4DIRA

2.6 angstrom x-ray structure of human ca(2+)-s100a5
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
78
Chain Sequence
TPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A5
publication title Target-binding to S100A5 changes Ca(2+)-binding affinity and dynamics.
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 78
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dirA00
2RGIA 3KF9A 3VROA 4MBEA 1U5IB 2K2FA 1K9KA 1HT9A 5JOLA 2H61C 4XJKA 2GGMA 3I5FB 1Q80A 1BF5A 2B1UA 1QV0A 2LMTA 2Q4UA 2D8NA 1IKUA 1RECA 2K8MB 1QLKA 3SG6A 1AHRA 1C7WA 2ZKMX 1U5IA 1W7IB 3BYAA 1CFPA 2L50A 1M63B 2SASA 2LP2A 2JRFA 2L4HA 5CPVA 1YVHA 1F70A 4OR9B 1OSAA 2BE6A 2V53A 1SL8A 1SYMA 2PSRA 1N0YA 1SR6C 2M8UA 2CBLA 3ICBA 4I5LB 1NSHA 3LL8B 4TNCA 1S5GZ 3EK7A 3CR4X 1QX5B 1J7RA 4DRWA 4MRXA 1F8HA 3OP0A 1UURA 5HYDA 3H4SE 1WLMA 1MWNA 1F55A 1KQMC 1M39A 2Q91A 5D69A 2WORA 5AFPA 1B7TY 4HREE 3ZWHA 2KAXA 2L51A 3WXAA 1IQ5A 2LLTA 1CLMA 1DJHA 1TRFA 2M9GA 4DIRA 1UP5A 4M2OA 4GBAA 2E30A 1S26D 1LINA 4CPVA 1IJ5A 1DT7B 1CM1A 3PLFB 3FWCA 5I2LA 1H8BA 3TDIA 1GGWA 1PRWA 4F0ZB 1NCXA 2KBMA 1XFVO 1GQMA 5BPJA 2KQYA 3AAJA 3PN7B 1G33A 5FYXA 1QVIY 1NX0A 2KAVA 3NSOA 4ORCB 2JWWA 3VRQA 2K0JA 5I8NA 3AKAA 5AANA 1SMGA 4PALA 3KPXA 2COLB 1KK7Z 1FI5A 1UHKA 1AVSA 2KDHA 2MHHA 3O6BA 4GUKA 1XO5A 2O60A 3TDZA 1SK6D 1BLQA 1S36A 5PALA 4N1GA 1CDLA 3CR2A 1PALA 4M2PA 4ZCVA 1MR8A 1MXLC 3BUOB 1FW4A 1QXPA 1WY9A 1IJ6A 1J1EA 1WRKA 3SIBA 1A4PA 1EJ3A 2KSPA 1KFXS 1XVJA 4ETOA 1KFUL 4AQIA 1CDMA 1C7VA 1BMOA 1WRLA 2M0RA 1S6CA 1WLZA 2P6BB 2PALA 2JQ6A 2ZFDA 3I5HC 1N2DA 1DJXA 2SCPA 1B7TZ 2M3WA 3VRNA 1CMGA 4YGCB 4U8DA 2LANA 3TS5C 2LUCA 1CDNA 1IGVA 4E68A 1CTRA 2MRDA 1MF8B 1KQVA 3GOFA 1PVAA 4MN0A 2DOQA 1K8UA 2I94A 4L9MA 1TCFA 3SG5A 3I5GC 1IWQA 2JZIA 2PMYA 2L0PA 4HSZA 4N1FA 1K93D 4OVNF 3TZ1A 2HQWA 2G9BA 2BL0B 1YR5A 4IL1A 1QVIZ 2AAOA 1J7PA 2EC6B 1V1FA 4P5OE 1A2XA 4OV2A 2QPTA 1QV1A 5K89A 4OCIA 3PALA 5F6TA 2K61A 2Y5IA 4PHJA 4R1EA 2F8PA 2LVKA 3C1VA 1EH2A 2NXQA 3DVKA 2EGDA 3K21A 2KI4C 1EL4A 4YGAA 1OMVA 1PK0D 1QIVA 4OKHA 1M46A 5D7FA 2ISDA 2I18A 4M2QA 1DGVA 1WDCB 4NDCA 4A4BA 1ZACA 2LE9B 1B47A 2PVBA 3JVTC 1KSOA 1QX7A 3BUXB 2ZN8A 1UWOA 4DUQA 1JUOA 2L2EA 2M29A 4GGFA 1QJTA 2VRGA 3CLNA 1YUTA 4ORAB 2OPOA 1OE9B 1NWDA 2QACA 2JT3A 1KWOB 2KGRA 1S3PA 1QATA 1BR4B 3RM1A 2KGBC 1YX8A 2HF5A 2ZN9A 1S6IA 2F3YA 3EK4A 1NUBA 4MEWA 2NCOA 3PFVA 1IH0A 2JTTA 1EXRA 3WHTB 2KQ6A 3BQ3A 3PATA 2LC5A 3TUYB 4WRIA 1TNWA 3JVTB 4PE4A 1YX7A 1K2HA 2F3ZA 1FBVA 3BOWB 1XFWO 4MZJA 1DJWA 3D0YB 1UHNA 1KCYA 3GK2A 1NX1A 1PULA 5HLOA 2HPSA 3PSRA 4D1EA 1L7ZA 2BKHB 3M0WA 1TNPA 3JTDC 4NDDA 1R6PA 1JBAA 3BOWA 1JFKA 2H61A 3D0YA 5J3XA 1SPYA 3EVUA 4GNKB 5AERA 4CIDA 4QJ4B 3SG2A 3CGAA 1KSMA 2LMVA 1S6JA 1SR6B 2NLNA 2LVIA 2OS8C 3QRXA 1LA3A 2F33A 2LV7A 1AP4A 3RLZA 1GGZA 4MSPA 1KQMB 1MXEA 2L5XB 2LNKA 1KK8C 1JC2A 1W7JB 1FF1A 5ER5A 2BKIB 1YUSA 1XK4C 1F4QA 2IS9A 1TN4A 3O2PA 5IBWA 1BT6A 3MSEB 4FTGA 5CSNA 1J7QA 1JF0A 4WQ3A 2KNEA 1A03A 2MLFC 3BXKA 4HRHA 1AUIB 1SW8A 1TOPA 3CWGA 4PHMA 2BCXA 3PM8A 1NX3A 2ZRTA 4PCWA 2FJUB 2OS8B 1CNPA 3VRPA 1XFUO 4PHNA 2I2RE 2BECA 3A4UB 1KFUS 3EKJA 4ICBA 3EVVA 1AK8A 1E8AA 4CFRA 4JQ0D 1OZSA 1UUSA 4QJ5B 1CB1A 1A29A 1Y1XA 1BOCA 1DJGA 2M1KB 1SCMC 1EG3A 1SL9A 1QLSA 2NZ0A 3WHUB 1OOJA 2Y1MA 4YBHB 4AQJA 1B4CA 1QASA 1SRAA 2E6WA 5AEQA 1D1OA 1ZOTB 5B8IB 2H2KA 1R2UA 3I5IC 4PE7A 2MBXA 2CCMA 3DF0B 1BODA 1JFJA 1ALVA 3DD4A 1L2OC 3O4YA 2M1UA 4GPLB 5HLVA 2TN4A 3CTNA 4JPZB 1J55A 2LVVA 1YTZC 3I5HB 3IF7A 3ZNIA 1YRUB 1RROA 1DMOA 1B1GA 1TNXA 1JWDA 1ZFSA 2JOJA 2JXCA 3DF0A 5G08A 3SG4A 1BJFA 1BR1B 3TS5B 4FQOA 2KAYA 1PVBA 1RK9A 4MZKA 1RFJA 2CTNA 2ZNDA 4CLNA 4JWQA 2Y1NA 1G4YR 3OX5A 1AJ5A 2FCEA 1DF0B 3EKHA 4ZCUA 3CR5X 3E3RA 3IQOA 3I5GB 2O5GA 5ER4X 1MQ1A 2PRUA 1QTXA 4P2YB 1TNQA 1YVLA 3AKBA 3OHMB 1DVIA 2AUCA 1TTXA 2AMIA 1OMDA 3KO0A 5AXIA 1L2OB 4XYNA 1J1DA 3I5FC 3O78A 2WNDA 1F71A 2LLUA 2CXJA 1DGUA 1YRTB 1DF0A 5HKYA 3GK4X 2GGZA 2M97A 2WCFA 1LVCD 1C07A 4YI9A 1K9PA 4MZLA 2KI6C 4YGEB 3HX4A 2PASA 4AOMA 2CT9A 4C0KA 3D10A 2KI4B 1OMRA 2NCPA 1F54A 1IG5A 2JNXA 2JNFA 2FOTA 3LK0A 1S1EA 2LMUA 2JTZA 4C0JA 1LA0A 3OB2B 1QS7A 3SG7A 1QIWA 1UHIA 5HKZA 1K9UA 1Y1UA 1KK7Y 2ZRSA 2Y4QA 4UPGA 5I2QA 2ZNEA 3EVRA 2HQ8A 5HKWA 1RJVA 4MRYA 5DKQA 2M7NA 2WOSA 1MHOA 1OZOA 2M7LA 2WCEA 1B8CA 2KFFA 4DCKA 2KOTA 2BE4A 2JULA 2L4IA 2MA2A 2K7CA 3DVJA 3BUMB 1YURA 2LM5A 1CLBA 2KYCA 2M49B 3NXAA 1B9AA 3PN7C 4NDBA 2K2AA 1JSAA 2F2OA 2KHNA 1SKTA 2BBNA 1BU3A 2MLEC 3AAKA 4C0LA 3KEVA 4MVFA 1AJ4A 4YGBB 1BG1A 1B8RA 3SJSA 3LK1A 1SL7A 1UHHA 3OX6A 1M31A 1DJZA 3A8RA 1EG4A 3NSIA 4A4CA 1CLLA 3LCPC 4HRGA 2R2IA 1PSBA 2KI6D 2LP3A 5KSZA 2G2BA 1K95A 2HETA 3JTDB 4PE0A 1FI6A 1XA5A 4GGNA 2KFHA 1SBJA 1PSRA 3CZTX 3FS7A 2A4JA 1UHJA 2JPTA 2CNPA 1SCVA 3GK1A 2JXLA 5TNCA 1CMFA 2EHBA 1MUXA 1IQ3A 4CFQA 4YRUA 1SY9A 4WQ2A 4PHKA 1K90D 1CDPA 2K7BA 3CS1A 1Y1AA 1ODBA 1CFFA 1SNLA 3IQQA 1IRJA 2K7DA 4YGDB 1CM4A 1Y6WA 2JU0A 1KK8B 3WNXB 1M45A 2JC2A 3F45A 1NCZA 5DKRA 1OQPA 1TCOB 3HCMA 4DS7A 1XYDA 1LXFC 3TDUA 4PE1A 3VGOA 2BBMA 2FCDA 3NSLA 4I5KA 1NP8A 4USLA 2LHLA 5CSIA 1XFXO 4GAOA 3EK8A 4NQGA 2BCBA 1KFXL 1ALWA 1CFDA 1N65A 1XK4A 1YUUA 2L98A 1NIWA 1K94A 2BL0C 3BUWB 4YI8A 5JJGA 2EC6C 1G8IA 3OB1B 2LUXA 2BCAA 3FWBA 4BY4A 4ORBB 5I2OA 1B8LA 1RWYA 5CSFA 2LCPA 1NYAA 1J7OA 5DKNA 2K7OA 1A75B 1NCYA 1CKKA 4GGFC 1DJYA 1X02A 3SG3A 3VRRA 3BUNB 5KTYA 4BY5A 4N5XA 2GV5A 5KU1A 1SCMB 2JT8A 1GJYA 1WDCC 2WC8A 1CFCA 1S5GY 4GFTA 2I7AA 1QX2A 1LKJA 2OTGC 4PDZA 1DJIA 2LVJA 3LLEA 3I5IB 1H4BA 1A75A 1XFYO 2KBIA 2MJWB 3KHEA 1RTP1 2WCBA 1DTLA 1NPQA 1HQVA 2MAZA 1ZMZA 1KWOC 2KYFA 2LAPA 1NX2A 1JF2A 3DVEA 4I5NB 1VRKA 1TIZA 1ZUZA 1FPWA 3SIAA 3FIAA 2KFGA 1V1GA 2F2PA 3DVMA 3NSKA 2JT0A 4XJKB 4MLWA 5GQQC 2LLSA 1WRZA 4I5JA 1F4OA 1XFZO 5CSJA 3TUYC 2LHIA 1Y0VH 2OTGB 4QJ3B 4Q04A 1K96A
chains in the Genus database with same CATH superfamily
2RGIA 3KF9A 3VROA 4MBEA 1U5IB 2K2FA 3CZ0A 1K9KA 4INXA 1HT9A 2WCMA 5JOLA 1DC1A 2H61C 4XJKA 2GGMA 3I5FB 1Q80A 1BF5A 2B1UA 3B7AA 4F7FA 1QV0A 2LMTA 2Q4UA 2D8NA 1IKUA 1RECA 2K8MB 1QLKA 3SG6A 3S0AA 1AHRA 1C7WA 5EL2A 2ZKMX 2BNXA 1U5IA 1W7IB 5FI7A 3BYAA 1CFPA 2L50A 1M63B 2SASA 2LP2A 2JRFA 2L4HA 3NGVA 5CPVA 1SSEB 2KLDA 1YVHA 1F70A 4OR9B 1OSAA 2BE6A 2V53A 1ORGA 1SL8A 1SYMA 2PSRA 1N0YA 1SR6C 2M8UA 2CBLA 3ICBA 3DYEA 2FJYA 1NSHA 3LL8B 4I5LB 3RZSA 4TNCA 1S5GZ 3EK7A 3CR4X 1QX5B 1J7RA 4DRWA 4MRXA 1F8HA 3OP0A 1UURA 5HYDA 3H4SE 1WLMA 1MWNA 1F55A 1KQMC 1M39A 2Q91A 3OGNA 5D69A 2WORA 5AFPA 1B7TY 4HREE 3ZWHA 1TUJA 2KAXA 4KYNA 2L51A 3WXAA 3QMEA 1IQ5A 2LLTA 1CLMA 1DJHA 1TRFA 2M9GA 4DIRA 1UP5A 4M2OA 4GBAA 2E30A 1S26D 1LINA 4CPVA 1IJ5A 1DT7B 1CM1A 3PLFB 3FWCA 5I2LA 1H8BA 3TDIA 1GGWA 1PRWA 4F0ZB 1NCXA 2KBMA 1XFVO 1GQMA 5BPJA 2KQYA 3AAJA 3PN7B 1G33A 5FYXA 1QVIY 1NX0A 3B6XA 2KAVA 3FE9A 3NSOA 3D74A 4ORCB 2JWWA 3VRQA 2K0JA 5I8NA 3AKAA 5AANA 1SMGA 4PALA 3KPXA 2COLB 1KK7Z 1FI5A 1UHKA 1AVSA 2KDHA 2MHHA 3D77A 3PM2A 3O6BA 4GUKA 1XO5A 2O60A 3TDZA 1SK6D 1BLQA 1S36A 5PALA 4N1GA 3OBVA 1CDLA 3CR2A 1PALA 4M2PA 4ZCVA 1MR8A 1MXLC 3BUOB 1FW4A 1QXPA 1WY9A 1IJ6A 1J1EA 1WRKA 1Z2CB 3SIBA 1A4PA 1EJ3A 3S0GA 2KSPA 1KFXS 1XVJA 4ETOA 1KFUL 4AQIA 1CDMA 1C7VA 1BMOA 1WRLA 2M0RA 1S6CA 1WLZA 2P6BB 2PALA 2JQ6A 2ZFDA 3I5HC 1N2DA 3EG5B 1DJXA 2WCKA 3VB1A 2SCPA 1B7TZ 2M3WA 3VRNA 1CMGA 4YGCB 1DEKA 4U8DA 2LANA 3TS5C 2LUCA 1CDNA 1IGVA 4E68A 1CTRA 2MRDA 1MF8B 1KQVA 3GOFA 4INWA 1PVAA 4MN0A 3R72A 3L4AA 2DOQA 1K8UA 2I94A 4L9MA 1TCFA 3SG5A 3I5GC 1IWQA 2JZIA 2PMYA 2L0PA 4HSZA 3DY9A 1K93D 4N1FA 4OVNF 2H8VA 3TZ1A 2HQWA 3UO9A 2G9BA 2BL0B 1YR5A 4IL1A 1QVIZ 2AAOA 1J7PA 2QEBA 3O4XA 2EC6B 1V1FA 4P5OE 1A2XA 4OV2A 2QPTA 1QV1A 3NHIA 4OCIA 3PALA 5HL1A 5K89A 5F6TA 2K61A 2Y5IA 4PHJA 3SS5A 4R1EA 2F8PA 2LVKA 3C1VA 3R1PA 1EH2A 2NXQA 3DVKA 2EGDA 3K21A 2KI4C 1EL4A 4YGAA 1OMVA 1PK0D 1QIVA 4OKHA 1M46A 5D7FA 2ISDA 2I18A 4M2QA 1DGVA 1WDCB 4NDCA 4A4BA 1ZACA 2QEHA 2LE9B 1B47A 2PVBA 3JVTC 1KSOA 1QX7A 3BUXB 2ZN8A 3BFAA 1UWOA 4DUQA 1JUOA 2L2EA 2M29A 4GGFA 1QJTA 2VRGA 3CLNA 1YUTA 4ORAB 2L2CA 2OPOA 1OE9B 1NWDA 2QACA 2JT3A 1KWOB 2KGRA 1S3PA 1QATA 1BR4B 3RM1A 2KGBC 1YX8A 2HF5A 2ZN9A 1S6IA 2F3YA 3EK4A 1NUBA 3PJIA 4MEWA 2NCOA 3PFVA 3Q8IA 1IH0A 2JTTA 1EXRA 3WHTB 2KQ6A 3BQ3A 3PATA 2LC5A 3TUYB 4WRIA 1TNWA 3JVTB 4PE4A 1YX7A 1K2HA 2F3ZA 2WC6A 1FBVA 3BOWB 1XFWO 4MZJA 3D76A 1DJWA 2GTEA 1UHNA 3D0YB 1KCYA 4IJ7A 3GK2A 1NX1A 1PULA 5HLOA 2HPSA 3PSRA 3UNWA 4D1EA 1L7ZA 2BKHB 3M0WA 1TNPA 3JTDC 4NDDA 1R6PA 1JBAA 1T14A 3BOWA 1OOHA 1JFKA 1OOGA 3CDNA 1IIOA 2H61A 3D0YA 5J3XA 1SPYA 3EVUA 4GNKB 5AERA 1Z4HA 3FE6A 3SG2A 4CIDA 4QJ4B 2K60A 3CGAA 1KSMA 2LMVA 1S6JA 1SR6B 2NLNA 1C3ZA 2LVIA 5I94A 2OS8C 3QRXA 1LA3A 2F33A 2LV7A 1AP4A 3RLZA 3DXLA 3S0DA 1GGZA 4MSPA 1KQMB 1MXEA 2L5XB 2LNKA 1KK8C 1JC2A 1W7JB 3D73A 1FF1A 5ER5A 2BKIB 1YUSA 1XK4C 1F4QA 2IS9A 1TN4A 3O2PA 5IBWA 1BT6A 3MSEB 4FTGA 5CSNA 1J7QA 1JF0A 4WQ3A 2KNEA 1A03A 2MLFC 1DQEA 3BXKA 4HRHA 1AUIB 1SW8A 1TOPA 2QEVA 3CWGA 4PHMA 2BCXA 3PM8A 1NX3A 2ZRTA 1TWOA 4PCWA 2FJUB 2OS8B 1CNPA 3VRPA 1XFUO 4PHNA 2I2RE 2BECA 3A4UB 1KFUS 3EKJA 4ICBA 3EVVA 1AK8A 1E8AA 4CFRA 4JQ0D 1OZSA 1UUSA 4QJ5B 1CB1A 1A29A 1Y1XA 3SS4A 1BOCA 1DJGA 4OZDA 2M1KB 1SCMC 1EG3A 1SL9A 2P71A 3K1EA 3S0FA 1QLSA 2NZ0A 3WHUB 1OOJA 2Y1MA 4YBHB 4AQJA 1B4CA 1QASA 1SRAA 3B88A 2E6WA 5AEQA 3V2LA 1D1OA 1ZOTB 5B8IB 2H2KA 1P28A 1R2UA 3I5IC 4PE7A 2MBXA 2CCMA 3DF0B 1BODA 1JFJA 1ALVA 3DD4A 1L2OC 3O4YA 2M1UA 4GPLB 5HLVA 2TN4A 3CTNA 4JPZB 1J55A 2LVVA 3S0BA 1YTZC 3I5HB 3IF7A 3ZNIA 1YRUB 1RROA 1DMOA 1B1GA 1TNXA 1JWDA 1ZFSA 2JOJA 2JXCA 3DF0A 2WC5A 5G08A 3SG4A 1BJFA 1BR1B 3TS5B 4FQOA 1C3YA 2KAYA 1PVBA 1RK9A 4MZKA 1RFJA 2CTNA 2ZNDA 4CLNA 4JWQA 2Y1NA 1G4YR 3OX5A 1AJ5A 2FCEA 1DF0B 3EKHA 4ZCUA 3CR5X 3E3RA 3IQOA 3I5GB 2O5GA 5ER4X 2PYQA 1MQ1A 2PRUA 1QTXA 2WCLA 1TNQA 1YVLA 3AKBA 3OHMB 1DVIA 4P2YB 2AUCA 1TTXA 1OMDA 2AMIA 3KO0A 5AXIA 1L2OB 2P70A 1J1DA 3I5FC 3O78A 4XYNA 2WNDA 1F71A 2LLUA 2CXJA 1DGUA 1YRTB 1DF0A 5HKYA 3GK4X 2GGZA 2M97A 3BFHA 4JD9A 2WCFA 1LVCD 1C07A 4YI9A 1K9PA 4MZLA 2KI6C 1OOIX 4YGEB 3HX4A 2PASA 4AOMA 2CT9A 4C0KA 3D10A 3CZ2A 2KI4B 1OMRA 2NCPA 5D3OA 1IG5A 2JNXA 1F54A 2JNFA 2FOTA 3DZTA 3LK0A 1S1EA 2LMUA 2JTZA 4C0JA 1LA0A 3OB2B 1QS7A 3B86A 3SG7A 1QIWA 1UHIA 5HKZA 1K9UA 1Y1UA 1KK7Y 2ZRSA 2Y4QA 5DICA 5FI6A 2ZNEA 3EVRA 4UPGA 2HQ8A 5HKWA 1TUZA 1RJVA 4MRYA 5DKQA 2M7NA 2WOSA 1MHOA 1OZOA 2M7LA 2WCEA 1B8CA 2KFFA 4DCKA 2KOTA 4PT1A 2BE4A 2QEOA 2JULA 2L4IA 2MA2A 2K7CA 3DVJA 3BUMB 1OOFA 1YURA 2LM5A 1CLBA 2KYCA 1XFRA 2M49B 3NXAA 1B9AA 3PN7C 4NDBA 2K2AA 1JSAA 2F2OA 3NHTA 2KHNA 1SKTA 2BBNA 1BU3A 2MLEC 3AAKA 4C0LA 3KEVA 4MVFA 1AJ4A 4YGBB 2WCJA 1BG1A 1B8RA 2WCHA 3SJSA 3LK1A 1SL7A 1UHHA 3OX6A 1M31A 1DJZA 3A8RA 3D75A 1EG4A 3NSIA 4A4CA 1CLLA 1W9ZA 3LCPC 4HRGA 2R2IA 1PSBA 2KI6D 2LP3A 5KSZA 2G2BA 1K95A 2HETA 3JTDB 4PE0A 1FI6A 1XA5A 4GGNA 2KFHA 1SBJA 1PSRA 3CZTX 3FS7A 2A4JA 1UHJA 2JPTA 2CNPA 1SCVA 3GK1A 2JXLA 5TNCA 1CMFA 2EHBA 1MUXA 1IQ3A 4CFQA 1OW4A 4YRUA 1SY9A 4WQ2A 4PHKA 1K90D 1CDPA 2K7BA 3CS1A 1Y1AA 1ODBA 2KPHA 3R1OA 1CFFA 1SNLA 3IQQA 1IRJA 2K7DA 4YGDB 5I2QA 1CM4A 3L47A 2PQLA 1Y6WA 2JU0A 1KK8B 3WNXB 1M45A 1GM0A 2JC2A 3FE8A 3D78A 3F45A 1NCZA 5DKRA 1OQPA 1TCOB 3HCMA 4DS7A 1XYDA 1LXFC 3TDUA 4JKTA 4PE1A 3VGOA 2BBMA 5FI2A 2FCDA 3NSLA 4I5KA 1NP8A 4USLA 2LHLA 5CSIA 1XFXO 4GAOA 3EK8A 4NQGA 2BCBA 1KFXL 1ALWA 1CFDA 1N65A 1XK4A 1YUUA 2L98A 1NIWA 1K94A 2BL0C 2BAPA 3BUWB 4YI8A 5JJGA 2EC6C 1G8IA 3OB1B 2LUXA 2BCAA 3FWBA 4BY4A 4ORBB 5I2OA 1B8LA 1RWYA 5CSFA 2LCPA 1NYAA 2YGUA 3CZ1A 1J7OA 5DKNA 2K7OA 1A75B 1NCYA 3L4LA 1CKKA 4GGFC 1DJYA 1X02A 3SG3A 3VRRA 3BUNB 2L5YA 4BY5A 4N5XA 2GV5A 5KU1A 5KTYA 1SCMB 2JT8A 3S0EA 1GJYA 1WDCC 2WC8A 3CYZA 1CFCA 1S5GY 3CABA 3N7HA 2I7AA 4GFTA 1QX2A 1LKJA 2OTGC 3BFBA 4PDZA 1DJIA 2LVJA 3LLEA 3I5IB 1H4BA 1A75A 1XFYO 2KBIA 2MJWB 1QWVA 3KHEA 1RTP1 2WCBA 3IVTA 1DTLA 1NPQA 4FQTA 1HQVA 2MAZA 1ZMZA 1KWOC 2KYFA 2JPOA 2LAPA 1NX2A 2QDIA 1JF2A 3DVEA 4I5NB 1VRKA 1TIZA 1ZUZA 1FPWA 3SIAA 3FIAA 1DELA 2KFGA 1V1GA 2F2PA 3DVMA 3NSKA 2JT0A 4XJKB 3BJHA 2KLEA 2LLSA 2ERBA 4MLWA 5GQQC 3SS3A 1WRZA 4I5JA 1F4OA 1XFZO 5CSJA 3TUYC 2LHIA 1LS8A 3B87A 3R1VA 1Y0VH 2OTGB 4QJ3B 4Q04A 1K96A
chains in the Genus database with same CATH topology
2RGIA 3KF9A 3VROA 4MBEA 1U5IB 2K2FA 1K9KA 1HT9A 5JOLA 2H61C 4XJKA 2GGMA 3I5FB 1Q80A 1BF5A 2B1UA 1QV0A 2LMTA 2Q4UA 2D8NA 1IKUA 1RECA 2K8MB 1QLKA 3SG6A 1AHRA 1C7WA 2ZKMX 1U5IA 1W7IB 3BYAA 1CFPA 2L50A 1M63B 2SASA 2LP2A 2JRFA 2L4HA 5CPVA 1YVHA 1F70A 4OR9B 1OSAA 2BE6A 2V53A 1SL8A 1SYMA 2PSRA 1N0YA 1SR6C 2M8UA 2CBLA 3ICBA 4I5LB 1NSHA 3LL8B 4TNCA 1S5GZ 3EK7A 3CR4X 1QX5B 1J7RA 4DRWA 4MRXA 1F8HA 3OP0A 1UURA 5HYDA 3H4SE 1WLMA 1MWNA 1F55A 1KQMC 1M39A 2Q91A 5D69A 2WORA 5AFPA 1B7TY 4HREE 3ZWHA 2KAXA 2L51A 3WXAA 1IQ5A 2LLTA 1CLMA 1DJHA 1TRFA 2M9GA 4DIRA 1UP5A 4M2OA 4GBAA 2E30A 1S26D 1LINA 4CPVA 1IJ5A 1DT7B 1CM1A 3PLFB 3FWCA 5I2LA 1H8BA 3TDIA 1GGWA 1PRWA 4F0ZB 1NCXA 2KBMA 1XFVO 1GQMA 5BPJA 2KQYA 3AAJA 3PN7B 1G33A 5FYXA 1QVIY 1NX0A 2KAVA 3NSOA 4ORCB 2JWWA 3VRQA 2K0JA 5I8NA 3AKAA 5AANA 1SMGA 4PALA 3KPXA 2COLB 1KK7Z 1FI5A 1UHKA 1AVSA 2KDHA 2MHHA 3O6BA 4GUKA 1XO5A 2O60A 3TDZA 1SK6D 1BLQA 1S36A 5PALA 4N1GA 1CDLA 3CR2A 1PALA 4M2PA 4ZCVA 1MR8A 1MXLC 3BUOB 1FW4A 1QXPA 1WY9A 1IJ6A 1J1EA 1WRKA 3SIBA 1A4PA 1EJ3A 2KSPA 1KFXS 1XVJA 4ETOA 1KFUL 4AQIA 1CDMA 1C7VA 1BMOA 1WRLA 2M0RA 1S6CA 1WLZA 2P6BB 2PALA 2JQ6A 2ZFDA 3I5HC 1N2DA 1DJXA 2SCPA 1B7TZ 2M3WA 3VRNA 1CMGA 4YGCB 4U8DA 2LANA 3TS5C 2LUCA 1CDNA 1IGVA 4E68A 1CTRA 2MRDA 1MF8B 1KQVA 3GOFA 1PVAA 4MN0A 2DOQA 1K8UA 2I94A 4L9MA 1TCFA 3SG5A 3I5GC 1IWQA 2JZIA 2PMYA 2L0PA 4HSZA 4N1FA 1K93D 4OVNF 3TZ1A 2HQWA 2G9BA 2BL0B 1YR5A 4IL1A 1QVIZ 2AAOA 1J7PA 2EC6B 1V1FA 4P5OE 1A2XA 4OV2A 2QPTA 1QV1A 5K89A 4OCIA 3PALA 5F6TA 2K61A 2Y5IA 4PHJA 4R1EA 2F8PA 2LVKA 3C1VA 1EH2A 2NXQA 3DVKA 2EGDA 3K21A 2KI4C 1EL4A 4YGAA 1OMVA 1PK0D 1QIVA 4OKHA 1M46A 5D7FA 2ISDA 2I18A 4M2QA 1DGVA 1WDCB 4NDCA 4A4BA 1ZACA 2LE9B 1B47A 2PVBA 3JVTC 1KSOA 1QX7A 3BUXB 2ZN8A 1UWOA 4DUQA 1JUOA 2L2EA 2M29A 4GGFA 1QJTA 2VRGA 3CLNA 1YUTA 4ORAB 2OPOA 1OE9B 1NWDA 2QACA 2JT3A 1KWOB 2KGRA 1S3PA 1QATA 1BR4B 3RM1A 2KGBC 1YX8A 2HF5A 2ZN9A 1S6IA 2F3YA 3EK4A 1NUBA 4MEWA 2NCOA 3PFVA 1IH0A 2JTTA 1EXRA 3WHTB 2KQ6A 3BQ3A 3PATA 2LC5A 3TUYB 4WRIA 1TNWA 3JVTB 4PE4A 1YX7A 1K2HA 2F3ZA 1FBVA 3BOWB 1XFWO 4MZJA 1DJWA 3D0YB 1UHNA 1KCYA 3GK2A 1NX1A 1PULA 5HLOA 2HPSA 3PSRA 4D1EA 1L7ZA 2BKHB 3M0WA 1TNPA 3JTDC 4NDDA 1R6PA 1JBAA 3BOWA 1JFKA 2H61A 3D0YA 5J3XA 1SPYA 3EVUA 4GNKB 5AERA 4CIDA 4QJ4B 3SG2A 3CGAA 1KSMA 2LMVA 1S6JA 1SR6B 2NLNA 2LVIA 2OS8C 3QRXA 1LA3A 2F33A 2LV7A 1AP4A 3RLZA 1GGZA 4MSPA 1KQMB 1MXEA 2L5XB 2LNKA 1KK8C 1JC2A 1W7JB 1FF1A 5ER5A 2BKIB 1YUSA 1XK4C 1F4QA 2IS9A 1TN4A 3O2PA 5IBWA 1BT6A 3MSEB 4FTGA 5CSNA 1J7QA 1JF0A 4WQ3A 2KNEA 1A03A 2MLFC 3BXKA 4HRHA 1AUIB 1SW8A 1TOPA 3CWGA 4PHMA 2BCXA 3PM8A 1NX3A 2ZRTA 4PCWA 2FJUB 2OS8B 1CNPA 3VRPA 1XFUO 4PHNA 2I2RE 2BECA 3A4UB 1KFUS 3EKJA 4ICBA 3EVVA 1AK8A 1E8AA 4CFRA 4JQ0D 1OZSA 1UUSA 4QJ5B 1CB1A 1A29A 1Y1XA 1BOCA 1DJGA 2M1KB 1SCMC 1EG3A 1SL9A 1QLSA 2NZ0A 3WHUB 1OOJA 2Y1MA 4YBHB 4AQJA 1B4CA 1QASA 1SRAA 2E6WA 5AEQA 1D1OA 1ZOTB 5B8IB 2H2KA 1R2UA 3I5IC 4PE7A 2MBXA 2CCMA 3DF0B 1BODA 1JFJA 1ALVA 3DD4A 1L2OC 3O4YA 2M1UA 4GPLB 5HLVA 2TN4A 3CTNA 4JPZB 1J55A 2LVVA 1YTZC 3I5HB 3IF7A 3ZNIA 1YRUB 1RROA 1DMOA 1B1GA 1TNXA 1JWDA 1ZFSA 2JOJA 2JXCA 3DF0A 5G08A 3SG4A 1BJFA 1BR1B 3TS5B 4FQOA 2KAYA 1PVBA 1RK9A 4MZKA 1RFJA 2CTNA 2ZNDA 4CLNA 4JWQA 2Y1NA 1G4YR 3OX5A 1AJ5A 2FCEA 1DF0B 3EKHA 4ZCUA 3CR5X 3E3RA 3IQOA 3I5GB 2O5GA 5ER4X 1MQ1A 2PRUA 1QTXA 4P2YB 1TNQA 1YVLA 3AKBA 3OHMB 1DVIA 2AUCA 1TTXA 2AMIA 1OMDA 3KO0A 5AXIA 1L2OB 4XYNA 1J1DA 3I5FC 3O78A 2WNDA 1F71A 2LLUA 2CXJA 1DGUA 1YRTB 1DF0A 5HKYA 3GK4X 2GGZA 2M97A 2WCFA 1LVCD 1C07A 4YI9A 1K9PA 4MZLA 2KI6C 4YGEB 3HX4A 2PASA 4AOMA 2CT9A 4C0KA 3D10A 2KI4B 1OMRA 2NCPA 1F54A 1IG5A 2JNXA 2JNFA 2FOTA 3LK0A 1S1EA 2LMUA 2JTZA 4C0JA 1LA0A 3OB2B 1QS7A 3SG7A 1QIWA 1UHIA 5HKZA 1K9UA 1Y1UA 1KK7Y 2ZRSA 2Y4QA 4UPGA 5I2QA 2ZNEA 3EVRA 2HQ8A 5HKWA 1RJVA 4MRYA 5DKQA 2M7NA 2WOSA 1MHOA 1OZOA 2M7LA 2WCEA 1B8CA 2KFFA 4DCKA 2KOTA 2BE4A 2JULA 2L4IA 2MA2A 2K7CA 3DVJA 3BUMB 1YURA 2LM5A 1CLBA 2KYCA 2M49B 3NXAA 1B9AA 3PN7C 4NDBA 2K2AA 1JSAA 2F2OA 2KHNA 1SKTA 2BBNA 1BU3A 2MLEC 3AAKA 4C0LA 3KEVA 4MVFA 1AJ4A 4YGBB 1BG1A 1B8RA 3SJSA 3LK1A 1SL7A 1UHHA 3OX6A 1M31A 1DJZA 3A8RA 1EG4A 3NSIA 4A4CA 1CLLA 3LCPC 4HRGA 2R2IA 1PSBA 2KI6D 2LP3A 5KSZA 2G2BA 1K95A 2HETA 3JTDB 4PE0A 1FI6A 1XA5A 4GGNA 2KFHA 1SBJA 1PSRA 3CZTX 3FS7A 2A4JA 1UHJA 2JPTA 2CNPA 1SCVA 3GK1A 2JXLA 5TNCA 1CMFA 2EHBA 1MUXA 1IQ3A 4CFQA 4YRUA 1SY9A 4WQ2A 4PHKA 1K90D 1CDPA 2K7BA 3CS1A 1Y1AA 1ODBA 1CFFA 1SNLA 3IQQA 1IRJA 2K7DA 4YGDB 1CM4A 1Y6WA 2JU0A 1KK8B 3WNXB 1M45A 2JC2A 3F45A 1NCZA 5DKRA 1OQPA 1TCOB 3HCMA 4DS7A 1XYDA 1LXFC 3TDUA 4PE1A 3VGOA 2BBMA 2FCDA 3NSLA 4I5KA 1NP8A 4USLA 2LHLA 5CSIA 1XFXO 4GAOA 3EK8A 4NQGA 2BCBA 1KFXL 1ALWA 1CFDA 1N65A 1XK4A 1YUUA 2L98A 1NIWA 1K94A 2BL0C 3BUWB 4YI8A 5JJGA 2EC6C 1G8IA 3OB1B 2LUXA 2BCAA 3FWBA 4BY4A 4ORBB 5I2OA 1B8LA 1RWYA 5CSFA 2LCPA 1NYAA 1J7OA 5DKNA 2K7OA 1A75B 1NCYA 1CKKA 4GGFC 1DJYA 1X02A 3SG3A 3VRRA 3BUNB 5KTYA 4BY5A 4N5XA 2GV5A 5KU1A 1SCMB 2JT8A 1GJYA 1WDCC 2WC8A 1CFCA 1S5GY 4GFTA 2I7AA 1QX2A 1LKJA 2OTGC 4PDZA 1DJIA 2LVJA 3LLEA 3I5IB 1H4BA 1A75A 1XFYO 2KBIA 2MJWB 3KHEA 1RTP1 2WCBA 1DTLA 1NPQA 1HQVA 2MAZA 1ZMZA 1KWOC 2KYFA 2LAPA 1NX2A 1JF2A 3DVEA 4I5NB 1VRKA 1TIZA 1ZUZA 1FPWA 3SIAA 3FIAA 2KFGA 1V1GA 2F2PA 3DVMA 3NSKA 2JT0A 4XJKB 4MLWA 5GQQC 2LLSA 1WRZA 4I5JA 1F4OA 1XFZO 5CSJA 3TUYC 2LHIA 1Y0VH 2OTGB 4QJ3B 4Q04A 1K96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGI A;  3KF9 A;  3VRO A;  4MBE A;  1U5I B;  2K2F A;  1K9K A;  1HT9 A;  5JOL A;  2H61 C;  4XJK A;  2GGM A;  3I5F B;  1Q80 A;  1BF5 A;  2B1U A;  1QV0 A;  2LMT A;  2Q4U A;  2D8N A;  1IKU A;  1REC A;  2K8M B;  1QLK A;  3SG6 A;  1AHR A;  1C7W A;  2ZKM X;  1U5I A;  1W7I B;  3BYA A;  1CFP A;  2L50 A;  1M63 B;  2SAS A;  2LP2 A;  2JRF A;  2L4H A;  5CPV A;  1YVH A;  1F70 A;  4OR9 B;  1OSA A;  2BE6 A;  2V53 A;  1SL8 A;  1SYM A;  2PSR A;  1N0Y A;  1SR6 C;  2M8U A;  2CBL A;  3ICB A;  4I5L B;  1NSH A;  3LL8 B;  4TNC A;  1S5G Z;  3EK7 A;  3CR4 X;  1QX5 B;  1J7R A;  4DRW A;  4MRX A;  1F8H A;  3OP0 A;  1UUR A;  5HYD A;  3H4S E;  1WLM A;  1MWN A;  1F55 A;  1KQM C;  1M39 A;  2Q91 A;  5D69 A;  2WOR A;  5AFP A;  1B7T Y;  4HRE E;  3ZWH A;  2KAX A;  2L51 A;  3WXA A;  1IQ5 A;  2LLT A;  1CLM A;  1DJH A;  1TRF A;  2M9G A;  4DIR A;  1UP5 A;  4M2O A;  4GBA A;  2E30 A;  1S26 D;  1LIN A;  4CPV A;  1IJ5 A;  1DT7 B;  1CM1 A;  3PLF B;  3FWC A;  5I2L A;  1H8B A;  3TDI A;  1GGW A;  1PRW A;  4F0Z B;  1NCX A;  2KBM A;  1XFV O;  1GQM A;  5BPJ A;  2KQY A;  3AAJ A;  3PN7 B;  1G33 A;  5FYX A;  1QVI Y;  1NX0 A;  2KAV A;  3NSO A;  4ORC B;  2JWW A;  3VRQ A;  2K0J A;  5I8N A;  3AKA A;  5AAN A;  1SMG A;  4PAL A;  3KPX A;  2COL B;  1KK7 Z;  1FI5 A;  1UHK A;  1AVS A;  2KDH A;  2MHH A;  3O6B A;  4GUK A;  1XO5 A;  2O60 A;  3TDZ A;  1SK6 D;  1BLQ A;  1S36 A;  5PAL A;  4N1G A;  1CDL A;  3CR2 A;  1PAL A;  4M2P A;  4ZCV A;  1MR8 A;  1MXL C;  3BUO B;  1FW4 A;  1QXP A;  1WY9 A;  1IJ6 A;  1J1E A;  1WRK A;  3SIB A;  1A4P A;  1EJ3 A;  2KSP A;  1KFX S;  1XVJ A;  4ETO A;  1KFU L;  4AQI A;  1CDM A;  1C7V A;  1BMO A;  1WRL A;  2M0R A;  1S6C A;  1WLZ A;  2P6B B;  2PAL A;  2JQ6 A;  2ZFD A;  3I5H C;  1N2D A;  1DJX A;  2SCP A;  1B7T Z;  2M3W A;  3VRN A;  1CMG A;  4YGC B;  4U8D A;  2LAN A;  3TS5 C;  2LUC A;  1CDN A;  1IGV A;  4E68 A;  1CTR A;  2MRD A;  1MF8 B;  1KQV A;  3GOF A;  1PVA A;  4MN0 A;  2DOQ A;  1K8U A;  2I94 A;  4L9M A;  1TCF A;  3SG5 A;  3I5G C;  1IWQ A;  2JZI A;  2PMY A;  2L0P A;  4HSZ A;  4N1F A;  1K93 D;  4OVN F;  3TZ1 A;  2HQW A;  2G9B A;  2BL0 B;  1YR5 A;  4IL1 A;  1QVI Z;  2AAO A;  1J7P A;  2EC6 B;  1V1F A;  4P5O E;  1A2X A;  4OV2 A;  2QPT A;  1QV1 A;  5K89 A;  4OCI A;  3PAL A;  5F6T A;  2K61 A;  2Y5I A;  4PHJ A;  4R1E A;  2F8P A;  2LVK A;  3C1V A;  1EH2 A;  2NXQ A;  3DVK A;  2EGD A;  3K21 A;  2KI4 C;  1EL4 A;  4YGA A;  1OMV A;  1PK0 D;  1QIV A;  4OKH A;  1M46 A;  5D7F A;  2ISD A;  2I18 A;  4M2Q A;  1DGV A;  1WDC B;  4NDC A;  4A4B A;  1ZAC A;  2LE9 B;  1B47 A;  2PVB A;  3JVT C;  1KSO A;  1QX7 A;  3BUX B;  2ZN8 A;  1UWO A;  4DUQ A;  1JUO A;  2L2E A;  2M29 A;  4GGF A;  1QJT A;  2VRG A;  3CLN A;  1YUT A;  4ORA B;  2OPO A;  1OE9 B;  1NWD A;  2QAC A;  2JT3 A;  1KWO B;  2KGR A;  1S3P A;  1QAT A;  1BR4 B;  3RM1 A;  2KGB C;  1YX8 A;  2HF5 A;  2ZN9 A;  1S6I A;  2F3Y A;  3EK4 A;  1NUB A;  4MEW A;  2NCO A;  3PFV A;  1IH0 A;  2JTT A;  1EXR A;  3WHT B;  2KQ6 A;  3BQ3 A;  3PAT A;  2LC5 A;  3TUY B;  4WRI A;  1TNW A;  3JVT B;  4PE4 A;  1YX7 A;  1K2H A;  2F3Z A;  1FBV A;  3BOW B;  1XFW O;  4MZJ A;  1DJW A;  3D0Y B;  1UHN A;  1KCY A;  3GK2 A;  1NX1 A;  1PUL A;  5HLO A;  2HPS A;  3PSR A;  4D1E A;  1L7Z A;  2BKH B;  3M0W A;  1TNP A;  3JTD C;  4NDD A;  1R6P A;  1JBA A;  3BOW A;  1JFK A;  2H61 A;  3D0Y A;  5J3X A;  1SPY A;  3EVU A;  4GNK B;  5AER A;  4CID A;  4QJ4 B;  3SG2 A;  3CGA A;  1KSM A;  2LMV A;  1S6J A;  1SR6 B;  2NLN A;  2LVI A;  2OS8 C;  3QRX A;  1LA3 A;  2F33 A;  2LV7 A;  1AP4 A;  3RLZ A;  1GGZ A;  4MSP A;  1KQM B;  1MXE A;  2L5X B;  2LNK A;  1KK8 C;  1JC2 A;  1W7J B;  1FF1 A;  5ER5 A;  2BKI B;  1YUS A;  1XK4 C;  1F4Q A;  2IS9 A;  1TN4 A;  3O2P A;  5IBW A;  1BT6 A;  3MSE B;  4FTG A;  5CSN A;  1J7Q A;  1JF0 A;  4WQ3 A;  2KNE A;  1A03 A;  2MLF C;  3BXK A;  4HRH A;  1AUI B;  1SW8 A;  1TOP A;  3CWG A;  4PHM A;  2BCX A;  3PM8 A;  1NX3 A;  2ZRT A;  4PCW A;  2FJU B;  2OS8 B;  1CNP A;  3VRP A;  1XFU O;  4PHN A;  2I2R E;  2BEC A;  3A4U B;  1KFU S;  3EKJ A;  4ICB A;  3EVV A;  1AK8 A;  1E8A A;  4CFR A;  4JQ0 D;  1OZS A;  1UUS A;  4QJ5 B;  1CB1 A;  1A29 A;  1Y1X A;  1BOC A;  1DJG A;  2M1K B;  1SCM C;  1EG3 A;  1SL9 A;  1QLS A;  2NZ0 A;  3WHU B;  1OOJ A;  2Y1M A;  4YBH B;  4AQJ A;  1B4C A;  1QAS A;  1SRA A;  2E6W A;  5AEQ A;  1D1O A;  1ZOT B;  5B8I B;  2H2K A;  1R2U A;  3I5I C;  4PE7 A;  2MBX A;  2CCM A;  3DF0 B;  1BOD A;  1JFJ A;  1ALV A;  3DD4 A;  1L2O C;  3O4Y A;  2M1U A;  4GPL B;  5HLV A;  2TN4 A;  3CTN A;  4JPZ B;  1J55 A;  2LVV A;  1YTZ C;  3I5H B;  3IF7 A;  3ZNI A;  1YRU B;  1RRO A;  1DMO A;  1B1G A;  1TNX A;  1JWD A;  1ZFS A;  2JOJ A;  2JXC A;  3DF0 A;  5G08 A;  3SG4 A;  1BJF A;  1BR1 B;  3TS5 B;  4FQO A;  2KAY A;  1PVB A;  1RK9 A;  4MZK A;  1RFJ A;  2CTN A;  2ZND A;  4CLN A;  4JWQ A;  2Y1N A;  1G4Y R;  3OX5 A;  1AJ5 A;  2FCE A;  1DF0 B;  3EKH A;  4ZCU A;  3CR5 X;  3E3R A;  3IQO A;  3I5G B;  2O5G A;  5ER4 X;  1MQ1 A;  2PRU A;  1QTX A;  4P2Y B;  1TNQ A;  1YVL A;  3AKB A;  3OHM B;  1DVI A;  2AUC A;  1TTX A;  2AMI A;  1OMD A;  3KO0 A;  5AXI A;  1L2O B;  4XYN A;  1J1D A;  3I5F C;  3O78 A;  2WND A;  1F71 A;  2LLU A;  2CXJ A;  1DGU A;  1YRT B;  1DF0 A;  5HKY A;  3GK4 X;  2GGZ A;  2M97 A;  2WCF A;  1LVC D;  1C07 A;  4YI9 A;  1K9P A;  4MZL A;  2KI6 C;  4YGE B;  3HX4 A;  2PAS A;  4AOM A;  2CT9 A;  4C0K A;  3D10 A;  2KI4 B;  1OMR A;  2NCP A;  1F54 A;  1IG5 A;  2JNX A;  2JNF A;  2FOT A;  3LK0 A;  1S1E A;  2LMU A;  2JTZ A;  4C0J A;  1LA0 A;  3OB2 B;  1QS7 A;  3SG7 A;  1QIW A;  1UHI A;  5HKZ A;  1K9U A;  1Y1U A;  1KK7 Y;  2ZRS A;  2Y4Q A;  4UPG A;  5I2Q A;  2ZNE A;  3EVR A;  2HQ8 A;  5HKW A;  1RJV A;  4MRY A;  5DKQ A;  2M7N A;  2WOS A;  1MHO A;  1OZO A;  2M7L A;  2WCE A;  1B8C A;  2KFF A;  4DCK A;  2KOT A;  2BE4 A;  2JUL A;  2L4I A;  2MA2 A;  2K7C A;  3DVJ A;  3BUM B;  1YUR A;  2LM5 A;  1CLB A;  2KYC A;  2M49 B;  3NXA A;  1B9A A;  3PN7 C;  4NDB A;  2K2A A;  1JSA A;  2F2O A;  2KHN A;  1SKT A;  2BBN A;  1BU3 A;  2MLE C;  3AAK A;  4C0L A;  3KEV A;  4MVF A;  1AJ4 A;  4YGB B;  1BG1 A;  1B8R A;  3SJS A;  3LK1 A;  1SL7 A;  1UHH A;  3OX6 A;  1M31 A;  1DJZ A;  3A8R A;  1EG4 A;  3NSI A;  4A4C A;  1CLL A;  3LCP C;  4HRG A;  2R2I A;  1PSB A;  2KI6 D;  2LP3 A;  5KSZ A;  2G2B A;  1K95 A;  2HET A;  3JTD B;  4PE0 A;  1FI6 A;  1XA5 A;  4GGN A;  2KFH A;  1SBJ A;  1PSR A;  3CZT X;  3FS7 A;  2A4J A;  1UHJ A;  2JPT A;  2CNP A;  1SCV A;  3GK1 A;  2JXL A;  5TNC A;  1CMF A;  2EHB A;  1MUX A;  1IQ3 A;  4CFQ A;  4YRU A;  1SY9 A;  4WQ2 A;  4PHK A;  1K90 D;  1CDP A;  2K7B A;  3CS1 A;  1Y1A A;  1ODB A;  1CFF A;  1SNL A;  3IQQ A;  1IRJ A;  2K7D A;  4YGD B;  1CM4 A;  1Y6W A;  2JU0 A;  1KK8 B;  3WNX B;  1M45 A;  2JC2 A;  3F45 A;  1NCZ A;  5DKR A;  1OQP A;  1TCO B;  3HCM A;  4DS7 A;  1XYD A;  1LXF C;  3TDU A;  4PE1 A;  3VGO A;  2BBM A;  2FCD A;  3NSL A;  4I5K A;  1NP8 A;  4USL A;  2LHL A;  5CSI A;  1XFX O;  4GAO A;  3EK8 A;  4NQG A;  2BCB A;  1KFX L;  1ALW A;  1CFD A;  1N65 A;  1XK4 A;  1YUU A;  2L98 A;  1NIW A;  1K94 A;  2BL0 C;  3BUW B;  4YI8 A;  5JJG A;  2EC6 C;  1G8I A;  3OB1 B;  2LUX A;  2BCA A;  3FWB A;  4BY4 A;  4ORB B;  5I2O A;  1B8L A;  1RWY A;  5CSF A;  2LCP A;  1NYA A;  1J7O A;  5DKN A;  2K7O A;  1A75 B;  1NCY A;  1CKK A;  4GGF C;  1DJY A;  1X02 A;  3SG3 A;  3VRR A;  3BUN B;  5KTY A;  4BY5 A;  4N5X A;  2GV5 A;  5KU1 A;  1SCM B;  2JT8 A;  1GJY A;  1WDC C;  2WC8 A;  1CFC A;  1S5G Y;  4GFT A;  2I7A A;  1QX2 A;  1LKJ A;  2OTG C;  4PDZ A;  1DJI A;  2LVJ A;  3LLE A;  3I5I B;  1H4B A;  1A75 A;  1XFY O;  2KBI A;  2MJW B;  3KHE A;  1RTP 1;  2WCB A;  1DTL A;  1NPQ A;  1HQV A;  2MAZ A;  1ZMZ A;  1KWO C;  2KYF A;  2LAP A;  1NX2 A;  1JF2 A;  3DVE A;  4I5N B;  1VRK A;  1TIZ A;  1ZUZ A;  1FPW A;  3SIA A;  3FIA A;  2KFG A;  1V1G A;  2F2P A;  3DVM A;  3NSK A;  2JT0 A;  4XJK B;  4MLW A;  5GQQ C;  2LLS A;  1WRZ A;  4I5J A;  1F4O A;  1XFZ O;  5CSJ A;  3TUY C;  2LHI A;  1Y0V H;  2OTG B;  4QJ3 B;  4Q04 A;  1K96 A; 
#chains in the Genus database with same CATH topology
 2RGI A;  3KF9 A;  3VRO A;  4MBE A;  1U5I B;  2K2F A;  3CZ0 A;  1K9K A;  4INX A;  1HT9 A;  2WCM A;  5JOL A;  1DC1 A;  2H61 C;  4XJK A;  2GGM A;  3I5F B;  1Q80 A;  1BF5 A;  2B1U A;  3B7A A;  4F7F A;  1QV0 A;  2LMT A;  2Q4U A;  2D8N A;  1IKU A;  1REC A;  2K8M B;  1QLK A;  3SG6 A;  3S0A A;  1AHR A;  1C7W A;  5EL2 A;  2ZKM X;  2BNX A;  1U5I A;  1W7I B;  5FI7 A;  3BYA A;  1CFP A;  2L50 A;  1M63 B;  2SAS A;  2LP2 A;  2JRF A;  2L4H A;  3NGV A;  5CPV A;  1SSE B;  2KLD A;  1YVH A;  1F70 A;  4OR9 B;  1OSA A;  2BE6 A;  2V53 A;  1ORG A;  1SL8 A;  1SYM A;  2PSR A;  1N0Y A;  1SR6 C;  2M8U A;  2CBL A;  3ICB A;  3DYE A;  2FJY A;  1NSH A;  3LL8 B;  4I5L B;  3RZS A;  4TNC A;  1S5G Z;  3EK7 A;  3CR4 X;  1QX5 B;  1J7R A;  4DRW A;  4MRX A;  1F8H A;  3OP0 A;  1UUR A;  5HYD A;  3H4S E;  1WLM A;  1MWN A;  1F55 A;  1KQM C;  1M39 A;  2Q91 A;  3OGN A;  5D69 A;  2WOR A;  5AFP A;  1B7T Y;  4HRE E;  3ZWH A;  1TUJ A;  2KAX A;  4KYN A;  2L51 A;  3WXA A;  3QME A;  1IQ5 A;  2LLT A;  1CLM A;  1DJH A;  1TRF A;  2M9G A;  4DIR A;  1UP5 A;  4M2O A;  4GBA A;  2E30 A;  1S26 D;  1LIN A;  4CPV A;  1IJ5 A;  1DT7 B;  1CM1 A;  3PLF B;  3FWC A;  5I2L A;  1H8B A;  3TDI A;  1GGW A;  1PRW A;  4F0Z B;  1NCX A;  2KBM A;  1XFV O;  1GQM A;  5BPJ A;  2KQY A;  3AAJ A;  3PN7 B;  1G33 A;  5FYX A;  1QVI Y;  1NX0 A;  3B6X A;  2KAV A;  3FE9 A;  3NSO A;  3D74 A;  4ORC B;  2JWW A;  3VRQ A;  2K0J A;  5I8N A;  3AKA A;  5AAN A;  1SMG A;  4PAL A;  3KPX A;  2COL B;  1KK7 Z;  1FI5 A;  1UHK A;  1AVS A;  2KDH A;  2MHH A;  3D77 A;  3PM2 A;  3O6B A;  4GUK A;  1XO5 A;  2O60 A;  3TDZ A;  1SK6 D;  1BLQ A;  1S36 A;  5PAL A;  4N1G A;  3OBV A;  1CDL A;  3CR2 A;  1PAL A;  4M2P A;  4ZCV A;  1MR8 A;  1MXL C;  3BUO B;  1FW4 A;  1QXP A;  1WY9 A;  1IJ6 A;  1J1E A;  1WRK A;  1Z2C B;  3SIB A;  1A4P A;  1EJ3 A;  3S0G A;  2KSP A;  1KFX S;  1XVJ A;  4ETO A;  1KFU L;  4AQI A;  1CDM A;  1C7V A;  1BMO A;  1WRL A;  2M0R A;  1S6C A;  1WLZ A;  2P6B B;  2PAL A;  2JQ6 A;  2ZFD A;  3I5H C;  1N2D A;  3EG5 B;  1DJX A;  2WCK A;  3VB1 A;  2SCP A;  1B7T Z;  2M3W A;  3VRN A;  1CMG A;  4YGC B;  1DEK A;  4U8D A;  2LAN A;  3TS5 C;  2LUC A;  1CDN A;  1IGV A;  4E68 A;  1CTR A;  2MRD A;  1MF8 B;  1KQV A;  3GOF A;  4INW A;  1PVA A;  4MN0 A;  3R72 A;  3L4A A;  2DOQ A;  1K8U A;  2I94 A;  4L9M A;  1TCF A;  3SG5 A;  3I5G C;  1IWQ A;  2JZI A;  2PMY A;  2L0P A;  4HSZ A;  3DY9 A;  1K93 D;  4N1F A;  4OVN F;  2H8V A;  3TZ1 A;  2HQW A;  3UO9 A;  2G9B A;  2BL0 B;  1YR5 A;  4IL1 A;  1QVI Z;  2AAO A;  1J7P A;  2QEB A;  3O4X A;  2EC6 B;  1V1F A;  4P5O E;  1A2X A;  4OV2 A;  2QPT A;  1QV1 A;  3NHI A;  4OCI A;  3PAL A;  5HL1 A;  5K89 A;  5F6T A;  2K61 A;  2Y5I A;  4PHJ A;  3SS5 A;  4R1E A;  2F8P A;  2LVK A;  3C1V A;  3R1P A;  1EH2 A;  2NXQ A;  3DVK A;  2EGD A;  3K21 A;  2KI4 C;  1EL4 A;  4YGA A;  1OMV A;  1PK0 D;  1QIV A;  4OKH A;  1M46 A;  5D7F A;  2ISD A;  2I18 A;  4M2Q A;  1DGV A;  1WDC B;  4NDC A;  4A4B A;  1ZAC A;  2QEH A;  2LE9 B;  1B47 A;  2PVB A;  3JVT C;  1KSO A;  1QX7 A;  3BUX B;  2ZN8 A;  3BFA A;  1UWO A;  4DUQ A;  1JUO A;  2L2E A;  2M29 A;  4GGF A;  1QJT A;  2VRG A;  3CLN A;  1YUT A;  4ORA B;  2L2C A;  2OPO A;  1OE9 B;  1NWD A;  2QAC A;  2JT3 A;  1KWO B;  2KGR A;  1S3P A;  1QAT A;  1BR4 B;  3RM1 A;  2KGB C;  1YX8 A;  2HF5 A;  2ZN9 A;  1S6I A;  2F3Y A;  3EK4 A;  1NUB A;  3PJI A;  4MEW A;  2NCO A;  3PFV A;  3Q8I A;  1IH0 A;  2JTT A;  1EXR A;  3WHT B;  2KQ6 A;  3BQ3 A;  3PAT A;  2LC5 A;  3TUY B;  4WRI A;  1TNW A;  3JVT B;  4PE4 A;  1YX7 A;  1K2H A;  2F3Z A;  2WC6 A;  1FBV A;  3BOW B;  1XFW O;  4MZJ A;  3D76 A;  1DJW A;  2GTE A;  1UHN A;  3D0Y B;  1KCY A;  4IJ7 A;  3GK2 A;  1NX1 A;  1PUL A;  5HLO A;  2HPS A;  3PSR A;  3UNW A;  4D1E A;  1L7Z A;  2BKH B;  3M0W A;  1TNP A;  3JTD C;  4NDD A;  1R6P A;  1JBA A;  1T14 A;  3BOW A;  1OOH A;  1JFK A;  1OOG A;  3CDN A;  1IIO A;  2H61 A;  3D0Y A;  5J3X A;  1SPY A;  3EVU A;  4GNK B;  5AER A;  1Z4H A;  3FE6 A;  3SG2 A;  4CID A;  4QJ4 B;  2K60 A;  3CGA A;  1KSM A;  2LMV A;  1S6J A;  1SR6 B;  2NLN A;  1C3Z A;  2LVI A;  5I94 A;  2OS8 C;  3QRX A;  1LA3 A;  2F33 A;  2LV7 A;  1AP4 A;  3RLZ A;  3DXL A;  3S0D A;  1GGZ A;  4MSP A;  1KQM B;  1MXE A;  2L5X B;  2LNK A;  1KK8 C;  1JC2 A;  1W7J B;  3D73 A;  1FF1 A;  5ER5 A;  2BKI B;  1YUS A;  1XK4 C;  1F4Q A;  2IS9 A;  1TN4 A;  3O2P A;  5IBW A;  1BT6 A;  3MSE B;  4FTG A;  5CSN A;  1J7Q A;  1JF0 A;  4WQ3 A;  2KNE A;  1A03 A;  2MLF C;  1DQE A;  3BXK A;  4HRH A;  1AUI B;  1SW8 A;  1TOP A;  2QEV A;  3CWG A;  4PHM A;  2BCX A;  3PM8 A;  1NX3 A;  2ZRT A;  1TWO A;  4PCW A;  2FJU B;  2OS8 B;  1CNP A;  3VRP A;  1XFU O;  4PHN A;  2I2R E;  2BEC A;  3A4U B;  1KFU S;  3EKJ A;  4ICB A;  3EVV A;  1AK8 A;  1E8A A;  4CFR A;  4JQ0 D;  1OZS A;  1UUS A;  4QJ5 B;  1CB1 A;  1A29 A;  1Y1X A;  3SS4 A;  1BOC A;  1DJG A;  4OZD A;  2M1K B;  1SCM C;  1EG3 A;  1SL9 A;  2P71 A;  3K1E A;  3S0F A;  1QLS A;  2NZ0 A;  3WHU B;  1OOJ A;  2Y1M A;  4YBH B;  4AQJ A;  1B4C A;  1QAS A;  1SRA A;  3B88 A;  2E6W A;  5AEQ A;  3V2L A;  1D1O A;  1ZOT B;  5B8I B;  2H2K A;  1P28 A;  1R2U A;  3I5I C;  4PE7 A;  2MBX A;  2CCM A;  3DF0 B;  1BOD A;  1JFJ A;  1ALV A;  3DD4 A;  1L2O C;  3O4Y A;  2M1U A;  4GPL B;  5HLV A;  2TN4 A;  3CTN A;  4JPZ B;  1J55 A;  2LVV A;  3S0B A;  1YTZ C;  3I5H B;  3IF7 A;  3ZNI A;  1YRU B;  1RRO A;  1DMO A;  1B1G A;  1TNX A;  1JWD A;  1ZFS A;  2JOJ A;  2JXC A;  3DF0 A;  2WC5 A;  5G08 A;  3SG4 A;  1BJF A;  1BR1 B;  3TS5 B;  4FQO A;  1C3Y A;  2KAY A;  1PVB A;  1RK9 A;  4MZK A;  1RFJ A;  2CTN A;  2ZND A;  4CLN A;  4JWQ A;  2Y1N A;  1G4Y R;  3OX5 A;  1AJ5 A;  2FCE A;  1DF0 B;  3EKH A;  4ZCU A;  3CR5 X;  3E3R A;  3IQO A;  3I5G B;  2O5G A;  5ER4 X;  2PYQ A;  1MQ1 A;  2PRU A;  1QTX A;  2WCL A;  1TNQ A;  1YVL A;  3AKB A;  3OHM B;  1DVI A;  4P2Y B;  2AUC A;  1TTX A;  1OMD A;  2AMI A;  3KO0 A;  5AXI A;  1L2O B;  2P70 A;  1J1D A;  3I5F C;  3O78 A;  4XYN A;  2WND A;  1F71 A;  2LLU A;  2CXJ A;  1DGU A;  1YRT B;  1DF0 A;  5HKY A;  3GK4 X;  2GGZ A;  2M97 A;  3BFH A;  4JD9 A;  2WCF A;  1LVC D;  1C07 A;  4YI9 A;  1K9P A;  4MZL A;  2KI6 C;  1OOI X;  4YGE B;  3HX4 A;  2PAS A;  4AOM A;  2CT9 A;  4C0K A;  3D10 A;  3CZ2 A;  2KI4 B;  1OMR A;  2NCP A;  5D3O A;  1IG5 A;  2JNX A;  1F54 A;  2JNF A;  2FOT A;  3DZT A;  3LK0 A;  1S1E A;  2LMU A;  2JTZ A;  4C0J A;  1LA0 A;  3OB2 B;  1QS7 A;  3B86 A;  3SG7 A;  1QIW A;  1UHI A;  5HKZ A;  1K9U A;  1Y1U A;  1KK7 Y;  2ZRS A;  2Y4Q A;  5DIC A;  5FI6 A;  2ZNE A;  3EVR A;  4UPG A;  2HQ8 A;  5HKW A;  1TUZ A;  1RJV A;  4MRY A;  5DKQ A;  2M7N A;  2WOS A;  1MHO A;  1OZO A;  2M7L A;  2WCE A;  1B8C A;  2KFF A;  4DCK A;  2KOT A;  4PT1 A;  2BE4 A;  2QEO A;  2JUL A;  2L4I A;  2MA2 A;  2K7C A;  3DVJ A;  3BUM B;  1OOF A;  1YUR A;  2LM5 A;  1CLB A;  2KYC A;  1XFR A;  2M49 B;  3NXA A;  1B9A A;  3PN7 C;  4NDB A;  2K2A A;  1JSA A;  2F2O A;  3NHT A;  2KHN A;  1SKT A;  2BBN A;  1BU3 A;  2MLE C;  3AAK A;  4C0L A;  3KEV A;  4MVF A;  1AJ4 A;  4YGB B;  2WCJ A;  1BG1 A;  1B8R A;  2WCH A;  3SJS A;  3LK1 A;  1SL7 A;  1UHH A;  3OX6 A;  1M31 A;  1DJZ A;  3A8R A;  3D75 A;  1EG4 A;  3NSI A;  4A4C A;  1CLL A;  1W9Z A;  3LCP C;  4HRG A;  2R2I A;  1PSB A;  2KI6 D;  2LP3 A;  5KSZ A;  2G2B A;  1K95 A;  2HET A;  3JTD B;  4PE0 A;  1FI6 A;  1XA5 A;  4GGN A;  2KFH A;  1SBJ A;  1PSR A;  3CZT X;  3FS7 A;  2A4J A;  1UHJ A;  2JPT A;  2CNP A;  1SCV A;  3GK1 A;  2JXL A;  5TNC A;  1CMF A;  2EHB A;  1MUX A;  1IQ3 A;  4CFQ A;  1OW4 A;  4YRU A;  1SY9 A;  4WQ2 A;  4PHK A;  1K90 D;  1CDP A;  2K7B A;  3CS1 A;  1Y1A A;  1ODB A;  2KPH A;  3R1O A;  1CFF A;  1SNL A;  3IQQ A;  1IRJ A;  2K7D A;  4YGD B;  5I2Q A;  1CM4 A;  3L47 A;  2PQL A;  1Y6W A;  2JU0 A;  1KK8 B;  3WNX B;  1M45 A;  1GM0 A;  2JC2 A;  3FE8 A;  3D78 A;  3F45 A;  1NCZ A;  5DKR A;  1OQP A;  1TCO B;  3HCM A;  4DS7 A;  1XYD A;  1LXF C;  3TDU A;  4JKT A;  4PE1 A;  3VGO A;  2BBM A;  5FI2 A;  2FCD A;  3NSL A;  4I5K A;  1NP8 A;  4USL A;  2LHL A;  5CSI A;  1XFX O;  4GAO A;  3EK8 A;  4NQG A;  2BCB A;  1KFX L;  1ALW A;  1CFD A;  1N65 A;  1XK4 A;  1YUU A;  2L98 A;  1NIW A;  1K94 A;  2BL0 C;  2BAP A;  3BUW B;  4YI8 A;  5JJG A;  2EC6 C;  1G8I A;  3OB1 B;  2LUX A;  2BCA A;  3FWB A;  4BY4 A;  4ORB B;  5I2O A;  1B8L A;  1RWY A;  5CSF A;  2LCP A;  1NYA A;  2YGU A;  3CZ1 A;  1J7O A;  5DKN A;  2K7O A;  1A75 B;  1NCY A;  3L4L A;  1CKK A;  4GGF C;  1DJY A;  1X02 A;  3SG3 A;  3VRR A;  3BUN B;  2L5Y A;  4BY5 A;  4N5X A;  2GV5 A;  5KU1 A;  5KTY A;  1SCM B;  2JT8 A;  3S0E A;  1GJY A;  1WDC C;  2WC8 A;  3CYZ A;  1CFC A;  1S5G Y;  3CAB A;  3N7H A;  2I7A A;  4GFT A;  1QX2 A;  1LKJ A;  2OTG C;  3BFB A;  4PDZ A;  1DJI A;  2LVJ A;  3LLE A;  3I5I B;  1H4B A;  1A75 A;  1XFY O;  2KBI A;  2MJW B;  1QWV A;  3KHE A;  1RTP 1;  2WCB A;  3IVT A;  1DTL A;  1NPQ A;  4FQT A;  1HQV A;  2MAZ A;  1ZMZ A;  1KWO C;  2KYF A;  2JPO A;  2LAP A;  1NX2 A;  2QDI A;  1JF2 A;  3DVE A;  4I5N B;  1VRK A;  1TIZ A;  1ZUZ A;  1FPW A;  3SIA A;  3FIA A;  1DEL A;  2KFG A;  1V1G A;  2F2P A;  3DVM A;  3NSK A;  2JT0 A;  4XJK B;  3BJH A;  2KLE A;  2LLS A;  2ERB A;  4MLW A;  5GQQ C;  3SS3 A;  1WRZ A;  4I5J A;  1F4O A;  1XFZ O;  5CSJ A;  3TUY C;  2LHI A;  1LS8 A;  3B87 A;  3R1V A;  1Y0V H;  2OTG B;  4QJ3 B;  4Q04 A;  1K96 A; 
#chains in the Genus database with same CATH homology
 2RGI A;  3KF9 A;  3VRO A;  4MBE A;  1U5I B;  2K2F A;  1K9K A;  1HT9 A;  5JOL A;  2H61 C;  4XJK A;  2GGM A;  3I5F B;  1Q80 A;  1BF5 A;  2B1U A;  1QV0 A;  2LMT A;  2Q4U A;  2D8N A;  1IKU A;  1REC A;  2K8M B;  1QLK A;  3SG6 A;  1AHR A;  1C7W A;  2ZKM X;  1U5I A;  1W7I B;  3BYA A;  1CFP A;  2L50 A;  1M63 B;  2SAS A;  2LP2 A;  2JRF A;  2L4H A;  5CPV A;  1YVH A;  1F70 A;  4OR9 B;  1OSA A;  2BE6 A;  2V53 A;  1SL8 A;  1SYM A;  2PSR A;  1N0Y A;  1SR6 C;  2M8U A;  2CBL A;  3ICB A;  4I5L B;  1NSH A;  3LL8 B;  4TNC A;  1S5G Z;  3EK7 A;  3CR4 X;  1QX5 B;  1J7R A;  4DRW A;  4MRX A;  1F8H A;  3OP0 A;  1UUR A;  5HYD A;  3H4S E;  1WLM A;  1MWN A;  1F55 A;  1KQM C;  1M39 A;  2Q91 A;  5D69 A;  2WOR A;  5AFP A;  1B7T Y;  4HRE E;  3ZWH A;  2KAX A;  2L51 A;  3WXA A;  1IQ5 A;  2LLT A;  1CLM A;  1DJH A;  1TRF A;  2M9G A;  4DIR A;  1UP5 A;  4M2O A;  4GBA A;  2E30 A;  1S26 D;  1LIN A;  4CPV A;  1IJ5 A;  1DT7 B;  1CM1 A;  3PLF B;  3FWC A;  5I2L A;  1H8B A;  3TDI A;  1GGW A;  1PRW A;  4F0Z B;  1NCX A;  2KBM A;  1XFV O;  1GQM A;  5BPJ A;  2KQY A;  3AAJ A;  3PN7 B;  1G33 A;  5FYX A;  1QVI Y;  1NX0 A;  2KAV A;  3NSO A;  4ORC B;  2JWW A;  3VRQ A;  2K0J A;  5I8N A;  3AKA A;  5AAN A;  1SMG A;  4PAL A;  3KPX A;  2COL B;  1KK7 Z;  1FI5 A;  1UHK A;  1AVS A;  2KDH A;  2MHH A;  3O6B A;  4GUK A;  1XO5 A;  2O60 A;  3TDZ A;  1SK6 D;  1BLQ A;  1S36 A;  5PAL A;  4N1G A;  1CDL A;  3CR2 A;  1PAL A;  4M2P A;  4ZCV A;  1MR8 A;  1MXL C;  3BUO B;  1FW4 A;  1QXP A;  1WY9 A;  1IJ6 A;  1J1E A;  1WRK A;  3SIB A;  1A4P A;  1EJ3 A;  2KSP A;  1KFX S;  1XVJ A;  4ETO A;  1KFU L;  4AQI A;  1CDM A;  1C7V A;  1BMO A;  1WRL A;  2M0R A;  1S6C A;  1WLZ A;  2P6B B;  2PAL A;  2JQ6 A;  2ZFD A;  3I5H C;  1N2D A;  1DJX A;  2SCP A;  1B7T Z;  2M3W A;  3VRN A;  1CMG A;  4YGC B;  4U8D A;  2LAN A;  3TS5 C;  2LUC A;  1CDN A;  1IGV A;  4E68 A;  1CTR A;  2MRD A;  1MF8 B;  1KQV A;  3GOF A;  1PVA A;  4MN0 A;  2DOQ A;  1K8U A;  2I94 A;  4L9M A;  1TCF A;  3SG5 A;  3I5G C;  1IWQ A;  2JZI A;  2PMY A;  2L0P A;  4HSZ A;  4N1F A;  1K93 D;  4OVN F;  3TZ1 A;  2HQW A;  2G9B A;  2BL0 B;  1YR5 A;  4IL1 A;  1QVI Z;  2AAO A;  1J7P A;  2EC6 B;  1V1F A;  4P5O E;  1A2X A;  4OV2 A;  2QPT A;  1QV1 A;  5K89 A;  4OCI A;  3PAL A;  5F6T A;  2K61 A;  2Y5I A;  4PHJ A;  4R1E A;  2F8P A;  2LVK A;  3C1V A;  1EH2 A;  2NXQ A;  3DVK A;  2EGD A;  3K21 A;  2KI4 C;  1EL4 A;  4YGA A;  1OMV A;  1PK0 D;  1QIV A;  4OKH A;  1M46 A;  5D7F A;  2ISD A;  2I18 A;  4M2Q A;  1DGV A;  1WDC B;  4NDC A;  4A4B A;  1ZAC A;  2LE9 B;  1B47 A;  2PVB A;  3JVT C;  1KSO A;  1QX7 A;  3BUX B;  2ZN8 A;  1UWO A;  4DUQ A;  1JUO A;  2L2E A;  2M29 A;  4GGF A;  1QJT A;  2VRG A;  3CLN A;  1YUT A;  4ORA B;  2OPO A;  1OE9 B;  1NWD A;  2QAC A;  2JT3 A;  1KWO B;  2KGR A;  1S3P A;  1QAT A;  1BR4 B;  3RM1 A;  2KGB C;  1YX8 A;  2HF5 A;  2ZN9 A;  1S6I A;  2F3Y A;  3EK4 A;  1NUB A;  4MEW A;  2NCO A;  3PFV A;  1IH0 A;  2JTT A;  1EXR A;  3WHT B;  2KQ6 A;  3BQ3 A;  3PAT A;  2LC5 A;  3TUY B;  4WRI A;  1TNW A;  3JVT B;  4PE4 A;  1YX7 A;  1K2H A;  2F3Z A;  1FBV A;  3BOW B;  1XFW O;  4MZJ A;  1DJW A;  3D0Y B;  1UHN A;  1KCY A;  3GK2 A;  1NX1 A;  1PUL A;  5HLO A;  2HPS A;  3PSR A;  4D1E A;  1L7Z A;  2BKH B;  3M0W A;  1TNP A;  3JTD C;  4NDD A;  1R6P A;  1JBA A;  3BOW A;  1JFK A;  2H61 A;  3D0Y A;  5J3X A;  1SPY A;  3EVU A;  4GNK B;  5AER A;  4CID A;  4QJ4 B;  3SG2 A;  3CGA A;  1KSM A;  2LMV A;  1S6J A;  1SR6 B;  2NLN A;  2LVI A;  2OS8 C;  3QRX A;  1LA3 A;  2F33 A;  2LV7 A;  1AP4 A;  3RLZ A;  1GGZ A;  4MSP A;  1KQM B;  1MXE A;  2L5X B;  2LNK A;  1KK8 C;  1JC2 A;  1W7J B;  1FF1 A;  5ER5 A;  2BKI B;  1YUS A;  1XK4 C;  1F4Q A;  2IS9 A;  1TN4 A;  3O2P A;  5IBW A;  1BT6 A;  3MSE B;  4FTG A;  5CSN A;  1J7Q A;  1JF0 A;  4WQ3 A;  2KNE A;  1A03 A;  2MLF C;  3BXK A;  4HRH A;  1AUI B;  1SW8 A;  1TOP A;  3CWG A;  4PHM A;  2BCX A;  3PM8 A;  1NX3 A;  2ZRT A;  4PCW A;  2FJU B;  2OS8 B;  1CNP A;  3VRP A;  1XFU O;  4PHN A;  2I2R E;  2BEC A;  3A4U B;  1KFU S;  3EKJ A;  4ICB A;  3EVV A;  1AK8 A;  1E8A A;  4CFR A;  4JQ0 D;  1OZS A;  1UUS A;  4QJ5 B;  1CB1 A;  1A29 A;  1Y1X A;  1BOC A;  1DJG A;  2M1K B;  1SCM C;  1EG3 A;  1SL9 A;  1QLS A;  2NZ0 A;  3WHU B;  1OOJ A;  2Y1M A;  4YBH B;  4AQJ A;  1B4C A;  1QAS A;  1SRA A;  2E6W A;  5AEQ A;  1D1O A;  1ZOT B;  5B8I B;  2H2K A;  1R2U A;  3I5I C;  4PE7 A;  2MBX A;  2CCM A;  3DF0 B;  1BOD A;  1JFJ A;  1ALV A;  3DD4 A;  1L2O C;  3O4Y A;  2M1U A;  4GPL B;  5HLV A;  2TN4 A;  3CTN A;  4JPZ B;  1J55 A;  2LVV A;  1YTZ C;  3I5H B;  3IF7 A;  3ZNI A;  1YRU B;  1RRO A;  1DMO A;  1B1G A;  1TNX A;  1JWD A;  1ZFS A;  2JOJ A;  2JXC A;  3DF0 A;  5G08 A;  3SG4 A;  1BJF A;  1BR1 B;  3TS5 B;  4FQO A;  2KAY A;  1PVB A;  1RK9 A;  4MZK A;  1RFJ A;  2CTN A;  2ZND A;  4CLN A;  4JWQ A;  2Y1N A;  1G4Y R;  3OX5 A;  1AJ5 A;  2FCE A;  1DF0 B;  3EKH A;  4ZCU A;  3CR5 X;  3E3R A;  3IQO A;  3I5G B;  2O5G A;  5ER4 X;  1MQ1 A;  2PRU A;  1QTX A;  4P2Y B;  1TNQ A;  1YVL A;  3AKB A;  3OHM B;  1DVI A;  2AUC A;  1TTX A;  2AMI A;  1OMD A;  3KO0 A;  5AXI A;  1L2O B;  4XYN A;  1J1D A;  3I5F C;  3O78 A;  2WND A;  1F71 A;  2LLU A;  2CXJ A;  1DGU A;  1YRT B;  1DF0 A;  5HKY A;  3GK4 X;  2GGZ A;  2M97 A;  2WCF A;  1LVC D;  1C07 A;  4YI9 A;  1K9P A;  4MZL A;  2KI6 C;  4YGE B;  3HX4 A;  2PAS A;  4AOM A;  2CT9 A;  4C0K A;  3D10 A;  2KI4 B;  1OMR A;  2NCP A;  1F54 A;  1IG5 A;  2JNX A;  2JNF A;  2FOT A;  3LK0 A;  1S1E A;  2LMU A;  2JTZ A;  4C0J A;  1LA0 A;  3OB2 B;  1QS7 A;  3SG7 A;  1QIW A;  1UHI A;  5HKZ A;  1K9U A;  1Y1U A;  1KK7 Y;  2ZRS A;  2Y4Q A;  4UPG A;  5I2Q A;  2ZNE A;  3EVR A;  2HQ8 A;  5HKW A;  1RJV A;  4MRY A;  5DKQ A;  2M7N A;  2WOS A;  1MHO A;  1OZO A;  2M7L A;  2WCE A;  1B8C A;  2KFF A;  4DCK A;  2KOT A;  2BE4 A;  2JUL A;  2L4I A;  2MA2 A;  2K7C A;  3DVJ A;  3BUM B;  1YUR A;  2LM5 A;  1CLB A;  2KYC A;  2M49 B;  3NXA A;  1B9A A;  3PN7 C;  4NDB A;  2K2A A;  1JSA A;  2F2O A;  2KHN A;  1SKT A;  2BBN A;  1BU3 A;  2MLE C;  3AAK A;  4C0L A;  3KEV A;  4MVF A;  1AJ4 A;  4YGB B;  1BG1 A;  1B8R A;  3SJS A;  3LK1 A;  1SL7 A;  1UHH A;  3OX6 A;  1M31 A;  1DJZ A;  3A8R A;  1EG4 A;  3NSI A;  4A4C A;  1CLL A;  3LCP C;  4HRG A;  2R2I A;  1PSB A;  2KI6 D;  2LP3 A;  5KSZ A;  2G2B A;  1K95 A;  2HET A;  3JTD B;  4PE0 A;  1FI6 A;  1XA5 A;  4GGN A;  2KFH A;  1SBJ A;  1PSR A;  3CZT X;  3FS7 A;  2A4J A;  1UHJ A;  2JPT A;  2CNP A;  1SCV A;  3GK1 A;  2JXL A;  5TNC A;  1CMF A;  2EHB A;  1MUX A;  1IQ3 A;  4CFQ A;  4YRU A;  1SY9 A;  4WQ2 A;  4PHK A;  1K90 D;  1CDP A;  2K7B A;  3CS1 A;  1Y1A A;  1ODB A;  1CFF A;  1SNL A;  3IQQ A;  1IRJ A;  2K7D A;  4YGD B;  1CM4 A;  1Y6W A;  2JU0 A;  1KK8 B;  3WNX B;  1M45 A;  2JC2 A;  3F45 A;  1NCZ A;  5DKR A;  1OQP A;  1TCO B;  3HCM A;  4DS7 A;  1XYD A;  1LXF C;  3TDU A;  4PE1 A;  3VGO A;  2BBM A;  2FCD A;  3NSL A;  4I5K A;  1NP8 A;  4USL A;  2LHL A;  5CSI A;  1XFX O;  4GAO A;  3EK8 A;  4NQG A;  2BCB A;  1KFX L;  1ALW A;  1CFD A;  1N65 A;  1XK4 A;  1YUU A;  2L98 A;  1NIW A;  1K94 A;  2BL0 C;  3BUW B;  4YI8 A;  5JJG A;  2EC6 C;  1G8I A;  3OB1 B;  2LUX A;  2BCA A;  3FWB A;  4BY4 A;  4ORB B;  5I2O A;  1B8L A;  1RWY A;  5CSF A;  2LCP A;  1NYA A;  1J7O A;  5DKN A;  2K7O A;  1A75 B;  1NCY A;  1CKK A;  4GGF C;  1DJY A;  1X02 A;  3SG3 A;  3VRR A;  3BUN B;  5KTY A;  4BY5 A;  4N5X A;  2GV5 A;  5KU1 A;  1SCM B;  2JT8 A;  1GJY A;  1WDC C;  2WC8 A;  1CFC A;  1S5G Y;  4GFT A;  2I7A A;  1QX2 A;  1LKJ A;  2OTG C;  4PDZ A;  1DJI A;  2LVJ A;  3LLE A;  3I5I B;  1H4B A;  1A75 A;  1XFY O;  2KBI A;  2MJW B;  3KHE A;  1RTP 1;  2WCB A;  1DTL A;  1NPQ A;  1HQV A;  2MAZ A;  1ZMZ A;  1KWO C;  2KYF A;  2LAP A;  1NX2 A;  1JF2 A;  3DVE A;  4I5N B;  1VRK A;  1TIZ A;  1ZUZ A;  1FPW A;  3SIA A;  3FIA A;  2KFG A;  1V1G A;  2F2P A;  3DVM A;  3NSK A;  2JT0 A;  4XJK B;  4MLW A;  5GQQ C;  2LLS A;  1WRZ A;  4I5J A;  1F4O A;  1XFZ O;  5CSJ A;  3TUY C;  2LHI A;  1Y0V H;  2OTG B;  4QJ3 B;  4Q04 A;  1K96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...