1IGVA

Bovine calbindin d9k binding mn2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN, INTESTINAL
publication title Structural basis for the negative allostery between Ca(2+)- and Mg(2+)-binding in the intracellular Ca(2+)-receptor calbindin D9k.
pubmed rcsb
source organism Bos taurus
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1igvA00
1YX7A 1XFXO 1YVLA 4GNKB 2LANA 2WOSA 3DVEA 2HQWA 1XO5A 2F2PA 5PALA 3D0YA 4FQOA 4N1GA 3BXKA 5ER5A 4Q04A 1SY9A 3K21A 1KSMA 2PRUA 5G08A 2BL0B 1CLMA 1SBJA 2LMTA 2KHNA 1TNWA 1OE9B 1C07A 1UHKA 5I8NA 3BQ3A 3OX6A 1XVJA 3I5GB 2QACA 2CNPA 1MXEA 4IL1A 1C7VA 3PLFB 2MLFC 1CMFA 3BUNB 4I5NB 1RECA 2L2EA 3CTNA 3JVTC 1CFFA 2P6BB 1S36A 2KBIA 1CB1A 1CFDA 2L5XB 2LV7A 1QIVA 2F3YA 4PCWA 1DJIA 1CMGA 1QLSA 3O4YA 4DUQA 2VRGA 3IQQA 4M2QA 3PN7B 2Q4UA 5HLOA 1H8BA 4HRHA 1DJXA 1QATA 2BCBA 1RK9A 1QVIY 5AEQA 4MZLA 2OTGB 2F2OA 2PSRA 4GFTA 1JF2A 3EK4A 2BBMA 4YGEB 2E6WA 1GGZA 4XYNA 1OQPA 1FF1A 1V1GA 4DCKA 4MRXA 2OS8B 1A03A 1F4OA 1IWQA 2AAOA 1RFJA 4YI8A 2H61A 1PK0D 2LAPA 4PHMA 1U5IB 4JWQA 1YRUB 1X02A 3WXAA 1CFCA 3SIAA 4PHKA 1XFVO 1U5IA 3JTDC 3O78A 2LLUA 2AUCA 1NX2A 1K90D 2E30A 2M3WA 4AOMA 1A29A 1SL7A 2EC6B 3GK4X 3PATA 4USLA 4YRUA 3EVVA 2MAZA 4MZJA 1BJFA 1NCYA 1FI6A 1R2UA 1A75B 3LK0A 1YUSA 2CCMA 2BECA 1A75A 1MQ1A 2F8PA 5CSJA 4HRGA 2IS9A 1J1EA 2ZKMX 3A4UB 2LNKA 2BKHB 1DGUA 2M49B 5JJGA 4C0LA 2LMUA 2JTTA 3OB1B 1OSAA 3I5GC 2JTZA 4GPLB 1F71A 4C0KA 1Y6WA 3TS5C 3AKBA 4PE7A 2BKIB 1KK8B 1L7ZA 2M97A 2K7OA 1NIWA 3I5IC 2NLNA 2O5GA 5I2LA 2LCPA 5J3XA 3HCMA 1SCMC 2K8MB 1XYDA 1IRJA 1KFXL 2KI4B 2KAXA 2WORA 3FWCA 3TDUA 2MRDA 1YTZC 4GGFC 1BG1A 1SL9A 3ZNIA 1NWDA 2M9GA 4MBEA 4PHNA 1JC2A 1WRZA 1C7WA 1BR1B 1AVSA 3KF9A 4NQGA 4BY4A 1B8RA 1NYAA 1KK7Z 4M2OA 2OS8C 1UHNA 2JT3A 2MHHA 3DVKA 2BE4A 4OKHA 1B8LA 1JUOA 3VRQA 2TN4A 1SMGA 4ZCUA 1TRFA 3TZ1A 1JFKA 3PSRA 1SNLA 5CPVA 5CSNA 1CM1A 2FJUB 2JULA 3HX4A 5FYXA 3C1VA 3KPXA 1GQMA 3IF7A 2K7CA 2JRFA 1KFUL 2EC6C 2MJWB 3QRXA 1S26D 2LVVA 1Y0VH 3D0YB 5HKZA 2JT0A 1CLLA 1DF0B 1L2OB 1TNPA 1SR6C 1SKTA 2I7AA 2LLTA 1F8HA 1DF0A 2LHLA 5GQQC 1IH0A 1GGWA 2EGDA 3CR2A 3LK1A 1WDCB 1EG3A 1N0YA 2Q91A 3ZWHA 2M7NA 1EL4A 2SASA 2KYCA 2G2BA 2ZNEA 1NP8A 1CDNA 5HKYA 1QASA 1YR5A 3WNXB 1NCZA 1QS7A 1NSHA 2LLSA 3BOWA 3PALA 3KO0A 1LXFC 1KK8C 1LA0A 2LMVA 3EKHA 1TOPA 3LLEA 2COLB 2CXJA 2MBXA 1PVAA 1KK7Y 2KI6D 2M8UA 3AKAA 3OX5A 1KWOC 1QLKA 1N65A 1MWNA 2KI4C 1AJ5A 2JNFA 1QX7A 1F55A 1CDPA 1FBVA 1DJYA 1NX0A 1CKKA 1IQ5A 2NCPA 2LE9B 1LVCD 3MSEB 1TCFA 1A2XA 5HKWA 3A8RA 1K9PA 1YVHA 2MLEC 1CLBA 1NUBA 3SG4A 1M31A 2LP3A 1CTRA 2KYFA 4OV2A 2L0PA 3EK8A 3I5HC 4MN0A 1DJZA 1IQ3A 1OOJA 1SPYA 2KDHA 1KQMC 5JOLA 1B7TZ 3CLNA 1K2HA 1BLQA 4DS7A 2HETA 2Y1MA 4D1EA 5CSIA 1V1FA 3NSLA 2LVIA 4HSZA 1IJ6A 2KFFA 4I5LB 4U8DA 3TDIA 4AQJA 1DMOA 2KFGA 4WQ3A 2K7DA 4QJ4B 1ZUZA 1OMDA 4C0JA 4R1EA 1S1EA 4AQIA 1S5GZ 3RLZA 3BUXB 4QJ3B 1KCYA 1PSBA 3VGOA 5IBWA 1BODA 2L4HA 1CDMA 2KNEA 1NCXA 1XK4A 1EJ3A 2KAYA 3EVRA 3SG2A 1AK8A 2ZRSA 3TUYB 4QJ5B 3E3RA 2BL0C 2NXQA 1G4YR 3TDZA 2L98A 2NCOA 1BMOA 2LHIA 2KFHA 2I2RE 2LUCA 3NSOA 2M1UA 4P2YB 1A4PA 4NDCA 3WHTB 5B8IB 1MR8A 4YGBB 1CM4A 2AMIA 4XJKA 1WY9A 2HF5A 4MZKA 1VRKA 2K0JA 4A4CA 1AP4A 2JQ6A 1ZMZA 2O60A 2ZN9A 1FI5A 2JC2A 4L9MA 1F54A 1B8CA 4MLWA 2WCFA 5ER4X 3PM8A 2GV5A 2B1UA 1K95A 3SJSA 1GJYA 1Q80A 4A4BA 1B7TY 2DOQA 5AFPA 3O6BA 3PN7C 1RWYA 2ZN8A 4N1FA 3SG5A 2PASA 3RM1A 4I5KA 1J7QA 2JXCA 4CFQA 2OTGC 1YX8A 1KQVA 1J1DA 1TIZA 1Y1UA 1IG5A 2KQYA 1IKUA 1YUTA 1OMRA 5TNCA 1PULA 1S5GY 2BE6A 2H61C 3GK1A 2FCEA 2WCBA 3M0WA 4TNCA 5DKNA 1Y1AA 3IQOA 4BY5A 4YI9A 5F6TA 4PE0A 1LKJA 1J55A 1DGVA 1EG4A 1YUUA 1K93D 2PVBA 1EH2A 3AAJA 3FWBA 1G8IA 4ICBA 1B47A 4ORAB 2SCPA 1QTXA 5HLVA 1Y1XA 5K89A 2KOTA 3LCPC 1TNQA 2L4IA 1QV1A 5HYDA 1CDLA 1JBAA 1UHIA 1UHHA 4NDDA 1AHRA 4GBAA 4MRYA 3SG6A 1K96A 3OB2B 1NPQA 1QJTA 3SIBA 1W7JB 1J7PA 4CFRA 1F4QA 1M39A 4M2PA 2QPTA 4CLNA 2Y1NA 3BOWB 4PE1A 2KBMA 1CNPA 4GUKA 4HREE 1K9UA 1S3PA 1R6PA 1TNXA 2LVJA 1SK6D 2KGBC 3NSIA 1ZACA 3JTDB 5D69A 1JSAA 5AERA 2ZRTA 3DF0A 2WC8A 1MF8B 2KI6C 1WLMA 3EVUA 3CGAA 1XFYO 2JXLA 2PALA 3BUWB 5I2OA 4CPVA 1EXRA 1DJGA 1UHJA 1UURA 2JWWA 2KQ6A 4GGNA 4JQ0D 1QXPA 1KFXS 1SW8A 1PALA 1AJ4A 2BBNA 3VROA 4ORBB 1NX3A 3BYAA 1RTP1 1UP5A 2OPOA 5KTYA 1JF0A 1K9KA 3OP0A 3NSKA 4JPZB 2LVKA 1PVBA 2I18A 2D8NA 1K8UA 3CWGA 1MXLC 2M1KB 2ZFDA 2BCAA 5I2QA 3TS5B 1MHOA 4F0ZB 1BT6A 3WHUB 3F45A 3I5IB 5BPJA 2CBLA 3BUOB 2PMYA 1ZFSA 1M45A 1OZOA 1SCMB 1ODBA 2F3ZA 3I5FB 1SL8A 1LINA 1ALWA 2ISDA 4N5XA 1WRKA 3SG3A 1AUIB 3H4SE 2Y4QA 3FS7A 3NXAA 1G33A 4YGDB 4ZCVA 5KU1A 2FOTA 3DVMA 4GGFA 4E68A 1KFUS 1M63B 4I5JA 2JPTA 1QV0A 1YURA 4OR9B 4ETOA 1L2OC 1J7OA 1B4CA 3D10A 4YGCB 1S6JA 3CR4X 1DJWA 1E8AA 5KSZA 1M46A 1QIWA 1UWOA 1WDCC 5DKQA 1F70A 2WCEA 1PRWA 5AANA 1BU3A 2K2FA 4YGAA 3FIAA 4XJKB 5DKRA 1DT7B 2L51A 1QX2A 2M29A 2R2IA 2EHBA 1BR4B 1JFJA 3ICBA 3DD4A 2BCXA 4OVNF 1SRAA 4DRWA 1N2DA 1XFUO 1ALVA 4UPGA 4MVFA 2F33A 2KAVA 1SR6B 1DVIA 2JZIA 1WRLA 2Y5IA 1MUXA 1OZSA 1DJHA 4P5OE 3OHMB 1IJ5A 2CTNA 4FTGA 1RROA 2FCDA 2JU0A 4CIDA 2NZ0A 4PALA 1BF5A 1H4BA 3GOFA 3PFVA 1CFPA 3O2PA 1FPWA 2ZNDA 1D1OA 1ZOTB 4NDBA 1B9AA 4PDZA 3KHEA 1XFZO 3DVJA 2I94A 2RGIA 4MSPA 2JT8A 2WNDA 1NX1A 5CSFA 1XA5A 1BOCA 1RJVA 3CZTX 3EK7A 3JVTB 4GAOA 4PE4A 1JWDA 3EKJA 3VRPA 1KWOB 1LA3A 3I5FC 2HPSA 3KEVA 2KSPA 1OMVA 1PSRA 1SCVA 1TCOB 4PHJA 1B1GA 1W7IB 2K7BA 1UUSA 1SYMA 2MA2A 2M7LA 4DIRA 2K2AA 1WLZA 2HQ8A 2CT9A 4MEWA 4YBHB 1XK4C 2A4JA 2LP2A 1HT9A 1TTXA 1S6CA 2H2KA 1J7RA 1DTLA 2GGMA 2LUXA 1QX5B 3TUYC 2JNXA 2M0RA 2JOJA 1S6IA 2LM5A 3I5HB 1KSOA 1KQMB 3GK2A 1FW4A 4WRIA 5AXIA 1HQVA 1TN4A 2K61A 4OCIA 5D7FA 3CR5X 2G9BA 3BUMB 3CS1A 1K94A 3AAKA 1QVIZ 2GGZA 2KGRA 2LC5A 3VRRA 3LL8B 2V53A 4WQ2A 3DF0B 4ORCB 2L50A 1XFWO 1IGVA 3SG7A 1YRTB 3VRNA
chains in the Genus database with same CATH superfamily
1YX7A 1ORGA 1XFXO 3CZ1A 1YVLA 4GNKB 2LANA 2WOSA 3DVEA 2HQWA 2BAPA 1XO5A 2F2PA 5PALA 3D0YA 4FQOA 4IJ7A 4N1GA 3BXKA 5ER5A 1Z4HA 4Q04A 1SY9A 3K21A 1KSMA 2PRUA 5G08A 2BL0B 1CLMA 1SBJA 2LMTA 2KHNA 1TNWA 1OE9B 1C07A 1UHKA 4PT1A 5I8NA 3BQ3A 3OX6A 1XVJA 3I5GB 1OOIX 3L4AA 2QACA 2CNPA 1MXEA 4IL1A 1C7VA 3PLFB 2MLFC 1CMFA 3BUNB 4I5NB 1GM0A 2WCMA 1RECA 2L2EA 1TWOA 3CTNA 3JVTC 1CFFA 3PM2A 2P6BB 1S36A 2KBIA 1CB1A 1CFDA 2L5XB 2LV7A 1QIVA 2F3YA 4PCWA 1DJIA 1CMGA 1QLSA 3O4YA 3BFAA 2VRGA 3IQQA 4M2QA 4DUQA 3PN7B 2Q4UA 5HLOA 1H8BA 4HRHA 1DJXA 1QATA 2BCBA 1RK9A 1QVIY 5AEQA 3DYEA 4MZLA 2OTGB 2F2OA 2PSRA 4GFTA 1JF2A 3EK4A 2BBMA 2WCJA 2E6WA 1GGZA 4YGEB 4XYNA 1OQPA 2YGUA 1V1GA 4DCKA 4MRXA 2OS8B 1A03A 1FF1A 1F4OA 1IWQA 2AAOA 1RFJA 4YI8A 2H61A 1PK0D 2LAPA 4PHMA 1U5IB 4JWQA 1YRUB 1X02A 5FI6A 2K60A 3CABA 3WXAA 1CFCA 2KLDA 3OBVA 4PHKA 3SIAA 1XFVO 1U5IA 3JTDC 3O78A 2LLUA 2AUCA 1NX2A 1K90D 2E30A 2M3WA 4AOMA 1A29A 1SL7A 2EC6B 3GK4X 3PATA 4USLA 4YRUA 3EVVA 2MAZA 2P70A 2WCLA 4MZJA 1BJFA 1NCYA 1FI6A 1R2UA 1A75B 3LK0A 1YUSA 3R1OA 2CCMA 3R1PA 2BECA 1A75A 1MQ1A 2F8PA 5CSJA 4HRGA 2IS9A 1J1EA 2ZKMX 3A4UB 3N7HA 1LS8A 2LNKA 2BKHB 1DGUA 2M49B 2WCHA 3NGVA 5JJGA 4C0LA 2LMUA 2JTTA 2KLEA 1OSAA 3B7AA 3OB1B 3I5GC 2JTZA 4GPLB 1C3YA 1F71A 4C0KA 3D78A 1Y6WA 3TS5C 1TUJA 3AKBA 4PE7A 2BKIB 3R1VA 1KK8B 1L7ZA 1P28A 2K7OA 2M97A 1NIWA 3I5IC 2NLNA 2O5GA 4INWA 5I2LA 2LCPA 5J3XA 3HCMA 1SCMC 2K8MB 1XYDA 1IRJA 1KFXL 3D75A 2KI4B 2KAXA 2WORA 3FWCA 3TDUA 3FE8A 2MRDA 1YTZC 4GGFC 1BG1A 1SL9A 3ZNIA 1NWDA 2M9GA 4MBEA 4PHNA 1JC2A 1WRZA 1C7WA 3BFBA 2QEOA 1BR1B 1AVSA 3KF9A 4NQGA 4BY4A 1B8RA 1NYAA 1KK7Z 3CZ2A 4M2OA 2OS8C 1UHNA 2JT3A 2MHHA 3DVKA 2BE4A 4OKHA 1B8LA 1JUOA 3VRQA 2TN4A 1SMGA 4ZCUA 1TRFA 3TZ1A 1JFKA 3PSRA 1SNLA 5CPVA 5CSNA 1CM1A 2FJUB 2JULA 3HX4A 5FYXA 3C1VA 3KPXA 1GQMA 3IF7A 2K7CA 2JRFA 1KFUL 2EC6C 2MJWB 5FI2A 3QRXA 1S26D 2LVVA 1Y0VH 3D0YB 3DY9A 5HKZA 2JT0A 1DEKA 1CLLA 3CYZA 1DF0B 1L2OB 1TNPA 1SR6C 2L2CA 1SKTA 2I7AA 2LLTA 2WC6A 1F8HA 1DF0A 2LHLA 5GQQC 1IH0A 1GGWA 2EGDA 3CR2A 3LK1A 1WDCB 1EG3A 1N0YA 2Q91A 3ZWHA 2M7NA 1EL4A 2SASA 2KYCA 2G2BA 2ZNEA 1NP8A 1CDNA 5HKYA 1QASA 1YR5A 3WNXB 1NCZA 1QS7A 1NSHA 2LLSA 3BFHA 3BOWA 3PALA 3KO0A 1LXFC 1KK8C 1LA0A 2LMVA 3EKHA 1TOPA 3LLEA 2COLB 2CXJA 2MBXA 1PVAA 1KK7Y 2KI6D 2M8UA 3AKAA 3OX5A 1KWOC 1QLKA 1N65A 1MWNA 2KI4C 1AJ5A 2JNFA 1QX7A 1F55A 3S0GA 1CDPA 1FBVA 1DJYA 1NX0A 1CKKA 1IQ5A 2NCPA 2LE9B 1LVCD 3MSEB 1TCFA 1A2XA 3L4LA 5HKWA 2KPHA 1K9PA 1YVHA 2MLEC 3A8RA 3B88A 3S0BA 1CLBA 1NUBA 3SG4A 1M31A 2LP3A 1CTRA 2KYFA 4OV2A 2L0PA 3EK8A 3I5HC 4MN0A 1DJZA 1IQ3A 1OOJA 1SPYA 2KDHA 1KQMC 5JOLA 3CDNA 1B7TZ 3CLNA 1K2HA 1BLQA 1OW4A 2HETA 2Y1MA 4DS7A 4D1EA 5CSIA 1V1FA 1T14A 1XFRA 3NSLA 2LVIA 3NHIA 4HSZA 1IJ6A 2KFFA 4I5LB 4JKTA 4U8DA 3TDIA 4AQJA 1DMOA 1SSEB 2KFGA 4WQ3A 1OOGA 3Q8IA 2K7DA 3QMEA 1ZUZA 4QJ4B 1OMDA 4C0JA 1DC1A 4R1EA 1S1EA 4AQIA 1S5GZ 3RLZA 3BUXB 4QJ3B 3UNWA 1KCYA 1PSBA 3VGOA 5IBWA 1BODA 2L4HA 1CDMA 2KNEA 1NCXA 1XK4A 1EJ3A 2KAYA 3EVRA 3SG2A 1AK8A 2ZRSA 4FQTA 3TUYB 4QJ5B 1Z2CB 2QDIA 3E3RA 3SS4A 2BL0C 2NXQA 1G4YR 3TDZA 2L98A 5HL1A 2NCOA 1BMOA 2LHIA 2KFHA 2I2RE 2LUCA 3NSOA 2M1UA 3D77A 4P2YB 1A4PA 4NDCA 3WHTB 5B8IB 1MR8A 4YGBB 1CM4A 2AMIA 4XJKA 1WY9A 2HF5A 3CZ0A 4MZKA 1VRKA 2K0JA 4A4CA 1AP4A 2JQ6A 1ZMZA 2O60A 3DXLA 2BNXA 2ZN9A 1FI5A 2JC2A 4L9MA 1F54A 1B8CA 4MLWA 2GTEA 2WCFA 5ER4X 3PM8A 2GV5A 2B1UA 1K95A 3SJSA 1GJYA 1Q80A 4A4BA 1B7TY 2DOQA 5AFPA 3O6BA 3PN7C 1RWYA 3FE9A 2ZN8A 4N1FA 3SG5A 2PASA 3RM1A 4I5KA 1J7QA 3DZTA 2JXCA 4CFQA 2OTGC 1YX8A 1KQVA 1J1DA 1TIZA 1Y1UA 1IG5A 2KQYA 1IKUA 1YUTA 1OMRA 5TNCA 1PULA 1S5GY 2BE6A 2H61C 3GK1A 2FCEA 2WCBA 3M0WA 4TNCA 5DKNA 1Y1AA 3IQOA 4BY5A 4YI9A 5F6TA 4PE0A 1LKJA 1J55A 1DGVA 1EG4A 1YUUA 1K93D 2PVBA 1EH2A 3AAJA 3FWBA 1G8IA 1TUZA 1B47A 4ICBA 4INXA 5DICA 4ORAB 2SCPA 5D3OA 1QTXA 5HLVA 1Y1XA 5K89A 2KOTA 3LCPC 1TNQA 1OOFA 1QV1A 2L4IA 5HYDA 1CDLA 1JBAA 1UHIA 1UHHA 4NDDA 1AHRA 4GBAA 4MRYA 3SG6A 1K96A 3OB2B 1NPQA 1QJTA 3SIBA 1W7JB 1J7PA 4CFRA 3B87A 1F4QA 1M39A 4M2PA 2QPTA 4CLNA 2Y1NA 2FJYA 3BOWB 4PE1A 2KBMA 1CNPA 1IIOA 2ERBA 4GUKA 4HREE 1K9UA 1S3PA 1R6PA 1TNXA 2LVJA 1SK6D 2KGBC 3NSIA 1ZACA 3JTDB 5D69A 3SS3A 1JSAA 5AERA 2ZRTA 3DF0A 3OGNA 2PYQA 2WC8A 1MF8B 2KI6C 1WLMA 3EVUA 3CGAA 1XFYO 3S0DA 2JXLA 2PALA 3BUWB 5I2OA 4CPVA 1DELA 1DJGA 1EXRA 1UHJA 1UURA 2JWWA 2KQ6A 4GGNA 4JQ0D 1QXPA 4OZDA 1KFXS 1SW8A 1PALA 1AJ4A 2BBNA 3VROA 4ORBB 1NX3A 3BYAA 1RTP1 1UP5A 2OPOA 5KTYA 1JF0A 1K9KA 3OP0A 3NSKA 4JPZB 2LVKA 3VB1A 1PVBA 2I18A 2D8NA 3S0EA 3BJHA 1K8UA 3CWGA 1MXLC 2M1KB 2QEVA 2ZFDA 2BCAA 5I2QA 3TS5B 1MHOA 2L5YA 4F0ZB 1BT6A 3WHUB 3F45A 3I5IB 5BPJA 2CBLA 2P71A 3BUOB 2PMYA 3R72A 1ZFSA 1M45A 4KYNA 1C3ZA 2QEHA 1OZOA 1SCMB 1ODBA 2F3ZA 3I5FB 1SL8A 1LINA 1ALWA 2ISDA 4N5XA 1WRKA 3SG3A 1AUIB 3H4SE 2Y4QA 3FS7A 3NXAA 1G33A 4YGDB 4ZCVA 5KU1A 2FOTA 3DVMA 4GGFA 4E68A 1KFUS 1M63B 4I5JA 2JPTA 1QV0A 1YURA 4OR9B 4ETOA 1L2OC 1J7OA 1B4CA 3D10A 3S0AA 4YGCB 1S6JA 3CR4X 1DJWA 1E8AA 5KSZA 1M46A 1QIWA 1UWOA 1WDCC 5DKQA 1F70A 2WCEA 1PRWA 5AANA 1BU3A 3L47A 2K2FA 4YGAA 3FIAA 4XJKB 5DKRA 1DT7B 2L51A 3K1EA 1QX2A 3UO9A 2M29A 3FE6A 2R2IA 2EHBA 1BR4B 1DQEA 1JFJA 3ICBA 3DD4A 2BCXA 3EG5B 4OVNF 1SRAA 3V2LA 4DRWA 1N2DA 1XFUO 1ALVA 3O4XA 3PJIA 3D74A 4UPGA 4MVFA 2F33A 2KAVA 1SR6B 1DVIA 2JZIA 2WCKA 1WRLA 2Y5IA 1MUXA 1OZSA 1DJHA 4P5OE 3OHMB 1IJ5A 2PQLA 4JD9A 3D76A 2CTNA 4FTGA 1RROA 2FCDA 2JU0A 4CIDA 2NZ0A 4PALA 1BF5A 1QWVA 1H4BA 3GOFA 3PFVA 1CFPA 3O2PA 1FPWA 2WC5A 2ZNDA 2H8VA 1ZOTB 1D1OA 1OOHA 4F7FA 4NDBA 1B9AA 4PDZA 3KHEA 1XFZO 3DVJA 2I94A 2RGIA 4MSPA 2QEBA 2JT8A 2WNDA 3S0FA 1NX1A 5CSFA 1XA5A 1BOCA 1RJVA 3CZTX 3EK7A 3JVTB 4GAOA 4PE4A 1JWDA 3EKJA 3VRPA 1KWOB 1LA3A 3I5FC 2HPSA 3KEVA 5EL2A 2KSPA 1OMVA 1PSRA 1SCVA 1TCOB 4PHJA 1B1GA 1W7IB 2K7BA 1W9ZA 1UUSA 1SYMA 2MA2A 2M7LA 4DIRA 5I94A 2K2AA 1WLZA 2HQ8A 2CT9A 4MEWA 4YBHB 1XK4C 2A4JA 2LP2A 1HT9A 1TTXA 1S6CA 2H2KA 5FI7A 1J7RA 1DTLA 2GGMA 2LUXA 1QX5B 3TUYC 2JNXA 2M0RA 2JOJA 1S6IA 2LM5A 3I5HB 1KSOA 1KQMB 3GK2A 1FW4A 4WRIA 5AXIA 1HQVA 1TN4A 2K61A 2JPOA 4OCIA 3IVTA 3B86A 3CR5X 5D7FA 2G9BA 3BUMB 3D73A 3CS1A 1K94A 3RZSA 3AAKA 1QVIZ 3NHTA 2GGZA 2KGRA 2LC5A 3SS5A 3B6XA 3LL8B 3VRRA 2V53A 4WQ2A 3DF0B 4ORCB 2L50A 1XFWO 1IGVA 3SG7A 1YRTB 3VRNA
chains in the Genus database with same CATH topology
1YX7A 1XFXO 1YVLA 4GNKB 2LANA 2WOSA 3DVEA 2HQWA 1XO5A 2F2PA 5PALA 3D0YA 4FQOA 4N1GA 3BXKA 5ER5A 4Q04A 1SY9A 3K21A 1KSMA 2PRUA 5G08A 2BL0B 1CLMA 1SBJA 2LMTA 2KHNA 1TNWA 1OE9B 1C07A 1UHKA 5I8NA 3BQ3A 3OX6A 1XVJA 3I5GB 2QACA 2CNPA 1MXEA 4IL1A 1C7VA 3PLFB 2MLFC 1CMFA 3BUNB 4I5NB 1RECA 2L2EA 3CTNA 3JVTC 1CFFA 2P6BB 1S36A 2KBIA 1CB1A 1CFDA 2L5XB 2LV7A 1QIVA 2F3YA 4PCWA 1DJIA 1CMGA 1QLSA 3O4YA 4DUQA 2VRGA 3IQQA 4M2QA 3PN7B 2Q4UA 5HLOA 1H8BA 4HRHA 1DJXA 1QATA 2BCBA 1RK9A 1QVIY 5AEQA 4MZLA 2OTGB 2F2OA 2PSRA 4GFTA 1JF2A 3EK4A 2BBMA 4YGEB 2E6WA 1GGZA 4XYNA 1OQPA 1FF1A 1V1GA 4DCKA 4MRXA 2OS8B 1A03A 1F4OA 1IWQA 2AAOA 1RFJA 4YI8A 2H61A 1PK0D 2LAPA 4PHMA 1U5IB 4JWQA 1YRUB 1X02A 3WXAA 1CFCA 3SIAA 4PHKA 1XFVO 1U5IA 3JTDC 3O78A 2LLUA 2AUCA 1NX2A 1K90D 2E30A 2M3WA 4AOMA 1A29A 1SL7A 2EC6B 3GK4X 3PATA 4USLA 4YRUA 3EVVA 2MAZA 4MZJA 1BJFA 1NCYA 1FI6A 1R2UA 1A75B 3LK0A 1YUSA 2CCMA 2BECA 1A75A 1MQ1A 2F8PA 5CSJA 4HRGA 2IS9A 1J1EA 2ZKMX 3A4UB 2LNKA 2BKHB 1DGUA 2M49B 5JJGA 4C0LA 2LMUA 2JTTA 3OB1B 1OSAA 3I5GC 2JTZA 4GPLB 1F71A 4C0KA 1Y6WA 3TS5C 3AKBA 4PE7A 2BKIB 1KK8B 1L7ZA 2M97A 2K7OA 1NIWA 3I5IC 2NLNA 2O5GA 5I2LA 2LCPA 5J3XA 3HCMA 1SCMC 2K8MB 1XYDA 1IRJA 1KFXL 2KI4B 2KAXA 2WORA 3FWCA 3TDUA 2MRDA 1YTZC 4GGFC 1BG1A 1SL9A 3ZNIA 1NWDA 2M9GA 4MBEA 4PHNA 1JC2A 1WRZA 1C7WA 1BR1B 1AVSA 3KF9A 4NQGA 4BY4A 1B8RA 1NYAA 1KK7Z 4M2OA 2OS8C 1UHNA 2JT3A 2MHHA 3DVKA 2BE4A 4OKHA 1B8LA 1JUOA 3VRQA 2TN4A 1SMGA 4ZCUA 1TRFA 3TZ1A 1JFKA 3PSRA 1SNLA 5CPVA 5CSNA 1CM1A 2FJUB 2JULA 3HX4A 5FYXA 3C1VA 3KPXA 1GQMA 3IF7A 2K7CA 2JRFA 1KFUL 2EC6C 2MJWB 3QRXA 1S26D 2LVVA 1Y0VH 3D0YB 5HKZA 2JT0A 1CLLA 1DF0B 1L2OB 1TNPA 1SR6C 1SKTA 2I7AA 2LLTA 1F8HA 1DF0A 2LHLA 5GQQC 1IH0A 1GGWA 2EGDA 3CR2A 3LK1A 1WDCB 1EG3A 1N0YA 2Q91A 3ZWHA 2M7NA 1EL4A 2SASA 2KYCA 2G2BA 2ZNEA 1NP8A 1CDNA 5HKYA 1QASA 1YR5A 3WNXB 1NCZA 1QS7A 1NSHA 2LLSA 3BOWA 3PALA 3KO0A 1LXFC 1KK8C 1LA0A 2LMVA 3EKHA 1TOPA 3LLEA 2COLB 2CXJA 2MBXA 1PVAA 1KK7Y 2KI6D 2M8UA 3AKAA 3OX5A 1KWOC 1QLKA 1N65A 1MWNA 2KI4C 1AJ5A 2JNFA 1QX7A 1F55A 1CDPA 1FBVA 1DJYA 1NX0A 1CKKA 1IQ5A 2NCPA 2LE9B 1LVCD 3MSEB 1TCFA 1A2XA 5HKWA 3A8RA 1K9PA 1YVHA 2MLEC 1CLBA 1NUBA 3SG4A 1M31A 2LP3A 1CTRA 2KYFA 4OV2A 2L0PA 3EK8A 3I5HC 4MN0A 1DJZA 1IQ3A 1OOJA 1SPYA 2KDHA 1KQMC 5JOLA 1B7TZ 3CLNA 1K2HA 1BLQA 4DS7A 2HETA 2Y1MA 4D1EA 5CSIA 1V1FA 3NSLA 2LVIA 4HSZA 1IJ6A 2KFFA 4I5LB 4U8DA 3TDIA 4AQJA 1DMOA 2KFGA 4WQ3A 2K7DA 4QJ4B 1ZUZA 1OMDA 4C0JA 4R1EA 1S1EA 4AQIA 1S5GZ 3RLZA 3BUXB 4QJ3B 1KCYA 1PSBA 3VGOA 5IBWA 1BODA 2L4HA 1CDMA 2KNEA 1NCXA 1XK4A 1EJ3A 2KAYA 3EVRA 3SG2A 1AK8A 2ZRSA 3TUYB 4QJ5B 3E3RA 2BL0C 2NXQA 1G4YR 3TDZA 2L98A 2NCOA 1BMOA 2LHIA 2KFHA 2I2RE 2LUCA 3NSOA 2M1UA 4P2YB 1A4PA 4NDCA 3WHTB 5B8IB 1MR8A 4YGBB 1CM4A 2AMIA 4XJKA 1WY9A 2HF5A 4MZKA 1VRKA 2K0JA 4A4CA 1AP4A 2JQ6A 1ZMZA 2O60A 2ZN9A 1FI5A 2JC2A 4L9MA 1F54A 1B8CA 4MLWA 2WCFA 5ER4X 3PM8A 2GV5A 2B1UA 1K95A 3SJSA 1GJYA 1Q80A 4A4BA 1B7TY 2DOQA 5AFPA 3O6BA 3PN7C 1RWYA 2ZN8A 4N1FA 3SG5A 2PASA 3RM1A 4I5KA 1J7QA 2JXCA 4CFQA 2OTGC 1YX8A 1KQVA 1J1DA 1TIZA 1Y1UA 1IG5A 2KQYA 1IKUA 1YUTA 1OMRA 5TNCA 1PULA 1S5GY 2BE6A 2H61C 3GK1A 2FCEA 2WCBA 3M0WA 4TNCA 5DKNA 1Y1AA 3IQOA 4BY5A 4YI9A 5F6TA 4PE0A 1LKJA 1J55A 1DGVA 1EG4A 1YUUA 1K93D 2PVBA 1EH2A 3AAJA 3FWBA 1G8IA 4ICBA 1B47A 4ORAB 2SCPA 1QTXA 5HLVA 1Y1XA 5K89A 2KOTA 3LCPC 1TNQA 2L4IA 1QV1A 5HYDA 1CDLA 1JBAA 1UHIA 1UHHA 4NDDA 1AHRA 4GBAA 4MRYA 3SG6A 1K96A 3OB2B 1NPQA 1QJTA 3SIBA 1W7JB 1J7PA 4CFRA 1F4QA 1M39A 4M2PA 2QPTA 4CLNA 2Y1NA 3BOWB 4PE1A 2KBMA 1CNPA 4GUKA 4HREE 1K9UA 1S3PA 1R6PA 1TNXA 2LVJA 1SK6D 2KGBC 3NSIA 1ZACA 3JTDB 5D69A 1JSAA 5AERA 2ZRTA 3DF0A 2WC8A 1MF8B 2KI6C 1WLMA 3EVUA 3CGAA 1XFYO 2JXLA 2PALA 3BUWB 5I2OA 4CPVA 1EXRA 1DJGA 1UHJA 1UURA 2JWWA 2KQ6A 4GGNA 4JQ0D 1QXPA 1KFXS 1SW8A 1PALA 1AJ4A 2BBNA 3VROA 4ORBB 1NX3A 3BYAA 1RTP1 1UP5A 2OPOA 5KTYA 1JF0A 1K9KA 3OP0A 3NSKA 4JPZB 2LVKA 1PVBA 2I18A 2D8NA 1K8UA 3CWGA 1MXLC 2M1KB 2ZFDA 2BCAA 5I2QA 3TS5B 1MHOA 4F0ZB 1BT6A 3WHUB 3F45A 3I5IB 5BPJA 2CBLA 3BUOB 2PMYA 1ZFSA 1M45A 1OZOA 1SCMB 1ODBA 2F3ZA 3I5FB 1SL8A 1LINA 1ALWA 2ISDA 4N5XA 1WRKA 3SG3A 1AUIB 3H4SE 2Y4QA 3FS7A 3NXAA 1G33A 4YGDB 4ZCVA 5KU1A 2FOTA 3DVMA 4GGFA 4E68A 1KFUS 1M63B 4I5JA 2JPTA 1QV0A 1YURA 4OR9B 4ETOA 1L2OC 1J7OA 1B4CA 3D10A 4YGCB 1S6JA 3CR4X 1DJWA 1E8AA 5KSZA 1M46A 1QIWA 1UWOA 1WDCC 5DKQA 1F70A 2WCEA 1PRWA 5AANA 1BU3A 2K2FA 4YGAA 3FIAA 4XJKB 5DKRA 1DT7B 2L51A 1QX2A 2M29A 2R2IA 2EHBA 1BR4B 1JFJA 3ICBA 3DD4A 2BCXA 4OVNF 1SRAA 4DRWA 1N2DA 1XFUO 1ALVA 4UPGA 4MVFA 2F33A 2KAVA 1SR6B 1DVIA 2JZIA 1WRLA 2Y5IA 1MUXA 1OZSA 1DJHA 4P5OE 3OHMB 1IJ5A 2CTNA 4FTGA 1RROA 2FCDA 2JU0A 4CIDA 2NZ0A 4PALA 1BF5A 1H4BA 3GOFA 3PFVA 1CFPA 3O2PA 1FPWA 2ZNDA 1D1OA 1ZOTB 4NDBA 1B9AA 4PDZA 3KHEA 1XFZO 3DVJA 2I94A 2RGIA 4MSPA 2JT8A 2WNDA 1NX1A 5CSFA 1XA5A 1BOCA 1RJVA 3CZTX 3EK7A 3JVTB 4GAOA 4PE4A 1JWDA 3EKJA 3VRPA 1KWOB 1LA3A 3I5FC 2HPSA 3KEVA 2KSPA 1OMVA 1PSRA 1SCVA 1TCOB 4PHJA 1B1GA 1W7IB 2K7BA 1UUSA 1SYMA 2MA2A 2M7LA 4DIRA 2K2AA 1WLZA 2HQ8A 2CT9A 4MEWA 4YBHB 1XK4C 2A4JA 2LP2A 1HT9A 1TTXA 1S6CA 2H2KA 1J7RA 1DTLA 2GGMA 2LUXA 1QX5B 3TUYC 2JNXA 2M0RA 2JOJA 1S6IA 2LM5A 3I5HB 1KSOA 1KQMB 3GK2A 1FW4A 4WRIA 5AXIA 1HQVA 1TN4A 2K61A 4OCIA 5D7FA 3CR5X 2G9BA 3BUMB 3CS1A 1K94A 3AAKA 1QVIZ 2GGZA 2KGRA 2LC5A 3VRRA 3LL8B 2V53A 4WQ2A 3DF0B 4ORCB 2L50A 1XFWO 1IGVA 3SG7A 1YRTB 3VRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX7 A;  1XFX O;  1YVL A;  4GNK B;  2LAN A;  2WOS A;  3DVE A;  2HQW A;  1XO5 A;  2F2P A;  5PAL A;  3D0Y A;  4FQO A;  4N1G A;  3BXK A;  5ER5 A;  4Q04 A;  1SY9 A;  3K21 A;  1KSM A;  2PRU A;  5G08 A;  2BL0 B;  1CLM A;  1SBJ A;  2LMT A;  2KHN A;  1TNW A;  1OE9 B;  1C07 A;  1UHK A;  5I8N A;  3BQ3 A;  3OX6 A;  1XVJ A;  3I5G B;  2QAC A;  2CNP A;  1MXE A;  4IL1 A;  1C7V A;  3PLF B;  2MLF C;  1CMF A;  3BUN B;  4I5N B;  1REC A;  2L2E A;  3CTN A;  3JVT C;  1CFF A;  2P6B B;  1S36 A;  2KBI A;  1CB1 A;  1CFD A;  2L5X B;  2LV7 A;  1QIV A;  2F3Y A;  4PCW A;  1DJI A;  1CMG A;  1QLS A;  3O4Y A;  4DUQ A;  2VRG A;  3IQQ A;  4M2Q A;  3PN7 B;  2Q4U A;  5HLO A;  1H8B A;  4HRH A;  1DJX A;  1QAT A;  2BCB A;  1RK9 A;  1QVI Y;  5AEQ A;  4MZL A;  2OTG B;  2F2O A;  2PSR A;  4GFT A;  1JF2 A;  3EK4 A;  2BBM A;  4YGE B;  2E6W A;  1GGZ A;  4XYN A;  1OQP A;  1FF1 A;  1V1G A;  4DCK A;  4MRX A;  2OS8 B;  1A03 A;  1F4O A;  1IWQ A;  2AAO A;  1RFJ A;  4YI8 A;  2H61 A;  1PK0 D;  2LAP A;  4PHM A;  1U5I B;  4JWQ A;  1YRU B;  1X02 A;  3WXA A;  1CFC A;  3SIA A;  4PHK A;  1XFV O;  1U5I A;  3JTD C;  3O78 A;  2LLU A;  2AUC A;  1NX2 A;  1K90 D;  2E30 A;  2M3W A;  4AOM A;  1A29 A;  1SL7 A;  2EC6 B;  3GK4 X;  3PAT A;  4USL A;  4YRU A;  3EVV A;  2MAZ A;  4MZJ A;  1BJF A;  1NCY A;  1FI6 A;  1R2U A;  1A75 B;  3LK0 A;  1YUS A;  2CCM A;  2BEC A;  1A75 A;  1MQ1 A;  2F8P A;  5CSJ A;  4HRG A;  2IS9 A;  1J1E A;  2ZKM X;  3A4U B;  2LNK A;  2BKH B;  1DGU A;  2M49 B;  5JJG A;  4C0L A;  2LMU A;  2JTT A;  3OB1 B;  1OSA A;  3I5G C;  2JTZ A;  4GPL B;  1F71 A;  4C0K A;  1Y6W A;  3TS5 C;  3AKB A;  4PE7 A;  2BKI B;  1KK8 B;  1L7Z A;  2M97 A;  2K7O A;  1NIW A;  3I5I C;  2NLN A;  2O5G A;  5I2L A;  2LCP A;  5J3X A;  3HCM A;  1SCM C;  2K8M B;  1XYD A;  1IRJ A;  1KFX L;  2KI4 B;  2KAX A;  2WOR A;  3FWC A;  3TDU A;  2MRD A;  1YTZ C;  4GGF C;  1BG1 A;  1SL9 A;  3ZNI A;  1NWD A;  2M9G A;  4MBE A;  4PHN A;  1JC2 A;  1WRZ A;  1C7W A;  1BR1 B;  1AVS A;  3KF9 A;  4NQG A;  4BY4 A;  1B8R A;  1NYA A;  1KK7 Z;  4M2O A;  2OS8 C;  1UHN A;  2JT3 A;  2MHH A;  3DVK A;  2BE4 A;  4OKH A;  1B8L A;  1JUO A;  3VRQ A;  2TN4 A;  1SMG A;  4ZCU A;  1TRF A;  3TZ1 A;  1JFK A;  3PSR A;  1SNL A;  5CPV A;  5CSN A;  1CM1 A;  2FJU B;  2JUL A;  3HX4 A;  5FYX A;  3C1V A;  3KPX A;  1GQM A;  3IF7 A;  2K7C A;  2JRF A;  1KFU L;  2EC6 C;  2MJW B;  3QRX A;  1S26 D;  2LVV A;  1Y0V H;  3D0Y B;  5HKZ A;  2JT0 A;  1CLL A;  1DF0 B;  1L2O B;  1TNP A;  1SR6 C;  1SKT A;  2I7A A;  2LLT A;  1F8H A;  1DF0 A;  2LHL A;  5GQQ C;  1IH0 A;  1GGW A;  2EGD A;  3CR2 A;  3LK1 A;  1WDC B;  1EG3 A;  1N0Y A;  2Q91 A;  3ZWH A;  2M7N A;  1EL4 A;  2SAS A;  2KYC A;  2G2B A;  2ZNE A;  1NP8 A;  1CDN A;  5HKY A;  1QAS A;  1YR5 A;  3WNX B;  1NCZ A;  1QS7 A;  1NSH A;  2LLS A;  3BOW A;  3PAL A;  3KO0 A;  1LXF C;  1KK8 C;  1LA0 A;  2LMV A;  3EKH A;  1TOP A;  3LLE A;  2COL B;  2CXJ A;  2MBX A;  1PVA A;  1KK7 Y;  2KI6 D;  2M8U A;  3AKA A;  3OX5 A;  1KWO C;  1QLK A;  1N65 A;  1MWN A;  2KI4 C;  1AJ5 A;  2JNF A;  1QX7 A;  1F55 A;  1CDP A;  1FBV A;  1DJY A;  1NX0 A;  1CKK A;  1IQ5 A;  2NCP A;  2LE9 B;  1LVC D;  3MSE B;  1TCF A;  1A2X A;  5HKW A;  3A8R A;  1K9P A;  1YVH A;  2MLE C;  1CLB A;  1NUB A;  3SG4 A;  1M31 A;  2LP3 A;  1CTR A;  2KYF A;  4OV2 A;  2L0P A;  3EK8 A;  3I5H C;  4MN0 A;  1DJZ A;  1IQ3 A;  1OOJ A;  1SPY A;  2KDH A;  1KQM C;  5JOL A;  1B7T Z;  3CLN A;  1K2H A;  1BLQ A;  4DS7 A;  2HET A;  2Y1M A;  4D1E A;  5CSI A;  1V1F A;  3NSL A;  2LVI A;  4HSZ A;  1IJ6 A;  2KFF A;  4I5L B;  4U8D A;  3TDI A;  4AQJ A;  1DMO A;  2KFG A;  4WQ3 A;  2K7D A;  4QJ4 B;  1ZUZ A;  1OMD A;  4C0J A;  4R1E A;  1S1E A;  4AQI A;  1S5G Z;  3RLZ A;  3BUX B;  4QJ3 B;  1KCY A;  1PSB A;  3VGO A;  5IBW A;  1BOD A;  2L4H A;  1CDM A;  2KNE A;  1NCX A;  1XK4 A;  1EJ3 A;  2KAY A;  3EVR A;  3SG2 A;  1AK8 A;  2ZRS A;  3TUY B;  4QJ5 B;  3E3R A;  2BL0 C;  2NXQ A;  1G4Y R;  3TDZ A;  2L98 A;  2NCO A;  1BMO A;  2LHI A;  2KFH A;  2I2R E;  2LUC A;  3NSO A;  2M1U A;  4P2Y B;  1A4P A;  4NDC A;  3WHT B;  5B8I B;  1MR8 A;  4YGB B;  1CM4 A;  2AMI A;  4XJK A;  1WY9 A;  2HF5 A;  4MZK A;  1VRK A;  2K0J A;  4A4C A;  1AP4 A;  2JQ6 A;  1ZMZ A;  2O60 A;  2ZN9 A;  1FI5 A;  2JC2 A;  4L9M A;  1F54 A;  1B8C A;  4MLW A;  2WCF A;  5ER4 X;  3PM8 A;  2GV5 A;  2B1U A;  1K95 A;  3SJS A;  1GJY A;  1Q80 A;  4A4B A;  1B7T Y;  2DOQ A;  5AFP A;  3O6B A;  3PN7 C;  1RWY A;  2ZN8 A;  4N1F A;  3SG5 A;  2PAS A;  3RM1 A;  4I5K A;  1J7Q A;  2JXC A;  4CFQ A;  2OTG C;  1YX8 A;  1KQV A;  1J1D A;  1TIZ A;  1Y1U A;  1IG5 A;  2KQY A;  1IKU A;  1YUT A;  1OMR A;  5TNC A;  1PUL A;  1S5G Y;  2BE6 A;  2H61 C;  3GK1 A;  2FCE A;  2WCB A;  3M0W A;  4TNC A;  5DKN A;  1Y1A A;  3IQO A;  4BY5 A;  4YI9 A;  5F6T A;  4PE0 A;  1LKJ A;  1J55 A;  1DGV A;  1EG4 A;  1YUU A;  1K93 D;  2PVB A;  1EH2 A;  3AAJ A;  3FWB A;  1G8I A;  4ICB A;  1B47 A;  4ORA B;  2SCP A;  1QTX A;  5HLV A;  1Y1X A;  5K89 A;  2KOT A;  3LCP C;  1TNQ A;  2L4I A;  1QV1 A;  5HYD A;  1CDL A;  1JBA A;  1UHI A;  1UHH A;  4NDD A;  1AHR A;  4GBA A;  4MRY A;  3SG6 A;  1K96 A;  3OB2 B;  1NPQ A;  1QJT A;  3SIB A;  1W7J B;  1J7P A;  4CFR A;  1F4Q A;  1M39 A;  4M2P A;  2QPT A;  4CLN A;  2Y1N A;  3BOW B;  4PE1 A;  2KBM A;  1CNP A;  4GUK A;  4HRE E;  1K9U A;  1S3P A;  1R6P A;  1TNX A;  2LVJ A;  1SK6 D;  2KGB C;  3NSI A;  1ZAC A;  3JTD B;  5D69 A;  1JSA A;  5AER A;  2ZRT A;  3DF0 A;  2WC8 A;  1MF8 B;  2KI6 C;  1WLM A;  3EVU A;  3CGA A;  1XFY O;  2JXL A;  2PAL A;  3BUW B;  5I2O A;  4CPV A;  1EXR A;  1DJG A;  1UHJ A;  1UUR A;  2JWW A;  2KQ6 A;  4GGN A;  4JQ0 D;  1QXP A;  1KFX S;  1SW8 A;  1PAL A;  1AJ4 A;  2BBN A;  3VRO A;  4ORB B;  1NX3 A;  3BYA A;  1RTP 1;  1UP5 A;  2OPO A;  5KTY A;  1JF0 A;  1K9K A;  3OP0 A;  3NSK A;  4JPZ B;  2LVK A;  1PVB A;  2I18 A;  2D8N A;  1K8U A;  3CWG A;  1MXL C;  2M1K B;  2ZFD A;  2BCA A;  5I2Q A;  3TS5 B;  1MHO A;  4F0Z B;  1BT6 A;  3WHU B;  3F45 A;  3I5I B;  5BPJ A;  2CBL A;  3BUO B;  2PMY A;  1ZFS A;  1M45 A;  1OZO A;  1SCM B;  1ODB A;  2F3Z A;  3I5F B;  1SL8 A;  1LIN A;  1ALW A;  2ISD A;  4N5X A;  1WRK A;  3SG3 A;  1AUI B;  3H4S E;  2Y4Q A;  3FS7 A;  3NXA A;  1G33 A;  4YGD B;  4ZCV A;  5KU1 A;  2FOT A;  3DVM A;  4GGF A;  4E68 A;  1KFU S;  1M63 B;  4I5J A;  2JPT A;  1QV0 A;  1YUR A;  4OR9 B;  4ETO A;  1L2O C;  1J7O A;  1B4C A;  3D10 A;  4YGC B;  1S6J A;  3CR4 X;  1DJW A;  1E8A A;  5KSZ A;  1M46 A;  1QIW A;  1UWO A;  1WDC C;  5DKQ A;  1F70 A;  2WCE A;  1PRW A;  5AAN A;  1BU3 A;  2K2F A;  4YGA A;  3FIA A;  4XJK B;  5DKR A;  1DT7 B;  2L51 A;  1QX2 A;  2M29 A;  2R2I A;  2EHB A;  1BR4 B;  1JFJ A;  3ICB A;  3DD4 A;  2BCX A;  4OVN F;  1SRA A;  4DRW A;  1N2D A;  1XFU O;  1ALV A;  4UPG A;  4MVF A;  2F33 A;  2KAV A;  1SR6 B;  1DVI A;  2JZI A;  1WRL A;  2Y5I A;  1MUX A;  1OZS A;  1DJH A;  4P5O E;  3OHM B;  1IJ5 A;  2CTN A;  4FTG A;  1RRO A;  2FCD A;  2JU0 A;  4CID A;  2NZ0 A;  4PAL A;  1BF5 A;  1H4B A;  3GOF A;  3PFV A;  1CFP A;  3O2P A;  1FPW A;  2ZND A;  1D1O A;  1ZOT B;  4NDB A;  1B9A A;  4PDZ A;  3KHE A;  1XFZ O;  3DVJ A;  2I94 A;  2RGI A;  4MSP A;  2JT8 A;  2WND A;  1NX1 A;  5CSF A;  1XA5 A;  1BOC A;  1RJV A;  3CZT X;  3EK7 A;  3JVT B;  4GAO A;  4PE4 A;  1JWD A;  3EKJ A;  3VRP A;  1KWO B;  1LA3 A;  3I5F C;  2HPS A;  3KEV A;  2KSP A;  1OMV A;  1PSR A;  1SCV A;  1TCO B;  4PHJ A;  1B1G A;  1W7I B;  2K7B A;  1UUS A;  1SYM A;  2MA2 A;  2M7L A;  4DIR A;  2K2A A;  1WLZ A;  2HQ8 A;  2CT9 A;  4MEW A;  4YBH B;  1XK4 C;  2A4J A;  2LP2 A;  1HT9 A;  1TTX A;  1S6C A;  2H2K A;  1J7R A;  1DTL A;  2GGM A;  2LUX A;  1QX5 B;  3TUY C;  2JNX A;  2M0R A;  2JOJ A;  1S6I A;  2LM5 A;  3I5H B;  1KSO A;  1KQM B;  3GK2 A;  1FW4 A;  4WRI A;  5AXI A;  1HQV A;  1TN4 A;  2K61 A;  4OCI A;  5D7F A;  3CR5 X;  2G9B A;  3BUM B;  3CS1 A;  1K94 A;  3AAK A;  1QVI Z;  2GGZ A;  2KGR A;  2LC5 A;  3VRR A;  3LL8 B;  2V53 A;  4WQ2 A;  3DF0 B;  4ORC B;  2L50 A;  1XFW O;  1IGV A;  3SG7 A;  1YRT B;  3VRN A; 
#chains in the Genus database with same CATH topology
 1YX7 A;  1ORG A;  1XFX O;  3CZ1 A;  1YVL A;  4GNK B;  2LAN A;  2WOS A;  3DVE A;  2HQW A;  2BAP A;  1XO5 A;  2F2P A;  5PAL A;  3D0Y A;  4FQO A;  4IJ7 A;  4N1G A;  3BXK A;  5ER5 A;  1Z4H A;  4Q04 A;  1SY9 A;  3K21 A;  1KSM A;  2PRU A;  5G08 A;  2BL0 B;  1CLM A;  1SBJ A;  2LMT A;  2KHN A;  1TNW A;  1OE9 B;  1C07 A;  1UHK A;  4PT1 A;  5I8N A;  3BQ3 A;  3OX6 A;  1XVJ A;  3I5G B;  1OOI X;  3L4A A;  2QAC A;  2CNP A;  1MXE A;  4IL1 A;  1C7V A;  3PLF B;  2MLF C;  1CMF A;  3BUN B;  4I5N B;  1GM0 A;  2WCM A;  1REC A;  2L2E A;  1TWO A;  3CTN A;  3JVT C;  1CFF A;  3PM2 A;  2P6B B;  1S36 A;  2KBI A;  1CB1 A;  1CFD A;  2L5X B;  2LV7 A;  1QIV A;  2F3Y A;  4PCW A;  1DJI A;  1CMG A;  1QLS A;  3O4Y A;  3BFA A;  2VRG A;  3IQQ A;  4M2Q A;  4DUQ A;  3PN7 B;  2Q4U A;  5HLO A;  1H8B A;  4HRH A;  1DJX A;  1QAT A;  2BCB A;  1RK9 A;  1QVI Y;  5AEQ A;  3DYE A;  4MZL A;  2OTG B;  2F2O A;  2PSR A;  4GFT A;  1JF2 A;  3EK4 A;  2BBM A;  2WCJ A;  2E6W A;  1GGZ A;  4YGE B;  4XYN A;  1OQP A;  2YGU A;  1V1G A;  4DCK A;  4MRX A;  2OS8 B;  1A03 A;  1FF1 A;  1F4O A;  1IWQ A;  2AAO A;  1RFJ A;  4YI8 A;  2H61 A;  1PK0 D;  2LAP A;  4PHM A;  1U5I B;  4JWQ A;  1YRU B;  1X02 A;  5FI6 A;  2K60 A;  3CAB A;  3WXA A;  1CFC A;  2KLD A;  3OBV A;  4PHK A;  3SIA A;  1XFV O;  1U5I A;  3JTD C;  3O78 A;  2LLU A;  2AUC A;  1NX2 A;  1K90 D;  2E30 A;  2M3W A;  4AOM A;  1A29 A;  1SL7 A;  2EC6 B;  3GK4 X;  3PAT A;  4USL A;  4YRU A;  3EVV A;  2MAZ A;  2P70 A;  2WCL A;  4MZJ A;  1BJF A;  1NCY A;  1FI6 A;  1R2U A;  1A75 B;  3LK0 A;  1YUS A;  3R1O A;  2CCM A;  3R1P A;  2BEC A;  1A75 A;  1MQ1 A;  2F8P A;  5CSJ A;  4HRG A;  2IS9 A;  1J1E A;  2ZKM X;  3A4U B;  3N7H A;  1LS8 A;  2LNK A;  2BKH B;  1DGU A;  2M49 B;  2WCH A;  3NGV A;  5JJG A;  4C0L A;  2LMU A;  2JTT A;  2KLE A;  1OSA A;  3B7A A;  3OB1 B;  3I5G C;  2JTZ A;  4GPL B;  1C3Y A;  1F71 A;  4C0K A;  3D78 A;  1Y6W A;  3TS5 C;  1TUJ A;  3AKB A;  4PE7 A;  2BKI B;  3R1V A;  1KK8 B;  1L7Z A;  1P28 A;  2K7O A;  2M97 A;  1NIW A;  3I5I C;  2NLN A;  2O5G A;  4INW A;  5I2L A;  2LCP A;  5J3X A;  3HCM A;  1SCM C;  2K8M B;  1XYD A;  1IRJ A;  1KFX L;  3D75 A;  2KI4 B;  2KAX A;  2WOR A;  3FWC A;  3TDU A;  3FE8 A;  2MRD A;  1YTZ C;  4GGF C;  1BG1 A;  1SL9 A;  3ZNI A;  1NWD A;  2M9G A;  4MBE A;  4PHN A;  1JC2 A;  1WRZ A;  1C7W A;  3BFB A;  2QEO A;  1BR1 B;  1AVS A;  3KF9 A;  4NQG A;  4BY4 A;  1B8R A;  1NYA A;  1KK7 Z;  3CZ2 A;  4M2O A;  2OS8 C;  1UHN A;  2JT3 A;  2MHH A;  3DVK A;  2BE4 A;  4OKH A;  1B8L A;  1JUO A;  3VRQ A;  2TN4 A;  1SMG A;  4ZCU A;  1TRF A;  3TZ1 A;  1JFK A;  3PSR A;  1SNL A;  5CPV A;  5CSN A;  1CM1 A;  2FJU B;  2JUL A;  3HX4 A;  5FYX A;  3C1V A;  3KPX A;  1GQM A;  3IF7 A;  2K7C A;  2JRF A;  1KFU L;  2EC6 C;  2MJW B;  5FI2 A;  3QRX A;  1S26 D;  2LVV A;  1Y0V H;  3D0Y B;  3DY9 A;  5HKZ A;  2JT0 A;  1DEK A;  1CLL A;  3CYZ A;  1DF0 B;  1L2O B;  1TNP A;  1SR6 C;  2L2C A;  1SKT A;  2I7A A;  2LLT A;  2WC6 A;  1F8H A;  1DF0 A;  2LHL A;  5GQQ C;  1IH0 A;  1GGW A;  2EGD A;  3CR2 A;  3LK1 A;  1WDC B;  1EG3 A;  1N0Y A;  2Q91 A;  3ZWH A;  2M7N A;  1EL4 A;  2SAS A;  2KYC A;  2G2B A;  2ZNE A;  1NP8 A;  1CDN A;  5HKY A;  1QAS A;  1YR5 A;  3WNX B;  1NCZ A;  1QS7 A;  1NSH A;  2LLS A;  3BFH A;  3BOW A;  3PAL A;  3KO0 A;  1LXF C;  1KK8 C;  1LA0 A;  2LMV A;  3EKH A;  1TOP A;  3LLE A;  2COL B;  2CXJ A;  2MBX A;  1PVA A;  1KK7 Y;  2KI6 D;  2M8U A;  3AKA A;  3OX5 A;  1KWO C;  1QLK A;  1N65 A;  1MWN A;  2KI4 C;  1AJ5 A;  2JNF A;  1QX7 A;  1F55 A;  3S0G A;  1CDP A;  1FBV A;  1DJY A;  1NX0 A;  1CKK A;  1IQ5 A;  2NCP A;  2LE9 B;  1LVC D;  3MSE B;  1TCF A;  1A2X A;  3L4L A;  5HKW A;  2KPH A;  1K9P A;  1YVH A;  2MLE C;  3A8R A;  3B88 A;  3S0B A;  1CLB A;  1NUB A;  3SG4 A;  1M31 A;  2LP3 A;  1CTR A;  2KYF A;  4OV2 A;  2L0P A;  3EK8 A;  3I5H C;  4MN0 A;  1DJZ A;  1IQ3 A;  1OOJ A;  1SPY A;  2KDH A;  1KQM C;  5JOL A;  3CDN A;  1B7T Z;  3CLN A;  1K2H A;  1BLQ A;  1OW4 A;  2HET A;  2Y1M A;  4DS7 A;  4D1E A;  5CSI A;  1V1F A;  1T14 A;  1XFR A;  3NSL A;  2LVI A;  3NHI A;  4HSZ A;  1IJ6 A;  2KFF A;  4I5L B;  4JKT A;  4U8D A;  3TDI A;  4AQJ A;  1DMO A;  1SSE B;  2KFG A;  4WQ3 A;  1OOG A;  3Q8I A;  2K7D A;  3QME A;  1ZUZ A;  4QJ4 B;  1OMD A;  4C0J A;  1DC1 A;  4R1E A;  1S1E A;  4AQI A;  1S5G Z;  3RLZ A;  3BUX B;  4QJ3 B;  3UNW A;  1KCY A;  1PSB A;  3VGO A;  5IBW A;  1BOD A;  2L4H A;  1CDM A;  2KNE A;  1NCX A;  1XK4 A;  1EJ3 A;  2KAY A;  3EVR A;  3SG2 A;  1AK8 A;  2ZRS A;  4FQT A;  3TUY B;  4QJ5 B;  1Z2C B;  2QDI A;  3E3R A;  3SS4 A;  2BL0 C;  2NXQ A;  1G4Y R;  3TDZ A;  2L98 A;  5HL1 A;  2NCO A;  1BMO A;  2LHI A;  2KFH A;  2I2R E;  2LUC A;  3NSO A;  2M1U A;  3D77 A;  4P2Y B;  1A4P A;  4NDC A;  3WHT B;  5B8I B;  1MR8 A;  4YGB B;  1CM4 A;  2AMI A;  4XJK A;  1WY9 A;  2HF5 A;  3CZ0 A;  4MZK A;  1VRK A;  2K0J A;  4A4C A;  1AP4 A;  2JQ6 A;  1ZMZ A;  2O60 A;  3DXL A;  2BNX A;  2ZN9 A;  1FI5 A;  2JC2 A;  4L9M A;  1F54 A;  1B8C A;  4MLW A;  2GTE A;  2WCF A;  5ER4 X;  3PM8 A;  2GV5 A;  2B1U A;  1K95 A;  3SJS A;  1GJY A;  1Q80 A;  4A4B A;  1B7T Y;  2DOQ A;  5AFP A;  3O6B A;  3PN7 C;  1RWY A;  3FE9 A;  2ZN8 A;  4N1F A;  3SG5 A;  2PAS A;  3RM1 A;  4I5K A;  1J7Q A;  3DZT A;  2JXC A;  4CFQ A;  2OTG C;  1YX8 A;  1KQV A;  1J1D A;  1TIZ A;  1Y1U A;  1IG5 A;  2KQY A;  1IKU A;  1YUT A;  1OMR A;  5TNC A;  1PUL A;  1S5G Y;  2BE6 A;  2H61 C;  3GK1 A;  2FCE A;  2WCB A;  3M0W A;  4TNC A;  5DKN A;  1Y1A A;  3IQO A;  4BY5 A;  4YI9 A;  5F6T A;  4PE0 A;  1LKJ A;  1J55 A;  1DGV A;  1EG4 A;  1YUU A;  1K93 D;  2PVB A;  1EH2 A;  3AAJ A;  3FWB A;  1G8I A;  1TUZ A;  1B47 A;  4ICB A;  4INX A;  5DIC A;  4ORA B;  2SCP A;  5D3O A;  1QTX A;  5HLV A;  1Y1X A;  5K89 A;  2KOT A;  3LCP C;  1TNQ A;  1OOF A;  1QV1 A;  2L4I A;  5HYD A;  1CDL A;  1JBA A;  1UHI A;  1UHH A;  4NDD A;  1AHR A;  4GBA A;  4MRY A;  3SG6 A;  1K96 A;  3OB2 B;  1NPQ A;  1QJT A;  3SIB A;  1W7J B;  1J7P A;  4CFR A;  3B87 A;  1F4Q A;  1M39 A;  4M2P A;  2QPT A;  4CLN A;  2Y1N A;  2FJY A;  3BOW B;  4PE1 A;  2KBM A;  1CNP A;  1IIO A;  2ERB A;  4GUK A;  4HRE E;  1K9U A;  1S3P A;  1R6P A;  1TNX A;  2LVJ A;  1SK6 D;  2KGB C;  3NSI A;  1ZAC A;  3JTD B;  5D69 A;  3SS3 A;  1JSA A;  5AER A;  2ZRT A;  3DF0 A;  3OGN A;  2PYQ A;  2WC8 A;  1MF8 B;  2KI6 C;  1WLM A;  3EVU A;  3CGA A;  1XFY O;  3S0D A;  2JXL A;  2PAL A;  3BUW B;  5I2O A;  4CPV A;  1DEL A;  1DJG A;  1EXR A;  1UHJ A;  1UUR A;  2JWW A;  2KQ6 A;  4GGN A;  4JQ0 D;  1QXP A;  4OZD A;  1KFX S;  1SW8 A;  1PAL A;  1AJ4 A;  2BBN A;  3VRO A;  4ORB B;  1NX3 A;  3BYA A;  1RTP 1;  1UP5 A;  2OPO A;  5KTY A;  1JF0 A;  1K9K A;  3OP0 A;  3NSK A;  4JPZ B;  2LVK A;  3VB1 A;  1PVB A;  2I18 A;  2D8N A;  3S0E A;  3BJH A;  1K8U A;  3CWG A;  1MXL C;  2M1K B;  2QEV A;  2ZFD A;  2BCA A;  5I2Q A;  3TS5 B;  1MHO A;  2L5Y A;  4F0Z B;  1BT6 A;  3WHU B;  3F45 A;  3I5I B;  5BPJ A;  2CBL A;  2P71 A;  3BUO B;  2PMY A;  3R72 A;  1ZFS A;  1M45 A;  4KYN A;  1C3Z A;  2QEH A;  1OZO A;  1SCM B;  1ODB A;  2F3Z A;  3I5F B;  1SL8 A;  1LIN A;  1ALW A;  2ISD A;  4N5X A;  1WRK A;  3SG3 A;  1AUI B;  3H4S E;  2Y4Q A;  3FS7 A;  3NXA A;  1G33 A;  4YGD B;  4ZCV A;  5KU1 A;  2FOT A;  3DVM A;  4GGF A;  4E68 A;  1KFU S;  1M63 B;  4I5J A;  2JPT A;  1QV0 A;  1YUR A;  4OR9 B;  4ETO A;  1L2O C;  1J7O A;  1B4C A;  3D10 A;  3S0A A;  4YGC B;  1S6J A;  3CR4 X;  1DJW A;  1E8A A;  5KSZ A;  1M46 A;  1QIW A;  1UWO A;  1WDC C;  5DKQ A;  1F70 A;  2WCE A;  1PRW A;  5AAN A;  1BU3 A;  3L47 A;  2K2F A;  4YGA A;  3FIA A;  4XJK B;  5DKR A;  1DT7 B;  2L51 A;  3K1E A;  1QX2 A;  3UO9 A;  2M29 A;  3FE6 A;  2R2I A;  2EHB A;  1BR4 B;  1DQE A;  1JFJ A;  3ICB A;  3DD4 A;  2BCX A;  3EG5 B;  4OVN F;  1SRA A;  3V2L A;  4DRW A;  1N2D A;  1XFU O;  1ALV A;  3O4X A;  3PJI A;  3D74 A;  4UPG A;  4MVF A;  2F33 A;  2KAV A;  1SR6 B;  1DVI A;  2JZI A;  2WCK A;  1WRL A;  2Y5I A;  1MUX A;  1OZS A;  1DJH A;  4P5O E;  3OHM B;  1IJ5 A;  2PQL A;  4JD9 A;  3D76 A;  2CTN A;  4FTG A;  1RRO A;  2FCD A;  2JU0 A;  4CID A;  2NZ0 A;  4PAL A;  1BF5 A;  1QWV A;  1H4B A;  3GOF A;  3PFV A;  1CFP A;  3O2P A;  1FPW A;  2WC5 A;  2ZND A;  2H8V A;  1ZOT B;  1D1O A;  1OOH A;  4F7F A;  4NDB A;  1B9A A;  4PDZ A;  3KHE A;  1XFZ O;  3DVJ A;  2I94 A;  2RGI A;  4MSP A;  2QEB A;  2JT8 A;  2WND A;  3S0F A;  1NX1 A;  5CSF A;  1XA5 A;  1BOC A;  1RJV A;  3CZT X;  3EK7 A;  3JVT B;  4GAO A;  4PE4 A;  1JWD A;  3EKJ A;  3VRP A;  1KWO B;  1LA3 A;  3I5F C;  2HPS A;  3KEV A;  5EL2 A;  2KSP A;  1OMV A;  1PSR A;  1SCV A;  1TCO B;  4PHJ A;  1B1G A;  1W7I B;  2K7B A;  1W9Z A;  1UUS A;  1SYM A;  2MA2 A;  2M7L A;  4DIR A;  5I94 A;  2K2A A;  1WLZ A;  2HQ8 A;  2CT9 A;  4MEW A;  4YBH B;  1XK4 C;  2A4J A;  2LP2 A;  1HT9 A;  1TTX A;  1S6C A;  2H2K A;  5FI7 A;  1J7R A;  1DTL A;  2GGM A;  2LUX A;  1QX5 B;  3TUY C;  2JNX A;  2M0R A;  2JOJ A;  1S6I A;  2LM5 A;  3I5H B;  1KSO A;  1KQM B;  3GK2 A;  1FW4 A;  4WRI A;  5AXI A;  1HQV A;  1TN4 A;  2K61 A;  2JPO A;  4OCI A;  3IVT A;  3B86 A;  3CR5 X;  5D7F A;  2G9B A;  3BUM B;  3D73 A;  3CS1 A;  1K94 A;  3RZS A;  3AAK A;  1QVI Z;  3NHT A;  2GGZ A;  2KGR A;  2LC5 A;  3SS5 A;  3B6X A;  3LL8 B;  3VRR A;  2V53 A;  4WQ2 A;  3DF0 B;  4ORC B;  2L50 A;  1XFW O;  1IGV A;  3SG7 A;  1YRT B;  3VRN A; 
#chains in the Genus database with same CATH homology
 1YX7 A;  1XFX O;  1YVL A;  4GNK B;  2LAN A;  2WOS A;  3DVE A;  2HQW A;  1XO5 A;  2F2P A;  5PAL A;  3D0Y A;  4FQO A;  4N1G A;  3BXK A;  5ER5 A;  4Q04 A;  1SY9 A;  3K21 A;  1KSM A;  2PRU A;  5G08 A;  2BL0 B;  1CLM A;  1SBJ A;  2LMT A;  2KHN A;  1TNW A;  1OE9 B;  1C07 A;  1UHK A;  5I8N A;  3BQ3 A;  3OX6 A;  1XVJ A;  3I5G B;  2QAC A;  2CNP A;  1MXE A;  4IL1 A;  1C7V A;  3PLF B;  2MLF C;  1CMF A;  3BUN B;  4I5N B;  1REC A;  2L2E A;  3CTN A;  3JVT C;  1CFF A;  2P6B B;  1S36 A;  2KBI A;  1CB1 A;  1CFD A;  2L5X B;  2LV7 A;  1QIV A;  2F3Y A;  4PCW A;  1DJI A;  1CMG A;  1QLS A;  3O4Y A;  4DUQ A;  2VRG A;  3IQQ A;  4M2Q A;  3PN7 B;  2Q4U A;  5HLO A;  1H8B A;  4HRH A;  1DJX A;  1QAT A;  2BCB A;  1RK9 A;  1QVI Y;  5AEQ A;  4MZL A;  2OTG B;  2F2O A;  2PSR A;  4GFT A;  1JF2 A;  3EK4 A;  2BBM A;  4YGE B;  2E6W A;  1GGZ A;  4XYN A;  1OQP A;  1FF1 A;  1V1G A;  4DCK A;  4MRX A;  2OS8 B;  1A03 A;  1F4O A;  1IWQ A;  2AAO A;  1RFJ A;  4YI8 A;  2H61 A;  1PK0 D;  2LAP A;  4PHM A;  1U5I B;  4JWQ A;  1YRU B;  1X02 A;  3WXA A;  1CFC A;  3SIA A;  4PHK A;  1XFV O;  1U5I A;  3JTD C;  3O78 A;  2LLU A;  2AUC A;  1NX2 A;  1K90 D;  2E30 A;  2M3W A;  4AOM A;  1A29 A;  1SL7 A;  2EC6 B;  3GK4 X;  3PAT A;  4USL A;  4YRU A;  3EVV A;  2MAZ A;  4MZJ A;  1BJF A;  1NCY A;  1FI6 A;  1R2U A;  1A75 B;  3LK0 A;  1YUS A;  2CCM A;  2BEC A;  1A75 A;  1MQ1 A;  2F8P A;  5CSJ A;  4HRG A;  2IS9 A;  1J1E A;  2ZKM X;  3A4U B;  2LNK A;  2BKH B;  1DGU A;  2M49 B;  5JJG A;  4C0L A;  2LMU A;  2JTT A;  3OB1 B;  1OSA A;  3I5G C;  2JTZ A;  4GPL B;  1F71 A;  4C0K A;  1Y6W A;  3TS5 C;  3AKB A;  4PE7 A;  2BKI B;  1KK8 B;  1L7Z A;  2M97 A;  2K7O A;  1NIW A;  3I5I C;  2NLN A;  2O5G A;  5I2L A;  2LCP A;  5J3X A;  3HCM A;  1SCM C;  2K8M B;  1XYD A;  1IRJ A;  1KFX L;  2KI4 B;  2KAX A;  2WOR A;  3FWC A;  3TDU A;  2MRD A;  1YTZ C;  4GGF C;  1BG1 A;  1SL9 A;  3ZNI A;  1NWD A;  2M9G A;  4MBE A;  4PHN A;  1JC2 A;  1WRZ A;  1C7W A;  1BR1 B;  1AVS A;  3KF9 A;  4NQG A;  4BY4 A;  1B8R A;  1NYA A;  1KK7 Z;  4M2O A;  2OS8 C;  1UHN A;  2JT3 A;  2MHH A;  3DVK A;  2BE4 A;  4OKH A;  1B8L A;  1JUO A;  3VRQ A;  2TN4 A;  1SMG A;  4ZCU A;  1TRF A;  3TZ1 A;  1JFK A;  3PSR A;  1SNL A;  5CPV A;  5CSN A;  1CM1 A;  2FJU B;  2JUL A;  3HX4 A;  5FYX A;  3C1V A;  3KPX A;  1GQM A;  3IF7 A;  2K7C A;  2JRF A;  1KFU L;  2EC6 C;  2MJW B;  3QRX A;  1S26 D;  2LVV A;  1Y0V H;  3D0Y B;  5HKZ A;  2JT0 A;  1CLL A;  1DF0 B;  1L2O B;  1TNP A;  1SR6 C;  1SKT A;  2I7A A;  2LLT A;  1F8H A;  1DF0 A;  2LHL A;  5GQQ C;  1IH0 A;  1GGW A;  2EGD A;  3CR2 A;  3LK1 A;  1WDC B;  1EG3 A;  1N0Y A;  2Q91 A;  3ZWH A;  2M7N A;  1EL4 A;  2SAS A;  2KYC A;  2G2B A;  2ZNE A;  1NP8 A;  1CDN A;  5HKY A;  1QAS A;  1YR5 A;  3WNX B;  1NCZ A;  1QS7 A;  1NSH A;  2LLS A;  3BOW A;  3PAL A;  3KO0 A;  1LXF C;  1KK8 C;  1LA0 A;  2LMV A;  3EKH A;  1TOP A;  3LLE A;  2COL B;  2CXJ A;  2MBX A;  1PVA A;  1KK7 Y;  2KI6 D;  2M8U A;  3AKA A;  3OX5 A;  1KWO C;  1QLK A;  1N65 A;  1MWN A;  2KI4 C;  1AJ5 A;  2JNF A;  1QX7 A;  1F55 A;  1CDP A;  1FBV A;  1DJY A;  1NX0 A;  1CKK A;  1IQ5 A;  2NCP A;  2LE9 B;  1LVC D;  3MSE B;  1TCF A;  1A2X A;  5HKW A;  3A8R A;  1K9P A;  1YVH A;  2MLE C;  1CLB A;  1NUB A;  3SG4 A;  1M31 A;  2LP3 A;  1CTR A;  2KYF A;  4OV2 A;  2L0P A;  3EK8 A;  3I5H C;  4MN0 A;  1DJZ A;  1IQ3 A;  1OOJ A;  1SPY A;  2KDH A;  1KQM C;  5JOL A;  1B7T Z;  3CLN A;  1K2H A;  1BLQ A;  4DS7 A;  2HET A;  2Y1M A;  4D1E A;  5CSI A;  1V1F A;  3NSL A;  2LVI A;  4HSZ A;  1IJ6 A;  2KFF A;  4I5L B;  4U8D A;  3TDI A;  4AQJ A;  1DMO A;  2KFG A;  4WQ3 A;  2K7D A;  4QJ4 B;  1ZUZ A;  1OMD A;  4C0J A;  4R1E A;  1S1E A;  4AQI A;  1S5G Z;  3RLZ A;  3BUX B;  4QJ3 B;  1KCY A;  1PSB A;  3VGO A;  5IBW A;  1BOD A;  2L4H A;  1CDM A;  2KNE A;  1NCX A;  1XK4 A;  1EJ3 A;  2KAY A;  3EVR A;  3SG2 A;  1AK8 A;  2ZRS A;  3TUY B;  4QJ5 B;  3E3R A;  2BL0 C;  2NXQ A;  1G4Y R;  3TDZ A;  2L98 A;  2NCO A;  1BMO A;  2LHI A;  2KFH A;  2I2R E;  2LUC A;  3NSO A;  2M1U A;  4P2Y B;  1A4P A;  4NDC A;  3WHT B;  5B8I B;  1MR8 A;  4YGB B;  1CM4 A;  2AMI A;  4XJK A;  1WY9 A;  2HF5 A;  4MZK A;  1VRK A;  2K0J A;  4A4C A;  1AP4 A;  2JQ6 A;  1ZMZ A;  2O60 A;  2ZN9 A;  1FI5 A;  2JC2 A;  4L9M A;  1F54 A;  1B8C A;  4MLW A;  2WCF A;  5ER4 X;  3PM8 A;  2GV5 A;  2B1U A;  1K95 A;  3SJS A;  1GJY A;  1Q80 A;  4A4B A;  1B7T Y;  2DOQ A;  5AFP A;  3O6B A;  3PN7 C;  1RWY A;  2ZN8 A;  4N1F A;  3SG5 A;  2PAS A;  3RM1 A;  4I5K A;  1J7Q A;  2JXC A;  4CFQ A;  2OTG C;  1YX8 A;  1KQV A;  1J1D A;  1TIZ A;  1Y1U A;  1IG5 A;  2KQY A;  1IKU A;  1YUT A;  1OMR A;  5TNC A;  1PUL A;  1S5G Y;  2BE6 A;  2H61 C;  3GK1 A;  2FCE A;  2WCB A;  3M0W A;  4TNC A;  5DKN A;  1Y1A A;  3IQO A;  4BY5 A;  4YI9 A;  5F6T A;  4PE0 A;  1LKJ A;  1J55 A;  1DGV A;  1EG4 A;  1YUU A;  1K93 D;  2PVB A;  1EH2 A;  3AAJ A;  3FWB A;  1G8I A;  4ICB A;  1B47 A;  4ORA B;  2SCP A;  1QTX A;  5HLV A;  1Y1X A;  5K89 A;  2KOT A;  3LCP C;  1TNQ A;  2L4I A;  1QV1 A;  5HYD A;  1CDL A;  1JBA A;  1UHI A;  1UHH A;  4NDD A;  1AHR A;  4GBA A;  4MRY A;  3SG6 A;  1K96 A;  3OB2 B;  1NPQ A;  1QJT A;  3SIB A;  1W7J B;  1J7P A;  4CFR A;  1F4Q A;  1M39 A;  4M2P A;  2QPT A;  4CLN A;  2Y1N A;  3BOW B;  4PE1 A;  2KBM A;  1CNP A;  4GUK A;  4HRE E;  1K9U A;  1S3P A;  1R6P A;  1TNX A;  2LVJ A;  1SK6 D;  2KGB C;  3NSI A;  1ZAC A;  3JTD B;  5D69 A;  1JSA A;  5AER A;  2ZRT A;  3DF0 A;  2WC8 A;  1MF8 B;  2KI6 C;  1WLM A;  3EVU A;  3CGA A;  1XFY O;  2JXL A;  2PAL A;  3BUW B;  5I2O A;  4CPV A;  1EXR A;  1DJG A;  1UHJ A;  1UUR A;  2JWW A;  2KQ6 A;  4GGN A;  4JQ0 D;  1QXP A;  1KFX S;  1SW8 A;  1PAL A;  1AJ4 A;  2BBN A;  3VRO A;  4ORB B;  1NX3 A;  3BYA A;  1RTP 1;  1UP5 A;  2OPO A;  5KTY A;  1JF0 A;  1K9K A;  3OP0 A;  3NSK A;  4JPZ B;  2LVK A;  1PVB A;  2I18 A;  2D8N A;  1K8U A;  3CWG A;  1MXL C;  2M1K B;  2ZFD A;  2BCA A;  5I2Q A;  3TS5 B;  1MHO A;  4F0Z B;  1BT6 A;  3WHU B;  3F45 A;  3I5I B;  5BPJ A;  2CBL A;  3BUO B;  2PMY A;  1ZFS A;  1M45 A;  1OZO A;  1SCM B;  1ODB A;  2F3Z A;  3I5F B;  1SL8 A;  1LIN A;  1ALW A;  2ISD A;  4N5X A;  1WRK A;  3SG3 A;  1AUI B;  3H4S E;  2Y4Q A;  3FS7 A;  3NXA A;  1G33 A;  4YGD B;  4ZCV A;  5KU1 A;  2FOT A;  3DVM A;  4GGF A;  4E68 A;  1KFU S;  1M63 B;  4I5J A;  2JPT A;  1QV0 A;  1YUR A;  4OR9 B;  4ETO A;  1L2O C;  1J7O A;  1B4C A;  3D10 A;  4YGC B;  1S6J A;  3CR4 X;  1DJW A;  1E8A A;  5KSZ A;  1M46 A;  1QIW A;  1UWO A;  1WDC C;  5DKQ A;  1F70 A;  2WCE A;  1PRW A;  5AAN A;  1BU3 A;  2K2F A;  4YGA A;  3FIA A;  4XJK B;  5DKR A;  1DT7 B;  2L51 A;  1QX2 A;  2M29 A;  2R2I A;  2EHB A;  1BR4 B;  1JFJ A;  3ICB A;  3DD4 A;  2BCX A;  4OVN F;  1SRA A;  4DRW A;  1N2D A;  1XFU O;  1ALV A;  4UPG A;  4MVF A;  2F33 A;  2KAV A;  1SR6 B;  1DVI A;  2JZI A;  1WRL A;  2Y5I A;  1MUX A;  1OZS A;  1DJH A;  4P5O E;  3OHM B;  1IJ5 A;  2CTN A;  4FTG A;  1RRO A;  2FCD A;  2JU0 A;  4CID A;  2NZ0 A;  4PAL A;  1BF5 A;  1H4B A;  3GOF A;  3PFV A;  1CFP A;  3O2P A;  1FPW A;  2ZND A;  1D1O A;  1ZOT B;  4NDB A;  1B9A A;  4PDZ A;  3KHE A;  1XFZ O;  3DVJ A;  2I94 A;  2RGI A;  4MSP A;  2JT8 A;  2WND A;  1NX1 A;  5CSF A;  1XA5 A;  1BOC A;  1RJV A;  3CZT X;  3EK7 A;  3JVT B;  4GAO A;  4PE4 A;  1JWD A;  3EKJ A;  3VRP A;  1KWO B;  1LA3 A;  3I5F C;  2HPS A;  3KEV A;  2KSP A;  1OMV A;  1PSR A;  1SCV A;  1TCO B;  4PHJ A;  1B1G A;  1W7I B;  2K7B A;  1UUS A;  1SYM A;  2MA2 A;  2M7L A;  4DIR A;  2K2A A;  1WLZ A;  2HQ8 A;  2CT9 A;  4MEW A;  4YBH B;  1XK4 C;  2A4J A;  2LP2 A;  1HT9 A;  1TTX A;  1S6C A;  2H2K A;  1J7R A;  1DTL A;  2GGM A;  2LUX A;  1QX5 B;  3TUY C;  2JNX A;  2M0R A;  2JOJ A;  1S6I A;  2LM5 A;  3I5H B;  1KSO A;  1KQM B;  3GK2 A;  1FW4 A;  4WRI A;  5AXI A;  1HQV A;  1TN4 A;  2K61 A;  4OCI A;  5D7F A;  3CR5 X;  2G9B A;  3BUM B;  3CS1 A;  1K94 A;  3AAK A;  1QVI Z;  2GGZ A;  2KGR A;  2LC5 A;  3VRR A;  3LL8 B;  2V53 A;  4WQ2 A;  3DF0 B;  4ORC B;  2L50 A;  1XFW O;  1IGV A;  3SG7 A;  1YRT B;  3VRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...