4DIRA

2.6 angstrom x-ray structure of human ca(2+)-s100a5
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
78
Chain Sequence
b'TPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A5
publication title Target-binding to S100A5 changes Ca(2+)-binding affinity and dynamics.
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 78
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dirA00
1K96A 2PRUA 3PATA 1H8BA 2O5GA 1BMOA 2MLFC 2K8MB 1XFYO 3KO0A 2LVKA 1GJYA 1KK7Z 1V1GA 2K7CA 4FTGA 1BG1A 2JTTA 1PK0D 5DKNA 4WQ2A 3EKHA 4HREE 5G08A 1S26D 1J1EA 1IGVA 4YGDB 3SJSA 1QIWA 2LAPA 1B8CA 2M1KB 1NP8A 3OX6A 3TS5C 3BXKA 1J7OA 2WCBA 1LKJA 1QVIZ 1YVLA 2JXCA 3LLEA 3BUXB 1KWOB 5JJGA 1FPWA 3WHUB 3CR4X 3H4SE 3SG4A 1CFDA 2BL0B 1XK4C 2K61A 1NIWA 2JNXA 3TDZA 3NXAA 2KQ6A 2WCEA 3JVTC 3KEVA 1MXEA 1OZSA 2JU0A 2KGRA 3VRQA 1F8HA 2BCXA 4MZKA 1TCFA 1TCOB 1X02A 2KAVA 2JC2A 4PHKA 1OE9B 4I5NB 4GPLB 1NX2A 1A03A 4PE4A 1SR6B 1XO5A 2PVBA 5HKZA 1B47A 2EHBA 2LE9B 5JOLA 1QLSA 4PHNA 1R6PA 3VRNA 1XVJA 1WRLA 4DIRA 4D1EA 4A4CA 1OOJA 1FW4A 2M3WA 1IRJA 3D0YB 1UP5A 1IWQA 1OMDA 3CS1A 2K0JA 3TZ1A 3BUWB 1ODBA 2I7AA 4M2PA 4DRWA 1UWOA 1L2OB 5I2OA 2MJWB 2ZKMX 4U8DA 5PALA 2SASA 3BUOB 5AXIA 1KFXS 2BE4A 4CFRA 1FBVA 4PHJA 4CLNA 5AANA 1K94A 4DCKA 2EC6C 1XFUO 3PN7C 2B1UA 4DUQA 2M1UA 2LUCA 4E68A 2QACA 1DJGA 2JT0A 3IQOA 2M7LA 2NCOA 2P6BB 5AFPA 1ALWA 1SYMA 1YURA 1DTLA 2BECA 2RGIA 2AAOA 3I5FB 1RK9A 2V53A 4OVNF 2LV7A 2WNDA 5I2LA 4YGBB 1M46A 1WRKA 3O2PA 1KWOC 2KYCA 1OMRA 4MZLA 3IQQA 4ZCUA 4QJ4B 2BL0C 2H61A 2NLNA 3DD4A 3GK2A 4PE7A 2KDHA 1J55A 4UPGA 1K9PA 2CCMA 2KYFA 2JULA 1MWNA 2ZRTA 4MZJA 5K89A 1E8AA 3BUMB 5DKRA 2WCFA 2IS9A 3OX5A 1SR6C 2K2FA 1PALA 4PALA 1BT6A 4AOMA 1N2DA 1GGWA 4MLWA 1KK8B 2F2OA 3NSIA 2EGDA 2JPTA 3EVVA 3JTDB 1DGUA 1NWDA 1G33A 3EVUA 3SIBA 2LANA 3AAJA 4IL1A 2DOQA 5KSZA 1PULA 1ZOTB 2JRFA 4MRXA 1DJWA 2ZN9A 1CLBA 2KI4B 1L2OC 3I5HB 1DF0A 1A29A 1EJ3A 1QX5B 1AP4A 2QPTA 2JXLA 3O4YA 5GQQC 1J1DA 1KCYA 1M31A 1YTZC 3I5GB 1XK4A 2G2BA 1JF2A 4WRIA 2JQ6A 3EKJA 3SIAA 2M49B 2F3ZA 1SL8A 1FF1A 1NX3A 1ZUZA 1LINA 1RFJA 2L4IA 3DVEA 4YI9A 1A75A 2I18A 2JOJA 1RTP1 2L51A 2ZFDA 3I5IC 5CSFA 3LCPC 3PFVA 1JF0A 2BBNA 1YVHA 1AJ4A 1SMGA 2JT3A 2MRDA 3I5FC 5I8NA 3TDUA 3LK0A 5KTYA 3QRXA 1YUTA 3DF0A 1TTXA 2JZIA 1M63B 1F4OA 2WC8A 2PSRA 3FS7A 3GK1A 1S6CA 2LC5A 3TUYB 2M0RA 3CR2A 4GUKA 4MSPA 2OTGC 1DJZA 2KAYA 3VROA 4MEWA 3KHEA 4DS7A 4HRHA 1QLKA 1V1FA 1TN4A 3EVRA 1BR1B 3VRPA 4OKHA 1WDCC 2Y4QA 1F4QA 1KK8C 1K95A 1JUOA 4OV2A 5HLOA 1B4CA 4FQOA 1AVSA 1M45A 4GGFC 4HRGA 1HQVA 5J3XA 1PSBA 1N65A 1K9KA 1WY9A 1QTXA 2KI4C 5D7FA 2JWWA 1EG4A 4YGCB 1LA3A 3RLZA 1KSOA 4CIDA 1ZACA 4YGAA 1SK6D 1XA5A 2H2KA 3I5GC 1RWYA 4I5KA 1W7IB 1Y1XA 2M9GA 4NQGA 1BR4B 2LHIA 2KHNA 1CM1A 2VRGA 3HCMA 4Q04A 2CNPA 2JTZA 1DJIA 1G8IA 4GNKB 1H4BA 2I2RE 3FWBA 3O6BA 1CMFA 1PRWA 3C1VA 3KF9A 4ORBB 5CPVA 1BLQA 1S6IA 4BY4A 2BE6A 2L50A 1R2UA 3CWGA 2TN4A 1YRUB 2LP3A 2O60A 2Y5IA 1EXRA 1RROA 2OPOA 4JPZB 2BBMA 3O78A 2GGMA 3CTNA 3ZNIA 1NUBA 2LVVA 5B8IB 2A4JA 3D0YA 4N1GA 3NSOA 4N5XA 2KBMA 3ICBA 3TUYC 1OSAA 4PDZA 2LVIA 3EK4A 2M97A 1PVAA 1S5GY 1MUXA 2KSPA 3DVJA 2CTNA 1S1EA 5IBWA 1GGZA 2LMTA 3ZWHA 4C0JA 1EL4A 2E6WA 1EG3A 3FWCA 1LA0A 2F8PA 2Q91A 2WORA 4M2QA 2K7DA 2KFFA 3GK4X 2KOTA 1NCZA 1QIVA 1YX8A 2PALA 4XJKA 1BOCA 1S36A 5ER5A 1UHKA 4P5OE 2ZN8A 1CDPA 1CKKA 4L9MA 2GV5A 1WLMA 4NDDA 4ORAB 1K90D 3TS5B 4NDCA 4I5JA 1DF0B 1TNXA 1Q80A 4BY5A 2KAXA 1U5IB 1WLZA 2PASA 1DMOA 1KQVA 2HETA 3TDIA 1EH2A 3A4UB 1B7TZ 2L2EA 2GGZA 1UHNA 4GAOA 3AAKA 4ICBA 2NXQA 1NCXA 4MN0A 2K2AA 5CSNA 1KFXL 4M2OA 1OZOA 4CFQA 5AERA 2MBXA 2KFGA 2KGBC 1IKUA 4YRUA 2G9BA 5HKWA 1XFVO 1QJTA 1HT9A 1B8LA 1Y0VH 4CPVA 4PCWA 2ZRSA 1OMVA 2NCPA 1KFUS 2JNFA 1C07A 2ISDA 1A4PA 1QXPA 1UURA 3IF7A 2LM5A 2M8UA 2FOTA 4MRYA 1CDMA 1MXLC 3WXAA 5HKYA 2BCBA 1C7WA 2R2IA 3GOFA 4GGFA 1LVCD 3PM8A 1F71A 1A2XA 3NSKA 1LXFC 1C7VA 1QV1A 2F3YA 2LMVA 1KQMB 1D1OA 3A8RA 1AK8A 1QV0A 1DJXA 3BOWA 2OS8B 3LL8B 4HSZA 1B8RA 3DVMA 3OHMB 1JSAA 3SG7A 3BQ3A 1JFJA 4ZCVA 1BF5A 3EK7A 4QJ3B 1K9UA 1ALVA 1YUUA 3PN7B 1FI6A 4TNCA 5BPJA 1BODA 1S5GZ 5F6TA 2FCEA 4ETOA 1SBJA 4ORCB 1BJFA 2L98A 2BKIB 1SCMB 1SRAA 4JWQA 1SW8A 4MBEA 1F55A 1MR8A 5HYDA 1DJYA 1WRZA 1XFXO 1F54A 5CSJA 1W7JB 3JTDC 4N1FA 1CMGA 2AMIA 5FYXA 1B7TY 1IJ6A 3D10A 2PMYA 2HQWA 2CXJA 1G4YR 1SNLA 1RJVA 3VGOA 3SG6A 1SL7A 3I5HC 2L0PA 3E3RA 2AUCA 3AKBA 2M29A 4GGNA 1NYAA 1TNQA 5ER4X 1IQ5A 2MAZA 3FIAA 2F2PA 2F33A 1IH0A 3DVKA 1IQ3A 2JT8A 4R1EA 5CSIA 5HLVA 2K7BA 4GFTA 3CLNA 1KFUL 1ZFSA 4MVFA 1AUIB 2K7OA 1MQ1A 1YR5A 2LHLA 1TNPA 3OB2B 1YUSA 2L5XB 4YBHB 2WOSA 2ZNEA 1VRKA 1J7RA 1JFKA 1S6JA 1IJ5A 1TOPA 1TRFA 1KSMA 1CLMA 1QASA 1XFZO 2E30A 2MHHA 5D69A 1OQPA 1KQMC 2HQ8A 1TIZA 1DJHA 2LNKA 4NDBA 4PE0A 2HF5A 2OS8C 3CGAA 2FJUB 1NX1A 2KI6D 1UHIA 1NX0A 2LVJA 1CM4A 1CLLA 2BCAA 1AJ5A 1SCVA 1L7ZA 2SCPA 3PLFB 2ZNDA 2LMUA 1KK7Y 2LLSA 2D8NA 5KU1A 2LLTA 2Y1NA 4XJKB 1CNPA 2CT9A 1SCMC 5DKQA 1ZMZA 3HX4A 3SG2A 1UHJA 3SG3A 1SL9A 1M39A 1RECA 1XFWO 1XYDA 3BUNB 3I5IB 1QVIY 4XYNA 4C0KA 1CFCA 1JC2A 5AEQA 3SG5A 4QJ5B 3CR5X 4I5LB 1QX2A 1BU3A 1DVIA 2L4HA 2LLUA 4OR9B 2LP2A 3CZTX 1DT7B 2HPSA 1CDNA 4GBAA 1DGVA 1MHOA 3WNXB 4YI8A 1FI5A 1UUSA 1S3PA 2MLEC 1YX7A 1JBAA 1PSRA 3EK8A 1TNWA 1F70A 4A4BA 4JQ0D 1QS7A 3K21A 1B9AA 4USLA 1Y1UA 1K2HA 2OTGB 1CTRA 1Y1AA 2KI6C 1SY9A 2M7NA 3LK1A 3KPXA 3JVTB 4PE1A 1QX7A 1WDCB 3M0WA 1CFPA 1A75B 1CFFA 1K8UA 4AQJA 2CBLA 2BKHB 1NSHA 2KQYA 1YRTB 2LCPA 1NPQA 1AHRA 4OCIA 1CDLA 4AQIA 1PVBA 1QATA 1NCYA 2MA2A 1UHHA 3NSLA 2Q4UA 3AKAA 3RM1A 3PALA 1N0YA 3F45A 1SPYA 4WQ3A 3BYAA 3WHTB 1JWDA 3BOWB 1CB1A 3DF0B 2NZ0A 4PHMA 1MF8B 1J7PA 1U5IA 2H61C 5TNCA 3OP0A 2FCDA 1K93D 3OB1B 3VRRA 1Y6WA 1B1GA 1GQMA 4F0ZB 4C0LA 2KBIA 4YGEB 2COLB 2Y1MA 2I94A 1IG5A 1SKTA 4P2YB 3PSRA 3MSEB 2KFHA 2KNEA 5I2QA 2LUXA 1J7QA 2EC6B
chains in the Genus database with same CATH superfamily
1K96A 2PRUA 3PATA 1H8BA 2O5GA 3S0DA 1BMOA 2MLFC 2K8MB 1XFYO 3KO0A 1SSEB 2LVKA 1GJYA 3CABA 1KK7Z 1V1GA 2K7CA 4FTGA 1BG1A 2JTTA 1PK0D 5DKNA 4WQ2A 3EKHA 4HREE 5G08A 1S26D 1J1EA 1IGVA 4YGDB 3SJSA 1QIWA 2LAPA 1B8CA 2M1KB 1NP8A 3OX6A 3TS5C 3BXKA 3N7HA 2WCBA 5FI7A 1J7OA 1LKJA 1QVIZ 1YVLA 2JXCA 3LLEA 3BUXB 1KWOB 5JJGA 1FPWA 3WHUB 3CR4X 3H4SE 3SG4A 1CFDA 2BL0B 1XK4C 2K61A 1NIWA 2JNXA 1TUJA 3TDZA 3NXAA 2KQ6A 2WCEA 3JVTC 3KEVA 1MXEA 1OZSA 2JU0A 2KGRA 3VRQA 1F8HA 2BCXA 4MZKA 1TCFA 1TCOB 1X02A 2KAVA 2JC2A 2P70A 2WCKA 1OE9B 4I5NB 4GPLB 4PHKA 1NX2A 1A03A 4PE4A 1SR6B 1ORGA 1XO5A 2PVBA 4KYNA 5HKZA 1B47A 2EHBA 2LE9B 5JOLA 1QLSA 4PHNA 1R6PA 3VRNA 1XVJA 1WRLA 2GTEA 4DIRA 4D1EA 4A4CA 1OOJA 1FW4A 2M3WA 1IRJA 3D0YB 1UP5A 1IWQA 1OMDA 3CS1A 2K0JA 3SS3A 3BUWB 3TZ1A 1ODBA 2I7AA 4M2PA 1DEKA 4DRWA 1UWOA 1L2OB 5I2OA 3QMEA 2MJWB 2ZKMX 4U8DA 5PALA 5FI2A 2SASA 3BUOB 5AXIA 1KFXS 2BE4A 3B87A 3BFAA 3R72A 3UO9A 1FBVA 4CFRA 4PHJA 4CLNA 2KLEA 5AANA 1K94A 4DCKA 2EC6C 1XFUO 3PN7C 2B1UA 4DUQA 2M1UA 2LUCA 4E68A 2QACA 1DJGA 2JT0A 3IQOA 2M7LA 2NCOA 2P6BB 5AFPA 1ALWA 1YURA 1SYMA 1DTLA 2BECA 2RGIA 2AAOA 3I5FB 1RK9A 2V53A 4OVNF 2LV7A 2WNDA 5I2LA 1DQEA 4YGBB 1M46A 1WRKA 3O2PA 1KWOC 2KYCA 1OMRA 3Q8IA 4MZLA 2P71A 3IQQA 4ZCUA 4QJ4B 2BNXA 2BL0C 2H61A 2NLNA 3DD4A 3GK2A 4PE7A 2KDHA 1J55A 4UPGA 1K9PA 2CCMA 3B88A 2KYFA 2JULA 1MWNA 2ZRTA 4MZJA 5K89A 1E8AA 2FJYA 2WCHA 3BUMB 5DKRA 2WCFA 2IS9A 3OX5A 3UNWA 3IVTA 3V2LA 1SR6C 2K2FA 1PALA 4PALA 1BT6A 4AOMA 1N2DA 1GGWA 4MLWA 1KK8B 2F2OA 3NSIA 2EGDA 2JPTA 3EVVA 3JTDB 5D3OA 1DC1A 1DGUA 1NWDA 1G33A 3EVUA 3SIBA 2LANA 3AAJA 4IL1A 2DOQA 5KSZA 4FQTA 1PULA 1ZOTB 2JRFA 4MRXA 3CZ2A 1DJWA 2ZN9A 1CLBA 2KI4B 2KPHA 1L2OC 3I5HB 1DF0A 1A29A 2WCMA 1EJ3A 1DELA 1QX5B 1AP4A 2QPTA 2JXLA 3O4YA 5GQQC 1J1DA 1KCYA 1M31A 1YTZC 3I5GB 1XK4A 2G2BA 1JF2A 4INWA 4WRIA 2JQ6A 3EKJA 3SIAA 2M49B 2F3ZA 1SL8A 1TWOA 1NX3A 1FF1A 1ZUZA 3NHTA 1LINA 1RFJA 2L4IA 3DVEA 4YI9A 1A75A 3VB1A 2I18A 2JOJA 1RTP1 2L51A 2ZFDA 3I5IC 5CSFA 3LCPC 3PFVA 1JF0A 1AJ4A 1YVHA 1SMGA 2BBNA 2JT3A 2MRDA 3I5FC 5I8NA 1C3ZA 3TDUA 3D77A 3LK0A 5KTYA 3QRXA 1YUTA 2PYQA 3DF0A 1TTXA 2JZIA 1M63B 1F4OA 2WC8A 2PSRA 3FS7A 3GK1A 1S6CA 2L2CA 2LC5A 3TUYB 2M0RA 3CR2A 4GUKA 3BJHA 4MSPA 2OTGC 1DJZA 2KAYA 3VROA 4MEWA 3KHEA 4DS7A 3B6XA 2YGUA 4HRHA 1QLKA 1V1FA 1TN4A 3EVRA 4JKTA 2L5YA 1BR1B 3VRPA 4OKHA 1WDCC 1OOFA 4F7FA 2Y4QA 1F4QA 1KK8C 1K95A 1JUOA 4OV2A 5HLOA 1B4CA 3S0AA 4FQOA 1AVSA 1M45A 4GGFC 4HRGA 1HQVA 5J3XA 1PSBA 1N65A 1K9KA 1WY9A 1QTXA 2KI4C 5D7FA 2JWWA 1EG4A 4YGCB 1LA3A 3RLZA 1KSOA 4CIDA 1ZACA 4YGAA 3K1EA 1SK6D 1XA5A 2H2KA 3I5GC 1RWYA 4I5KA 1W7IB 1Y1XA 2M9GA 4NQGA 1BR4B 3DYEA 2LHIA 2KHNA 1CM1A 2VRGA 3HCMA 4Q04A 2CNPA 2BAPA 2JTZA 1DJIA 1G8IA 4GNKB 1H4BA 2I2RE 3FWBA 3O6BA 1CMFA 1PRWA 3C1VA 3KF9A 4ORBB 5CPVA 1BLQA 1S6IA 4BY4A 4OZDA 1OOHA 2BE6A 2L50A 1R2UA 3CWGA 2TN4A 1YRUB 2LP3A 2O60A 2Y5IA 1EXRA 1RROA 2OPOA 1LS8A 4JPZB 2BBMA 3O78A 2GGMA 3CTNA 3OGNA 3ZNIA 1NUBA 2LVVA 5B8IB 4JD9A 2A4JA 3D0YA 4N1GA 3NSOA 4N5XA 2KBMA 3ICBA 3TUYC 1OSAA 4PDZA 2LVIA 3EK4A 2ERBA 2M97A 1PVAA 1S5GY 1MUXA 2KSPA 1P28A 3DVJA 3S0FA 2CTNA 3DY9A 1S1EA 3NGVA 2WC5A 1GGZA 3L47A 2LMTA 3ZWHA 4C0JA 1EL4A 2E6WA 5IBWA 1EG3A 3S0GA 3FWCA 1LA0A 2F8PA 2Q91A 2WORA 4M2QA 2K7DA 2KFFA 3GK4X 2JPOA 2KOTA 1NCZA 3OBVA 1QIVA 1YX8A 3D76A 2PALA 4IJ7A 4XJKA 1BOCA 1S36A 5ER5A 1UHKA 4P5OE 2WCJA 2ZN8A 1CDPA 1CKKA 4L9MA 2GV5A 1WLMA 4NDDA 4ORAB 1K90D 3TS5B 4NDCA 4I5JA 3RZSA 1DF0B 1TNXA 1Q80A 4BY5A 2KAXA 1U5IB 1WLZA 2PASA 2QEHA 1DMOA 2HETA 3TDIA 3EG5B 1EH2A 1KQVA 3A4UB 1B7TZ 2L2EA 2GGZA 1UHNA 4GAOA 2WC6A 3AAKA 4ICBA 2NXQA 1NCXA 2QEVA 2K2AA 4MN0A 1KFXL 5CSNA 4M2OA 1OZOA 4CFQA 2QEOA 5AERA 2K60A 2KFGA 2MBXA 3FE9A 2KGBC 1IKUA 4YRUA 2G9BA 5HKWA 1XFVO 1QJTA 1HT9A 1B8LA 1Y0VH 4CPVA 3D74A 4PCWA 2ZRSA 1OMVA 2NCPA 1KFUS 2JNFA 1C07A 2ISDA 1A4PA 1QXPA 1UURA 3IF7A 2LM5A 3BFBA 2M8UA 3S0EA 2FOTA 3FE8A 4MRYA 1T14A 1Z4HA 1CDMA 1MXLC 3WXAA 5HKYA 2BCBA 1C7WA 2H8VA 2R2IA 3GOFA 4GGFA 1LVCD 3PM8A 1F71A 1A2XA 3NSKA 1LXFC 1C7VA 1QV1A 2F3YA 2LMVA 1KQMB 2PQLA 1D1OA 3A8RA 1AK8A 1QV0A 1DJXA 3BOWA 3CZ0A 3NHIA 1XFRA 2OS8B 3DXLA 3LL8B 4HSZA 3B7AA 1B8RA 2WCLA 3DVMA 3OHMB 1JSAA 3SG7A 3BQ3A 1JFJA 2QDIA 3L4LA 4ZCVA 3CYZA 3EK7A 4QJ3B 1BF5A 1K9UA 1ALVA 1YUUA 3PN7B 1FI6A 4TNCA 5BPJA 1BODA 1S5GZ 5F6TA 1W9ZA 2FCEA 4ETOA 1SBJA 4ORCB 1BJFA 2L98A 2BKIB 1SCMB 5EL2A 1SRAA 4JWQA 1SW8A 4MBEA 1F55A 1MR8A 5HYDA 1DJYA 1WRZA 1XFXO 3DZTA 1F54A 5CSJA 1W7JB 3JTDC 4N1FA 1CMGA 2AMIA 5FYXA 1B7TY 1IJ6A 3D10A 2PMYA 3SS4A 2HQWA 2CXJA 1G4YR 1SNLA 1RJVA 3VGOA 3SG6A 1SL7A 3I5HC 2L0PA 3E3RA 1OOIX 2AUCA 2M29A 3AKBA 1NYAA 4GGNA 1TNQA 5ER4X 5DICA 1IQ5A 3B86A 2MAZA 3FIAA 2F2PA 2F33A 1IH0A 2KLDA 3DVKA 1IQ3A 2JT8A 4R1EA 5CSIA 5HLVA 2K7BA 3R1VA 4GFTA 3FE6A 3CLNA 1KFUL 3SS5A 1ZFSA 3O4XA 4MVFA 1AUIB 2K7OA 1MQ1A 1YR5A 2LHLA 1TNPA 3OB2B 1YUSA 2L5XB 4YBHB 2WOSA 2ZNEA 1IIOA 1VRKA 1J7RA 1JFKA 1S6JA 1IJ5A 1TOPA 1TRFA 1KSMA 1CLMA 1QASA 1XFZO 1OOGA 2E30A 2MHHA 5D69A 1OQPA 1KQMC 2HQ8A 1TIZA 1DJHA 2LNKA 4NDBA 4PE0A 2HF5A 2OS8C 3CGAA 2FJUB 1NX1A 2KI6D 1UHIA 1NX0A 2LVJA 1CM4A 1CLLA 4PT1A 2BCAA 1AJ5A 1SCVA 1L7ZA 2SCPA 3PLFB 2ZNDA 2LMUA 1GM0A 1KK7Y 2LLSA 2D8NA 5KU1A 2LLTA 2Y1NA 4XJKB 1CNPA 2CT9A 1SCMC 5DKQA 1ZMZA 3HX4A 3SG2A 1UHJA 3SG3A 2QEBA 1SL9A 1M39A 1RECA 1XFWO 1XYDA 3BUNB 3I5IB 1QVIY 3PM2A 4XYNA 4C0KA 1CFCA 1JC2A 5AEQA 3SG5A 4QJ5B 3CR5X 4I5LB 1QX2A 1BU3A 1DVIA 2L4HA 2LLUA 4OR9B 2LP2A 3CZTX 1DT7B 2HPSA 1CDNA 4GBAA 5I94A 1DGVA 1MHOA 3WNXB 3CZ1A 4YI8A 1FI5A 1UUSA 1S3PA 2MLEC 5HL1A 1YX7A 1JBAA 3R1OA 1PSRA 3EK8A 1TNWA 3L4AA 1C3YA 1F70A 4A4BA 4JQ0D 1QS7A 3K21A 1B9AA 1TUZA 4USLA 1Y1UA 1K2HA 2OTGB 1CTRA 3D78A 1Y1AA 2KI6C 1SY9A 2M7NA 3LK1A 3KPXA 3JVTB 4PE1A 1QX7A 1OW4A 1WDCB 3M0WA 1A75B 1CFFA 1CFPA 1K8UA 3BFHA 4AQJA 2BKHB 2CBLA 1NSHA 2KQYA 1YRTB 2LCPA 1NPQA 1AHRA 4OCIA 1CDLA 4AQIA 1PVBA 1QATA 1NCYA 2MA2A 1UHHA 3NSLA 3D73A 2Q4UA 3AKAA 3RM1A 3PALA 1N0YA 5FI6A 3F45A 1SPYA 1QWVA 4WQ3A 3BYAA 3CDNA 3WHTB 1JWDA 3BOWB 3PJIA 1CB1A 3DF0B 2NZ0A 4PHMA 1MF8B 1J7PA 1U5IA 2H61C 4INXA 5TNCA 3OP0A 2FCDA 1K93D 3OB1B 3VRRA 1Y6WA 1B1GA 1GQMA 4F0ZB 4C0LA 2KBIA 4YGEB 2COLB 2Y1MA 2I94A 1Z2CB 3D75A 1IG5A 1SKTA 4P2YB 3PSRA 3MSEB 2KFHA 3R1PA 2KNEA 5I2QA 2LUXA 3S0BA 1J7QA 2EC6B
chains in the Genus database with same CATH topology
1K96A 2PRUA 3PATA 1H8BA 2O5GA 1BMOA 2MLFC 2K8MB 1XFYO 3KO0A 2LVKA 1GJYA 1KK7Z 1V1GA 2K7CA 4FTGA 1BG1A 2JTTA 1PK0D 5DKNA 4WQ2A 3EKHA 4HREE 5G08A 1S26D 1J1EA 1IGVA 4YGDB 3SJSA 1QIWA 2LAPA 1B8CA 2M1KB 1NP8A 3OX6A 3TS5C 3BXKA 1J7OA 2WCBA 1LKJA 1QVIZ 1YVLA 2JXCA 3LLEA 3BUXB 1KWOB 5JJGA 1FPWA 3WHUB 3CR4X 3H4SE 3SG4A 1CFDA 2BL0B 1XK4C 2K61A 1NIWA 2JNXA 3TDZA 3NXAA 2KQ6A 2WCEA 3JVTC 3KEVA 1MXEA 1OZSA 2JU0A 2KGRA 3VRQA 1F8HA 2BCXA 4MZKA 1TCFA 1TCOB 1X02A 2KAVA 2JC2A 4PHKA 1OE9B 4I5NB 4GPLB 1NX2A 1A03A 4PE4A 1SR6B 1XO5A 2PVBA 5HKZA 1B47A 2EHBA 2LE9B 5JOLA 1QLSA 4PHNA 1R6PA 3VRNA 1XVJA 1WRLA 4DIRA 4D1EA 4A4CA 1OOJA 1FW4A 2M3WA 1IRJA 3D0YB 1UP5A 1IWQA 1OMDA 3CS1A 2K0JA 3TZ1A 3BUWB 1ODBA 2I7AA 4M2PA 4DRWA 1UWOA 1L2OB 5I2OA 2MJWB 2ZKMX 4U8DA 5PALA 2SASA 3BUOB 5AXIA 1KFXS 2BE4A 4CFRA 1FBVA 4PHJA 4CLNA 5AANA 1K94A 4DCKA 2EC6C 1XFUO 3PN7C 2B1UA 4DUQA 2M1UA 2LUCA 4E68A 2QACA 1DJGA 2JT0A 3IQOA 2M7LA 2NCOA 2P6BB 5AFPA 1ALWA 1SYMA 1YURA 1DTLA 2BECA 2RGIA 2AAOA 3I5FB 1RK9A 2V53A 4OVNF 2LV7A 2WNDA 5I2LA 4YGBB 1M46A 1WRKA 3O2PA 1KWOC 2KYCA 1OMRA 4MZLA 3IQQA 4ZCUA 4QJ4B 2BL0C 2H61A 2NLNA 3DD4A 3GK2A 4PE7A 2KDHA 1J55A 4UPGA 1K9PA 2CCMA 2KYFA 2JULA 1MWNA 2ZRTA 4MZJA 5K89A 1E8AA 3BUMB 5DKRA 2WCFA 2IS9A 3OX5A 1SR6C 2K2FA 1PALA 4PALA 1BT6A 4AOMA 1N2DA 1GGWA 4MLWA 1KK8B 2F2OA 3NSIA 2EGDA 2JPTA 3EVVA 3JTDB 1DGUA 1NWDA 1G33A 3EVUA 3SIBA 2LANA 3AAJA 4IL1A 2DOQA 5KSZA 1PULA 1ZOTB 2JRFA 4MRXA 1DJWA 2ZN9A 1CLBA 2KI4B 1L2OC 3I5HB 1DF0A 1A29A 1EJ3A 1QX5B 1AP4A 2QPTA 2JXLA 3O4YA 5GQQC 1J1DA 1KCYA 1M31A 1YTZC 3I5GB 1XK4A 2G2BA 1JF2A 4WRIA 2JQ6A 3EKJA 3SIAA 2M49B 2F3ZA 1SL8A 1FF1A 1NX3A 1ZUZA 1LINA 1RFJA 2L4IA 3DVEA 4YI9A 1A75A 2I18A 2JOJA 1RTP1 2L51A 2ZFDA 3I5IC 5CSFA 3LCPC 3PFVA 1JF0A 2BBNA 1YVHA 1AJ4A 1SMGA 2JT3A 2MRDA 3I5FC 5I8NA 3TDUA 3LK0A 5KTYA 3QRXA 1YUTA 3DF0A 1TTXA 2JZIA 1M63B 1F4OA 2WC8A 2PSRA 3FS7A 3GK1A 1S6CA 2LC5A 3TUYB 2M0RA 3CR2A 4GUKA 4MSPA 2OTGC 1DJZA 2KAYA 3VROA 4MEWA 3KHEA 4DS7A 4HRHA 1QLKA 1V1FA 1TN4A 3EVRA 1BR1B 3VRPA 4OKHA 1WDCC 2Y4QA 1F4QA 1KK8C 1K95A 1JUOA 4OV2A 5HLOA 1B4CA 4FQOA 1AVSA 1M45A 4GGFC 4HRGA 1HQVA 5J3XA 1PSBA 1N65A 1K9KA 1WY9A 1QTXA 2KI4C 5D7FA 2JWWA 1EG4A 4YGCB 1LA3A 3RLZA 1KSOA 4CIDA 1ZACA 4YGAA 1SK6D 1XA5A 2H2KA 3I5GC 1RWYA 4I5KA 1W7IB 1Y1XA 2M9GA 4NQGA 1BR4B 2LHIA 2KHNA 1CM1A 2VRGA 3HCMA 4Q04A 2CNPA 2JTZA 1DJIA 1G8IA 4GNKB 1H4BA 2I2RE 3FWBA 3O6BA 1CMFA 1PRWA 3C1VA 3KF9A 4ORBB 5CPVA 1BLQA 1S6IA 4BY4A 2BE6A 2L50A 1R2UA 3CWGA 2TN4A 1YRUB 2LP3A 2O60A 2Y5IA 1EXRA 1RROA 2OPOA 4JPZB 2BBMA 3O78A 2GGMA 3CTNA 3ZNIA 1NUBA 2LVVA 5B8IB 2A4JA 3D0YA 4N1GA 3NSOA 4N5XA 2KBMA 3ICBA 3TUYC 1OSAA 4PDZA 2LVIA 3EK4A 2M97A 1PVAA 1S5GY 1MUXA 2KSPA 3DVJA 2CTNA 1S1EA 5IBWA 1GGZA 2LMTA 3ZWHA 4C0JA 1EL4A 2E6WA 1EG3A 3FWCA 1LA0A 2F8PA 2Q91A 2WORA 4M2QA 2K7DA 2KFFA 3GK4X 2KOTA 1NCZA 1QIVA 1YX8A 2PALA 4XJKA 1BOCA 1S36A 5ER5A 1UHKA 4P5OE 2ZN8A 1CDPA 1CKKA 4L9MA 2GV5A 1WLMA 4NDDA 4ORAB 1K90D 3TS5B 4NDCA 4I5JA 1DF0B 1TNXA 1Q80A 4BY5A 2KAXA 1U5IB 1WLZA 2PASA 1DMOA 1KQVA 2HETA 3TDIA 1EH2A 3A4UB 1B7TZ 2L2EA 2GGZA 1UHNA 4GAOA 3AAKA 4ICBA 2NXQA 1NCXA 4MN0A 2K2AA 5CSNA 1KFXL 4M2OA 1OZOA 4CFQA 5AERA 2MBXA 2KFGA 2KGBC 1IKUA 4YRUA 2G9BA 5HKWA 1XFVO 1QJTA 1HT9A 1B8LA 1Y0VH 4CPVA 4PCWA 2ZRSA 1OMVA 2NCPA 1KFUS 2JNFA 1C07A 2ISDA 1A4PA 1QXPA 1UURA 3IF7A 2LM5A 2M8UA 2FOTA 4MRYA 1CDMA 1MXLC 3WXAA 5HKYA 2BCBA 1C7WA 2R2IA 3GOFA 4GGFA 1LVCD 3PM8A 1F71A 1A2XA 3NSKA 1LXFC 1C7VA 1QV1A 2F3YA 2LMVA 1KQMB 1D1OA 3A8RA 1AK8A 1QV0A 1DJXA 3BOWA 2OS8B 3LL8B 4HSZA 1B8RA 3DVMA 3OHMB 1JSAA 3SG7A 3BQ3A 1JFJA 4ZCVA 1BF5A 3EK7A 4QJ3B 1K9UA 1ALVA 1YUUA 3PN7B 1FI6A 4TNCA 5BPJA 1BODA 1S5GZ 5F6TA 2FCEA 4ETOA 1SBJA 4ORCB 1BJFA 2L98A 2BKIB 1SCMB 1SRAA 4JWQA 1SW8A 4MBEA 1F55A 1MR8A 5HYDA 1DJYA 1WRZA 1XFXO 1F54A 5CSJA 1W7JB 3JTDC 4N1FA 1CMGA 2AMIA 5FYXA 1B7TY 1IJ6A 3D10A 2PMYA 2HQWA 2CXJA 1G4YR 1SNLA 1RJVA 3VGOA 3SG6A 1SL7A 3I5HC 2L0PA 3E3RA 2AUCA 3AKBA 2M29A 4GGNA 1NYAA 1TNQA 5ER4X 1IQ5A 2MAZA 3FIAA 2F2PA 2F33A 1IH0A 3DVKA 1IQ3A 2JT8A 4R1EA 5CSIA 5HLVA 2K7BA 4GFTA 3CLNA 1KFUL 1ZFSA 4MVFA 1AUIB 2K7OA 1MQ1A 1YR5A 2LHLA 1TNPA 3OB2B 1YUSA 2L5XB 4YBHB 2WOSA 2ZNEA 1VRKA 1J7RA 1JFKA 1S6JA 1IJ5A 1TOPA 1TRFA 1KSMA 1CLMA 1QASA 1XFZO 2E30A 2MHHA 5D69A 1OQPA 1KQMC 2HQ8A 1TIZA 1DJHA 2LNKA 4NDBA 4PE0A 2HF5A 2OS8C 3CGAA 2FJUB 1NX1A 2KI6D 1UHIA 1NX0A 2LVJA 1CM4A 1CLLA 2BCAA 1AJ5A 1SCVA 1L7ZA 2SCPA 3PLFB 2ZNDA 2LMUA 1KK7Y 2LLSA 2D8NA 5KU1A 2LLTA 2Y1NA 4XJKB 1CNPA 2CT9A 1SCMC 5DKQA 1ZMZA 3HX4A 3SG2A 1UHJA 3SG3A 1SL9A 1M39A 1RECA 1XFWO 1XYDA 3BUNB 3I5IB 1QVIY 4XYNA 4C0KA 1CFCA 1JC2A 5AEQA 3SG5A 4QJ5B 3CR5X 4I5LB 1QX2A 1BU3A 1DVIA 2L4HA 2LLUA 4OR9B 2LP2A 3CZTX 1DT7B 2HPSA 1CDNA 4GBAA 1DGVA 1MHOA 3WNXB 4YI8A 1FI5A 1UUSA 1S3PA 2MLEC 1YX7A 1JBAA 1PSRA 3EK8A 1TNWA 1F70A 4A4BA 4JQ0D 1QS7A 3K21A 1B9AA 4USLA 1Y1UA 1K2HA 2OTGB 1CTRA 1Y1AA 2KI6C 1SY9A 2M7NA 3LK1A 3KPXA 3JVTB 4PE1A 1QX7A 1WDCB 3M0WA 1CFPA 1A75B 1CFFA 1K8UA 4AQJA 2CBLA 2BKHB 1NSHA 2KQYA 1YRTB 2LCPA 1NPQA 1AHRA 4OCIA 1CDLA 4AQIA 1PVBA 1QATA 1NCYA 2MA2A 1UHHA 3NSLA 2Q4UA 3AKAA 3RM1A 3PALA 1N0YA 3F45A 1SPYA 4WQ3A 3BYAA 3WHTB 1JWDA 3BOWB 1CB1A 3DF0B 2NZ0A 4PHMA 1MF8B 1J7PA 1U5IA 2H61C 5TNCA 3OP0A 2FCDA 1K93D 3OB1B 3VRRA 1Y6WA 1B1GA 1GQMA 4F0ZB 4C0LA 2KBIA 4YGEB 2COLB 2Y1MA 2I94A 1IG5A 1SKTA 4P2YB 3PSRA 3MSEB 2KFHA 2KNEA 5I2QA 2LUXA 1J7QA 2EC6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K96 A;  2PRU A;  3PAT A;  1H8B A;  2O5G A;  1BMO A;  2MLF C;  2K8M B;  1XFY O;  3KO0 A;  2LVK A;  1GJY A;  1KK7 Z;  1V1G A;  2K7C A;  4FTG A;  1BG1 A;  2JTT A;  1PK0 D;  5DKN A;  4WQ2 A;  3EKH A;  4HRE E;  5G08 A;  1S26 D;  1J1E A;  1IGV A;  4YGD B;  3SJS A;  1QIW A;  2LAP A;  1B8C A;  2M1K B;  1NP8 A;  3OX6 A;  3TS5 C;  3BXK A;  1J7O A;  2WCB A;  1LKJ A;  1QVI Z;  1YVL A;  2JXC A;  3LLE A;  3BUX B;  1KWO B;  5JJG A;  1FPW A;  3WHU B;  3CR4 X;  3H4S E;  3SG4 A;  1CFD A;  2BL0 B;  1XK4 C;  2K61 A;  1NIW A;  2JNX A;  3TDZ A;  3NXA A;  2KQ6 A;  2WCE A;  3JVT C;  3KEV A;  1MXE A;  1OZS A;  2JU0 A;  2KGR A;  3VRQ A;  1F8H A;  2BCX A;  4MZK A;  1TCF A;  1TCO B;  1X02 A;  2KAV A;  2JC2 A;  4PHK A;  1OE9 B;  4I5N B;  4GPL B;  1NX2 A;  1A03 A;  4PE4 A;  1SR6 B;  1XO5 A;  2PVB A;  5HKZ A;  1B47 A;  2EHB A;  2LE9 B;  5JOL A;  1QLS A;  4PHN A;  1R6P A;  3VRN A;  1XVJ A;  1WRL A;  4DIR A;  4D1E A;  4A4C A;  1OOJ A;  1FW4 A;  2M3W A;  1IRJ A;  3D0Y B;  1UP5 A;  1IWQ A;  1OMD A;  3CS1 A;  2K0J A;  3TZ1 A;  3BUW B;  1ODB A;  2I7A A;  4M2P A;  4DRW A;  1UWO A;  1L2O B;  5I2O A;  2MJW B;  2ZKM X;  4U8D A;  5PAL A;  2SAS A;  3BUO B;  5AXI A;  1KFX S;  2BE4 A;  4CFR A;  1FBV A;  4PHJ A;  4CLN A;  5AAN A;  1K94 A;  4DCK A;  2EC6 C;  1XFU O;  3PN7 C;  2B1U A;  4DUQ A;  2M1U A;  2LUC A;  4E68 A;  2QAC A;  1DJG A;  2JT0 A;  3IQO A;  2M7L A;  2NCO A;  2P6B B;  5AFP A;  1ALW A;  1SYM A;  1YUR A;  1DTL A;  2BEC A;  2RGI A;  2AAO A;  3I5F B;  1RK9 A;  2V53 A;  4OVN F;  2LV7 A;  2WND A;  5I2L A;  4YGB B;  1M46 A;  1WRK A;  3O2P A;  1KWO C;  2KYC A;  1OMR A;  4MZL A;  3IQQ A;  4ZCU A;  4QJ4 B;  2BL0 C;  2H61 A;  2NLN A;  3DD4 A;  3GK2 A;  4PE7 A;  2KDH A;  1J55 A;  4UPG A;  1K9P A;  2CCM A;  2KYF A;  2JUL A;  1MWN A;  2ZRT A;  4MZJ A;  5K89 A;  1E8A A;  3BUM B;  5DKR A;  2WCF A;  2IS9 A;  3OX5 A;  1SR6 C;  2K2F A;  1PAL A;  4PAL A;  1BT6 A;  4AOM A;  1N2D A;  1GGW A;  4MLW A;  1KK8 B;  2F2O A;  3NSI A;  2EGD A;  2JPT A;  3EVV A;  3JTD B;  1DGU A;  1NWD A;  1G33 A;  3EVU A;  3SIB A;  2LAN A;  3AAJ A;  4IL1 A;  2DOQ A;  5KSZ A;  1PUL A;  1ZOT B;  2JRF A;  4MRX A;  1DJW A;  2ZN9 A;  1CLB A;  2KI4 B;  1L2O C;  3I5H B;  1DF0 A;  1A29 A;  1EJ3 A;  1QX5 B;  1AP4 A;  2QPT A;  2JXL A;  3O4Y A;  5GQQ C;  1J1D A;  1KCY A;  1M31 A;  1YTZ C;  3I5G B;  1XK4 A;  2G2B A;  1JF2 A;  4WRI A;  2JQ6 A;  3EKJ A;  3SIA A;  2M49 B;  2F3Z A;  1SL8 A;  1FF1 A;  1NX3 A;  1ZUZ A;  1LIN A;  1RFJ A;  2L4I A;  3DVE A;  4YI9 A;  1A75 A;  2I18 A;  2JOJ A;  1RTP 1;  2L51 A;  2ZFD A;  3I5I C;  5CSF A;  3LCP C;  3PFV A;  1JF0 A;  2BBN A;  1YVH A;  1AJ4 A;  1SMG A;  2JT3 A;  2MRD A;  3I5F C;  5I8N A;  3TDU A;  3LK0 A;  5KTY A;  3QRX A;  1YUT A;  3DF0 A;  1TTX A;  2JZI A;  1M63 B;  1F4O A;  2WC8 A;  2PSR A;  3FS7 A;  3GK1 A;  1S6C A;  2LC5 A;  3TUY B;  2M0R A;  3CR2 A;  4GUK A;  4MSP A;  2OTG C;  1DJZ A;  2KAY A;  3VRO A;  4MEW A;  3KHE A;  4DS7 A;  4HRH A;  1QLK A;  1V1F A;  1TN4 A;  3EVR A;  1BR1 B;  3VRP A;  4OKH A;  1WDC C;  2Y4Q A;  1F4Q A;  1KK8 C;  1K95 A;  1JUO A;  4OV2 A;  5HLO A;  1B4C A;  4FQO A;  1AVS A;  1M45 A;  4GGF C;  4HRG A;  1HQV A;  5J3X A;  1PSB A;  1N65 A;  1K9K A;  1WY9 A;  1QTX A;  2KI4 C;  5D7F A;  2JWW A;  1EG4 A;  4YGC B;  1LA3 A;  3RLZ A;  1KSO A;  4CID A;  1ZAC A;  4YGA A;  1SK6 D;  1XA5 A;  2H2K A;  3I5G C;  1RWY A;  4I5K A;  1W7I B;  1Y1X A;  2M9G A;  4NQG A;  1BR4 B;  2LHI A;  2KHN A;  1CM1 A;  2VRG A;  3HCM A;  4Q04 A;  2CNP A;  2JTZ A;  1DJI A;  1G8I A;  4GNK B;  1H4B A;  2I2R E;  3FWB A;  3O6B A;  1CMF A;  1PRW A;  3C1V A;  3KF9 A;  4ORB B;  5CPV A;  1BLQ A;  1S6I A;  4BY4 A;  2BE6 A;  2L50 A;  1R2U A;  3CWG A;  2TN4 A;  1YRU B;  2LP3 A;  2O60 A;  2Y5I A;  1EXR A;  1RRO A;  2OPO A;  4JPZ B;  2BBM A;  3O78 A;  2GGM A;  3CTN A;  3ZNI A;  1NUB A;  2LVV A;  5B8I B;  2A4J A;  3D0Y A;  4N1G A;  3NSO A;  4N5X A;  2KBM A;  3ICB A;  3TUY C;  1OSA A;  4PDZ A;  2LVI A;  3EK4 A;  2M97 A;  1PVA A;  1S5G Y;  1MUX A;  2KSP A;  3DVJ A;  2CTN A;  1S1E A;  5IBW A;  1GGZ A;  2LMT A;  3ZWH A;  4C0J A;  1EL4 A;  2E6W A;  1EG3 A;  3FWC A;  1LA0 A;  2F8P A;  2Q91 A;  2WOR A;  4M2Q A;  2K7D A;  2KFF A;  3GK4 X;  2KOT A;  1NCZ A;  1QIV A;  1YX8 A;  2PAL A;  4XJK A;  1BOC A;  1S36 A;  5ER5 A;  1UHK A;  4P5O E;  2ZN8 A;  1CDP A;  1CKK A;  4L9M A;  2GV5 A;  1WLM A;  4NDD A;  4ORA B;  1K90 D;  3TS5 B;  4NDC A;  4I5J A;  1DF0 B;  1TNX A;  1Q80 A;  4BY5 A;  2KAX A;  1U5I B;  1WLZ A;  2PAS A;  1DMO A;  1KQV A;  2HET A;  3TDI A;  1EH2 A;  3A4U B;  1B7T Z;  2L2E A;  2GGZ A;  1UHN A;  4GAO A;  3AAK A;  4ICB A;  2NXQ A;  1NCX A;  4MN0 A;  2K2A A;  5CSN A;  1KFX L;  4M2O A;  1OZO A;  4CFQ A;  5AER A;  2MBX A;  2KFG A;  2KGB C;  1IKU A;  4YRU A;  2G9B A;  5HKW A;  1XFV O;  1QJT A;  1HT9 A;  1B8L A;  1Y0V H;  4CPV A;  4PCW A;  2ZRS A;  1OMV A;  2NCP A;  1KFU S;  2JNF A;  1C07 A;  2ISD A;  1A4P A;  1QXP A;  1UUR A;  3IF7 A;  2LM5 A;  2M8U A;  2FOT A;  4MRY A;  1CDM A;  1MXL C;  3WXA A;  5HKY A;  2BCB A;  1C7W A;  2R2I A;  3GOF A;  4GGF A;  1LVC D;  3PM8 A;  1F71 A;  1A2X A;  3NSK A;  1LXF C;  1C7V A;  1QV1 A;  2F3Y A;  2LMV A;  1KQM B;  1D1O A;  3A8R A;  1AK8 A;  1QV0 A;  1DJX A;  3BOW A;  2OS8 B;  3LL8 B;  4HSZ A;  1B8R A;  3DVM A;  3OHM B;  1JSA A;  3SG7 A;  3BQ3 A;  1JFJ A;  4ZCV A;  1BF5 A;  3EK7 A;  4QJ3 B;  1K9U A;  1ALV A;  1YUU A;  3PN7 B;  1FI6 A;  4TNC A;  5BPJ A;  1BOD A;  1S5G Z;  5F6T A;  2FCE A;  4ETO A;  1SBJ A;  4ORC B;  1BJF A;  2L98 A;  2BKI B;  1SCM B;  1SRA A;  4JWQ A;  1SW8 A;  4MBE A;  1F55 A;  1MR8 A;  5HYD A;  1DJY A;  1WRZ A;  1XFX O;  1F54 A;  5CSJ A;  1W7J B;  3JTD C;  4N1F A;  1CMG A;  2AMI A;  5FYX A;  1B7T Y;  1IJ6 A;  3D10 A;  2PMY A;  2HQW A;  2CXJ A;  1G4Y R;  1SNL A;  1RJV A;  3VGO A;  3SG6 A;  1SL7 A;  3I5H C;  2L0P A;  3E3R A;  2AUC A;  3AKB A;  2M29 A;  4GGN A;  1NYA A;  1TNQ A;  5ER4 X;  1IQ5 A;  2MAZ A;  3FIA A;  2F2P A;  2F33 A;  1IH0 A;  3DVK A;  1IQ3 A;  2JT8 A;  4R1E A;  5CSI A;  5HLV A;  2K7B A;  4GFT A;  3CLN A;  1KFU L;  1ZFS A;  4MVF A;  1AUI B;  2K7O A;  1MQ1 A;  1YR5 A;  2LHL A;  1TNP A;  3OB2 B;  1YUS A;  2L5X B;  4YBH B;  2WOS A;  2ZNE A;  1VRK A;  1J7R A;  1JFK A;  1S6J A;  1IJ5 A;  1TOP A;  1TRF A;  1KSM A;  1CLM A;  1QAS A;  1XFZ O;  2E30 A;  2MHH A;  5D69 A;  1OQP A;  1KQM C;  2HQ8 A;  1TIZ A;  1DJH A;  2LNK A;  4NDB A;  4PE0 A;  2HF5 A;  2OS8 C;  3CGA A;  2FJU B;  1NX1 A;  2KI6 D;  1UHI A;  1NX0 A;  2LVJ A;  1CM4 A;  1CLL A;  2BCA A;  1AJ5 A;  1SCV A;  1L7Z A;  2SCP A;  3PLF B;  2ZND A;  2LMU A;  1KK7 Y;  2LLS A;  2D8N A;  5KU1 A;  2LLT A;  2Y1N A;  4XJK B;  1CNP A;  2CT9 A;  1SCM C;  5DKQ A;  1ZMZ A;  3HX4 A;  3SG2 A;  1UHJ A;  3SG3 A;  1SL9 A;  1M39 A;  1REC A;  1XFW O;  1XYD A;  3BUN B;  3I5I B;  1QVI Y;  4XYN A;  4C0K A;  1CFC A;  1JC2 A;  5AEQ A;  3SG5 A;  4QJ5 B;  3CR5 X;  4I5L B;  1QX2 A;  1BU3 A;  1DVI A;  2L4H A;  2LLU A;  4OR9 B;  2LP2 A;  3CZT X;  1DT7 B;  2HPS A;  1CDN A;  4GBA A;  1DGV A;  1MHO A;  3WNX B;  4YI8 A;  1FI5 A;  1UUS A;  1S3P A;  2MLE C;  1YX7 A;  1JBA A;  1PSR A;  3EK8 A;  1TNW A;  1F70 A;  4A4B A;  4JQ0 D;  1QS7 A;  3K21 A;  1B9A A;  4USL A;  1Y1U A;  1K2H A;  2OTG B;  1CTR A;  1Y1A A;  2KI6 C;  1SY9 A;  2M7N A;  3LK1 A;  3KPX A;  3JVT B;  4PE1 A;  1QX7 A;  1WDC B;  3M0W A;  1CFP A;  1A75 B;  1CFF A;  1K8U A;  4AQJ A;  2CBL A;  2BKH B;  1NSH A;  2KQY A;  1YRT B;  2LCP A;  1NPQ A;  1AHR A;  4OCI A;  1CDL A;  4AQI A;  1PVB A;  1QAT A;  1NCY A;  2MA2 A;  1UHH A;  3NSL A;  2Q4U A;  3AKA A;  3RM1 A;  3PAL A;  1N0Y A;  3F45 A;  1SPY A;  4WQ3 A;  3BYA A;  3WHT B;  1JWD A;  3BOW B;  1CB1 A;  3DF0 B;  2NZ0 A;  4PHM A;  1MF8 B;  1J7P A;  1U5I A;  2H61 C;  5TNC A;  3OP0 A;  2FCD A;  1K93 D;  3OB1 B;  3VRR A;  1Y6W A;  1B1G A;  1GQM A;  4F0Z B;  4C0L A;  2KBI A;  4YGE B;  2COL B;  2Y1M A;  2I94 A;  1IG5 A;  1SKT A;  4P2Y B;  3PSR A;  3MSE B;  2KFH A;  2KNE A;  5I2Q A;  2LUX A;  1J7Q A;  2EC6 B; 
#chains in the Genus database with same CATH topology
 1K96 A;  2PRU A;  3PAT A;  1H8B A;  2O5G A;  3S0D A;  1BMO A;  2MLF C;  2K8M B;  1XFY O;  3KO0 A;  1SSE B;  2LVK A;  1GJY A;  3CAB A;  1KK7 Z;  1V1G A;  2K7C A;  4FTG A;  1BG1 A;  2JTT A;  1PK0 D;  5DKN A;  4WQ2 A;  3EKH A;  4HRE E;  5G08 A;  1S26 D;  1J1E A;  1IGV A;  4YGD B;  3SJS A;  1QIW A;  2LAP A;  1B8C A;  2M1K B;  1NP8 A;  3OX6 A;  3TS5 C;  3BXK A;  3N7H A;  2WCB A;  5FI7 A;  1J7O A;  1LKJ A;  1QVI Z;  1YVL A;  2JXC A;  3LLE A;  3BUX B;  1KWO B;  5JJG A;  1FPW A;  3WHU B;  3CR4 X;  3H4S E;  3SG4 A;  1CFD A;  2BL0 B;  1XK4 C;  2K61 A;  1NIW A;  2JNX A;  1TUJ A;  3TDZ A;  3NXA A;  2KQ6 A;  2WCE A;  3JVT C;  3KEV A;  1MXE A;  1OZS A;  2JU0 A;  2KGR A;  3VRQ A;  1F8H A;  2BCX A;  4MZK A;  1TCF A;  1TCO B;  1X02 A;  2KAV A;  2JC2 A;  2P70 A;  2WCK A;  1OE9 B;  4I5N B;  4GPL B;  4PHK A;  1NX2 A;  1A03 A;  4PE4 A;  1SR6 B;  1ORG A;  1XO5 A;  2PVB A;  4KYN A;  5HKZ A;  1B47 A;  2EHB A;  2LE9 B;  5JOL A;  1QLS A;  4PHN A;  1R6P A;  3VRN A;  1XVJ A;  1WRL A;  2GTE A;  4DIR A;  4D1E A;  4A4C A;  1OOJ A;  1FW4 A;  2M3W A;  1IRJ A;  3D0Y B;  1UP5 A;  1IWQ A;  1OMD A;  3CS1 A;  2K0J A;  3SS3 A;  3BUW B;  3TZ1 A;  1ODB A;  2I7A A;  4M2P A;  1DEK A;  4DRW A;  1UWO A;  1L2O B;  5I2O A;  3QME A;  2MJW B;  2ZKM X;  4U8D A;  5PAL A;  5FI2 A;  2SAS A;  3BUO B;  5AXI A;  1KFX S;  2BE4 A;  3B87 A;  3BFA A;  3R72 A;  3UO9 A;  1FBV A;  4CFR A;  4PHJ A;  4CLN A;  2KLE A;  5AAN A;  1K94 A;  4DCK A;  2EC6 C;  1XFU O;  3PN7 C;  2B1U A;  4DUQ A;  2M1U A;  2LUC A;  4E68 A;  2QAC A;  1DJG A;  2JT0 A;  3IQO A;  2M7L A;  2NCO A;  2P6B B;  5AFP A;  1ALW A;  1YUR A;  1SYM A;  1DTL A;  2BEC A;  2RGI A;  2AAO A;  3I5F B;  1RK9 A;  2V53 A;  4OVN F;  2LV7 A;  2WND A;  5I2L A;  1DQE A;  4YGB B;  1M46 A;  1WRK A;  3O2P A;  1KWO C;  2KYC A;  1OMR A;  3Q8I A;  4MZL A;  2P71 A;  3IQQ A;  4ZCU A;  4QJ4 B;  2BNX A;  2BL0 C;  2H61 A;  2NLN A;  3DD4 A;  3GK2 A;  4PE7 A;  2KDH A;  1J55 A;  4UPG A;  1K9P A;  2CCM A;  3B88 A;  2KYF A;  2JUL A;  1MWN A;  2ZRT A;  4MZJ A;  5K89 A;  1E8A A;  2FJY A;  2WCH A;  3BUM B;  5DKR A;  2WCF A;  2IS9 A;  3OX5 A;  3UNW A;  3IVT A;  3V2L A;  1SR6 C;  2K2F A;  1PAL A;  4PAL A;  1BT6 A;  4AOM A;  1N2D A;  1GGW A;  4MLW A;  1KK8 B;  2F2O A;  3NSI A;  2EGD A;  2JPT A;  3EVV A;  3JTD B;  5D3O A;  1DC1 A;  1DGU A;  1NWD A;  1G33 A;  3EVU A;  3SIB A;  2LAN A;  3AAJ A;  4IL1 A;  2DOQ A;  5KSZ A;  4FQT A;  1PUL A;  1ZOT B;  2JRF A;  4MRX A;  3CZ2 A;  1DJW A;  2ZN9 A;  1CLB A;  2KI4 B;  2KPH A;  1L2O C;  3I5H B;  1DF0 A;  1A29 A;  2WCM A;  1EJ3 A;  1DEL A;  1QX5 B;  1AP4 A;  2QPT A;  2JXL A;  3O4Y A;  5GQQ C;  1J1D A;  1KCY A;  1M31 A;  1YTZ C;  3I5G B;  1XK4 A;  2G2B A;  1JF2 A;  4INW A;  4WRI A;  2JQ6 A;  3EKJ A;  3SIA A;  2M49 B;  2F3Z A;  1SL8 A;  1TWO A;  1NX3 A;  1FF1 A;  1ZUZ A;  3NHT A;  1LIN A;  1RFJ A;  2L4I A;  3DVE A;  4YI9 A;  1A75 A;  3VB1 A;  2I18 A;  2JOJ A;  1RTP 1;  2L51 A;  2ZFD A;  3I5I C;  5CSF A;  3LCP C;  3PFV A;  1JF0 A;  1AJ4 A;  1YVH A;  1SMG A;  2BBN A;  2JT3 A;  2MRD A;  3I5F C;  5I8N A;  1C3Z A;  3TDU A;  3D77 A;  3LK0 A;  5KTY A;  3QRX A;  1YUT A;  2PYQ A;  3DF0 A;  1TTX A;  2JZI A;  1M63 B;  1F4O A;  2WC8 A;  2PSR A;  3FS7 A;  3GK1 A;  1S6C A;  2L2C A;  2LC5 A;  3TUY B;  2M0R A;  3CR2 A;  4GUK A;  3BJH A;  4MSP A;  2OTG C;  1DJZ A;  2KAY A;  3VRO A;  4MEW A;  3KHE A;  4DS7 A;  3B6X A;  2YGU A;  4HRH A;  1QLK A;  1V1F A;  1TN4 A;  3EVR A;  4JKT A;  2L5Y A;  1BR1 B;  3VRP A;  4OKH A;  1WDC C;  1OOF A;  4F7F A;  2Y4Q A;  1F4Q A;  1KK8 C;  1K95 A;  1JUO A;  4OV2 A;  5HLO A;  1B4C A;  3S0A A;  4FQO A;  1AVS A;  1M45 A;  4GGF C;  4HRG A;  1HQV A;  5J3X A;  1PSB A;  1N65 A;  1K9K A;  1WY9 A;  1QTX A;  2KI4 C;  5D7F A;  2JWW A;  1EG4 A;  4YGC B;  1LA3 A;  3RLZ A;  1KSO A;  4CID A;  1ZAC A;  4YGA A;  3K1E A;  1SK6 D;  1XA5 A;  2H2K A;  3I5G C;  1RWY A;  4I5K A;  1W7I B;  1Y1X A;  2M9G A;  4NQG A;  1BR4 B;  3DYE A;  2LHI A;  2KHN A;  1CM1 A;  2VRG A;  3HCM A;  4Q04 A;  2CNP A;  2BAP A;  2JTZ A;  1DJI A;  1G8I A;  4GNK B;  1H4B A;  2I2R E;  3FWB A;  3O6B A;  1CMF A;  1PRW A;  3C1V A;  3KF9 A;  4ORB B;  5CPV A;  1BLQ A;  1S6I A;  4BY4 A;  4OZD A;  1OOH A;  2BE6 A;  2L50 A;  1R2U A;  3CWG A;  2TN4 A;  1YRU B;  2LP3 A;  2O60 A;  2Y5I A;  1EXR A;  1RRO A;  2OPO A;  1LS8 A;  4JPZ B;  2BBM A;  3O78 A;  2GGM A;  3CTN A;  3OGN A;  3ZNI A;  1NUB A;  2LVV A;  5B8I B;  4JD9 A;  2A4J A;  3D0Y A;  4N1G A;  3NSO A;  4N5X A;  2KBM A;  3ICB A;  3TUY C;  1OSA A;  4PDZ A;  2LVI A;  3EK4 A;  2ERB A;  2M97 A;  1PVA A;  1S5G Y;  1MUX A;  2KSP A;  1P28 A;  3DVJ A;  3S0F A;  2CTN A;  3DY9 A;  1S1E A;  3NGV A;  2WC5 A;  1GGZ A;  3L47 A;  2LMT A;  3ZWH A;  4C0J A;  1EL4 A;  2E6W A;  5IBW A;  1EG3 A;  3S0G A;  3FWC A;  1LA0 A;  2F8P A;  2Q91 A;  2WOR A;  4M2Q A;  2K7D A;  2KFF A;  3GK4 X;  2JPO A;  2KOT A;  1NCZ A;  3OBV A;  1QIV A;  1YX8 A;  3D76 A;  2PAL A;  4IJ7 A;  4XJK A;  1BOC A;  1S36 A;  5ER5 A;  1UHK A;  4P5O E;  2WCJ A;  2ZN8 A;  1CDP A;  1CKK A;  4L9M A;  2GV5 A;  1WLM A;  4NDD A;  4ORA B;  1K90 D;  3TS5 B;  4NDC A;  4I5J A;  3RZS A;  1DF0 B;  1TNX A;  1Q80 A;  4BY5 A;  2KAX A;  1U5I B;  1WLZ A;  2PAS A;  2QEH A;  1DMO A;  2HET A;  3TDI A;  3EG5 B;  1EH2 A;  1KQV A;  3A4U B;  1B7T Z;  2L2E A;  2GGZ A;  1UHN A;  4GAO A;  2WC6 A;  3AAK A;  4ICB A;  2NXQ A;  1NCX A;  2QEV A;  2K2A A;  4MN0 A;  1KFX L;  5CSN A;  4M2O A;  1OZO A;  4CFQ A;  2QEO A;  5AER A;  2K60 A;  2KFG A;  2MBX A;  3FE9 A;  2KGB C;  1IKU A;  4YRU A;  2G9B A;  5HKW A;  1XFV O;  1QJT A;  1HT9 A;  1B8L A;  1Y0V H;  4CPV A;  3D74 A;  4PCW A;  2ZRS A;  1OMV A;  2NCP A;  1KFU S;  2JNF A;  1C07 A;  2ISD A;  1A4P A;  1QXP A;  1UUR A;  3IF7 A;  2LM5 A;  3BFB A;  2M8U A;  3S0E A;  2FOT A;  3FE8 A;  4MRY A;  1T14 A;  1Z4H A;  1CDM A;  1MXL C;  3WXA A;  5HKY A;  2BCB A;  1C7W A;  2H8V A;  2R2I A;  3GOF A;  4GGF A;  1LVC D;  3PM8 A;  1F71 A;  1A2X A;  3NSK A;  1LXF C;  1C7V A;  1QV1 A;  2F3Y A;  2LMV A;  1KQM B;  2PQL A;  1D1O A;  3A8R A;  1AK8 A;  1QV0 A;  1DJX A;  3BOW A;  3CZ0 A;  3NHI A;  1XFR A;  2OS8 B;  3DXL A;  3LL8 B;  4HSZ A;  3B7A A;  1B8R A;  2WCL A;  3DVM A;  3OHM B;  1JSA A;  3SG7 A;  3BQ3 A;  1JFJ A;  2QDI A;  3L4L A;  4ZCV A;  3CYZ A;  3EK7 A;  4QJ3 B;  1BF5 A;  1K9U A;  1ALV A;  1YUU A;  3PN7 B;  1FI6 A;  4TNC A;  5BPJ A;  1BOD A;  1S5G Z;  5F6T A;  1W9Z A;  2FCE A;  4ETO A;  1SBJ A;  4ORC B;  1BJF A;  2L98 A;  2BKI B;  1SCM B;  5EL2 A;  1SRA A;  4JWQ A;  1SW8 A;  4MBE A;  1F55 A;  1MR8 A;  5HYD A;  1DJY A;  1WRZ A;  1XFX O;  3DZT A;  1F54 A;  5CSJ A;  1W7J B;  3JTD C;  4N1F A;  1CMG A;  2AMI A;  5FYX A;  1B7T Y;  1IJ6 A;  3D10 A;  2PMY A;  3SS4 A;  2HQW A;  2CXJ A;  1G4Y R;  1SNL A;  1RJV A;  3VGO A;  3SG6 A;  1SL7 A;  3I5H C;  2L0P A;  3E3R A;  1OOI X;  2AUC A;  2M29 A;  3AKB A;  1NYA A;  4GGN A;  1TNQ A;  5ER4 X;  5DIC A;  1IQ5 A;  3B86 A;  2MAZ A;  3FIA A;  2F2P A;  2F33 A;  1IH0 A;  2KLD A;  3DVK A;  1IQ3 A;  2JT8 A;  4R1E A;  5CSI A;  5HLV A;  2K7B A;  3R1V A;  4GFT A;  3FE6 A;  3CLN A;  1KFU L;  3SS5 A;  1ZFS A;  3O4X A;  4MVF A;  1AUI B;  2K7O A;  1MQ1 A;  1YR5 A;  2LHL A;  1TNP A;  3OB2 B;  1YUS A;  2L5X B;  4YBH B;  2WOS A;  2ZNE A;  1IIO A;  1VRK A;  1J7R A;  1JFK A;  1S6J A;  1IJ5 A;  1TOP A;  1TRF A;  1KSM A;  1CLM A;  1QAS A;  1XFZ O;  1OOG A;  2E30 A;  2MHH A;  5D69 A;  1OQP A;  1KQM C;  2HQ8 A;  1TIZ A;  1DJH A;  2LNK A;  4NDB A;  4PE0 A;  2HF5 A;  2OS8 C;  3CGA A;  2FJU B;  1NX1 A;  2KI6 D;  1UHI A;  1NX0 A;  2LVJ A;  1CM4 A;  1CLL A;  4PT1 A;  2BCA A;  1AJ5 A;  1SCV A;  1L7Z A;  2SCP A;  3PLF B;  2ZND A;  2LMU A;  1GM0 A;  1KK7 Y;  2LLS A;  2D8N A;  5KU1 A;  2LLT A;  2Y1N A;  4XJK B;  1CNP A;  2CT9 A;  1SCM C;  5DKQ A;  1ZMZ A;  3HX4 A;  3SG2 A;  1UHJ A;  3SG3 A;  2QEB A;  1SL9 A;  1M39 A;  1REC A;  1XFW O;  1XYD A;  3BUN B;  3I5I B;  1QVI Y;  3PM2 A;  4XYN A;  4C0K A;  1CFC A;  1JC2 A;  5AEQ A;  3SG5 A;  4QJ5 B;  3CR5 X;  4I5L B;  1QX2 A;  1BU3 A;  1DVI A;  2L4H A;  2LLU A;  4OR9 B;  2LP2 A;  3CZT X;  1DT7 B;  2HPS A;  1CDN A;  4GBA A;  5I94 A;  1DGV A;  1MHO A;  3WNX B;  3CZ1 A;  4YI8 A;  1FI5 A;  1UUS A;  1S3P A;  2MLE C;  5HL1 A;  1YX7 A;  1JBA A;  3R1O A;  1PSR A;  3EK8 A;  1TNW A;  3L4A A;  1C3Y A;  1F70 A;  4A4B A;  4JQ0 D;  1QS7 A;  3K21 A;  1B9A A;  1TUZ A;  4USL A;  1Y1U A;  1K2H A;  2OTG B;  1CTR A;  3D78 A;  1Y1A A;  2KI6 C;  1SY9 A;  2M7N A;  3LK1 A;  3KPX A;  3JVT B;  4PE1 A;  1QX7 A;  1OW4 A;  1WDC B;  3M0W A;  1A75 B;  1CFF A;  1CFP A;  1K8U A;  3BFH A;  4AQJ A;  2BKH B;  2CBL A;  1NSH A;  2KQY A;  1YRT B;  2LCP A;  1NPQ A;  1AHR A;  4OCI A;  1CDL A;  4AQI A;  1PVB A;  1QAT A;  1NCY A;  2MA2 A;  1UHH A;  3NSL A;  3D73 A;  2Q4U A;  3AKA A;  3RM1 A;  3PAL A;  1N0Y A;  5FI6 A;  3F45 A;  1SPY A;  1QWV A;  4WQ3 A;  3BYA A;  3CDN A;  3WHT B;  1JWD A;  3BOW B;  3PJI A;  1CB1 A;  3DF0 B;  2NZ0 A;  4PHM A;  1MF8 B;  1J7P A;  1U5I A;  2H61 C;  4INX A;  5TNC A;  3OP0 A;  2FCD A;  1K93 D;  3OB1 B;  3VRR A;  1Y6W A;  1B1G A;  1GQM A;  4F0Z B;  4C0L A;  2KBI A;  4YGE B;  2COL B;  2Y1M A;  2I94 A;  1Z2C B;  3D75 A;  1IG5 A;  1SKT A;  4P2Y B;  3PSR A;  3MSE B;  2KFH A;  3R1P A;  2KNE A;  5I2Q A;  2LUX A;  3S0B A;  1J7Q A;  2EC6 B; 
#chains in the Genus database with same CATH homology
 1K96 A;  2PRU A;  3PAT A;  1H8B A;  2O5G A;  1BMO A;  2MLF C;  2K8M B;  1XFY O;  3KO0 A;  2LVK A;  1GJY A;  1KK7 Z;  1V1G A;  2K7C A;  4FTG A;  1BG1 A;  2JTT A;  1PK0 D;  5DKN A;  4WQ2 A;  3EKH A;  4HRE E;  5G08 A;  1S26 D;  1J1E A;  1IGV A;  4YGD B;  3SJS A;  1QIW A;  2LAP A;  1B8C A;  2M1K B;  1NP8 A;  3OX6 A;  3TS5 C;  3BXK A;  1J7O A;  2WCB A;  1LKJ A;  1QVI Z;  1YVL A;  2JXC A;  3LLE A;  3BUX B;  1KWO B;  5JJG A;  1FPW A;  3WHU B;  3CR4 X;  3H4S E;  3SG4 A;  1CFD A;  2BL0 B;  1XK4 C;  2K61 A;  1NIW A;  2JNX A;  3TDZ A;  3NXA A;  2KQ6 A;  2WCE A;  3JVT C;  3KEV A;  1MXE A;  1OZS A;  2JU0 A;  2KGR A;  3VRQ A;  1F8H A;  2BCX A;  4MZK A;  1TCF A;  1TCO B;  1X02 A;  2KAV A;  2JC2 A;  4PHK A;  1OE9 B;  4I5N B;  4GPL B;  1NX2 A;  1A03 A;  4PE4 A;  1SR6 B;  1XO5 A;  2PVB A;  5HKZ A;  1B47 A;  2EHB A;  2LE9 B;  5JOL A;  1QLS A;  4PHN A;  1R6P A;  3VRN A;  1XVJ A;  1WRL A;  4DIR A;  4D1E A;  4A4C A;  1OOJ A;  1FW4 A;  2M3W A;  1IRJ A;  3D0Y B;  1UP5 A;  1IWQ A;  1OMD A;  3CS1 A;  2K0J A;  3TZ1 A;  3BUW B;  1ODB A;  2I7A A;  4M2P A;  4DRW A;  1UWO A;  1L2O B;  5I2O A;  2MJW B;  2ZKM X;  4U8D A;  5PAL A;  2SAS A;  3BUO B;  5AXI A;  1KFX S;  2BE4 A;  4CFR A;  1FBV A;  4PHJ A;  4CLN A;  5AAN A;  1K94 A;  4DCK A;  2EC6 C;  1XFU O;  3PN7 C;  2B1U A;  4DUQ A;  2M1U A;  2LUC A;  4E68 A;  2QAC A;  1DJG A;  2JT0 A;  3IQO A;  2M7L A;  2NCO A;  2P6B B;  5AFP A;  1ALW A;  1SYM A;  1YUR A;  1DTL A;  2BEC A;  2RGI A;  2AAO A;  3I5F B;  1RK9 A;  2V53 A;  4OVN F;  2LV7 A;  2WND A;  5I2L A;  4YGB B;  1M46 A;  1WRK A;  3O2P A;  1KWO C;  2KYC A;  1OMR A;  4MZL A;  3IQQ A;  4ZCU A;  4QJ4 B;  2BL0 C;  2H61 A;  2NLN A;  3DD4 A;  3GK2 A;  4PE7 A;  2KDH A;  1J55 A;  4UPG A;  1K9P A;  2CCM A;  2KYF A;  2JUL A;  1MWN A;  2ZRT A;  4MZJ A;  5K89 A;  1E8A A;  3BUM B;  5DKR A;  2WCF A;  2IS9 A;  3OX5 A;  1SR6 C;  2K2F A;  1PAL A;  4PAL A;  1BT6 A;  4AOM A;  1N2D A;  1GGW A;  4MLW A;  1KK8 B;  2F2O A;  3NSI A;  2EGD A;  2JPT A;  3EVV A;  3JTD B;  1DGU A;  1NWD A;  1G33 A;  3EVU A;  3SIB A;  2LAN A;  3AAJ A;  4IL1 A;  2DOQ A;  5KSZ A;  1PUL A;  1ZOT B;  2JRF A;  4MRX A;  1DJW A;  2ZN9 A;  1CLB A;  2KI4 B;  1L2O C;  3I5H B;  1DF0 A;  1A29 A;  1EJ3 A;  1QX5 B;  1AP4 A;  2QPT A;  2JXL A;  3O4Y A;  5GQQ C;  1J1D A;  1KCY A;  1M31 A;  1YTZ C;  3I5G B;  1XK4 A;  2G2B A;  1JF2 A;  4WRI A;  2JQ6 A;  3EKJ A;  3SIA A;  2M49 B;  2F3Z A;  1SL8 A;  1FF1 A;  1NX3 A;  1ZUZ A;  1LIN A;  1RFJ A;  2L4I A;  3DVE A;  4YI9 A;  1A75 A;  2I18 A;  2JOJ A;  1RTP 1;  2L51 A;  2ZFD A;  3I5I C;  5CSF A;  3LCP C;  3PFV A;  1JF0 A;  2BBN A;  1YVH A;  1AJ4 A;  1SMG A;  2JT3 A;  2MRD A;  3I5F C;  5I8N A;  3TDU A;  3LK0 A;  5KTY A;  3QRX A;  1YUT A;  3DF0 A;  1TTX A;  2JZI A;  1M63 B;  1F4O A;  2WC8 A;  2PSR A;  3FS7 A;  3GK1 A;  1S6C A;  2LC5 A;  3TUY B;  2M0R A;  3CR2 A;  4GUK A;  4MSP A;  2OTG C;  1DJZ A;  2KAY A;  3VRO A;  4MEW A;  3KHE A;  4DS7 A;  4HRH A;  1QLK A;  1V1F A;  1TN4 A;  3EVR A;  1BR1 B;  3VRP A;  4OKH A;  1WDC C;  2Y4Q A;  1F4Q A;  1KK8 C;  1K95 A;  1JUO A;  4OV2 A;  5HLO A;  1B4C A;  4FQO A;  1AVS A;  1M45 A;  4GGF C;  4HRG A;  1HQV A;  5J3X A;  1PSB A;  1N65 A;  1K9K A;  1WY9 A;  1QTX A;  2KI4 C;  5D7F A;  2JWW A;  1EG4 A;  4YGC B;  1LA3 A;  3RLZ A;  1KSO A;  4CID A;  1ZAC A;  4YGA A;  1SK6 D;  1XA5 A;  2H2K A;  3I5G C;  1RWY A;  4I5K A;  1W7I B;  1Y1X A;  2M9G A;  4NQG A;  1BR4 B;  2LHI A;  2KHN A;  1CM1 A;  2VRG A;  3HCM A;  4Q04 A;  2CNP A;  2JTZ A;  1DJI A;  1G8I A;  4GNK B;  1H4B A;  2I2R E;  3FWB A;  3O6B A;  1CMF A;  1PRW A;  3C1V A;  3KF9 A;  4ORB B;  5CPV A;  1BLQ A;  1S6I A;  4BY4 A;  2BE6 A;  2L50 A;  1R2U A;  3CWG A;  2TN4 A;  1YRU B;  2LP3 A;  2O60 A;  2Y5I A;  1EXR A;  1RRO A;  2OPO A;  4JPZ B;  2BBM A;  3O78 A;  2GGM A;  3CTN A;  3ZNI A;  1NUB A;  2LVV A;  5B8I B;  2A4J A;  3D0Y A;  4N1G A;  3NSO A;  4N5X A;  2KBM A;  3ICB A;  3TUY C;  1OSA A;  4PDZ A;  2LVI A;  3EK4 A;  2M97 A;  1PVA A;  1S5G Y;  1MUX A;  2KSP A;  3DVJ A;  2CTN A;  1S1E A;  5IBW A;  1GGZ A;  2LMT A;  3ZWH A;  4C0J A;  1EL4 A;  2E6W A;  1EG3 A;  3FWC A;  1LA0 A;  2F8P A;  2Q91 A;  2WOR A;  4M2Q A;  2K7D A;  2KFF A;  3GK4 X;  2KOT A;  1NCZ A;  1QIV A;  1YX8 A;  2PAL A;  4XJK A;  1BOC A;  1S36 A;  5ER5 A;  1UHK A;  4P5O E;  2ZN8 A;  1CDP A;  1CKK A;  4L9M A;  2GV5 A;  1WLM A;  4NDD A;  4ORA B;  1K90 D;  3TS5 B;  4NDC A;  4I5J A;  1DF0 B;  1TNX A;  1Q80 A;  4BY5 A;  2KAX A;  1U5I B;  1WLZ A;  2PAS A;  1DMO A;  1KQV A;  2HET A;  3TDI A;  1EH2 A;  3A4U B;  1B7T Z;  2L2E A;  2GGZ A;  1UHN A;  4GAO A;  3AAK A;  4ICB A;  2NXQ A;  1NCX A;  4MN0 A;  2K2A A;  5CSN A;  1KFX L;  4M2O A;  1OZO A;  4CFQ A;  5AER A;  2MBX A;  2KFG A;  2KGB C;  1IKU A;  4YRU A;  2G9B A;  5HKW A;  1XFV O;  1QJT A;  1HT9 A;  1B8L A;  1Y0V H;  4CPV A;  4PCW A;  2ZRS A;  1OMV A;  2NCP A;  1KFU S;  2JNF A;  1C07 A;  2ISD A;  1A4P A;  1QXP A;  1UUR A;  3IF7 A;  2LM5 A;  2M8U A;  2FOT A;  4MRY A;  1CDM A;  1MXL C;  3WXA A;  5HKY A;  2BCB A;  1C7W A;  2R2I A;  3GOF A;  4GGF A;  1LVC D;  3PM8 A;  1F71 A;  1A2X A;  3NSK A;  1LXF C;  1C7V A;  1QV1 A;  2F3Y A;  2LMV A;  1KQM B;  1D1O A;  3A8R A;  1AK8 A;  1QV0 A;  1DJX A;  3BOW A;  2OS8 B;  3LL8 B;  4HSZ A;  1B8R A;  3DVM A;  3OHM B;  1JSA A;  3SG7 A;  3BQ3 A;  1JFJ A;  4ZCV A;  1BF5 A;  3EK7 A;  4QJ3 B;  1K9U A;  1ALV A;  1YUU A;  3PN7 B;  1FI6 A;  4TNC A;  5BPJ A;  1BOD A;  1S5G Z;  5F6T A;  2FCE A;  4ETO A;  1SBJ A;  4ORC B;  1BJF A;  2L98 A;  2BKI B;  1SCM B;  1SRA A;  4JWQ A;  1SW8 A;  4MBE A;  1F55 A;  1MR8 A;  5HYD A;  1DJY A;  1WRZ A;  1XFX O;  1F54 A;  5CSJ A;  1W7J B;  3JTD C;  4N1F A;  1CMG A;  2AMI A;  5FYX A;  1B7T Y;  1IJ6 A;  3D10 A;  2PMY A;  2HQW A;  2CXJ A;  1G4Y R;  1SNL A;  1RJV A;  3VGO A;  3SG6 A;  1SL7 A;  3I5H C;  2L0P A;  3E3R A;  2AUC A;  3AKB A;  2M29 A;  4GGN A;  1NYA A;  1TNQ A;  5ER4 X;  1IQ5 A;  2MAZ A;  3FIA A;  2F2P A;  2F33 A;  1IH0 A;  3DVK A;  1IQ3 A;  2JT8 A;  4R1E A;  5CSI A;  5HLV A;  2K7B A;  4GFT A;  3CLN A;  1KFU L;  1ZFS A;  4MVF A;  1AUI B;  2K7O A;  1MQ1 A;  1YR5 A;  2LHL A;  1TNP A;  3OB2 B;  1YUS A;  2L5X B;  4YBH B;  2WOS A;  2ZNE A;  1VRK A;  1J7R A;  1JFK A;  1S6J A;  1IJ5 A;  1TOP A;  1TRF A;  1KSM A;  1CLM A;  1QAS A;  1XFZ O;  2E30 A;  2MHH A;  5D69 A;  1OQP A;  1KQM C;  2HQ8 A;  1TIZ A;  1DJH A;  2LNK A;  4NDB A;  4PE0 A;  2HF5 A;  2OS8 C;  3CGA A;  2FJU B;  1NX1 A;  2KI6 D;  1UHI A;  1NX0 A;  2LVJ A;  1CM4 A;  1CLL A;  2BCA A;  1AJ5 A;  1SCV A;  1L7Z A;  2SCP A;  3PLF B;  2ZND A;  2LMU A;  1KK7 Y;  2LLS A;  2D8N A;  5KU1 A;  2LLT A;  2Y1N A;  4XJK B;  1CNP A;  2CT9 A;  1SCM C;  5DKQ A;  1ZMZ A;  3HX4 A;  3SG2 A;  1UHJ A;  3SG3 A;  1SL9 A;  1M39 A;  1REC A;  1XFW O;  1XYD A;  3BUN B;  3I5I B;  1QVI Y;  4XYN A;  4C0K A;  1CFC A;  1JC2 A;  5AEQ A;  3SG5 A;  4QJ5 B;  3CR5 X;  4I5L B;  1QX2 A;  1BU3 A;  1DVI A;  2L4H A;  2LLU A;  4OR9 B;  2LP2 A;  3CZT X;  1DT7 B;  2HPS A;  1CDN A;  4GBA A;  1DGV A;  1MHO A;  3WNX B;  4YI8 A;  1FI5 A;  1UUS A;  1S3P A;  2MLE C;  1YX7 A;  1JBA A;  1PSR A;  3EK8 A;  1TNW A;  1F70 A;  4A4B A;  4JQ0 D;  1QS7 A;  3K21 A;  1B9A A;  4USL A;  1Y1U A;  1K2H A;  2OTG B;  1CTR A;  1Y1A A;  2KI6 C;  1SY9 A;  2M7N A;  3LK1 A;  3KPX A;  3JVT B;  4PE1 A;  1QX7 A;  1WDC B;  3M0W A;  1CFP A;  1A75 B;  1CFF A;  1K8U A;  4AQJ A;  2CBL A;  2BKH B;  1NSH A;  2KQY A;  1YRT B;  2LCP A;  1NPQ A;  1AHR A;  4OCI A;  1CDL A;  4AQI A;  1PVB A;  1QAT A;  1NCY A;  2MA2 A;  1UHH A;  3NSL A;  2Q4U A;  3AKA A;  3RM1 A;  3PAL A;  1N0Y A;  3F45 A;  1SPY A;  4WQ3 A;  3BYA A;  3WHT B;  1JWD A;  3BOW B;  1CB1 A;  3DF0 B;  2NZ0 A;  4PHM A;  1MF8 B;  1J7P A;  1U5I A;  2H61 C;  5TNC A;  3OP0 A;  2FCD A;  1K93 D;  3OB1 B;  3VRR A;  1Y6W A;  1B1G A;  1GQM A;  4F0Z B;  4C0L A;  2KBI A;  4YGE B;  2COL B;  2Y1M A;  2I94 A;  1IG5 A;  1SKT A;  4P2Y B;  3PSR A;  3MSE B;  2KFH A;  2KNE A;  5I2Q A;  2LUX A;  1J7Q A;  2EC6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...