4DIRA

2.6 angstrom x-ray structure of human ca(2+)-s100a5
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
78
Chain Sequence
TPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A5
publication title Target-binding to S100A5 changes Ca(2+)-binding affinity and dynamics.
rcsb
source organism Homo sapiens
total genus 30
structure length 78
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dirA00
4D1EA 3BQ3A 5HLOA 4YI9A 5TNCA 1WLZA 1K96A 2L0PA 3WHTB 1N65A 2JPTA 2KDHA 2LANA 2OS8C 3WHUB 2KHNA 1YUUA 3CR2A 4PHMA 4AOMA 4AQIA 2PSRA 3I5IB 1RK9A 1QJTA 2M29A 1L2OC 3GK1A 4MEWA 1CLMA 1CDMA 1B1GA 1FBVA 5PALA 1NPQA 1ALWA 3BUNB 3E3RA 2BCXA 4YGCB 5CSNA 1JF2A 3M0WA 3BOWB 1GQMA 2LHLA 2M7NA 3AAJA 1DJYA 2KAVA 1TNQA 2IS9A 4FTGA 1CB1A 3KF9A 1SPYA 2BL0C 4C0JA 5AEQA 4PE4A 1KWOB 4MRXA 1IQ5A 1QTXA 1LKJA 1XK4A 4ZCUA 2ZKMX 4CLNA 1ZFSA 2L4IA 5AERA 2Y1MA 1AUIB 1GGWA 1DGVA 1KK8B 1Y1UA 1F71A 2ZFDA 3I5GC 4UPGA 4NQGA 5FYXA 2R2IA 3DVKA 1FI5A 2PRUA 1U5IA 3EVVA 1M63B 4OR9B 1S3PA 1CLLA 1VRKA 2L98A 2VRGA 1XFXO 1KQVA 1KFUL 2LV7A 2KFFA 1NCZA 1K90D 2NZ0A 2EGDA 2H2KA 1KSMA 1PULA 1KQMC 3NSLA 1J7QA 1CFDA 3DVJA 2O5GA 5CSJA 2MLEC 4QJ3B 4M2PA 1BT6A 1FF1A 3D0YA 1JFJA 1FI6A 1LVCD 1K9PA 5ER5A 4A4CA 2JXCA 3IQOA 3SG7A 3ZWHA 1B4CA 1TCFA 2ZRTA 4YRUA 1OMRA 1PVBA 3PFVA 2LLSA 3SG5A 2KQYA 4DS7A 1NYAA 3CTNA 4GGNA 1QASA 1MXEA 2MBXA 5K89A 4JWQA 1YTZC 1K2HA 2E6WA 2M49B 1TNPA 1TN4A 4BY5A 1EJ3A 1WRZA 3PSRA 4GAOA 4Q04A 1OE9B 1PSRA 2Q91A 1DJIA 1SY9A 2PMYA 2JTZA 5G08A 1DJHA 1SCMB 3PN7C 4YI8A 2MAZA 1B8CA 2KSPA 4MN0A 1XVJA 1S36A 2WCEA 1NUBA 2BCAA 2HQWA 2LMTA 1ALVA 2CTNA 4E68A 1TRFA 2LVVA 2SASA 4CFQA 3GK4X 1JBAA 3TUYC 1NP8A 3SG2A 4MZLA 1ODBA 3CR4X 4DCKA 1S5GY 5CPVA 5I2QA 1CDNA 1DF0A 1JF0A 1EG4A 4XYNA 1UHJA 3I5FB 4P2YB 4C0KA 4PE0A 2WORA 3SG6A 5JOLA 2CBLA 2Y1NA 3AKAA 3AAKA 1UP5A 2ZNDA 1TNWA 1SBJA 1B7TY 2QPTA 1QVIY 2L2EA 1S6CA 2MLFC 2HF5A 4N5XA 2BKHB 5HLVA 4GGFC 1QX5B 5DKRA 1FW4A 2KAYA 3CWGA 2M3WA 5AFPA 1ZACA 3OHMB 1W7JB 1EL4A 2K7OA 1TOPA 2KAXA 1K9KA 1M45A 3EVUA 4GNKB 1BU3A 1Y6WA 2JU0A 4WRIA 3ZNIA 1XA5A 4USLA 2BE6A 3TDUA 1N2DA 3H4SE 1EH2A 3BUWB 1V1GA 4MVFA 2I2RE 3LK0A 1GGZA 1YUTA 2KFHA 4I5LB 2HETA 4GFTA 1F70A 3JVTB 2QACA 1SR6B 1CNPA 2JT0A 1IJ5A 1LINA 1BLQA 5BPJA 3DF0A 4MSPA 5ER4X 3TS5B 2LVKA 3OX5A 2JOJA 3A8RA 1PK0D 1M39A 1OQPA 1OZSA 1RWYA 3O2PA 4OKHA 2CXJA 4ORBB 2PVBA 2GGMA 4PHJA 5I2LA 2KGRA 2I18A 4JPZB 1YR5A 1RJVA 2BCBA 1AJ4A 3KEVA 1KFXL 1J55A 2AUCA 2K7CA 1WDCC 1WRKA 2LLTA 4HSZA 3I5HB 2M0RA 1KK7Z 2LHIA 3VRQA 1U5IB 3K21A 3IQQA 3SJSA 2FJUB 2KBMA 2KI6C 2K2AA 2CNPA 1W7IB 1NIWA 3CR5X 3SG3A 1IQ3A 1F54A 1QX7A 3DD4A 2BBNA 1YURA 4OCIA 4ORAB 2K61A 1SNLA 2PASA 1DGUA 1XFZO 1K9UA 4GGFA 3LL8B 5CSIA 1MF8B 3VRPA 1CFFA 1YX8A 3NSKA 2OS8B 2KBIA 3D0YB 2MJWB 1UWOA 1CTRA 2KQ6A 1PALA 1L7ZA 1L2OB 4YGDB 2JT3A 1SKTA 2Y5IA 4MRYA 3KO0A 3CZTX 2F2PA 1Y0VH 2L4HA 3BYAA 3DVEA 2F33A 4CPVA 2KNEA 2KGBC 1DTLA 2JXLA 1A29A 3VROA 4I5JA 1LXFC 2JC2A 2ZRSA 1J7RA 1V1FA 4MZKA 2ISDA 5GQQC 4WQ3A 1K95A 2BL0B 2E30A 1DJXA 1CDPA 1H8BA 1RROA 2BE4A 1KFXS 2NXQA 4PCWA 1QXPA 2LUCA 4XJKA 1XFUO 3I5GB 4U8DA 4AQJA 2OTGC 4NDBA 4PALA 2CT9A 4I5NB 3WNXB 2CCMA 1QV0A 1OOJA 1JC2A 2JULA 1OMVA 2BECA 2LUXA 5I8NA 4YGEB 2K2FA 1BG1A 5JJGA 4ETOA 2ZNEA 1ZOTB 1DF0B 4F0ZB 3CGAA 1IH0A 1UHIA 2F2OA 2GGZA 1YRUB 2OPOA 1N0YA 1M46A 1IGVA 3OB2B 3PLFB 2JZIA 1RECA 2EC6C 2K7BA 3EVRA 3VGOA 1J1EA 2KYCA 5CSFA 1KQMB 1MWNA 2Y4QA 1BODA 5D69A 2WCBA 3SIAA 3JTDC 1CMFA 1K8UA 1HT9A 5HKWA 1ZUZA 1SCVA 1SW8A 3FS7A 4TNCA 2LNKA 3CS1A 3QRXA 4PHNA 2LVJA 1CFPA 1D1OA 1TIZA 1XFYO 1CMGA 2AMIA 2L50A 2KI4C 4N1FA 4JQ0D 1F55A 3ICBA 1DMOA 4YGAA 1JUOA 3KPXA 2LMVA 2MRDA 1SK6D 1OMDA 4ZCVA 5I2OA 1PRWA 1BOCA 4PE7A 2JNXA 2G9BA 1G4YR 1AJ5A 1XYDA 3I5IC 3F45A 1XO5A 2NCPA 1JWDA 3DF0B 4NDDA 3PN7B 1QLKA 2WC8A 2G2BA 2V53A 1MR8A 3AKBA 2KFGA 4R1EA 1B8RA 3BUMB 3PATA 2F8PA 2M7LA 3LLEA 4OV2A 2RGIA 3TUYB 1IJ6A 1WY9A 1KWOC 4QJ4B 3OP0A 1K94A 2GV5A 1DJZA 3VRRA 1PVAA 1QIVA 2COLB 1JSAA 1G33A 2JTTA 5KSZA 1J1DA 1KK8C 4QJ5B 1EG3A 1S6JA 2M8UA 1X02A 1SYMA 5HKZA 1K93D 2M97A 4HREE 1QLSA 1RFJA 2MA2A 1A75A 3A4UB 1IG5A 1YVLA 1KSOA 1UHHA 4M2OA 1XFVO 3OX6A 2MHHA 3OB1B 4YGBB 5HYDA 4CFRA 1EXRA 1F4QA 1NCXA 5AXIA 2P6BB 3NXAA 1DVIA 3TZ1A 1NSHA 1BR4B 5HKYA 5DKQA 2WCFA 2NCOA 2PALA 1C07A 1BMOA 4MZJA 1CM1A 3EKJA 1UUSA 1A4PA 2LAPA 2L51A 4ICBA 1S6IA 1SRAA 1NX2A 3PALA 2JT8A 3FIAA 5B8IB 1MQ1A 1SL8A 2JRFA 3TDZA 2WOSA 4HRHA 1MHOA 5F6TA 1J7OA 4PHKA 2K7DA 2FCEA 1AP4A 1PSBA 1S26D 2BBMA 5KU1A 1A2XA 3WXAA 4P5OE 2M1UA 1GJYA 4ORCB 3GK2A 2B1UA 3BXKA 1BJFA 3BOWA 4GBAA 3HCMA 2K0JA 4XJKB 3VRNA 1S5GZ 1R2UA 2ZN9A 1QS7A 3NSIA 3D10A 1WDCB 1DJWA 1SL7A 1QV1A 1SCMC 3TDIA 3HX4A 1LA0A 1OZOA 1KCYA 4CIDA 1A03A 3LCPC 2Q4UA 1B47A 2LLUA 3BUXB 1MUXA 1B7TZ 1C7WA 1QVIZ 2JNFA 1TCOB 3EK7A 4HRGA 2FOTA 2LM5A 4YBHB 1QIWA 2WNDA 1B8LA 1B9AA 2F3ZA 2LE9B 3FWBA 1YUSA 4DRWA 2H61C 3I5FC 4M2QA 1C7VA 1KK7Y 1F8HA 1NX1A 4A4BA 1R6PA 2HPSA 4N1GA 1ZMZA 2A4JA 1M31A 1IWQA 3GOFA 1BR1B 3SIBA 3RLZA 1IKUA 1AVSA 5D7FA 5J3XA 3PM8A 3CLNA 3IF7A 1CKKA 2NLNA 1DJGA 2M9GA 2L5XB 3FWCA 4WQ2A 1RTP1 2KI6D 1Q80A 1QATA 1SMGA 3O4YA 3MSEB 4L9MA 3DVMA 4PDZA 5KTYA 1DT7B 3SG4A 1NCYA 3C1VA 2HQ8A 1LA3A 2KYFA 4BY4A 1TNXA 1MXLC 1AK8A 2F3YA 1CDLA 3O6BA 2I7AA 1TTXA 2TN4A 1UURA 4NDCA 1S1EA 3RM1A 2DOQA 3JVTC 1SR6C 2OTGB 2LC5A 1CLBA 1AHRA 4GUKA 2I94A 4MLWA 1OSAA 1KFUS 5DKNA 1YX7A 3O78A 3TS5C 1F4OA 1SL9A 1Y1AA 4OVNF 2ZN8A 1NWDA 1WLMA 1CFCA 1QX2A 5AANA 3BUOB 1HQVA 1XK4C 4DIRA 2BKIB 3NSOA 4IL1A 2LCPA 1E8AA 2SCPA 2EC6B 2O60A 2KOTA 5IBWA 4MBEA 2M1KB 2K8MB 1NX0A 4FQOA 1CM4A 2JWWA 3I5HC 1BF5A 4I5KA 1IRJA 2H61A 2JQ6A 4PE1A 3JTDB 2EHBA 1A75B 1XFWO 4C0LA 1YVHA 3EKHA 4GPLB 3EK4A 2LVIA 1WRLA 3LK1A 4DUQA 1H4BA 3KHEA 1YRTB 1UHNA 2KI4B 2LMUA 3EK8A 1UHKA 2FCDA 1Y1XA 2D8NA 1J7PA 1G8IA 1NX3A 2LP2A 2AAOA 1FPWA 2LP3A 1JFKA
chains in the Genus database with same CATH superfamily
4D1EA 3BQ3A 5HLOA 4YI9A 5TNCA 1WLZA 1K96A 2L0PA 3WHTB 1N65A 2JPTA 2KDHA 2LANA 2OS8C 3WHUB 2YGUA 2KHNA 1YUUA 2QEVA 3CR2A 4PHMA 4AOMA 4AQIA 2KLDA 2PSRA 3I5IB 1RK9A 1QJTA 1IIOA 2M29A 1L2OC 3GK1A 4MEWA 1CLMA 1CDMA 1B1GA 1FBVA 5PALA 1NPQA 2KPHA 1ALWA 2WCLA 1OOIX 3BUNB 3E3RA 2BCXA 4YGCB 5CSNA 1JF2A 3M0WA 3IVTA 3BOWB 1GQMA 2LHLA 2M7NA 3AAJA 3DZTA 1DJYA 2KAVA 1TNQA 2IS9A 2P71A 3PJIA 3KF9A 4FTGA 1SPYA 1CB1A 3B88A 2BL0C 4C0JA 5AEQA 3S0EA 4PE4A 1KWOB 4MRXA 1IQ5A 5FI7A 1QTXA 1LKJA 1XK4A 4ZCUA 2ZKMX 4CLNA 1ZFSA 2L4IA 5AERA 2Y1MA 1AUIB 1GGWA 1DGVA 1KK8B 1Y1UA 1F71A 2ZFDA 3I5GC 4UPGA 4NQGA 5FYXA 2R2IA 3NHTA 3UO9A 3DVKA 1FI5A 2PRUA 1U5IA 3EVVA 1M63B 4OR9B 1S3PA 4INWA 1CLLA 1VRKA 2L98A 2VRGA 1XFXO 3B7AA 1KQVA 1KFUL 2LV7A 3K1EA 2KFFA 1NCZA 1K90D 3B87A 2NZ0A 2EGDA 2H2KA 1KSMA 1PULA 1KQMC 3NSLA 1J7QA 1CFDA 3DVJA 2O5GA 5CSJA 2MLEC 4QJ3B 4M2PA 1BT6A 1FF1A 3D0YA 1JFJA 1FI6A 1LVCD 1K9PA 5ER5A 4A4CA 2JXCA 3IQOA 3SG7A 3ZWHA 1B4CA 1TCFA 2ZRTA 4YRUA 5D3OA 1OMRA 1PVBA 3PFVA 2LLSA 3CZ1A 3SG5A 3BFBA 3BJHA 2KQYA 4DS7A 1NYAA 3CTNA 1DEKA 4GGNA 3S0AA 1QASA 1MXEA 2MBXA 5K89A 4JWQA 1YTZC 1K2HA 2E6WA 2M49B 1TNPA 1TN4A 4BY5A 1EJ3A 1WRZA 3PSRA 4GAOA 4Q04A 1OE9B 1PSRA 2Q91A 3R1OA 1DJIA 1SY9A 1DC1A 2PMYA 2JTZA 5G08A 1DJHA 1SCMB 3PN7C 4YI8A 2MAZA 1B8CA 2KSPA 4MN0A 1XVJA 1S36A 2WCEA 1NUBA 2BCAA 2HQWA 2LMTA 1ALVA 2CTNA 4E68A 1TRFA 2LVVA 2SASA 4CFQA 3GK4X 1JBAA 3TUYC 1NP8A 3SG2A 4MZLA 1ODBA 3CR4X 4DCKA 1S5GY 5CPVA 5I2QA 1CDNA 1DF0A 1JF0A 1OOGA 1EG4A 4XYNA 1UHJA 3I5FB 4P2YB 4C0KA 4PE0A 2WORA 3SG6A 5JOLA 2CBLA 2Y1NA 3AKAA 3SS5A 3AAKA 1UP5A 2ZNDA 1TNWA 1QWVA 1SBJA 1B7TY 2QPTA 1QVIY 2L2EA 1S6CA 2MLFC 2HF5A 3O4XA 2BKHB 3D73A 4GGFC 1QX5B 4N5XA 5DKRA 5HLVA 1FW4A 2KAYA 3CWGA 4WQ2A 2M3WA 5AFPA 1ZACA 3OHMB 1W7JB 1EL4A 2K7OA 3D74A 5HL1A 1TOPA 2KAXA 1K9KA 1M45A 3EVUA 4GNKB 3S0FA 1BU3A 1Y6WA 2JU0A 4WRIA 3ZNIA 1XA5A 4USLA 2BE6A 3TDUA 1N2DA 3H4SE 3UNWA 1EH2A 3BUWB 1V1GA 4MVFA 2I2RE 3LK0A 1GGZA 1YUTA 2KFHA 4I5LB 2HETA 4GFTA 3S0DA 4PT1A 1F70A 3JVTB 2QACA 1SR6B 1CNPA 2JT0A 1IJ5A 1LINA 1BLQA 5BPJA 3DF0A 3D77A 4MSPA 5ER4X 3TS5B 2LVKA 3OX5A 2JOJA 3A8RA 1PK0D 1M39A 1OQPA 1OZSA 2L2CA 1RWYA 3O2PA 4OKHA 2CXJA 4ORBB 2PVBA 2GGMA 4PHJA 5I2LA 2KGRA 2I18A 4JPZB 1YR5A 1RJVA 2BCBA 1AJ4A 3KEVA 1KFXL 1J55A 2AUCA 2K7CA 1WDCC 1WRKA 2LLTA 4HSZA 3I5HB 2M0RA 5EL2A 1KK7Z 2LHIA 3VRQA 1U5IB 3K21A 2QEBA 3IQQA 3SJSA 2FJUB 2KBMA 2KI6C 2K2AA 2CNPA 1W7IB 1NIWA 3CR5X 3SG3A 3QMEA 1IQ3A 1F54A 1QX7A 3DD4A 2BBNA 1YURA 4OCIA 4ORAB 2K61A 1SNLA 2PASA 3OBVA 1DGUA 1XFZO 1K9UA 4GGFA 3LL8B 5CSIA 3RZSA 1MF8B 3VRPA 1CFFA 1YX8A 3NSKA 2OS8B 2KBIA 3D0YB 2MJWB 1TWOA 1UWOA 1CTRA 2KQ6A 1PALA 1L7ZA 1L2OB 4YGDB 1LS8A 2JT3A 1SKTA 2Y5IA 4MRYA 3KO0A 3CZTX 4IJ7A 2F2PA 1Y0VH 2L4HA 3BYAA 3DVEA 3Q8IA 2L5YA 2F33A 5I94A 2WCJA 4CPVA 2KNEA 2KGBC 1DTLA 2JXLA 1A29A 3VROA 1DQEA 4I5JA 1LXFC 2JC2A 2ZRSA 1J7RA 1V1FA 4MZKA 2ISDA 5GQQC 4WQ3A 1K95A 2BL0B 3S0GA 2E30A 1C3YA 4JD9A 3CZ2A 1DJXA 1CDPA 1H8BA 1RROA 2BE4A 1KFXS 2NXQA 4PCWA 1QXPA 2LUCA 4XJKA 1XFUO 3I5GB 4U8DA 1OW4A 2OTGC 4NDBA 4PALA 2CT9A 4I5NB 3WNXB 1OOHA 4AQJA 2CCMA 1QV0A 1OOJA 4KYNA 1JC2A 2GTEA 1OMVA 2BECA 2JULA 2LUXA 5I8NA 4YGEB 2K2FA 1BG1A 5JJGA 4ETOA 2ZNEA 1ZOTB 1DF0B 4F0ZB 3CGAA 1IH0A 1UHIA 2F2OA 2GGZA 2WC6A 1YRUB 2OPOA 1N0YA 1M46A 1IGVA 3OB2B 3L47A 2JZIA 1RECA 3PLFB 2EC6C 2K7BA 3EVRA 3VGOA 1J1EA 2KYCA 5CSFA 1KQMB 1MWNA 2Y4QA 1BODA 5D69A 2WCBA 3SIAA 3JTDC 3L4AA 1CMFA 1K8UA 1HT9A 5HKWA 1ZUZA 1SCVA 1SW8A 3FS7A 4TNCA 2LNKA 3CS1A 3QRXA 1SSEB 4PHNA 2LVJA 1CFPA 1D1OA 1TIZA 1XFYO 1CMGA 2AMIA 2BAPA 2L50A 2KI4C 4N1FA 2BNXA 4JQ0D 3D78A 1F55A 3ICBA 2PYQA 1DMOA 2KLEA 4YGAA 1JUOA 3D76A 3KPXA 2LMVA 2MRDA 1SK6D 1OMDA 4ZCVA 1TUZA 5I2OA 1PRWA 1BOCA 4PE7A 2JNXA 2G9BA 1G4YR 1AJ5A 1XFRA 1XYDA 3I5IC 3F45A 1XO5A 3S0BA 2NCPA 1JWDA 3DF0B 4NDDA 3PN7B 1QLKA 2WC8A 2G2BA 2H8VA 2V53A 1MR8A 3AKBA 2KFGA 4R1EA 1B8RA 3BFHA 3BUMB 3PATA 2F8PA 2M7LA 3LLEA 4OV2A 2RGIA 3TUYB 2PQLA 1IJ6A 1WY9A 1KWOC 4QJ4B 3OP0A 2JPOA 1K94A 2GV5A 1DJZA 4OZDA 1PVAA 1QIVA 2COLB 2QDIA 3VRRA 1JSAA 1G33A 2JTTA 3CABA 5KSZA 1J1DA 1KK8C 4QJ5B 1EG3A 1S6JA 2M8UA 1X02A 1SYMA 3NGVA 4INXA 5HKZA 1K93D 3CZ0A 2M97A 4HREE 4JKTA 1QLSA 1RFJA 2MA2A 1A75A 5FI2A 3V2LA 3A4UB 1IG5A 1YVLA 1KSOA 1UHHA 4M2OA 1T14A 1XFVO 3OX6A 2MHHA 3OB1B 4YGBB 5HYDA 4CFRA 1EXRA 1F4QA 1NCXA 3DXLA 5AXIA 2P6BB 3NXAA 1DVIA 3TZ1A 1NSHA 1BR4B 3FE6A 3DY9A 5DKQA 5HKYA 2WCFA 1Z2CB 2NCOA 2PALA 1C07A 1BMOA 4MZJA 1CM1A 3EKJA 1UUSA 1A4PA 1C3ZA 2L51A 2LAPA 4ICBA 1S6IA 1SRAA 2ERBA 1NX2A 3FE8A 3PALA 2JT8A 3FIAA 5B8IB 1MQ1A 2K60A 1SL8A 2JRFA 3TDZA 2WOSA 4HRHA 1MHOA 5F6TA 2WC5A 1J7OA 1OOFA 2FJYA 2K7DA 2FCEA 4PHKA 1AP4A 1PSBA 1S26D 3CDNA 2BBMA 5KU1A 1A2XA 3WXAA 4P5OE 2M1UA 3CYZA 1GJYA 4ORCB 4F7FA 3GK2A 2B1UA 3SS3A 3BXKA 1BJFA 2QEHA 3BOWA 4GBAA 3HCMA 2K0JA 2P70A 4XJKB 3VRNA 1S5GZ 1R2UA 2ZN9A 1QS7A 3NSIA 3D10A 1P28A 1WDCB 1DJWA 1SL7A 1QV1A 1SCMC 3TDIA 1TUJA 3HX4A 1LA0A 1OZOA 1KCYA 3L4LA 4CIDA 2WCMA 1A03A 3LCPC 2Q4UA 1B47A 4FQTA 2LLUA 3BUXB 1MUXA 1B7TZ 1C7WA 1QVIZ 2JNFA 1TCOB 3EK7A 4HRGA 1ORGA 1Z4HA 2FOTA 2LM5A 4YBHB 3D75A 3OGNA 1QIWA 2WNDA 1B8LA 1B9AA 2F3ZA 2LE9B 3FWBA 1YUSA 4DRWA 2H61C 1DELA 3I5FC 4M2QA 1C7VA 1KK7Y 3B86A 1F8HA 1NX1A 4A4BA 1R6PA 2HPSA 4N1GA 1ZMZA 3R1PA 2A4JA 3VB1A 1M31A 1IWQA 3GOFA 1BR1B 3SIBA 3NHIA 3RLZA 1IKUA 1AVSA 3DYEA 5D7FA 5J3XA 3PM8A 3CLNA 3IF7A 1CKKA 2NLNA 1DJGA 2M9GA 2L5XB 2QEOA 3FWCA 3R72A 1RTP1 2KI6D 1Q80A 1QATA 1SMGA 3O4YA 3MSEB 1GM0A 4L9MA 3DVMA 4PDZA 5KTYA 1DT7B 3SG4A 1NCYA 3SS4A 3C1VA 2HQ8A 1LA3A 2KYFA 3FE9A 4BY4A 1TNXA 1MXLC 1AK8A 2F3YA 1CDLA 3O6BA 2I7AA 1TTXA 2TN4A 1UURA 4NDCA 1S1EA 3RM1A 2DOQA 3JVTC 1W9ZA 2WCKA 1SR6C 2OTGB 2LC5A 1CLBA 1AHRA 4GUKA 2I94A 4MLWA 1OSAA 1KFUS 5DKNA 1YX7A 3O78A 3TS5C 1F4OA 1SL9A 1Y1AA 4OVNF 2ZN8A 1NWDA 1WLMA 1CFCA 1QX2A 3R1VA 3BFAA 3BUOB 5AANA 1HQVA 1XK4C 3PM2A 4DIRA 2BKIB 3NSOA 4IL1A 2LCPA 1E8AA 2SCPA 2EC6B 2WCHA 2O60A 2KOTA 5IBWA 4MBEA 2M1KB 2K8MB 1NX0A 5DICA 3N7HA 4FQOA 1CM4A 2JWWA 3I5HC 3EG5B 4I5KA 1IRJA 2H61A 2JQ6A 1BF5A 4PE1A 3JTDB 2EHBA 1A75B 1XFWO 4C0LA 1YVHA 3B6XA 3EKHA 4GPLB 3EK4A 2LVIA 1WRLA 3LK1A 4DUQA 1H4BA 3KHEA 1YRTB 1UHNA 2KI4B 2LMUA 3EK8A 5FI6A 1UHKA 2FCDA 1Y1XA 2D8NA 1J7PA 1G8IA 1NX3A 2LP2A 2AAOA 1FPWA 2LP3A 1JFKA
chains in the Genus database with same CATH topology
4D1EA 3BQ3A 5HLOA 4YI9A 5TNCA 1WLZA 1K96A 2L0PA 3WHTB 1N65A 2JPTA 2KDHA 2LANA 2OS8C 3WHUB 2KHNA 1YUUA 3CR2A 4PHMA 4AOMA 4AQIA 2PSRA 3I5IB 1RK9A 1QJTA 2M29A 1L2OC 3GK1A 4MEWA 1CLMA 1CDMA 1B1GA 1FBVA 5PALA 1NPQA 1ALWA 3BUNB 3E3RA 2BCXA 4YGCB 5CSNA 1JF2A 3M0WA 3BOWB 1GQMA 2LHLA 2M7NA 3AAJA 1DJYA 2KAVA 1TNQA 2IS9A 4FTGA 1CB1A 3KF9A 1SPYA 2BL0C 4C0JA 5AEQA 4PE4A 1KWOB 4MRXA 1IQ5A 1QTXA 1LKJA 1XK4A 4ZCUA 2ZKMX 4CLNA 1ZFSA 2L4IA 5AERA 2Y1MA 1AUIB 1GGWA 1DGVA 1KK8B 1Y1UA 1F71A 2ZFDA 3I5GC 4UPGA 4NQGA 5FYXA 2R2IA 3DVKA 1FI5A 2PRUA 1U5IA 3EVVA 1M63B 4OR9B 1S3PA 1CLLA 1VRKA 2L98A 2VRGA 1XFXO 1KQVA 1KFUL 2LV7A 2KFFA 1NCZA 1K90D 2NZ0A 2EGDA 2H2KA 1KSMA 1PULA 1KQMC 3NSLA 1J7QA 1CFDA 3DVJA 2O5GA 5CSJA 2MLEC 4QJ3B 4M2PA 1BT6A 1FF1A 3D0YA 1JFJA 1FI6A 1LVCD 1K9PA 5ER5A 4A4CA 2JXCA 3IQOA 3SG7A 3ZWHA 1B4CA 1TCFA 2ZRTA 4YRUA 1OMRA 1PVBA 3PFVA 2LLSA 3SG5A 2KQYA 4DS7A 1NYAA 3CTNA 4GGNA 1QASA 1MXEA 2MBXA 5K89A 4JWQA 1YTZC 1K2HA 2E6WA 2M49B 1TNPA 1TN4A 4BY5A 1EJ3A 1WRZA 3PSRA 4GAOA 4Q04A 1OE9B 1PSRA 2Q91A 1DJIA 1SY9A 2PMYA 2JTZA 5G08A 1DJHA 1SCMB 3PN7C 4YI8A 2MAZA 1B8CA 2KSPA 4MN0A 1XVJA 1S36A 2WCEA 1NUBA 2BCAA 2HQWA 2LMTA 1ALVA 2CTNA 4E68A 1TRFA 2LVVA 2SASA 4CFQA 3GK4X 1JBAA 3TUYC 1NP8A 3SG2A 4MZLA 1ODBA 3CR4X 4DCKA 1S5GY 5CPVA 5I2QA 1CDNA 1DF0A 1JF0A 1EG4A 4XYNA 1UHJA 3I5FB 4P2YB 4C0KA 4PE0A 2WORA 3SG6A 5JOLA 2CBLA 2Y1NA 3AKAA 3AAKA 1UP5A 2ZNDA 1TNWA 1SBJA 1B7TY 2QPTA 1QVIY 2L2EA 1S6CA 2MLFC 2HF5A 4N5XA 2BKHB 5HLVA 4GGFC 1QX5B 5DKRA 1FW4A 2KAYA 3CWGA 2M3WA 5AFPA 1ZACA 3OHMB 1W7JB 1EL4A 2K7OA 1TOPA 2KAXA 1K9KA 1M45A 3EVUA 4GNKB 1BU3A 1Y6WA 2JU0A 4WRIA 3ZNIA 1XA5A 4USLA 2BE6A 3TDUA 1N2DA 3H4SE 1EH2A 3BUWB 1V1GA 4MVFA 2I2RE 3LK0A 1GGZA 1YUTA 2KFHA 4I5LB 2HETA 4GFTA 1F70A 3JVTB 2QACA 1SR6B 1CNPA 2JT0A 1IJ5A 1LINA 1BLQA 5BPJA 3DF0A 4MSPA 5ER4X 3TS5B 2LVKA 3OX5A 2JOJA 3A8RA 1PK0D 1M39A 1OQPA 1OZSA 1RWYA 3O2PA 4OKHA 2CXJA 4ORBB 2PVBA 2GGMA 4PHJA 5I2LA 2KGRA 2I18A 4JPZB 1YR5A 1RJVA 2BCBA 1AJ4A 3KEVA 1KFXL 1J55A 2AUCA 2K7CA 1WDCC 1WRKA 2LLTA 4HSZA 3I5HB 2M0RA 1KK7Z 2LHIA 3VRQA 1U5IB 3K21A 3IQQA 3SJSA 2FJUB 2KBMA 2KI6C 2K2AA 2CNPA 1W7IB 1NIWA 3CR5X 3SG3A 1IQ3A 1F54A 1QX7A 3DD4A 2BBNA 1YURA 4OCIA 4ORAB 2K61A 1SNLA 2PASA 1DGUA 1XFZO 1K9UA 4GGFA 3LL8B 5CSIA 1MF8B 3VRPA 1CFFA 1YX8A 3NSKA 2OS8B 2KBIA 3D0YB 2MJWB 1UWOA 1CTRA 2KQ6A 1PALA 1L7ZA 1L2OB 4YGDB 2JT3A 1SKTA 2Y5IA 4MRYA 3KO0A 3CZTX 2F2PA 1Y0VH 2L4HA 3BYAA 3DVEA 2F33A 4CPVA 2KNEA 2KGBC 1DTLA 2JXLA 1A29A 3VROA 4I5JA 1LXFC 2JC2A 2ZRSA 1J7RA 1V1FA 4MZKA 2ISDA 5GQQC 4WQ3A 1K95A 2BL0B 2E30A 1DJXA 1CDPA 1H8BA 1RROA 2BE4A 1KFXS 2NXQA 4PCWA 1QXPA 2LUCA 4XJKA 1XFUO 3I5GB 4U8DA 4AQJA 2OTGC 4NDBA 4PALA 2CT9A 4I5NB 3WNXB 2CCMA 1QV0A 1OOJA 1JC2A 2JULA 1OMVA 2BECA 2LUXA 5I8NA 4YGEB 2K2FA 1BG1A 5JJGA 4ETOA 2ZNEA 1ZOTB 1DF0B 4F0ZB 3CGAA 1IH0A 1UHIA 2F2OA 2GGZA 1YRUB 2OPOA 1N0YA 1M46A 1IGVA 3OB2B 3PLFB 2JZIA 1RECA 2EC6C 2K7BA 3EVRA 3VGOA 1J1EA 2KYCA 5CSFA 1KQMB 1MWNA 2Y4QA 1BODA 5D69A 2WCBA 3SIAA 3JTDC 1CMFA 1K8UA 1HT9A 5HKWA 1ZUZA 1SCVA 1SW8A 3FS7A 4TNCA 2LNKA 3CS1A 3QRXA 4PHNA 2LVJA 1CFPA 1D1OA 1TIZA 1XFYO 1CMGA 2AMIA 2L50A 2KI4C 4N1FA 4JQ0D 1F55A 3ICBA 1DMOA 4YGAA 1JUOA 3KPXA 2LMVA 2MRDA 1SK6D 1OMDA 4ZCVA 5I2OA 1PRWA 1BOCA 4PE7A 2JNXA 2G9BA 1G4YR 1AJ5A 1XYDA 3I5IC 3F45A 1XO5A 2NCPA 1JWDA 3DF0B 4NDDA 3PN7B 1QLKA 2WC8A 2G2BA 2V53A 1MR8A 3AKBA 2KFGA 4R1EA 1B8RA 3BUMB 3PATA 2F8PA 2M7LA 3LLEA 4OV2A 2RGIA 3TUYB 1IJ6A 1WY9A 1KWOC 4QJ4B 3OP0A 1K94A 2GV5A 1DJZA 3VRRA 1PVAA 1QIVA 2COLB 1JSAA 1G33A 2JTTA 5KSZA 1J1DA 1KK8C 4QJ5B 1EG3A 1S6JA 2M8UA 1X02A 1SYMA 5HKZA 1K93D 2M97A 4HREE 1QLSA 1RFJA 2MA2A 1A75A 3A4UB 1IG5A 1YVLA 1KSOA 1UHHA 4M2OA 1XFVO 3OX6A 2MHHA 3OB1B 4YGBB 5HYDA 4CFRA 1EXRA 1F4QA 1NCXA 5AXIA 2P6BB 3NXAA 1DVIA 3TZ1A 1NSHA 1BR4B 5HKYA 5DKQA 2WCFA 2NCOA 2PALA 1C07A 1BMOA 4MZJA 1CM1A 3EKJA 1UUSA 1A4PA 2LAPA 2L51A 4ICBA 1S6IA 1SRAA 1NX2A 3PALA 2JT8A 3FIAA 5B8IB 1MQ1A 1SL8A 2JRFA 3TDZA 2WOSA 4HRHA 1MHOA 5F6TA 1J7OA 4PHKA 2K7DA 2FCEA 1AP4A 1PSBA 1S26D 2BBMA 5KU1A 1A2XA 3WXAA 4P5OE 2M1UA 1GJYA 4ORCB 3GK2A 2B1UA 3BXKA 1BJFA 3BOWA 4GBAA 3HCMA 2K0JA 4XJKB 3VRNA 1S5GZ 1R2UA 2ZN9A 1QS7A 3NSIA 3D10A 1WDCB 1DJWA 1SL7A 1QV1A 1SCMC 3TDIA 3HX4A 1LA0A 1OZOA 1KCYA 4CIDA 1A03A 3LCPC 2Q4UA 1B47A 2LLUA 3BUXB 1MUXA 1B7TZ 1C7WA 1QVIZ 2JNFA 1TCOB 3EK7A 4HRGA 2FOTA 2LM5A 4YBHB 1QIWA 2WNDA 1B8LA 1B9AA 2F3ZA 2LE9B 3FWBA 1YUSA 4DRWA 2H61C 3I5FC 4M2QA 1C7VA 1KK7Y 1F8HA 1NX1A 4A4BA 1R6PA 2HPSA 4N1GA 1ZMZA 2A4JA 1M31A 1IWQA 3GOFA 1BR1B 3SIBA 3RLZA 1IKUA 1AVSA 5D7FA 5J3XA 3PM8A 3CLNA 3IF7A 1CKKA 2NLNA 1DJGA 2M9GA 2L5XB 3FWCA 4WQ2A 1RTP1 2KI6D 1Q80A 1QATA 1SMGA 3O4YA 3MSEB 4L9MA 3DVMA 4PDZA 5KTYA 1DT7B 3SG4A 1NCYA 3C1VA 2HQ8A 1LA3A 2KYFA 4BY4A 1TNXA 1MXLC 1AK8A 2F3YA 1CDLA 3O6BA 2I7AA 1TTXA 2TN4A 1UURA 4NDCA 1S1EA 3RM1A 2DOQA 3JVTC 1SR6C 2OTGB 2LC5A 1CLBA 1AHRA 4GUKA 2I94A 4MLWA 1OSAA 1KFUS 5DKNA 1YX7A 3O78A 3TS5C 1F4OA 1SL9A 1Y1AA 4OVNF 2ZN8A 1NWDA 1WLMA 1CFCA 1QX2A 5AANA 3BUOB 1HQVA 1XK4C 4DIRA 2BKIB 3NSOA 4IL1A 2LCPA 1E8AA 2SCPA 2EC6B 2O60A 2KOTA 5IBWA 4MBEA 2M1KB 2K8MB 1NX0A 4FQOA 1CM4A 2JWWA 3I5HC 1BF5A 4I5KA 1IRJA 2H61A 2JQ6A 4PE1A 3JTDB 2EHBA 1A75B 1XFWO 4C0LA 1YVHA 3EKHA 4GPLB 3EK4A 2LVIA 1WRLA 3LK1A 4DUQA 1H4BA 3KHEA 1YRTB 1UHNA 2KI4B 2LMUA 3EK8A 1UHKA 2FCDA 1Y1XA 2D8NA 1J7PA 1G8IA 1NX3A 2LP2A 2AAOA 1FPWA 2LP3A 1JFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1E A;  3BQ3 A;  5HLO A;  4YI9 A;  5TNC A;  1WLZ A;  1K96 A;  2L0P A;  3WHT B;  1N65 A;  2JPT A;  2KDH A;  2LAN A;  2OS8 C;  3WHU B;  2KHN A;  1YUU A;  3CR2 A;  4PHM A;  4AOM A;  4AQI A;  2PSR A;  3I5I B;  1RK9 A;  1QJT A;  2M29 A;  1L2O C;  3GK1 A;  4MEW A;  1CLM A;  1CDM A;  1B1G A;  1FBV A;  5PAL A;  1NPQ A;  1ALW A;  3BUN B;  3E3R A;  2BCX A;  4YGC B;  5CSN A;  1JF2 A;  3M0W A;  3BOW B;  1GQM A;  2LHL A;  2M7N A;  3AAJ A;  1DJY A;  2KAV A;  1TNQ A;  2IS9 A;  4FTG A;  1CB1 A;  3KF9 A;  1SPY A;  2BL0 C;  4C0J A;  5AEQ A;  4PE4 A;  1KWO B;  4MRX A;  1IQ5 A;  1QTX A;  1LKJ A;  1XK4 A;  4ZCU A;  2ZKM X;  4CLN A;  1ZFS A;  2L4I A;  5AER A;  2Y1M A;  1AUI B;  1GGW A;  1DGV A;  1KK8 B;  1Y1U A;  1F71 A;  2ZFD A;  3I5G C;  4UPG A;  4NQG A;  5FYX A;  2R2I A;  3DVK A;  1FI5 A;  2PRU A;  1U5I A;  3EVV A;  1M63 B;  4OR9 B;  1S3P A;  1CLL A;  1VRK A;  2L98 A;  2VRG A;  1XFX O;  1KQV A;  1KFU L;  2LV7 A;  2KFF A;  1NCZ A;  1K90 D;  2NZ0 A;  2EGD A;  2H2K A;  1KSM A;  1PUL A;  1KQM C;  3NSL A;  1J7Q A;  1CFD A;  3DVJ A;  2O5G A;  5CSJ A;  2MLE C;  4QJ3 B;  4M2P A;  1BT6 A;  1FF1 A;  3D0Y A;  1JFJ A;  1FI6 A;  1LVC D;  1K9P A;  5ER5 A;  4A4C A;  2JXC A;  3IQO A;  3SG7 A;  3ZWH A;  1B4C A;  1TCF A;  2ZRT A;  4YRU A;  1OMR A;  1PVB A;  3PFV A;  2LLS A;  3SG5 A;  2KQY A;  4DS7 A;  1NYA A;  3CTN A;  4GGN A;  1QAS A;  1MXE A;  2MBX A;  5K89 A;  4JWQ A;  1YTZ C;  1K2H A;  2E6W A;  2M49 B;  1TNP A;  1TN4 A;  4BY5 A;  1EJ3 A;  1WRZ A;  3PSR A;  4GAO A;  4Q04 A;  1OE9 B;  1PSR A;  2Q91 A;  1DJI A;  1SY9 A;  2PMY A;  2JTZ A;  5G08 A;  1DJH A;  1SCM B;  3PN7 C;  4YI8 A;  2MAZ A;  1B8C A;  2KSP A;  4MN0 A;  1XVJ A;  1S36 A;  2WCE A;  1NUB A;  2BCA A;  2HQW A;  2LMT A;  1ALV A;  2CTN A;  4E68 A;  1TRF A;  2LVV A;  2SAS A;  4CFQ A;  3GK4 X;  1JBA A;  3TUY C;  1NP8 A;  3SG2 A;  4MZL A;  1ODB A;  3CR4 X;  4DCK A;  1S5G Y;  5CPV A;  5I2Q A;  1CDN A;  1DF0 A;  1JF0 A;  1EG4 A;  4XYN A;  1UHJ A;  3I5F B;  4P2Y B;  4C0K A;  4PE0 A;  2WOR A;  3SG6 A;  5JOL A;  2CBL A;  2Y1N A;  3AKA A;  3AAK A;  1UP5 A;  2ZND A;  1TNW A;  1SBJ A;  1B7T Y;  2QPT A;  1QVI Y;  2L2E A;  1S6C A;  2MLF C;  2HF5 A;  4N5X A;  2BKH B;  5HLV A;  4GGF C;  1QX5 B;  5DKR A;  1FW4 A;  2KAY A;  3CWG A;  2M3W A;  5AFP A;  1ZAC A;  3OHM B;  1W7J B;  1EL4 A;  2K7O A;  1TOP A;  2KAX A;  1K9K A;  1M45 A;  3EVU A;  4GNK B;  1BU3 A;  1Y6W A;  2JU0 A;  4WRI A;  3ZNI A;  1XA5 A;  4USL A;  2BE6 A;  3TDU A;  1N2D A;  3H4S E;  1EH2 A;  3BUW B;  1V1G A;  4MVF A;  2I2R E;  3LK0 A;  1GGZ A;  1YUT A;  2KFH A;  4I5L B;  2HET A;  4GFT A;  1F70 A;  3JVT B;  2QAC A;  1SR6 B;  1CNP A;  2JT0 A;  1IJ5 A;  1LIN A;  1BLQ A;  5BPJ A;  3DF0 A;  4MSP A;  5ER4 X;  3TS5 B;  2LVK A;  3OX5 A;  2JOJ A;  3A8R A;  1PK0 D;  1M39 A;  1OQP A;  1OZS A;  1RWY A;  3O2P A;  4OKH A;  2CXJ A;  4ORB B;  2PVB A;  2GGM A;  4PHJ A;  5I2L A;  2KGR A;  2I18 A;  4JPZ B;  1YR5 A;  1RJV A;  2BCB A;  1AJ4 A;  3KEV A;  1KFX L;  1J55 A;  2AUC A;  2K7C A;  1WDC C;  1WRK A;  2LLT A;  4HSZ A;  3I5H B;  2M0R A;  1KK7 Z;  2LHI A;  3VRQ A;  1U5I B;  3K21 A;  3IQQ A;  3SJS A;  2FJU B;  2KBM A;  2KI6 C;  2K2A A;  2CNP A;  1W7I B;  1NIW A;  3CR5 X;  3SG3 A;  1IQ3 A;  1F54 A;  1QX7 A;  3DD4 A;  2BBN A;  1YUR A;  4OCI A;  4ORA B;  2K61 A;  1SNL A;  2PAS A;  1DGU A;  1XFZ O;  1K9U A;  4GGF A;  3LL8 B;  5CSI A;  1MF8 B;  3VRP A;  1CFF A;  1YX8 A;  3NSK A;  2OS8 B;  2KBI A;  3D0Y B;  2MJW B;  1UWO A;  1CTR A;  2KQ6 A;  1PAL A;  1L7Z A;  1L2O B;  4YGD B;  2JT3 A;  1SKT A;  2Y5I A;  4MRY A;  3KO0 A;  3CZT X;  2F2P A;  1Y0V H;  2L4H A;  3BYA A;  3DVE A;  2F33 A;  4CPV A;  2KNE A;  2KGB C;  1DTL A;  2JXL A;  1A29 A;  3VRO A;  4I5J A;  1LXF C;  2JC2 A;  2ZRS A;  1J7R A;  1V1F A;  4MZK A;  2ISD A;  5GQQ C;  4WQ3 A;  1K95 A;  2BL0 B;  2E30 A;  1DJX A;  1CDP A;  1H8B A;  1RRO A;  2BE4 A;  1KFX S;  2NXQ A;  4PCW A;  1QXP A;  2LUC A;  4XJK A;  1XFU O;  3I5G B;  4U8D A;  4AQJ A;  2OTG C;  4NDB A;  4PAL A;  2CT9 A;  4I5N B;  3WNX B;  2CCM A;  1QV0 A;  1OOJ A;  1JC2 A;  2JUL A;  1OMV A;  2BEC A;  2LUX A;  5I8N A;  4YGE B;  2K2F A;  1BG1 A;  5JJG A;  4ETO A;  2ZNE A;  1ZOT B;  1DF0 B;  4F0Z B;  3CGA A;  1IH0 A;  1UHI A;  2F2O A;  2GGZ A;  1YRU B;  2OPO A;  1N0Y A;  1M46 A;  1IGV A;  3OB2 B;  3PLF B;  2JZI A;  1REC A;  2EC6 C;  2K7B A;  3EVR A;  3VGO A;  1J1E A;  2KYC A;  5CSF A;  1KQM B;  1MWN A;  2Y4Q A;  1BOD A;  5D69 A;  2WCB A;  3SIA A;  3JTD C;  1CMF A;  1K8U A;  1HT9 A;  5HKW A;  1ZUZ A;  1SCV A;  1SW8 A;  3FS7 A;  4TNC A;  2LNK A;  3CS1 A;  3QRX A;  4PHN A;  2LVJ A;  1CFP A;  1D1O A;  1TIZ A;  1XFY O;  1CMG A;  2AMI A;  2L50 A;  2KI4 C;  4N1F A;  4JQ0 D;  1F55 A;  3ICB A;  1DMO A;  4YGA A;  1JUO A;  3KPX A;  2LMV A;  2MRD A;  1SK6 D;  1OMD A;  4ZCV A;  5I2O A;  1PRW A;  1BOC A;  4PE7 A;  2JNX A;  2G9B A;  1G4Y R;  1AJ5 A;  1XYD A;  3I5I C;  3F45 A;  1XO5 A;  2NCP A;  1JWD A;  3DF0 B;  4NDD A;  3PN7 B;  1QLK A;  2WC8 A;  2G2B A;  2V53 A;  1MR8 A;  3AKB A;  2KFG A;  4R1E A;  1B8R A;  3BUM B;  3PAT A;  2F8P A;  2M7L A;  3LLE A;  4OV2 A;  2RGI A;  3TUY B;  1IJ6 A;  1WY9 A;  1KWO C;  4QJ4 B;  3OP0 A;  1K94 A;  2GV5 A;  1DJZ A;  3VRR A;  1PVA A;  1QIV A;  2COL B;  1JSA A;  1G33 A;  2JTT A;  5KSZ A;  1J1D A;  1KK8 C;  4QJ5 B;  1EG3 A;  1S6J A;  2M8U A;  1X02 A;  1SYM A;  5HKZ A;  1K93 D;  2M97 A;  4HRE E;  1QLS A;  1RFJ A;  2MA2 A;  1A75 A;  3A4U B;  1IG5 A;  1YVL A;  1KSO A;  1UHH A;  4M2O A;  1XFV O;  3OX6 A;  2MHH A;  3OB1 B;  4YGB B;  5HYD A;  4CFR A;  1EXR A;  1F4Q A;  1NCX A;  5AXI A;  2P6B B;  3NXA A;  1DVI A;  3TZ1 A;  1NSH A;  1BR4 B;  5HKY A;  5DKQ A;  2WCF A;  2NCO A;  2PAL A;  1C07 A;  1BMO A;  4MZJ A;  1CM1 A;  3EKJ A;  1UUS A;  1A4P A;  2LAP A;  2L51 A;  4ICB A;  1S6I A;  1SRA A;  1NX2 A;  3PAL A;  2JT8 A;  3FIA A;  5B8I B;  1MQ1 A;  1SL8 A;  2JRF A;  3TDZ A;  2WOS A;  4HRH A;  1MHO A;  5F6T A;  1J7O A;  4PHK A;  2K7D A;  2FCE A;  1AP4 A;  1PSB A;  1S26 D;  2BBM A;  5KU1 A;  1A2X A;  3WXA A;  4P5O E;  2M1U A;  1GJY A;  4ORC B;  3GK2 A;  2B1U A;  3BXK A;  1BJF A;  3BOW A;  4GBA A;  3HCM A;  2K0J A;  4XJK B;  3VRN A;  1S5G Z;  1R2U A;  2ZN9 A;  1QS7 A;  3NSI A;  3D10 A;  1WDC B;  1DJW A;  1SL7 A;  1QV1 A;  1SCM C;  3TDI A;  3HX4 A;  1LA0 A;  1OZO A;  1KCY A;  4CID A;  1A03 A;  3LCP C;  2Q4U A;  1B47 A;  2LLU A;  3BUX B;  1MUX A;  1B7T Z;  1C7W A;  1QVI Z;  2JNF A;  1TCO B;  3EK7 A;  4HRG A;  2FOT A;  2LM5 A;  4YBH B;  1QIW A;  2WND A;  1B8L A;  1B9A A;  2F3Z A;  2LE9 B;  3FWB A;  1YUS A;  4DRW A;  2H61 C;  3I5F C;  4M2Q A;  1C7V A;  1KK7 Y;  1F8H A;  1NX1 A;  4A4B A;  1R6P A;  2HPS A;  4N1G A;  1ZMZ A;  2A4J A;  1M31 A;  1IWQ A;  3GOF A;  1BR1 B;  3SIB A;  3RLZ A;  1IKU A;  1AVS A;  5D7F A;  5J3X A;  3PM8 A;  3CLN A;  3IF7 A;  1CKK A;  2NLN A;  1DJG A;  2M9G A;  2L5X B;  3FWC A;  4WQ2 A;  1RTP 1;  2KI6 D;  1Q80 A;  1QAT A;  1SMG A;  3O4Y A;  3MSE B;  4L9M A;  3DVM A;  4PDZ A;  5KTY A;  1DT7 B;  3SG4 A;  1NCY A;  3C1V A;  2HQ8 A;  1LA3 A;  2KYF A;  4BY4 A;  1TNX A;  1MXL C;  1AK8 A;  2F3Y A;  1CDL A;  3O6B A;  2I7A A;  1TTX A;  2TN4 A;  1UUR A;  4NDC A;  1S1E A;  3RM1 A;  2DOQ A;  3JVT C;  1SR6 C;  2OTG B;  2LC5 A;  1CLB A;  1AHR A;  4GUK A;  2I94 A;  4MLW A;  1OSA A;  1KFU S;  5DKN A;  1YX7 A;  3O78 A;  3TS5 C;  1F4O A;  1SL9 A;  1Y1A A;  4OVN F;  2ZN8 A;  1NWD A;  1WLM A;  1CFC A;  1QX2 A;  5AAN A;  3BUO B;  1HQV A;  1XK4 C;  4DIR A;  2BKI B;  3NSO A;  4IL1 A;  2LCP A;  1E8A A;  2SCP A;  2EC6 B;  2O60 A;  2KOT A;  5IBW A;  4MBE A;  2M1K B;  2K8M B;  1NX0 A;  4FQO A;  1CM4 A;  2JWW A;  3I5H C;  1BF5 A;  4I5K A;  1IRJ A;  2H61 A;  2JQ6 A;  4PE1 A;  3JTD B;  2EHB A;  1A75 B;  1XFW O;  4C0L A;  1YVH A;  3EKH A;  4GPL B;  3EK4 A;  2LVI A;  1WRL A;  3LK1 A;  4DUQ A;  1H4B A;  3KHE A;  1YRT B;  1UHN A;  2KI4 B;  2LMU A;  3EK8 A;  1UHK A;  2FCD A;  1Y1X A;  2D8N A;  1J7P A;  1G8I A;  1NX3 A;  2LP2 A;  2AAO A;  1FPW A;  2LP3 A;  1JFK A; 
#chains in the Genus database with same CATH topology
 4D1E A;  3BQ3 A;  5HLO A;  4YI9 A;  5TNC A;  1WLZ A;  1K96 A;  2L0P A;  3WHT B;  1N65 A;  2JPT A;  2KDH A;  2LAN A;  2OS8 C;  3WHU B;  2YGU A;  2KHN A;  1YUU A;  2QEV A;  3CR2 A;  4PHM A;  4AOM A;  4AQI A;  2KLD A;  2PSR A;  3I5I B;  1RK9 A;  1QJT A;  1IIO A;  2M29 A;  1L2O C;  3GK1 A;  4MEW A;  1CLM A;  1CDM A;  1B1G A;  1FBV A;  5PAL A;  1NPQ A;  2KPH A;  1ALW A;  2WCL A;  1OOI X;  3BUN B;  3E3R A;  2BCX A;  4YGC B;  5CSN A;  1JF2 A;  3M0W A;  3IVT A;  3BOW B;  1GQM A;  2LHL A;  2M7N A;  3AAJ A;  3DZT A;  1DJY A;  2KAV A;  1TNQ A;  2IS9 A;  2P71 A;  3PJI A;  3KF9 A;  4FTG A;  1SPY A;  1CB1 A;  3B88 A;  2BL0 C;  4C0J A;  5AEQ A;  3S0E A;  4PE4 A;  1KWO B;  4MRX A;  1IQ5 A;  5FI7 A;  1QTX A;  1LKJ A;  1XK4 A;  4ZCU A;  2ZKM X;  4CLN A;  1ZFS A;  2L4I A;  5AER A;  2Y1M A;  1AUI B;  1GGW A;  1DGV A;  1KK8 B;  1Y1U A;  1F71 A;  2ZFD A;  3I5G C;  4UPG A;  4NQG A;  5FYX A;  2R2I A;  3NHT A;  3UO9 A;  3DVK A;  1FI5 A;  2PRU A;  1U5I A;  3EVV A;  1M63 B;  4OR9 B;  1S3P A;  4INW A;  1CLL A;  1VRK A;  2L98 A;  2VRG A;  1XFX O;  3B7A A;  1KQV A;  1KFU L;  2LV7 A;  3K1E A;  2KFF A;  1NCZ A;  1K90 D;  3B87 A;  2NZ0 A;  2EGD A;  2H2K A;  1KSM A;  1PUL A;  1KQM C;  3NSL A;  1J7Q A;  1CFD A;  3DVJ A;  2O5G A;  5CSJ A;  2MLE C;  4QJ3 B;  4M2P A;  1BT6 A;  1FF1 A;  3D0Y A;  1JFJ A;  1FI6 A;  1LVC D;  1K9P A;  5ER5 A;  4A4C A;  2JXC A;  3IQO A;  3SG7 A;  3ZWH A;  1B4C A;  1TCF A;  2ZRT A;  4YRU A;  5D3O A;  1OMR A;  1PVB A;  3PFV A;  2LLS A;  3CZ1 A;  3SG5 A;  3BFB A;  3BJH A;  2KQY A;  4DS7 A;  1NYA A;  3CTN A;  1DEK A;  4GGN A;  3S0A A;  1QAS A;  1MXE A;  2MBX A;  5K89 A;  4JWQ A;  1YTZ C;  1K2H A;  2E6W A;  2M49 B;  1TNP A;  1TN4 A;  4BY5 A;  1EJ3 A;  1WRZ A;  3PSR A;  4GAO A;  4Q04 A;  1OE9 B;  1PSR A;  2Q91 A;  3R1O A;  1DJI A;  1SY9 A;  1DC1 A;  2PMY A;  2JTZ A;  5G08 A;  1DJH A;  1SCM B;  3PN7 C;  4YI8 A;  2MAZ A;  1B8C A;  2KSP A;  4MN0 A;  1XVJ A;  1S36 A;  2WCE A;  1NUB A;  2BCA A;  2HQW A;  2LMT A;  1ALV A;  2CTN A;  4E68 A;  1TRF A;  2LVV A;  2SAS A;  4CFQ A;  3GK4 X;  1JBA A;  3TUY C;  1NP8 A;  3SG2 A;  4MZL A;  1ODB A;  3CR4 X;  4DCK A;  1S5G Y;  5CPV A;  5I2Q A;  1CDN A;  1DF0 A;  1JF0 A;  1OOG A;  1EG4 A;  4XYN A;  1UHJ A;  3I5F B;  4P2Y B;  4C0K A;  4PE0 A;  2WOR A;  3SG6 A;  5JOL A;  2CBL A;  2Y1N A;  3AKA A;  3SS5 A;  3AAK A;  1UP5 A;  2ZND A;  1TNW A;  1QWV A;  1SBJ A;  1B7T Y;  2QPT A;  1QVI Y;  2L2E A;  1S6C A;  2MLF C;  2HF5 A;  3O4X A;  2BKH B;  3D73 A;  4GGF C;  1QX5 B;  4N5X A;  5DKR A;  5HLV A;  1FW4 A;  2KAY A;  3CWG A;  4WQ2 A;  2M3W A;  5AFP A;  1ZAC A;  3OHM B;  1W7J B;  1EL4 A;  2K7O A;  3D74 A;  5HL1 A;  1TOP A;  2KAX A;  1K9K A;  1M45 A;  3EVU A;  4GNK B;  3S0F A;  1BU3 A;  1Y6W A;  2JU0 A;  4WRI A;  3ZNI A;  1XA5 A;  4USL A;  2BE6 A;  3TDU A;  1N2D A;  3H4S E;  3UNW A;  1EH2 A;  3BUW B;  1V1G A;  4MVF A;  2I2R E;  3LK0 A;  1GGZ A;  1YUT A;  2KFH A;  4I5L B;  2HET A;  4GFT A;  3S0D A;  4PT1 A;  1F70 A;  3JVT B;  2QAC A;  1SR6 B;  1CNP A;  2JT0 A;  1IJ5 A;  1LIN A;  1BLQ A;  5BPJ A;  3DF0 A;  3D77 A;  4MSP A;  5ER4 X;  3TS5 B;  2LVK A;  3OX5 A;  2JOJ A;  3A8R A;  1PK0 D;  1M39 A;  1OQP A;  1OZS A;  2L2C A;  1RWY A;  3O2P A;  4OKH A;  2CXJ A;  4ORB B;  2PVB A;  2GGM A;  4PHJ A;  5I2L A;  2KGR A;  2I18 A;  4JPZ B;  1YR5 A;  1RJV A;  2BCB A;  1AJ4 A;  3KEV A;  1KFX L;  1J55 A;  2AUC A;  2K7C A;  1WDC C;  1WRK A;  2LLT A;  4HSZ A;  3I5H B;  2M0R A;  5EL2 A;  1KK7 Z;  2LHI A;  3VRQ A;  1U5I B;  3K21 A;  2QEB A;  3IQQ A;  3SJS A;  2FJU B;  2KBM A;  2KI6 C;  2K2A A;  2CNP A;  1W7I B;  1NIW A;  3CR5 X;  3SG3 A;  3QME A;  1IQ3 A;  1F54 A;  1QX7 A;  3DD4 A;  2BBN A;  1YUR A;  4OCI A;  4ORA B;  2K61 A;  1SNL A;  2PAS A;  3OBV A;  1DGU A;  1XFZ O;  1K9U A;  4GGF A;  3LL8 B;  5CSI A;  3RZS A;  1MF8 B;  3VRP A;  1CFF A;  1YX8 A;  3NSK A;  2OS8 B;  2KBI A;  3D0Y B;  2MJW B;  1TWO A;  1UWO A;  1CTR A;  2KQ6 A;  1PAL A;  1L7Z A;  1L2O B;  4YGD B;  1LS8 A;  2JT3 A;  1SKT A;  2Y5I A;  4MRY A;  3KO0 A;  3CZT X;  4IJ7 A;  2F2P A;  1Y0V H;  2L4H A;  3BYA A;  3DVE A;  3Q8I A;  2L5Y A;  2F33 A;  5I94 A;  2WCJ A;  4CPV A;  2KNE A;  2KGB C;  1DTL A;  2JXL A;  1A29 A;  3VRO A;  1DQE A;  4I5J A;  1LXF C;  2JC2 A;  2ZRS A;  1J7R A;  1V1F A;  4MZK A;  2ISD A;  5GQQ C;  4WQ3 A;  1K95 A;  2BL0 B;  3S0G A;  2E30 A;  1C3Y A;  4JD9 A;  3CZ2 A;  1DJX A;  1CDP A;  1H8B A;  1RRO A;  2BE4 A;  1KFX S;  2NXQ A;  4PCW A;  1QXP A;  2LUC A;  4XJK A;  1XFU O;  3I5G B;  4U8D A;  1OW4 A;  2OTG C;  4NDB A;  4PAL A;  2CT9 A;  4I5N B;  3WNX B;  1OOH A;  4AQJ A;  2CCM A;  1QV0 A;  1OOJ A;  4KYN A;  1JC2 A;  2GTE A;  1OMV A;  2BEC A;  2JUL A;  2LUX A;  5I8N A;  4YGE B;  2K2F A;  1BG1 A;  5JJG A;  4ETO A;  2ZNE A;  1ZOT B;  1DF0 B;  4F0Z B;  3CGA A;  1IH0 A;  1UHI A;  2F2O A;  2GGZ A;  2WC6 A;  1YRU B;  2OPO A;  1N0Y A;  1M46 A;  1IGV A;  3OB2 B;  3L47 A;  2JZI A;  1REC A;  3PLF B;  2EC6 C;  2K7B A;  3EVR A;  3VGO A;  1J1E A;  2KYC A;  5CSF A;  1KQM B;  1MWN A;  2Y4Q A;  1BOD A;  5D69 A;  2WCB A;  3SIA A;  3JTD C;  3L4A A;  1CMF A;  1K8U A;  1HT9 A;  5HKW A;  1ZUZ A;  1SCV A;  1SW8 A;  3FS7 A;  4TNC A;  2LNK A;  3CS1 A;  3QRX A;  1SSE B;  4PHN A;  2LVJ A;  1CFP A;  1D1O A;  1TIZ A;  1XFY O;  1CMG A;  2AMI A;  2BAP A;  2L50 A;  2KI4 C;  4N1F A;  2BNX A;  4JQ0 D;  3D78 A;  1F55 A;  3ICB A;  2PYQ A;  1DMO A;  2KLE A;  4YGA A;  1JUO A;  3D76 A;  3KPX A;  2LMV A;  2MRD A;  1SK6 D;  1OMD A;  4ZCV A;  1TUZ A;  5I2O A;  1PRW A;  1BOC A;  4PE7 A;  2JNX A;  2G9B A;  1G4Y R;  1AJ5 A;  1XFR A;  1XYD A;  3I5I C;  3F45 A;  1XO5 A;  3S0B A;  2NCP A;  1JWD A;  3DF0 B;  4NDD A;  3PN7 B;  1QLK A;  2WC8 A;  2G2B A;  2H8V A;  2V53 A;  1MR8 A;  3AKB A;  2KFG A;  4R1E A;  1B8R A;  3BFH A;  3BUM B;  3PAT A;  2F8P A;  2M7L A;  3LLE A;  4OV2 A;  2RGI A;  3TUY B;  2PQL A;  1IJ6 A;  1WY9 A;  1KWO C;  4QJ4 B;  3OP0 A;  2JPO A;  1K94 A;  2GV5 A;  1DJZ A;  4OZD A;  1PVA A;  1QIV A;  2COL B;  2QDI A;  3VRR A;  1JSA A;  1G33 A;  2JTT A;  3CAB A;  5KSZ A;  1J1D A;  1KK8 C;  4QJ5 B;  1EG3 A;  1S6J A;  2M8U A;  1X02 A;  1SYM A;  3NGV A;  4INX A;  5HKZ A;  1K93 D;  3CZ0 A;  2M97 A;  4HRE E;  4JKT A;  1QLS A;  1RFJ A;  2MA2 A;  1A75 A;  5FI2 A;  3V2L A;  3A4U B;  1IG5 A;  1YVL A;  1KSO A;  1UHH A;  4M2O A;  1T14 A;  1XFV O;  3OX6 A;  2MHH A;  3OB1 B;  4YGB B;  5HYD A;  4CFR A;  1EXR A;  1F4Q A;  1NCX A;  3DXL A;  5AXI A;  2P6B B;  3NXA A;  1DVI A;  3TZ1 A;  1NSH A;  1BR4 B;  3FE6 A;  3DY9 A;  5DKQ A;  5HKY A;  2WCF A;  1Z2C B;  2NCO A;  2PAL A;  1C07 A;  1BMO A;  4MZJ A;  1CM1 A;  3EKJ A;  1UUS A;  1A4P A;  1C3Z A;  2L51 A;  2LAP A;  4ICB A;  1S6I A;  1SRA A;  2ERB A;  1NX2 A;  3FE8 A;  3PAL A;  2JT8 A;  3FIA A;  5B8I B;  1MQ1 A;  2K60 A;  1SL8 A;  2JRF A;  3TDZ A;  2WOS A;  4HRH A;  1MHO A;  5F6T A;  2WC5 A;  1J7O A;  1OOF A;  2FJY A;  2K7D A;  2FCE A;  4PHK A;  1AP4 A;  1PSB A;  1S26 D;  3CDN A;  2BBM A;  5KU1 A;  1A2X A;  3WXA A;  4P5O E;  2M1U A;  3CYZ A;  1GJY A;  4ORC B;  4F7F A;  3GK2 A;  2B1U A;  3SS3 A;  3BXK A;  1BJF A;  2QEH A;  3BOW A;  4GBA A;  3HCM A;  2K0J A;  2P70 A;  4XJK B;  3VRN A;  1S5G Z;  1R2U A;  2ZN9 A;  1QS7 A;  3NSI A;  3D10 A;  1P28 A;  1WDC B;  1DJW A;  1SL7 A;  1QV1 A;  1SCM C;  3TDI A;  1TUJ A;  3HX4 A;  1LA0 A;  1OZO A;  1KCY A;  3L4L A;  4CID A;  2WCM A;  1A03 A;  3LCP C;  2Q4U A;  1B47 A;  4FQT A;  2LLU A;  3BUX B;  1MUX A;  1B7T Z;  1C7W A;  1QVI Z;  2JNF A;  1TCO B;  3EK7 A;  4HRG A;  1ORG A;  1Z4H A;  2FOT A;  2LM5 A;  4YBH B;  3D75 A;  3OGN A;  1QIW A;  2WND A;  1B8L A;  1B9A A;  2F3Z A;  2LE9 B;  3FWB A;  1YUS A;  4DRW A;  2H61 C;  1DEL A;  3I5F C;  4M2Q A;  1C7V A;  1KK7 Y;  3B86 A;  1F8H A;  1NX1 A;  4A4B A;  1R6P A;  2HPS A;  4N1G A;  1ZMZ A;  3R1P A;  2A4J A;  3VB1 A;  1M31 A;  1IWQ A;  3GOF A;  1BR1 B;  3SIB A;  3NHI A;  3RLZ A;  1IKU A;  1AVS A;  3DYE A;  5D7F A;  5J3X A;  3PM8 A;  3CLN A;  3IF7 A;  1CKK A;  2NLN A;  1DJG A;  2M9G A;  2L5X B;  2QEO A;  3FWC A;  3R72 A;  1RTP 1;  2KI6 D;  1Q80 A;  1QAT A;  1SMG A;  3O4Y A;  3MSE B;  1GM0 A;  4L9M A;  3DVM A;  4PDZ A;  5KTY A;  1DT7 B;  3SG4 A;  1NCY A;  3SS4 A;  3C1V A;  2HQ8 A;  1LA3 A;  2KYF A;  3FE9 A;  4BY4 A;  1TNX A;  1MXL C;  1AK8 A;  2F3Y A;  1CDL A;  3O6B A;  2I7A A;  1TTX A;  2TN4 A;  1UUR A;  4NDC A;  1S1E A;  3RM1 A;  2DOQ A;  3JVT C;  1W9Z A;  2WCK A;  1SR6 C;  2OTG B;  2LC5 A;  1CLB A;  1AHR A;  4GUK A;  2I94 A;  4MLW A;  1OSA A;  1KFU S;  5DKN A;  1YX7 A;  3O78 A;  3TS5 C;  1F4O A;  1SL9 A;  1Y1A A;  4OVN F;  2ZN8 A;  1NWD A;  1WLM A;  1CFC A;  1QX2 A;  3R1V A;  3BFA A;  3BUO B;  5AAN A;  1HQV A;  1XK4 C;  3PM2 A;  4DIR A;  2BKI B;  3NSO A;  4IL1 A;  2LCP A;  1E8A A;  2SCP A;  2EC6 B;  2WCH A;  2O60 A;  2KOT A;  5IBW A;  4MBE A;  2M1K B;  2K8M B;  1NX0 A;  5DIC A;  3N7H A;  4FQO A;  1CM4 A;  2JWW A;  3I5H C;  3EG5 B;  4I5K A;  1IRJ A;  2H61 A;  2JQ6 A;  1BF5 A;  4PE1 A;  3JTD B;  2EHB A;  1A75 B;  1XFW O;  4C0L A;  1YVH A;  3B6X A;  3EKH A;  4GPL B;  3EK4 A;  2LVI A;  1WRL A;  3LK1 A;  4DUQ A;  1H4B A;  3KHE A;  1YRT B;  1UHN A;  2KI4 B;  2LMU A;  3EK8 A;  5FI6 A;  1UHK A;  2FCD A;  1Y1X A;  2D8N A;  1J7P A;  1G8I A;  1NX3 A;  2LP2 A;  2AAO A;  1FPW A;  2LP3 A;  1JFK A; 
#chains in the Genus database with same CATH homology
 4D1E A;  3BQ3 A;  5HLO A;  4YI9 A;  5TNC A;  1WLZ A;  1K96 A;  2L0P A;  3WHT B;  1N65 A;  2JPT A;  2KDH A;  2LAN A;  2OS8 C;  3WHU B;  2KHN A;  1YUU A;  3CR2 A;  4PHM A;  4AOM A;  4AQI A;  2PSR A;  3I5I B;  1RK9 A;  1QJT A;  2M29 A;  1L2O C;  3GK1 A;  4MEW A;  1CLM A;  1CDM A;  1B1G A;  1FBV A;  5PAL A;  1NPQ A;  1ALW A;  3BUN B;  3E3R A;  2BCX A;  4YGC B;  5CSN A;  1JF2 A;  3M0W A;  3BOW B;  1GQM A;  2LHL A;  2M7N A;  3AAJ A;  1DJY A;  2KAV A;  1TNQ A;  2IS9 A;  4FTG A;  1CB1 A;  3KF9 A;  1SPY A;  2BL0 C;  4C0J A;  5AEQ A;  4PE4 A;  1KWO B;  4MRX A;  1IQ5 A;  1QTX A;  1LKJ A;  1XK4 A;  4ZCU A;  2ZKM X;  4CLN A;  1ZFS A;  2L4I A;  5AER A;  2Y1M A;  1AUI B;  1GGW A;  1DGV A;  1KK8 B;  1Y1U A;  1F71 A;  2ZFD A;  3I5G C;  4UPG A;  4NQG A;  5FYX A;  2R2I A;  3DVK A;  1FI5 A;  2PRU A;  1U5I A;  3EVV A;  1M63 B;  4OR9 B;  1S3P A;  1CLL A;  1VRK A;  2L98 A;  2VRG A;  1XFX O;  1KQV A;  1KFU L;  2LV7 A;  2KFF A;  1NCZ A;  1K90 D;  2NZ0 A;  2EGD A;  2H2K A;  1KSM A;  1PUL A;  1KQM C;  3NSL A;  1J7Q A;  1CFD A;  3DVJ A;  2O5G A;  5CSJ A;  2MLE C;  4QJ3 B;  4M2P A;  1BT6 A;  1FF1 A;  3D0Y A;  1JFJ A;  1FI6 A;  1LVC D;  1K9P A;  5ER5 A;  4A4C A;  2JXC A;  3IQO A;  3SG7 A;  3ZWH A;  1B4C A;  1TCF A;  2ZRT A;  4YRU A;  1OMR A;  1PVB A;  3PFV A;  2LLS A;  3SG5 A;  2KQY A;  4DS7 A;  1NYA A;  3CTN A;  4GGN A;  1QAS A;  1MXE A;  2MBX A;  5K89 A;  4JWQ A;  1YTZ C;  1K2H A;  2E6W A;  2M49 B;  1TNP A;  1TN4 A;  4BY5 A;  1EJ3 A;  1WRZ A;  3PSR A;  4GAO A;  4Q04 A;  1OE9 B;  1PSR A;  2Q91 A;  1DJI A;  1SY9 A;  2PMY A;  2JTZ A;  5G08 A;  1DJH A;  1SCM B;  3PN7 C;  4YI8 A;  2MAZ A;  1B8C A;  2KSP A;  4MN0 A;  1XVJ A;  1S36 A;  2WCE A;  1NUB A;  2BCA A;  2HQW A;  2LMT A;  1ALV A;  2CTN A;  4E68 A;  1TRF A;  2LVV A;  2SAS A;  4CFQ A;  3GK4 X;  1JBA A;  3TUY C;  1NP8 A;  3SG2 A;  4MZL A;  1ODB A;  3CR4 X;  4DCK A;  1S5G Y;  5CPV A;  5I2Q A;  1CDN A;  1DF0 A;  1JF0 A;  1EG4 A;  4XYN A;  1UHJ A;  3I5F B;  4P2Y B;  4C0K A;  4PE0 A;  2WOR A;  3SG6 A;  5JOL A;  2CBL A;  2Y1N A;  3AKA A;  3AAK A;  1UP5 A;  2ZND A;  1TNW A;  1SBJ A;  1B7T Y;  2QPT A;  1QVI Y;  2L2E A;  1S6C A;  2MLF C;  2HF5 A;  4N5X A;  2BKH B;  5HLV A;  4GGF C;  1QX5 B;  5DKR A;  1FW4 A;  2KAY A;  3CWG A;  2M3W A;  5AFP A;  1ZAC A;  3OHM B;  1W7J B;  1EL4 A;  2K7O A;  1TOP A;  2KAX A;  1K9K A;  1M45 A;  3EVU A;  4GNK B;  1BU3 A;  1Y6W A;  2JU0 A;  4WRI A;  3ZNI A;  1XA5 A;  4USL A;  2BE6 A;  3TDU A;  1N2D A;  3H4S E;  1EH2 A;  3BUW B;  1V1G A;  4MVF A;  2I2R E;  3LK0 A;  1GGZ A;  1YUT A;  2KFH A;  4I5L B;  2HET A;  4GFT A;  1F70 A;  3JVT B;  2QAC A;  1SR6 B;  1CNP A;  2JT0 A;  1IJ5 A;  1LIN A;  1BLQ A;  5BPJ A;  3DF0 A;  4MSP A;  5ER4 X;  3TS5 B;  2LVK A;  3OX5 A;  2JOJ A;  3A8R A;  1PK0 D;  1M39 A;  1OQP A;  1OZS A;  1RWY A;  3O2P A;  4OKH A;  2CXJ A;  4ORB B;  2PVB A;  2GGM A;  4PHJ A;  5I2L A;  2KGR A;  2I18 A;  4JPZ B;  1YR5 A;  1RJV A;  2BCB A;  1AJ4 A;  3KEV A;  1KFX L;  1J55 A;  2AUC A;  2K7C A;  1WDC C;  1WRK A;  2LLT A;  4HSZ A;  3I5H B;  2M0R A;  1KK7 Z;  2LHI A;  3VRQ A;  1U5I B;  3K21 A;  3IQQ A;  3SJS A;  2FJU B;  2KBM A;  2KI6 C;  2K2A A;  2CNP A;  1W7I B;  1NIW A;  3CR5 X;  3SG3 A;  1IQ3 A;  1F54 A;  1QX7 A;  3DD4 A;  2BBN A;  1YUR A;  4OCI A;  4ORA B;  2K61 A;  1SNL A;  2PAS A;  1DGU A;  1XFZ O;  1K9U A;  4GGF A;  3LL8 B;  5CSI A;  1MF8 B;  3VRP A;  1CFF A;  1YX8 A;  3NSK A;  2OS8 B;  2KBI A;  3D0Y B;  2MJW B;  1UWO A;  1CTR A;  2KQ6 A;  1PAL A;  1L7Z A;  1L2O B;  4YGD B;  2JT3 A;  1SKT A;  2Y5I A;  4MRY A;  3KO0 A;  3CZT X;  2F2P A;  1Y0V H;  2L4H A;  3BYA A;  3DVE A;  2F33 A;  4CPV A;  2KNE A;  2KGB C;  1DTL A;  2JXL A;  1A29 A;  3VRO A;  4I5J A;  1LXF C;  2JC2 A;  2ZRS A;  1J7R A;  1V1F A;  4MZK A;  2ISD A;  5GQQ C;  4WQ3 A;  1K95 A;  2BL0 B;  2E30 A;  1DJX A;  1CDP A;  1H8B A;  1RRO A;  2BE4 A;  1KFX S;  2NXQ A;  4PCW A;  1QXP A;  2LUC A;  4XJK A;  1XFU O;  3I5G B;  4U8D A;  4AQJ A;  2OTG C;  4NDB A;  4PAL A;  2CT9 A;  4I5N B;  3WNX B;  2CCM A;  1QV0 A;  1OOJ A;  1JC2 A;  2JUL A;  1OMV A;  2BEC A;  2LUX A;  5I8N A;  4YGE B;  2K2F A;  1BG1 A;  5JJG A;  4ETO A;  2ZNE A;  1ZOT B;  1DF0 B;  4F0Z B;  3CGA A;  1IH0 A;  1UHI A;  2F2O A;  2GGZ A;  1YRU B;  2OPO A;  1N0Y A;  1M46 A;  1IGV A;  3OB2 B;  3PLF B;  2JZI A;  1REC A;  2EC6 C;  2K7B A;  3EVR A;  3VGO A;  1J1E A;  2KYC A;  5CSF A;  1KQM B;  1MWN A;  2Y4Q A;  1BOD A;  5D69 A;  2WCB A;  3SIA A;  3JTD C;  1CMF A;  1K8U A;  1HT9 A;  5HKW A;  1ZUZ A;  1SCV A;  1SW8 A;  3FS7 A;  4TNC A;  2LNK A;  3CS1 A;  3QRX A;  4PHN A;  2LVJ A;  1CFP A;  1D1O A;  1TIZ A;  1XFY O;  1CMG A;  2AMI A;  2L50 A;  2KI4 C;  4N1F A;  4JQ0 D;  1F55 A;  3ICB A;  1DMO A;  4YGA A;  1JUO A;  3KPX A;  2LMV A;  2MRD A;  1SK6 D;  1OMD A;  4ZCV A;  5I2O A;  1PRW A;  1BOC A;  4PE7 A;  2JNX A;  2G9B A;  1G4Y R;  1AJ5 A;  1XYD A;  3I5I C;  3F45 A;  1XO5 A;  2NCP A;  1JWD A;  3DF0 B;  4NDD A;  3PN7 B;  1QLK A;  2WC8 A;  2G2B A;  2V53 A;  1MR8 A;  3AKB A;  2KFG A;  4R1E A;  1B8R A;  3BUM B;  3PAT A;  2F8P A;  2M7L A;  3LLE A;  4OV2 A;  2RGI A;  3TUY B;  1IJ6 A;  1WY9 A;  1KWO C;  4QJ4 B;  3OP0 A;  1K94 A;  2GV5 A;  1DJZ A;  3VRR A;  1PVA A;  1QIV A;  2COL B;  1JSA A;  1G33 A;  2JTT A;  5KSZ A;  1J1D A;  1KK8 C;  4QJ5 B;  1EG3 A;  1S6J A;  2M8U A;  1X02 A;  1SYM A;  5HKZ A;  1K93 D;  2M97 A;  4HRE E;  1QLS A;  1RFJ A;  2MA2 A;  1A75 A;  3A4U B;  1IG5 A;  1YVL A;  1KSO A;  1UHH A;  4M2O A;  1XFV O;  3OX6 A;  2MHH A;  3OB1 B;  4YGB B;  5HYD A;  4CFR A;  1EXR A;  1F4Q A;  1NCX A;  5AXI A;  2P6B B;  3NXA A;  1DVI A;  3TZ1 A;  1NSH A;  1BR4 B;  5HKY A;  5DKQ A;  2WCF A;  2NCO A;  2PAL A;  1C07 A;  1BMO A;  4MZJ A;  1CM1 A;  3EKJ A;  1UUS A;  1A4P A;  2LAP A;  2L51 A;  4ICB A;  1S6I A;  1SRA A;  1NX2 A;  3PAL A;  2JT8 A;  3FIA A;  5B8I B;  1MQ1 A;  1SL8 A;  2JRF A;  3TDZ A;  2WOS A;  4HRH A;  1MHO A;  5F6T A;  1J7O A;  4PHK A;  2K7D A;  2FCE A;  1AP4 A;  1PSB A;  1S26 D;  2BBM A;  5KU1 A;  1A2X A;  3WXA A;  4P5O E;  2M1U A;  1GJY A;  4ORC B;  3GK2 A;  2B1U A;  3BXK A;  1BJF A;  3BOW A;  4GBA A;  3HCM A;  2K0J A;  4XJK B;  3VRN A;  1S5G Z;  1R2U A;  2ZN9 A;  1QS7 A;  3NSI A;  3D10 A;  1WDC B;  1DJW A;  1SL7 A;  1QV1 A;  1SCM C;  3TDI A;  3HX4 A;  1LA0 A;  1OZO A;  1KCY A;  4CID A;  1A03 A;  3LCP C;  2Q4U A;  1B47 A;  2LLU A;  3BUX B;  1MUX A;  1B7T Z;  1C7W A;  1QVI Z;  2JNF A;  1TCO B;  3EK7 A;  4HRG A;  2FOT A;  2LM5 A;  4YBH B;  1QIW A;  2WND A;  1B8L A;  1B9A A;  2F3Z A;  2LE9 B;  3FWB A;  1YUS A;  4DRW A;  2H61 C;  3I5F C;  4M2Q A;  1C7V A;  1KK7 Y;  1F8H A;  1NX1 A;  4A4B A;  1R6P A;  2HPS A;  4N1G A;  1ZMZ A;  2A4J A;  1M31 A;  1IWQ A;  3GOF A;  1BR1 B;  3SIB A;  3RLZ A;  1IKU A;  1AVS A;  5D7F A;  5J3X A;  3PM8 A;  3CLN A;  3IF7 A;  1CKK A;  2NLN A;  1DJG A;  2M9G A;  2L5X B;  3FWC A;  4WQ2 A;  1RTP 1;  2KI6 D;  1Q80 A;  1QAT A;  1SMG A;  3O4Y A;  3MSE B;  4L9M A;  3DVM A;  4PDZ A;  5KTY A;  1DT7 B;  3SG4 A;  1NCY A;  3C1V A;  2HQ8 A;  1LA3 A;  2KYF A;  4BY4 A;  1TNX A;  1MXL C;  1AK8 A;  2F3Y A;  1CDL A;  3O6B A;  2I7A A;  1TTX A;  2TN4 A;  1UUR A;  4NDC A;  1S1E A;  3RM1 A;  2DOQ A;  3JVT C;  1SR6 C;  2OTG B;  2LC5 A;  1CLB A;  1AHR A;  4GUK A;  2I94 A;  4MLW A;  1OSA A;  1KFU S;  5DKN A;  1YX7 A;  3O78 A;  3TS5 C;  1F4O A;  1SL9 A;  1Y1A A;  4OVN F;  2ZN8 A;  1NWD A;  1WLM A;  1CFC A;  1QX2 A;  5AAN A;  3BUO B;  1HQV A;  1XK4 C;  4DIR A;  2BKI B;  3NSO A;  4IL1 A;  2LCP A;  1E8A A;  2SCP A;  2EC6 B;  2O60 A;  2KOT A;  5IBW A;  4MBE A;  2M1K B;  2K8M B;  1NX0 A;  4FQO A;  1CM4 A;  2JWW A;  3I5H C;  1BF5 A;  4I5K A;  1IRJ A;  2H61 A;  2JQ6 A;  4PE1 A;  3JTD B;  2EHB A;  1A75 B;  1XFW O;  4C0L A;  1YVH A;  3EKH A;  4GPL B;  3EK4 A;  2LVI A;  1WRL A;  3LK1 A;  4DUQ A;  1H4B A;  3KHE A;  1YRT B;  1UHN A;  2KI4 B;  2LMU A;  3EK8 A;  1UHK A;  2FCD A;  1Y1X A;  2D8N A;  1J7P A;  1G8I A;  1NX3 A;  2LP2 A;  2AAO A;  1FPW A;  2LP3 A;  1JFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...