2JOJA

Nmr solution structure of n-terminal domain of euplotes octocarinatus centrin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
LSEEQKQEIKEAFDLFDTNKTGSIDYHELKVAMRALGFDVKKPEILELMNEYDREGNGYIGFDDFLDIMTEKIKNRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrin protein
publication title NMR solution structure of N-terminal domain of Euplotes octocarinatus centrin
rcsb
source organism Euplotes octocarinatus
molecule tags Cell cycle
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jojA00
2LC5A 4GAOA 1TOPA 2O60A 3CS1A 1G4YR 2BBNA 1YX8A 3NSOA 4GPLB 3ZNIA 1F4OA 2QACA 4YI9A 3A4UB 4PCWA 1ZOTB 3LK1A 4GBAA 1MR8A 1XFUO 3I5GC 2ZKMX 2D8NA 2KSPA 4QJ5B 1DVIA 2F3YA 2M1UA 1F8HA 1XVJA 2F2PA 4PDZA 5HKYA 1B47A 5D7FA 2KI6C 1CFFA 3O4YA 1SKTA 2LLUA 3TDZA 1SK6D 1CFCA 1IQ3A 1BR4B 2NCPA 2KBMA 4I5KA 2KNEA 1FBVA 1QATA 1A4PA 4PHNA 4M2OA 1GGZA 4GNKB 5DKNA 4P5OE 1ZACA 1TNWA 2M0RA 1S1EA 1RECA 1NCZA 2LCPA 4BY5A 3BYAA 2JT3A 3K21A 1TNXA 2ZFDA 3GOFA 2K61A 2MRDA 4FTGA 3VRRA 1B9AA 2EHBA 2KHNA 1QLSA 2JWWA 1JSAA 1K93D 1QX5B 2JTZA 1BODA 3BUNB 2KFHA 2KAYA 2I7AA 4MZLA 4XYNA 1QV1A 2WC8A 4MVFA 2LMVA 3OB1B 1KK7Y 1YRTB 4NDBA 5HKWA 1B8LA 5G08A 4WQ3A 2M7NA 2OPOA 2OTGB 1ALVA 2KOTA 2KQYA 1H4BA 1NX1A 1SNLA 1FF1A 2M49B 4ICBA 1M31A 4U8DA 2NLNA 5ER5A 2BBMA 2PASA 1BR1B 1NX3A 4P2YB 3I5FB 3O2PA 4HRGA 4XJKB 2EC6C 1OQPA 4DRWA 2CXJA 5CSIA 5I2OA 2JRFA 2M97A 2ZRSA 3TZ1A 1AK8A 2WOSA 3CLNA 4NQGA 4PE4A 4UPGA 1J7RA 1CM1A 1JF2A 1KQMB 5BPJA 1C07A 4OR9B 1B8CA 3DF0B 5AFPA 1KWOB 1UHIA 4YRUA 1M39A 1QVIZ 2CNPA 1KK8C 3D10A 5CSNA 2JOJA 3VGOA 1OZOA 1IRJA 2LE9B 2BKIB 3SG2A 2WCBA 3DD4A 2JT0A 1MXLC 2JQ6A 2KI4B 1N2DA 1A29A 3CTNA 1HT9A 2O5GA 2HPSA 1OE9B 4ZCVA 5J3XA 4D1EA 1K95A 4C0KA 5AXIA 1NCYA 2F33A 5DKQA 3FWCA 1BJFA 2ISDA 3SG6A 3CR2A 1H8BA 2SASA 1Y0VH 4TNCA 1QLKA 3JVTC 3PFVA 1SCMC 4E68A 2MA2A 1E8AA 1UHNA 3EVRA 3FIAA 1SL8A 1JFKA 4WQ2A 3BUOB 2GV5A 1B8RA 4PHJA 1W7IB 1WDCB 2H61A 2HQWA 1L7ZA 3EKHA 2PMYA 1YTZC 4YBHB 1XO5A 3OX6A 4MN0A 3PSRA 1PSBA 1PULA 1QTXA 3OX5A 4OCIA 2JTTA 3TDIA 5DKRA 2KYFA 1ZFSA 5TNCA 1DJYA 1SRAA 1CDNA 4ORAB 4ETOA 1MF8B 3SJSA 1IGVA 2SCPA 1UHKA 2H2KA 5K89A 1YR5A 1BF5A 3CR4X 1RFJA 5IBWA 1MQ1A 1XFYO 4CFQA 4PHMA 3AAKA 1N65A 2LVKA 3FWBA 1QASA 1J1EA 2JXCA 1TNPA 1OZSA 1IJ6A 4HSZA 4YGBB 3VRPA 4NDDA 1PVAA 1WRKA 2JC2A 1B4CA 2KFFA 3DVJA 4AOMA 4MRYA 4N1FA 1K90D 2L5XB 1J7QA 1S6JA 4CLNA 2CCMA 1FI5A 2I2RE 4A4CA 1V1GA 3IF7A 3TUYB 4MZJA 1SW8A 2IS9A 3IQOA 4NDCA 4F0ZB 1D1OA 1N0YA 2TN4A 1TNQA 1CNPA 1YVHA 1UP5A 4DCKA 3EK8A 2M3WA 1RROA 3WHTB 1KK7Z 1JBAA 1XA5A 3BUWB 1OMDA 4BY4A 5HYDA 5GQQC 3KEVA 1MUXA 1DJIA 2P6BB 1HQVA 1SL9A 3I5HB 2M9GA 1Y1UA 4MZKA 1LINA 3CWGA 1PSRA 2K8MB 2Y1MA 4PE7A 4XJKA 3BUXB 1S36A 2V53A 3EK7A 5FYXA 3I5IB 1K9PA 3D0YB 3I5FC 2JULA 3JTDB 4IL1A 4MRXA 1XFWO 5AERA 1DJWA 4I5JA 3DF0A 2BECA 2I18A 2Y4QA 3FS7A 4MLWA 1IH0A 1XFVO 1AJ4A 1KQMC 3PLFB 1YX7A 2LNKA 3ICBA 5PALA 1KWOC 1SYMA 2JNFA 4OV2A 1F71A 1DJHA 2FJUB 4GFTA 2CTNA 3NSKA 5KSZA 2AMIA 4JQ0D 4JPZB 1RK9A 1DGVA 1IG5A 1BG1A 5KU1A 2LVVA 3LCPC 1L2OB 1G33A 2KI4C 1KCYA 3HX4A 3IQQA 1SPYA 4PALA 1CLMA 1K9UA 3PN7B 4GUKA 1SL7A 2JU0A 2JZIA 1K9KA 1LA3A 3TS5B 1S3PA 3RM1A 1CFPA 1S6CA 4L9MA 1AVSA 1J7OA 2BE4A 3DVMA 1WLMA 4N5XA 1AJ5A 1SR6B 1QX7A 2LM5A 2LUXA 4PE0A 1IKUA 1A2XA 1PK0D 3CR5X 1DF0B 4CFRA 2Y5IA 1WDCC 2GGMA 1TIZA 1R2UA 2HF5A 2K2FA 4I5NB 1DJXA 1B7TZ 1TCOB 1TTXA 3O6BA 4GGFA 3KF9A 4DIRA 1ODBA 5AANA 2R2IA 4DS7A 1Q80A 2F8PA 1R6PA 2KDHA 1ALWA 4GGFC 3WHUB 3BUMB 3EVUA 2M1KB 1KFUL 4YGAA 2OS8B 2M8UA 3DVEA 3NXAA 4M2QA 2B1UA 3H4SE 1PALA 1M46A 4HRHA 1YUUA 1XK4A 1SBJA 2LUCA 2EC6B 1QIVA 2DOQA 2H61C 4HREE 4YI8A 2LP2A 2MBXA 1S5GY 1CKKA 1VRKA 1KFUS 2BKHB 2K7DA 5JOLA 4ZCUA 1FPWA 1V1FA 2HETA 1XFXO 2KGBC 3PALA 1QVIY 1BMOA 3A8RA 3TUYC 2L2EA 1YUSA 1KK8B 2KAXA 1CM4A 3VRNA 1JC2A 1JWDA 2K7CA 1S6IA 2BCBA 3BXKA 1UWOA 4USLA 1TCFA 1GJYA 2WNDA 2KI6D 3WNXB 1NX0A 2CBLA 1FW4A 1CLBA 1CFDA 3I5HC 1QX2A 3D0YA 2FCEA 1KQVA 1RTP1 3JVTB 1TRFA 2WORA 1M63B 3I5IC 1NP8A 3JTDC 1NPQA 1NUBA 1F4QA 1S26D 2WCEA 5ER4X 2JT8A 3HCMA 2NXQA 2ZRTA 1IJ5A 2F3ZA 1ZUZA 3AAJA 4CIDA 1JUOA 1DT7B 1PRWA 3CGAA 4N1GA 2OTGC 5I8NA 1MHOA 1NIWA 2E6WA 1TN4A 2EGDA 1GQMA 2ZN8A 2MAZA 2BL0B 4MSPA 1C7WA 1J1DA 4ORBB 1AP4A 1DJGA 1OMVA 2F2OA 3OP0A 1JFJA 5B8IB 1A75B 1L2OC 2AUCA 2KAVA 2CT9A 2MHHA 2KQ6A 1U5IB 5HLVA 1B1GA 1EL4A 1UHHA 1F70A 3PN7C 1QJTA 2AAOA 1PVBA 1A03A 1Y1XA 3TS5C 2ZN9A 1SCVA 2LVJA 5JJGA 4C0LA 2FCDA 2MLFC 3O78A 4YGCB 1NSHA 1BOCA 1QV0A 4ORCB 1DF0A 3I5GB 1SR6C 5HKZA 2G9BA 4PE1A 2JXLA 4WRIA 1RJVA 2BE6A 1NWDA 1BLQA 3PATA 1NX2A 5CSJA 2LLTA 2PVBA 4MBEA 1OOJA 1YURA 3EK4A 1DJZA 3SG4A 1G8IA 1CTRA 3GK4X 1XFZO 2M29A 2Q91A 4OVNF 1MXEA 1Y1AA 5I2LA 1IQ5A 1CB1A 3GK2A 2LMUA 2KBIA 2HQ8A 2VRGA 1LXFC 1MWNA 1EG3A 3NSLA 3CZTX 1YUTA 2K7OA 3F45A 3ZWHA 1IWQA 2L98A 3C1VA 1M45A 3M0WA 1YVLA 1K94A 2BCAA 4M2PA 4MEWA 1J7PA 2OS8C 1Y6WA 3SG3A 1K8UA 1BU3A 1UHJA 4QJ3B 3SG7A 2QPTA 1KFXL 5D69A 5I2QA 1DMOA 1QIWA 3TDUA 2RGIA 2KYCA 2G2BA 1CLLA 1LKJA 2I94A 2MLEC 1SY9A 2K0JA 2Q4UA 4OKHA 1KSOA 3E3RA 3MSEB 5F6TA 1QS7A 2LHLA 2MJWB 2LMTA 3OB2B 1C7VA 1S5GZ 1AUIB 1BT6A 2LP3A 4DUQA 1CMFA 3BOWA 3GK1A 1KFXS 1XYDA 3PM8A 3SG5A 3WXAA 1WRLA 5CSFA 2L4HA 1EXRA 4AQJA 3EVVA 2LVIA 1WLZA 3KPXA 3SIBA 4AQIA 1EG4A 1F54A 2K2AA 1W7JB 2KGRA 4YGDB 4YGEB 2FOTA 2ZNDA 2ZNEA 4PHKA 1K96A 2A4JA 2L51A 2LAPA 1NCXA 4GGNA 3VROA 1WY9A 2BCXA 2L0PA 3AKBA 5AEQA 1AHRA 1LA0A 1XK4C 4QJ4B 1EH2A 1YRUB 2K7BA 2L50A 4Q04A 3DVKA 1LVCD 1DGUA 1SMGA 2COLB 3LK0A 3NSIA 1J55A 1EJ3A 4FQOA 2KFGA 5HLOA 2M7LA 1DTLA 1NYAA 2E30A 1X02A 2NCOA 2PALA 2JNXA 1KSMA 3BOWB 1CDPA 3KHEA 3OHMB 1UUSA 1UURA 1GGWA 2PSRA 4CPVA 1CDLA 2WCFA 4JWQA 2JPTA 2LHIA 2Y1NA 1QXPA 3BQ3A 3SIAA 3AKAA 3RLZA 4A4BA 2LANA 1OSAA 1B7TY 5KTYA 1JF0A 1FI6A 2LLSA 1F55A 1RWYA 3KO0A 1WRZA 2NZ0A 1OMRA 1ZMZA 3EKJA 1A75A 2L4IA 2BL0C 2PRUA 1U5IA 2GGZA 1K2HA 1CMGA 3VRQA 1CDMA 3LL8B 1SCMB 3LLEA 4R1EA 2LV7A 5CPVA 4I5LB 3QRXA 4C0JA
chains in the Genus database with same CATH superfamily
2LC5A 4GAOA 1TOPA 1W9ZA 3S0BA 2O60A 3CS1A 1G4YR 2BBNA 1YX8A 3NSOA 4GPLB 3ZNIA 1F4OA 2QACA 4YI9A 3A4UB 4PCWA 1ZOTB 3LK1A 4GBAA 1MR8A 1QWVA 1XFUO 3I5GC 2ZKMX 2D8NA 2KSPA 4QJ5B 1DVIA 2F3YA 2M1UA 1F8HA 1XVJA 2F2PA 4PDZA 3UO9A 5HKYA 3VB1A 1B47A 5D7FA 2KI6C 1CFFA 3O4YA 2WC5A 4F7FA 1SKTA 2LLUA 3TDZA 1SK6D 1CFCA 1IQ3A 1BR4B 2NCPA 2KBMA 4I5KA 2KNEA 1FBVA 1QATA 1A4PA 4PHNA 4M2OA 3O4XA 1GGZA 4GNKB 5DKNA 4P5OE 1ZACA 1TNWA 2KLDA 1S1EA 1RECA 1NCZA 1OOIX 2LCPA 2M0RA 4BY5A 3BYAA 2JT3A 3K21A 1TNXA 2ZFDA 3GOFA 2K61A 2MRDA 2BAPA 4FTGA 1B9AA 2EHBA 2KHNA 3VRRA 1QLSA 2JWWA 1JSAA 1K93D 1QX5B 2JTZA 1BODA 3BUNB 2KFHA 2KAYA 2I7AA 4MZLA 4XYNA 1QV1A 2WC8A 4MVFA 2LMVA 3OB1B 1KK7Y 1YRTB 4NDBA 5HKWA 1ORGA 3DYEA 1B8LA 5G08A 4WQ3A 2M7NA 2OPOA 2OTGB 1ALVA 1C3YA 2KOTA 2KQYA 1H4BA 3L47A 1NX1A 2K60A 1SNLA 1FF1A 2M49B 4ICBA 1M31A 4U8DA 1TUJA 2NLNA 5EL2A 5ER5A 4KYNA 2BBMA 2PASA 1BR1B 3K1EA 1NX3A 5FI2A 4P2YB 3FE8A 3I5FB 3D77A 3O2PA 4HRGA 4XJKB 2EC6C 1OQPA 5DICA 4DRWA 2CXJA 5CSIA 3R1VA 5I2OA 2JRFA 2M97A 2ZRSA 3TZ1A 1AK8A 2WOSA 3CLNA 4NQGA 4PE4A 4UPGA 1J7RA 1CM1A 1JF2A 1KQMB 5BPJA 1C07A 4OR9B 1B8CA 3DF0B 5AFPA 1KWOB 1UHIA 3BFBA 1M39A 1QVIZ 2CNPA 4YRUA 1KK8C 3D10A 5CSNA 2JOJA 3R1PA 3VGOA 1OZOA 1IRJA 1DEKA 2LE9B 2BKIB 3SG2A 2WCBA 3DD4A 2JT0A 1MXLC 2JQ6A 2KI4B 1N2DA 1A29A 1T14A 3CTNA 1C3ZA 1HT9A 1TWOA 2O5GA 2HPSA 1OE9B 4ZCVA 5J3XA 1TUZA 1K95A 4D1EA 4C0KA 5AXIA 1NCYA 2F33A 5DKQA 3FWCA 1BJFA 2ISDA 3SG6A 3CR2A 1H8BA 2SASA 2QDIA 1Y0VH 4TNCA 1QLKA 3JVTC 3PFVA 1OOGA 1SCMC 4E68A 2MA2A 1E8AA 1UHNA 3EVRA 3FIAA 1SL8A 3S0GA 1JFKA 4WQ2A 3BUOB 2GV5A 1B8RA 4PHJA 1W7IB 1WDCB 2H61A 2QEBA 2HQWA 1L7ZA 3EKHA 2PMYA 1YTZC 4YBHB 1XO5A 3OX6A 4MN0A 3PSRA 1PSBA 1PULA 1QTXA 3OX5A 4OCIA 2JTTA 5FI7A 5DKRA 2QEHA 3TDIA 2GTEA 1ZFSA 2KYFA 5TNCA 1DJYA 1SRAA 1CDNA 4ORAB 4ETOA 1MF8B 3R72A 1DQEA 3SJSA 1IGVA 2SCPA 1UHKA 2H2KA 5K89A 1YR5A 1BF5A 3NHIA 3CR4X 1RFJA 5IBWA 1MQ1A 1XFYO 3BJHA 4CFQA 4PHMA 3AAKA 1N65A 2LVKA 1OW4A 1QASA 3D76A 3FWBA 1J1EA 4PT1A 2JXCA 1TNPA 1OZSA 1IJ6A 4HSZA 4YGBB 5D3OA 3VRPA 2P71A 4NDDA 3FE9A 1Z2CB 1PVAA 1WRKA 2JC2A 1B4CA 2KFFA 3DVJA 4AOMA 3BFHA 4MRYA 4N1FA 1K90D 2L5XB 1J7QA 1S6JA 4CLNA 3N7HA 2CCMA 1FI5A 2I2RE 4A4CA 1V1GA 3DXLA 3IF7A 3TUYB 4MZJA 3OGNA 1SW8A 2IS9A 3IQOA 4NDCA 2WCMA 4F0ZB 1D1OA 1N0YA 2TN4A 1TNQA 1CNPA 1YVHA 1UP5A 3DY9A 4DCKA 3EK8A 2M3WA 1RROA 3WHTB 1KK7Z 1JBAA 1XA5A 3BUWB 1OMDA 4BY4A 2FJYA 5HYDA 5GQQC 3S0AA 3KEVA 1MUXA 1DJIA 2P6BB 3S0FA 1HQVA 1SL9A 2JPOA 2M9GA 1Y1UA 3I5HB 1LINA 3CWGA 1PSRA 3NGVA 4MZKA 2K8MB 2Y1MA 4PE7A 4XJKA 1DELA 3BUXB 2KLEA 1S36A 2V53A 5I94A 2PQLA 3EK7A 5FYXA 3I5IB 1K9PA 3D0YB 3I5FC 2JULA 3JTDB 4IL1A 4MRXA 1XFWO 3SS5A 5AERA 1DJWA 4I5JA 3DF0A 3B88A 2BECA 2WCHA 2I18A 2Y4QA 3FS7A 4MLWA 1DC1A 1IH0A 1XFVO 2WCLA 1AJ4A 1KQMC 3PLFB 1YX7A 2LNKA 3ICBA 5PALA 1KWOC 1SYMA 2JNFA 4OV2A 1F71A 1DJHA 2FJUB 4GFTA 2CTNA 3NSKA 5KSZA 2AMIA 4JQ0D 4JPZB 1RK9A 1DGVA 1IG5A 3Q8IA 1BG1A 5KU1A 2LVVA 3LCPC 1L2OB 1G33A 2KI4C 3SS3A 1KCYA 3HX4A 3IQQA 1SPYA 4PALA 1CLMA 1K9UA 3PN7B 4GUKA 1SL7A 2JU0A 2JZIA 1K9KA 1LA3A 3TS5B 1S3PA 3RM1A 1CFPA 1S6CA 4L9MA 1AVSA 1OOFA 2BE4A 3DVMA 1WLMA 3NHTA 1J7OA 4N5XA 1AJ5A 1SR6B 1QX7A 2QEOA 2LM5A 2LUXA 4PE0A 1IKUA 1A2XA 1PK0D 3CR5X 1DF0B 4CFRA 2Y5IA 1WDCC 2GGMA 1TIZA 1R2UA 3BFAA 2HF5A 2K2FA 4I5NB 1DJXA 3D73A 3CZ0A 1B7TZ 3D78A 1TCOB 1TTXA 3O6BA 4GGFA 3KF9A 4DIRA 1ODBA 5AANA 2R2IA 4DS7A 2L2CA 4IJ7A 1Q80A 2F8PA 1R6PA 2KDHA 1ALWA 4GGFC 3WHUB 3BUMB 3EVUA 2M1KB 1KFUL 3OBVA 2OS8B 2M8UA 3DVEA 2P70A 3CZ1A 3NXAA 4M2QA 4YGAA 3CZ2A 3CYZA 2B1UA 3H4SE 1PALA 1M46A 4HRHA 1YUUA 1XK4A 1SBJA 2LUCA 4JKTA 2EC6B 1QIVA 2DOQA 2H61C 4HREE 4YI8A 2LP2A 2MBXA 1S5GY 1CKKA 1VRKA 1KFUS 2BKHB 2K7DA 5JOLA 3QMEA 3UNWA 4ZCUA 5HL1A 1FPWA 1V1FA 2HETA 1XFXO 2KGBC 2WC6A 3B7AA 3PALA 1QVIY 2L5YA 1BMOA 3A8RA 3TUYC 2L2EA 1YUSA 1KK8B 3B86A 3IVTA 2KAXA 1CM4A 3D75A 3VRNA 4INXA 1JC2A 1JWDA 2YGUA 2K7CA 1S6IA 1GM0A 2BCBA 4OZDA 3BXKA 1UWOA 4USLA 2BNXA 3D74A 1TCFA 1GJYA 2WNDA 2KI6D 3WNXB 1NX0A 2CBLA 1FW4A 1CLBA 1CFDA 3I5HC 1QX2A 4JD9A 3D0YA 2FCEA 1KQVA 1RTP1 3JVTB 1XFRA 2WCJA 5FI6A 1TRFA 2WORA 1M63B 3I5IC 1NP8A 3JTDC 1NPQA 1NUBA 1F4QA 1S26D 2WCEA 5ER4X 3S0EA 3CABA 2JT8A 3HCMA 2NXQA 2ZRTA 1IJ5A 3PM2A 1LS8A 2F3ZA 1ZUZA 3AAJA 4CIDA 1JUOA 1DT7B 1PRWA 3CGAA 4N1GA 2OTGC 5I8NA 1MHOA 1NIWA 2E6WA 1TN4A 2EGDA 1GQMA 2ZN8A 2MAZA 4FQTA 2BL0B 4MSPA 1C7WA 1J1DA 4ORBB 2WCKA 1AP4A 1DJGA 1OMVA 2F2OA 3OP0A 1JFJA 5B8IB 1A75B 1L2OC 2AUCA 2KAVA 2CT9A 2MHHA 1Z4HA 2KQ6A 1U5IB 5HLVA 1B1GA 1EL4A 1UHHA 3S0DA 3PN7C 1QJTA 2AAOA 1F70A 3RZSA 1PVBA 1A03A 1Y1XA 3TS5C 2ZN9A 1SCVA 2LVJA 5JJGA 4C0LA 2FCDA 2MLFC 3EG5B 3O78A 3DZTA 4YGCB 1P28A 1NSHA 1BOCA 1QV0A 1SSEB 4ORCB 1DF0A 2QEVA 3I5GB 1SR6C 5HKZA 2G9BA 4PE1A 2JXLA 4WRIA 1RJVA 2BE6A 1NWDA 1BLQA 3B6XA 3PATA 1NX2A 5CSJA 2LLTA 2PVBA 4MBEA 1OOJA 1YURA 3EK4A 1DJZA 3SG4A 1G8IA 1CTRA 3GK4X 1XFZO 2M29A 2Q91A 4OVNF 1MXEA 1Y1AA 5I2LA 1IQ5A 1CB1A 3GK2A 2LMUA 2KBIA 2HQ8A 2VRGA 2H8VA 1LXFC 1MWNA 1EG3A 3NSLA 3CZTX 1YUTA 2K7OA 3F45A 3ZWHA 1IWQA 2L98A 3C1VA 1M45A 2KPHA 1YVLA 1K94A 2BCAA 3M0WA 4M2PA 4MEWA 1J7PA 2OS8C 1Y6WA 3SG3A 1K8UA 1BU3A 1UHJA 4QJ3B 3SG7A 2QPTA 1KFXL 5D69A 5I2QA 2ERBA 1DMOA 1QIWA 3TDUA 2RGIA 2KYCA 2G2BA 1CLLA 1LKJA 2I94A 3B87A 2MLEC 1SY9A 2K0JA 2Q4UA 4OKHA 1KSOA 3E3RA 3MSEB 5F6TA 1QS7A 2LHLA 2MJWB 2LMTA 3OB2B 1C7VA 1S5GZ 1AUIB 1BT6A 2LP3A 4DUQA 1CMFA 3BOWA 3GK1A 1KFXS 1XYDA 3PM8A 3SG5A 3WXAA 1WRLA 5CSFA 2L4HA 1EXRA 4AQJA 3EVVA 2LVIA 1WLZA 3KPXA 3SIBA 4AQIA 1EG4A 1F54A 1IIOA 3L4AA 2K2AA 1W7JB 3L4LA 2KGRA 4INWA 4YGDB 4YGEB 2FOTA 2ZNDA 3CDNA 2ZNEA 4PHKA 1K96A 1OOHA 2A4JA 2L51A 2LAPA 1NCXA 4GGNA 3VROA 1WY9A 2BCXA 2L0PA 3AKBA 5AEQA 1AHRA 1LA0A 1XK4C 3R1OA 4QJ4B 1EH2A 1YRUB 3SS4A 2K7BA 2L50A 4Q04A 3DVKA 1LVCD 1DGUA 1SMGA 3PJIA 2COLB 3LK0A 3NSIA 1J55A 1EJ3A 4FQOA 2KFGA 5HLOA 2M7LA 1DTLA 1NYAA 2E30A 1X02A 2NCOA 2PALA 3FE6A 2JNXA 1KSMA 3BOWB 1CDPA 3KHEA 3OHMB 1UUSA 1UURA 1GGWA 2PSRA 4CPVA 1CDLA 2WCFA 4JWQA 2JPTA 2LHIA 2Y1NA 1QXPA 3BQ3A 3SIAA 3AKAA 3V2LA 3RLZA 4A4BA 2LANA 1OSAA 1B7TY 5KTYA 1JF0A 1FI6A 2LLSA 1F55A 1RWYA 3KO0A 1WRZA 2NZ0A 1OMRA 1ZMZA 3EKJA 1A75A 2L4IA 2BL0C 2PRUA 1U5IA 2PYQA 2GGZA 1K2HA 1CMGA 3VRQA 1CDMA 3LL8B 1SCMB 3LLEA 4R1EA 2LV7A 5CPVA 4I5LB 3QRXA 4C0JA
chains in the Genus database with same CATH topology
2LC5A 4GAOA 1TOPA 2O60A 3CS1A 1G4YR 2BBNA 1YX8A 3NSOA 4GPLB 3ZNIA 1F4OA 2QACA 4YI9A 3A4UB 4PCWA 1ZOTB 3LK1A 4GBAA 1MR8A 1XFUO 3I5GC 2ZKMX 2D8NA 2KSPA 4QJ5B 1DVIA 2F3YA 2M1UA 1F8HA 1XVJA 2F2PA 4PDZA 5HKYA 1B47A 5D7FA 2KI6C 1CFFA 3O4YA 1SKTA 2LLUA 3TDZA 1SK6D 1CFCA 1IQ3A 1BR4B 2NCPA 2KBMA 4I5KA 2KNEA 1FBVA 1QATA 1A4PA 4PHNA 4M2OA 1GGZA 4GNKB 5DKNA 4P5OE 1ZACA 1TNWA 2M0RA 1S1EA 1RECA 1NCZA 2LCPA 4BY5A 3BYAA 2JT3A 3K21A 1TNXA 2ZFDA 3GOFA 2K61A 2MRDA 4FTGA 3VRRA 1B9AA 2EHBA 2KHNA 1QLSA 2JWWA 1JSAA 1K93D 1QX5B 2JTZA 1BODA 3BUNB 2KFHA 2KAYA 2I7AA 4MZLA 4XYNA 1QV1A 2WC8A 4MVFA 2LMVA 3OB1B 1KK7Y 1YRTB 4NDBA 5HKWA 1B8LA 5G08A 4WQ3A 2M7NA 2OPOA 2OTGB 1ALVA 2KOTA 2KQYA 1H4BA 1NX1A 1SNLA 1FF1A 2M49B 4ICBA 1M31A 4U8DA 2NLNA 5ER5A 2BBMA 2PASA 1BR1B 1NX3A 4P2YB 3I5FB 3O2PA 4HRGA 4XJKB 2EC6C 1OQPA 4DRWA 2CXJA 5CSIA 5I2OA 2JRFA 2M97A 2ZRSA 3TZ1A 1AK8A 2WOSA 3CLNA 4NQGA 4PE4A 4UPGA 1J7RA 1CM1A 1JF2A 1KQMB 5BPJA 1C07A 4OR9B 1B8CA 3DF0B 5AFPA 1KWOB 1UHIA 4YRUA 1M39A 1QVIZ 2CNPA 1KK8C 3D10A 5CSNA 2JOJA 3VGOA 1OZOA 1IRJA 2LE9B 2BKIB 3SG2A 2WCBA 3DD4A 2JT0A 1MXLC 2JQ6A 2KI4B 1N2DA 1A29A 3CTNA 1HT9A 2O5GA 2HPSA 1OE9B 4ZCVA 5J3XA 4D1EA 1K95A 4C0KA 5AXIA 1NCYA 2F33A 5DKQA 3FWCA 1BJFA 2ISDA 3SG6A 3CR2A 1H8BA 2SASA 1Y0VH 4TNCA 1QLKA 3JVTC 3PFVA 1SCMC 4E68A 2MA2A 1E8AA 1UHNA 3EVRA 3FIAA 1SL8A 1JFKA 4WQ2A 3BUOB 2GV5A 1B8RA 4PHJA 1W7IB 1WDCB 2H61A 2HQWA 1L7ZA 3EKHA 2PMYA 1YTZC 4YBHB 1XO5A 3OX6A 4MN0A 3PSRA 1PSBA 1PULA 1QTXA 3OX5A 4OCIA 2JTTA 3TDIA 5DKRA 2KYFA 1ZFSA 5TNCA 1DJYA 1SRAA 1CDNA 4ORAB 4ETOA 1MF8B 3SJSA 1IGVA 2SCPA 1UHKA 2H2KA 5K89A 1YR5A 1BF5A 3CR4X 1RFJA 5IBWA 1MQ1A 1XFYO 4CFQA 4PHMA 3AAKA 1N65A 2LVKA 3FWBA 1QASA 1J1EA 2JXCA 1TNPA 1OZSA 1IJ6A 4HSZA 4YGBB 3VRPA 4NDDA 1PVAA 1WRKA 2JC2A 1B4CA 2KFFA 3DVJA 4AOMA 4MRYA 4N1FA 1K90D 2L5XB 1J7QA 1S6JA 4CLNA 2CCMA 1FI5A 2I2RE 4A4CA 1V1GA 3IF7A 3TUYB 4MZJA 1SW8A 2IS9A 3IQOA 4NDCA 4F0ZB 1D1OA 1N0YA 2TN4A 1TNQA 1CNPA 1YVHA 1UP5A 4DCKA 3EK8A 2M3WA 1RROA 3WHTB 1KK7Z 1JBAA 1XA5A 3BUWB 1OMDA 4BY4A 5HYDA 5GQQC 3KEVA 1MUXA 1DJIA 2P6BB 1HQVA 1SL9A 3I5HB 2M9GA 1Y1UA 4MZKA 1LINA 3CWGA 1PSRA 2K8MB 2Y1MA 4PE7A 4XJKA 3BUXB 1S36A 2V53A 3EK7A 5FYXA 3I5IB 1K9PA 3D0YB 3I5FC 2JULA 3JTDB 4IL1A 4MRXA 1XFWO 5AERA 1DJWA 4I5JA 3DF0A 2BECA 2I18A 2Y4QA 3FS7A 4MLWA 1IH0A 1XFVO 1AJ4A 1KQMC 3PLFB 1YX7A 2LNKA 3ICBA 5PALA 1KWOC 1SYMA 2JNFA 4OV2A 1F71A 1DJHA 2FJUB 4GFTA 2CTNA 3NSKA 5KSZA 2AMIA 4JQ0D 4JPZB 1RK9A 1DGVA 1IG5A 1BG1A 5KU1A 2LVVA 3LCPC 1L2OB 1G33A 2KI4C 1KCYA 3HX4A 3IQQA 1SPYA 4PALA 1CLMA 1K9UA 3PN7B 4GUKA 1SL7A 2JU0A 2JZIA 1K9KA 1LA3A 3TS5B 1S3PA 3RM1A 1CFPA 1S6CA 4L9MA 1AVSA 1J7OA 2BE4A 3DVMA 1WLMA 4N5XA 1AJ5A 1SR6B 1QX7A 2LM5A 2LUXA 4PE0A 1IKUA 1A2XA 1PK0D 3CR5X 1DF0B 4CFRA 2Y5IA 1WDCC 2GGMA 1TIZA 1R2UA 2HF5A 2K2FA 4I5NB 1DJXA 1B7TZ 1TCOB 1TTXA 3O6BA 4GGFA 3KF9A 4DIRA 1ODBA 5AANA 2R2IA 4DS7A 1Q80A 2F8PA 1R6PA 2KDHA 1ALWA 4GGFC 3WHUB 3BUMB 3EVUA 2M1KB 1KFUL 4YGAA 2OS8B 2M8UA 3DVEA 3NXAA 4M2QA 2B1UA 3H4SE 1PALA 1M46A 4HRHA 1YUUA 1XK4A 1SBJA 2LUCA 2EC6B 1QIVA 2DOQA 2H61C 4HREE 4YI8A 2LP2A 2MBXA 1S5GY 1CKKA 1VRKA 1KFUS 2BKHB 2K7DA 5JOLA 4ZCUA 1FPWA 1V1FA 2HETA 1XFXO 2KGBC 3PALA 1QVIY 1BMOA 3A8RA 3TUYC 2L2EA 1YUSA 1KK8B 2KAXA 1CM4A 3VRNA 1JC2A 1JWDA 2K7CA 1S6IA 2BCBA 3BXKA 1UWOA 4USLA 1TCFA 1GJYA 2WNDA 2KI6D 3WNXB 1NX0A 2CBLA 1FW4A 1CLBA 1CFDA 3I5HC 1QX2A 3D0YA 2FCEA 1KQVA 1RTP1 3JVTB 1TRFA 2WORA 1M63B 3I5IC 1NP8A 3JTDC 1NPQA 1NUBA 1F4QA 1S26D 2WCEA 5ER4X 2JT8A 3HCMA 2NXQA 2ZRTA 1IJ5A 2F3ZA 1ZUZA 3AAJA 4CIDA 1JUOA 1DT7B 1PRWA 3CGAA 4N1GA 2OTGC 5I8NA 1MHOA 1NIWA 2E6WA 1TN4A 2EGDA 1GQMA 2ZN8A 2MAZA 2BL0B 4MSPA 1C7WA 1J1DA 4ORBB 1AP4A 1DJGA 1OMVA 2F2OA 3OP0A 1JFJA 5B8IB 1A75B 1L2OC 2AUCA 2KAVA 2CT9A 2MHHA 2KQ6A 1U5IB 5HLVA 1B1GA 1EL4A 1UHHA 1F70A 3PN7C 1QJTA 2AAOA 1PVBA 1A03A 1Y1XA 3TS5C 2ZN9A 1SCVA 2LVJA 5JJGA 4C0LA 2FCDA 2MLFC 3O78A 4YGCB 1NSHA 1BOCA 1QV0A 4ORCB 1DF0A 3I5GB 1SR6C 5HKZA 2G9BA 4PE1A 2JXLA 4WRIA 1RJVA 2BE6A 1NWDA 1BLQA 3PATA 1NX2A 5CSJA 2LLTA 2PVBA 4MBEA 1OOJA 1YURA 3EK4A 1DJZA 3SG4A 1G8IA 1CTRA 3GK4X 1XFZO 2M29A 2Q91A 4OVNF 1MXEA 1Y1AA 5I2LA 1IQ5A 1CB1A 3GK2A 2LMUA 2KBIA 2HQ8A 2VRGA 1LXFC 1MWNA 1EG3A 3NSLA 3CZTX 1YUTA 2K7OA 3F45A 3ZWHA 1IWQA 2L98A 3C1VA 1M45A 3M0WA 1YVLA 1K94A 2BCAA 4M2PA 4MEWA 1J7PA 2OS8C 1Y6WA 3SG3A 1K8UA 1BU3A 1UHJA 4QJ3B 3SG7A 2QPTA 1KFXL 5D69A 5I2QA 1DMOA 1QIWA 3TDUA 2RGIA 2KYCA 2G2BA 1CLLA 1LKJA 2I94A 2MLEC 1SY9A 2K0JA 2Q4UA 4OKHA 1KSOA 3E3RA 3MSEB 5F6TA 1QS7A 2LHLA 2MJWB 2LMTA 3OB2B 1C7VA 1S5GZ 1AUIB 1BT6A 2LP3A 4DUQA 1CMFA 3BOWA 3GK1A 1KFXS 1XYDA 3PM8A 3SG5A 3WXAA 1WRLA 5CSFA 2L4HA 1EXRA 4AQJA 3EVVA 2LVIA 1WLZA 3KPXA 3SIBA 4AQIA 1EG4A 1F54A 2K2AA 1W7JB 2KGRA 4YGDB 4YGEB 2FOTA 2ZNDA 2ZNEA 4PHKA 1K96A 2A4JA 2L51A 2LAPA 1NCXA 4GGNA 3VROA 1WY9A 2BCXA 2L0PA 3AKBA 5AEQA 1AHRA 1LA0A 1XK4C 4QJ4B 1EH2A 1YRUB 2K7BA 2L50A 4Q04A 3DVKA 1LVCD 1DGUA 1SMGA 2COLB 3LK0A 3NSIA 1J55A 1EJ3A 4FQOA 2KFGA 5HLOA 2M7LA 1DTLA 1NYAA 2E30A 1X02A 2NCOA 2PALA 2JNXA 1KSMA 3BOWB 1CDPA 3KHEA 3OHMB 1UUSA 1UURA 1GGWA 2PSRA 4CPVA 1CDLA 2WCFA 4JWQA 2JPTA 2LHIA 2Y1NA 1QXPA 3BQ3A 3SIAA 3AKAA 3RLZA 4A4BA 2LANA 1OSAA 1B7TY 5KTYA 1JF0A 1FI6A 2LLSA 1F55A 1RWYA 3KO0A 1WRZA 2NZ0A 1OMRA 1ZMZA 3EKJA 1A75A 2L4IA 2BL0C 2PRUA 1U5IA 2GGZA 1K2HA 1CMGA 3VRQA 1CDMA 3LL8B 1SCMB 3LLEA 4R1EA 2LV7A 5CPVA 4I5LB 3QRXA 4C0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LC5 A;  4GAO A;  1TOP A;  2O60 A;  3CS1 A;  1G4Y R;  2BBN A;  1YX8 A;  3NSO A;  4GPL B;  3ZNI A;  1F4O A;  2QAC A;  4YI9 A;  3A4U B;  4PCW A;  1ZOT B;  3LK1 A;  4GBA A;  1MR8 A;  1XFU O;  3I5G C;  2ZKM X;  2D8N A;  2KSP A;  4QJ5 B;  1DVI A;  2F3Y A;  2M1U A;  1F8H A;  1XVJ A;  2F2P A;  4PDZ A;  5HKY A;  1B47 A;  5D7F A;  2KI6 C;  1CFF A;  3O4Y A;  1SKT A;  2LLU A;  3TDZ A;  1SK6 D;  1CFC A;  1IQ3 A;  1BR4 B;  2NCP A;  2KBM A;  4I5K A;  2KNE A;  1FBV A;  1QAT A;  1A4P A;  4PHN A;  4M2O A;  1GGZ A;  4GNK B;  5DKN A;  4P5O E;  1ZAC A;  1TNW A;  2M0R A;  1S1E A;  1REC A;  1NCZ A;  2LCP A;  4BY5 A;  3BYA A;  2JT3 A;  3K21 A;  1TNX A;  2ZFD A;  3GOF A;  2K61 A;  2MRD A;  4FTG A;  3VRR A;  1B9A A;  2EHB A;  2KHN A;  1QLS A;  2JWW A;  1JSA A;  1K93 D;  1QX5 B;  2JTZ A;  1BOD A;  3BUN B;  2KFH A;  2KAY A;  2I7A A;  4MZL A;  4XYN A;  1QV1 A;  2WC8 A;  4MVF A;  2LMV A;  3OB1 B;  1KK7 Y;  1YRT B;  4NDB A;  5HKW A;  1B8L A;  5G08 A;  4WQ3 A;  2M7N A;  2OPO A;  2OTG B;  1ALV A;  2KOT A;  2KQY A;  1H4B A;  1NX1 A;  1SNL A;  1FF1 A;  2M49 B;  4ICB A;  1M31 A;  4U8D A;  2NLN A;  5ER5 A;  2BBM A;  2PAS A;  1BR1 B;  1NX3 A;  4P2Y B;  3I5F B;  3O2P A;  4HRG A;  4XJK B;  2EC6 C;  1OQP A;  4DRW A;  2CXJ A;  5CSI A;  5I2O A;  2JRF A;  2M97 A;  2ZRS A;  3TZ1 A;  1AK8 A;  2WOS A;  3CLN A;  4NQG A;  4PE4 A;  4UPG A;  1J7R A;  1CM1 A;  1JF2 A;  1KQM B;  5BPJ A;  1C07 A;  4OR9 B;  1B8C A;  3DF0 B;  5AFP A;  1KWO B;  1UHI A;  4YRU A;  1M39 A;  1QVI Z;  2CNP A;  1KK8 C;  3D10 A;  5CSN A;  2JOJ A;  3VGO A;  1OZO A;  1IRJ A;  2LE9 B;  2BKI B;  3SG2 A;  2WCB A;  3DD4 A;  2JT0 A;  1MXL C;  2JQ6 A;  2KI4 B;  1N2D A;  1A29 A;  3CTN A;  1HT9 A;  2O5G A;  2HPS A;  1OE9 B;  4ZCV A;  5J3X A;  4D1E A;  1K95 A;  4C0K A;  5AXI A;  1NCY A;  2F33 A;  5DKQ A;  3FWC A;  1BJF A;  2ISD A;  3SG6 A;  3CR2 A;  1H8B A;  2SAS A;  1Y0V H;  4TNC A;  1QLK A;  3JVT C;  3PFV A;  1SCM C;  4E68 A;  2MA2 A;  1E8A A;  1UHN A;  3EVR A;  3FIA A;  1SL8 A;  1JFK A;  4WQ2 A;  3BUO B;  2GV5 A;  1B8R A;  4PHJ A;  1W7I B;  1WDC B;  2H61 A;  2HQW A;  1L7Z A;  3EKH A;  2PMY A;  1YTZ C;  4YBH B;  1XO5 A;  3OX6 A;  4MN0 A;  3PSR A;  1PSB A;  1PUL A;  1QTX A;  3OX5 A;  4OCI A;  2JTT A;  3TDI A;  5DKR A;  2KYF A;  1ZFS A;  5TNC A;  1DJY A;  1SRA A;  1CDN A;  4ORA B;  4ETO A;  1MF8 B;  3SJS A;  1IGV A;  2SCP A;  1UHK A;  2H2K A;  5K89 A;  1YR5 A;  1BF5 A;  3CR4 X;  1RFJ A;  5IBW A;  1MQ1 A;  1XFY O;  4CFQ A;  4PHM A;  3AAK A;  1N65 A;  2LVK A;  3FWB A;  1QAS A;  1J1E A;  2JXC A;  1TNP A;  1OZS A;  1IJ6 A;  4HSZ A;  4YGB B;  3VRP A;  4NDD A;  1PVA A;  1WRK A;  2JC2 A;  1B4C A;  2KFF A;  3DVJ A;  4AOM A;  4MRY A;  4N1F A;  1K90 D;  2L5X B;  1J7Q A;  1S6J A;  4CLN A;  2CCM A;  1FI5 A;  2I2R E;  4A4C A;  1V1G A;  3IF7 A;  3TUY B;  4MZJ A;  1SW8 A;  2IS9 A;  3IQO A;  4NDC A;  4F0Z B;  1D1O A;  1N0Y A;  2TN4 A;  1TNQ A;  1CNP A;  1YVH A;  1UP5 A;  4DCK A;  3EK8 A;  2M3W A;  1RRO A;  3WHT B;  1KK7 Z;  1JBA A;  1XA5 A;  3BUW B;  1OMD A;  4BY4 A;  5HYD A;  5GQQ C;  3KEV A;  1MUX A;  1DJI A;  2P6B B;  1HQV A;  1SL9 A;  3I5H B;  2M9G A;  1Y1U A;  4MZK A;  1LIN A;  3CWG A;  1PSR A;  2K8M B;  2Y1M A;  4PE7 A;  4XJK A;  3BUX B;  1S36 A;  2V53 A;  3EK7 A;  5FYX A;  3I5I B;  1K9P A;  3D0Y B;  3I5F C;  2JUL A;  3JTD B;  4IL1 A;  4MRX A;  1XFW O;  5AER A;  1DJW A;  4I5J A;  3DF0 A;  2BEC A;  2I18 A;  2Y4Q A;  3FS7 A;  4MLW A;  1IH0 A;  1XFV O;  1AJ4 A;  1KQM C;  3PLF B;  1YX7 A;  2LNK A;  3ICB A;  5PAL A;  1KWO C;  1SYM A;  2JNF A;  4OV2 A;  1F71 A;  1DJH A;  2FJU B;  4GFT A;  2CTN A;  3NSK A;  5KSZ A;  2AMI A;  4JQ0 D;  4JPZ B;  1RK9 A;  1DGV A;  1IG5 A;  1BG1 A;  5KU1 A;  2LVV A;  3LCP C;  1L2O B;  1G33 A;  2KI4 C;  1KCY A;  3HX4 A;  3IQQ A;  1SPY A;  4PAL A;  1CLM A;  1K9U A;  3PN7 B;  4GUK A;  1SL7 A;  2JU0 A;  2JZI A;  1K9K A;  1LA3 A;  3TS5 B;  1S3P A;  3RM1 A;  1CFP A;  1S6C A;  4L9M A;  1AVS A;  1J7O A;  2BE4 A;  3DVM A;  1WLM A;  4N5X A;  1AJ5 A;  1SR6 B;  1QX7 A;  2LM5 A;  2LUX A;  4PE0 A;  1IKU A;  1A2X A;  1PK0 D;  3CR5 X;  1DF0 B;  4CFR A;  2Y5I A;  1WDC C;  2GGM A;  1TIZ A;  1R2U A;  2HF5 A;  2K2F A;  4I5N B;  1DJX A;  1B7T Z;  1TCO B;  1TTX A;  3O6B A;  4GGF A;  3KF9 A;  4DIR A;  1ODB A;  5AAN A;  2R2I A;  4DS7 A;  1Q80 A;  2F8P A;  1R6P A;  2KDH A;  1ALW A;  4GGF C;  3WHU B;  3BUM B;  3EVU A;  2M1K B;  1KFU L;  4YGA A;  2OS8 B;  2M8U A;  3DVE A;  3NXA A;  4M2Q A;  2B1U A;  3H4S E;  1PAL A;  1M46 A;  4HRH A;  1YUU A;  1XK4 A;  1SBJ A;  2LUC A;  2EC6 B;  1QIV A;  2DOQ A;  2H61 C;  4HRE E;  4YI8 A;  2LP2 A;  2MBX A;  1S5G Y;  1CKK A;  1VRK A;  1KFU S;  2BKH B;  2K7D A;  5JOL A;  4ZCU A;  1FPW A;  1V1F A;  2HET A;  1XFX O;  2KGB C;  3PAL A;  1QVI Y;  1BMO A;  3A8R A;  3TUY C;  2L2E A;  1YUS A;  1KK8 B;  2KAX A;  1CM4 A;  3VRN A;  1JC2 A;  1JWD A;  2K7C A;  1S6I A;  2BCB A;  3BXK A;  1UWO A;  4USL A;  1TCF A;  1GJY A;  2WND A;  2KI6 D;  3WNX B;  1NX0 A;  2CBL A;  1FW4 A;  1CLB A;  1CFD A;  3I5H C;  1QX2 A;  3D0Y A;  2FCE A;  1KQV A;  1RTP 1;  3JVT B;  1TRF A;  2WOR A;  1M63 B;  3I5I C;  1NP8 A;  3JTD C;  1NPQ A;  1NUB A;  1F4Q A;  1S26 D;  2WCE A;  5ER4 X;  2JT8 A;  3HCM A;  2NXQ A;  2ZRT A;  1IJ5 A;  2F3Z A;  1ZUZ A;  3AAJ A;  4CID A;  1JUO A;  1DT7 B;  1PRW A;  3CGA A;  4N1G A;  2OTG C;  5I8N A;  1MHO A;  1NIW A;  2E6W A;  1TN4 A;  2EGD A;  1GQM A;  2ZN8 A;  2MAZ A;  2BL0 B;  4MSP A;  1C7W A;  1J1D A;  4ORB B;  1AP4 A;  1DJG A;  1OMV A;  2F2O A;  3OP0 A;  1JFJ A;  5B8I B;  1A75 B;  1L2O C;  2AUC A;  2KAV A;  2CT9 A;  2MHH A;  2KQ6 A;  1U5I B;  5HLV A;  1B1G A;  1EL4 A;  1UHH A;  1F70 A;  3PN7 C;  1QJT A;  2AAO A;  1PVB A;  1A03 A;  1Y1X A;  3TS5 C;  2ZN9 A;  1SCV A;  2LVJ A;  5JJG A;  4C0L A;  2FCD A;  2MLF C;  3O78 A;  4YGC B;  1NSH A;  1BOC A;  1QV0 A;  4ORC B;  1DF0 A;  3I5G B;  1SR6 C;  5HKZ A;  2G9B A;  4PE1 A;  2JXL A;  4WRI A;  1RJV A;  2BE6 A;  1NWD A;  1BLQ A;  3PAT A;  1NX2 A;  5CSJ A;  2LLT A;  2PVB A;  4MBE A;  1OOJ A;  1YUR A;  3EK4 A;  1DJZ A;  3SG4 A;  1G8I A;  1CTR A;  3GK4 X;  1XFZ O;  2M29 A;  2Q91 A;  4OVN F;  1MXE A;  1Y1A A;  5I2L A;  1IQ5 A;  1CB1 A;  3GK2 A;  2LMU A;  2KBI A;  2HQ8 A;  2VRG A;  1LXF C;  1MWN A;  1EG3 A;  3NSL A;  3CZT X;  1YUT A;  2K7O A;  3F45 A;  3ZWH A;  1IWQ A;  2L98 A;  3C1V A;  1M45 A;  3M0W A;  1YVL A;  1K94 A;  2BCA A;  4M2P A;  4MEW A;  1J7P A;  2OS8 C;  1Y6W A;  3SG3 A;  1K8U A;  1BU3 A;  1UHJ A;  4QJ3 B;  3SG7 A;  2QPT A;  1KFX L;  5D69 A;  5I2Q A;  1DMO A;  1QIW A;  3TDU A;  2RGI A;  2KYC A;  2G2B A;  1CLL A;  1LKJ A;  2I94 A;  2MLE C;  1SY9 A;  2K0J A;  2Q4U A;  4OKH A;  1KSO A;  3E3R A;  3MSE B;  5F6T A;  1QS7 A;  2LHL A;  2MJW B;  2LMT A;  3OB2 B;  1C7V A;  1S5G Z;  1AUI B;  1BT6 A;  2LP3 A;  4DUQ A;  1CMF A;  3BOW A;  3GK1 A;  1KFX S;  1XYD A;  3PM8 A;  3SG5 A;  3WXA A;  1WRL A;  5CSF A;  2L4H A;  1EXR A;  4AQJ A;  3EVV A;  2LVI A;  1WLZ A;  3KPX A;  3SIB A;  4AQI A;  1EG4 A;  1F54 A;  2K2A A;  1W7J B;  2KGR A;  4YGD B;  4YGE B;  2FOT A;  2ZND A;  2ZNE A;  4PHK A;  1K96 A;  2A4J A;  2L51 A;  2LAP A;  1NCX A;  4GGN A;  3VRO A;  1WY9 A;  2BCX A;  2L0P A;  3AKB A;  5AEQ A;  1AHR A;  1LA0 A;  1XK4 C;  4QJ4 B;  1EH2 A;  1YRU B;  2K7B A;  2L50 A;  4Q04 A;  3DVK A;  1LVC D;  1DGU A;  1SMG A;  2COL B;  3LK0 A;  3NSI A;  1J55 A;  1EJ3 A;  4FQO A;  2KFG A;  5HLO A;  2M7L A;  1DTL A;  1NYA A;  2E30 A;  1X02 A;  2NCO A;  2PAL A;  2JNX A;  1KSM A;  3BOW B;  1CDP A;  3KHE A;  3OHM B;  1UUS A;  1UUR A;  1GGW A;  2PSR A;  4CPV A;  1CDL A;  2WCF A;  4JWQ A;  2JPT A;  2LHI A;  2Y1N A;  1QXP A;  3BQ3 A;  3SIA A;  3AKA A;  3RLZ A;  4A4B A;  2LAN A;  1OSA A;  1B7T Y;  5KTY A;  1JF0 A;  1FI6 A;  2LLS A;  1F55 A;  1RWY A;  3KO0 A;  1WRZ A;  2NZ0 A;  1OMR A;  1ZMZ A;  3EKJ A;  1A75 A;  2L4I A;  2BL0 C;  2PRU A;  1U5I A;  2GGZ A;  1K2H A;  1CMG A;  3VRQ A;  1CDM A;  3LL8 B;  1SCM B;  3LLE A;  4R1E A;  2LV7 A;  5CPV A;  4I5L B;  3QRX A;  4C0J A; 
#chains in the Genus database with same CATH topology
 2LC5 A;  4GAO A;  1TOP A;  1W9Z A;  3S0B A;  2O60 A;  3CS1 A;  1G4Y R;  2BBN A;  1YX8 A;  3NSO A;  4GPL B;  3ZNI A;  1F4O A;  2QAC A;  4YI9 A;  3A4U B;  4PCW A;  1ZOT B;  3LK1 A;  4GBA A;  1MR8 A;  1QWV A;  1XFU O;  3I5G C;  2ZKM X;  2D8N A;  2KSP A;  4QJ5 B;  1DVI A;  2F3Y A;  2M1U A;  1F8H A;  1XVJ A;  2F2P A;  4PDZ A;  3UO9 A;  5HKY A;  3VB1 A;  1B47 A;  5D7F A;  2KI6 C;  1CFF A;  3O4Y A;  2WC5 A;  4F7F A;  1SKT A;  2LLU A;  3TDZ A;  1SK6 D;  1CFC A;  1IQ3 A;  1BR4 B;  2NCP A;  2KBM A;  4I5K A;  2KNE A;  1FBV A;  1QAT A;  1A4P A;  4PHN A;  4M2O A;  3O4X A;  1GGZ A;  4GNK B;  5DKN A;  4P5O E;  1ZAC A;  1TNW A;  2KLD A;  1S1E A;  1REC A;  1NCZ A;  1OOI X;  2LCP A;  2M0R A;  4BY5 A;  3BYA A;  2JT3 A;  3K21 A;  1TNX A;  2ZFD A;  3GOF A;  2K61 A;  2MRD A;  2BAP A;  4FTG A;  1B9A A;  2EHB A;  2KHN A;  3VRR A;  1QLS A;  2JWW A;  1JSA A;  1K93 D;  1QX5 B;  2JTZ A;  1BOD A;  3BUN B;  2KFH A;  2KAY A;  2I7A A;  4MZL A;  4XYN A;  1QV1 A;  2WC8 A;  4MVF A;  2LMV A;  3OB1 B;  1KK7 Y;  1YRT B;  4NDB A;  5HKW A;  1ORG A;  3DYE A;  1B8L A;  5G08 A;  4WQ3 A;  2M7N A;  2OPO A;  2OTG B;  1ALV A;  1C3Y A;  2KOT A;  2KQY A;  1H4B A;  3L47 A;  1NX1 A;  2K60 A;  1SNL A;  1FF1 A;  2M49 B;  4ICB A;  1M31 A;  4U8D A;  1TUJ A;  2NLN A;  5EL2 A;  5ER5 A;  4KYN A;  2BBM A;  2PAS A;  1BR1 B;  3K1E A;  1NX3 A;  5FI2 A;  4P2Y B;  3FE8 A;  3I5F B;  3D77 A;  3O2P A;  4HRG A;  4XJK B;  2EC6 C;  1OQP A;  5DIC A;  4DRW A;  2CXJ A;  5CSI A;  3R1V A;  5I2O A;  2JRF A;  2M97 A;  2ZRS A;  3TZ1 A;  1AK8 A;  2WOS A;  3CLN A;  4NQG A;  4PE4 A;  4UPG A;  1J7R A;  1CM1 A;  1JF2 A;  1KQM B;  5BPJ A;  1C07 A;  4OR9 B;  1B8C A;  3DF0 B;  5AFP A;  1KWO B;  1UHI A;  3BFB A;  1M39 A;  1QVI Z;  2CNP A;  4YRU A;  1KK8 C;  3D10 A;  5CSN A;  2JOJ A;  3R1P A;  3VGO A;  1OZO A;  1IRJ A;  1DEK A;  2LE9 B;  2BKI B;  3SG2 A;  2WCB A;  3DD4 A;  2JT0 A;  1MXL C;  2JQ6 A;  2KI4 B;  1N2D A;  1A29 A;  1T14 A;  3CTN A;  1C3Z A;  1HT9 A;  1TWO A;  2O5G A;  2HPS A;  1OE9 B;  4ZCV A;  5J3X A;  1TUZ A;  1K95 A;  4D1E A;  4C0K A;  5AXI A;  1NCY A;  2F33 A;  5DKQ A;  3FWC A;  1BJF A;  2ISD A;  3SG6 A;  3CR2 A;  1H8B A;  2SAS A;  2QDI A;  1Y0V H;  4TNC A;  1QLK A;  3JVT C;  3PFV A;  1OOG A;  1SCM C;  4E68 A;  2MA2 A;  1E8A A;  1UHN A;  3EVR A;  3FIA A;  1SL8 A;  3S0G A;  1JFK A;  4WQ2 A;  3BUO B;  2GV5 A;  1B8R A;  4PHJ A;  1W7I B;  1WDC B;  2H61 A;  2QEB A;  2HQW A;  1L7Z A;  3EKH A;  2PMY A;  1YTZ C;  4YBH B;  1XO5 A;  3OX6 A;  4MN0 A;  3PSR A;  1PSB A;  1PUL A;  1QTX A;  3OX5 A;  4OCI A;  2JTT A;  5FI7 A;  5DKR A;  2QEH A;  3TDI A;  2GTE A;  1ZFS A;  2KYF A;  5TNC A;  1DJY A;  1SRA A;  1CDN A;  4ORA B;  4ETO A;  1MF8 B;  3R72 A;  1DQE A;  3SJS A;  1IGV A;  2SCP A;  1UHK A;  2H2K A;  5K89 A;  1YR5 A;  1BF5 A;  3NHI A;  3CR4 X;  1RFJ A;  5IBW A;  1MQ1 A;  1XFY O;  3BJH A;  4CFQ A;  4PHM A;  3AAK A;  1N65 A;  2LVK A;  1OW4 A;  1QAS A;  3D76 A;  3FWB A;  1J1E A;  4PT1 A;  2JXC A;  1TNP A;  1OZS A;  1IJ6 A;  4HSZ A;  4YGB B;  5D3O A;  3VRP A;  2P71 A;  4NDD A;  3FE9 A;  1Z2C B;  1PVA A;  1WRK A;  2JC2 A;  1B4C A;  2KFF A;  3DVJ A;  4AOM A;  3BFH A;  4MRY A;  4N1F A;  1K90 D;  2L5X B;  1J7Q A;  1S6J A;  4CLN A;  3N7H A;  2CCM A;  1FI5 A;  2I2R E;  4A4C A;  1V1G A;  3DXL A;  3IF7 A;  3TUY B;  4MZJ A;  3OGN A;  1SW8 A;  2IS9 A;  3IQO A;  4NDC A;  2WCM A;  4F0Z B;  1D1O A;  1N0Y A;  2TN4 A;  1TNQ A;  1CNP A;  1YVH A;  1UP5 A;  3DY9 A;  4DCK A;  3EK8 A;  2M3W A;  1RRO A;  3WHT B;  1KK7 Z;  1JBA A;  1XA5 A;  3BUW B;  1OMD A;  4BY4 A;  2FJY A;  5HYD A;  5GQQ C;  3S0A A;  3KEV A;  1MUX A;  1DJI A;  2P6B B;  3S0F A;  1HQV A;  1SL9 A;  2JPO A;  2M9G A;  1Y1U A;  3I5H B;  1LIN A;  3CWG A;  1PSR A;  3NGV A;  4MZK A;  2K8M B;  2Y1M A;  4PE7 A;  4XJK A;  1DEL A;  3BUX B;  2KLE A;  1S36 A;  2V53 A;  5I94 A;  2PQL A;  3EK7 A;  5FYX A;  3I5I B;  1K9P A;  3D0Y B;  3I5F C;  2JUL A;  3JTD B;  4IL1 A;  4MRX A;  1XFW O;  3SS5 A;  5AER A;  1DJW A;  4I5J A;  3DF0 A;  3B88 A;  2BEC A;  2WCH A;  2I18 A;  2Y4Q A;  3FS7 A;  4MLW A;  1DC1 A;  1IH0 A;  1XFV O;  2WCL A;  1AJ4 A;  1KQM C;  3PLF B;  1YX7 A;  2LNK A;  3ICB A;  5PAL A;  1KWO C;  1SYM A;  2JNF A;  4OV2 A;  1F71 A;  1DJH A;  2FJU B;  4GFT A;  2CTN A;  3NSK A;  5KSZ A;  2AMI A;  4JQ0 D;  4JPZ B;  1RK9 A;  1DGV A;  1IG5 A;  3Q8I A;  1BG1 A;  5KU1 A;  2LVV A;  3LCP C;  1L2O B;  1G33 A;  2KI4 C;  3SS3 A;  1KCY A;  3HX4 A;  3IQQ A;  1SPY A;  4PAL A;  1CLM A;  1K9U A;  3PN7 B;  4GUK A;  1SL7 A;  2JU0 A;  2JZI A;  1K9K A;  1LA3 A;  3TS5 B;  1S3P A;  3RM1 A;  1CFP A;  1S6C A;  4L9M A;  1AVS A;  1OOF A;  2BE4 A;  3DVM A;  1WLM A;  3NHT A;  1J7O A;  4N5X A;  1AJ5 A;  1SR6 B;  1QX7 A;  2QEO A;  2LM5 A;  2LUX A;  4PE0 A;  1IKU A;  1A2X A;  1PK0 D;  3CR5 X;  1DF0 B;  4CFR A;  2Y5I A;  1WDC C;  2GGM A;  1TIZ A;  1R2U A;  3BFA A;  2HF5 A;  2K2F A;  4I5N B;  1DJX A;  3D73 A;  3CZ0 A;  1B7T Z;  3D78 A;  1TCO B;  1TTX A;  3O6B A;  4GGF A;  3KF9 A;  4DIR A;  1ODB A;  5AAN A;  2R2I A;  4DS7 A;  2L2C A;  4IJ7 A;  1Q80 A;  2F8P A;  1R6P A;  2KDH A;  1ALW A;  4GGF C;  3WHU B;  3BUM B;  3EVU A;  2M1K B;  1KFU L;  3OBV A;  2OS8 B;  2M8U A;  3DVE A;  2P70 A;  3CZ1 A;  3NXA A;  4M2Q A;  4YGA A;  3CZ2 A;  3CYZ A;  2B1U A;  3H4S E;  1PAL A;  1M46 A;  4HRH A;  1YUU A;  1XK4 A;  1SBJ A;  2LUC A;  4JKT A;  2EC6 B;  1QIV A;  2DOQ A;  2H61 C;  4HRE E;  4YI8 A;  2LP2 A;  2MBX A;  1S5G Y;  1CKK A;  1VRK A;  1KFU S;  2BKH B;  2K7D A;  5JOL A;  3QME A;  3UNW A;  4ZCU A;  5HL1 A;  1FPW A;  1V1F A;  2HET A;  1XFX O;  2KGB C;  2WC6 A;  3B7A A;  3PAL A;  1QVI Y;  2L5Y A;  1BMO A;  3A8R A;  3TUY C;  2L2E A;  1YUS A;  1KK8 B;  3B86 A;  3IVT A;  2KAX A;  1CM4 A;  3D75 A;  3VRN A;  4INX A;  1JC2 A;  1JWD A;  2YGU A;  2K7C A;  1S6I A;  1GM0 A;  2BCB A;  4OZD A;  3BXK A;  1UWO A;  4USL A;  2BNX A;  3D74 A;  1TCF A;  1GJY A;  2WND A;  2KI6 D;  3WNX B;  1NX0 A;  2CBL A;  1FW4 A;  1CLB A;  1CFD A;  3I5H C;  1QX2 A;  4JD9 A;  3D0Y A;  2FCE A;  1KQV A;  1RTP 1;  3JVT B;  1XFR A;  2WCJ A;  5FI6 A;  1TRF A;  2WOR A;  1M63 B;  3I5I C;  1NP8 A;  3JTD C;  1NPQ A;  1NUB A;  1F4Q A;  1S26 D;  2WCE A;  5ER4 X;  3S0E A;  3CAB A;  2JT8 A;  3HCM A;  2NXQ A;  2ZRT A;  1IJ5 A;  3PM2 A;  1LS8 A;  2F3Z A;  1ZUZ A;  3AAJ A;  4CID A;  1JUO A;  1DT7 B;  1PRW A;  3CGA A;  4N1G A;  2OTG C;  5I8N A;  1MHO A;  1NIW A;  2E6W A;  1TN4 A;  2EGD A;  1GQM A;  2ZN8 A;  2MAZ A;  4FQT A;  2BL0 B;  4MSP A;  1C7W A;  1J1D A;  4ORB B;  2WCK A;  1AP4 A;  1DJG A;  1OMV A;  2F2O A;  3OP0 A;  1JFJ A;  5B8I B;  1A75 B;  1L2O C;  2AUC A;  2KAV A;  2CT9 A;  2MHH A;  1Z4H A;  2KQ6 A;  1U5I B;  5HLV A;  1B1G A;  1EL4 A;  1UHH A;  3S0D A;  3PN7 C;  1QJT A;  2AAO A;  1F70 A;  3RZS A;  1PVB A;  1A03 A;  1Y1X A;  3TS5 C;  2ZN9 A;  1SCV A;  2LVJ A;  5JJG A;  4C0L A;  2FCD A;  2MLF C;  3EG5 B;  3O78 A;  3DZT A;  4YGC B;  1P28 A;  1NSH A;  1BOC A;  1QV0 A;  1SSE B;  4ORC B;  1DF0 A;  2QEV A;  3I5G B;  1SR6 C;  5HKZ A;  2G9B A;  4PE1 A;  2JXL A;  4WRI A;  1RJV A;  2BE6 A;  1NWD A;  1BLQ A;  3B6X A;  3PAT A;  1NX2 A;  5CSJ A;  2LLT A;  2PVB A;  4MBE A;  1OOJ A;  1YUR A;  3EK4 A;  1DJZ A;  3SG4 A;  1G8I A;  1CTR A;  3GK4 X;  1XFZ O;  2M29 A;  2Q91 A;  4OVN F;  1MXE A;  1Y1A A;  5I2L A;  1IQ5 A;  1CB1 A;  3GK2 A;  2LMU A;  2KBI A;  2HQ8 A;  2VRG A;  2H8V A;  1LXF C;  1MWN A;  1EG3 A;  3NSL A;  3CZT X;  1YUT A;  2K7O A;  3F45 A;  3ZWH A;  1IWQ A;  2L98 A;  3C1V A;  1M45 A;  2KPH A;  1YVL A;  1K94 A;  2BCA A;  3M0W A;  4M2P A;  4MEW A;  1J7P A;  2OS8 C;  1Y6W A;  3SG3 A;  1K8U A;  1BU3 A;  1UHJ A;  4QJ3 B;  3SG7 A;  2QPT A;  1KFX L;  5D69 A;  5I2Q A;  2ERB A;  1DMO A;  1QIW A;  3TDU A;  2RGI A;  2KYC A;  2G2B A;  1CLL A;  1LKJ A;  2I94 A;  3B87 A;  2MLE C;  1SY9 A;  2K0J A;  2Q4U A;  4OKH A;  1KSO A;  3E3R A;  3MSE B;  5F6T A;  1QS7 A;  2LHL A;  2MJW B;  2LMT A;  3OB2 B;  1C7V A;  1S5G Z;  1AUI B;  1BT6 A;  2LP3 A;  4DUQ A;  1CMF A;  3BOW A;  3GK1 A;  1KFX S;  1XYD A;  3PM8 A;  3SG5 A;  3WXA A;  1WRL A;  5CSF A;  2L4H A;  1EXR A;  4AQJ A;  3EVV A;  2LVI A;  1WLZ A;  3KPX A;  3SIB A;  4AQI A;  1EG4 A;  1F54 A;  1IIO A;  3L4A A;  2K2A A;  1W7J B;  3L4L A;  2KGR A;  4INW A;  4YGD B;  4YGE B;  2FOT A;  2ZND A;  3CDN A;  2ZNE A;  4PHK A;  1K96 A;  1OOH A;  2A4J A;  2L51 A;  2LAP A;  1NCX A;  4GGN A;  3VRO A;  1WY9 A;  2BCX A;  2L0P A;  3AKB A;  5AEQ A;  1AHR A;  1LA0 A;  1XK4 C;  3R1O A;  4QJ4 B;  1EH2 A;  1YRU B;  3SS4 A;  2K7B A;  2L50 A;  4Q04 A;  3DVK A;  1LVC D;  1DGU A;  1SMG A;  3PJI A;  2COL B;  3LK0 A;  3NSI A;  1J55 A;  1EJ3 A;  4FQO A;  2KFG A;  5HLO A;  2M7L A;  1DTL A;  1NYA A;  2E30 A;  1X02 A;  2NCO A;  2PAL A;  3FE6 A;  2JNX A;  1KSM A;  3BOW B;  1CDP A;  3KHE A;  3OHM B;  1UUS A;  1UUR A;  1GGW A;  2PSR A;  4CPV A;  1CDL A;  2WCF A;  4JWQ A;  2JPT A;  2LHI A;  2Y1N A;  1QXP A;  3BQ3 A;  3SIA A;  3AKA A;  3V2L A;  3RLZ A;  4A4B A;  2LAN A;  1OSA A;  1B7T Y;  5KTY A;  1JF0 A;  1FI6 A;  2LLS A;  1F55 A;  1RWY A;  3KO0 A;  1WRZ A;  2NZ0 A;  1OMR A;  1ZMZ A;  3EKJ A;  1A75 A;  2L4I A;  2BL0 C;  2PRU A;  1U5I A;  2PYQ A;  2GGZ A;  1K2H A;  1CMG A;  3VRQ A;  1CDM A;  3LL8 B;  1SCM B;  3LLE A;  4R1E A;  2LV7 A;  5CPV A;  4I5L B;  3QRX A;  4C0J A; 
#chains in the Genus database with same CATH homology
 2LC5 A;  4GAO A;  1TOP A;  2O60 A;  3CS1 A;  1G4Y R;  2BBN A;  1YX8 A;  3NSO A;  4GPL B;  3ZNI A;  1F4O A;  2QAC A;  4YI9 A;  3A4U B;  4PCW A;  1ZOT B;  3LK1 A;  4GBA A;  1MR8 A;  1XFU O;  3I5G C;  2ZKM X;  2D8N A;  2KSP A;  4QJ5 B;  1DVI A;  2F3Y A;  2M1U A;  1F8H A;  1XVJ A;  2F2P A;  4PDZ A;  5HKY A;  1B47 A;  5D7F A;  2KI6 C;  1CFF A;  3O4Y A;  1SKT A;  2LLU A;  3TDZ A;  1SK6 D;  1CFC A;  1IQ3 A;  1BR4 B;  2NCP A;  2KBM A;  4I5K A;  2KNE A;  1FBV A;  1QAT A;  1A4P A;  4PHN A;  4M2O A;  1GGZ A;  4GNK B;  5DKN A;  4P5O E;  1ZAC A;  1TNW A;  2M0R A;  1S1E A;  1REC A;  1NCZ A;  2LCP A;  4BY5 A;  3BYA A;  2JT3 A;  3K21 A;  1TNX A;  2ZFD A;  3GOF A;  2K61 A;  2MRD A;  4FTG A;  3VRR A;  1B9A A;  2EHB A;  2KHN A;  1QLS A;  2JWW A;  1JSA A;  1K93 D;  1QX5 B;  2JTZ A;  1BOD A;  3BUN B;  2KFH A;  2KAY A;  2I7A A;  4MZL A;  4XYN A;  1QV1 A;  2WC8 A;  4MVF A;  2LMV A;  3OB1 B;  1KK7 Y;  1YRT B;  4NDB A;  5HKW A;  1B8L A;  5G08 A;  4WQ3 A;  2M7N A;  2OPO A;  2OTG B;  1ALV A;  2KOT A;  2KQY A;  1H4B A;  1NX1 A;  1SNL A;  1FF1 A;  2M49 B;  4ICB A;  1M31 A;  4U8D A;  2NLN A;  5ER5 A;  2BBM A;  2PAS A;  1BR1 B;  1NX3 A;  4P2Y B;  3I5F B;  3O2P A;  4HRG A;  4XJK B;  2EC6 C;  1OQP A;  4DRW A;  2CXJ A;  5CSI A;  5I2O A;  2JRF A;  2M97 A;  2ZRS A;  3TZ1 A;  1AK8 A;  2WOS A;  3CLN A;  4NQG A;  4PE4 A;  4UPG A;  1J7R A;  1CM1 A;  1JF2 A;  1KQM B;  5BPJ A;  1C07 A;  4OR9 B;  1B8C A;  3DF0 B;  5AFP A;  1KWO B;  1UHI A;  4YRU A;  1M39 A;  1QVI Z;  2CNP A;  1KK8 C;  3D10 A;  5CSN A;  2JOJ A;  3VGO A;  1OZO A;  1IRJ A;  2LE9 B;  2BKI B;  3SG2 A;  2WCB A;  3DD4 A;  2JT0 A;  1MXL C;  2JQ6 A;  2KI4 B;  1N2D A;  1A29 A;  3CTN A;  1HT9 A;  2O5G A;  2HPS A;  1OE9 B;  4ZCV A;  5J3X A;  4D1E A;  1K95 A;  4C0K A;  5AXI A;  1NCY A;  2F33 A;  5DKQ A;  3FWC A;  1BJF A;  2ISD A;  3SG6 A;  3CR2 A;  1H8B A;  2SAS A;  1Y0V H;  4TNC A;  1QLK A;  3JVT C;  3PFV A;  1SCM C;  4E68 A;  2MA2 A;  1E8A A;  1UHN A;  3EVR A;  3FIA A;  1SL8 A;  1JFK A;  4WQ2 A;  3BUO B;  2GV5 A;  1B8R A;  4PHJ A;  1W7I B;  1WDC B;  2H61 A;  2HQW A;  1L7Z A;  3EKH A;  2PMY A;  1YTZ C;  4YBH B;  1XO5 A;  3OX6 A;  4MN0 A;  3PSR A;  1PSB A;  1PUL A;  1QTX A;  3OX5 A;  4OCI A;  2JTT A;  3TDI A;  5DKR A;  2KYF A;  1ZFS A;  5TNC A;  1DJY A;  1SRA A;  1CDN A;  4ORA B;  4ETO A;  1MF8 B;  3SJS A;  1IGV A;  2SCP A;  1UHK A;  2H2K A;  5K89 A;  1YR5 A;  1BF5 A;  3CR4 X;  1RFJ A;  5IBW A;  1MQ1 A;  1XFY O;  4CFQ A;  4PHM A;  3AAK A;  1N65 A;  2LVK A;  3FWB A;  1QAS A;  1J1E A;  2JXC A;  1TNP A;  1OZS A;  1IJ6 A;  4HSZ A;  4YGB B;  3VRP A;  4NDD A;  1PVA A;  1WRK A;  2JC2 A;  1B4C A;  2KFF A;  3DVJ A;  4AOM A;  4MRY A;  4N1F A;  1K90 D;  2L5X B;  1J7Q A;  1S6J A;  4CLN A;  2CCM A;  1FI5 A;  2I2R E;  4A4C A;  1V1G A;  3IF7 A;  3TUY B;  4MZJ A;  1SW8 A;  2IS9 A;  3IQO A;  4NDC A;  4F0Z B;  1D1O A;  1N0Y A;  2TN4 A;  1TNQ A;  1CNP A;  1YVH A;  1UP5 A;  4DCK A;  3EK8 A;  2M3W A;  1RRO A;  3WHT B;  1KK7 Z;  1JBA A;  1XA5 A;  3BUW B;  1OMD A;  4BY4 A;  5HYD A;  5GQQ C;  3KEV A;  1MUX A;  1DJI A;  2P6B B;  1HQV A;  1SL9 A;  3I5H B;  2M9G A;  1Y1U A;  4MZK A;  1LIN A;  3CWG A;  1PSR A;  2K8M B;  2Y1M A;  4PE7 A;  4XJK A;  3BUX B;  1S36 A;  2V53 A;  3EK7 A;  5FYX A;  3I5I B;  1K9P A;  3D0Y B;  3I5F C;  2JUL A;  3JTD B;  4IL1 A;  4MRX A;  1XFW O;  5AER A;  1DJW A;  4I5J A;  3DF0 A;  2BEC A;  2I18 A;  2Y4Q A;  3FS7 A;  4MLW A;  1IH0 A;  1XFV O;  1AJ4 A;  1KQM C;  3PLF B;  1YX7 A;  2LNK A;  3ICB A;  5PAL A;  1KWO C;  1SYM A;  2JNF A;  4OV2 A;  1F71 A;  1DJH A;  2FJU B;  4GFT A;  2CTN A;  3NSK A;  5KSZ A;  2AMI A;  4JQ0 D;  4JPZ B;  1RK9 A;  1DGV A;  1IG5 A;  1BG1 A;  5KU1 A;  2LVV A;  3LCP C;  1L2O B;  1G33 A;  2KI4 C;  1KCY A;  3HX4 A;  3IQQ A;  1SPY A;  4PAL A;  1CLM A;  1K9U A;  3PN7 B;  4GUK A;  1SL7 A;  2JU0 A;  2JZI A;  1K9K A;  1LA3 A;  3TS5 B;  1S3P A;  3RM1 A;  1CFP A;  1S6C A;  4L9M A;  1AVS A;  1J7O A;  2BE4 A;  3DVM A;  1WLM A;  4N5X A;  1AJ5 A;  1SR6 B;  1QX7 A;  2LM5 A;  2LUX A;  4PE0 A;  1IKU A;  1A2X A;  1PK0 D;  3CR5 X;  1DF0 B;  4CFR A;  2Y5I A;  1WDC C;  2GGM A;  1TIZ A;  1R2U A;  2HF5 A;  2K2F A;  4I5N B;  1DJX A;  1B7T Z;  1TCO B;  1TTX A;  3O6B A;  4GGF A;  3KF9 A;  4DIR A;  1ODB A;  5AAN A;  2R2I A;  4DS7 A;  1Q80 A;  2F8P A;  1R6P A;  2KDH A;  1ALW A;  4GGF C;  3WHU B;  3BUM B;  3EVU A;  2M1K B;  1KFU L;  4YGA A;  2OS8 B;  2M8U A;  3DVE A;  3NXA A;  4M2Q A;  2B1U A;  3H4S E;  1PAL A;  1M46 A;  4HRH A;  1YUU A;  1XK4 A;  1SBJ A;  2LUC A;  2EC6 B;  1QIV A;  2DOQ A;  2H61 C;  4HRE E;  4YI8 A;  2LP2 A;  2MBX A;  1S5G Y;  1CKK A;  1VRK A;  1KFU S;  2BKH B;  2K7D A;  5JOL A;  4ZCU A;  1FPW A;  1V1F A;  2HET A;  1XFX O;  2KGB C;  3PAL A;  1QVI Y;  1BMO A;  3A8R A;  3TUY C;  2L2E A;  1YUS A;  1KK8 B;  2KAX A;  1CM4 A;  3VRN A;  1JC2 A;  1JWD A;  2K7C A;  1S6I A;  2BCB A;  3BXK A;  1UWO A;  4USL A;  1TCF A;  1GJY A;  2WND A;  2KI6 D;  3WNX B;  1NX0 A;  2CBL A;  1FW4 A;  1CLB A;  1CFD A;  3I5H C;  1QX2 A;  3D0Y A;  2FCE A;  1KQV A;  1RTP 1;  3JVT B;  1TRF A;  2WOR A;  1M63 B;  3I5I C;  1NP8 A;  3JTD C;  1NPQ A;  1NUB A;  1F4Q A;  1S26 D;  2WCE A;  5ER4 X;  2JT8 A;  3HCM A;  2NXQ A;  2ZRT A;  1IJ5 A;  2F3Z A;  1ZUZ A;  3AAJ A;  4CID A;  1JUO A;  1DT7 B;  1PRW A;  3CGA A;  4N1G A;  2OTG C;  5I8N A;  1MHO A;  1NIW A;  2E6W A;  1TN4 A;  2EGD A;  1GQM A;  2ZN8 A;  2MAZ A;  2BL0 B;  4MSP A;  1C7W A;  1J1D A;  4ORB B;  1AP4 A;  1DJG A;  1OMV A;  2F2O A;  3OP0 A;  1JFJ A;  5B8I B;  1A75 B;  1L2O C;  2AUC A;  2KAV A;  2CT9 A;  2MHH A;  2KQ6 A;  1U5I B;  5HLV A;  1B1G A;  1EL4 A;  1UHH A;  1F70 A;  3PN7 C;  1QJT A;  2AAO A;  1PVB A;  1A03 A;  1Y1X A;  3TS5 C;  2ZN9 A;  1SCV A;  2LVJ A;  5JJG A;  4C0L A;  2FCD A;  2MLF C;  3O78 A;  4YGC B;  1NSH A;  1BOC A;  1QV0 A;  4ORC B;  1DF0 A;  3I5G B;  1SR6 C;  5HKZ A;  2G9B A;  4PE1 A;  2JXL A;  4WRI A;  1RJV A;  2BE6 A;  1NWD A;  1BLQ A;  3PAT A;  1NX2 A;  5CSJ A;  2LLT A;  2PVB A;  4MBE A;  1OOJ A;  1YUR A;  3EK4 A;  1DJZ A;  3SG4 A;  1G8I A;  1CTR A;  3GK4 X;  1XFZ O;  2M29 A;  2Q91 A;  4OVN F;  1MXE A;  1Y1A A;  5I2L A;  1IQ5 A;  1CB1 A;  3GK2 A;  2LMU A;  2KBI A;  2HQ8 A;  2VRG A;  1LXF C;  1MWN A;  1EG3 A;  3NSL A;  3CZT X;  1YUT A;  2K7O A;  3F45 A;  3ZWH A;  1IWQ A;  2L98 A;  3C1V A;  1M45 A;  3M0W A;  1YVL A;  1K94 A;  2BCA A;  4M2P A;  4MEW A;  1J7P A;  2OS8 C;  1Y6W A;  3SG3 A;  1K8U A;  1BU3 A;  1UHJ A;  4QJ3 B;  3SG7 A;  2QPT A;  1KFX L;  5D69 A;  5I2Q A;  1DMO A;  1QIW A;  3TDU A;  2RGI A;  2KYC A;  2G2B A;  1CLL A;  1LKJ A;  2I94 A;  2MLE C;  1SY9 A;  2K0J A;  2Q4U A;  4OKH A;  1KSO A;  3E3R A;  3MSE B;  5F6T A;  1QS7 A;  2LHL A;  2MJW B;  2LMT A;  3OB2 B;  1C7V A;  1S5G Z;  1AUI B;  1BT6 A;  2LP3 A;  4DUQ A;  1CMF A;  3BOW A;  3GK1 A;  1KFX S;  1XYD A;  3PM8 A;  3SG5 A;  3WXA A;  1WRL A;  5CSF A;  2L4H A;  1EXR A;  4AQJ A;  3EVV A;  2LVI A;  1WLZ A;  3KPX A;  3SIB A;  4AQI A;  1EG4 A;  1F54 A;  2K2A A;  1W7J B;  2KGR A;  4YGD B;  4YGE B;  2FOT A;  2ZND A;  2ZNE A;  4PHK A;  1K96 A;  2A4J A;  2L51 A;  2LAP A;  1NCX A;  4GGN A;  3VRO A;  1WY9 A;  2BCX A;  2L0P A;  3AKB A;  5AEQ A;  1AHR A;  1LA0 A;  1XK4 C;  4QJ4 B;  1EH2 A;  1YRU B;  2K7B A;  2L50 A;  4Q04 A;  3DVK A;  1LVC D;  1DGU A;  1SMG A;  2COL B;  3LK0 A;  3NSI A;  1J55 A;  1EJ3 A;  4FQO A;  2KFG A;  5HLO A;  2M7L A;  1DTL A;  1NYA A;  2E30 A;  1X02 A;  2NCO A;  2PAL A;  2JNX A;  1KSM A;  3BOW B;  1CDP A;  3KHE A;  3OHM B;  1UUS A;  1UUR A;  1GGW A;  2PSR A;  4CPV A;  1CDL A;  2WCF A;  4JWQ A;  2JPT A;  2LHI A;  2Y1N A;  1QXP A;  3BQ3 A;  3SIA A;  3AKA A;  3RLZ A;  4A4B A;  2LAN A;  1OSA A;  1B7T Y;  5KTY A;  1JF0 A;  1FI6 A;  2LLS A;  1F55 A;  1RWY A;  3KO0 A;  1WRZ A;  2NZ0 A;  1OMR A;  1ZMZ A;  3EKJ A;  1A75 A;  2L4I A;  2BL0 C;  2PRU A;  1U5I A;  2GGZ A;  1K2H A;  1CMG A;  3VRQ A;  1CDM A;  3LL8 B;  1SCM B;  3LLE A;  4R1E A;  2LV7 A;  5CPV A;  4I5L B;  3QRX A;  4C0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...