequence
TPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Target-binding to S100A5 changes Ca(2+)-binding affinity and dynamics.
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A5
total genus 30
structure length 78
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dirA00
4HRHA 1TTXA 5CSNA 2F2OA 3PM8A 1FW4A 1YR5A 4L9MA 3TDUA 2LNKA 4PALA 4PDZA 2JXCA 1EXRA 1KQMB 1PRWA 1SRAA 2KAXA 1DJGA 1MF8B 3KO0A 4GFTA 1VRKA 1TCOB 1M31A 3LCPC 5HLOA 3CS1A 4DS7A 1ZMZA 2JNXA 2CNPA 1B1GA 1W7JB 2NCPA 4PCWA 5IBWA 1WRZA 1B8LA 1SCMB 1LVCD 1IH0A 2M97A 4DRWA 1J7OA 1KSOA 2Y4QA 4M2QA 1K9UA 1QS7A 1QX5B 1TRFA 1FI6A 1PVBA 2Y1MA 1QIWA 1EH2A 1NPQA 1DJZA 1PVAA 3D0YA 2OS8B 1CKKA 2K7CA 3AAJA 2M1KB 1AJ5A 1CTRA 2KFFA 2K7OA 2E6WA 1BU3A 1NX1A 3BXKA 1N0YA 2O60A 3SG6A 1CM4A 1AUIB 1J1DA 1Y1UA 2GV5A 4N1GA 2LAPA 1K94A 1KSMA 4C0LA 1EL4A 1XFXO 2L0PA 5AEQA 1V1FA 2KI6C 1QLSA 3KHEA 4NDDA 2SASA 1F71A 1IG5A 1IQ5A 1NCZA 2H61C 1F55A 1GQMA 2JTZA 4AOMA 3PSRA 1BLQA 1R2UA 2KI4C 1TIZA 2WNDA 2JWWA 4DIRA 1UHKA 1UUSA 3PLFB 1XO5A 1MWNA 3HCMA 2PMYA 1CFDA 1IGVA 2MLEC 4I5KA 4CLNA 1WLZA 5HKWA 3QRXA 1Q80A 3H4SE 3I5GB 2MLFC 3O2PA 2FJUB 2LVVA 1CDNA 1DT7B 1NCYA 3DF0A 1E8AA 3AAKA 1NUBA 1IJ5A 1S26D 2JT8A 3BUXB 4C0KA 2MRDA 1PSRA 1ODBA 3AKAA 1C07A 2H61A 2JPTA 2KDHA 3F45A 4M2PA 1QIVA 1KK7Y 5HYDA 2JQ6A 2LE9B 2FCDA 4MZJA 1TN4A 4GPLB 4XJKB 1YUUA 1KQVA 1CLLA 1WDCC 1CFCA 1JC2A 3BUMB 2KBMA 3IF7A 2M3WA 1OMDA 3M0WA 2KBIA 2L4IA 2JRFA 1K8UA 2LCPA 4YGDB 3TS5C 2LVKA 1M45A 1J7QA 4MRXA 3DF0B 1BR4B 1SK6D 1M63B 5JJGA 2Q4UA 1JWDA 5D7FA 2M29A 1XFVO 1GGWA 2L98A 2HQ8A 3SIBA 5AXIA 1G4YR 3CWGA 2HETA 1C7WA 1B7TY 1OZSA 2ZN9A 4M2OA 1DJYA 4JQ0D 2M1UA 3I5FB 1FBVA 5DKQA 1BOCA 3I5FC 1WLMA 5GQQC 1OMRA 2MA2A 1OQPA 2FCEA 3KF9A 2KAYA 5KTYA 3DVJA 5J3XA 3O6BA 2D8NA 2ZRSA 3EK7A 4IL1A 3I5IC 1SL9A 1Y1AA 1YVHA 2JU0A 2ZRTA 3OX5A 3CGAA 1B9AA 3A4UB 2BCXA 3SJSA 1A03A 2MHHA 2SCPA 3NSIA 1J1EA 2I94A 1RFJA 3O4YA 2BL0B 2OTGC 1SL7A 4YBHB 5TNCA 1AVSA 3EKHA 3JTDC 3HX4A 2JC2A 2EHBA 4QJ3B 1SBJA 1SR6C 4GGNA 4D1EA 4XJKA 4MLWA 4OV2A 1XFZO 2EGDA 2LV7A 1PULA 1YRTB 3TUYC 1KFUL 1QASA 3KPXA 2LLTA 2LM5A 1XFWO 1G33A 1AK8A 3SG5A 2ZKMX 2BKHB 3D0YB 1PSBA 2QPTA 3FWBA 5HKYA 1HQVA 2HQWA 4GBAA 1SCVA 1DJXA 2MBXA 4UPGA 1QLKA 4HREE 1S5GZ 2HF5A 1SMGA 2JT0A 2V53A 3EVRA 4ORAB 5KU1A 1C7VA 2GGZA 1JBAA 1DJWA 2OTGB 3MSEB 1KWOC 1PALA 4ZCVA 4JWQA 1MHOA 1QVIZ 2FOTA 2WCFA 3ZWHA 2LP2A 1AP4A 3BQ3A 5AFPA 2NZ0A 3CZTX 2K2AA 2MAZA 3EK8A 2KYCA 1A4PA 5ER4X 2LUXA 2O5GA 1F54A 2L5XB 4PHJA 3GK4X 1RWYA 4HRGA 2M7NA 5K89A 2L51A 1B8RA 2M0RA 1TNXA 1PK0D 1BMOA 2BBMA 1EG4A 2K2FA 4OR9B 3FWCA 2IS9A 4MRYA 4I5NB 2MJWB 3JVTB 1MUXA 1MXLC 1K95A 2KFHA 5I2LA 2CXJA 3BOWB 1YURA 4MSPA 1CLBA 2NXQA 5B8IB 5F6TA 3OB1B 2WC8A 4MZLA 4GGFC 4WQ3A 1IKUA 1B7TZ 1LA0A 1DJHA 1WRKA 1QV0A 2LLSA 4MEWA 5KSZA 1CM1A 4A4CA 4WRIA 3A8RA 1A29A 3OB2B 1BG1A 1EG3A 2CCMA 4MVFA 2LHIA 3OHMB 5BPJA 4PHKA 2H2KA 1TOPA 4JPZB 1DMOA 1S1EA 1H8BA 2RGIA 5DKRA 1XA5A 4OVNF 2ZNEA 1DF0B 5JOLA 1SYMA 2BBNA 3SG3A 5CSIA 1RK9A 4DUQA 1K90D 5G08A 4CFQA 1JF2A 1JUOA 3I5GC 1Y1XA 3SG2A 1DTLA 2G9BA 1CMFA 1TNPA 1YUSA 1QTXA 1QATA 3AKBA 1YX8A 1DGVA 1KK7Z 2JNFA 4YI9A 2LVJA 2PVBA 3NSOA 1U5IB 1XVJA 3DVMA 1HT9A 1G8IA 1RJVA 2GGMA 3BYAA 2P6BB 4YI8A 1NIWA 2LHLA 2VRGA 1S3PA 4PHNA 1RROA 1GJYA 4I5LB 4YRUA 3RLZA 3NSLA 4P2YB 1Y0VH 1IQ3A 1K2HA 4CPVA 2M9GA 3I5HC 1BODA 2COLB 3VGOA 1V1GA 2KHNA 4OKHA 3DVKA 5CPVA 1NCXA 5D69A 4PE7A 1TCFA 1IJ6A 3IQQA 1JF0A 2CBLA 1H4BA 2BCBA 2CTNA 1BJFA 3CTNA 3LL8B 4U8DA 4PE0A 1F8HA 2LMTA 2OS8C 1X02A 1A75A 1CFFA 2LMVA 3VRPA 4FTGA 1DJIA 1S36A 1UHNA 4ETOA 1OOJA 1OSAA 1SL8A 2G2BA 5DKNA 1CFPA 2BL0C 3PATA 2LC5A 3BUWB 1SR6B 1QXPA 4TNCA 5HKZA 1SNLA 3WHTB 2K7DA 5I2OA 1ALWA 2LP3A 1FPWA 3GK1A 3D10A 2CT9A 1XK4C 2AUCA 1SW8A 1OZOA 1DGUA 1DVIA 3LK0A 3VRRA 1ZFSA 3PALA 1AJ4A 2ISDA 2KGBC 1F4OA 1AHRA 1Y6WA 3I5HB 3WHUB 1NX2A 1B47A 2JTTA 1SPYA 1KCYA 1NX3A 2BKIB 4CFRA 1QV1A 4BY4A 2AAOA 4NDBA 5ER5A 3ZNIA 1TNQA 1ALVA 4Q04A 2EC6B 4CIDA 1K96A 2M49B 1GGZA 1XYDA 1YX7A 2K61A 1CDMA 1MXEA 1XK4A 1YRUB 2KYFA 2LMUA 2TN4A 3PN7C 2I2RE 3TDZA 1FF1A 4P5OE 5I2QA 2KFGA 3RM1A 2BE4A 1NWDA 2KNEA 1B8CA 1KFXS 2PASA 2M8UA 1UWOA 1BF5A 2JULA 2WCBA 2JZIA 1LXFC 3BUNB 1K9KA 1ZACA 5FYXA 1EJ3A 4GAOA 5PALA 4QJ5B 3BUOB 1N65A 3SG7A 2OPOA 3JVTC 4GUKA 1KK8B 1YUTA 2R2IA 1NP8A 2AMIA 2E30A 4PHMA 4YGEB 5I8NA 1NYAA 2ZFDA 1QVIY 1R6PA 1SCMC 4E68A 1WRLA 1S6JA 2I7AA 3TDIA 2WCEA 1XFUO 4MBEA 2KQYA 2LANA 4AQJA 1KWOB 2JT3A 1LKJA 2WORA 1S6CA 4YGBB 1K93D 3PFVA 5CSJA 1DF0A 1S5GY 1L2OC 2PSRA 4ORBB 4NDCA 1FI5A 1A2XA 1L2OB 2LUCA 4AQIA 1K9PA 3SG4A 1L7ZA 1B4CA 1ZOTB 3GK2A 1M39A 1QX7A 3OX6A 2K7BA 2F8PA 3ICBA 1YVLA 1NSHA 2M7LA 3TZ1A 1QX2A 4OCIA 5CSFA 3EKJA 3K21A 3I5IB 3BOWA 1J55A 3GOFA 4WQ2A 1M46A 2KI4B 2K8MB 3FS7A 1D1OA 2F33A 3CLNA 3VROA 1RECA 3FIAA 4USLA 2KQ6A 3CR5X 1W7IB 1LINA 3NSKA 1UURA 3WNXB 3DVEA 1CMGA 1JSAA 1XFYO 2BE6A 2Y1NA 3EVVA 2WOSA 1CDPA 3O78A 4YGCB 4F0ZB 3E3RA 3VRNA 4DCKA 2EC6C 1RTP1 2KAVA 2LLUA 1UHHA 1JFJA 2L4HA 2ZN8A 1KQMC 1YTZC 3WXAA 1U5IA 2JXLA 2PRUA 4ZCUA 1CDLA 3TS5B 1SY9A 3C1VA 3LK1A 3NXAA 4GGFA 4A4BA 1N2DA 1UHJA 5HLVA 4NQGA 4ORCB 1ZUZA 3IQOA 1A75B 2I18A 4N5XA 2KSPA 1MQ1A 2KGRA 2NCOA 1MR8A 1LA3A 2KI6D 3CR4X 4GNKB 3JTDB 1UHIA 4ICBA 2KOTA 4HSZA 1CLMA 1JFKA 1KFUS 1F4QA 3EVUA 4FQOA 4YGAA 1IWQA 1KFXL 2L2EA 3VRQA 4PE1A 1J7PA 4MN0A 2A4JA 2DOQA 5AERA 1IRJA 4XYNA 2F3ZA 4C0JA 2F2PA 1J7RA 1NX0A 1F70A 4MZKA 1WDCB 2K0JA 1OE9B 1KK8C 2BECA 2HPSA 1WY9A 3SIAA 2F3YA 2B1UA 3KEVA 1SKTA 2NLNA 2ZNDA 3OP0A 3CR2A 1OMVA 2QACA 1S6IA 1TNWA 2L50A 1CB1A 2BCAA 4BY5A 3EK4A 1BR1B 3LLEA 2PALA 1CNPA 4I5JA 4N1FA 5AANA 3PN7B 4R1EA 3TUYB 1QJTA 4QJ4B 2Y5IA 1UP5A 3DD4A 4PE4A 2JOJA 1BT6A 2Q91A 2LVIA
chains in the Genus database with same CATH superfamily
4HRHA 1TTXA 5CSNA 2F2OA 3PM8A 1FW4A 1YR5A 4L9MA 3TDUA 2LNKA 4PALA 3D75A 4PDZA 2JXCA 1EXRA 1KQMB 1PRWA 1SRAA 2KAXA 1DJGA 1MF8B 3KO0A 4GFTA 1VRKA 1TCOB 1M31A 3LCPC 5HLOA 3CS1A 4DS7A 1ZMZA 2JNXA 2CNPA 1B1GA 1W7JB 2NCPA 2ERBA 4PCWA 5IBWA 1WRZA 1B8LA 1SCMB 1LVCD 1IH0A 2M97A 2KLDA 4DRWA 1J7OA 1KSOA 2Y4QA 4M2QA 1K9UA 1QS7A 1QX5B 1TRFA 1FI6A 1PVBA 2P71A 1QIWA 2Y1MA 1EH2A 1NPQA 1DJZA 1PVAA 3D0YA 3D78A 2OS8B 1CKKA 2K7CA 3AAJA 2M1KB 1AJ5A 1CTRA 2KFFA 2K7OA 2E6WA 1BU3A 1NX1A 2WC6A 3BXKA 1N0YA 2O60A 3SG6A 1CM4A 1AUIB 1J1DA 1DQEA 1Y1UA 2GV5A 3N7HA 4N1GA 3IVTA 2LAPA 1K94A 1KSMA 4C0LA 1EL4A 1XFXO 2L0PA 5AEQA 1V1FA 2KI6C 3B86A 1QLSA 3KHEA 4NDDA 2SASA 1F71A 1IG5A 1IQ5A 1NCZA 2H61C 2WCMA 1F55A 1GQMA 2JTZA 4AOMA 3CDNA 1C3ZA 3PSRA 4JKTA 1R2UA 1BLQA 2KI4C 4OZDA 1TIZA 2WNDA 2JWWA 4DIRA 1UHKA 1UUSA 3PLFB 1XO5A 1MWNA 1IIOA 3HCMA 2PMYA 1CFDA 1IGVA 2MLEC 4I5KA 4CLNA 1WLZA 5HKWA 3QRXA 1Q80A 3H4SE 3I5GB 2MLFC 3O2PA 2FJUB 2LVVA 3D74A 5FI6A 2L5YA 3CZ1A 1CDNA 1DT7B 1NCYA 3DF0A 5I94A 1E8AA 3AAKA 1NUBA 1IJ5A 1S26D 2JT8A 3BUXB 4C0KA 2MRDA 1PSRA 1ODBA 3AKAA 1C07A 3S0BA 2H61A 2JPTA 2KDHA 3F45A 4M2PA 1QIVA 1KK7Y 5HL1A 3B87A 5HYDA 2JQ6A 2LE9B 3PJIA 2FCDA 4MZJA 1TN4A 4GPLB 4XJKB 1YUUA 1KQVA 1CLLA 1WDCC 1CFCA 1JC2A 3BUMB 2KBMA 2H8VA 3IF7A 2M3WA 1OMDA 3M0WA 2KBIA 2L4IA 2JRFA 1K8UA 2LCPA 4YGDB 3TS5C 2LVKA 1M45A 1J7QA 4MRXA 3DF0B 1BR4B 1SK6D 1M63B 5JJGA 1OOHA 2Q4UA 5D7FA 1JWDA 2M29A 1XFVO 1GGWA 2L98A 2HQ8A 3SIBA 5AXIA 1G4YR 2WCLA 3CWGA 2HETA 1C7WA 1B7TY 1OZSA 2ZN9A 4M2OA 1DJYA 4JQ0D 2M1UA 3I5FB 3PM2A 1FBVA 4FQTA 5DKQA 1BOCA 3I5FC 1WLMA 5GQQC 3UO9A 3Q8IA 1OMRA 2MA2A 1DEKA 1OQPA 2FCEA 3CZ0A 3KF9A 2KAYA 5KTYA 3DVJA 5J3XA 3O6BA 2D8NA 2ZRSA 3EK7A 4IL1A 3I5IC 1SL9A 1Y1AA 1YVHA 2JU0A 2ZRTA 3OX5A 3CGAA 1B9AA 3A4UB 1XFRA 2BCXA 3SJSA 1A03A 3SS5A 3SS3A 2MHHA 2SCPA 3NSIA 1J1EA 2I94A 1RFJA 3O4YA 2BL0B 2OTGC 1SL7A 4YBHB 3L4LA 1TWOA 5TNCA 1AVSA 3EKHA 3JTDC 3HX4A 2JC2A 2EHBA 4QJ3B 1SBJA 1SR6C 4GGNA 4D1EA 4XJKA 4MLWA 4OV2A 1XFZO 2EGDA 2LV7A 1PULA 1YRTB 4KYNA 3TUYC 1KFUL 1QASA 3DZTA 2LLTA 3KPXA 2LM5A 5FI2A 1C3YA 1XFWO 1G33A 1AK8A 1TUZA 3SG5A 3BFAA 1OOGA 2ZKMX 2BKHB 3D0YB 1PSBA 2QPTA 3FWBA 5HKYA 1HQVA 2HQWA 2L2CA 4GBAA 1SCVA 1DJXA 2MBXA 4UPGA 1QLKA 2WCJA 4HREE 1S5GZ 1SMGA 2HF5A 2JT0A 2V53A 3EVRA 4ORAB 5KU1A 1C7VA 2GGZA 1JBAA 1DJWA 2OTGB 3MSEB 1KWOC 1PALA 4ZCVA 4JWQA 1MHOA 4INWA 1QVIZ 2FOTA 2WCFA 3ZWHA 2LP2A 3R1VA 1AP4A 3BQ3A 5AFPA 2NZ0A 3CZTX 3S0FA 2K2AA 2MAZA 3EK8A 2KYCA 1A4PA 5ER4X 3B88A 2JPOA 2LUXA 2O5GA 1F54A 2L5XB 4PHJA 1QWVA 3D73A 3GK4X 1RWYA 4HRGA 2M7NA 5K89A 2L51A 1B8RA 3DXLA 2M0RA 1TNXA 2KLEA 1PK0D 1BMOA 2BBMA 1EG4A 2K2FA 4OR9B 3FWCA 5DICA 2IS9A 4MRYA 4I5NB 2MJWB 3CABA 3JVTB 1MUXA 1MXLC 1K95A 2KFHA 5I2LA 2CXJA 3BOWB 1YURA 4MSPA 1CLBA 2NXQA 5B8IB 3L4AA 5D3OA 5F6TA 3OB1B 2WC8A 4MZLA 4GGFC 4WQ3A 1IKUA 1B7TZ 1LA0A 1DJHA 1WRKA 1QV0A 2LLSA 1OOIX 4MEWA 5KSZA 1CM1A 4A4CA 4WRIA 3A8RA 1A29A 3OB2B 3S0AA 1BG1A 1EG3A 2CCMA 4MVFA 2LHIA 3OBVA 3OHMB 5BPJA 4PHKA 2H2KA 1TOPA 1Z2CB 4JPZB 1DMOA 1S1EA 2WCKA 2RGIA 1H8BA 3D76A 1XA5A 4OVNF 2ZNEA 1DF0B 5DKRA 5JOLA 1SYMA 2BBNA 3SG3A 5CSIA 1RK9A 4DUQA 1K90D 1W9ZA 3S0DA 5G08A 4CFQA 1JF2A 1JUOA 3I5GC 1Y1XA 3SG2A 1DTLA 2G9BA 4JD9A 1CMFA 1TNPA 1YUSA 1QTXA 1QATA 3AKBA 1YX8A 1DGVA 1OOFA 1KK7Z 2JNFA 2K60A 4YI9A 2LVJA 2PVBA 3NSOA 2QEVA 1U5IB 1XVJA 3DVMA 1HT9A 1G8IA 1RJVA 2GGMA 2QDIA 2P6BB 3BYAA 1NIWA 2LHLA 2VRGA 2FJYA 1S3PA 4YI8A 4PHNA 1RROA 1GJYA 4I5LB 4YRUA 3RLZA 3NSLA 2PQLA 4P2YB 1Y0VH 1IQ3A 1K2HA 4CPVA 2M9GA 3I5HC 1BODA 1OW4A 2COLB 3VGOA 1V1GA 2KHNA 4OKHA 3DVKA 5CPVA 1NCXA 5D69A 4PE7A 1TCFA 1IJ6A 3IQQA 1JF0A 2CBLA 3FE6A 1T14A 1H4BA 2BCBA 2CTNA 1BJFA 3CTNA 1DELA 3LL8B 4U8DA 4PE0A 1F8HA 2LMTA 2BNXA 2OS8C 1X02A 1A75A 1CFFA 2LMVA 3VRPA 2PYQA 4FTGA 1DJIA 1S36A 3FE9A 1Z4HA 1UHNA 3BFBA 1OOJA 4ETOA 2KPHA 1OSAA 1SL8A 2G2BA 5DKNA 1CFPA 2BL0C 3PATA 2GTEA 2LC5A 3BUWB 1SR6B 1QXPA 4TNCA 5HKZA 1SNLA 3WHTB 2K7DA 5I2OA 1SSEB 1ALWA 2LP3A 1FPWA 3GK1A 3D10A 2CT9A 1XK4C 2AUCA 1SW8A 1OZOA 1DGUA 1DVIA 3LK0A 3VRRA 1ZFSA 3PALA 1AJ4A 2ISDA 2KGBC 1F4OA 1AHRA 1Y6WA 3I5HB 3WHUB 4IJ7A 2QEHA 1NX2A 1B47A 2JTTA 1SPYA 3RZSA 1KCYA 1NX3A 2BKIB 4CFRA 1QV1A 4BY4A 2AAOA 4NDBA 5ER5A 3ZNIA 1TNQA 1ALVA 4Q04A 2EC6B 4CIDA 1K96A 2M49B 1GGZA 1XYDA 1YX7A 2K61A 1CDMA 1MXEA 1XK4A 1YRUB 2KYFA 2LMUA 2WC5A 2TN4A 3PN7C 2I2RE 3TDZA 1FF1A 1ORGA 4P5OE 5FI7A 5I2QA 2KFGA 3B7AA 3RM1A 2BE4A 1NWDA 2KNEA 1B8CA 1KFXS 2PASA 2M8UA 2YGUA 1UWOA 1BF5A 2JULA 2WCBA 2JZIA 1LXFC 3BUNB 1K9KA 1ZACA 5FYXA 1EJ3A 4GAOA 5PALA 4QJ5B 2WCHA 3BUOB 1N65A 3SG7A 2OPOA 3JVTC 4GUKA 1KK8B 1YUTA 2R2IA 1NP8A 2AMIA 2E30A 4PHMA 4YGEB 5I8NA 1NYAA 2ZFDA 1QVIY 1R6PA 1SCMC 4E68A 1WRLA 1S6JA 2I7AA 3TDIA 2WCEA 1XFUO 4MBEA 2KQYA 2LANA 4AQJA 1KWOB 2JT3A 1LKJA 2WORA 3S0EA 1S6CA 3FE8A 4YGBB 1K93D 3PFVA 5CSJA 1DF0A 1S5GY 1L2OC 2PSRA 4ORBB 4NDCA 3OGNA 4F7FA 1FI5A 1A2XA 1L2OB 2LUCA 4AQIA 3QMEA 1K9PA 3SG4A 1L7ZA 1B4CA 1ZOTB 3GK2A 1M39A 1QX7A 3OX6A 2K7BA 3UNWA 2F8PA 3ICBA 1YVLA 1NSHA 2M7LA 3TZ1A 1QX2A 4OCIA 5CSFA 3EKJA 3K21A 3I5IB 2QEOA 3BOWA 1J55A 3GOFA 3R1PA 1M46A 2KI4B 2K8MB 3FS7A 4WQ2A 1D1OA 2F33A 3CLNA 3VROA 1RECA 3FIAA 4USLA 2KQ6A 3CR5X 5EL2A 3EG5B 1W7IB 3DY9A 1LINA 3NSKA 1TUJA 1UURA 3WNXB 3DVEA 1CMGA 1JSAA 3VB1A 1XFYO 2BE6A 2Y1NA 3EVVA 2WOSA 1CDPA 3O78A 4YGCB 4F0ZB 1GM0A 3E3RA 3VRNA 4DCKA 3R72A 2EC6C 1RTP1 2KAVA 2LLUA 1UHHA 1JFJA 2L4HA 2ZN8A 1KQMC 1YTZC 3WXAA 1U5IA 2JXLA 2PRUA 4ZCUA 1CDLA 3TS5B 1SY9A 3V2LA 3C1VA 3LK1A 3NXAA 2P70A 4GGFA 4A4BA 1N2DA 1DC1A 1UHJA 5HLVA 4NQGA 4ORCB 1ZUZA 3L47A 3IQOA 1A75B 3BFHA 2I18A 4N5XA 2KSPA 1MQ1A 1P28A 3B6XA 2KGRA 3O4XA 2NCOA 3CZ2A 1MR8A 1LA3A 2KI6D 1LS8A 3CR4X 4GNKB 3JTDB 1UHIA 4ICBA 2KOTA 3BJHA 4HSZA 1CLMA 1JFKA 1KFUS 1F4QA 3EVUA 4FQOA 4YGAA 1IWQA 1KFXL 2L2EA 2QEBA 3VRQA 3S0GA 4PE1A 3CYZA 3SS4A 1J7PA 4MN0A 2A4JA 2DOQA 5AERA 1IRJA 3NHIA 4XYNA 2F3ZA 3DYEA 4C0JA 2F2PA 2BAPA 1J7RA 3D77A 3R1OA 1NX0A 1F70A 4MZKA 1WDCB 2K0JA 3K1EA 1OE9B 1KK8C 2BECA 2HPSA 1WY9A 3SIAA 2F3YA 2B1UA 3KEVA 4PT1A 1SKTA 2NLNA 2ZNDA 3OP0A 3CR2A 1OMVA 2QACA 1S6IA 1TNWA 2L50A 1CB1A 2BCAA 4BY5A 3EK4A 1BR1B 3LLEA 3NGVA 2PALA 1CNPA 4I5JA 4N1FA 5AANA 3PN7B 4R1EA 3TUYB 1QJTA 4QJ4B 2Y5IA 1UP5A 3NHTA 3DD4A 4INXA 4PE4A 2JOJA 1BT6A 2Q91A 2LVIA
chains in the Genus database with same CATH topology
4HRHA 1TTXA 5CSNA 2F2OA 3PM8A 1FW4A 1YR5A 4L9MA 3TDUA 2LNKA 4PALA 4PDZA 2JXCA 1EXRA 1KQMB 1PRWA 1SRAA 2KAXA 1DJGA 1MF8B 3KO0A 4GFTA 1VRKA 1TCOB 1M31A 3LCPC 5HLOA 3CS1A 4DS7A 1ZMZA 2JNXA 2CNPA 1B1GA 1W7JB 2NCPA 4PCWA 5IBWA 1WRZA 1B8LA 1SCMB 1LVCD 1IH0A 2M97A 4DRWA 1J7OA 1KSOA 2Y4QA 4M2QA 1K9UA 1QS7A 1QX5B 1TRFA 1FI6A 1PVBA 2Y1MA 1QIWA 1EH2A 1NPQA 1DJZA 1PVAA 3D0YA 2OS8B 1CKKA 2K7CA 3AAJA 2M1KB 1AJ5A 1CTRA 2KFFA 2K7OA 2E6WA 1BU3A 1NX1A 3BXKA 1N0YA 2O60A 3SG6A 1CM4A 1AUIB 1J1DA 1Y1UA 2GV5A 4N1GA 2LAPA 1K94A 1KSMA 4C0LA 1EL4A 1XFXO 2L0PA 5AEQA 1V1FA 2KI6C 1QLSA 3KHEA 4NDDA 2SASA 1F71A 1IG5A 1IQ5A 1NCZA 2H61C 1F55A 1GQMA 2JTZA 4AOMA 3PSRA 1BLQA 1R2UA 2KI4C 1TIZA 2WNDA 2JWWA 4DIRA 1UHKA 1UUSA 3PLFB 1XO5A 1MWNA 3HCMA 2PMYA 1CFDA 1IGVA 2MLEC 4I5KA 4CLNA 1WLZA 5HKWA 3QRXA 1Q80A 3H4SE 3I5GB 2MLFC 3O2PA 2FJUB 2LVVA 1CDNA 1DT7B 1NCYA 3DF0A 1E8AA 3AAKA 1NUBA 1IJ5A 1S26D 2JT8A 3BUXB 4C0KA 2MRDA 1PSRA 1ODBA 3AKAA 1C07A 2H61A 2JPTA 2KDHA 3F45A 4M2PA 1QIVA 1KK7Y 5HYDA 2JQ6A 2LE9B 2FCDA 4MZJA 1TN4A 4GPLB 4XJKB 1YUUA 1KQVA 1CLLA 1WDCC 1CFCA 1JC2A 3BUMB 2KBMA 3IF7A 2M3WA 1OMDA 3M0WA 2KBIA 2L4IA 2JRFA 1K8UA 2LCPA 4YGDB 3TS5C 2LVKA 1M45A 1J7QA 4MRXA 3DF0B 1BR4B 1SK6D 1M63B 5JJGA 2Q4UA 1JWDA 5D7FA 2M29A 1XFVO 1GGWA 2L98A 2HQ8A 3SIBA 5AXIA 1G4YR 3CWGA 2HETA 1C7WA 1B7TY 1OZSA 2ZN9A 4M2OA 1DJYA 4JQ0D 2M1UA 3I5FB 1FBVA 5DKQA 1BOCA 3I5FC 1WLMA 5GQQC 1OMRA 2MA2A 1OQPA 2FCEA 3KF9A 2KAYA 5KTYA 3DVJA 5J3XA 3O6BA 2D8NA 2ZRSA 3EK7A 4IL1A 3I5IC 1SL9A 1Y1AA 1YVHA 2JU0A 2ZRTA 3OX5A 3CGAA 1B9AA 3A4UB 2BCXA 3SJSA 1A03A 2MHHA 2SCPA 3NSIA 1J1EA 2I94A 1RFJA 3O4YA 2BL0B 2OTGC 1SL7A 4YBHB 5TNCA 1AVSA 3EKHA 3JTDC 3HX4A 2JC2A 2EHBA 4QJ3B 1SBJA 1SR6C 4GGNA 4D1EA 4XJKA 4MLWA 4OV2A 1XFZO 2EGDA 2LV7A 1PULA 1YRTB 3TUYC 1KFUL 1QASA 3KPXA 2LLTA 2LM5A 1XFWO 1G33A 1AK8A 3SG5A 2ZKMX 2BKHB 3D0YB 1PSBA 2QPTA 3FWBA 5HKYA 1HQVA 2HQWA 4GBAA 1SCVA 1DJXA 2MBXA 4UPGA 1QLKA 4HREE 1S5GZ 2HF5A 1SMGA 2JT0A 2V53A 3EVRA 4ORAB 5KU1A 1C7VA 2GGZA 1JBAA 1DJWA 2OTGB 3MSEB 1KWOC 1PALA 4ZCVA 4JWQA 1MHOA 1QVIZ 2FOTA 2WCFA 3ZWHA 2LP2A 1AP4A 3BQ3A 5AFPA 2NZ0A 3CZTX 2K2AA 2MAZA 3EK8A 2KYCA 1A4PA 5ER4X 2LUXA 2O5GA 1F54A 2L5XB 4PHJA 3GK4X 1RWYA 4HRGA 2M7NA 5K89A 2L51A 1B8RA 2M0RA 1TNXA 1PK0D 1BMOA 2BBMA 1EG4A 2K2FA 4OR9B 3FWCA 2IS9A 4MRYA 4I5NB 2MJWB 3JVTB 1MUXA 1MXLC 1K95A 2KFHA 5I2LA 2CXJA 3BOWB 1YURA 4MSPA 1CLBA 2NXQA 5B8IB 5F6TA 3OB1B 2WC8A 4MZLA 4GGFC 4WQ3A 1IKUA 1B7TZ 1LA0A 1DJHA 1WRKA 1QV0A 2LLSA 4MEWA 5KSZA 1CM1A 4A4CA 4WRIA 3A8RA 1A29A 3OB2B 1BG1A 1EG3A 2CCMA 4MVFA 2LHIA 3OHMB 5BPJA 4PHKA 2H2KA 1TOPA 4JPZB 1DMOA 1S1EA 1H8BA 2RGIA 5DKRA 1XA5A 4OVNF 2ZNEA 1DF0B 5JOLA 1SYMA 2BBNA 3SG3A 5CSIA 1RK9A 4DUQA 1K90D 5G08A 4CFQA 1JF2A 1JUOA 3I5GC 1Y1XA 3SG2A 1DTLA 2G9BA 1CMFA 1TNPA 1YUSA 1QTXA 1QATA 3AKBA 1YX8A 1DGVA 1KK7Z 2JNFA 4YI9A 2LVJA 2PVBA 3NSOA 1U5IB 1XVJA 3DVMA 1HT9A 1G8IA 1RJVA 2GGMA 3BYAA 2P6BB 4YI8A 1NIWA 2LHLA 2VRGA 1S3PA 4PHNA 1RROA 1GJYA 4I5LB 4YRUA 3RLZA 3NSLA 4P2YB 1Y0VH 1IQ3A 1K2HA 4CPVA 2M9GA 3I5HC 1BODA 2COLB 3VGOA 1V1GA 2KHNA 4OKHA 3DVKA 5CPVA 1NCXA 5D69A 4PE7A 1TCFA 1IJ6A 3IQQA 1JF0A 2CBLA 1H4BA 2BCBA 2CTNA 1BJFA 3CTNA 3LL8B 4U8DA 4PE0A 1F8HA 2LMTA 2OS8C 1X02A 1A75A 1CFFA 2LMVA 3VRPA 4FTGA 1DJIA 1S36A 1UHNA 4ETOA 1OOJA 1OSAA 1SL8A 2G2BA 5DKNA 1CFPA 2BL0C 3PATA 2LC5A 3BUWB 1SR6B 1QXPA 4TNCA 5HKZA 1SNLA 3WHTB 2K7DA 5I2OA 1ALWA 2LP3A 1FPWA 3GK1A 3D10A 2CT9A 1XK4C 2AUCA 1SW8A 1OZOA 1DGUA 1DVIA 3LK0A 3VRRA 1ZFSA 3PALA 1AJ4A 2ISDA 2KGBC 1F4OA 1AHRA 1Y6WA 3I5HB 3WHUB 1NX2A 1B47A 2JTTA 1SPYA 1KCYA 1NX3A 2BKIB 4CFRA 1QV1A 4BY4A 2AAOA 4NDBA 5ER5A 3ZNIA 1TNQA 1ALVA 4Q04A 2EC6B 4CIDA 1K96A 2M49B 1GGZA 1XYDA 1YX7A 2K61A 1CDMA 1MXEA 1XK4A 1YRUB 2KYFA 2LMUA 2TN4A 3PN7C 2I2RE 3TDZA 1FF1A 4P5OE 5I2QA 2KFGA 3RM1A 2BE4A 1NWDA 2KNEA 1B8CA 1KFXS 2PASA 2M8UA 1UWOA 1BF5A 2JULA 2WCBA 2JZIA 1LXFC 3BUNB 1K9KA 1ZACA 5FYXA 1EJ3A 4GAOA 5PALA 4QJ5B 3BUOB 1N65A 3SG7A 2OPOA 3JVTC 4GUKA 1KK8B 1YUTA 2R2IA 1NP8A 2AMIA 2E30A 4PHMA 4YGEB 5I8NA 1NYAA 2ZFDA 1QVIY 1R6PA 1SCMC 4E68A 1WRLA 1S6JA 2I7AA 3TDIA 2WCEA 1XFUO 4MBEA 2KQYA 2LANA 4AQJA 1KWOB 2JT3A 1LKJA 2WORA 1S6CA 4YGBB 1K93D 3PFVA 5CSJA 1DF0A 1S5GY 1L2OC 2PSRA 4ORBB 4NDCA 1FI5A 1A2XA 1L2OB 2LUCA 4AQIA 1K9PA 3SG4A 1L7ZA 1B4CA 1ZOTB 3GK2A 1M39A 1QX7A 3OX6A 2K7BA 2F8PA 3ICBA 1YVLA 1NSHA 2M7LA 3TZ1A 1QX2A 4OCIA 5CSFA 3EKJA 3K21A 3I5IB 3BOWA 1J55A 3GOFA 4WQ2A 1M46A 2KI4B 2K8MB 3FS7A 1D1OA 2F33A 3CLNA 3VROA 1RECA 3FIAA 4USLA 2KQ6A 3CR5X 1W7IB 1LINA 3NSKA 1UURA 3WNXB 3DVEA 1CMGA 1JSAA 1XFYO 2BE6A 2Y1NA 3EVVA 2WOSA 1CDPA 3O78A 4YGCB 4F0ZB 3E3RA 3VRNA 4DCKA 2EC6C 1RTP1 2KAVA 2LLUA 1UHHA 1JFJA 2L4HA 2ZN8A 1KQMC 1YTZC 3WXAA 1U5IA 2JXLA 2PRUA 4ZCUA 1CDLA 3TS5B 1SY9A 3C1VA 3LK1A 3NXAA 4GGFA 4A4BA 1N2DA 1UHJA 5HLVA 4NQGA 4ORCB 1ZUZA 3IQOA 1A75B 2I18A 4N5XA 2KSPA 1MQ1A 2KGRA 2NCOA 1MR8A 1LA3A 2KI6D 3CR4X 4GNKB 3JTDB 1UHIA 4ICBA 2KOTA 4HSZA 1CLMA 1JFKA 1KFUS 1F4QA 3EVUA 4FQOA 4YGAA 1IWQA 1KFXL 2L2EA 3VRQA 4PE1A 1J7PA 4MN0A 2A4JA 2DOQA 5AERA 1IRJA 4XYNA 2F3ZA 4C0JA 2F2PA 1J7RA 1NX0A 1F70A 4MZKA 1WDCB 2K0JA 1OE9B 1KK8C 2BECA 2HPSA 1WY9A 3SIAA 2F3YA 2B1UA 3KEVA 1SKTA 2NLNA 2ZNDA 3OP0A 3CR2A 1OMVA 2QACA 1S6IA 1TNWA 2L50A 1CB1A 2BCAA 4BY5A 3EK4A 1BR1B 3LLEA 2PALA 1CNPA 4I5JA 4N1FA 5AANA 3PN7B 4R1EA 3TUYB 1QJTA 4QJ4B 2Y5IA 1UP5A 3DD4A 4PE4A 2JOJA 1BT6A 2Q91A 2LVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRH A;  1TTX A;  5CSN A;  2F2O A;  3PM8 A;  1FW4 A;  1YR5 A;  4L9M A;  3TDU A;  2LNK A;  4PAL A;  4PDZ A;  2JXC A;  1EXR A;  1KQM B;  1PRW A;  1SRA A;  2KAX A;  1DJG A;  1MF8 B;  3KO0 A;  4GFT A;  1VRK A;  1TCO B;  1M31 A;  3LCP C;  5HLO A;  3CS1 A;  4DS7 A;  1ZMZ A;  2JNX A;  2CNP A;  1B1G A;  1W7J B;  2NCP A;  4PCW A;  5IBW A;  1WRZ A;  1B8L A;  1SCM B;  1LVC D;  1IH0 A;  2M97 A;  4DRW A;  1J7O A;  1KSO A;  2Y4Q A;  4M2Q A;  1K9U A;  1QS7 A;  1QX5 B;  1TRF A;  1FI6 A;  1PVB A;  2Y1M A;  1QIW A;  1EH2 A;  1NPQ A;  1DJZ A;  1PVA A;  3D0Y A;  2OS8 B;  1CKK A;  2K7C A;  3AAJ A;  2M1K B;  1AJ5 A;  1CTR A;  2KFF A;  2K7O A;  2E6W A;  1BU3 A;  1NX1 A;  3BXK A;  1N0Y A;  2O60 A;  3SG6 A;  1CM4 A;  1AUI B;  1J1D A;  1Y1U A;  2GV5 A;  4N1G A;  2LAP A;  1K94 A;  1KSM A;  4C0L A;  1EL4 A;  1XFX O;  2L0P A;  5AEQ A;  1V1F A;  2KI6 C;  1QLS A;  3KHE A;  4NDD A;  2SAS A;  1F71 A;  1IG5 A;  1IQ5 A;  1NCZ A;  2H61 C;  1F55 A;  1GQM A;  2JTZ A;  4AOM A;  3PSR A;  1BLQ A;  1R2U A;  2KI4 C;  1TIZ A;  2WND A;  2JWW A;  4DIR A;  1UHK A;  1UUS A;  3PLF B;  1XO5 A;  1MWN A;  3HCM A;  2PMY A;  1CFD A;  1IGV A;  2MLE C;  4I5K A;  4CLN A;  1WLZ A;  5HKW A;  3QRX A;  1Q80 A;  3H4S E;  3I5G B;  2MLF C;  3O2P A;  2FJU B;  2LVV A;  1CDN A;  1DT7 B;  1NCY A;  3DF0 A;  1E8A A;  3AAK A;  1NUB A;  1IJ5 A;  1S26 D;  2JT8 A;  3BUX B;  4C0K A;  2MRD A;  1PSR A;  1ODB A;  3AKA A;  1C07 A;  2H61 A;  2JPT A;  2KDH A;  3F45 A;  4M2P A;  1QIV A;  1KK7 Y;  5HYD A;  2JQ6 A;  2LE9 B;  2FCD A;  4MZJ A;  1TN4 A;  4GPL B;  4XJK B;  1YUU A;  1KQV A;  1CLL A;  1WDC C;  1CFC A;  1JC2 A;  3BUM B;  2KBM A;  3IF7 A;  2M3W A;  1OMD A;  3M0W A;  2KBI A;  2L4I A;  2JRF A;  1K8U A;  2LCP A;  4YGD B;  3TS5 C;  2LVK A;  1M45 A;  1J7Q A;  4MRX A;  3DF0 B;  1BR4 B;  1SK6 D;  1M63 B;  5JJG A;  2Q4U A;  1JWD A;  5D7F A;  2M29 A;  1XFV O;  1GGW A;  2L98 A;  2HQ8 A;  3SIB A;  5AXI A;  1G4Y R;  3CWG A;  2HET A;  1C7W A;  1B7T Y;  1OZS A;  2ZN9 A;  4M2O A;  1DJY A;  4JQ0 D;  2M1U A;  3I5F B;  1FBV A;  5DKQ A;  1BOC A;  3I5F C;  1WLM A;  5GQQ C;  1OMR A;  2MA2 A;  1OQP A;  2FCE A;  3KF9 A;  2KAY A;  5KTY A;  3DVJ A;  5J3X A;  3O6B A;  2D8N A;  2ZRS A;  3EK7 A;  4IL1 A;  3I5I C;  1SL9 A;  1Y1A A;  1YVH A;  2JU0 A;  2ZRT A;  3OX5 A;  3CGA A;  1B9A A;  3A4U B;  2BCX A;  3SJS A;  1A03 A;  2MHH A;  2SCP A;  3NSI A;  1J1E A;  2I94 A;  1RFJ A;  3O4Y A;  2BL0 B;  2OTG C;  1SL7 A;  4YBH B;  5TNC A;  1AVS A;  3EKH A;  3JTD C;  3HX4 A;  2JC2 A;  2EHB A;  4QJ3 B;  1SBJ A;  1SR6 C;  4GGN A;  4D1E A;  4XJK A;  4MLW A;  4OV2 A;  1XFZ O;  2EGD A;  2LV7 A;  1PUL A;  1YRT B;  3TUY C;  1KFU L;  1QAS A;  3KPX A;  2LLT A;  2LM5 A;  1XFW O;  1G33 A;  1AK8 A;  3SG5 A;  2ZKM X;  2BKH B;  3D0Y B;  1PSB A;  2QPT A;  3FWB A;  5HKY A;  1HQV A;  2HQW A;  4GBA A;  1SCV A;  1DJX A;  2MBX A;  4UPG A;  1QLK A;  4HRE E;  1S5G Z;  2HF5 A;  1SMG A;  2JT0 A;  2V53 A;  3EVR A;  4ORA B;  5KU1 A;  1C7V A;  2GGZ A;  1JBA A;  1DJW A;  2OTG B;  3MSE B;  1KWO C;  1PAL A;  4ZCV A;  4JWQ A;  1MHO A;  1QVI Z;  2FOT A;  2WCF A;  3ZWH A;  2LP2 A;  1AP4 A;  3BQ3 A;  5AFP A;  2NZ0 A;  3CZT X;  2K2A A;  2MAZ A;  3EK8 A;  2KYC A;  1A4P A;  5ER4 X;  2LUX A;  2O5G A;  1F54 A;  2L5X B;  4PHJ A;  3GK4 X;  1RWY A;  4HRG A;  2M7N A;  5K89 A;  2L51 A;  1B8R A;  2M0R A;  1TNX A;  1PK0 D;  1BMO A;  2BBM A;  1EG4 A;  2K2F A;  4OR9 B;  3FWC A;  2IS9 A;  4MRY A;  4I5N B;  2MJW B;  3JVT B;  1MUX A;  1MXL C;  1K95 A;  2KFH A;  5I2L A;  2CXJ A;  3BOW B;  1YUR A;  4MSP A;  1CLB A;  2NXQ A;  5B8I B;  5F6T A;  3OB1 B;  2WC8 A;  4MZL A;  4GGF C;  4WQ3 A;  1IKU A;  1B7T Z;  1LA0 A;  1DJH A;  1WRK A;  1QV0 A;  2LLS A;  4MEW A;  5KSZ A;  1CM1 A;  4A4C A;  4WRI A;  3A8R A;  1A29 A;  3OB2 B;  1BG1 A;  1EG3 A;  2CCM A;  4MVF A;  2LHI A;  3OHM B;  5BPJ A;  4PHK A;  2H2K A;  1TOP A;  4JPZ B;  1DMO A;  1S1E A;  1H8B A;  2RGI A;  5DKR A;  1XA5 A;  4OVN F;  2ZNE A;  1DF0 B;  5JOL A;  1SYM A;  2BBN A;  3SG3 A;  5CSI A;  1RK9 A;  4DUQ A;  1K90 D;  5G08 A;  4CFQ A;  1JF2 A;  1JUO A;  3I5G C;  1Y1X A;  3SG2 A;  1DTL A;  2G9B A;  1CMF A;  1TNP A;  1YUS A;  1QTX A;  1QAT A;  3AKB A;  1YX8 A;  1DGV A;  1KK7 Z;  2JNF A;  4YI9 A;  2LVJ A;  2PVB A;  3NSO A;  1U5I B;  1XVJ A;  3DVM A;  1HT9 A;  1G8I A;  1RJV A;  2GGM A;  3BYA A;  2P6B B;  4YI8 A;  1NIW A;  2LHL A;  2VRG A;  1S3P A;  4PHN A;  1RRO A;  1GJY A;  4I5L B;  4YRU A;  3RLZ A;  3NSL A;  4P2Y B;  1Y0V H;  1IQ3 A;  1K2H A;  4CPV A;  2M9G A;  3I5H C;  1BOD A;  2COL B;  3VGO A;  1V1G A;  2KHN A;  4OKH A;  3DVK A;  5CPV A;  1NCX A;  5D69 A;  4PE7 A;  1TCF A;  1IJ6 A;  3IQQ A;  1JF0 A;  2CBL A;  1H4B A;  2BCB A;  2CTN A;  1BJF A;  3CTN A;  3LL8 B;  4U8D A;  4PE0 A;  1F8H A;  2LMT A;  2OS8 C;  1X02 A;  1A75 A;  1CFF A;  2LMV A;  3VRP A;  4FTG A;  1DJI A;  1S36 A;  1UHN A;  4ETO A;  1OOJ A;  1OSA A;  1SL8 A;  2G2B A;  5DKN A;  1CFP A;  2BL0 C;  3PAT A;  2LC5 A;  3BUW B;  1SR6 B;  1QXP A;  4TNC A;  5HKZ A;  1SNL A;  3WHT B;  2K7D A;  5I2O A;  1ALW A;  2LP3 A;  1FPW A;  3GK1 A;  3D10 A;  2CT9 A;  1XK4 C;  2AUC A;  1SW8 A;  1OZO A;  1DGU A;  1DVI A;  3LK0 A;  3VRR A;  1ZFS A;  3PAL A;  1AJ4 A;  2ISD A;  2KGB C;  1F4O A;  1AHR A;  1Y6W A;  3I5H B;  3WHU B;  1NX2 A;  1B47 A;  2JTT A;  1SPY A;  1KCY A;  1NX3 A;  2BKI B;  4CFR A;  1QV1 A;  4BY4 A;  2AAO A;  4NDB A;  5ER5 A;  3ZNI A;  1TNQ A;  1ALV A;  4Q04 A;  2EC6 B;  4CID A;  1K96 A;  2M49 B;  1GGZ A;  1XYD A;  1YX7 A;  2K61 A;  1CDM A;  1MXE A;  1XK4 A;  1YRU B;  2KYF A;  2LMU A;  2TN4 A;  3PN7 C;  2I2R E;  3TDZ A;  1FF1 A;  4P5O E;  5I2Q A;  2KFG A;  3RM1 A;  2BE4 A;  1NWD A;  2KNE A;  1B8C A;  1KFX S;  2PAS A;  2M8U A;  1UWO A;  1BF5 A;  2JUL A;  2WCB A;  2JZI A;  1LXF C;  3BUN B;  1K9K A;  1ZAC A;  5FYX A;  1EJ3 A;  4GAO A;  5PAL A;  4QJ5 B;  3BUO B;  1N65 A;  3SG7 A;  2OPO A;  3JVT C;  4GUK A;  1KK8 B;  1YUT A;  2R2I A;  1NP8 A;  2AMI A;  2E30 A;  4PHM A;  4YGE B;  5I8N A;  1NYA A;  2ZFD A;  1QVI Y;  1R6P A;  1SCM C;  4E68 A;  1WRL A;  1S6J A;  2I7A A;  3TDI A;  2WCE A;  1XFU O;  4MBE A;  2KQY A;  2LAN A;  4AQJ A;  1KWO B;  2JT3 A;  1LKJ A;  2WOR A;  1S6C A;  4YGB B;  1K93 D;  3PFV A;  5CSJ A;  1DF0 A;  1S5G Y;  1L2O C;  2PSR A;  4ORB B;  4NDC A;  1FI5 A;  1A2X A;  1L2O B;  2LUC A;  4AQI A;  1K9P A;  3SG4 A;  1L7Z A;  1B4C A;  1ZOT B;  3GK2 A;  1M39 A;  1QX7 A;  3OX6 A;  2K7B A;  2F8P A;  3ICB A;  1YVL A;  1NSH A;  2M7L A;  3TZ1 A;  1QX2 A;  4OCI A;  5CSF A;  3EKJ A;  3K21 A;  3I5I B;  3BOW A;  1J55 A;  3GOF A;  4WQ2 A;  1M46 A;  2KI4 B;  2K8M B;  3FS7 A;  1D1O A;  2F33 A;  3CLN A;  3VRO A;  1REC A;  3FIA A;  4USL A;  2KQ6 A;  3CR5 X;  1W7I B;  1LIN A;  3NSK A;  1UUR A;  3WNX B;  3DVE A;  1CMG A;  1JSA A;  1XFY O;  2BE6 A;  2Y1N A;  3EVV A;  2WOS A;  1CDP A;  3O78 A;  4YGC B;  4F0Z B;  3E3R A;  3VRN A;  4DCK A;  2EC6 C;  1RTP 1;  2KAV A;  2LLU A;  1UHH A;  1JFJ A;  2L4H A;  2ZN8 A;  1KQM C;  1YTZ C;  3WXA A;  1U5I A;  2JXL A;  2PRU A;  4ZCU A;  1CDL A;  3TS5 B;  1SY9 A;  3C1V A;  3LK1 A;  3NXA A;  4GGF A;  4A4B A;  1N2D A;  1UHJ A;  5HLV A;  4NQG A;  4ORC B;  1ZUZ A;  3IQO A;  1A75 B;  2I18 A;  4N5X A;  2KSP A;  1MQ1 A;  2KGR A;  2NCO A;  1MR8 A;  1LA3 A;  2KI6 D;  3CR4 X;  4GNK B;  3JTD B;  1UHI A;  4ICB A;  2KOT A;  4HSZ A;  1CLM A;  1JFK A;  1KFU S;  1F4Q A;  3EVU A;  4FQO A;  4YGA A;  1IWQ A;  1KFX L;  2L2E A;  3VRQ A;  4PE1 A;  1J7P A;  4MN0 A;  2A4J A;  2DOQ A;  5AER A;  1IRJ A;  4XYN A;  2F3Z A;  4C0J A;  2F2P A;  1J7R A;  1NX0 A;  1F70 A;  4MZK A;  1WDC B;  2K0J A;  1OE9 B;  1KK8 C;  2BEC A;  2HPS A;  1WY9 A;  3SIA A;  2F3Y A;  2B1U A;  3KEV A;  1SKT A;  2NLN A;  2ZND A;  3OP0 A;  3CR2 A;  1OMV A;  2QAC A;  1S6I A;  1TNW A;  2L50 A;  1CB1 A;  2BCA A;  4BY5 A;  3EK4 A;  1BR1 B;  3LLE A;  2PAL A;  1CNP A;  4I5J A;  4N1F A;  5AAN A;  3PN7 B;  4R1E A;  3TUY B;  1QJT A;  4QJ4 B;  2Y5I A;  1UP5 A;  3DD4 A;  4PE4 A;  2JOJ A;  1BT6 A;  2Q91 A;  2LVI A; 
#chains in the Genus database with same CATH topology
 4HRH A;  1TTX A;  5CSN A;  2F2O A;  3PM8 A;  1FW4 A;  1YR5 A;  4L9M A;  3TDU A;  2LNK A;  4PAL A;  3D75 A;  4PDZ A;  2JXC A;  1EXR A;  1KQM B;  1PRW A;  1SRA A;  2KAX A;  1DJG A;  1MF8 B;  3KO0 A;  4GFT A;  1VRK A;  1TCO B;  1M31 A;  3LCP C;  5HLO A;  3CS1 A;  4DS7 A;  1ZMZ A;  2JNX A;  2CNP A;  1B1G A;  1W7J B;  2NCP A;  2ERB A;  4PCW A;  5IBW A;  1WRZ A;  1B8L A;  1SCM B;  1LVC D;  1IH0 A;  2M97 A;  2KLD A;  4DRW A;  1J7O A;  1KSO A;  2Y4Q A;  4M2Q A;  1K9U A;  1QS7 A;  1QX5 B;  1TRF A;  1FI6 A;  1PVB A;  2P71 A;  1QIW A;  2Y1M A;  1EH2 A;  1NPQ A;  1DJZ A;  1PVA A;  3D0Y A;  3D78 A;  2OS8 B;  1CKK A;  2K7C A;  3AAJ A;  2M1K B;  1AJ5 A;  1CTR A;  2KFF A;  2K7O A;  2E6W A;  1BU3 A;  1NX1 A;  2WC6 A;  3BXK A;  1N0Y A;  2O60 A;  3SG6 A;  1CM4 A;  1AUI B;  1J1D A;  1DQE A;  1Y1U A;  2GV5 A;  3N7H A;  4N1G A;  3IVT A;  2LAP A;  1K94 A;  1KSM A;  4C0L A;  1EL4 A;  1XFX O;  2L0P A;  5AEQ A;  1V1F A;  2KI6 C;  3B86 A;  1QLS A;  3KHE A;  4NDD A;  2SAS A;  1F71 A;  1IG5 A;  1IQ5 A;  1NCZ A;  2H61 C;  2WCM A;  1F55 A;  1GQM A;  2JTZ A;  4AOM A;  3CDN A;  1C3Z A;  3PSR A;  4JKT A;  1R2U A;  1BLQ A;  2KI4 C;  4OZD A;  1TIZ A;  2WND A;  2JWW A;  4DIR A;  1UHK A;  1UUS A;  3PLF B;  1XO5 A;  1MWN A;  1IIO A;  3HCM A;  2PMY A;  1CFD A;  1IGV A;  2MLE C;  4I5K A;  4CLN A;  1WLZ A;  5HKW A;  3QRX A;  1Q80 A;  3H4S E;  3I5G B;  2MLF C;  3O2P A;  2FJU B;  2LVV A;  3D74 A;  5FI6 A;  2L5Y A;  3CZ1 A;  1CDN A;  1DT7 B;  1NCY A;  3DF0 A;  5I94 A;  1E8A A;  3AAK A;  1NUB A;  1IJ5 A;  1S26 D;  2JT8 A;  3BUX B;  4C0K A;  2MRD A;  1PSR A;  1ODB A;  3AKA A;  1C07 A;  3S0B A;  2H61 A;  2JPT A;  2KDH A;  3F45 A;  4M2P A;  1QIV A;  1KK7 Y;  5HL1 A;  3B87 A;  5HYD A;  2JQ6 A;  2LE9 B;  3PJI A;  2FCD A;  4MZJ A;  1TN4 A;  4GPL B;  4XJK B;  1YUU A;  1KQV A;  1CLL A;  1WDC C;  1CFC A;  1JC2 A;  3BUM B;  2KBM A;  2H8V A;  3IF7 A;  2M3W A;  1OMD A;  3M0W A;  2KBI A;  2L4I A;  2JRF A;  1K8U A;  2LCP A;  4YGD B;  3TS5 C;  2LVK A;  1M45 A;  1J7Q A;  4MRX A;  3DF0 B;  1BR4 B;  1SK6 D;  1M63 B;  5JJG A;  1OOH A;  2Q4U A;  5D7F A;  1JWD A;  2M29 A;  1XFV O;  1GGW A;  2L98 A;  2HQ8 A;  3SIB A;  5AXI A;  1G4Y R;  2WCL A;  3CWG A;  2HET A;  1C7W A;  1B7T Y;  1OZS A;  2ZN9 A;  4M2O A;  1DJY A;  4JQ0 D;  2M1U A;  3I5F B;  3PM2 A;  1FBV A;  4FQT A;  5DKQ A;  1BOC A;  3I5F C;  1WLM A;  5GQQ C;  3UO9 A;  3Q8I A;  1OMR A;  2MA2 A;  1DEK A;  1OQP A;  2FCE A;  3CZ0 A;  3KF9 A;  2KAY A;  5KTY A;  3DVJ A;  5J3X A;  3O6B A;  2D8N A;  2ZRS A;  3EK7 A;  4IL1 A;  3I5I C;  1SL9 A;  1Y1A A;  1YVH A;  2JU0 A;  2ZRT A;  3OX5 A;  3CGA A;  1B9A A;  3A4U B;  1XFR A;  2BCX A;  3SJS A;  1A03 A;  3SS5 A;  3SS3 A;  2MHH A;  2SCP A;  3NSI A;  1J1E A;  2I94 A;  1RFJ A;  3O4Y A;  2BL0 B;  2OTG C;  1SL7 A;  4YBH B;  3L4L A;  1TWO A;  5TNC A;  1AVS A;  3EKH A;  3JTD C;  3HX4 A;  2JC2 A;  2EHB A;  4QJ3 B;  1SBJ A;  1SR6 C;  4GGN A;  4D1E A;  4XJK A;  4MLW A;  4OV2 A;  1XFZ O;  2EGD A;  2LV7 A;  1PUL A;  1YRT B;  4KYN A;  3TUY C;  1KFU L;  1QAS A;  3DZT A;  2LLT A;  3KPX A;  2LM5 A;  5FI2 A;  1C3Y A;  1XFW O;  1G33 A;  1AK8 A;  1TUZ A;  3SG5 A;  3BFA A;  1OOG A;  2ZKM X;  2BKH B;  3D0Y B;  1PSB A;  2QPT A;  3FWB A;  5HKY A;  1HQV A;  2HQW A;  2L2C A;  4GBA A;  1SCV A;  1DJX A;  2MBX A;  4UPG A;  1QLK A;  2WCJ A;  4HRE E;  1S5G Z;  1SMG A;  2HF5 A;  2JT0 A;  2V53 A;  3EVR A;  4ORA B;  5KU1 A;  1C7V A;  2GGZ A;  1JBA A;  1DJW A;  2OTG B;  3MSE B;  1KWO C;  1PAL A;  4ZCV A;  4JWQ A;  1MHO A;  4INW A;  1QVI Z;  2FOT A;  2WCF A;  3ZWH A;  2LP2 A;  3R1V A;  1AP4 A;  3BQ3 A;  5AFP A;  2NZ0 A;  3CZT X;  3S0F A;  2K2A A;  2MAZ A;  3EK8 A;  2KYC A;  1A4P A;  5ER4 X;  3B88 A;  2JPO A;  2LUX A;  2O5G A;  1F54 A;  2L5X B;  4PHJ A;  1QWV A;  3D73 A;  3GK4 X;  1RWY A;  4HRG A;  2M7N A;  5K89 A;  2L51 A;  1B8R A;  3DXL A;  2M0R A;  1TNX A;  2KLE A;  1PK0 D;  1BMO A;  2BBM A;  1EG4 A;  2K2F A;  4OR9 B;  3FWC A;  5DIC A;  2IS9 A;  4MRY A;  4I5N B;  2MJW B;  3CAB A;  3JVT B;  1MUX A;  1MXL C;  1K95 A;  2KFH A;  5I2L A;  2CXJ A;  3BOW B;  1YUR A;  4MSP A;  1CLB A;  2NXQ A;  5B8I B;  3L4A A;  5D3O A;  5F6T A;  3OB1 B;  2WC8 A;  4MZL A;  4GGF C;  4WQ3 A;  1IKU A;  1B7T Z;  1LA0 A;  1DJH A;  1WRK A;  1QV0 A;  2LLS A;  1OOI X;  4MEW A;  5KSZ A;  1CM1 A;  4A4C A;  4WRI A;  3A8R A;  1A29 A;  3OB2 B;  3S0A A;  1BG1 A;  1EG3 A;  2CCM A;  4MVF A;  2LHI A;  3OBV A;  3OHM B;  5BPJ A;  4PHK A;  2H2K A;  1TOP A;  1Z2C B;  4JPZ B;  1DMO A;  1S1E A;  2WCK A;  2RGI A;  1H8B A;  3D76 A;  1XA5 A;  4OVN F;  2ZNE A;  1DF0 B;  5DKR A;  5JOL A;  1SYM A;  2BBN A;  3SG3 A;  5CSI A;  1RK9 A;  4DUQ A;  1K90 D;  1W9Z A;  3S0D A;  5G08 A;  4CFQ A;  1JF2 A;  1JUO A;  3I5G C;  1Y1X A;  3SG2 A;  1DTL A;  2G9B A;  4JD9 A;  1CMF A;  1TNP A;  1YUS A;  1QTX A;  1QAT A;  3AKB A;  1YX8 A;  1DGV A;  1OOF A;  1KK7 Z;  2JNF A;  2K60 A;  4YI9 A;  2LVJ A;  2PVB A;  3NSO A;  2QEV A;  1U5I B;  1XVJ A;  3DVM A;  1HT9 A;  1G8I A;  1RJV A;  2GGM A;  2QDI A;  2P6B B;  3BYA A;  1NIW A;  2LHL A;  2VRG A;  2FJY A;  1S3P A;  4YI8 A;  4PHN A;  1RRO A;  1GJY A;  4I5L B;  4YRU A;  3RLZ A;  3NSL A;  2PQL A;  4P2Y B;  1Y0V H;  1IQ3 A;  1K2H A;  4CPV A;  2M9G A;  3I5H C;  1BOD A;  1OW4 A;  2COL B;  3VGO A;  1V1G A;  2KHN A;  4OKH A;  3DVK A;  5CPV A;  1NCX A;  5D69 A;  4PE7 A;  1TCF A;  1IJ6 A;  3IQQ A;  1JF0 A;  2CBL A;  3FE6 A;  1T14 A;  1H4B A;  2BCB A;  2CTN A;  1BJF A;  3CTN A;  1DEL A;  3LL8 B;  4U8D A;  4PE0 A;  1F8H A;  2LMT A;  2BNX A;  2OS8 C;  1X02 A;  1A75 A;  1CFF A;  2LMV A;  3VRP A;  2PYQ A;  4FTG A;  1DJI A;  1S36 A;  3FE9 A;  1Z4H A;  1UHN A;  3BFB A;  1OOJ A;  4ETO A;  2KPH A;  1OSA A;  1SL8 A;  2G2B A;  5DKN A;  1CFP A;  2BL0 C;  3PAT A;  2GTE A;  2LC5 A;  3BUW B;  1SR6 B;  1QXP A;  4TNC A;  5HKZ A;  1SNL A;  3WHT B;  2K7D A;  5I2O A;  1SSE B;  1ALW A;  2LP3 A;  1FPW A;  3GK1 A;  3D10 A;  2CT9 A;  1XK4 C;  2AUC A;  1SW8 A;  1OZO A;  1DGU A;  1DVI A;  3LK0 A;  3VRR A;  1ZFS A;  3PAL A;  1AJ4 A;  2ISD A;  2KGB C;  1F4O A;  1AHR A;  1Y6W A;  3I5H B;  3WHU B;  4IJ7 A;  2QEH A;  1NX2 A;  1B47 A;  2JTT A;  1SPY A;  3RZS A;  1KCY A;  1NX3 A;  2BKI B;  4CFR A;  1QV1 A;  4BY4 A;  2AAO A;  4NDB A;  5ER5 A;  3ZNI A;  1TNQ A;  1ALV A;  4Q04 A;  2EC6 B;  4CID A;  1K96 A;  2M49 B;  1GGZ A;  1XYD A;  1YX7 A;  2K61 A;  1CDM A;  1MXE A;  1XK4 A;  1YRU B;  2KYF A;  2LMU A;  2WC5 A;  2TN4 A;  3PN7 C;  2I2R E;  3TDZ A;  1FF1 A;  1ORG A;  4P5O E;  5FI7 A;  5I2Q A;  2KFG A;  3B7A A;  3RM1 A;  2BE4 A;  1NWD A;  2KNE A;  1B8C A;  1KFX S;  2PAS A;  2M8U A;  2YGU A;  1UWO A;  1BF5 A;  2JUL A;  2WCB A;  2JZI A;  1LXF C;  3BUN B;  1K9K A;  1ZAC A;  5FYX A;  1EJ3 A;  4GAO A;  5PAL A;  4QJ5 B;  2WCH A;  3BUO B;  1N65 A;  3SG7 A;  2OPO A;  3JVT C;  4GUK A;  1KK8 B;  1YUT A;  2R2I A;  1NP8 A;  2AMI A;  2E30 A;  4PHM A;  4YGE B;  5I8N A;  1NYA A;  2ZFD A;  1QVI Y;  1R6P A;  1SCM C;  4E68 A;  1WRL A;  1S6J A;  2I7A A;  3TDI A;  2WCE A;  1XFU O;  4MBE A;  2KQY A;  2LAN A;  4AQJ A;  1KWO B;  2JT3 A;  1LKJ A;  2WOR A;  3S0E A;  1S6C A;  3FE8 A;  4YGB B;  1K93 D;  3PFV A;  5CSJ A;  1DF0 A;  1S5G Y;  1L2O C;  2PSR A;  4ORB B;  4NDC A;  3OGN A;  4F7F A;  1FI5 A;  1A2X A;  1L2O B;  2LUC A;  4AQI A;  3QME A;  1K9P A;  3SG4 A;  1L7Z A;  1B4C A;  1ZOT B;  3GK2 A;  1M39 A;  1QX7 A;  3OX6 A;  2K7B A;  3UNW A;  2F8P A;  3ICB A;  1YVL A;  1NSH A;  2M7L A;  3TZ1 A;  1QX2 A;  4OCI A;  5CSF A;  3EKJ A;  3K21 A;  3I5I B;  2QEO A;  3BOW A;  1J55 A;  3GOF A;  3R1P A;  1M46 A;  2KI4 B;  2K8M B;  3FS7 A;  4WQ2 A;  1D1O A;  2F33 A;  3CLN A;  3VRO A;  1REC A;  3FIA A;  4USL A;  2KQ6 A;  3CR5 X;  5EL2 A;  3EG5 B;  1W7I B;  3DY9 A;  1LIN A;  3NSK A;  1TUJ A;  1UUR A;  3WNX B;  3DVE A;  1CMG A;  1JSA A;  3VB1 A;  1XFY O;  2BE6 A;  2Y1N A;  3EVV A;  2WOS A;  1CDP A;  3O78 A;  4YGC B;  4F0Z B;  1GM0 A;  3E3R A;  3VRN A;  4DCK A;  3R72 A;  2EC6 C;  1RTP 1;  2KAV A;  2LLU A;  1UHH A;  1JFJ A;  2L4H A;  2ZN8 A;  1KQM C;  1YTZ C;  3WXA A;  1U5I A;  2JXL A;  2PRU A;  4ZCU A;  1CDL A;  3TS5 B;  1SY9 A;  3V2L A;  3C1V A;  3LK1 A;  3NXA A;  2P70 A;  4GGF A;  4A4B A;  1N2D A;  1DC1 A;  1UHJ A;  5HLV A;  4NQG A;  4ORC B;  1ZUZ A;  3L47 A;  3IQO A;  1A75 B;  3BFH A;  2I18 A;  4N5X A;  2KSP A;  1MQ1 A;  1P28 A;  3B6X A;  2KGR A;  3O4X A;  2NCO A;  3CZ2 A;  1MR8 A;  1LA3 A;  2KI6 D;  1LS8 A;  3CR4 X;  4GNK B;  3JTD B;  1UHI A;  4ICB A;  2KOT A;  3BJH A;  4HSZ A;  1CLM A;  1JFK A;  1KFU S;  1F4Q A;  3EVU A;  4FQO A;  4YGA A;  1IWQ A;  1KFX L;  2L2E A;  2QEB A;  3VRQ A;  3S0G A;  4PE1 A;  3CYZ A;  3SS4 A;  1J7P A;  4MN0 A;  2A4J A;  2DOQ A;  5AER A;  1IRJ A;  3NHI A;  4XYN A;  2F3Z A;  3DYE A;  4C0J A;  2F2P A;  2BAP A;  1J7R A;  3D77 A;  3R1O A;  1NX0 A;  1F70 A;  4MZK A;  1WDC B;  2K0J A;  3K1E A;  1OE9 B;  1KK8 C;  2BEC A;  2HPS A;  1WY9 A;  3SIA A;  2F3Y A;  2B1U A;  3KEV A;  4PT1 A;  1SKT A;  2NLN A;  2ZND A;  3OP0 A;  3CR2 A;  1OMV A;  2QAC A;  1S6I A;  1TNW A;  2L50 A;  1CB1 A;  2BCA A;  4BY5 A;  3EK4 A;  1BR1 B;  3LLE A;  3NGV A;  2PAL A;  1CNP A;  4I5J A;  4N1F A;  5AAN A;  3PN7 B;  4R1E A;  3TUY B;  1QJT A;  4QJ4 B;  2Y5I A;  1UP5 A;  3NHT A;  3DD4 A;  4INX A;  4PE4 A;  2JOJ A;  1BT6 A;  2Q91 A;  2LVI A; 
#chains in the Genus database with same CATH homology
 4HRH A;  1TTX A;  5CSN A;  2F2O A;  3PM8 A;  1FW4 A;  1YR5 A;  4L9M A;  3TDU A;  2LNK A;  4PAL A;  4PDZ A;  2JXC A;  1EXR A;  1KQM B;  1PRW A;  1SRA A;  2KAX A;  1DJG A;  1MF8 B;  3KO0 A;  4GFT A;  1VRK A;  1TCO B;  1M31 A;  3LCP C;  5HLO A;  3CS1 A;  4DS7 A;  1ZMZ A;  2JNX A;  2CNP A;  1B1G A;  1W7J B;  2NCP A;  4PCW A;  5IBW A;  1WRZ A;  1B8L A;  1SCM B;  1LVC D;  1IH0 A;  2M97 A;  4DRW A;  1J7O A;  1KSO A;  2Y4Q A;  4M2Q A;  1K9U A;  1QS7 A;  1QX5 B;  1TRF A;  1FI6 A;  1PVB A;  2Y1M A;  1QIW A;  1EH2 A;  1NPQ A;  1DJZ A;  1PVA A;  3D0Y A;  2OS8 B;  1CKK A;  2K7C A;  3AAJ A;  2M1K B;  1AJ5 A;  1CTR A;  2KFF A;  2K7O A;  2E6W A;  1BU3 A;  1NX1 A;  3BXK A;  1N0Y A;  2O60 A;  3SG6 A;  1CM4 A;  1AUI B;  1J1D A;  1Y1U A;  2GV5 A;  4N1G A;  2LAP A;  1K94 A;  1KSM A;  4C0L A;  1EL4 A;  1XFX O;  2L0P A;  5AEQ A;  1V1F A;  2KI6 C;  1QLS A;  3KHE A;  4NDD A;  2SAS A;  1F71 A;  1IG5 A;  1IQ5 A;  1NCZ A;  2H61 C;  1F55 A;  1GQM A;  2JTZ A;  4AOM A;  3PSR A;  1BLQ A;  1R2U A;  2KI4 C;  1TIZ A;  2WND A;  2JWW A;  4DIR A;  1UHK A;  1UUS A;  3PLF B;  1XO5 A;  1MWN A;  3HCM A;  2PMY A;  1CFD A;  1IGV A;  2MLE C;  4I5K A;  4CLN A;  1WLZ A;  5HKW A;  3QRX A;  1Q80 A;  3H4S E;  3I5G B;  2MLF C;  3O2P A;  2FJU B;  2LVV A;  1CDN A;  1DT7 B;  1NCY A;  3DF0 A;  1E8A A;  3AAK A;  1NUB A;  1IJ5 A;  1S26 D;  2JT8 A;  3BUX B;  4C0K A;  2MRD A;  1PSR A;  1ODB A;  3AKA A;  1C07 A;  2H61 A;  2JPT A;  2KDH A;  3F45 A;  4M2P A;  1QIV A;  1KK7 Y;  5HYD A;  2JQ6 A;  2LE9 B;  2FCD A;  4MZJ A;  1TN4 A;  4GPL B;  4XJK B;  1YUU A;  1KQV A;  1CLL A;  1WDC C;  1CFC A;  1JC2 A;  3BUM B;  2KBM A;  3IF7 A;  2M3W A;  1OMD A;  3M0W A;  2KBI A;  2L4I A;  2JRF A;  1K8U A;  2LCP A;  4YGD B;  3TS5 C;  2LVK A;  1M45 A;  1J7Q A;  4MRX A;  3DF0 B;  1BR4 B;  1SK6 D;  1M63 B;  5JJG A;  2Q4U A;  1JWD A;  5D7F A;  2M29 A;  1XFV O;  1GGW A;  2L98 A;  2HQ8 A;  3SIB A;  5AXI A;  1G4Y R;  3CWG A;  2HET A;  1C7W A;  1B7T Y;  1OZS A;  2ZN9 A;  4M2O A;  1DJY A;  4JQ0 D;  2M1U A;  3I5F B;  1FBV A;  5DKQ A;  1BOC A;  3I5F C;  1WLM A;  5GQQ C;  1OMR A;  2MA2 A;  1OQP A;  2FCE A;  3KF9 A;  2KAY A;  5KTY A;  3DVJ A;  5J3X A;  3O6B A;  2D8N A;  2ZRS A;  3EK7 A;  4IL1 A;  3I5I C;  1SL9 A;  1Y1A A;  1YVH A;  2JU0 A;  2ZRT A;  3OX5 A;  3CGA A;  1B9A A;  3A4U B;  2BCX A;  3SJS A;  1A03 A;  2MHH A;  2SCP A;  3NSI A;  1J1E A;  2I94 A;  1RFJ A;  3O4Y A;  2BL0 B;  2OTG C;  1SL7 A;  4YBH B;  5TNC A;  1AVS A;  3EKH A;  3JTD C;  3HX4 A;  2JC2 A;  2EHB A;  4QJ3 B;  1SBJ A;  1SR6 C;  4GGN A;  4D1E A;  4XJK A;  4MLW A;  4OV2 A;  1XFZ O;  2EGD A;  2LV7 A;  1PUL A;  1YRT B;  3TUY C;  1KFU L;  1QAS A;  3KPX A;  2LLT A;  2LM5 A;  1XFW O;  1G33 A;  1AK8 A;  3SG5 A;  2ZKM X;  2BKH B;  3D0Y B;  1PSB A;  2QPT A;  3FWB A;  5HKY A;  1HQV A;  2HQW A;  4GBA A;  1SCV A;  1DJX A;  2MBX A;  4UPG A;  1QLK A;  4HRE E;  1S5G Z;  2HF5 A;  1SMG A;  2JT0 A;  2V53 A;  3EVR A;  4ORA B;  5KU1 A;  1C7V A;  2GGZ A;  1JBA A;  1DJW A;  2OTG B;  3MSE B;  1KWO C;  1PAL A;  4ZCV A;  4JWQ A;  1MHO A;  1QVI Z;  2FOT A;  2WCF A;  3ZWH A;  2LP2 A;  1AP4 A;  3BQ3 A;  5AFP A;  2NZ0 A;  3CZT X;  2K2A A;  2MAZ A;  3EK8 A;  2KYC A;  1A4P A;  5ER4 X;  2LUX A;  2O5G A;  1F54 A;  2L5X B;  4PHJ A;  3GK4 X;  1RWY A;  4HRG A;  2M7N A;  5K89 A;  2L51 A;  1B8R A;  2M0R A;  1TNX A;  1PK0 D;  1BMO A;  2BBM A;  1EG4 A;  2K2F A;  4OR9 B;  3FWC A;  2IS9 A;  4MRY A;  4I5N B;  2MJW B;  3JVT B;  1MUX A;  1MXL C;  1K95 A;  2KFH A;  5I2L A;  2CXJ A;  3BOW B;  1YUR A;  4MSP A;  1CLB A;  2NXQ A;  5B8I B;  5F6T A;  3OB1 B;  2WC8 A;  4MZL A;  4GGF C;  4WQ3 A;  1IKU A;  1B7T Z;  1LA0 A;  1DJH A;  1WRK A;  1QV0 A;  2LLS A;  4MEW A;  5KSZ A;  1CM1 A;  4A4C A;  4WRI A;  3A8R A;  1A29 A;  3OB2 B;  1BG1 A;  1EG3 A;  2CCM A;  4MVF A;  2LHI A;  3OHM B;  5BPJ A;  4PHK A;  2H2K A;  1TOP A;  4JPZ B;  1DMO A;  1S1E A;  1H8B A;  2RGI A;  5DKR A;  1XA5 A;  4OVN F;  2ZNE A;  1DF0 B;  5JOL A;  1SYM A;  2BBN A;  3SG3 A;  5CSI A;  1RK9 A;  4DUQ A;  1K90 D;  5G08 A;  4CFQ A;  1JF2 A;  1JUO A;  3I5G C;  1Y1X A;  3SG2 A;  1DTL A;  2G9B A;  1CMF A;  1TNP A;  1YUS A;  1QTX A;  1QAT A;  3AKB A;  1YX8 A;  1DGV A;  1KK7 Z;  2JNF A;  4YI9 A;  2LVJ A;  2PVB A;  3NSO A;  1U5I B;  1XVJ A;  3DVM A;  1HT9 A;  1G8I A;  1RJV A;  2GGM A;  3BYA A;  2P6B B;  4YI8 A;  1NIW A;  2LHL A;  2VRG A;  1S3P A;  4PHN A;  1RRO A;  1GJY A;  4I5L B;  4YRU A;  3RLZ A;  3NSL A;  4P2Y B;  1Y0V H;  1IQ3 A;  1K2H A;  4CPV A;  2M9G A;  3I5H C;  1BOD A;  2COL B;  3VGO A;  1V1G A;  2KHN A;  4OKH A;  3DVK A;  5CPV A;  1NCX A;  5D69 A;  4PE7 A;  1TCF A;  1IJ6 A;  3IQQ A;  1JF0 A;  2CBL A;  1H4B A;  2BCB A;  2CTN A;  1BJF A;  3CTN A;  3LL8 B;  4U8D A;  4PE0 A;  1F8H A;  2LMT A;  2OS8 C;  1X02 A;  1A75 A;  1CFF A;  2LMV A;  3VRP A;  4FTG A;  1DJI A;  1S36 A;  1UHN A;  4ETO A;  1OOJ A;  1OSA A;  1SL8 A;  2G2B A;  5DKN A;  1CFP A;  2BL0 C;  3PAT A;  2LC5 A;  3BUW B;  1SR6 B;  1QXP A;  4TNC A;  5HKZ A;  1SNL A;  3WHT B;  2K7D A;  5I2O A;  1ALW A;  2LP3 A;  1FPW A;  3GK1 A;  3D10 A;  2CT9 A;  1XK4 C;  2AUC A;  1SW8 A;  1OZO A;  1DGU A;  1DVI A;  3LK0 A;  3VRR A;  1ZFS A;  3PAL A;  1AJ4 A;  2ISD A;  2KGB C;  1F4O A;  1AHR A;  1Y6W A;  3I5H B;  3WHU B;  1NX2 A;  1B47 A;  2JTT A;  1SPY A;  1KCY A;  1NX3 A;  2BKI B;  4CFR A;  1QV1 A;  4BY4 A;  2AAO A;  4NDB A;  5ER5 A;  3ZNI A;  1TNQ A;  1ALV A;  4Q04 A;  2EC6 B;  4CID A;  1K96 A;  2M49 B;  1GGZ A;  1XYD A;  1YX7 A;  2K61 A;  1CDM A;  1MXE A;  1XK4 A;  1YRU B;  2KYF A;  2LMU A;  2TN4 A;  3PN7 C;  2I2R E;  3TDZ A;  1FF1 A;  4P5O E;  5I2Q A;  2KFG A;  3RM1 A;  2BE4 A;  1NWD A;  2KNE A;  1B8C A;  1KFX S;  2PAS A;  2M8U A;  1UWO A;  1BF5 A;  2JUL A;  2WCB A;  2JZI A;  1LXF C;  3BUN B;  1K9K A;  1ZAC A;  5FYX A;  1EJ3 A;  4GAO A;  5PAL A;  4QJ5 B;  3BUO B;  1N65 A;  3SG7 A;  2OPO A;  3JVT C;  4GUK A;  1KK8 B;  1YUT A;  2R2I A;  1NP8 A;  2AMI A;  2E30 A;  4PHM A;  4YGE B;  5I8N A;  1NYA A;  2ZFD A;  1QVI Y;  1R6P A;  1SCM C;  4E68 A;  1WRL A;  1S6J A;  2I7A A;  3TDI A;  2WCE A;  1XFU O;  4MBE A;  2KQY A;  2LAN A;  4AQJ A;  1KWO B;  2JT3 A;  1LKJ A;  2WOR A;  1S6C A;  4YGB B;  1K93 D;  3PFV A;  5CSJ A;  1DF0 A;  1S5G Y;  1L2O C;  2PSR A;  4ORB B;  4NDC A;  1FI5 A;  1A2X A;  1L2O B;  2LUC A;  4AQI A;  1K9P A;  3SG4 A;  1L7Z A;  1B4C A;  1ZOT B;  3GK2 A;  1M39 A;  1QX7 A;  3OX6 A;  2K7B A;  2F8P A;  3ICB A;  1YVL A;  1NSH A;  2M7L A;  3TZ1 A;  1QX2 A;  4OCI A;  5CSF A;  3EKJ A;  3K21 A;  3I5I B;  3BOW A;  1J55 A;  3GOF A;  4WQ2 A;  1M46 A;  2KI4 B;  2K8M B;  3FS7 A;  1D1O A;  2F33 A;  3CLN A;  3VRO A;  1REC A;  3FIA A;  4USL A;  2KQ6 A;  3CR5 X;  1W7I B;  1LIN A;  3NSK A;  1UUR A;  3WNX B;  3DVE A;  1CMG A;  1JSA A;  1XFY O;  2BE6 A;  2Y1N A;  3EVV A;  2WOS A;  1CDP A;  3O78 A;  4YGC B;  4F0Z B;  3E3R A;  3VRN A;  4DCK A;  2EC6 C;  1RTP 1;  2KAV A;  2LLU A;  1UHH A;  1JFJ A;  2L4H A;  2ZN8 A;  1KQM C;  1YTZ C;  3WXA A;  1U5I A;  2JXL A;  2PRU A;  4ZCU A;  1CDL A;  3TS5 B;  1SY9 A;  3C1V A;  3LK1 A;  3NXA A;  4GGF A;  4A4B A;  1N2D A;  1UHJ A;  5HLV A;  4NQG A;  4ORC B;  1ZUZ A;  3IQO A;  1A75 B;  2I18 A;  4N5X A;  2KSP A;  1MQ1 A;  2KGR A;  2NCO A;  1MR8 A;  1LA3 A;  2KI6 D;  3CR4 X;  4GNK B;  3JTD B;  1UHI A;  4ICB A;  2KOT A;  4HSZ A;  1CLM A;  1JFK A;  1KFU S;  1F4Q A;  3EVU A;  4FQO A;  4YGA A;  1IWQ A;  1KFX L;  2L2E A;  3VRQ A;  4PE1 A;  1J7P A;  4MN0 A;  2A4J A;  2DOQ A;  5AER A;  1IRJ A;  4XYN A;  2F3Z A;  4C0J A;  2F2P A;  1J7R A;  1NX0 A;  1F70 A;  4MZK A;  1WDC B;  2K0J A;  1OE9 B;  1KK8 C;  2BEC A;  2HPS A;  1WY9 A;  3SIA A;  2F3Y A;  2B1U A;  3KEV A;  1SKT A;  2NLN A;  2ZND A;  3OP0 A;  3CR2 A;  1OMV A;  2QAC A;  1S6I A;  1TNW A;  2L50 A;  1CB1 A;  2BCA A;  4BY5 A;  3EK4 A;  1BR1 B;  3LLE A;  2PAL A;  1CNP A;  4I5J A;  4N1F A;  5AAN A;  3PN7 B;  4R1E A;  3TUY B;  1QJT A;  4QJ4 B;  2Y5I A;  1UP5 A;  3DD4 A;  4PE4 A;  2JOJ A;  1BT6 A;  2Q91 A;  2LVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...