1IGVA

Bovine calbindin d9k binding mn2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN, INTESTINAL
publication title Structural basis for the negative allostery between Ca(2+)- and Mg(2+)-binding in the intracellular Ca(2+)-receptor calbindin D9k.
pubmed rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1igvA00
5HKZA 1J7RA 3GK2A 5KU1A 5KSZA 3DF0B 3JTDB 3MSEB 1IQ3A 1WDCC 2F2PA 2KGRA 3VRRA 5HYDA 1KK7Z 2LM5A 2GGMA 5BPJA 4C0JA 2RGIA 2OS8B 2WORA 5DKNA 1NX0A 1F4OA 2M49B 4M2OA 4WQ3A 4UPGA 5DKQA 1S3PA 5TNCA 3EVRA 5B8IB 1RK9A 4YGDB 3EKJA 1A4PA 2B1UA 2K8MB 1CMGA 4MZKA 4MLWA 1QTXA 1J7OA 1TIZA 1WRLA 3RM1A 1QLKA 2KAXA 4IL1A 2KAVA 2JXCA 1PSBA 1C07A 1CFDA 3HX4A 1M45A 2EC6C 2NCOA 2KI6D 4GGNA 4AOMA 1BMOA 3JVTB 2K0JA 1OMVA 1CFFA 2R2IA 5F6TA 1YUUA 2BCXA 1OMRA 1S6JA 3DVJA 3LL8B 1F4QA 5I2LA 3NSOA 2K2AA 1BLQA 2WCBA 5AXIA 3RLZA 4XJKB 4C0KA 1XVJA 4NDCA 2QPTA 2JQ6A 2K2FA 2GGZA 3SG6A 3ZWHA 3F45A 2GV5A 4YBHB 1SPYA 2M8UA 2VRGA 2LV7A 3NXAA 1V1FA 2WNDA 1QXPA 3VROA 2Y1MA 1JSAA 2EHBA 5AERA 3PN7C 3FIAA 2BBMA 5G08A 1SY9A 5JOLA 1IH0A 2PVBA 2LMTA 2LVKA 3I5FC 3PATA 2E30A 1K9PA 4E68A 1BU3A 1AUIB 1BR1B 1JF2A 3O6BA 4U8DA 1DGUA 3CGAA 1SBJA 1FBVA 4CLNA 1MR8A 3PFVA 3GK4X 1PVAA 2BKHB 2M7LA 1N65A 2CT9A 2BKIB 2H2KA 1H4BA 2KI4C 4PHNA 5IBWA 1CDPA 1KSMA 3D0YB 3SG4A 1DF0A 4DRWA 3O2PA 2F3YA 2ZNEA 2MLFC 4DS7A 5KTYA 1QVIZ 1HT9A 2M1UA 3TUYC 3GOFA 2K61A 4GGFA 2OTGB 4QJ5B 4YGAA 1RWYA 2LHIA 3CLNA 2KBIA 3KF9A 1F54A 2H61C 3K21A 1UHHA 4GNKB 5AFPA 5CSJA 2M7NA 1CB1A 2KOTA 4PCWA 2KAYA 1NCXA 5FYXA 1GQMA 3H4SE 2JULA 1YUTA 4A4CA 3WXAA 2FCEA 1OQPA 2ZN8A 4USLA 3DD4A 3BOWB 2JPTA 2PRUA 1WY9A 3D10A 1ZOTB 1LKJA 1KFXL 3TDUA 1IG5A 2JT0A 3O4YA 3NSLA 2LC5A 2M1KB 2G2BA 4PDZA 1G8IA 1KK7Y 2NCPA 1NWDA 1JUOA 1ZFSA 1EH2A 3BUOB 1YRTB 2LNKA 1RECA 2HF5A 4YI9A 2Y1NA 1A75B 1K9KA 2M9GA 2ZNDA 2TN4A 3ICBA 2LLSA 1IWQA 1IRJA 4MEWA 1S6CA 1S26D 1AHRA 3EVUA 2BCAA 3KPXA 4QJ3B 3AAKA 1YX7A 2AMIA 3SG5A 4YGBB 1Y1AA 1K2HA 1QX2A 1K93D 1ALWA 4I5JA 4R1EA 2Y4QA 1ODBA 1NCZA 2NLNA 3LK1A 2ZRSA 1QS7A 2KI6C 1H8BA 4GGFC 1RFJA 3EK8A 4GBAA 1Q80A 2NXQA 2KBMA 4PALA 1FW4A 4XJKA 1B1GA 1K96A 4HRHA 2EGDA 2G9BA 3OP0A 1IQ5A 1OZSA 3BXKA 1KQVA 1G33A 1NX3A 1IJ5A 1TCOB 1UURA 1SNLA 1AJ4A 2LANA 2I94A 2K7OA 2ZN9A 3BUWB 3IF7A 2L5XB 4I5LB 2SCPA 2O5GA 1DVIA 2HQWA 3O78A 1F71A 2KQ6A 1BODA 3I5HC 1YR5A 2E6WA 2BE4A 4JPZB 2MA2A 2OPOA 3PM8A 1X02A 4DIRA 1SCMC 1C7VA 2JT8A 1MXLC 2P6BB 1QX7A 1YVHA 2PMYA 3CR5X 4L9MA 2H61A 4BY4A 4QJ4B 2MHHA 1K8UA 1KWOB 1NIWA 4PE1A 3EVVA 1F8HA 3NSKA 4JWQA 1BR4B 3TS5C 2A4JA 3JTDC 3SG3A 4GPLB 1B47A 1DJIA 2OS8C 1QJTA 1AK8A 3TDZA 3WHUB 4MZJA 4WRIA 3FWCA 1F70A 1BJFA 1QVIY 2WCFA 1YRUB 1PRWA 1XFVO 1TN4A 5CPVA 1TTXA 1MWNA 1U5IA 2JWWA 3IQQA 5ER5A 3KEVA 1JC2A 3PN7B 1EXRA 2AAOA 1SRAA 1KCYA 2LVIA 2LUCA 1NSHA 1DJHA 4FTGA 1R2UA 4GAOA 1A2XA 1K94A 2F2OA 4M2PA 4OR9B 4ORCB 2F33A 4C0LA 1GJYA 4HRGA 5HKWA 3JVTC 4D1EA 3TDIA 3BUNB 1Y6WA 1XA5A 1E8AA 2BL0B 2L4HA 2ZKMX 4F0ZB 2LHLA 2KGBC 1A29A 1G4YR 2L0PA 3BOWA 2WOSA 3CZTX 1V1GA 3CR4X 2ISDA 3PSRA 1SR6C 3EK4A 1DJZA 1FI5A 1PSRA 3TUYB 1L2OB 1TNPA 1KK8C 1N0YA 4N1GA 2D8NA 3KHEA 1BOCA 1XO5A 2HQ8A 1KQMB 1RJVA 2L2EA 3I5IB 1WRKA 1OE9B 3VGOA 1L7ZA 3VRQA 1RTP1 2K7BA 3LK0A 2M97A 1C7WA 2WCEA 1J1DA 3DVKA 1SW8A 1A75A 2F8PA 4PE4A 2HETA 3FS7A 3QRXA 3A8RA 5CSIA 1TCFA 3AKAA 2WC8A 1N2DA 1S5GZ 4YI8A 1YUSA 4YGEB 2M29A 1NP8A 1S36A 3HCMA 2BECA 2K7DA 4N5XA 1PULA 4Q04A 1FPWA 2Q4UA 1QV1A 1UWOA 3CTNA 4N1FA 2JXLA 3BUMB 3I5GB 2KFGA 1B7TZ 1EJ3A 2OTGC 5D69A 1IKUA 1DJWA 1NYAA 1MXEA 1UHKA 2LLUA 1S6IA 3DF0A 1F55A 1M63B 1UHJA 1YURA 4NDDA 1J7PA 1ZUZA 2PASA 1CNPA 1MQ1A 2LP2A 1CFCA 2CBLA 1B8CA 1PVBA 2JOJA 4NQGA 1LA3A 2ZFDA 1CLMA 4FQOA 5I2OA 1GGZA 2JNXA 1AVSA 1DMOA 2M0RA 1SYMA 1EG3A 3CWGA 1DF0B 1CLBA 2JNFA 1LVCD 1W7IB 2CNPA 1XFYO 1VRKA 2BCBA 1WRZA 4BY5A 4HSZA 5HLVA 1XFXO 1TNWA 1WDCB 5ER4X 1SK6D 4MZLA 1MUXA 4OVNF 3VRPA 1IJ6A 1PALA 3WHTB 1CDMA 1CM4A 3PALA 1NCYA 1JF0A 1Y1UA 1ZACA 1YVLA 1ZMZA 4ZCUA 3SG2A 5GQQC 4YRUA 1CFPA 1BF5A 3LLEA 3C1VA 5D7FA 4AQJA 2CCMA 1XK4A 2KFFA 3DVEA 2EC6B 3KO0A 1DT7B 4OCIA 4I5KA 4YGCB 2JT3A 5CSNA 2LVJA 2BBNA 3TS5B 2MJWB 1QATA 1Y1XA 3EKHA 1RROA 1TOPA 1QLSA 2PSRA 4XYNA 4ORAB 3OHMB 1UHIA 1B8RA 3CR2A 4GFTA 2ZRTA 5PALA 1K9UA 3D0YA 4P5OE 4PHJA 1UUSA 3EK7A 1KFUL 4I5NB 1OSAA 1DJYA 2JZIA 1QASA 2L4IA 1QX5B 2MBXA 1JFJA 1AJ5A 1CLLA 1SL9A 1DJXA 3OX6A 4NDBA 1CTRA 2AUCA 5I8NA 2JC2A 2L50A 1WLMA 1QIVA 2I2RE 3SJSA 2MAZA 1KWOC 4ORBB 4PE0A 3I5FB 1HQVA 3WNXB 4A4BA 2KNEA 3M0WA 1UP5A 2BE6A 3DVMA 4DUQA 1S5GY 1IGVA 4OV2A 1GGWA 2COLB 5HKYA 2LVVA 1NUBA 3E3RA 4M2QA 1BT6A 1KSOA 1MHOA 2LMUA 1K90D 2KI4B 4CIDA 1K95A 1SCVA 5DKRA 1MF8B 1SR6B 3FWBA 1KFUS 4MRYA 1ALVA 3LCPC 5JJGA 1KK8B 1B7TY 1LXFC 3PLFB 1CMFA 2KYCA 4MN0A 2I18A 5AANA 2JTTA 4MBEA 2JTZA 1XK4C 1CM1A 2Y5IA 2K7CA 5AEQA 2PALA 2LE9B 2SASA 1B8LA 3SIAA 1XYDA 1JWDA 1TNQA 1OMDA 2BL0C 1M31A 1SMGA 3ZNIA 1DTLA 1JBAA 3BUXB 3NSIA 3OB1B 4JQ0D 4ETOA 4CFQA 1B9AA 1J1EA 3IQOA 4GUKA 3CS1A 1S1EA 1XFUO 4WQ2A 1NX1A 1U5IB 1CDLA 2L98A 1NX2A 1DGVA 1L2OC 1LA0A 2I7AA 1UHNA 2HPSA 2LP3A 4CFRA 5CSFA 1BG1A 1KQMC 2M3WA 2KQYA 3I5IC 2FJUB 4PHKA 3OB2B 4CPVA 2JU0A 1LINA 1M46A 1TNXA 2L51A 2KFHA 2LUXA 2V53A 3OX5A 1DJGA 4DCKA 2O60A 1QIWA 2Q91A 1J55A 2KDHA 1QV0A 3AKBA 1SL8A 1A03A 1W7JB 1EG4A 1YX8A 1D1OA 1SKTA 2MLEC 1M39A 1OZOA 1J7QA 5I2QA 2JRFA 2FCDA 5HLOA 2CTNA 1WLZA 4ICBA 2LAPA 2IS9A 4PE7A 4AQIA 1CDNA 1JFKA 3I5GC 1CKKA 4MRXA 4TNCA 1TRFA 4P2YB 2KHNA 4MSPA 5K89A 3SIBA 3AAJA 3BYAA 2LLTA 2DOQA 3VRNA 2CXJA 2KSPA 2FOTA 3SG7A 2LCPA 4HREE 2F3ZA 2LMVA 1XFZO 3TZ1A 1AP4A 3GK1A 3BQ3A 1NPQA 1R6PA 4PHMA 5J3XA 1B4CA 3I5HB 1PK0D 1KFXS 4MVFA 4OKHA 2NZ0A 1FI6A 1YTZC 1FF1A 1SCMB 1Y0VH 2KYFA 1XFWO 1OOJA 1SL7A 3A4UB 2MRDA 2QACA 1EL4A 4ZCVA
chains in the Genus database with same CATH superfamily
5HKZA 1XFRA 1J7RA 3GK2A 3IVTA 3D75A 5KU1A 5KSZA 3DF0B 4INWA 3JTDB 3MSEB 1IQ3A 1WDCC 2F2PA 2KGRA 3VRRA 5HYDA 1KK7Z 2LM5A 2GGMA 5BPJA 4C0JA 2RGIA 2OS8B 2WORA 5DKNA 1NX0A 1F4OA 2M49B 4M2OA 4WQ3A 4UPGA 5DKQA 1S3PA 5TNCA 3EVRA 5B8IB 1RK9A 4YGDB 3EKJA 1A4PA 2B1UA 2K8MB 3R1VA 1CMGA 4MZKA 4MLWA 1QTXA 1J7OA 1TIZA 1WRLA 3RM1A 1QLKA 2KAXA 4IL1A 4OZDA 2KAVA 2JXCA 3BFHA 1PSBA 3BFAA 1C07A 1CFDA 3HX4A 1M45A 2EC6C 2NCOA 2KI6D 4GGNA 4AOMA 1BMOA 3FE9A 3JVTB 2K0JA 1OMVA 1CFFA 2WCLA 2R2IA 5F6TA 1YUUA 1OMRA 2BCXA 1S6JA 3DVJA 3LL8B 1F4QA 5I2LA 3NSOA 2K2AA 4JD9A 1BLQA 2WCBA 5AXIA 3RLZA 4XJKB 4C0KA 1XVJA 3L4LA 2QPTA 4NDCA 2JQ6A 2K2FA 2GGZA 3SG6A 3ZWHA 3F45A 2GV5A 4YBHB 1SPYA 2M8UA 2VRGA 2LV7A 3NXAA 1V1FA 2WNDA 3EG5B 1QXPA 3VROA 2Y1MA 1JSAA 2EHBA 5AERA 3PN7C 1DQEA 1TWOA 4F7FA 3FIAA 2BBMA 5DICA 2BNXA 2L5YA 5G08A 1SY9A 5JOLA 1IH0A 2PVBA 2LMTA 2LVKA 3I5FC 3PATA 1ORGA 2E30A 1K9PA 4E68A 1BU3A 1AUIB 1BR1B 1JF2A 3O6BA 4U8DA 1DGUA 3CGAA 1SBJA 1FBVA 4CLNA 1MR8A 3PFVA 3GK4X 1PVAA 2BKHB 2KLEA 2M7LA 1N65A 2CT9A 2BKIB 2H2KA 1H4BA 2KI4C 4PHNA 5IBWA 1CDPA 1KSMA 3D0YB 3PM2A 3SG4A 1DF0A 4DRWA 3O2PA 2F3YA 2ZNEA 2MLFC 4DS7A 5KTYA 1QVIZ 2P70A 1HT9A 2M1UA 3TUYC 3GOFA 2K61A 3CZ2A 3SS3A 4GGFA 2OTGB 3UNWA 4QJ5B 4YGAA 1RWYA 2LHIA 3CLNA 2KBIA 3KF9A 1F54A 2H61C 3K21A 1UHHA 4GNKB 5AFPA 5CSJA 5HL1A 2M7NA 3SS4A 1DC1A 1CB1A 2KOTA 4PCWA 2KAYA 1NCXA 5FYXA 1GQMA 3H4SE 2JULA 1YUTA 3R1PA 4A4CA 3WXAA 1OOFA 2FCEA 1OQPA 2ZN8A 4USLA 3DD4A 3BOWB 3K1EA 2JPTA 2PRUA 1WY9A 3CZ0A 1ZOTB 1LKJA 1P28A 1KFXL 3D10A 1IG5A 2JT0A 3TDUA 3O4YA 3NSLA 2LC5A 2M1KB 2G2BA 4PDZA 1G8IA 1KK7Y 2NCPA 3NGVA 1NWDA 1JUOA 1ZFSA 1EH2A 3BUOB 1YRTB 2LNKA 1RECA 2HF5A 3DY9A 2Y1NA 4YI9A 2KPHA 5EL2A 1A75B 1K9KA 2M9GA 2ZNDA 2TN4A 4INXA 3ICBA 2LLSA 1IWQA 4PT1A 3B86A 1IRJA 4MEWA 1S6CA 1S26D 1AHRA 3EVUA 2BCAA 3KPXA 3N7HA 4QJ3B 3D77A 3AAKA 1YX7A 2AMIA 3SG5A 4YGBB 1Y1AA 1K2HA 1QX2A 2QDIA 1K93D 1ALWA 1T14A 2H8VA 4I5JA 4R1EA 2Y4QA 4FQTA 1ODBA 1NCZA 2NLNA 3LK1A 1LS8A 1QS7A 2ZRSA 2KI6C 1Z2CB 1H8BA 4GGFC 1RFJA 3EK8A 2YGUA 4GBAA 1Q80A 2NXQA 2KBMA 3PJIA 4PALA 1FW4A 4XJKA 1B1GA 1K96A 4HRHA 2EGDA 2G9BA 3CYZA 3OP0A 1IQ5A 1OZSA 3BXKA 1KQVA 1G33A 3S0DA 1NX3A 1IJ5A 1TCOB 1UURA 1SNLA 1AJ4A 2LANA 2I94A 2K7OA 2ZN9A 3BUWB 3IF7A 2L5XB 4I5LB 3S0BA 2SCPA 2O5GA 1DVIA 2HQWA 3O78A 1TUZA 1F71A 2KQ6A 1BODA 2WCJA 3I5HC 1YR5A 2E6WA 2BE4A 3B87A 4JPZB 2MA2A 2OPOA 3PM8A 1X02A 4DIRA 1SCMC 5FI2A 1C7VA 2JT8A 1MXLC 2P6BB 1DEKA 1QX7A 1YVHA 2PMYA 3CR5X 4L9MA 2H61A 4BY4A 4QJ4B 2MHHA 1K8UA 1KWOB 1NIWA 4PE1A 3EVVA 1F8HA 3NSKA 4JWQA 2WC6A 1BR4B 3TS5C 2A4JA 3JTDC 5D3OA 3SG3A 4GPLB 1B47A 1DJIA 2OS8C 1QJTA 1AK8A 3TDZA 3WHUB 4MZJA 4WRIA 2JPOA 3FWCA 1F70A 1BJFA 2QEHA 1QVIY 2WCFA 1YRUB 1PRWA 1XFVO 1TN4A 5CPVA 1TTXA 1MWNA 1U5IA 2JWWA 3IQQA 5ER5A 3KEVA 1JC2A 3PN7B 1EXRA 2AAOA 1SRAA 1KCYA 2LVIA 2LUCA 1NSHA 1DJHA 4FTGA 1R2UA 3FE6A 4GAOA 1A2XA 1K94A 2F2OA 4M2PA 4OR9B 4ORCB 3UO9A 3CABA 2F33A 4C0LA 2P71A 1GJYA 4HRGA 5HKWA 1OOIX 3JVTC 4D1EA 4IJ7A 3TDIA 3BUNB 1Y6WA 1XA5A 1E8AA 2BL0B 2L4HA 2ZKMX 1IIOA 4F0ZB 2LHLA 2KGBC 1A29A 1G4YR 2L0PA 3BOWA 2WOSA 3CZTX 5FI7A 1V1GA 2K60A 3CR4X 2WCMA 2ISDA 3PSRA 1OW4A 1SR6C 3EK4A 1DJZA 1FI5A 1PSRA 3TUYB 1L2OB 1TNPA 1KK8C 1N0YA 4N1GA 2D8NA 2PYQA 3KHEA 1BOCA 1XO5A 2HQ8A 1KQMB 1RJVA 2L2EA 3I5IB 1WRKA 1OE9B 3VGOA 1L7ZA 3VRQA 1RTP1 2K7BA 3LK0A 2M97A 1C7WA 1DELA 2WCEA 1J1DA 3DVKA 1SW8A 1A75A 2F8PA 4PE4A 3DZTA 2HETA 3FS7A 3QRXA 3A8RA 5CSIA 1TCFA 3AKAA 3S0GA 2WC8A 1N2DA 1S5GZ 4YI8A 1YUSA 4YGEB 2M29A 1NP8A 1S36A 3HCMA 2BECA 2K7DA 4N5XA 1PULA 4Q04A 1FPWA 2Q4UA 1QV1A 1UWOA 3CTNA 4N1FA 3CDNA 2JXLA 2WC5A 3BUMB 3I5GB 2KFGA 2PQLA 1B7TZ 1EJ3A 2OTGC 5D69A 1IKUA 1DJWA 1NYAA 1MXEA 1UHKA 2LLUA 1S6IA 3DF0A 3BFBA 1M63B 1F55A 1UHJA 1YURA 4NDDA 1J7PA 1ZUZA 2PASA 1CNPA 1MQ1A 2LP2A 1CFCA 2CBLA 1B8CA 1PVBA 2JOJA 4NQGA 1LA3A 2ZFDA 1CLMA 4FQOA 4JKTA 5I2OA 1GGZA 2JNXA 1AVSA 1DMOA 2M0RA 3CZ1A 1SYMA 1EG3A 1C3YA 3CWGA 3D74A 1DF0B 3B88A 1CLBA 2JNFA 1LVCD 1W7IB 2CNPA 1XFYO 3Q8IA 3OGNA 1VRKA 2BCBA 1WRZA 4BY5A 4HSZA 5HLVA 1XFXO 2QEOA 1TNWA 1WDCB 3R72A 5ER4X 1SK6D 4MZLA 1MUXA 4OVNF 3DXLA 3VRPA 1IJ6A 1PALA 3WHTB 3DYEA 4KYNA 5FI6A 1CDMA 1CM4A 3PALA 1NCYA 1JF0A 1Y1UA 1ZACA 1YVLA 1ZMZA 3S0EA 4ZCUA 3SG2A 3S0AA 5GQQC 4YRUA 1CFPA 1BF5A 3LLEA 3C1VA 1OOGA 5D7FA 4AQJA 2CCMA 1XK4A 2KFFA 3DVEA 2EC6B 3KO0A 1DT7B 4OCIA 4I5KA 4YGCB 3NHIA 2BAPA 2JT3A 5CSNA 1OOHA 3FE8A 3VB1A 2LVJA 2BBNA 3TS5B 2MJWB 1QATA 1Y1XA 3EKHA 1RROA 1TOPA 1QLSA 2PSRA 4XYNA 4ORAB 3OHMB 1UHIA 1GM0A 1B8RA 3CR2A 3SS5A 4GFTA 2ZRTA 5PALA 1K9UA 3D0YA 4P5OE 4PHJA 3O4XA 1UUSA 3EK7A 1KFUL 4I5NB 1OSAA 1DJYA 2JZIA 1QASA 2L4IA 1QX5B 2MBXA 1JFJA 1AJ5A 1CLLA 1SL9A 1DJXA 3OX6A 4NDBA 1CTRA 2AUCA 5I8NA 2JC2A 2L50A 1WLMA 1QIVA 2I2RE 3SJSA 2MAZA 1KWOC 4ORBB 4PE0A 3I5FB 1HQVA 3WNXB 4A4BA 2KNEA 3M0WA 1UP5A 2BE6A 3DVMA 4DUQA 1S5GY 3OBVA 1IGVA 4OV2A 1GGWA 2COLB 5HKYA 2LVVA 1NUBA 3E3RA 4M2QA 1BT6A 1KSOA 1MHOA 2LMUA 1K90D 2KI4B 2QEBA 1K95A 1SCVA 4CIDA 3S0FA 5DKRA 1MF8B 1SR6B 3BJHA 3FWBA 1KFUS 4MRYA 1ALVA 3LCPC 5I94A 5JJGA 1KK8B 1B7TY 1LXFC 3PLFB 1CMFA 2KYCA 4MN0A 2I18A 5AANA 2JTTA 4MBEA 2WCKA 2JTZA 1XK4C 1CM1A 2Y5IA 2K7CA 5AEQA 2PALA 1QWVA 2LE9B 2SASA 1B8LA 2GTEA 3SIAA 1XYDA 1JWDA 1TNQA 2L2CA 1OMDA 2BL0C 1M31A 1SMGA 3ZNIA 1DTLA 1JBAA 3BUXB 3NSIA 3OB1B 4JQ0D 3D78A 4ETOA 4CFQA 1B9AA 1J1EA 3IQOA 4GUKA 3CS1A 1S1EA 1XFUO 4WQ2A 1C3ZA 1NX1A 1U5IB 1CDLA 2L98A 1NX2A 1DGVA 1L2OC 1LA0A 2I7AA 1UHNA 2HPSA 2LP3A 4CFRA 5CSFA 1BG1A 1KQMC 2M3WA 2KQYA 3I5IC 2FJUB 4PHKA 3OB2B 4CPVA 2JU0A 1LINA 1M46A 1TNXA 2L51A 2KFHA 2LUXA 2V53A 3NHTA 3OX5A 3QMEA 1DJGA 2WCHA 4DCKA 2O60A 1QIWA 2Q91A 1J55A 2KDHA 1QV0A 3R1OA 3AKBA 1SL8A 3V2LA 1A03A 1W7JB 2ERBA 1EG4A 1YX8A 1D1OA 1SKTA 2MLEC 1Z4HA 3L47A 1M39A 2FJYA 1OZOA 1J7QA 1W9ZA 5I2QA 2JRFA 2FCDA 5HLOA 2CTNA 1WLZA 4ICBA 2LAPA 2IS9A 4PE7A 4AQIA 1CDNA 1JFKA 3I5GC 1CKKA 4MRXA 4TNCA 1TRFA 4P2YB 2KHNA 4MSPA 3L4AA 5K89A 3SIBA 3AAJA 3BYAA 2LLTA 2DOQA 3VRNA 2QEVA 2CXJA 1SSEB 2KLDA 2KSPA 3B6XA 2FOTA 3SG7A 1TUJA 3B7AA 2LCPA 4HREE 2F3ZA 2LMVA 1XFZO 3TZ1A 1AP4A 3D73A 3GK1A 3BQ3A 1NPQA 1R6PA 4PHMA 3RZSA 5J3XA 1B4CA 3I5HB 1PK0D 3D76A 1KFXS 4MVFA 4OKHA 2NZ0A 1FI6A 1YTZC 1FF1A 1SCMB 1Y0VH 2KYFA 1XFWO 1OOJA 1SL7A 3A4UB 2MRDA 2QACA 1EL4A 4ZCVA
chains in the Genus database with same CATH topology
5HKZA 1J7RA 3GK2A 5KU1A 5KSZA 3DF0B 3JTDB 3MSEB 1IQ3A 1WDCC 2F2PA 2KGRA 3VRRA 5HYDA 1KK7Z 2LM5A 2GGMA 5BPJA 4C0JA 2RGIA 2OS8B 2WORA 5DKNA 1NX0A 1F4OA 2M49B 4M2OA 4WQ3A 4UPGA 5DKQA 1S3PA 5TNCA 3EVRA 5B8IB 1RK9A 4YGDB 3EKJA 1A4PA 2B1UA 2K8MB 1CMGA 4MZKA 4MLWA 1QTXA 1J7OA 1TIZA 1WRLA 3RM1A 1QLKA 2KAXA 4IL1A 2KAVA 2JXCA 1PSBA 1C07A 1CFDA 3HX4A 1M45A 2EC6C 2NCOA 2KI6D 4GGNA 4AOMA 1BMOA 3JVTB 2K0JA 1OMVA 1CFFA 2R2IA 5F6TA 1YUUA 2BCXA 1OMRA 1S6JA 3DVJA 3LL8B 1F4QA 5I2LA 3NSOA 2K2AA 1BLQA 2WCBA 5AXIA 3RLZA 4XJKB 4C0KA 1XVJA 4NDCA 2QPTA 2JQ6A 2K2FA 2GGZA 3SG6A 3ZWHA 3F45A 2GV5A 4YBHB 1SPYA 2M8UA 2VRGA 2LV7A 3NXAA 1V1FA 2WNDA 1QXPA 3VROA 2Y1MA 1JSAA 2EHBA 5AERA 3PN7C 3FIAA 2BBMA 5G08A 1SY9A 5JOLA 1IH0A 2PVBA 2LMTA 2LVKA 3I5FC 3PATA 2E30A 1K9PA 4E68A 1BU3A 1AUIB 1BR1B 1JF2A 3O6BA 4U8DA 1DGUA 3CGAA 1SBJA 1FBVA 4CLNA 1MR8A 3PFVA 3GK4X 1PVAA 2BKHB 2M7LA 1N65A 2CT9A 2BKIB 2H2KA 1H4BA 2KI4C 4PHNA 5IBWA 1CDPA 1KSMA 3D0YB 3SG4A 1DF0A 4DRWA 3O2PA 2F3YA 2ZNEA 2MLFC 4DS7A 5KTYA 1QVIZ 1HT9A 2M1UA 3TUYC 3GOFA 2K61A 4GGFA 2OTGB 4QJ5B 4YGAA 1RWYA 2LHIA 3CLNA 2KBIA 3KF9A 1F54A 2H61C 3K21A 1UHHA 4GNKB 5AFPA 5CSJA 2M7NA 1CB1A 2KOTA 4PCWA 2KAYA 1NCXA 5FYXA 1GQMA 3H4SE 2JULA 1YUTA 4A4CA 3WXAA 2FCEA 1OQPA 2ZN8A 4USLA 3DD4A 3BOWB 2JPTA 2PRUA 1WY9A 3D10A 1ZOTB 1LKJA 1KFXL 3TDUA 1IG5A 2JT0A 3O4YA 3NSLA 2LC5A 2M1KB 2G2BA 4PDZA 1G8IA 1KK7Y 2NCPA 1NWDA 1JUOA 1ZFSA 1EH2A 3BUOB 1YRTB 2LNKA 1RECA 2HF5A 4YI9A 2Y1NA 1A75B 1K9KA 2M9GA 2ZNDA 2TN4A 3ICBA 2LLSA 1IWQA 1IRJA 4MEWA 1S6CA 1S26D 1AHRA 3EVUA 2BCAA 3KPXA 4QJ3B 3AAKA 1YX7A 2AMIA 3SG5A 4YGBB 1Y1AA 1K2HA 1QX2A 1K93D 1ALWA 4I5JA 4R1EA 2Y4QA 1ODBA 1NCZA 2NLNA 3LK1A 2ZRSA 1QS7A 2KI6C 1H8BA 4GGFC 1RFJA 3EK8A 4GBAA 1Q80A 2NXQA 2KBMA 4PALA 1FW4A 4XJKA 1B1GA 1K96A 4HRHA 2EGDA 2G9BA 3OP0A 1IQ5A 1OZSA 3BXKA 1KQVA 1G33A 1NX3A 1IJ5A 1TCOB 1UURA 1SNLA 1AJ4A 2LANA 2I94A 2K7OA 2ZN9A 3BUWB 3IF7A 2L5XB 4I5LB 2SCPA 2O5GA 1DVIA 2HQWA 3O78A 1F71A 2KQ6A 1BODA 3I5HC 1YR5A 2E6WA 2BE4A 4JPZB 2MA2A 2OPOA 3PM8A 1X02A 4DIRA 1SCMC 1C7VA 2JT8A 1MXLC 2P6BB 1QX7A 1YVHA 2PMYA 3CR5X 4L9MA 2H61A 4BY4A 4QJ4B 2MHHA 1K8UA 1KWOB 1NIWA 4PE1A 3EVVA 1F8HA 3NSKA 4JWQA 1BR4B 3TS5C 2A4JA 3JTDC 3SG3A 4GPLB 1B47A 1DJIA 2OS8C 1QJTA 1AK8A 3TDZA 3WHUB 4MZJA 4WRIA 3FWCA 1F70A 1BJFA 1QVIY 2WCFA 1YRUB 1PRWA 1XFVO 1TN4A 5CPVA 1TTXA 1MWNA 1U5IA 2JWWA 3IQQA 5ER5A 3KEVA 1JC2A 3PN7B 1EXRA 2AAOA 1SRAA 1KCYA 2LVIA 2LUCA 1NSHA 1DJHA 4FTGA 1R2UA 4GAOA 1A2XA 1K94A 2F2OA 4M2PA 4OR9B 4ORCB 2F33A 4C0LA 1GJYA 4HRGA 5HKWA 3JVTC 4D1EA 3TDIA 3BUNB 1Y6WA 1XA5A 1E8AA 2BL0B 2L4HA 2ZKMX 4F0ZB 2LHLA 2KGBC 1A29A 1G4YR 2L0PA 3BOWA 2WOSA 3CZTX 1V1GA 3CR4X 2ISDA 3PSRA 1SR6C 3EK4A 1DJZA 1FI5A 1PSRA 3TUYB 1L2OB 1TNPA 1KK8C 1N0YA 4N1GA 2D8NA 3KHEA 1BOCA 1XO5A 2HQ8A 1KQMB 1RJVA 2L2EA 3I5IB 1WRKA 1OE9B 3VGOA 1L7ZA 3VRQA 1RTP1 2K7BA 3LK0A 2M97A 1C7WA 2WCEA 1J1DA 3DVKA 1SW8A 1A75A 2F8PA 4PE4A 2HETA 3FS7A 3QRXA 3A8RA 5CSIA 1TCFA 3AKAA 2WC8A 1N2DA 1S5GZ 4YI8A 1YUSA 4YGEB 2M29A 1NP8A 1S36A 3HCMA 2BECA 2K7DA 4N5XA 1PULA 4Q04A 1FPWA 2Q4UA 1QV1A 1UWOA 3CTNA 4N1FA 2JXLA 3BUMB 3I5GB 2KFGA 1B7TZ 1EJ3A 2OTGC 5D69A 1IKUA 1DJWA 1NYAA 1MXEA 1UHKA 2LLUA 1S6IA 3DF0A 1F55A 1M63B 1UHJA 1YURA 4NDDA 1J7PA 1ZUZA 2PASA 1CNPA 1MQ1A 2LP2A 1CFCA 2CBLA 1B8CA 1PVBA 2JOJA 4NQGA 1LA3A 2ZFDA 1CLMA 4FQOA 5I2OA 1GGZA 2JNXA 1AVSA 1DMOA 2M0RA 1SYMA 1EG3A 3CWGA 1DF0B 1CLBA 2JNFA 1LVCD 1W7IB 2CNPA 1XFYO 1VRKA 2BCBA 1WRZA 4BY5A 4HSZA 5HLVA 1XFXO 1TNWA 1WDCB 5ER4X 1SK6D 4MZLA 1MUXA 4OVNF 3VRPA 1IJ6A 1PALA 3WHTB 1CDMA 1CM4A 3PALA 1NCYA 1JF0A 1Y1UA 1ZACA 1YVLA 1ZMZA 4ZCUA 3SG2A 5GQQC 4YRUA 1CFPA 1BF5A 3LLEA 3C1VA 5D7FA 4AQJA 2CCMA 1XK4A 2KFFA 3DVEA 2EC6B 3KO0A 1DT7B 4OCIA 4I5KA 4YGCB 2JT3A 5CSNA 2LVJA 2BBNA 3TS5B 2MJWB 1QATA 1Y1XA 3EKHA 1RROA 1TOPA 1QLSA 2PSRA 4XYNA 4ORAB 3OHMB 1UHIA 1B8RA 3CR2A 4GFTA 2ZRTA 5PALA 1K9UA 3D0YA 4P5OE 4PHJA 1UUSA 3EK7A 1KFUL 4I5NB 1OSAA 1DJYA 2JZIA 1QASA 2L4IA 1QX5B 2MBXA 1JFJA 1AJ5A 1CLLA 1SL9A 1DJXA 3OX6A 4NDBA 1CTRA 2AUCA 5I8NA 2JC2A 2L50A 1WLMA 1QIVA 2I2RE 3SJSA 2MAZA 1KWOC 4ORBB 4PE0A 3I5FB 1HQVA 3WNXB 4A4BA 2KNEA 3M0WA 1UP5A 2BE6A 3DVMA 4DUQA 1S5GY 1IGVA 4OV2A 1GGWA 2COLB 5HKYA 2LVVA 1NUBA 3E3RA 4M2QA 1BT6A 1KSOA 1MHOA 2LMUA 1K90D 2KI4B 4CIDA 1K95A 1SCVA 5DKRA 1MF8B 1SR6B 3FWBA 1KFUS 4MRYA 1ALVA 3LCPC 5JJGA 1KK8B 1B7TY 1LXFC 3PLFB 1CMFA 2KYCA 4MN0A 2I18A 5AANA 2JTTA 4MBEA 2JTZA 1XK4C 1CM1A 2Y5IA 2K7CA 5AEQA 2PALA 2LE9B 2SASA 1B8LA 3SIAA 1XYDA 1JWDA 1TNQA 1OMDA 2BL0C 1M31A 1SMGA 3ZNIA 1DTLA 1JBAA 3BUXB 3NSIA 3OB1B 4JQ0D 4ETOA 4CFQA 1B9AA 1J1EA 3IQOA 4GUKA 3CS1A 1S1EA 1XFUO 4WQ2A 1NX1A 1U5IB 1CDLA 2L98A 1NX2A 1DGVA 1L2OC 1LA0A 2I7AA 1UHNA 2HPSA 2LP3A 4CFRA 5CSFA 1BG1A 1KQMC 2M3WA 2KQYA 3I5IC 2FJUB 4PHKA 3OB2B 4CPVA 2JU0A 1LINA 1M46A 1TNXA 2L51A 2KFHA 2LUXA 2V53A 3OX5A 1DJGA 4DCKA 2O60A 1QIWA 2Q91A 1J55A 2KDHA 1QV0A 3AKBA 1SL8A 1A03A 1W7JB 1EG4A 1YX8A 1D1OA 1SKTA 2MLEC 1M39A 1OZOA 1J7QA 5I2QA 2JRFA 2FCDA 5HLOA 2CTNA 1WLZA 4ICBA 2LAPA 2IS9A 4PE7A 4AQIA 1CDNA 1JFKA 3I5GC 1CKKA 4MRXA 4TNCA 1TRFA 4P2YB 2KHNA 4MSPA 5K89A 3SIBA 3AAJA 3BYAA 2LLTA 2DOQA 3VRNA 2CXJA 2KSPA 2FOTA 3SG7A 2LCPA 4HREE 2F3ZA 2LMVA 1XFZO 3TZ1A 1AP4A 3GK1A 3BQ3A 1NPQA 1R6PA 4PHMA 5J3XA 1B4CA 3I5HB 1PK0D 1KFXS 4MVFA 4OKHA 2NZ0A 1FI6A 1YTZC 1FF1A 1SCMB 1Y0VH 2KYFA 1XFWO 1OOJA 1SL7A 3A4UB 2MRDA 2QACA 1EL4A 4ZCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKZ A;  1J7R A;  3GK2 A;  5KU1 A;  5KSZ A;  3DF0 B;  3JTD B;  3MSE B;  1IQ3 A;  1WDC C;  2F2P A;  2KGR A;  3VRR A;  5HYD A;  1KK7 Z;  2LM5 A;  2GGM A;  5BPJ A;  4C0J A;  2RGI A;  2OS8 B;  2WOR A;  5DKN A;  1NX0 A;  1F4O A;  2M49 B;  4M2O A;  4WQ3 A;  4UPG A;  5DKQ A;  1S3P A;  5TNC A;  3EVR A;  5B8I B;  1RK9 A;  4YGD B;  3EKJ A;  1A4P A;  2B1U A;  2K8M B;  1CMG A;  4MZK A;  4MLW A;  1QTX A;  1J7O A;  1TIZ A;  1WRL A;  3RM1 A;  1QLK A;  2KAX A;  4IL1 A;  2KAV A;  2JXC A;  1PSB A;  1C07 A;  1CFD A;  3HX4 A;  1M45 A;  2EC6 C;  2NCO A;  2KI6 D;  4GGN A;  4AOM A;  1BMO A;  3JVT B;  2K0J A;  1OMV A;  1CFF A;  2R2I A;  5F6T A;  1YUU A;  2BCX A;  1OMR A;  1S6J A;  3DVJ A;  3LL8 B;  1F4Q A;  5I2L A;  3NSO A;  2K2A A;  1BLQ A;  2WCB A;  5AXI A;  3RLZ A;  4XJK B;  4C0K A;  1XVJ A;  4NDC A;  2QPT A;  2JQ6 A;  2K2F A;  2GGZ A;  3SG6 A;  3ZWH A;  3F45 A;  2GV5 A;  4YBH B;  1SPY A;  2M8U A;  2VRG A;  2LV7 A;  3NXA A;  1V1F A;  2WND A;  1QXP A;  3VRO A;  2Y1M A;  1JSA A;  2EHB A;  5AER A;  3PN7 C;  3FIA A;  2BBM A;  5G08 A;  1SY9 A;  5JOL A;  1IH0 A;  2PVB A;  2LMT A;  2LVK A;  3I5F C;  3PAT A;  2E30 A;  1K9P A;  4E68 A;  1BU3 A;  1AUI B;  1BR1 B;  1JF2 A;  3O6B A;  4U8D A;  1DGU A;  3CGA A;  1SBJ A;  1FBV A;  4CLN A;  1MR8 A;  3PFV A;  3GK4 X;  1PVA A;  2BKH B;  2M7L A;  1N65 A;  2CT9 A;  2BKI B;  2H2K A;  1H4B A;  2KI4 C;  4PHN A;  5IBW A;  1CDP A;  1KSM A;  3D0Y B;  3SG4 A;  1DF0 A;  4DRW A;  3O2P A;  2F3Y A;  2ZNE A;  2MLF C;  4DS7 A;  5KTY A;  1QVI Z;  1HT9 A;  2M1U A;  3TUY C;  3GOF A;  2K61 A;  4GGF A;  2OTG B;  4QJ5 B;  4YGA A;  1RWY A;  2LHI A;  3CLN A;  2KBI A;  3KF9 A;  1F54 A;  2H61 C;  3K21 A;  1UHH A;  4GNK B;  5AFP A;  5CSJ A;  2M7N A;  1CB1 A;  2KOT A;  4PCW A;  2KAY A;  1NCX A;  5FYX A;  1GQM A;  3H4S E;  2JUL A;  1YUT A;  4A4C A;  3WXA A;  2FCE A;  1OQP A;  2ZN8 A;  4USL A;  3DD4 A;  3BOW B;  2JPT A;  2PRU A;  1WY9 A;  3D10 A;  1ZOT B;  1LKJ A;  1KFX L;  3TDU A;  1IG5 A;  2JT0 A;  3O4Y A;  3NSL A;  2LC5 A;  2M1K B;  2G2B A;  4PDZ A;  1G8I A;  1KK7 Y;  2NCP A;  1NWD A;  1JUO A;  1ZFS A;  1EH2 A;  3BUO B;  1YRT B;  2LNK A;  1REC A;  2HF5 A;  4YI9 A;  2Y1N A;  1A75 B;  1K9K A;  2M9G A;  2ZND A;  2TN4 A;  3ICB A;  2LLS A;  1IWQ A;  1IRJ A;  4MEW A;  1S6C A;  1S26 D;  1AHR A;  3EVU A;  2BCA A;  3KPX A;  4QJ3 B;  3AAK A;  1YX7 A;  2AMI A;  3SG5 A;  4YGB B;  1Y1A A;  1K2H A;  1QX2 A;  1K93 D;  1ALW A;  4I5J A;  4R1E A;  2Y4Q A;  1ODB A;  1NCZ A;  2NLN A;  3LK1 A;  2ZRS A;  1QS7 A;  2KI6 C;  1H8B A;  4GGF C;  1RFJ A;  3EK8 A;  4GBA A;  1Q80 A;  2NXQ A;  2KBM A;  4PAL A;  1FW4 A;  4XJK A;  1B1G A;  1K96 A;  4HRH A;  2EGD A;  2G9B A;  3OP0 A;  1IQ5 A;  1OZS A;  3BXK A;  1KQV A;  1G33 A;  1NX3 A;  1IJ5 A;  1TCO B;  1UUR A;  1SNL A;  1AJ4 A;  2LAN A;  2I94 A;  2K7O A;  2ZN9 A;  3BUW B;  3IF7 A;  2L5X B;  4I5L B;  2SCP A;  2O5G A;  1DVI A;  2HQW A;  3O78 A;  1F71 A;  2KQ6 A;  1BOD A;  3I5H C;  1YR5 A;  2E6W A;  2BE4 A;  4JPZ B;  2MA2 A;  2OPO A;  3PM8 A;  1X02 A;  4DIR A;  1SCM C;  1C7V A;  2JT8 A;  1MXL C;  2P6B B;  1QX7 A;  1YVH A;  2PMY A;  3CR5 X;  4L9M A;  2H61 A;  4BY4 A;  4QJ4 B;  2MHH A;  1K8U A;  1KWO B;  1NIW A;  4PE1 A;  3EVV A;  1F8H A;  3NSK A;  4JWQ A;  1BR4 B;  3TS5 C;  2A4J A;  3JTD C;  3SG3 A;  4GPL B;  1B47 A;  1DJI A;  2OS8 C;  1QJT A;  1AK8 A;  3TDZ A;  3WHU B;  4MZJ A;  4WRI A;  3FWC A;  1F70 A;  1BJF A;  1QVI Y;  2WCF A;  1YRU B;  1PRW A;  1XFV O;  1TN4 A;  5CPV A;  1TTX A;  1MWN A;  1U5I A;  2JWW A;  3IQQ A;  5ER5 A;  3KEV A;  1JC2 A;  3PN7 B;  1EXR A;  2AAO A;  1SRA A;  1KCY A;  2LVI A;  2LUC A;  1NSH A;  1DJH A;  4FTG A;  1R2U A;  4GAO A;  1A2X A;  1K94 A;  2F2O A;  4M2P A;  4OR9 B;  4ORC B;  2F33 A;  4C0L A;  1GJY A;  4HRG A;  5HKW A;  3JVT C;  4D1E A;  3TDI A;  3BUN B;  1Y6W A;  1XA5 A;  1E8A A;  2BL0 B;  2L4H A;  2ZKM X;  4F0Z B;  2LHL A;  2KGB C;  1A29 A;  1G4Y R;  2L0P A;  3BOW A;  2WOS A;  3CZT X;  1V1G A;  3CR4 X;  2ISD A;  3PSR A;  1SR6 C;  3EK4 A;  1DJZ A;  1FI5 A;  1PSR A;  3TUY B;  1L2O B;  1TNP A;  1KK8 C;  1N0Y A;  4N1G A;  2D8N A;  3KHE A;  1BOC A;  1XO5 A;  2HQ8 A;  1KQM B;  1RJV A;  2L2E A;  3I5I B;  1WRK A;  1OE9 B;  3VGO A;  1L7Z A;  3VRQ A;  1RTP 1;  2K7B A;  3LK0 A;  2M97 A;  1C7W A;  2WCE A;  1J1D A;  3DVK A;  1SW8 A;  1A75 A;  2F8P A;  4PE4 A;  2HET A;  3FS7 A;  3QRX A;  3A8R A;  5CSI A;  1TCF A;  3AKA A;  2WC8 A;  1N2D A;  1S5G Z;  4YI8 A;  1YUS A;  4YGE B;  2M29 A;  1NP8 A;  1S36 A;  3HCM A;  2BEC A;  2K7D A;  4N5X A;  1PUL A;  4Q04 A;  1FPW A;  2Q4U A;  1QV1 A;  1UWO A;  3CTN A;  4N1F A;  2JXL A;  3BUM B;  3I5G B;  2KFG A;  1B7T Z;  1EJ3 A;  2OTG C;  5D69 A;  1IKU A;  1DJW A;  1NYA A;  1MXE A;  1UHK A;  2LLU A;  1S6I A;  3DF0 A;  1F55 A;  1M63 B;  1UHJ A;  1YUR A;  4NDD A;  1J7P A;  1ZUZ A;  2PAS A;  1CNP A;  1MQ1 A;  2LP2 A;  1CFC A;  2CBL A;  1B8C A;  1PVB A;  2JOJ A;  4NQG A;  1LA3 A;  2ZFD A;  1CLM A;  4FQO A;  5I2O A;  1GGZ A;  2JNX A;  1AVS A;  1DMO A;  2M0R A;  1SYM A;  1EG3 A;  3CWG A;  1DF0 B;  1CLB A;  2JNF A;  1LVC D;  1W7I B;  2CNP A;  1XFY O;  1VRK A;  2BCB A;  1WRZ A;  4BY5 A;  4HSZ A;  5HLV A;  1XFX O;  1TNW A;  1WDC B;  5ER4 X;  1SK6 D;  4MZL A;  1MUX A;  4OVN F;  3VRP A;  1IJ6 A;  1PAL A;  3WHT B;  1CDM A;  1CM4 A;  3PAL A;  1NCY A;  1JF0 A;  1Y1U A;  1ZAC A;  1YVL A;  1ZMZ A;  4ZCU A;  3SG2 A;  5GQQ C;  4YRU A;  1CFP A;  1BF5 A;  3LLE A;  3C1V A;  5D7F A;  4AQJ A;  2CCM A;  1XK4 A;  2KFF A;  3DVE A;  2EC6 B;  3KO0 A;  1DT7 B;  4OCI A;  4I5K A;  4YGC B;  2JT3 A;  5CSN A;  2LVJ A;  2BBN A;  3TS5 B;  2MJW B;  1QAT A;  1Y1X A;  3EKH A;  1RRO A;  1TOP A;  1QLS A;  2PSR A;  4XYN A;  4ORA B;  3OHM B;  1UHI A;  1B8R A;  3CR2 A;  4GFT A;  2ZRT A;  5PAL A;  1K9U A;  3D0Y A;  4P5O E;  4PHJ A;  1UUS A;  3EK7 A;  1KFU L;  4I5N B;  1OSA A;  1DJY A;  2JZI A;  1QAS A;  2L4I A;  1QX5 B;  2MBX A;  1JFJ A;  1AJ5 A;  1CLL A;  1SL9 A;  1DJX A;  3OX6 A;  4NDB A;  1CTR A;  2AUC A;  5I8N A;  2JC2 A;  2L50 A;  1WLM A;  1QIV A;  2I2R E;  3SJS A;  2MAZ A;  1KWO C;  4ORB B;  4PE0 A;  3I5F B;  1HQV A;  3WNX B;  4A4B A;  2KNE A;  3M0W A;  1UP5 A;  2BE6 A;  3DVM A;  4DUQ A;  1S5G Y;  1IGV A;  4OV2 A;  1GGW A;  2COL B;  5HKY A;  2LVV A;  1NUB A;  3E3R A;  4M2Q A;  1BT6 A;  1KSO A;  1MHO A;  2LMU A;  1K90 D;  2KI4 B;  4CID A;  1K95 A;  1SCV A;  5DKR A;  1MF8 B;  1SR6 B;  3FWB A;  1KFU S;  4MRY A;  1ALV A;  3LCP C;  5JJG A;  1KK8 B;  1B7T Y;  1LXF C;  3PLF B;  1CMF A;  2KYC A;  4MN0 A;  2I18 A;  5AAN A;  2JTT A;  4MBE A;  2JTZ A;  1XK4 C;  1CM1 A;  2Y5I A;  2K7C A;  5AEQ A;  2PAL A;  2LE9 B;  2SAS A;  1B8L A;  3SIA A;  1XYD A;  1JWD A;  1TNQ A;  1OMD A;  2BL0 C;  1M31 A;  1SMG A;  3ZNI A;  1DTL A;  1JBA A;  3BUX B;  3NSI A;  3OB1 B;  4JQ0 D;  4ETO A;  4CFQ A;  1B9A A;  1J1E A;  3IQO A;  4GUK A;  3CS1 A;  1S1E A;  1XFU O;  4WQ2 A;  1NX1 A;  1U5I B;  1CDL A;  2L98 A;  1NX2 A;  1DGV A;  1L2O C;  1LA0 A;  2I7A A;  1UHN A;  2HPS A;  2LP3 A;  4CFR A;  5CSF A;  1BG1 A;  1KQM C;  2M3W A;  2KQY A;  3I5I C;  2FJU B;  4PHK A;  3OB2 B;  4CPV A;  2JU0 A;  1LIN A;  1M46 A;  1TNX A;  2L51 A;  2KFH A;  2LUX A;  2V53 A;  3OX5 A;  1DJG A;  4DCK A;  2O60 A;  1QIW A;  2Q91 A;  1J55 A;  2KDH A;  1QV0 A;  3AKB A;  1SL8 A;  1A03 A;  1W7J B;  1EG4 A;  1YX8 A;  1D1O A;  1SKT A;  2MLE C;  1M39 A;  1OZO A;  1J7Q A;  5I2Q A;  2JRF A;  2FCD A;  5HLO A;  2CTN A;  1WLZ A;  4ICB A;  2LAP A;  2IS9 A;  4PE7 A;  4AQI A;  1CDN A;  1JFK A;  3I5G C;  1CKK A;  4MRX A;  4TNC A;  1TRF A;  4P2Y B;  2KHN A;  4MSP A;  5K89 A;  3SIB A;  3AAJ A;  3BYA A;  2LLT A;  2DOQ A;  3VRN A;  2CXJ A;  2KSP A;  2FOT A;  3SG7 A;  2LCP A;  4HRE E;  2F3Z A;  2LMV A;  1XFZ O;  3TZ1 A;  1AP4 A;  3GK1 A;  3BQ3 A;  1NPQ A;  1R6P A;  4PHM A;  5J3X A;  1B4C A;  3I5H B;  1PK0 D;  1KFX S;  4MVF A;  4OKH A;  2NZ0 A;  1FI6 A;  1YTZ C;  1FF1 A;  1SCM B;  1Y0V H;  2KYF A;  1XFW O;  1OOJ A;  1SL7 A;  3A4U B;  2MRD A;  2QAC A;  1EL4 A;  4ZCV A; 
#chains in the Genus database with same CATH topology
 5HKZ A;  1XFR A;  1J7R A;  3GK2 A;  3IVT A;  3D75 A;  5KU1 A;  5KSZ A;  3DF0 B;  4INW A;  3JTD B;  3MSE B;  1IQ3 A;  1WDC C;  2F2P A;  2KGR A;  3VRR A;  5HYD A;  1KK7 Z;  2LM5 A;  2GGM A;  5BPJ A;  4C0J A;  2RGI A;  2OS8 B;  2WOR A;  5DKN A;  1NX0 A;  1F4O A;  2M49 B;  4M2O A;  4WQ3 A;  4UPG A;  5DKQ A;  1S3P A;  5TNC A;  3EVR A;  5B8I B;  1RK9 A;  4YGD B;  3EKJ A;  1A4P A;  2B1U A;  2K8M B;  3R1V A;  1CMG A;  4MZK A;  4MLW A;  1QTX A;  1J7O A;  1TIZ A;  1WRL A;  3RM1 A;  1QLK A;  2KAX A;  4IL1 A;  4OZD A;  2KAV A;  2JXC A;  3BFH A;  1PSB A;  3BFA A;  1C07 A;  1CFD A;  3HX4 A;  1M45 A;  2EC6 C;  2NCO A;  2KI6 D;  4GGN A;  4AOM A;  1BMO A;  3FE9 A;  3JVT B;  2K0J A;  1OMV A;  1CFF A;  2WCL A;  2R2I A;  5F6T A;  1YUU A;  1OMR A;  2BCX A;  1S6J A;  3DVJ A;  3LL8 B;  1F4Q A;  5I2L A;  3NSO A;  2K2A A;  4JD9 A;  1BLQ A;  2WCB A;  5AXI A;  3RLZ A;  4XJK B;  4C0K A;  1XVJ A;  3L4L A;  2QPT A;  4NDC A;  2JQ6 A;  2K2F A;  2GGZ A;  3SG6 A;  3ZWH A;  3F45 A;  2GV5 A;  4YBH B;  1SPY A;  2M8U A;  2VRG A;  2LV7 A;  3NXA A;  1V1F A;  2WND A;  3EG5 B;  1QXP A;  3VRO A;  2Y1M A;  1JSA A;  2EHB A;  5AER A;  3PN7 C;  1DQE A;  1TWO A;  4F7F A;  3FIA A;  2BBM A;  5DIC A;  2BNX A;  2L5Y A;  5G08 A;  1SY9 A;  5JOL A;  1IH0 A;  2PVB A;  2LMT A;  2LVK A;  3I5F C;  3PAT A;  1ORG A;  2E30 A;  1K9P A;  4E68 A;  1BU3 A;  1AUI B;  1BR1 B;  1JF2 A;  3O6B A;  4U8D A;  1DGU A;  3CGA A;  1SBJ A;  1FBV A;  4CLN A;  1MR8 A;  3PFV A;  3GK4 X;  1PVA A;  2BKH B;  2KLE A;  2M7L A;  1N65 A;  2CT9 A;  2BKI B;  2H2K A;  1H4B A;  2KI4 C;  4PHN A;  5IBW A;  1CDP A;  1KSM A;  3D0Y B;  3PM2 A;  3SG4 A;  1DF0 A;  4DRW A;  3O2P A;  2F3Y A;  2ZNE A;  2MLF C;  4DS7 A;  5KTY A;  1QVI Z;  2P70 A;  1HT9 A;  2M1U A;  3TUY C;  3GOF A;  2K61 A;  3CZ2 A;  3SS3 A;  4GGF A;  2OTG B;  3UNW A;  4QJ5 B;  4YGA A;  1RWY A;  2LHI A;  3CLN A;  2KBI A;  3KF9 A;  1F54 A;  2H61 C;  3K21 A;  1UHH A;  4GNK B;  5AFP A;  5CSJ A;  5HL1 A;  2M7N A;  3SS4 A;  1DC1 A;  1CB1 A;  2KOT A;  4PCW A;  2KAY A;  1NCX A;  5FYX A;  1GQM A;  3H4S E;  2JUL A;  1YUT A;  3R1P A;  4A4C A;  3WXA A;  1OOF A;  2FCE A;  1OQP A;  2ZN8 A;  4USL A;  3DD4 A;  3BOW B;  3K1E A;  2JPT A;  2PRU A;  1WY9 A;  3CZ0 A;  1ZOT B;  1LKJ A;  1P28 A;  1KFX L;  3D10 A;  1IG5 A;  2JT0 A;  3TDU A;  3O4Y A;  3NSL A;  2LC5 A;  2M1K B;  2G2B A;  4PDZ A;  1G8I A;  1KK7 Y;  2NCP A;  3NGV A;  1NWD A;  1JUO A;  1ZFS A;  1EH2 A;  3BUO B;  1YRT B;  2LNK A;  1REC A;  2HF5 A;  3DY9 A;  2Y1N A;  4YI9 A;  2KPH A;  5EL2 A;  1A75 B;  1K9K A;  2M9G A;  2ZND A;  2TN4 A;  4INX A;  3ICB A;  2LLS A;  1IWQ A;  4PT1 A;  3B86 A;  1IRJ A;  4MEW A;  1S6C A;  1S26 D;  1AHR A;  3EVU A;  2BCA A;  3KPX A;  3N7H A;  4QJ3 B;  3D77 A;  3AAK A;  1YX7 A;  2AMI A;  3SG5 A;  4YGB B;  1Y1A A;  1K2H A;  1QX2 A;  2QDI A;  1K93 D;  1ALW A;  1T14 A;  2H8V A;  4I5J A;  4R1E A;  2Y4Q A;  4FQT A;  1ODB A;  1NCZ A;  2NLN A;  3LK1 A;  1LS8 A;  1QS7 A;  2ZRS A;  2KI6 C;  1Z2C B;  1H8B A;  4GGF C;  1RFJ A;  3EK8 A;  2YGU A;  4GBA A;  1Q80 A;  2NXQ A;  2KBM A;  3PJI A;  4PAL A;  1FW4 A;  4XJK A;  1B1G A;  1K96 A;  4HRH A;  2EGD A;  2G9B A;  3CYZ A;  3OP0 A;  1IQ5 A;  1OZS A;  3BXK A;  1KQV A;  1G33 A;  3S0D A;  1NX3 A;  1IJ5 A;  1TCO B;  1UUR A;  1SNL A;  1AJ4 A;  2LAN A;  2I94 A;  2K7O A;  2ZN9 A;  3BUW B;  3IF7 A;  2L5X B;  4I5L B;  3S0B A;  2SCP A;  2O5G A;  1DVI A;  2HQW A;  3O78 A;  1TUZ A;  1F71 A;  2KQ6 A;  1BOD A;  2WCJ A;  3I5H C;  1YR5 A;  2E6W A;  2BE4 A;  3B87 A;  4JPZ B;  2MA2 A;  2OPO A;  3PM8 A;  1X02 A;  4DIR A;  1SCM C;  5FI2 A;  1C7V A;  2JT8 A;  1MXL C;  2P6B B;  1DEK A;  1QX7 A;  1YVH A;  2PMY A;  3CR5 X;  4L9M A;  2H61 A;  4BY4 A;  4QJ4 B;  2MHH A;  1K8U A;  1KWO B;  1NIW A;  4PE1 A;  3EVV A;  1F8H A;  3NSK A;  4JWQ A;  2WC6 A;  1BR4 B;  3TS5 C;  2A4J A;  3JTD C;  5D3O A;  3SG3 A;  4GPL B;  1B47 A;  1DJI A;  2OS8 C;  1QJT A;  1AK8 A;  3TDZ A;  3WHU B;  4MZJ A;  4WRI A;  2JPO A;  3FWC A;  1F70 A;  1BJF A;  2QEH A;  1QVI Y;  2WCF A;  1YRU B;  1PRW A;  1XFV O;  1TN4 A;  5CPV A;  1TTX A;  1MWN A;  1U5I A;  2JWW A;  3IQQ A;  5ER5 A;  3KEV A;  1JC2 A;  3PN7 B;  1EXR A;  2AAO A;  1SRA A;  1KCY A;  2LVI A;  2LUC A;  1NSH A;  1DJH A;  4FTG A;  1R2U A;  3FE6 A;  4GAO A;  1A2X A;  1K94 A;  2F2O A;  4M2P A;  4OR9 B;  4ORC B;  3UO9 A;  3CAB A;  2F33 A;  4C0L A;  2P71 A;  1GJY A;  4HRG A;  5HKW A;  1OOI X;  3JVT C;  4D1E A;  4IJ7 A;  3TDI A;  3BUN B;  1Y6W A;  1XA5 A;  1E8A A;  2BL0 B;  2L4H A;  2ZKM X;  1IIO A;  4F0Z B;  2LHL A;  2KGB C;  1A29 A;  1G4Y R;  2L0P A;  3BOW A;  2WOS A;  3CZT X;  5FI7 A;  1V1G A;  2K60 A;  3CR4 X;  2WCM A;  2ISD A;  3PSR A;  1OW4 A;  1SR6 C;  3EK4 A;  1DJZ A;  1FI5 A;  1PSR A;  3TUY B;  1L2O B;  1TNP A;  1KK8 C;  1N0Y A;  4N1G A;  2D8N A;  2PYQ A;  3KHE A;  1BOC A;  1XO5 A;  2HQ8 A;  1KQM B;  1RJV A;  2L2E A;  3I5I B;  1WRK A;  1OE9 B;  3VGO A;  1L7Z A;  3VRQ A;  1RTP 1;  2K7B A;  3LK0 A;  2M97 A;  1C7W A;  1DEL A;  2WCE A;  1J1D A;  3DVK A;  1SW8 A;  1A75 A;  2F8P A;  4PE4 A;  3DZT A;  2HET A;  3FS7 A;  3QRX A;  3A8R A;  5CSI A;  1TCF A;  3AKA A;  3S0G A;  2WC8 A;  1N2D A;  1S5G Z;  4YI8 A;  1YUS A;  4YGE B;  2M29 A;  1NP8 A;  1S36 A;  3HCM A;  2BEC A;  2K7D A;  4N5X A;  1PUL A;  4Q04 A;  1FPW A;  2Q4U A;  1QV1 A;  1UWO A;  3CTN A;  4N1F A;  3CDN A;  2JXL A;  2WC5 A;  3BUM B;  3I5G B;  2KFG A;  2PQL A;  1B7T Z;  1EJ3 A;  2OTG C;  5D69 A;  1IKU A;  1DJW A;  1NYA A;  1MXE A;  1UHK A;  2LLU A;  1S6I A;  3DF0 A;  3BFB A;  1M63 B;  1F55 A;  1UHJ A;  1YUR A;  4NDD A;  1J7P A;  1ZUZ A;  2PAS A;  1CNP A;  1MQ1 A;  2LP2 A;  1CFC A;  2CBL A;  1B8C A;  1PVB A;  2JOJ A;  4NQG A;  1LA3 A;  2ZFD A;  1CLM A;  4FQO A;  4JKT A;  5I2O A;  1GGZ A;  2JNX A;  1AVS A;  1DMO A;  2M0R A;  3CZ1 A;  1SYM A;  1EG3 A;  1C3Y A;  3CWG A;  3D74 A;  1DF0 B;  3B88 A;  1CLB A;  2JNF A;  1LVC D;  1W7I B;  2CNP A;  1XFY O;  3Q8I A;  3OGN A;  1VRK A;  2BCB A;  1WRZ A;  4BY5 A;  4HSZ A;  5HLV A;  1XFX O;  2QEO A;  1TNW A;  1WDC B;  3R72 A;  5ER4 X;  1SK6 D;  4MZL A;  1MUX A;  4OVN F;  3DXL A;  3VRP A;  1IJ6 A;  1PAL A;  3WHT B;  3DYE A;  4KYN A;  5FI6 A;  1CDM A;  1CM4 A;  3PAL A;  1NCY A;  1JF0 A;  1Y1U A;  1ZAC A;  1YVL A;  1ZMZ A;  3S0E A;  4ZCU A;  3SG2 A;  3S0A A;  5GQQ C;  4YRU A;  1CFP A;  1BF5 A;  3LLE A;  3C1V A;  1OOG A;  5D7F A;  4AQJ A;  2CCM A;  1XK4 A;  2KFF A;  3DVE A;  2EC6 B;  3KO0 A;  1DT7 B;  4OCI A;  4I5K A;  4YGC B;  3NHI A;  2BAP A;  2JT3 A;  5CSN A;  1OOH A;  3FE8 A;  3VB1 A;  2LVJ A;  2BBN A;  3TS5 B;  2MJW B;  1QAT A;  1Y1X A;  3EKH A;  1RRO A;  1TOP A;  1QLS A;  2PSR A;  4XYN A;  4ORA B;  3OHM B;  1UHI A;  1GM0 A;  1B8R A;  3CR2 A;  3SS5 A;  4GFT A;  2ZRT A;  5PAL A;  1K9U A;  3D0Y A;  4P5O E;  4PHJ A;  3O4X A;  1UUS A;  3EK7 A;  1KFU L;  4I5N B;  1OSA A;  1DJY A;  2JZI A;  1QAS A;  2L4I A;  1QX5 B;  2MBX A;  1JFJ A;  1AJ5 A;  1CLL A;  1SL9 A;  1DJX A;  3OX6 A;  4NDB A;  1CTR A;  2AUC A;  5I8N A;  2JC2 A;  2L50 A;  1WLM A;  1QIV A;  2I2R E;  3SJS A;  2MAZ A;  1KWO C;  4ORB B;  4PE0 A;  3I5F B;  1HQV A;  3WNX B;  4A4B A;  2KNE A;  3M0W A;  1UP5 A;  2BE6 A;  3DVM A;  4DUQ A;  1S5G Y;  3OBV A;  1IGV A;  4OV2 A;  1GGW A;  2COL B;  5HKY A;  2LVV A;  1NUB A;  3E3R A;  4M2Q A;  1BT6 A;  1KSO A;  1MHO A;  2LMU A;  1K90 D;  2KI4 B;  2QEB A;  1K95 A;  1SCV A;  4CID A;  3S0F A;  5DKR A;  1MF8 B;  1SR6 B;  3BJH A;  3FWB A;  1KFU S;  4MRY A;  1ALV A;  3LCP C;  5I94 A;  5JJG A;  1KK8 B;  1B7T Y;  1LXF C;  3PLF B;  1CMF A;  2KYC A;  4MN0 A;  2I18 A;  5AAN A;  2JTT A;  4MBE A;  2WCK A;  2JTZ A;  1XK4 C;  1CM1 A;  2Y5I A;  2K7C A;  5AEQ A;  2PAL A;  1QWV A;  2LE9 B;  2SAS A;  1B8L A;  2GTE A;  3SIA A;  1XYD A;  1JWD A;  1TNQ A;  2L2C A;  1OMD A;  2BL0 C;  1M31 A;  1SMG A;  3ZNI A;  1DTL A;  1JBA A;  3BUX B;  3NSI A;  3OB1 B;  4JQ0 D;  3D78 A;  4ETO A;  4CFQ A;  1B9A A;  1J1E A;  3IQO A;  4GUK A;  3CS1 A;  1S1E A;  1XFU O;  4WQ2 A;  1C3Z A;  1NX1 A;  1U5I B;  1CDL A;  2L98 A;  1NX2 A;  1DGV A;  1L2O C;  1LA0 A;  2I7A A;  1UHN A;  2HPS A;  2LP3 A;  4CFR A;  5CSF A;  1BG1 A;  1KQM C;  2M3W A;  2KQY A;  3I5I C;  2FJU B;  4PHK A;  3OB2 B;  4CPV A;  2JU0 A;  1LIN A;  1M46 A;  1TNX A;  2L51 A;  2KFH A;  2LUX A;  2V53 A;  3NHT A;  3OX5 A;  3QME A;  1DJG A;  2WCH A;  4DCK A;  2O60 A;  1QIW A;  2Q91 A;  1J55 A;  2KDH A;  1QV0 A;  3R1O A;  3AKB A;  1SL8 A;  3V2L A;  1A03 A;  1W7J B;  2ERB A;  1EG4 A;  1YX8 A;  1D1O A;  1SKT A;  2MLE C;  1Z4H A;  3L47 A;  1M39 A;  2FJY A;  1OZO A;  1J7Q A;  1W9Z A;  5I2Q A;  2JRF A;  2FCD A;  5HLO A;  2CTN A;  1WLZ A;  4ICB A;  2LAP A;  2IS9 A;  4PE7 A;  4AQI A;  1CDN A;  1JFK A;  3I5G C;  1CKK A;  4MRX A;  4TNC A;  1TRF A;  4P2Y B;  2KHN A;  4MSP A;  3L4A A;  5K89 A;  3SIB A;  3AAJ A;  3BYA A;  2LLT A;  2DOQ A;  3VRN A;  2QEV A;  2CXJ A;  1SSE B;  2KLD A;  2KSP A;  3B6X A;  2FOT A;  3SG7 A;  1TUJ A;  3B7A A;  2LCP A;  4HRE E;  2F3Z A;  2LMV A;  1XFZ O;  3TZ1 A;  1AP4 A;  3D73 A;  3GK1 A;  3BQ3 A;  1NPQ A;  1R6P A;  4PHM A;  3RZS A;  5J3X A;  1B4C A;  3I5H B;  1PK0 D;  3D76 A;  1KFX S;  4MVF A;  4OKH A;  2NZ0 A;  1FI6 A;  1YTZ C;  1FF1 A;  1SCM B;  1Y0V H;  2KYF A;  1XFW O;  1OOJ A;  1SL7 A;  3A4U B;  2MRD A;  2QAC A;  1EL4 A;  4ZCV A; 
#chains in the Genus database with same CATH homology
 5HKZ A;  1J7R A;  3GK2 A;  5KU1 A;  5KSZ A;  3DF0 B;  3JTD B;  3MSE B;  1IQ3 A;  1WDC C;  2F2P A;  2KGR A;  3VRR A;  5HYD A;  1KK7 Z;  2LM5 A;  2GGM A;  5BPJ A;  4C0J A;  2RGI A;  2OS8 B;  2WOR A;  5DKN A;  1NX0 A;  1F4O A;  2M49 B;  4M2O A;  4WQ3 A;  4UPG A;  5DKQ A;  1S3P A;  5TNC A;  3EVR A;  5B8I B;  1RK9 A;  4YGD B;  3EKJ A;  1A4P A;  2B1U A;  2K8M B;  1CMG A;  4MZK A;  4MLW A;  1QTX A;  1J7O A;  1TIZ A;  1WRL A;  3RM1 A;  1QLK A;  2KAX A;  4IL1 A;  2KAV A;  2JXC A;  1PSB A;  1C07 A;  1CFD A;  3HX4 A;  1M45 A;  2EC6 C;  2NCO A;  2KI6 D;  4GGN A;  4AOM A;  1BMO A;  3JVT B;  2K0J A;  1OMV A;  1CFF A;  2R2I A;  5F6T A;  1YUU A;  2BCX A;  1OMR A;  1S6J A;  3DVJ A;  3LL8 B;  1F4Q A;  5I2L A;  3NSO A;  2K2A A;  1BLQ A;  2WCB A;  5AXI A;  3RLZ A;  4XJK B;  4C0K A;  1XVJ A;  4NDC A;  2QPT A;  2JQ6 A;  2K2F A;  2GGZ A;  3SG6 A;  3ZWH A;  3F45 A;  2GV5 A;  4YBH B;  1SPY A;  2M8U A;  2VRG A;  2LV7 A;  3NXA A;  1V1F A;  2WND A;  1QXP A;  3VRO A;  2Y1M A;  1JSA A;  2EHB A;  5AER A;  3PN7 C;  3FIA A;  2BBM A;  5G08 A;  1SY9 A;  5JOL A;  1IH0 A;  2PVB A;  2LMT A;  2LVK A;  3I5F C;  3PAT A;  2E30 A;  1K9P A;  4E68 A;  1BU3 A;  1AUI B;  1BR1 B;  1JF2 A;  3O6B A;  4U8D A;  1DGU A;  3CGA A;  1SBJ A;  1FBV A;  4CLN A;  1MR8 A;  3PFV A;  3GK4 X;  1PVA A;  2BKH B;  2M7L A;  1N65 A;  2CT9 A;  2BKI B;  2H2K A;  1H4B A;  2KI4 C;  4PHN A;  5IBW A;  1CDP A;  1KSM A;  3D0Y B;  3SG4 A;  1DF0 A;  4DRW A;  3O2P A;  2F3Y A;  2ZNE A;  2MLF C;  4DS7 A;  5KTY A;  1QVI Z;  1HT9 A;  2M1U A;  3TUY C;  3GOF A;  2K61 A;  4GGF A;  2OTG B;  4QJ5 B;  4YGA A;  1RWY A;  2LHI A;  3CLN A;  2KBI A;  3KF9 A;  1F54 A;  2H61 C;  3K21 A;  1UHH A;  4GNK B;  5AFP A;  5CSJ A;  2M7N A;  1CB1 A;  2KOT A;  4PCW A;  2KAY A;  1NCX A;  5FYX A;  1GQM A;  3H4S E;  2JUL A;  1YUT A;  4A4C A;  3WXA A;  2FCE A;  1OQP A;  2ZN8 A;  4USL A;  3DD4 A;  3BOW B;  2JPT A;  2PRU A;  1WY9 A;  3D10 A;  1ZOT B;  1LKJ A;  1KFX L;  3TDU A;  1IG5 A;  2JT0 A;  3O4Y A;  3NSL A;  2LC5 A;  2M1K B;  2G2B A;  4PDZ A;  1G8I A;  1KK7 Y;  2NCP A;  1NWD A;  1JUO A;  1ZFS A;  1EH2 A;  3BUO B;  1YRT B;  2LNK A;  1REC A;  2HF5 A;  4YI9 A;  2Y1N A;  1A75 B;  1K9K A;  2M9G A;  2ZND A;  2TN4 A;  3ICB A;  2LLS A;  1IWQ A;  1IRJ A;  4MEW A;  1S6C A;  1S26 D;  1AHR A;  3EVU A;  2BCA A;  3KPX A;  4QJ3 B;  3AAK A;  1YX7 A;  2AMI A;  3SG5 A;  4YGB B;  1Y1A A;  1K2H A;  1QX2 A;  1K93 D;  1ALW A;  4I5J A;  4R1E A;  2Y4Q A;  1ODB A;  1NCZ A;  2NLN A;  3LK1 A;  2ZRS A;  1QS7 A;  2KI6 C;  1H8B A;  4GGF C;  1RFJ A;  3EK8 A;  4GBA A;  1Q80 A;  2NXQ A;  2KBM A;  4PAL A;  1FW4 A;  4XJK A;  1B1G A;  1K96 A;  4HRH A;  2EGD A;  2G9B A;  3OP0 A;  1IQ5 A;  1OZS A;  3BXK A;  1KQV A;  1G33 A;  1NX3 A;  1IJ5 A;  1TCO B;  1UUR A;  1SNL A;  1AJ4 A;  2LAN A;  2I94 A;  2K7O A;  2ZN9 A;  3BUW B;  3IF7 A;  2L5X B;  4I5L B;  2SCP A;  2O5G A;  1DVI A;  2HQW A;  3O78 A;  1F71 A;  2KQ6 A;  1BOD A;  3I5H C;  1YR5 A;  2E6W A;  2BE4 A;  4JPZ B;  2MA2 A;  2OPO A;  3PM8 A;  1X02 A;  4DIR A;  1SCM C;  1C7V A;  2JT8 A;  1MXL C;  2P6B B;  1QX7 A;  1YVH A;  2PMY A;  3CR5 X;  4L9M A;  2H61 A;  4BY4 A;  4QJ4 B;  2MHH A;  1K8U A;  1KWO B;  1NIW A;  4PE1 A;  3EVV A;  1F8H A;  3NSK A;  4JWQ A;  1BR4 B;  3TS5 C;  2A4J A;  3JTD C;  3SG3 A;  4GPL B;  1B47 A;  1DJI A;  2OS8 C;  1QJT A;  1AK8 A;  3TDZ A;  3WHU B;  4MZJ A;  4WRI A;  3FWC A;  1F70 A;  1BJF A;  1QVI Y;  2WCF A;  1YRU B;  1PRW A;  1XFV O;  1TN4 A;  5CPV A;  1TTX A;  1MWN A;  1U5I A;  2JWW A;  3IQQ A;  5ER5 A;  3KEV A;  1JC2 A;  3PN7 B;  1EXR A;  2AAO A;  1SRA A;  1KCY A;  2LVI A;  2LUC A;  1NSH A;  1DJH A;  4FTG A;  1R2U A;  4GAO A;  1A2X A;  1K94 A;  2F2O A;  4M2P A;  4OR9 B;  4ORC B;  2F33 A;  4C0L A;  1GJY A;  4HRG A;  5HKW A;  3JVT C;  4D1E A;  3TDI A;  3BUN B;  1Y6W A;  1XA5 A;  1E8A A;  2BL0 B;  2L4H A;  2ZKM X;  4F0Z B;  2LHL A;  2KGB C;  1A29 A;  1G4Y R;  2L0P A;  3BOW A;  2WOS A;  3CZT X;  1V1G A;  3CR4 X;  2ISD A;  3PSR A;  1SR6 C;  3EK4 A;  1DJZ A;  1FI5 A;  1PSR A;  3TUY B;  1L2O B;  1TNP A;  1KK8 C;  1N0Y A;  4N1G A;  2D8N A;  3KHE A;  1BOC A;  1XO5 A;  2HQ8 A;  1KQM B;  1RJV A;  2L2E A;  3I5I B;  1WRK A;  1OE9 B;  3VGO A;  1L7Z A;  3VRQ A;  1RTP 1;  2K7B A;  3LK0 A;  2M97 A;  1C7W A;  2WCE A;  1J1D A;  3DVK A;  1SW8 A;  1A75 A;  2F8P A;  4PE4 A;  2HET A;  3FS7 A;  3QRX A;  3A8R A;  5CSI A;  1TCF A;  3AKA A;  2WC8 A;  1N2D A;  1S5G Z;  4YI8 A;  1YUS A;  4YGE B;  2M29 A;  1NP8 A;  1S36 A;  3HCM A;  2BEC A;  2K7D A;  4N5X A;  1PUL A;  4Q04 A;  1FPW A;  2Q4U A;  1QV1 A;  1UWO A;  3CTN A;  4N1F A;  2JXL A;  3BUM B;  3I5G B;  2KFG A;  1B7T Z;  1EJ3 A;  2OTG C;  5D69 A;  1IKU A;  1DJW A;  1NYA A;  1MXE A;  1UHK A;  2LLU A;  1S6I A;  3DF0 A;  1F55 A;  1M63 B;  1UHJ A;  1YUR A;  4NDD A;  1J7P A;  1ZUZ A;  2PAS A;  1CNP A;  1MQ1 A;  2LP2 A;  1CFC A;  2CBL A;  1B8C A;  1PVB A;  2JOJ A;  4NQG A;  1LA3 A;  2ZFD A;  1CLM A;  4FQO A;  5I2O A;  1GGZ A;  2JNX A;  1AVS A;  1DMO A;  2M0R A;  1SYM A;  1EG3 A;  3CWG A;  1DF0 B;  1CLB A;  2JNF A;  1LVC D;  1W7I B;  2CNP A;  1XFY O;  1VRK A;  2BCB A;  1WRZ A;  4BY5 A;  4HSZ A;  5HLV A;  1XFX O;  1TNW A;  1WDC B;  5ER4 X;  1SK6 D;  4MZL A;  1MUX A;  4OVN F;  3VRP A;  1IJ6 A;  1PAL A;  3WHT B;  1CDM A;  1CM4 A;  3PAL A;  1NCY A;  1JF0 A;  1Y1U A;  1ZAC A;  1YVL A;  1ZMZ A;  4ZCU A;  3SG2 A;  5GQQ C;  4YRU A;  1CFP A;  1BF5 A;  3LLE A;  3C1V A;  5D7F A;  4AQJ A;  2CCM A;  1XK4 A;  2KFF A;  3DVE A;  2EC6 B;  3KO0 A;  1DT7 B;  4OCI A;  4I5K A;  4YGC B;  2JT3 A;  5CSN A;  2LVJ A;  2BBN A;  3TS5 B;  2MJW B;  1QAT A;  1Y1X A;  3EKH A;  1RRO A;  1TOP A;  1QLS A;  2PSR A;  4XYN A;  4ORA B;  3OHM B;  1UHI A;  1B8R A;  3CR2 A;  4GFT A;  2ZRT A;  5PAL A;  1K9U A;  3D0Y A;  4P5O E;  4PHJ A;  1UUS A;  3EK7 A;  1KFU L;  4I5N B;  1OSA A;  1DJY A;  2JZI A;  1QAS A;  2L4I A;  1QX5 B;  2MBX A;  1JFJ A;  1AJ5 A;  1CLL A;  1SL9 A;  1DJX A;  3OX6 A;  4NDB A;  1CTR A;  2AUC A;  5I8N A;  2JC2 A;  2L50 A;  1WLM A;  1QIV A;  2I2R E;  3SJS A;  2MAZ A;  1KWO C;  4ORB B;  4PE0 A;  3I5F B;  1HQV A;  3WNX B;  4A4B A;  2KNE A;  3M0W A;  1UP5 A;  2BE6 A;  3DVM A;  4DUQ A;  1S5G Y;  1IGV A;  4OV2 A;  1GGW A;  2COL B;  5HKY A;  2LVV A;  1NUB A;  3E3R A;  4M2Q A;  1BT6 A;  1KSO A;  1MHO A;  2LMU A;  1K90 D;  2KI4 B;  4CID A;  1K95 A;  1SCV A;  5DKR A;  1MF8 B;  1SR6 B;  3FWB A;  1KFU S;  4MRY A;  1ALV A;  3LCP C;  5JJG A;  1KK8 B;  1B7T Y;  1LXF C;  3PLF B;  1CMF A;  2KYC A;  4MN0 A;  2I18 A;  5AAN A;  2JTT A;  4MBE A;  2JTZ A;  1XK4 C;  1CM1 A;  2Y5I A;  2K7C A;  5AEQ A;  2PAL A;  2LE9 B;  2SAS A;  1B8L A;  3SIA A;  1XYD A;  1JWD A;  1TNQ A;  1OMD A;  2BL0 C;  1M31 A;  1SMG A;  3ZNI A;  1DTL A;  1JBA A;  3BUX B;  3NSI A;  3OB1 B;  4JQ0 D;  4ETO A;  4CFQ A;  1B9A A;  1J1E A;  3IQO A;  4GUK A;  3CS1 A;  1S1E A;  1XFU O;  4WQ2 A;  1NX1 A;  1U5I B;  1CDL A;  2L98 A;  1NX2 A;  1DGV A;  1L2O C;  1LA0 A;  2I7A A;  1UHN A;  2HPS A;  2LP3 A;  4CFR A;  5CSF A;  1BG1 A;  1KQM C;  2M3W A;  2KQY A;  3I5I C;  2FJU B;  4PHK A;  3OB2 B;  4CPV A;  2JU0 A;  1LIN A;  1M46 A;  1TNX A;  2L51 A;  2KFH A;  2LUX A;  2V53 A;  3OX5 A;  1DJG A;  4DCK A;  2O60 A;  1QIW A;  2Q91 A;  1J55 A;  2KDH A;  1QV0 A;  3AKB A;  1SL8 A;  1A03 A;  1W7J B;  1EG4 A;  1YX8 A;  1D1O A;  1SKT A;  2MLE C;  1M39 A;  1OZO A;  1J7Q A;  5I2Q A;  2JRF A;  2FCD A;  5HLO A;  2CTN A;  1WLZ A;  4ICB A;  2LAP A;  2IS9 A;  4PE7 A;  4AQI A;  1CDN A;  1JFK A;  3I5G C;  1CKK A;  4MRX A;  4TNC A;  1TRF A;  4P2Y B;  2KHN A;  4MSP A;  5K89 A;  3SIB A;  3AAJ A;  3BYA A;  2LLT A;  2DOQ A;  3VRN A;  2CXJ A;  2KSP A;  2FOT A;  3SG7 A;  2LCP A;  4HRE E;  2F3Z A;  2LMV A;  1XFZ O;  3TZ1 A;  1AP4 A;  3GK1 A;  3BQ3 A;  1NPQ A;  1R6P A;  4PHM A;  5J3X A;  1B4C A;  3I5H B;  1PK0 D;  1KFX S;  4MVF A;  4OKH A;  2NZ0 A;  1FI6 A;  1YTZ C;  1FF1 A;  1SCM B;  1Y0V H;  2KYF A;  1XFW O;  1OOJ A;  1SL7 A;  3A4U B;  2MRD A;  2QAC A;  1EL4 A;  4ZCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...