4DIRA

2.6 angstrom x-ray structure of human ca(2+)-s100a5
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
78
Chain Sequence
TPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Target-binding to S100A5 changes Ca(2+)-binding affinity and dynamics.
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A5
total genus 30
structure length 78
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dirA00
4P5OE 1NX3A 2BKIB 1FI5A 2Y4QA 1GGZA 2BCBA 1YUUA 1IQ5A 3BUMB 5D69A 2HPSA 1UHKA 2KOTA 3NSLA 1N2DA 1XFWO 1N0YA 1F4QA 2RGIA 2LLUA 1K96A 2MHHA 1UHHA 2LE9B 1SMGA 1A4PA 2K7CA 3CWGA 4L9MA 3KEVA 3C1VA 1YURA 1DJGA 1AVSA 4ICBA 1JFKA 1K2HA 2PMYA 2LC5A 3BXKA 4YGEB 3JVTB 1CLBA 3SG5A 4JQ0D 4HRGA 4FTGA 1M39A 1KQVA 1XK4C 1NPQA 3KF9A 1YVHA 4GGNA 1CTRA 5DKQA 1KK7Y 1WDCB 2JPTA 3WHTB 3GOFA 4TNCA 3VGOA 1A75A 1QJTA 5ER4X 1RTP1 1CFCA 3SIBA 1B7TZ 2JNXA 1XYDA 4ZCUA 1KSOA 2KYCA 3BUWB 1YRTB 2MRDA 3KO0A 3NSOA 4YGAA 4DRWA 3I5FB 2OPOA 4C0JA 4PHKA 3ZWHA 2Y1NA 2BCXA 4OV2A 4PHNA 1SL7A 3NXAA 1XFUO 1MUXA 3CR2A 2B1UA 3IF7A 1QATA 3JTDC 3OX6A 2F3ZA 5I2QA 2CTNA 2NLNA 3CR5X 2FOTA 5HKZA 3SG7A 2MA2A 1C07A 2JT0A 1CFDA 3PLFB 4XJKA 1TIZA 1DF0A 1KQMC 3VRQA 2COLB 2JWWA 1J7QA 1PULA 1U5IB 3CGAA 2LVIA 1ALWA 2LVKA 1QTXA 2LHIA 1S1EA 4Q04A 2O60A 1F54A 2D8NA 4MVFA 3I5FC 1YR5A 3CS1A 3I5GC 1PSRA 1BF5A 1SBJA 1RJVA 3SG4A 4YBHB 1J7RA 2Q91A 4ETOA 4GGFA 3VROA 2LLTA 1TTXA 3DD4A 1JWDA 4IL1A 2LMUA 2JXCA 3OHMB 3AAJA 1F70A 4YGBB 2OTGB 4MZKA 2WCEA 3LCPC 3I5GB 3I5HC 5CSFA 2JOJA 2AUCA 1S3PA 4BY4A 3VRRA 3JVTC 1K9PA 2G2BA 4YRUA 2NZ0A 3SG2A 3AAKA 2WC8A 1NCXA 2L2EA 2M1KB 1PRWA 4DCKA 4C0KA 1BT6A 2ZRTA 3LL8B 5AERA 3VRPA 1CDLA 1F4OA 1RFJA 1L2OC 4QJ4B 1NIWA 2BL0B 2FCDA 4DIRA 2I2RE 1BODA 3O6BA 3EVVA 1J7OA 1S6JA 2ZN9A 4ORBB 2ZNEA 2LHLA 1AHRA 4CPVA 1WY9A 1L7ZA 4PE7A 1NUBA 3OX5A 2PVBA 3SG3A 1DJHA 3SIAA 1E8AA 1DMOA 1H8BA 2QACA 4MRYA 4R1EA 1QX5B 3TZ1A 2Q4UA 1J1DA 4FQOA 1BMOA 1NP8A 1TN4A 3BOWB 1NSHA 4NQGA 5HKWA 1SCVA 2JTZA 2BBNA 1CNPA 4PE1A 1JF0A 2KSPA 1YRUB 1IKUA 1DJYA 1CKKA 2JQ6A 1W7JB 3CR4X 1B9AA 1WRZA 1A75B 3PN7C 5BPJA 1K9UA 1PVAA 5G08A 1SYMA 3WXAA 2I94A 2EC6B 2KFFA 4A4CA 4CFQA 1V1FA 2KBMA 2M1UA 1MWNA 2KFHA 4YI8A 2SASA 2EGDA 2LUXA 1M45A 2OS8B 4QJ5B 1BJFA 2KGRA 1EG3A 1K9KA 1KK8B 2CXJA 1LA3A 3EVRA 3GK1A 3WNXB 4BY5A 1SR6C 2KAXA 1SW8A 2CBLA 1B8RA 1LKJA 3BYAA 5JJGA 1SCMC 5KU1A 1AP4A 4QJ3B 2WOSA 1K94A 5IBWA 2M7LA 3DVEA 1B4CA 1CM1A 1KK7Z 1IRJA 1SKTA 1N65A 4MRXA 1CLLA 3PM8A 3MSEB 1B7TY 2ZNDA 2GV5A 1WLMA 1YTZC 2PALA 3CTNA 1B47A 3HX4A 1U5IA 4M2PA 1SNLA 1YVLA 4MBEA 1IWQA 2KAYA 4I5NB 1BOCA 2PASA 1MXEA 4OKHA 1Y1UA 3E3RA 5CSIA 4GBAA 2JT3A 4YGCB 1QASA 2V53A 4ZCVA 2OTGC 1M31A 1OE9B 2MJWB 2JC2A 5CSNA 2F8PA 4NDBA 4AQIA 2NCOA 1UHIA 4N1GA 1EJ3A 5AFPA 1YX7A 5GQQC 1LA0A 3NSKA 3H4SE 2AAOA 5HKYA 4MEWA 1LXFC 3TDIA 2WCBA 1CMGA 3PN7B 1C7VA 1DF0B 1OSAA 4OVNF 1DJZA 2O5GA 3LLEA 2Y1MA 1DJWA 4N5XA 4XYNA 1JFJA 5DKRA 2KAVA 2P6BB 1KFXL 3BUXB 3EK4A 3OB2B 4JPZB 1BLQA 4GGFC 4GFTA 1K93D 1CB1A 1AK8A 1BU3A 1ZFSA 2KI6D 2ZN8A 1J7PA 2VRGA 2L5XB 3HCMA 4YGDB 1NWDA 3DF0B 1OMVA 1MXLC 3KPXA 2JNFA 1EL4A 1QV1A 2F3YA 2H61A 2NCPA 2LP2A 3DVKA 2KQ6A 2EHBA 2R2IA 1CMFA 2KYFA 3GK4X 1PSBA 3I5IC 1KCYA 1SL8A 1AUIB 3TS5C 1RECA 5CSJA 1F8HA 2KI6C 2KFGA 3JTDB 2K7BA 1ZACA 4NDCA 4D1EA 5D7FA 2H61C 1CLMA 1Q80A 1JC2A 1CM4A 1KWOB 1GGWA 1IJ5A 3M0WA 5K89A 2AMIA 3TDZA 3LK0A 1G8IA 3EKJA 1SK6D 4WQ3A 4HSZA 5HYDA 1KFUS 2L4IA 1J55A 4N1FA 1TNQA 3QRXA 2PSRA 2K0JA 1NYAA 2A4JA 2JULA 1ODBA 2LCPA 1HQVA 2L4HA 3TDUA 2DOQA 4USLA 1VRKA 4HREE 2BCAA 1ZOTB 1NCYA 3O78A 3BQ3A 2GGMA 1FF1A 1A2XA 1G4YR 3A4UB 4MN0A 3CLNA 1SR6B 2ZRSA 1YUSA 2M7NA 3O2PA 1B1GA 2K2AA 3TUYB 1S5GY 4UPGA 3BOWA 2KDHA 3FS7A 1QXPA 1EH2A 1XVJA 3SG6A 1IQ3A 1XFXO 3I5HB 3SJSA 1OMRA 1RK9A 1YUTA 2E30A 3FWBA 2KGBC 1CFPA 4OCIA 2HETA 1DVIA 1UP5A 1UWOA 2QPTA 3GK2A 1MF8B 2LM5A 2WNDA 1AJ4A 1R2UA 1TNWA 2PRUA 4CFRA 5CPVA 1S26D 2CCMA 2BL0C 1CDPA 2SCPA 1S36A 2HQ8A 3PATA 3OB1B 1DT7B 5KSZA 2WORA 2LUCA 2OS8C 1BR1B 2LANA 1FI6A 1UHJA 1LINA 2BKHB 3F45A 2LNKA 1K95A 2M8UA 1R6PA 3AKAA 1Y1AA 2ZKMX 4YI9A 2KQYA 1SCMB 1KQMB 2BE6A 4PHMA 1M63B 2LMVA 1A03A 1XFZO 2M9GA 1KFUL 1IGVA 2JT8A 1Y6WA 1K8UA 1XFYO 3IQOA 5PALA 5AANA 1ALVA 4GAOA 1JBAA 5HLVA 4AQJA 3CZTX 5TNCA 2LVJA 1HT9A 3IQQA 4PE0A 1JSAA 1DGUA 1UUSA 1WLZA 4OR9B 2M97A 2FCEA 1DTLA 2G9BA 2LP3A 1S5GZ 1TCOB 2BECA 1V1GA 3A8RA 3NSIA 2BBMA 2E6WA 2F2PA 2MLFC 3RM1A 1IG5A 3EK8A 2Y5IA 2KI4C 3EK7A 1MQ1A 4PALA 4MSPA 1AJ5A 1C7WA 1L2OB 4DUQA 4CIDA 2CNPA 3D0YB 2EC6C 2MBXA 1WRKA 1YX8A 4HRHA 1JUOA 3D10A 1OOJA 2NXQA 5AXIA 1SRAA 4E68A 1DJIA 1NX2A 1XK4A 3OP0A 1K90D 1OMDA 5HLOA 2JXLA 3ZNIA 4I5KA 4I5JA 1NCZA 3PALA 4WRIA 1IH0A 3TUYC 1B8LA 1QVIY 1SL9A 3D0YA 1DJXA 3I5IB 4XJKB 2HF5A 2I7AA 1S6CA 3RLZA 5ER5A 4NDDA 2K8MB 2L98A 3DF0A 5J3XA 1LVCD 4PHJA 4ORAB 1SPYA 2MAZA 4GUKA 4P2YB 1WDCC 5I8NA 4MLWA 1FW4A 1Y0VH 4ORCB 2LMTA 1TOPA 1NX1A 4I5LB 2K61A 3DVMA 3VRNA 5F6TA 2KHNA 1GQMA 3ICBA 1QLKA 1TNXA 2HQWA 5KTYA 3PSRA 1SY9A 2L0PA 2TN4A 1QIWA 2ZFDA 2M3WA 4U8DA 1XFVO 2LVVA 3BUOB 1QS7A 1UHNA 1S6IA 1XA5A 3KHEA 2L50A 4MZLA 1ZMZA 3EVUA 4GPLB 4GNKB 4PE4A 1F71A 2K7DA 2KBIA 1KFXS 1DGVA 1KK8C 1NX0A 2K7OA 2FJUB 1MR8A 2JRFA 5B8IB 5I2LA 2K2FA 4WQ2A 4PDZA 2M49B 4C0LA 1TCFA 1F55A 1H4BA 1J1EA 1OQPA 1UURA 2F33A 2L51A 1MHOA 1W7IB 1KWOC 2I18A 1Y1XA 1ZUZA 3LK1A 1KSMA 4M2QA 1FPWA 3FIAA 2KNEA 2MLEC 3WHUB 5FYXA 1B8CA 1OZSA 1IJ6A 1M46A 2KI4B 2F2OA 2LV7A 3BUNB 1TRFA 4F0ZB 3AKBA 1CFFA 1QLSA 5JOLA 1QX2A 5DKNA 4JWQA 1BR4B 1PALA 2LAPA 2M0RA 1OZOA 3K21A 4DS7A 4CLNA 1TNPA 1JF2A 2CT9A 1CDNA 1RROA 3EKHA 2H2KA 1QX7A 1D1OA 3O4YA 1EG4A 1GJYA 1QV0A 1X02A 4PCWA 4M2OA 2M29A 1QIVA 5AEQA 2JU0A 1EXRA 2IS9A 2ISDA 1G33A 5I2OA 1CDMA 2LLSA 1BG1A 2GGZA 2WCFA 1WRLA 3DVJA 3TS5B 1PVBA 1QVIZ 2JZIA 2JTTA 2BE4A 3FWCA 4MZJA 3PFVA 4A4BA 1FBVA 1PK0D 4AOMA 1A29A 1XO5A 1RWYA
chains in the Genus database with same CATH superfamily
4P5OE 1NX3A 2BKIB 1FI5A 2Y4QA 1GGZA 2BCBA 5FI2A 3NGVA 1YUUA 1IQ5A 3BUMB 3NHIA 5D69A 3S0FA 2HPSA 1UHKA 2KOTA 4KYNA 3NSLA 1N2DA 1XFWO 1N0YA 1F4QA 2RGIA 2LLUA 1K96A 2MHHA 1UHHA 2LE9B 1SMGA 1A4PA 2K7CA 2WC5A 2L2CA 3CWGA 3C1VA 3KEVA 4L9MA 1YURA 1DJGA 1AVSA 4ICBA 1JFKA 1K2HA 2PMYA 2LC5A 3BXKA 4YGEB 3JVTB 1CLBA 3SG5A 2QEBA 4JQ0D 4HRGA 4FTGA 1M39A 1KQVA 1XK4C 1NPQA 3KF9A 1YVHA 4GGNA 1CTRA 5DKQA 1KK7Y 1WDCB 2JPTA 3WHTB 3GOFA 4TNCA 3N7HA 3VGOA 1A75A 1DQEA 1QJTA 1RTP1 5ER4X 1CFCA 3SIBA 1B7TZ 2JNXA 1XYDA 4ZCUA 1KSOA 2KYCA 3BUWB 1YRTB 2MRDA 3KO0A 3NSOA 4YGAA 4DRWA 3I5FB 2OPOA 4C0JA 3QMEA 4PHKA 3ZWHA 2Y1NA 3Q8IA 2BCXA 4OV2A 4PHNA 1SL7A 3NXAA 1XFUO 1MUXA 3CR2A 2B1UA 3IF7A 1QATA 3JTDC 3OX6A 5D3OA 3UNWA 2F3ZA 5I2QA 2CTNA 2NLNA 3CR5X 2FOTA 5HKZA 4PT1A 3SG7A 2MA2A 2KPHA 2JT0A 1CFDA 2WCLA 3PLFB 4XJKA 1C07A 2KLDA 1TIZA 2PYQA 1DF0A 1KQMC 3VRQA 2COLB 2JWWA 1J7QA 1PULA 1U5IB 3CGAA 2LVIA 2WCMA 1ALWA 2LVKA 1QTXA 3BFBA 2LHIA 1S1EA 4Q04A 2O60A 1F54A 2D8NA 4MVFA 3I5FC 1YR5A 1DELA 3CS1A 3I5GC 1PSRA 1BF5A 1SBJA 1RJVA 3L4LA 3SG4A 4YBHB 1J7RA 2Q91A 4ETOA 4GGFA 3VROA 2LLTA 1TTXA 3DD4A 1JWDA 3R1VA 4IL1A 3SS3A 2LMUA 2JXCA 3OHMB 3AAJA 1F70A 4YGBB 2OTGB 4MZKA 2WCEA 3LCPC 3I5GB 3I5HC 5CSFA 2JOJA 2AUCA 1SSEB 1S3PA 4BY4A 3VRRA 3JVTC 1K9PA 2G2BA 4YRUA 2NZ0A 3SG2A 3AAKA 2WC8A 1NCXA 2L2EA 2M1KB 1PRWA 4DCKA 4C0KA 1BT6A 2ZRTA 3LL8B 5AERA 3VRPA 1CDLA 1F4OA 1RFJA 1L2OC 3S0DA 1NIWA 2BL0B 2FCDA 4DIRA 2I2RE 1BODA 3O6BA 3EVVA 1J7OA 1S6JA 2ZN9A 4ORBB 3DY9A 3NHTA 2ZNEA 2LHLA 1AHRA 5EL2A 4CPVA 1WY9A 3B86A 1L7ZA 4PE7A 1NUBA 3OX5A 2PVBA 3SG3A 1DJHA 3SIAA 1E8AA 1DMOA 1H8BA 2QACA 4MRYA 4R1EA 1QX5B 3TZ1A 2Q4UA 1J1DA 1IIOA 4FQOA 1BMOA 1NP8A 1TN4A 3BOWB 1NSHA 4NQGA 3CYZA 5HKWA 1SCVA 2JTZA 2BBNA 1CNPA 4PE1A 3CZ2A 1JF0A 2KSPA 1YRUB 1IKUA 1DJYA 1CKKA 2JQ6A 1W7JB 2QEVA 3B7AA 1TUJA 1B9AA 3CR4X 3S0AA 1WRZA 2ISDA 1A75B 3PN7C 5BPJA 1K9UA 1PVAA 5G08A 1SYMA 3WXAA 2I94A 2EC6B 3D76A 2KFFA 4A4CA 4CFQA 1V1FA 2KBMA 2M1UA 1MWNA 2KFHA 4YI8A 2SASA 2EGDA 2LUXA 1M45A 2OS8B 3DYEA 4QJ5B 1BJFA 2KGRA 1EG3A 1K9KA 1KK8B 2CXJA 1LA3A 3EVRA 3GK1A 3WNXB 4BY5A 1SR6C 2KAXA 1SW8A 2CBLA 2ERBA 1B8RA 1LKJA 3BYAA 3S0EA 5JJGA 1SCMC 3L47A 5KU1A 1AP4A 4QJ3B 2WOSA 1K94A 5IBWA 2M7LA 3DVEA 1OOFA 1B4CA 1XFRA 1CM1A 3VB1A 1KK7Z 1IRJA 1SKTA 1N65A 4MRXA 1CLLA 3K1EA 3MSEB 1B7TY 3PM8A 2ZNDA 3DXLA 2GV5A 1WLMA 1YTZC 2PALA 3CTNA 1B47A 3HX4A 1U5IA 4M2PA 1SNLA 1YVLA 4MBEA 1IWQA 2KAYA 2KLEA 4I5NB 1BOCA 4INXA 2PASA 1MXEA 4OKHA 1Y1UA 3E3RA 5CSIA 4GBAA 2JT3A 4YGCB 1QASA 2V53A 4ZCVA 2OTGC 1M31A 1OE9B 2MJWB 2L5YA 2JC2A 5CSNA 1TWOA 2F8PA 4NDBA 3D75A 4AQIA 2GTEA 2NCOA 1UHIA 4N1GA 1EJ3A 5AFPA 1LS8A 2P71A 1YX7A 5GQQC 3RZSA 1LA0A 3NSKA 3H4SE 2AAOA 3OGNA 5HKYA 4MEWA 1LXFC 3TDIA 2WCBA 1CMGA 1ORGA 3PN7B 2WC6A 1C7VA 1DF0B 1OSAA 4OVNF 1DJZA 2O5GA 3LLEA 3S0GA 2Y1MA 1DJWA 4N5XA 4XYNA 1QWVA 1JFJA 5DKRA 2KAVA 2P6BB 1KFXL 3BUXB 3EK4A 3OB2B 4JPZB 1BLQA 4JD9A 4GGFC 4GFTA 1K93D 1CB1A 1AK8A 1BU3A 1ZFSA 2KI6D 2ZN8A 1J7PA 2VRGA 3L4AA 2L5XB 3HCMA 2WCJA 4YGDB 1NWDA 3BJHA 3DF0B 1OMVA 1MXLC 3KPXA 2JNFA 1EL4A 1QV1A 2F3YA 2H61A 2NCPA 2LP2A 3DVKA 2KQ6A 2EHBA 2R2IA 1CMFA 2KYFA 3GK4X 1DEKA 1PSBA 3I5IC 1KCYA 1SL8A 1AUIB 3TS5C 1RECA 5CSJA 1F8HA 2KI6C 2KFGA 3JTDB 2K7BA 1ZACA 3O4XA 4NDCA 4D1EA 5D7FA 2H61C 1CLMA 3CZ1A 3PJIA 1Q80A 1JC2A 3DZTA 1CM4A 1KWOB 1GGWA 1IJ5A 3M0WA 5K89A 2AMIA 3TDZA 3LK0A 1G8IA 1W9ZA 1SK6D 3EKJA 4HSZA 4WQ3A 5HYDA 1KFUS 2L4IA 1J55A 4N1FA 4IJ7A 1OW4A 1TNQA 2K60A 2PSRA 3QRXA 2K0JA 1NYAA 2A4JA 2JULA 1ODBA 2LCPA 1HQVA 2L4HA 3TDUA 2DOQA 4USLA 1VRKA 4HREE 2BCAA 1ZOTB 1NCYA 5DICA 3O78A 2FJYA 3BQ3A 3PM2A 2GGMA 1FF1A 3R72A 1A2XA 1G4YR 3A4UB 4MN0A 3CLNA 1OOIX 1SR6B 2ZRSA 3D77A 1YUSA 1Z2CB 2M7NA 3O2PA 1TUZA 1B1GA 4FQTA 2K2AA 3TUYB 1S5GY 4UPGA 3BOWA 2YGUA 2KDHA 3FS7A 1QXPA 1EH2A 1XVJA 3SG6A 1IQ3A 3B87A 1XFXO 3I5HB 3SJSA 1OMRA 1RK9A 1YUTA 2E30A 3FWBA 2KGBC 1CFPA 4OCIA 2HETA 3BFHA 1DVIA 1UP5A 1UWOA 2QPTA 3GK2A 1MF8B 2LM5A 2WNDA 1AJ4A 1R2UA 1TNWA 2PRUA 4CFRA 5CPVA 1S26D 1T14A 2CCMA 2BL0C 1CDPA 2SCPA 1S36A 2HQ8A 3PATA 3OB1B 1DT7B 5KSZA 2WORA 2WCHA 2LUCA 2OS8C 1BR1B 2LANA 1FI6A 1UHJA 1LINA 2BKHB 3F45A 2LNKA 1K95A 2M8UA 1R6PA 3AKAA 1Y1AA 2ZKMX 4YI9A 2KQYA 1SCMB 4F7FA 1KQMB 2BE6A 4PHMA 1M63B 2LMVA 1A03A 1XFZO 2M9GA 1KFUL 1IGVA 2BNXA 2JT8A 1Y6WA 1K8UA 1XFYO 3IQOA 1C3YA 5PALA 5AANA 1ALVA 4GAOA 1JBAA 5HLVA 3BFAA 3CZTX 4AQJA 5TNCA 2LVJA 3R1PA 1HT9A 3IQQA 4INWA 4PE0A 1JSAA 1DGUA 1UUSA 1WLZA 3EG5B 4OR9B 2M97A 2FCEA 1DTLA 2G9BA 2LP3A 3D74A 1S5GZ 1TCOB 2BECA 1V1GA 3A8RA 3NSIA 2BBMA 2E6WA 2F2PA 2MLFC 3RM1A 1IG5A 2QDIA 3EK8A 4QJ4B 2Y5IA 2KI4C 3EK7A 1MQ1A 4PALA 4MSPA 1AJ5A 1C7WA 1L2OB 4DUQA 4CIDA 2CNPA 3D0YB 2BAPA 2EC6C 2MBXA 1WRKA 1YX8A 4HRHA 1JUOA 3D10A 1OOJA 2NXQA 3FE8A 1SRAA 5AXIA 4E68A 3IVTA 3D73A 1DJIA 1NX2A 1XK4A 3OP0A 1K90D 1OMDA 5HLOA 2JXLA 3ZNIA 4I5KA 4I5JA 3V2LA 1NCZA 3PALA 4WRIA 3UO9A 3TUYC 1IH0A 1B8LA 1QVIY 1SL9A 3D0YA 1C3ZA 3R1OA 1DJXA 3I5IB 4XJKB 2HF5A 2I7AA 1S6CA 3RLZA 5ER5A 2H8VA 2K8MB 4NDDA 2L98A 3B6XA 3DF0A 5J3XA 1LVCD 4PHJA 4ORAB 1SPYA 2MAZA 4GUKA 4P2YB 1WDCC 3OBVA 5FI7A 4MLWA 5I8NA 1FW4A 1Y0VH 4ORCB 2LMTA 3D78A 1TOPA 3CABA 1NX1A 4I5LB 2K61A 3DVMA 3VRNA 3B88A 1GM0A 5F6TA 2KHNA 1DC1A 1GQMA 3ICBA 1QLKA 4OZDA 2P70A 1TNXA 2HQWA 5KTYA 3PSRA 1SY9A 2L0PA 2TN4A 1QIWA 2ZFDA 2M3WA 4U8DA 1XFVO 2LVVA 3CDNA 3BUOB 1QS7A 1UHNA 1S6IA 5HL1A 5FI6A 1XA5A 3KHEA 1OOHA 2L50A 1ZMZA 3EVUA 4GPLB 4GNKB 4MZLA 4PE4A 3SS5A 1F71A 2K7DA 2KBIA 2WCKA 1KFXS 1DGVA 1KK8C 1NX0A 2K7OA 2FJUB 1MR8A 2JRFA 5B8IB 5I2LA 2K2FA 4WQ2A 4PDZA 2M49B 4C0LA 1TCFA 1Z4HA 1F55A 1H4BA 1J1EA 1OQPA 1UURA 2F33A 2L51A 1MHOA 1W7IB 1KWOC 1Y1XA 1ZUZA 2I18A 3CZ0A 1KSMA 3LK1A 4M2QA 1FPWA 3FIAA 2KNEA 2MLEC 3WHUB 5FYXA 1B8CA 1OZSA 1IJ6A 1M46A 2KI4B 2F2OA 2LV7A 3BUNB 1TRFA 4F0ZB 3AKBA 1CFFA 1QLSA 5JOLA 1QX2A 5DKNA 4JWQA 1BR4B 1PALA 2LAPA 2M0RA 1OZOA 3K21A 4DS7A 4CLNA 1TNPA 1JF2A 3SS4A 2CT9A 5I94A 1CDNA 2JPOA 1RROA 3EKHA 2H2KA 1QX7A 1D1OA 3O4YA 1EG4A 1GJYA 1QV0A 4JKTA 3FE9A 1X02A 4PCWA 4M2OA 2M29A 1QIVA 5AEQA 2JU0A 1EXRA 2IS9A 3FE6A 1G33A 2QEHA 1CDMA 1P28A 2LLSA 2GGZA 5I2OA 2WCFA 1BG1A 1WRLA 2PQLA 1OOGA 3DVJA 2QEOA 3S0BA 3TS5B 1PVBA 1QVIZ 2JZIA 2JTTA 2BE4A 3FWCA 4MZJA 3PFVA 4A4BA 1FBVA 1PK0D 4AOMA 1A29A 1XO5A 1RWYA
chains in the Genus database with same CATH topology
4P5OE 1NX3A 2BKIB 1FI5A 2Y4QA 1GGZA 2BCBA 1YUUA 1IQ5A 3BUMB 5D69A 2HPSA 1UHKA 2KOTA 3NSLA 1N2DA 1XFWO 1N0YA 1F4QA 2RGIA 2LLUA 1K96A 2MHHA 1UHHA 2LE9B 1SMGA 1A4PA 2K7CA 3CWGA 4L9MA 3KEVA 3C1VA 1YURA 1DJGA 1AVSA 4ICBA 1JFKA 1K2HA 2PMYA 2LC5A 3BXKA 4YGEB 3JVTB 1CLBA 3SG5A 4JQ0D 4HRGA 4FTGA 1M39A 1KQVA 1XK4C 1NPQA 3KF9A 1YVHA 4GGNA 1CTRA 5DKQA 1KK7Y 1WDCB 2JPTA 3WHTB 3GOFA 4TNCA 3VGOA 1A75A 1QJTA 5ER4X 1RTP1 1CFCA 3SIBA 1B7TZ 2JNXA 1XYDA 4ZCUA 1KSOA 2KYCA 3BUWB 1YRTB 2MRDA 3KO0A 3NSOA 4YGAA 4DRWA 3I5FB 2OPOA 4C0JA 4PHKA 3ZWHA 2Y1NA 2BCXA 4OV2A 4PHNA 1SL7A 3NXAA 1XFUO 1MUXA 3CR2A 2B1UA 3IF7A 1QATA 3JTDC 3OX6A 2F3ZA 5I2QA 2CTNA 2NLNA 3CR5X 2FOTA 5HKZA 3SG7A 2MA2A 1C07A 2JT0A 1CFDA 3PLFB 4XJKA 1TIZA 1DF0A 1KQMC 3VRQA 2COLB 2JWWA 1J7QA 1PULA 1U5IB 3CGAA 2LVIA 1ALWA 2LVKA 1QTXA 2LHIA 1S1EA 4Q04A 2O60A 1F54A 2D8NA 4MVFA 3I5FC 1YR5A 3CS1A 3I5GC 1PSRA 1BF5A 1SBJA 1RJVA 3SG4A 4YBHB 1J7RA 2Q91A 4ETOA 4GGFA 3VROA 2LLTA 1TTXA 3DD4A 1JWDA 4IL1A 2LMUA 2JXCA 3OHMB 3AAJA 1F70A 4YGBB 2OTGB 4MZKA 2WCEA 3LCPC 3I5GB 3I5HC 5CSFA 2JOJA 2AUCA 1S3PA 4BY4A 3VRRA 3JVTC 1K9PA 2G2BA 4YRUA 2NZ0A 3SG2A 3AAKA 2WC8A 1NCXA 2L2EA 2M1KB 1PRWA 4DCKA 4C0KA 1BT6A 2ZRTA 3LL8B 5AERA 3VRPA 1CDLA 1F4OA 1RFJA 1L2OC 4QJ4B 1NIWA 2BL0B 2FCDA 4DIRA 2I2RE 1BODA 3O6BA 3EVVA 1J7OA 1S6JA 2ZN9A 4ORBB 2ZNEA 2LHLA 1AHRA 4CPVA 1WY9A 1L7ZA 4PE7A 1NUBA 3OX5A 2PVBA 3SG3A 1DJHA 3SIAA 1E8AA 1DMOA 1H8BA 2QACA 4MRYA 4R1EA 1QX5B 3TZ1A 2Q4UA 1J1DA 4FQOA 1BMOA 1NP8A 1TN4A 3BOWB 1NSHA 4NQGA 5HKWA 1SCVA 2JTZA 2BBNA 1CNPA 4PE1A 1JF0A 2KSPA 1YRUB 1IKUA 1DJYA 1CKKA 2JQ6A 1W7JB 3CR4X 1B9AA 1WRZA 1A75B 3PN7C 5BPJA 1K9UA 1PVAA 5G08A 1SYMA 3WXAA 2I94A 2EC6B 2KFFA 4A4CA 4CFQA 1V1FA 2KBMA 2M1UA 1MWNA 2KFHA 4YI8A 2SASA 2EGDA 2LUXA 1M45A 2OS8B 4QJ5B 1BJFA 2KGRA 1EG3A 1K9KA 1KK8B 2CXJA 1LA3A 3EVRA 3GK1A 3WNXB 4BY5A 1SR6C 2KAXA 1SW8A 2CBLA 1B8RA 1LKJA 3BYAA 5JJGA 1SCMC 5KU1A 1AP4A 4QJ3B 2WOSA 1K94A 5IBWA 2M7LA 3DVEA 1B4CA 1CM1A 1KK7Z 1IRJA 1SKTA 1N65A 4MRXA 1CLLA 3PM8A 3MSEB 1B7TY 2ZNDA 2GV5A 1WLMA 1YTZC 2PALA 3CTNA 1B47A 3HX4A 1U5IA 4M2PA 1SNLA 1YVLA 4MBEA 1IWQA 2KAYA 4I5NB 1BOCA 2PASA 1MXEA 4OKHA 1Y1UA 3E3RA 5CSIA 4GBAA 2JT3A 4YGCB 1QASA 2V53A 4ZCVA 2OTGC 1M31A 1OE9B 2MJWB 2JC2A 5CSNA 2F8PA 4NDBA 4AQIA 2NCOA 1UHIA 4N1GA 1EJ3A 5AFPA 1YX7A 5GQQC 1LA0A 3NSKA 3H4SE 2AAOA 5HKYA 4MEWA 1LXFC 3TDIA 2WCBA 1CMGA 3PN7B 1C7VA 1DF0B 1OSAA 4OVNF 1DJZA 2O5GA 3LLEA 2Y1MA 1DJWA 4N5XA 4XYNA 1JFJA 5DKRA 2KAVA 2P6BB 1KFXL 3BUXB 3EK4A 3OB2B 4JPZB 1BLQA 4GGFC 4GFTA 1K93D 1CB1A 1AK8A 1BU3A 1ZFSA 2KI6D 2ZN8A 1J7PA 2VRGA 2L5XB 3HCMA 4YGDB 1NWDA 3DF0B 1OMVA 1MXLC 3KPXA 2JNFA 1EL4A 1QV1A 2F3YA 2H61A 2NCPA 2LP2A 3DVKA 2KQ6A 2EHBA 2R2IA 1CMFA 2KYFA 3GK4X 1PSBA 3I5IC 1KCYA 1SL8A 1AUIB 3TS5C 1RECA 5CSJA 1F8HA 2KI6C 2KFGA 3JTDB 2K7BA 1ZACA 4NDCA 4D1EA 5D7FA 2H61C 1CLMA 1Q80A 1JC2A 1CM4A 1KWOB 1GGWA 1IJ5A 3M0WA 5K89A 2AMIA 3TDZA 3LK0A 1G8IA 3EKJA 1SK6D 4WQ3A 4HSZA 5HYDA 1KFUS 2L4IA 1J55A 4N1FA 1TNQA 3QRXA 2PSRA 2K0JA 1NYAA 2A4JA 2JULA 1ODBA 2LCPA 1HQVA 2L4HA 3TDUA 2DOQA 4USLA 1VRKA 4HREE 2BCAA 1ZOTB 1NCYA 3O78A 3BQ3A 2GGMA 1FF1A 1A2XA 1G4YR 3A4UB 4MN0A 3CLNA 1SR6B 2ZRSA 1YUSA 2M7NA 3O2PA 1B1GA 2K2AA 3TUYB 1S5GY 4UPGA 3BOWA 2KDHA 3FS7A 1QXPA 1EH2A 1XVJA 3SG6A 1IQ3A 1XFXO 3I5HB 3SJSA 1OMRA 1RK9A 1YUTA 2E30A 3FWBA 2KGBC 1CFPA 4OCIA 2HETA 1DVIA 1UP5A 1UWOA 2QPTA 3GK2A 1MF8B 2LM5A 2WNDA 1AJ4A 1R2UA 1TNWA 2PRUA 4CFRA 5CPVA 1S26D 2CCMA 2BL0C 1CDPA 2SCPA 1S36A 2HQ8A 3PATA 3OB1B 1DT7B 5KSZA 2WORA 2LUCA 2OS8C 1BR1B 2LANA 1FI6A 1UHJA 1LINA 2BKHB 3F45A 2LNKA 1K95A 2M8UA 1R6PA 3AKAA 1Y1AA 2ZKMX 4YI9A 2KQYA 1SCMB 1KQMB 2BE6A 4PHMA 1M63B 2LMVA 1A03A 1XFZO 2M9GA 1KFUL 1IGVA 2JT8A 1Y6WA 1K8UA 1XFYO 3IQOA 5PALA 5AANA 1ALVA 4GAOA 1JBAA 5HLVA 4AQJA 3CZTX 5TNCA 2LVJA 1HT9A 3IQQA 4PE0A 1JSAA 1DGUA 1UUSA 1WLZA 4OR9B 2M97A 2FCEA 1DTLA 2G9BA 2LP3A 1S5GZ 1TCOB 2BECA 1V1GA 3A8RA 3NSIA 2BBMA 2E6WA 2F2PA 2MLFC 3RM1A 1IG5A 3EK8A 2Y5IA 2KI4C 3EK7A 1MQ1A 4PALA 4MSPA 1AJ5A 1C7WA 1L2OB 4DUQA 4CIDA 2CNPA 3D0YB 2EC6C 2MBXA 1WRKA 1YX8A 4HRHA 1JUOA 3D10A 1OOJA 2NXQA 5AXIA 1SRAA 4E68A 1DJIA 1NX2A 1XK4A 3OP0A 1K90D 1OMDA 5HLOA 2JXLA 3ZNIA 4I5KA 4I5JA 1NCZA 3PALA 4WRIA 1IH0A 3TUYC 1B8LA 1QVIY 1SL9A 3D0YA 1DJXA 3I5IB 4XJKB 2HF5A 2I7AA 1S6CA 3RLZA 5ER5A 4NDDA 2K8MB 2L98A 3DF0A 5J3XA 1LVCD 4PHJA 4ORAB 1SPYA 2MAZA 4GUKA 4P2YB 1WDCC 5I8NA 4MLWA 1FW4A 1Y0VH 4ORCB 2LMTA 1TOPA 1NX1A 4I5LB 2K61A 3DVMA 3VRNA 5F6TA 2KHNA 1GQMA 3ICBA 1QLKA 1TNXA 2HQWA 5KTYA 3PSRA 1SY9A 2L0PA 2TN4A 1QIWA 2ZFDA 2M3WA 4U8DA 1XFVO 2LVVA 3BUOB 1QS7A 1UHNA 1S6IA 1XA5A 3KHEA 2L50A 4MZLA 1ZMZA 3EVUA 4GPLB 4GNKB 4PE4A 1F71A 2K7DA 2KBIA 1KFXS 1DGVA 1KK8C 1NX0A 2K7OA 2FJUB 1MR8A 2JRFA 5B8IB 5I2LA 2K2FA 4WQ2A 4PDZA 2M49B 4C0LA 1TCFA 1F55A 1H4BA 1J1EA 1OQPA 1UURA 2F33A 2L51A 1MHOA 1W7IB 1KWOC 2I18A 1Y1XA 1ZUZA 3LK1A 1KSMA 4M2QA 1FPWA 3FIAA 2KNEA 2MLEC 3WHUB 5FYXA 1B8CA 1OZSA 1IJ6A 1M46A 2KI4B 2F2OA 2LV7A 3BUNB 1TRFA 4F0ZB 3AKBA 1CFFA 1QLSA 5JOLA 1QX2A 5DKNA 4JWQA 1BR4B 1PALA 2LAPA 2M0RA 1OZOA 3K21A 4DS7A 4CLNA 1TNPA 1JF2A 2CT9A 1CDNA 1RROA 3EKHA 2H2KA 1QX7A 1D1OA 3O4YA 1EG4A 1GJYA 1QV0A 1X02A 4PCWA 4M2OA 2M29A 1QIVA 5AEQA 2JU0A 1EXRA 2IS9A 2ISDA 1G33A 5I2OA 1CDMA 2LLSA 1BG1A 2GGZA 2WCFA 1WRLA 3DVJA 3TS5B 1PVBA 1QVIZ 2JZIA 2JTTA 2BE4A 3FWCA 4MZJA 3PFVA 4A4BA 1FBVA 1PK0D 4AOMA 1A29A 1XO5A 1RWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O E;  1NX3 A;  2BKI B;  1FI5 A;  2Y4Q A;  1GGZ A;  2BCB A;  1YUU A;  1IQ5 A;  3BUM B;  5D69 A;  2HPS A;  1UHK A;  2KOT A;  3NSL A;  1N2D A;  1XFW O;  1N0Y A;  1F4Q A;  2RGI A;  2LLU A;  1K96 A;  2MHH A;  1UHH A;  2LE9 B;  1SMG A;  1A4P A;  2K7C A;  3CWG A;  4L9M A;  3KEV A;  3C1V A;  1YUR A;  1DJG A;  1AVS A;  4ICB A;  1JFK A;  1K2H A;  2PMY A;  2LC5 A;  3BXK A;  4YGE B;  3JVT B;  1CLB A;  3SG5 A;  4JQ0 D;  4HRG A;  4FTG A;  1M39 A;  1KQV A;  1XK4 C;  1NPQ A;  3KF9 A;  1YVH A;  4GGN A;  1CTR A;  5DKQ A;  1KK7 Y;  1WDC B;  2JPT A;  3WHT B;  3GOF A;  4TNC A;  3VGO A;  1A75 A;  1QJT A;  5ER4 X;  1RTP 1;  1CFC A;  3SIB A;  1B7T Z;  2JNX A;  1XYD A;  4ZCU A;  1KSO A;  2KYC A;  3BUW B;  1YRT B;  2MRD A;  3KO0 A;  3NSO A;  4YGA A;  4DRW A;  3I5F B;  2OPO A;  4C0J A;  4PHK A;  3ZWH A;  2Y1N A;  2BCX A;  4OV2 A;  4PHN A;  1SL7 A;  3NXA A;  1XFU O;  1MUX A;  3CR2 A;  2B1U A;  3IF7 A;  1QAT A;  3JTD C;  3OX6 A;  2F3Z A;  5I2Q A;  2CTN A;  2NLN A;  3CR5 X;  2FOT A;  5HKZ A;  3SG7 A;  2MA2 A;  1C07 A;  2JT0 A;  1CFD A;  3PLF B;  4XJK A;  1TIZ A;  1DF0 A;  1KQM C;  3VRQ A;  2COL B;  2JWW A;  1J7Q A;  1PUL A;  1U5I B;  3CGA A;  2LVI A;  1ALW A;  2LVK A;  1QTX A;  2LHI A;  1S1E A;  4Q04 A;  2O60 A;  1F54 A;  2D8N A;  4MVF A;  3I5F C;  1YR5 A;  3CS1 A;  3I5G C;  1PSR A;  1BF5 A;  1SBJ A;  1RJV A;  3SG4 A;  4YBH B;  1J7R A;  2Q91 A;  4ETO A;  4GGF A;  3VRO A;  2LLT A;  1TTX A;  3DD4 A;  1JWD A;  4IL1 A;  2LMU A;  2JXC A;  3OHM B;  3AAJ A;  1F70 A;  4YGB B;  2OTG B;  4MZK A;  2WCE A;  3LCP C;  3I5G B;  3I5H C;  5CSF A;  2JOJ A;  2AUC A;  1S3P A;  4BY4 A;  3VRR A;  3JVT C;  1K9P A;  2G2B A;  4YRU A;  2NZ0 A;  3SG2 A;  3AAK A;  2WC8 A;  1NCX A;  2L2E A;  2M1K B;  1PRW A;  4DCK A;  4C0K A;  1BT6 A;  2ZRT A;  3LL8 B;  5AER A;  3VRP A;  1CDL A;  1F4O A;  1RFJ A;  1L2O C;  4QJ4 B;  1NIW A;  2BL0 B;  2FCD A;  4DIR A;  2I2R E;  1BOD A;  3O6B A;  3EVV A;  1J7O A;  1S6J A;  2ZN9 A;  4ORB B;  2ZNE A;  2LHL A;  1AHR A;  4CPV A;  1WY9 A;  1L7Z A;  4PE7 A;  1NUB A;  3OX5 A;  2PVB A;  3SG3 A;  1DJH A;  3SIA A;  1E8A A;  1DMO A;  1H8B A;  2QAC A;  4MRY A;  4R1E A;  1QX5 B;  3TZ1 A;  2Q4U A;  1J1D A;  4FQO A;  1BMO A;  1NP8 A;  1TN4 A;  3BOW B;  1NSH A;  4NQG A;  5HKW A;  1SCV A;  2JTZ A;  2BBN A;  1CNP A;  4PE1 A;  1JF0 A;  2KSP A;  1YRU B;  1IKU A;  1DJY A;  1CKK A;  2JQ6 A;  1W7J B;  3CR4 X;  1B9A A;  1WRZ A;  1A75 B;  3PN7 C;  5BPJ A;  1K9U A;  1PVA A;  5G08 A;  1SYM A;  3WXA A;  2I94 A;  2EC6 B;  2KFF A;  4A4C A;  4CFQ A;  1V1F A;  2KBM A;  2M1U A;  1MWN A;  2KFH A;  4YI8 A;  2SAS A;  2EGD A;  2LUX A;  1M45 A;  2OS8 B;  4QJ5 B;  1BJF A;  2KGR A;  1EG3 A;  1K9K A;  1KK8 B;  2CXJ A;  1LA3 A;  3EVR A;  3GK1 A;  3WNX B;  4BY5 A;  1SR6 C;  2KAX A;  1SW8 A;  2CBL A;  1B8R A;  1LKJ A;  3BYA A;  5JJG A;  1SCM C;  5KU1 A;  1AP4 A;  4QJ3 B;  2WOS A;  1K94 A;  5IBW A;  2M7L A;  3DVE A;  1B4C A;  1CM1 A;  1KK7 Z;  1IRJ A;  1SKT A;  1N65 A;  4MRX A;  1CLL A;  3PM8 A;  3MSE B;  1B7T Y;  2ZND A;  2GV5 A;  1WLM A;  1YTZ C;  2PAL A;  3CTN A;  1B47 A;  3HX4 A;  1U5I A;  4M2P A;  1SNL A;  1YVL A;  4MBE A;  1IWQ A;  2KAY A;  4I5N B;  1BOC A;  2PAS A;  1MXE A;  4OKH A;  1Y1U A;  3E3R A;  5CSI A;  4GBA A;  2JT3 A;  4YGC B;  1QAS A;  2V53 A;  4ZCV A;  2OTG C;  1M31 A;  1OE9 B;  2MJW B;  2JC2 A;  5CSN A;  2F8P A;  4NDB A;  4AQI A;  2NCO A;  1UHI A;  4N1G A;  1EJ3 A;  5AFP A;  1YX7 A;  5GQQ C;  1LA0 A;  3NSK A;  3H4S E;  2AAO A;  5HKY A;  4MEW A;  1LXF C;  3TDI A;  2WCB A;  1CMG A;  3PN7 B;  1C7V A;  1DF0 B;  1OSA A;  4OVN F;  1DJZ A;  2O5G A;  3LLE A;  2Y1M A;  1DJW A;  4N5X A;  4XYN A;  1JFJ A;  5DKR A;  2KAV A;  2P6B B;  1KFX L;  3BUX B;  3EK4 A;  3OB2 B;  4JPZ B;  1BLQ A;  4GGF C;  4GFT A;  1K93 D;  1CB1 A;  1AK8 A;  1BU3 A;  1ZFS A;  2KI6 D;  2ZN8 A;  1J7P A;  2VRG A;  2L5X B;  3HCM A;  4YGD B;  1NWD A;  3DF0 B;  1OMV A;  1MXL C;  3KPX A;  2JNF A;  1EL4 A;  1QV1 A;  2F3Y A;  2H61 A;  2NCP A;  2LP2 A;  3DVK A;  2KQ6 A;  2EHB A;  2R2I A;  1CMF A;  2KYF A;  3GK4 X;  1PSB A;  3I5I C;  1KCY A;  1SL8 A;  1AUI B;  3TS5 C;  1REC A;  5CSJ A;  1F8H A;  2KI6 C;  2KFG A;  3JTD B;  2K7B A;  1ZAC A;  4NDC A;  4D1E A;  5D7F A;  2H61 C;  1CLM A;  1Q80 A;  1JC2 A;  1CM4 A;  1KWO B;  1GGW A;  1IJ5 A;  3M0W A;  5K89 A;  2AMI A;  3TDZ A;  3LK0 A;  1G8I A;  3EKJ A;  1SK6 D;  4WQ3 A;  4HSZ A;  5HYD A;  1KFU S;  2L4I A;  1J55 A;  4N1F A;  1TNQ A;  3QRX A;  2PSR A;  2K0J A;  1NYA A;  2A4J A;  2JUL A;  1ODB A;  2LCP A;  1HQV A;  2L4H A;  3TDU A;  2DOQ A;  4USL A;  1VRK A;  4HRE E;  2BCA A;  1ZOT B;  1NCY A;  3O78 A;  3BQ3 A;  2GGM A;  1FF1 A;  1A2X A;  1G4Y R;  3A4U B;  4MN0 A;  3CLN A;  1SR6 B;  2ZRS A;  1YUS A;  2M7N A;  3O2P A;  1B1G A;  2K2A A;  3TUY B;  1S5G Y;  4UPG A;  3BOW A;  2KDH A;  3FS7 A;  1QXP A;  1EH2 A;  1XVJ A;  3SG6 A;  1IQ3 A;  1XFX O;  3I5H B;  3SJS A;  1OMR A;  1RK9 A;  1YUT A;  2E30 A;  3FWB A;  2KGB C;  1CFP A;  4OCI A;  2HET A;  1DVI A;  1UP5 A;  1UWO A;  2QPT A;  3GK2 A;  1MF8 B;  2LM5 A;  2WND A;  1AJ4 A;  1R2U A;  1TNW A;  2PRU A;  4CFR A;  5CPV A;  1S26 D;  2CCM A;  2BL0 C;  1CDP A;  2SCP A;  1S36 A;  2HQ8 A;  3PAT A;  3OB1 B;  1DT7 B;  5KSZ A;  2WOR A;  2LUC A;  2OS8 C;  1BR1 B;  2LAN A;  1FI6 A;  1UHJ A;  1LIN A;  2BKH B;  3F45 A;  2LNK A;  1K95 A;  2M8U A;  1R6P A;  3AKA A;  1Y1A A;  2ZKM X;  4YI9 A;  2KQY A;  1SCM B;  1KQM B;  2BE6 A;  4PHM A;  1M63 B;  2LMV A;  1A03 A;  1XFZ O;  2M9G A;  1KFU L;  1IGV A;  2JT8 A;  1Y6W A;  1K8U A;  1XFY O;  3IQO A;  5PAL A;  5AAN A;  1ALV A;  4GAO A;  1JBA A;  5HLV A;  4AQJ A;  3CZT X;  5TNC A;  2LVJ A;  1HT9 A;  3IQQ A;  4PE0 A;  1JSA A;  1DGU A;  1UUS A;  1WLZ A;  4OR9 B;  2M97 A;  2FCE A;  1DTL A;  2G9B A;  2LP3 A;  1S5G Z;  1TCO B;  2BEC A;  1V1G A;  3A8R A;  3NSI A;  2BBM A;  2E6W A;  2F2P A;  2MLF C;  3RM1 A;  1IG5 A;  3EK8 A;  2Y5I A;  2KI4 C;  3EK7 A;  1MQ1 A;  4PAL A;  4MSP A;  1AJ5 A;  1C7W A;  1L2O B;  4DUQ A;  4CID A;  2CNP A;  3D0Y B;  2EC6 C;  2MBX A;  1WRK A;  1YX8 A;  4HRH A;  1JUO A;  3D10 A;  1OOJ A;  2NXQ A;  5AXI A;  1SRA A;  4E68 A;  1DJI A;  1NX2 A;  1XK4 A;  3OP0 A;  1K90 D;  1OMD A;  5HLO A;  2JXL A;  3ZNI A;  4I5K A;  4I5J A;  1NCZ A;  3PAL A;  4WRI A;  1IH0 A;  3TUY C;  1B8L A;  1QVI Y;  1SL9 A;  3D0Y A;  1DJX A;  3I5I B;  4XJK B;  2HF5 A;  2I7A A;  1S6C A;  3RLZ A;  5ER5 A;  4NDD A;  2K8M B;  2L98 A;  3DF0 A;  5J3X A;  1LVC D;  4PHJ A;  4ORA B;  1SPY A;  2MAZ A;  4GUK A;  4P2Y B;  1WDC C;  5I8N A;  4MLW A;  1FW4 A;  1Y0V H;  4ORC B;  2LMT A;  1TOP A;  1NX1 A;  4I5L B;  2K61 A;  3DVM A;  3VRN A;  5F6T A;  2KHN A;  1GQM A;  3ICB A;  1QLK A;  1TNX A;  2HQW A;  5KTY A;  3PSR A;  1SY9 A;  2L0P A;  2TN4 A;  1QIW A;  2ZFD A;  2M3W A;  4U8D A;  1XFV O;  2LVV A;  3BUO B;  1QS7 A;  1UHN A;  1S6I A;  1XA5 A;  3KHE A;  2L50 A;  4MZL A;  1ZMZ A;  3EVU A;  4GPL B;  4GNK B;  4PE4 A;  1F71 A;  2K7D A;  2KBI A;  1KFX S;  1DGV A;  1KK8 C;  1NX0 A;  2K7O A;  2FJU B;  1MR8 A;  2JRF A;  5B8I B;  5I2L A;  2K2F A;  4WQ2 A;  4PDZ A;  2M49 B;  4C0L A;  1TCF A;  1F55 A;  1H4B A;  1J1E A;  1OQP A;  1UUR A;  2F33 A;  2L51 A;  1MHO A;  1W7I B;  1KWO C;  2I18 A;  1Y1X A;  1ZUZ A;  3LK1 A;  1KSM A;  4M2Q A;  1FPW A;  3FIA A;  2KNE A;  2MLE C;  3WHU B;  5FYX A;  1B8C A;  1OZS A;  1IJ6 A;  1M46 A;  2KI4 B;  2F2O A;  2LV7 A;  3BUN B;  1TRF A;  4F0Z B;  3AKB A;  1CFF A;  1QLS A;  5JOL A;  1QX2 A;  5DKN A;  4JWQ A;  1BR4 B;  1PAL A;  2LAP A;  2M0R A;  1OZO A;  3K21 A;  4DS7 A;  4CLN A;  1TNP A;  1JF2 A;  2CT9 A;  1CDN A;  1RRO A;  3EKH A;  2H2K A;  1QX7 A;  1D1O A;  3O4Y A;  1EG4 A;  1GJY A;  1QV0 A;  1X02 A;  4PCW A;  4M2O A;  2M29 A;  1QIV A;  5AEQ A;  2JU0 A;  1EXR A;  2IS9 A;  2ISD A;  1G33 A;  5I2O A;  1CDM A;  2LLS A;  1BG1 A;  2GGZ A;  2WCF A;  1WRL A;  3DVJ A;  3TS5 B;  1PVB A;  1QVI Z;  2JZI A;  2JTT A;  2BE4 A;  3FWC A;  4MZJ A;  3PFV A;  4A4B A;  1FBV A;  1PK0 D;  4AOM A;  1A29 A;  1XO5 A;  1RWY A; 
#chains in the Genus database with same CATH topology
 4P5O E;  1NX3 A;  2BKI B;  1FI5 A;  2Y4Q A;  1GGZ A;  2BCB A;  5FI2 A;  3NGV A;  1YUU A;  1IQ5 A;  3BUM B;  3NHI A;  5D69 A;  3S0F A;  2HPS A;  1UHK A;  2KOT A;  4KYN A;  3NSL A;  1N2D A;  1XFW O;  1N0Y A;  1F4Q A;  2RGI A;  2LLU A;  1K96 A;  2MHH A;  1UHH A;  2LE9 B;  1SMG A;  1A4P A;  2K7C A;  2WC5 A;  2L2C A;  3CWG A;  3C1V A;  3KEV A;  4L9M A;  1YUR A;  1DJG A;  1AVS A;  4ICB A;  1JFK A;  1K2H A;  2PMY A;  2LC5 A;  3BXK A;  4YGE B;  3JVT B;  1CLB A;  3SG5 A;  2QEB A;  4JQ0 D;  4HRG A;  4FTG A;  1M39 A;  1KQV A;  1XK4 C;  1NPQ A;  3KF9 A;  1YVH A;  4GGN A;  1CTR A;  5DKQ A;  1KK7 Y;  1WDC B;  2JPT A;  3WHT B;  3GOF A;  4TNC A;  3N7H A;  3VGO A;  1A75 A;  1DQE A;  1QJT A;  1RTP 1;  5ER4 X;  1CFC A;  3SIB A;  1B7T Z;  2JNX A;  1XYD A;  4ZCU A;  1KSO A;  2KYC A;  3BUW B;  1YRT B;  2MRD A;  3KO0 A;  3NSO A;  4YGA A;  4DRW A;  3I5F B;  2OPO A;  4C0J A;  3QME A;  4PHK A;  3ZWH A;  2Y1N A;  3Q8I A;  2BCX A;  4OV2 A;  4PHN A;  1SL7 A;  3NXA A;  1XFU O;  1MUX A;  3CR2 A;  2B1U A;  3IF7 A;  1QAT A;  3JTD C;  3OX6 A;  5D3O A;  3UNW A;  2F3Z A;  5I2Q A;  2CTN A;  2NLN A;  3CR5 X;  2FOT A;  5HKZ A;  4PT1 A;  3SG7 A;  2MA2 A;  2KPH A;  2JT0 A;  1CFD A;  2WCL A;  3PLF B;  4XJK A;  1C07 A;  2KLD A;  1TIZ A;  2PYQ A;  1DF0 A;  1KQM C;  3VRQ A;  2COL B;  2JWW A;  1J7Q A;  1PUL A;  1U5I B;  3CGA A;  2LVI A;  2WCM A;  1ALW A;  2LVK A;  1QTX A;  3BFB A;  2LHI A;  1S1E A;  4Q04 A;  2O60 A;  1F54 A;  2D8N A;  4MVF A;  3I5F C;  1YR5 A;  1DEL A;  3CS1 A;  3I5G C;  1PSR A;  1BF5 A;  1SBJ A;  1RJV A;  3L4L A;  3SG4 A;  4YBH B;  1J7R A;  2Q91 A;  4ETO A;  4GGF A;  3VRO A;  2LLT A;  1TTX A;  3DD4 A;  1JWD A;  3R1V A;  4IL1 A;  3SS3 A;  2LMU A;  2JXC A;  3OHM B;  3AAJ A;  1F70 A;  4YGB B;  2OTG B;  4MZK A;  2WCE A;  3LCP C;  3I5G B;  3I5H C;  5CSF A;  2JOJ A;  2AUC A;  1SSE B;  1S3P A;  4BY4 A;  3VRR A;  3JVT C;  1K9P A;  2G2B A;  4YRU A;  2NZ0 A;  3SG2 A;  3AAK A;  2WC8 A;  1NCX A;  2L2E A;  2M1K B;  1PRW A;  4DCK A;  4C0K A;  1BT6 A;  2ZRT A;  3LL8 B;  5AER A;  3VRP A;  1CDL A;  1F4O A;  1RFJ A;  1L2O C;  3S0D A;  1NIW A;  2BL0 B;  2FCD A;  4DIR A;  2I2R E;  1BOD A;  3O6B A;  3EVV A;  1J7O A;  1S6J A;  2ZN9 A;  4ORB B;  3DY9 A;  3NHT A;  2ZNE A;  2LHL A;  1AHR A;  5EL2 A;  4CPV A;  1WY9 A;  3B86 A;  1L7Z A;  4PE7 A;  1NUB A;  3OX5 A;  2PVB A;  3SG3 A;  1DJH A;  3SIA A;  1E8A A;  1DMO A;  1H8B A;  2QAC A;  4MRY A;  4R1E A;  1QX5 B;  3TZ1 A;  2Q4U A;  1J1D A;  1IIO A;  4FQO A;  1BMO A;  1NP8 A;  1TN4 A;  3BOW B;  1NSH A;  4NQG A;  3CYZ A;  5HKW A;  1SCV A;  2JTZ A;  2BBN A;  1CNP A;  4PE1 A;  3CZ2 A;  1JF0 A;  2KSP A;  1YRU B;  1IKU A;  1DJY A;  1CKK A;  2JQ6 A;  1W7J B;  2QEV A;  3B7A A;  1TUJ A;  1B9A A;  3CR4 X;  3S0A A;  1WRZ A;  2ISD A;  1A75 B;  3PN7 C;  5BPJ A;  1K9U A;  1PVA A;  5G08 A;  1SYM A;  3WXA A;  2I94 A;  2EC6 B;  3D76 A;  2KFF A;  4A4C A;  4CFQ A;  1V1F A;  2KBM A;  2M1U A;  1MWN A;  2KFH A;  4YI8 A;  2SAS A;  2EGD A;  2LUX A;  1M45 A;  2OS8 B;  3DYE A;  4QJ5 B;  1BJF A;  2KGR A;  1EG3 A;  1K9K A;  1KK8 B;  2CXJ A;  1LA3 A;  3EVR A;  3GK1 A;  3WNX B;  4BY5 A;  1SR6 C;  2KAX A;  1SW8 A;  2CBL A;  2ERB A;  1B8R A;  1LKJ A;  3BYA A;  3S0E A;  5JJG A;  1SCM C;  3L47 A;  5KU1 A;  1AP4 A;  4QJ3 B;  2WOS A;  1K94 A;  5IBW A;  2M7L A;  3DVE A;  1OOF A;  1B4C A;  1XFR A;  1CM1 A;  3VB1 A;  1KK7 Z;  1IRJ A;  1SKT A;  1N65 A;  4MRX A;  1CLL A;  3K1E A;  3MSE B;  1B7T Y;  3PM8 A;  2ZND A;  3DXL A;  2GV5 A;  1WLM A;  1YTZ C;  2PAL A;  3CTN A;  1B47 A;  3HX4 A;  1U5I A;  4M2P A;  1SNL A;  1YVL A;  4MBE A;  1IWQ A;  2KAY A;  2KLE A;  4I5N B;  1BOC A;  4INX A;  2PAS A;  1MXE A;  4OKH A;  1Y1U A;  3E3R A;  5CSI A;  4GBA A;  2JT3 A;  4YGC B;  1QAS A;  2V53 A;  4ZCV A;  2OTG C;  1M31 A;  1OE9 B;  2MJW B;  2L5Y A;  2JC2 A;  5CSN A;  1TWO A;  2F8P A;  4NDB A;  3D75 A;  4AQI A;  2GTE A;  2NCO A;  1UHI A;  4N1G A;  1EJ3 A;  5AFP A;  1LS8 A;  2P71 A;  1YX7 A;  5GQQ C;  3RZS A;  1LA0 A;  3NSK A;  3H4S E;  2AAO A;  3OGN A;  5HKY A;  4MEW A;  1LXF C;  3TDI A;  2WCB A;  1CMG A;  1ORG A;  3PN7 B;  2WC6 A;  1C7V A;  1DF0 B;  1OSA A;  4OVN F;  1DJZ A;  2O5G A;  3LLE A;  3S0G A;  2Y1M A;  1DJW A;  4N5X A;  4XYN A;  1QWV A;  1JFJ A;  5DKR A;  2KAV A;  2P6B B;  1KFX L;  3BUX B;  3EK4 A;  3OB2 B;  4JPZ B;  1BLQ A;  4JD9 A;  4GGF C;  4GFT A;  1K93 D;  1CB1 A;  1AK8 A;  1BU3 A;  1ZFS A;  2KI6 D;  2ZN8 A;  1J7P A;  2VRG A;  3L4A A;  2L5X B;  3HCM A;  2WCJ A;  4YGD B;  1NWD A;  3BJH A;  3DF0 B;  1OMV A;  1MXL C;  3KPX A;  2JNF A;  1EL4 A;  1QV1 A;  2F3Y A;  2H61 A;  2NCP A;  2LP2 A;  3DVK A;  2KQ6 A;  2EHB A;  2R2I A;  1CMF A;  2KYF A;  3GK4 X;  1DEK A;  1PSB A;  3I5I C;  1KCY A;  1SL8 A;  1AUI B;  3TS5 C;  1REC A;  5CSJ A;  1F8H A;  2KI6 C;  2KFG A;  3JTD B;  2K7B A;  1ZAC A;  3O4X A;  4NDC A;  4D1E A;  5D7F A;  2H61 C;  1CLM A;  3CZ1 A;  3PJI A;  1Q80 A;  1JC2 A;  3DZT A;  1CM4 A;  1KWO B;  1GGW A;  1IJ5 A;  3M0W A;  5K89 A;  2AMI A;  3TDZ A;  3LK0 A;  1G8I A;  1W9Z A;  1SK6 D;  3EKJ A;  4HSZ A;  4WQ3 A;  5HYD A;  1KFU S;  2L4I A;  1J55 A;  4N1F A;  4IJ7 A;  1OW4 A;  1TNQ A;  2K60 A;  2PSR A;  3QRX A;  2K0J A;  1NYA A;  2A4J A;  2JUL A;  1ODB A;  2LCP A;  1HQV A;  2L4H A;  3TDU A;  2DOQ A;  4USL A;  1VRK A;  4HRE E;  2BCA A;  1ZOT B;  1NCY A;  5DIC A;  3O78 A;  2FJY A;  3BQ3 A;  3PM2 A;  2GGM A;  1FF1 A;  3R72 A;  1A2X A;  1G4Y R;  3A4U B;  4MN0 A;  3CLN A;  1OOI X;  1SR6 B;  2ZRS A;  3D77 A;  1YUS A;  1Z2C B;  2M7N A;  3O2P A;  1TUZ A;  1B1G A;  4FQT A;  2K2A A;  3TUY B;  1S5G Y;  4UPG A;  3BOW A;  2YGU A;  2KDH A;  3FS7 A;  1QXP A;  1EH2 A;  1XVJ A;  3SG6 A;  1IQ3 A;  3B87 A;  1XFX O;  3I5H B;  3SJS A;  1OMR A;  1RK9 A;  1YUT A;  2E30 A;  3FWB A;  2KGB C;  1CFP A;  4OCI A;  2HET A;  3BFH A;  1DVI A;  1UP5 A;  1UWO A;  2QPT A;  3GK2 A;  1MF8 B;  2LM5 A;  2WND A;  1AJ4 A;  1R2U A;  1TNW A;  2PRU A;  4CFR A;  5CPV A;  1S26 D;  1T14 A;  2CCM A;  2BL0 C;  1CDP A;  2SCP A;  1S36 A;  2HQ8 A;  3PAT A;  3OB1 B;  1DT7 B;  5KSZ A;  2WOR A;  2WCH A;  2LUC A;  2OS8 C;  1BR1 B;  2LAN A;  1FI6 A;  1UHJ A;  1LIN A;  2BKH B;  3F45 A;  2LNK A;  1K95 A;  2M8U A;  1R6P A;  3AKA A;  1Y1A A;  2ZKM X;  4YI9 A;  2KQY A;  1SCM B;  4F7F A;  1KQM B;  2BE6 A;  4PHM A;  1M63 B;  2LMV A;  1A03 A;  1XFZ O;  2M9G A;  1KFU L;  1IGV A;  2BNX A;  2JT8 A;  1Y6W A;  1K8U A;  1XFY O;  3IQO A;  1C3Y A;  5PAL A;  5AAN A;  1ALV A;  4GAO A;  1JBA A;  5HLV A;  3BFA A;  3CZT X;  4AQJ A;  5TNC A;  2LVJ A;  3R1P A;  1HT9 A;  3IQQ A;  4INW A;  4PE0 A;  1JSA A;  1DGU A;  1UUS A;  1WLZ A;  3EG5 B;  4OR9 B;  2M97 A;  2FCE A;  1DTL A;  2G9B A;  2LP3 A;  3D74 A;  1S5G Z;  1TCO B;  2BEC A;  1V1G A;  3A8R A;  3NSI A;  2BBM A;  2E6W A;  2F2P A;  2MLF C;  3RM1 A;  1IG5 A;  2QDI A;  3EK8 A;  4QJ4 B;  2Y5I A;  2KI4 C;  3EK7 A;  1MQ1 A;  4PAL A;  4MSP A;  1AJ5 A;  1C7W A;  1L2O B;  4DUQ A;  4CID A;  2CNP A;  3D0Y B;  2BAP A;  2EC6 C;  2MBX A;  1WRK A;  1YX8 A;  4HRH A;  1JUO A;  3D10 A;  1OOJ A;  2NXQ A;  3FE8 A;  1SRA A;  5AXI A;  4E68 A;  3IVT A;  3D73 A;  1DJI A;  1NX2 A;  1XK4 A;  3OP0 A;  1K90 D;  1OMD A;  5HLO A;  2JXL A;  3ZNI A;  4I5K A;  4I5J A;  3V2L A;  1NCZ A;  3PAL A;  4WRI A;  3UO9 A;  3TUY C;  1IH0 A;  1B8L A;  1QVI Y;  1SL9 A;  3D0Y A;  1C3Z A;  3R1O A;  1DJX A;  3I5I B;  4XJK B;  2HF5 A;  2I7A A;  1S6C A;  3RLZ A;  5ER5 A;  2H8V A;  2K8M B;  4NDD A;  2L98 A;  3B6X A;  3DF0 A;  5J3X A;  1LVC D;  4PHJ A;  4ORA B;  1SPY A;  2MAZ A;  4GUK A;  4P2Y B;  1WDC C;  3OBV A;  5FI7 A;  4MLW A;  5I8N A;  1FW4 A;  1Y0V H;  4ORC B;  2LMT A;  3D78 A;  1TOP A;  3CAB A;  1NX1 A;  4I5L B;  2K61 A;  3DVM A;  3VRN A;  3B88 A;  1GM0 A;  5F6T A;  2KHN A;  1DC1 A;  1GQM A;  3ICB A;  1QLK A;  4OZD A;  2P70 A;  1TNX A;  2HQW A;  5KTY A;  3PSR A;  1SY9 A;  2L0P A;  2TN4 A;  1QIW A;  2ZFD A;  2M3W A;  4U8D A;  1XFV O;  2LVV A;  3CDN A;  3BUO B;  1QS7 A;  1UHN A;  1S6I A;  5HL1 A;  5FI6 A;  1XA5 A;  3KHE A;  1OOH A;  2L50 A;  1ZMZ A;  3EVU A;  4GPL B;  4GNK B;  4MZL A;  4PE4 A;  3SS5 A;  1F71 A;  2K7D A;  2KBI A;  2WCK A;  1KFX S;  1DGV A;  1KK8 C;  1NX0 A;  2K7O A;  2FJU B;  1MR8 A;  2JRF A;  5B8I B;  5I2L A;  2K2F A;  4WQ2 A;  4PDZ A;  2M49 B;  4C0L A;  1TCF A;  1Z4H A;  1F55 A;  1H4B A;  1J1E A;  1OQP A;  1UUR A;  2F33 A;  2L51 A;  1MHO A;  1W7I B;  1KWO C;  1Y1X A;  1ZUZ A;  2I18 A;  3CZ0 A;  1KSM A;  3LK1 A;  4M2Q A;  1FPW A;  3FIA A;  2KNE A;  2MLE C;  3WHU B;  5FYX A;  1B8C A;  1OZS A;  1IJ6 A;  1M46 A;  2KI4 B;  2F2O A;  2LV7 A;  3BUN B;  1TRF A;  4F0Z B;  3AKB A;  1CFF A;  1QLS A;  5JOL A;  1QX2 A;  5DKN A;  4JWQ A;  1BR4 B;  1PAL A;  2LAP A;  2M0R A;  1OZO A;  3K21 A;  4DS7 A;  4CLN A;  1TNP A;  1JF2 A;  3SS4 A;  2CT9 A;  5I94 A;  1CDN A;  2JPO A;  1RRO A;  3EKH A;  2H2K A;  1QX7 A;  1D1O A;  3O4Y A;  1EG4 A;  1GJY A;  1QV0 A;  4JKT A;  3FE9 A;  1X02 A;  4PCW A;  4M2O A;  2M29 A;  1QIV A;  5AEQ A;  2JU0 A;  1EXR A;  2IS9 A;  3FE6 A;  1G33 A;  2QEH A;  1CDM A;  1P28 A;  2LLS A;  2GGZ A;  5I2O A;  2WCF A;  1BG1 A;  1WRL A;  2PQL A;  1OOG A;  3DVJ A;  2QEO A;  3S0B A;  3TS5 B;  1PVB A;  1QVI Z;  2JZI A;  2JTT A;  2BE4 A;  3FWC A;  4MZJ A;  3PFV A;  4A4B A;  1FBV A;  1PK0 D;  4AOM A;  1A29 A;  1XO5 A;  1RWY A; 
#chains in the Genus database with same CATH homology
 4P5O E;  1NX3 A;  2BKI B;  1FI5 A;  2Y4Q A;  1GGZ A;  2BCB A;  1YUU A;  1IQ5 A;  3BUM B;  5D69 A;  2HPS A;  1UHK A;  2KOT A;  3NSL A;  1N2D A;  1XFW O;  1N0Y A;  1F4Q A;  2RGI A;  2LLU A;  1K96 A;  2MHH A;  1UHH A;  2LE9 B;  1SMG A;  1A4P A;  2K7C A;  3CWG A;  4L9M A;  3KEV A;  3C1V A;  1YUR A;  1DJG A;  1AVS A;  4ICB A;  1JFK A;  1K2H A;  2PMY A;  2LC5 A;  3BXK A;  4YGE B;  3JVT B;  1CLB A;  3SG5 A;  4JQ0 D;  4HRG A;  4FTG A;  1M39 A;  1KQV A;  1XK4 C;  1NPQ A;  3KF9 A;  1YVH A;  4GGN A;  1CTR A;  5DKQ A;  1KK7 Y;  1WDC B;  2JPT A;  3WHT B;  3GOF A;  4TNC A;  3VGO A;  1A75 A;  1QJT A;  5ER4 X;  1RTP 1;  1CFC A;  3SIB A;  1B7T Z;  2JNX A;  1XYD A;  4ZCU A;  1KSO A;  2KYC A;  3BUW B;  1YRT B;  2MRD A;  3KO0 A;  3NSO A;  4YGA A;  4DRW A;  3I5F B;  2OPO A;  4C0J A;  4PHK A;  3ZWH A;  2Y1N A;  2BCX A;  4OV2 A;  4PHN A;  1SL7 A;  3NXA A;  1XFU O;  1MUX A;  3CR2 A;  2B1U A;  3IF7 A;  1QAT A;  3JTD C;  3OX6 A;  2F3Z A;  5I2Q A;  2CTN A;  2NLN A;  3CR5 X;  2FOT A;  5HKZ A;  3SG7 A;  2MA2 A;  1C07 A;  2JT0 A;  1CFD A;  3PLF B;  4XJK A;  1TIZ A;  1DF0 A;  1KQM C;  3VRQ A;  2COL B;  2JWW A;  1J7Q A;  1PUL A;  1U5I B;  3CGA A;  2LVI A;  1ALW A;  2LVK A;  1QTX A;  2LHI A;  1S1E A;  4Q04 A;  2O60 A;  1F54 A;  2D8N A;  4MVF A;  3I5F C;  1YR5 A;  3CS1 A;  3I5G C;  1PSR A;  1BF5 A;  1SBJ A;  1RJV A;  3SG4 A;  4YBH B;  1J7R A;  2Q91 A;  4ETO A;  4GGF A;  3VRO A;  2LLT A;  1TTX A;  3DD4 A;  1JWD A;  4IL1 A;  2LMU A;  2JXC A;  3OHM B;  3AAJ A;  1F70 A;  4YGB B;  2OTG B;  4MZK A;  2WCE A;  3LCP C;  3I5G B;  3I5H C;  5CSF A;  2JOJ A;  2AUC A;  1S3P A;  4BY4 A;  3VRR A;  3JVT C;  1K9P A;  2G2B A;  4YRU A;  2NZ0 A;  3SG2 A;  3AAK A;  2WC8 A;  1NCX A;  2L2E A;  2M1K B;  1PRW A;  4DCK A;  4C0K A;  1BT6 A;  2ZRT A;  3LL8 B;  5AER A;  3VRP A;  1CDL A;  1F4O A;  1RFJ A;  1L2O C;  4QJ4 B;  1NIW A;  2BL0 B;  2FCD A;  4DIR A;  2I2R E;  1BOD A;  3O6B A;  3EVV A;  1J7O A;  1S6J A;  2ZN9 A;  4ORB B;  2ZNE A;  2LHL A;  1AHR A;  4CPV A;  1WY9 A;  1L7Z A;  4PE7 A;  1NUB A;  3OX5 A;  2PVB A;  3SG3 A;  1DJH A;  3SIA A;  1E8A A;  1DMO A;  1H8B A;  2QAC A;  4MRY A;  4R1E A;  1QX5 B;  3TZ1 A;  2Q4U A;  1J1D A;  4FQO A;  1BMO A;  1NP8 A;  1TN4 A;  3BOW B;  1NSH A;  4NQG A;  5HKW A;  1SCV A;  2JTZ A;  2BBN A;  1CNP A;  4PE1 A;  1JF0 A;  2KSP A;  1YRU B;  1IKU A;  1DJY A;  1CKK A;  2JQ6 A;  1W7J B;  3CR4 X;  1B9A A;  1WRZ A;  1A75 B;  3PN7 C;  5BPJ A;  1K9U A;  1PVA A;  5G08 A;  1SYM A;  3WXA A;  2I94 A;  2EC6 B;  2KFF A;  4A4C A;  4CFQ A;  1V1F A;  2KBM A;  2M1U A;  1MWN A;  2KFH A;  4YI8 A;  2SAS A;  2EGD A;  2LUX A;  1M45 A;  2OS8 B;  4QJ5 B;  1BJF A;  2KGR A;  1EG3 A;  1K9K A;  1KK8 B;  2CXJ A;  1LA3 A;  3EVR A;  3GK1 A;  3WNX B;  4BY5 A;  1SR6 C;  2KAX A;  1SW8 A;  2CBL A;  1B8R A;  1LKJ A;  3BYA A;  5JJG A;  1SCM C;  5KU1 A;  1AP4 A;  4QJ3 B;  2WOS A;  1K94 A;  5IBW A;  2M7L A;  3DVE A;  1B4C A;  1CM1 A;  1KK7 Z;  1IRJ A;  1SKT A;  1N65 A;  4MRX A;  1CLL A;  3PM8 A;  3MSE B;  1B7T Y;  2ZND A;  2GV5 A;  1WLM A;  1YTZ C;  2PAL A;  3CTN A;  1B47 A;  3HX4 A;  1U5I A;  4M2P A;  1SNL A;  1YVL A;  4MBE A;  1IWQ A;  2KAY A;  4I5N B;  1BOC A;  2PAS A;  1MXE A;  4OKH A;  1Y1U A;  3E3R A;  5CSI A;  4GBA A;  2JT3 A;  4YGC B;  1QAS A;  2V53 A;  4ZCV A;  2OTG C;  1M31 A;  1OE9 B;  2MJW B;  2JC2 A;  5CSN A;  2F8P A;  4NDB A;  4AQI A;  2NCO A;  1UHI A;  4N1G A;  1EJ3 A;  5AFP A;  1YX7 A;  5GQQ C;  1LA0 A;  3NSK A;  3H4S E;  2AAO A;  5HKY A;  4MEW A;  1LXF C;  3TDI A;  2WCB A;  1CMG A;  3PN7 B;  1C7V A;  1DF0 B;  1OSA A;  4OVN F;  1DJZ A;  2O5G A;  3LLE A;  2Y1M A;  1DJW A;  4N5X A;  4XYN A;  1JFJ A;  5DKR A;  2KAV A;  2P6B B;  1KFX L;  3BUX B;  3EK4 A;  3OB2 B;  4JPZ B;  1BLQ A;  4GGF C;  4GFT A;  1K93 D;  1CB1 A;  1AK8 A;  1BU3 A;  1ZFS A;  2KI6 D;  2ZN8 A;  1J7P A;  2VRG A;  2L5X B;  3HCM A;  4YGD B;  1NWD A;  3DF0 B;  1OMV A;  1MXL C;  3KPX A;  2JNF A;  1EL4 A;  1QV1 A;  2F3Y A;  2H61 A;  2NCP A;  2LP2 A;  3DVK A;  2KQ6 A;  2EHB A;  2R2I A;  1CMF A;  2KYF A;  3GK4 X;  1PSB A;  3I5I C;  1KCY A;  1SL8 A;  1AUI B;  3TS5 C;  1REC A;  5CSJ A;  1F8H A;  2KI6 C;  2KFG A;  3JTD B;  2K7B A;  1ZAC A;  4NDC A;  4D1E A;  5D7F A;  2H61 C;  1CLM A;  1Q80 A;  1JC2 A;  1CM4 A;  1KWO B;  1GGW A;  1IJ5 A;  3M0W A;  5K89 A;  2AMI A;  3TDZ A;  3LK0 A;  1G8I A;  3EKJ A;  1SK6 D;  4WQ3 A;  4HSZ A;  5HYD A;  1KFU S;  2L4I A;  1J55 A;  4N1F A;  1TNQ A;  3QRX A;  2PSR A;  2K0J A;  1NYA A;  2A4J A;  2JUL A;  1ODB A;  2LCP A;  1HQV A;  2L4H A;  3TDU A;  2DOQ A;  4USL A;  1VRK A;  4HRE E;  2BCA A;  1ZOT B;  1NCY A;  3O78 A;  3BQ3 A;  2GGM A;  1FF1 A;  1A2X A;  1G4Y R;  3A4U B;  4MN0 A;  3CLN A;  1SR6 B;  2ZRS A;  1YUS A;  2M7N A;  3O2P A;  1B1G A;  2K2A A;  3TUY B;  1S5G Y;  4UPG A;  3BOW A;  2KDH A;  3FS7 A;  1QXP A;  1EH2 A;  1XVJ A;  3SG6 A;  1IQ3 A;  1XFX O;  3I5H B;  3SJS A;  1OMR A;  1RK9 A;  1YUT A;  2E30 A;  3FWB A;  2KGB C;  1CFP A;  4OCI A;  2HET A;  1DVI A;  1UP5 A;  1UWO A;  2QPT A;  3GK2 A;  1MF8 B;  2LM5 A;  2WND A;  1AJ4 A;  1R2U A;  1TNW A;  2PRU A;  4CFR A;  5CPV A;  1S26 D;  2CCM A;  2BL0 C;  1CDP A;  2SCP A;  1S36 A;  2HQ8 A;  3PAT A;  3OB1 B;  1DT7 B;  5KSZ A;  2WOR A;  2LUC A;  2OS8 C;  1BR1 B;  2LAN A;  1FI6 A;  1UHJ A;  1LIN A;  2BKH B;  3F45 A;  2LNK A;  1K95 A;  2M8U A;  1R6P A;  3AKA A;  1Y1A A;  2ZKM X;  4YI9 A;  2KQY A;  1SCM B;  1KQM B;  2BE6 A;  4PHM A;  1M63 B;  2LMV A;  1A03 A;  1XFZ O;  2M9G A;  1KFU L;  1IGV A;  2JT8 A;  1Y6W A;  1K8U A;  1XFY O;  3IQO A;  5PAL A;  5AAN A;  1ALV A;  4GAO A;  1JBA A;  5HLV A;  4AQJ A;  3CZT X;  5TNC A;  2LVJ A;  1HT9 A;  3IQQ A;  4PE0 A;  1JSA A;  1DGU A;  1UUS A;  1WLZ A;  4OR9 B;  2M97 A;  2FCE A;  1DTL A;  2G9B A;  2LP3 A;  1S5G Z;  1TCO B;  2BEC A;  1V1G A;  3A8R A;  3NSI A;  2BBM A;  2E6W A;  2F2P A;  2MLF C;  3RM1 A;  1IG5 A;  3EK8 A;  2Y5I A;  2KI4 C;  3EK7 A;  1MQ1 A;  4PAL A;  4MSP A;  1AJ5 A;  1C7W A;  1L2O B;  4DUQ A;  4CID A;  2CNP A;  3D0Y B;  2EC6 C;  2MBX A;  1WRK A;  1YX8 A;  4HRH A;  1JUO A;  3D10 A;  1OOJ A;  2NXQ A;  5AXI A;  1SRA A;  4E68 A;  1DJI A;  1NX2 A;  1XK4 A;  3OP0 A;  1K90 D;  1OMD A;  5HLO A;  2JXL A;  3ZNI A;  4I5K A;  4I5J A;  1NCZ A;  3PAL A;  4WRI A;  1IH0 A;  3TUY C;  1B8L A;  1QVI Y;  1SL9 A;  3D0Y A;  1DJX A;  3I5I B;  4XJK B;  2HF5 A;  2I7A A;  1S6C A;  3RLZ A;  5ER5 A;  4NDD A;  2K8M B;  2L98 A;  3DF0 A;  5J3X A;  1LVC D;  4PHJ A;  4ORA B;  1SPY A;  2MAZ A;  4GUK A;  4P2Y B;  1WDC C;  5I8N A;  4MLW A;  1FW4 A;  1Y0V H;  4ORC B;  2LMT A;  1TOP A;  1NX1 A;  4I5L B;  2K61 A;  3DVM A;  3VRN A;  5F6T A;  2KHN A;  1GQM A;  3ICB A;  1QLK A;  1TNX A;  2HQW A;  5KTY A;  3PSR A;  1SY9 A;  2L0P A;  2TN4 A;  1QIW A;  2ZFD A;  2M3W A;  4U8D A;  1XFV O;  2LVV A;  3BUO B;  1QS7 A;  1UHN A;  1S6I A;  1XA5 A;  3KHE A;  2L50 A;  4MZL A;  1ZMZ A;  3EVU A;  4GPL B;  4GNK B;  4PE4 A;  1F71 A;  2K7D A;  2KBI A;  1KFX S;  1DGV A;  1KK8 C;  1NX0 A;  2K7O A;  2FJU B;  1MR8 A;  2JRF A;  5B8I B;  5I2L A;  2K2F A;  4WQ2 A;  4PDZ A;  2M49 B;  4C0L A;  1TCF A;  1F55 A;  1H4B A;  1J1E A;  1OQP A;  1UUR A;  2F33 A;  2L51 A;  1MHO A;  1W7I B;  1KWO C;  2I18 A;  1Y1X A;  1ZUZ A;  3LK1 A;  1KSM A;  4M2Q A;  1FPW A;  3FIA A;  2KNE A;  2MLE C;  3WHU B;  5FYX A;  1B8C A;  1OZS A;  1IJ6 A;  1M46 A;  2KI4 B;  2F2O A;  2LV7 A;  3BUN B;  1TRF A;  4F0Z B;  3AKB A;  1CFF A;  1QLS A;  5JOL A;  1QX2 A;  5DKN A;  4JWQ A;  1BR4 B;  1PAL A;  2LAP A;  2M0R A;  1OZO A;  3K21 A;  4DS7 A;  4CLN A;  1TNP A;  1JF2 A;  2CT9 A;  1CDN A;  1RRO A;  3EKH A;  2H2K A;  1QX7 A;  1D1O A;  3O4Y A;  1EG4 A;  1GJY A;  1QV0 A;  1X02 A;  4PCW A;  4M2O A;  2M29 A;  1QIV A;  5AEQ A;  2JU0 A;  1EXR A;  2IS9 A;  2ISD A;  1G33 A;  5I2O A;  1CDM A;  2LLS A;  1BG1 A;  2GGZ A;  2WCF A;  1WRL A;  3DVJ A;  3TS5 B;  1PVB A;  1QVI Z;  2JZI A;  2JTT A;  2BE4 A;  3FWC A;  4MZJ A;  3PFV A;  4A4B A;  1FBV A;  1PK0 D;  4AOM A;  1A29 A;  1XO5 A;  1RWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...