5CSJA

S100b-rsk1 crystal structure b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
GSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein S100-B
publication title Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5csjA00
3TS5C 3EK4A 4TNCA 4AQIA 3TUYC 2NLNA 4DIRA 3FIAA 3OHMB 1UP5A 1Y1XA 2LNKA 1NWDA 1BT6A 2O5GA 2LLTA 1DJIA 2WCBA 3I5FB 5KTYA 2L51A 3GK2A 2LVJA 1CFPA 1RROA 2KAYA 1H8BA 5JOLA 1S6JA 3OB1B 4XJKA 1UURA 2LCPA 2BBMA 1SMGA 3IQQA 4MZLA 2EHBA 1CDMA 1NX3A 4CFRA 1QTXA 4E68A 5HKYA 2SCPA 1TNXA 1KQVA 2R2IA 4PE4A 2FOTA 3CLNA 3TDZA 4HRGA 1UHNA 3IF7A 3PATA 5ER5A 1DVIA 4BY5A 2F3ZA 1W7JB 1CM4A 4PHNA 2F2PA 3KPXA 2CNPA 2SASA 4GGNA 1SCVA 2TN4A 1D1OA 1FF1A 1YR5A 1WLZA 2LE9B 2GV5A 1V1GA 1ZFSA 2ZNEA 1NPQA 2JT0A 4USLA 1AHRA 3RLZA 3VRQA 1M45A 2I18A 2KI6D 4MBEA 4MVFA 2I94A 4OCIA 1EG3A 1SYMA 2WOSA 1CFFA 1XFZO 4MZKA 1NCYA 1A75B 1UHJA 2M3WA 1B1GA 1NYAA 4GGFC 1SBJA 4YGDB 2AUCA 3BYAA 2OS8C 1ZACA 3SJSA 5F6TA 1BR4B 4A4BA 1K95A 2JRFA 2O60A 2KFHA 2JTTA 1BU3A 1TOPA 1NX0A 1G4YR 4WRIA 1S26D 3PN7B 4DUQA 1EH2A 2L50A 1VRKA 4MRYA 2BE6A 1IQ3A 2K2AA 2HETA 1N2DA 1IJ6A 2JULA 2KFFA 1XA5A 1S6IA 2FCEA 2L5XB 5CSNA 1B7TZ 2HQ8A 5DKNA 4C0LA 1A4PA 2BECA 4YGBB 3WNXB 4ORBB 1AJ4A 3BOWA 2M0RA 1SNLA 2HQWA 1F8HA 3SG2A 4PHKA 1R2UA 2Y5IA 1OZSA 2LMUA 1QASA 2NCPA 4FTGA 1C7WA 1SK6D 2KNEA 4GBAA 1DTLA 1KK7Z 2K0JA 2WNDA 3KEVA 1FPWA 1M31A 3O4YA 1JWDA 1J7PA 1X02A 4R1EA 2HF5A 5G08A 3A4UB 1GQMA 3BUOB 1W7IB 3EK8A 4PALA 1K90D 4XYNA 1J1DA 1B8RA 1MF8B 1CM1A 4NDDA 2ZRSA 4I5JA 2I7AA 4ETOA 2BL0B 3NSLA 2PVBA 1QS7A 2BBNA 4YRUA 1TN4A 1DJZA 1QX5B 2KYFA 3EKHA 2LMVA 4YGCB 1QIVA 1UHKA 3IQOA 1NIWA 3A8RA 4OR9B 2ZNDA 4CIDA 4UPGA 1DMOA 3JVTB 1WY9A 1TCOB 2EC6B 1DF0B 2JQ6A 1IJ5A 1TCFA 4OVNF 1J1EA 2FCDA 3AKBA 2F8PA 2ZFDA 1PK0D 1B7TY 2Q4UA 1JUOA 1BJFA 2K7DA 4HREE 2CXJA 2MA2A 4FQOA 2LVKA 1RECA 2JNXA 2IS9A 2Y1NA 2LLUA 3FS7A 1CMGA 1IKUA 1FBVA 1SY9A 4CLNA 3OB2B 1LXFC 2KAXA 2LUXA 2KI4B 1S6CA 2P6BB 1DJGA 2B1UA 4ORAB 1M39A 1QX2A 4PE1A 3BUMB 1J7QA 1XFYO 3AAJA 4NDBA 4F0ZB 3OP0A 3BQ3A 4ZCVA 1FI6A 2H61A 2JXCA 2MJWB 3FWCA 3I5HB 1NUBA 1CLLA 1HQVA 2LHLA 1K2HA 4ORCB 4WQ3A 3BUXB 2PRUA 3K21A 4NQGA 1AUIB 5HYDA 3VRPA 4PHMA 3KHEA 1KFUL 1U5IA 3LLEA 3RM1A 5I2OA 1JFKA 3VGOA 1IWQA 2JNFA 5CPVA 2G2BA 3NSKA 1F54A 2M8UA 3BXKA 3LK0A 5CSFA 1YRUB 1TNWA 1U5IB 1JSAA 3JTDB 2F2OA 1RFJA 1XVJA 2QPTA 2KGRA 1SL7A 2ISDA 4MEWA 5I8NA 1B4CA 1LA0A 1EXRA 2K7OA 5D69A 2OPOA 4I5KA 2L2EA 2BE4A 1GGWA 2V53A 5DKRA 1YRTB 1K93D 1A75A 2CT9A 2QACA 4YGEB 1A29A 1YTZC 1V1FA 3GK4X 1KFUS 1YVLA 1JF2A 2JT8A 1Y6WA 4DRWA 3I5IB 1B9AA 1K96A 2HPSA 3SG7A 4CPVA 1IG5A 2DOQA 4HSZA 1CNPA 1F71A 3TZ1A 2BL0C 3I5GB 1OMVA 1G33A 2CTNA 1L2OB 5AANA 1OE9B 4MSPA 3GOFA 1AVSA 2JWWA 4JPZB 2MBXA 3BUWB 3EKJA 3CWGA 4L9MA 1DJWA 1BODA 1KFXS 2LUCA 1L7ZA 3JVTC 4GFTA 1UHHA 3EVVA 2EC6C 3DVEA 1UHIA 2KYCA 1J7OA 4N1FA 1XYDA 4QJ5B 3SG6A 1WRLA 2KGBC 4P5OE 4NDCA 3TS5B 1YX8A 4PHJA 3SG5A 3TUYB 1N0YA 5IBWA 1ZOTB 1CTRA 3HX4A 4MZJA 2EGDA 1S3PA 1JF0A 1M63B 4M2PA 2PASA 1TNQA 2KI4C 1XO5A 1LA3A 1CDPA 1OZOA 2JTZA 1FI5A 3CZTX 2KFGA 2LV7A 3I5FC 5J3XA 2Y4QA 1TNPA 3I5HC 2L4IA 1DGVA 2H2KA 1WDCB 1YX7A 1KQMB 4N5XA 1YUSA 3DD4A 4C0JA 3TDUA 1Y1UA 2KAVA 2MLFC 1CLMA 2JU0A 2WORA 4P2YB 1B8CA 3NXAA 2H61C 3EK7A 1LINA 1HT9A 1NCZA 2LVIA 2M1UA 3D0YB 1DJHA 2F3YA 1BG1A 3KO0A 1F4QA 1DF0A 3JTDC 3O78A 1XK4C 3EVRA 1RWYA 1TRFA 2JT3A 4PCWA 3DF0B 4ZCUA 5KSZA 1MWNA 4AQJA 2K61A 4M2OA 5HKWA 4PE7A 3LCPC 4D1EA 1EG4A 2NZ0A 2M29A 1CFCA 2RGIA 4YI9A 1J55A 3FWBA 1IH0A 5B8IB 3O6BA 2GGMA 2LMTA 1KWOB 1IGVA 1LKJA 1SW8A 2ZN9A 2VRGA 3I5IC 2M49B 2JZIA 2KQYA 2OS8B 1S5GY 1ZUZA 1DJXA 2CBLA 3WXAA 2GGZA 3E3RA 1QJTA 3I5GC 3PALA 1L2OC 5CSIA 3OX6A 3SIBA 5HLOA 3MSEB 1MQ1A 2KDHA 2K7BA 1DT7B 1NX2A 2KHNA 4IL1A 4OV2A 1BLQA 3PN7C 1DJYA 2WCFA 1TIZA 1Y1AA 1RJVA 1WRZA 3DVMA 4JWQA 4WQ2A 1CKKA 1M46A 4OKHA 2KOTA 2MRDA 3NSIA 1QXPA 1AP4A 1XK4A 1A03A 1FW4A 3ICBA 1CB1A 1K94A 2JOJA 2A4JA 2FJUB 5KU1A 1PALA 3QRXA 5I2LA 2OTGB 3CR2A 2K8MB 2E6WA 1C7VA 5AEQA 3LK1A 2JC2A 4GAOA 4A4CA 1BF5A 1ALWA 1ZMZA 2M97A 1R6PA 3CGAA 2WCEA 5HLVA 1KFXL 1IRJA 4PE0A 2LP2A 1QATA 2LM5A 1PSBA 1XFWO 2MHHA 4PDZA 1S36A 5BPJA 2L0PA 1WDCC 3EVUA 1K9KA 1KQMC 2LC5A 2D8NA 1NX1A 4XJKB 2KBIA 2M7NA 1MUXA 4GPLB 4CFQA 2M9GA 3NSOA 2JPTA 1A2XA 1EJ3A 4YGAA 2MLEC 1SR6B 3AAKA 3C1VA 1PVBA 2Q91A 1B47A 1Y0VH 5PALA 4GUKA 4DCKA 3VRNA 2KI6C 2G9BA 1B8LA 2K7CA 1ODBA 1CFDA 3PM8A 3TDIA 2K2FA 1JC2A 3CTNA 1NCXA 1YUUA 2LANA 3AKAA 1XFXO 4M2QA 1KSOA 1PULA 2KSPA 1OMRA 1Q80A 1SL9A 5AERA 1J7RA 1OMDA 3SG4A 2COLB 1AK8A 1KWOC 1CDLA 1SCMB 1KK8B 1QLKA 2BCAA 5I2QA 4I5NB 1CDNA 2BKIB 5TNCA 1RTP1 1GJYA 2ZN8A 4QJ3B 1SKTA 3DVJA 2BCBA 2LAPA 4N1GA 2LVVA 2NXQA 1E8AA 2WC8A 1SL8A 4QJ4B 1S5GZ 1KSMA 1SPYA 1XFUO 1F55A 4Q04A 1PRWA 1H4BA 1AJ5A 2BKHB 1F4OA 1GGZA 2BCXA 2L4HA 2E30A 2M1KB 1QVIZ 1K9PA 3D10A 1RK9A 5HKZA 1K9UA 1C07A 5ER4X 1CMFA 1MXEA 1S1EA 4JQ0D 1G8IA 1EL4A 3WHUB 3D0YA 1JBAA 2AAOA 1BMOA 4ICBA 4GNKB 1QLSA 3GK1A 2F33A 1QX7A 2PALA 3OX5A 2JXLA 3PSRA 1OOJA 1QIWA 3DF0A 1OSAA 5D7FA 3SG3A 1SRAA 3O2PA 1IQ5A 2OTGC 3BOWB 3DVKA 5K89A 1XFVO 4I5LB 1UUSA 3KF9A 5DKQA 3H4SE 2MAZA 1MR8A 1QV0A 5FYXA 3ZWHA 4GGFA 1CLBA 4BY4A 1WRKA 1PSRA 3PFVA 4HRHA 3SIAA 3CR5X 1N65A 5AFPA 1NSHA 4AOMA 1DGUA 1LVCD 2KBMA 3F45A 2LP3A 2AMIA 1BR1B 3VRRA 1F70A 3BUNB 1KCYA 1MXLC 3VROA 1MHOA 2LHIA 3M0WA 5AXIA 1JFJA 4MLWA 4YI8A 2LLSA 1UWOA 4YBHB 4C0KA 4U8DA 3LL8B 1SR6C 2PSRA 5CSJA 1NP8A 1QVIY 1ALVA 1BOCA 4MRXA 5GQQC 2Y1MA 2NCOA 4MN0A 1TTXA 3CR4X 1YUTA 2ZKMX 2KQ6A 1WLMA 2I2RE 1PVAA 1QV1A 2ZRTA 3CS1A 3ZNIA 5JJGA 1K8UA 3PLFB 1OQPA 2M7LA 2L98A 1YURA 2CCMA 2PMYA 3WHTB 4DS7A 1SCMC 3HCMA 1KK8C 1YVHA 1KK7Y
chains in the Genus database with same CATH superfamily
3TS5C 3EK4A 4TNCA 4AQIA 3TUYC 2NLNA 2KPHA 4DIRA 3FIAA 3OHMB 1UP5A 1Y1XA 2LNKA 1NWDA 1BT6A 2O5GA 2LLTA 2FJYA 1DJIA 2WCBA 3B88A 3I5FB 5KTYA 2L51A 3GK2A 2LVJA 1CFPA 1RROA 2KAYA 1H8BA 5JOLA 1S6JA 3OB1B 4XJKA 1OW4A 1UURA 2BBMA 1SMGA 2LCPA 3IQQA 4MZLA 2EHBA 1CDMA 1NX3A 4CFRA 1QTXA 4E68A 5HKYA 2SCPA 3DYEA 1TNXA 1KQVA 2R2IA 4PE4A 2FOTA 3CLNA 3TDZA 4HRGA 1UHNA 3IF7A 3PATA 5ER5A 1DVIA 4BY5A 2F3ZA 1W7JB 1CM4A 1P28A 4PHNA 2F2PA 3KPXA 2CNPA 5I94A 2SASA 3CYZA 4GGNA 1SCVA 2TN4A 1D1OA 1FF1A 1YR5A 1WLZA 2LE9B 2GV5A 1V1GA 1ZFSA 3SS5A 2ZNEA 1NPQA 2JT0A 4USLA 3S0DA 1AHRA 3RLZA 3VRQA 1M45A 2I18A 2KI6D 4MBEA 4MVFA 2I94A 4OCIA 1EG3A 1SYMA 2WOSA 1CFFA 3L4LA 1XFZO 4MZKA 1NCYA 1A75B 1UHJA 2M3WA 1B1GA 1NYAA 5FI6A 4GGFC 1SBJA 4YGDB 2AUCA 1C3ZA 3BYAA 2OS8C 1ZACA 2WCMA 3SJSA 5F6TA 1BR4B 4A4BA 1K95A 2JRFA 2O60A 2KFHA 2JTTA 1BU3A 1TOPA 1NX0A 1G4YR 4WRIA 3L4AA 2GTEA 1S26D 3PN7B 4DUQA 1EH2A 2L50A 1VRKA 4MRYA 2BE6A 1IQ3A 2K2AA 3V2LA 2HETA 3QMEA 1N2DA 1IJ6A 2JULA 5EL2A 1DC1A 2KFFA 1OOGA 1S6IA 1XA5A 2FCEA 2L5XB 3L47A 1B7TZ 2HQ8A 3B7AA 5CSNA 5DKNA 4C0LA 1A4PA 3D74A 2BECA 4YGBB 3WNXB 4ORBB 1AJ4A 3BOWA 2M0RA 1SNLA 2HQWA 3S0BA 3SG2A 1F8HA 4PHKA 1R2UA 2Y5IA 1OZSA 2LMUA 1QASA 2NCPA 4FTGA 1C7WA 1SK6D 2KNEA 4GBAA 1DTLA 1KK7Z 2K0JA 2WNDA 3CZ1A 3KEVA 3UO9A 1FPWA 1M31A 3O4YA 1JWDA 1J7PA 1X02A 4R1EA 2HF5A 5G08A 3A4UB 1GQMA 3BUOB 1W7IB 3EK8A 4PALA 1K90D 4XYNA 1J1DA 1B8RA 1MF8B 1CM1A 3S0EA 4NDDA 2ZRSA 4I5JA 2I7AA 4ETOA 2BL0B 3NSLA 2PVBA 1QS7A 2BBNA 4YRUA 1TN4A 1DJZA 2WCHA 1QX5B 2KYFA 3EKHA 2LMVA 4YGCB 1QIVA 1UHKA 5DICA 3IQOA 1NIWA 3A8RA 2ERBA 4OR9B 2ZNDA 4CIDA 4UPGA 1DMOA 3JVTB 1WY9A 1TCOB 2EC6B 1DF0B 2JQ6A 1IJ5A 1TCFA 2QDIA 4OVNF 1J1EA 2FCDA 2WC5A 3AKBA 2F8PA 2ZFDA 1PK0D 1B7TY 2Q4UA 1JUOA 1BJFA 2K7DA 3BJHA 4HREE 2CXJA 2MA2A 4FQOA 2LVKA 1RECA 4INWA 2JNXA 2IS9A 2Y1NA 2LLUA 3FS7A 1CMGA 3R1OA 1IKUA 1FBVA 3N7HA 2K60A 1SY9A 4CLNA 1Z4HA 3OB2B 1LXFC 2KAXA 2LUXA 2KI4B 1S6CA 2P6BB 1DJGA 2B1UA 4ORAB 1M39A 1QX2A 4PE1A 3BUMB 1J7QA 1XFYO 2L5YA 3AAJA 4NDBA 4F0ZB 3OP0A 3BQ3A 3D76A 4ZCVA 1DELA 1FI6A 2H61A 2JXCA 2MJWB 3FWCA 3I5HB 1NUBA 1IIOA 1CLLA 1HQVA 2LHLA 2BNXA 1K2HA 4ORCB 4WQ3A 3BUXB 2PRUA 3K21A 4NQGA 1AUIB 5HYDA 3VRPA 3OBVA 4PHMA 3KHEA 4OZDA 1KFUL 1U5IA 3D77A 3LLEA 3RM1A 5FI7A 5I2OA 1JFKA 3VGOA 1IWQA 2JNFA 5CPVA 2G2BA 3NSKA 2H8VA 1F54A 2M8UA 3BXKA 3LK0A 2YGUA 5CSFA 1YRUB 1TNWA 1U5IB 1JSAA 3JTDB 2F2OA 1RFJA 1XVJA 3UNWA 2QPTA 3D78A 2KGRA 1SL7A 2ISDA 4MEWA 5I8NA 2WCKA 3S0AA 1LA0A 1EXRA 1B4CA 3RZSA 2K7OA 5D69A 2OPOA 4I5KA 2L2EA 4INXA 2BE4A 1GGWA 2V53A 5DKRA 1YRTB 1K93D 1A75A 2CT9A 2QACA 4YGEB 1A29A 1YTZC 1V1FA 3GK4X 1KFUS 1YVLA 1JF2A 2JT8A 1Y6WA 4DRWA 3I5IB 1B9AA 1K96A 2HPSA 3CZ2A 3SG7A 4CPVA 1IG5A 2DOQA 4HSZA 1CNPA 1F71A 3TZ1A 2BL0C 3I5GB 1OMVA 1G33A 2CTNA 1L2OB 5AANA 1OE9B 3S0FA 4MSPA 3FE8A 3GOFA 1AVSA 2JWWA 4JPZB 2MBXA 2L2CA 3BUWB 1LS8A 3CWGA 3EKJA 4L9MA 1DJWA 1BODA 1KFXS 2LUCA 1L7ZA 3JVTC 4GFTA 1UHHA 4PT1A 3EVVA 2EC6C 3DVEA 1UHIA 2KYCA 3BFAA 5FI2A 1J7OA 4N1FA 1XYDA 4KYNA 4QJ5B 2PYQA 3SG6A 1WRLA 2KGBC 4P5OE 4NDCA 3TS5B 1YX8A 4PHJA 3SG5A 3TUYB 1N0YA 5IBWA 1ZOTB 1CTRA 3CDNA 3HX4A 4MZJA 1OOIX 2EGDA 1S3PA 3FE6A 1JF0A 1M63B 4M2PA 2PASA 1TNQA 2KI4C 1XO5A 1LA3A 1CDPA 1OZOA 3BFBA 2JTZA 1FI5A 3CZTX 3EG5B 2QEVA 2KFGA 2LV7A 3I5FC 1DQEA 5J3XA 2Y4QA 1TNPA 3I5HC 2L4IA 1DGVA 2H2KA 1WDCB 1YX7A 1KQMB 4N5XA 1YUSA 3DD4A 4C0JA 3TDUA 1Y1UA 2KAVA 2MLFC 1CLMA 2JU0A 2WORA 4P2YB 1B8CA 3B6XA 3NXAA 3NHIA 2H61C 3EK7A 3FE9A 1LINA 1HT9A 1NCZA 4IJ7A 2LVIA 2QEBA 2M1UA 3D0YB 1DJHA 2F3YA 3SS4A 1BG1A 3KO0A 1F4QA 1DF0A 3JTDC 3O78A 1XK4C 3EVRA 1RWYA 1TRFA 2JT3A 4PCWA 3DF0B 3S0GA 4ZCUA 5KSZA 1OOFA 1MWNA 3BFHA 2K61A 4M2OA 5HKWA 4AQJA 4PE7A 3LCPC 4D1EA 1EG4A 2NZ0A 2M29A 1CFCA 2RGIA 3DXLA 4YI9A 1J55A 3FWBA 1IH0A 5B8IB 2P70A 3D73A 3O6BA 2GGMA 2LMTA 1KWOB 1IGVA 1LKJA 2QEOA 1SW8A 2ZN9A 2VRGA 3I5IC 2M49B 1W9ZA 2JZIA 2KQYA 2OS8B 1S5GY 1ZUZA 1DJXA 2CBLA 3WXAA 2GGZA 2P71A 3E3RA 2JPOA 1QJTA 3I5GC 3PALA 1L2OC 5CSIA 3R1VA 3OX6A 3SS3A 3SIBA 5HLOA 2WCLA 1MQ1A 2KDHA 3MSEB 2K7BA 1DT7B 1NX2A 2KHNA 4IL1A 4OV2A 1BLQA 3PN7C 1DJYA 2WCFA 1TIZA 1Y1AA 1RJVA 1WRZA 3DVMA 4JWQA 4WQ2A 1CKKA 1M46A 4OKHA 2KOTA 2MRDA 3NSIA 1QXPA 1AP4A 1XK4A 1A03A 1FW4A 3ICBA 1CB1A 1K94A 2JOJA 3Q8IA 2A4JA 2FJUB 5KU1A 3NHTA 1PALA 3QRXA 5I2LA 2OTGB 2WC6A 3CR2A 2K8MB 2E6WA 1C7VA 2WCJA 4F7FA 5AEQA 3LK1A 2JC2A 4GAOA 4A4CA 1BF5A 2KLEA 1ALWA 4JKTA 1TWOA 1ZMZA 2M97A 1R6PA 3CGAA 2WCEA 5HLVA 1KFXL 1IRJA 4PE0A 2PQLA 2LP2A 3PM2A 4JD9A 1QATA 1GM0A 2LM5A 1PSBA 1XFWO 2MHHA 4PDZA 1S36A 5BPJA 2L0PA 1WDCC 3EVUA 1K9KA 1KQMC 2LC5A 2D8NA 1NX1A 4XJKB 2KBIA 3NGVA 2M7NA 1MUXA 4GPLB 4CFQA 2M9GA 3NSOA 1SSEB 2JPTA 1A2XA 1EJ3A 4YGAA 5D3OA 2MLEC 1SR6B 3AAKA 1XFRA 1PVBA 2Q91A 3C1VA 1B47A 1Y0VH 5PALA 4GUKA 4DCKA 3VRNA 2KI6C 2G9BA 1B8LA 3O4XA 2K7CA 1ODBA 1CFDA 4FQTA 1ORGA 3PM8A 2K2FA 3TDIA 1JC2A 3CTNA 1NCXA 1YUUA 2LANA 3AKAA 3DY9A 1XFXO 4M2QA 1KSOA 1PULA 2KSPA 1OMRA 1Q80A 1SL9A 5AERA 1J7RA 1OMDA 3SG4A 2COLB 3D75A 1KWOC 1CDLA 1SCMB 1KK8B 3R1PA 1AK8A 1QLKA 2BCAA 5I2QA 4I5NB 1CDNA 2BKIB 5TNCA 1RTP1 1GJYA 2ZN8A 4QJ3B 1SKTA 3DVJA 1QWVA 1T14A 2BCBA 2LAPA 4N1GA 2LVVA 2NXQA 1E8AA 2WC8A 1SL8A 3K1EA 4QJ4B 1S5GZ 1KSMA 1SPYA 1XFUO 1F55A 3R72A 4Q04A 1PRWA 1H4BA 1AJ5A 2BKHB 1F4OA 1GGZA 5HL1A 2BCXA 2L4HA 2E30A 2M1KB 3CZ0A 1DEKA 1QVIZ 3PJIA 1K9PA 3D10A 1RK9A 5HKZA 1K9UA 1C07A 5ER4X 1CMFA 1MXEA 1S1EA 4JQ0D 1G8IA 1EL4A 3WHUB 3D0YA 1JBAA 2AAOA 1BMOA 4ICBA 4GNKB 1Z2CB 3B87A 1QLSA 3GK1A 2F33A 1QX7A 1C3YA 2PALA 3OX5A 2JXLA 3PSRA 1OOJA 1QIWA 3DF0A 1OSAA 5D7FA 3B86A 3SG3A 1SRAA 3O2PA 1IQ5A 3VB1A 1TUJA 2BAPA 2OTGC 3BOWB 3DVKA 5K89A 1XFVO 4I5LB 1UUSA 3KF9A 5DKQA 3H4SE 2MAZA 1MR8A 1QV0A 3IVTA 5FYXA 3ZWHA 4GGFA 1CLBA 4BY4A 1WRKA 1PSRA 3PFVA 4HRHA 3SIAA 3CR5X 1N65A 5AFPA 1NSHA 4AOMA 1DGUA 1LVCD 2KBMA 3F45A 2LP3A 2AMIA 1BR1B 3VRRA 1F70A 3BUNB 1KCYA 3OGNA 1MXLC 3VROA 1MHOA 2LHIA 3M0WA 5AXIA 1JFJA 4MLWA 4YI8A 2LLSA 1UWOA 4YBHB 4C0KA 4U8DA 3LL8B 1SR6C 2PSRA 5CSJA 1NP8A 1QVIY 2KLDA 3CABA 1ALVA 1BOCA 4MRXA 5GQQC 2Y1MA 2NCOA 4MN0A 1TTXA 3CR4X 1YUTA 2ZKMX 2KQ6A 2QEHA 1WLMA 2I2RE 1PVAA 1QV1A 2ZRTA 3CS1A 3ZNIA 5JJGA 1K8UA 3PLFB 1OQPA 2M7LA 2L98A 1YURA 2CCMA 2PMYA 3WHTB 3DZTA 4DS7A 1TUZA 1OOHA 1SCMC 3HCMA 1KK8C 1YVHA 1KK7Y
chains in the Genus database with same CATH topology
3TS5C 3EK4A 4TNCA 4AQIA 3TUYC 2NLNA 4DIRA 3FIAA 3OHMB 1UP5A 1Y1XA 2LNKA 1NWDA 1BT6A 2O5GA 2LLTA 1DJIA 2WCBA 3I5FB 5KTYA 2L51A 3GK2A 2LVJA 1CFPA 1RROA 2KAYA 1H8BA 5JOLA 1S6JA 3OB1B 4XJKA 1UURA 2LCPA 2BBMA 1SMGA 3IQQA 4MZLA 2EHBA 1CDMA 1NX3A 4CFRA 1QTXA 4E68A 5HKYA 2SCPA 1TNXA 1KQVA 2R2IA 4PE4A 2FOTA 3CLNA 3TDZA 4HRGA 1UHNA 3IF7A 3PATA 5ER5A 1DVIA 4BY5A 2F3ZA 1W7JB 1CM4A 4PHNA 2F2PA 3KPXA 2CNPA 2SASA 4GGNA 1SCVA 2TN4A 1D1OA 1FF1A 1YR5A 1WLZA 2LE9B 2GV5A 1V1GA 1ZFSA 2ZNEA 1NPQA 2JT0A 4USLA 1AHRA 3RLZA 3VRQA 1M45A 2I18A 2KI6D 4MBEA 4MVFA 2I94A 4OCIA 1EG3A 1SYMA 2WOSA 1CFFA 1XFZO 4MZKA 1NCYA 1A75B 1UHJA 2M3WA 1B1GA 1NYAA 4GGFC 1SBJA 4YGDB 2AUCA 3BYAA 2OS8C 1ZACA 3SJSA 5F6TA 1BR4B 4A4BA 1K95A 2JRFA 2O60A 2KFHA 2JTTA 1BU3A 1TOPA 1NX0A 1G4YR 4WRIA 1S26D 3PN7B 4DUQA 1EH2A 2L50A 1VRKA 4MRYA 2BE6A 1IQ3A 2K2AA 2HETA 1N2DA 1IJ6A 2JULA 2KFFA 1XA5A 1S6IA 2FCEA 2L5XB 5CSNA 1B7TZ 2HQ8A 5DKNA 4C0LA 1A4PA 2BECA 4YGBB 3WNXB 4ORBB 1AJ4A 3BOWA 2M0RA 1SNLA 2HQWA 1F8HA 3SG2A 4PHKA 1R2UA 2Y5IA 1OZSA 2LMUA 1QASA 2NCPA 4FTGA 1C7WA 1SK6D 2KNEA 4GBAA 1DTLA 1KK7Z 2K0JA 2WNDA 3KEVA 1FPWA 1M31A 3O4YA 1JWDA 1J7PA 1X02A 4R1EA 2HF5A 5G08A 3A4UB 1GQMA 3BUOB 1W7IB 3EK8A 4PALA 1K90D 4XYNA 1J1DA 1B8RA 1MF8B 1CM1A 4NDDA 2ZRSA 4I5JA 2I7AA 4ETOA 2BL0B 3NSLA 2PVBA 1QS7A 2BBNA 4YRUA 1TN4A 1DJZA 1QX5B 2KYFA 3EKHA 2LMVA 4YGCB 1QIVA 1UHKA 3IQOA 1NIWA 3A8RA 4OR9B 2ZNDA 4CIDA 4UPGA 1DMOA 3JVTB 1WY9A 1TCOB 2EC6B 1DF0B 2JQ6A 1IJ5A 1TCFA 4OVNF 1J1EA 2FCDA 3AKBA 2F8PA 2ZFDA 1PK0D 1B7TY 2Q4UA 1JUOA 1BJFA 2K7DA 4HREE 2CXJA 2MA2A 4FQOA 2LVKA 1RECA 2JNXA 2IS9A 2Y1NA 2LLUA 3FS7A 1CMGA 1IKUA 1FBVA 1SY9A 4CLNA 3OB2B 1LXFC 2KAXA 2LUXA 2KI4B 1S6CA 2P6BB 1DJGA 2B1UA 4ORAB 1M39A 1QX2A 4PE1A 3BUMB 1J7QA 1XFYO 3AAJA 4NDBA 4F0ZB 3OP0A 3BQ3A 4ZCVA 1FI6A 2H61A 2JXCA 2MJWB 3FWCA 3I5HB 1NUBA 1CLLA 1HQVA 2LHLA 1K2HA 4ORCB 4WQ3A 3BUXB 2PRUA 3K21A 4NQGA 1AUIB 5HYDA 3VRPA 4PHMA 3KHEA 1KFUL 1U5IA 3LLEA 3RM1A 5I2OA 1JFKA 3VGOA 1IWQA 2JNFA 5CPVA 2G2BA 3NSKA 1F54A 2M8UA 3BXKA 3LK0A 5CSFA 1YRUB 1TNWA 1U5IB 1JSAA 3JTDB 2F2OA 1RFJA 1XVJA 2QPTA 2KGRA 1SL7A 2ISDA 4MEWA 5I8NA 1B4CA 1LA0A 1EXRA 2K7OA 5D69A 2OPOA 4I5KA 2L2EA 2BE4A 1GGWA 2V53A 5DKRA 1YRTB 1K93D 1A75A 2CT9A 2QACA 4YGEB 1A29A 1YTZC 1V1FA 3GK4X 1KFUS 1YVLA 1JF2A 2JT8A 1Y6WA 4DRWA 3I5IB 1B9AA 1K96A 2HPSA 3SG7A 4CPVA 1IG5A 2DOQA 4HSZA 1CNPA 1F71A 3TZ1A 2BL0C 3I5GB 1OMVA 1G33A 2CTNA 1L2OB 5AANA 1OE9B 4MSPA 3GOFA 1AVSA 2JWWA 4JPZB 2MBXA 3BUWB 3EKJA 3CWGA 4L9MA 1DJWA 1BODA 1KFXS 2LUCA 1L7ZA 3JVTC 4GFTA 1UHHA 3EVVA 2EC6C 3DVEA 1UHIA 2KYCA 1J7OA 4N1FA 1XYDA 4QJ5B 3SG6A 1WRLA 2KGBC 4P5OE 4NDCA 3TS5B 1YX8A 4PHJA 3SG5A 3TUYB 1N0YA 5IBWA 1ZOTB 1CTRA 3HX4A 4MZJA 2EGDA 1S3PA 1JF0A 1M63B 4M2PA 2PASA 1TNQA 2KI4C 1XO5A 1LA3A 1CDPA 1OZOA 2JTZA 1FI5A 3CZTX 2KFGA 2LV7A 3I5FC 5J3XA 2Y4QA 1TNPA 3I5HC 2L4IA 1DGVA 2H2KA 1WDCB 1YX7A 1KQMB 4N5XA 1YUSA 3DD4A 4C0JA 3TDUA 1Y1UA 2KAVA 2MLFC 1CLMA 2JU0A 2WORA 4P2YB 1B8CA 3NXAA 2H61C 3EK7A 1LINA 1HT9A 1NCZA 2LVIA 2M1UA 3D0YB 1DJHA 2F3YA 1BG1A 3KO0A 1F4QA 1DF0A 3JTDC 3O78A 1XK4C 3EVRA 1RWYA 1TRFA 2JT3A 4PCWA 3DF0B 4ZCUA 5KSZA 1MWNA 4AQJA 2K61A 4M2OA 5HKWA 4PE7A 3LCPC 4D1EA 1EG4A 2NZ0A 2M29A 1CFCA 2RGIA 4YI9A 1J55A 3FWBA 1IH0A 5B8IB 3O6BA 2GGMA 2LMTA 1KWOB 1IGVA 1LKJA 1SW8A 2ZN9A 2VRGA 3I5IC 2M49B 2JZIA 2KQYA 2OS8B 1S5GY 1ZUZA 1DJXA 2CBLA 3WXAA 2GGZA 3E3RA 1QJTA 3I5GC 3PALA 1L2OC 5CSIA 3OX6A 3SIBA 5HLOA 3MSEB 1MQ1A 2KDHA 2K7BA 1DT7B 1NX2A 2KHNA 4IL1A 4OV2A 1BLQA 3PN7C 1DJYA 2WCFA 1TIZA 1Y1AA 1RJVA 1WRZA 3DVMA 4JWQA 4WQ2A 1CKKA 1M46A 4OKHA 2KOTA 2MRDA 3NSIA 1QXPA 1AP4A 1XK4A 1A03A 1FW4A 3ICBA 1CB1A 1K94A 2JOJA 2A4JA 2FJUB 5KU1A 1PALA 3QRXA 5I2LA 2OTGB 3CR2A 2K8MB 2E6WA 1C7VA 5AEQA 3LK1A 2JC2A 4GAOA 4A4CA 1BF5A 1ALWA 1ZMZA 2M97A 1R6PA 3CGAA 2WCEA 5HLVA 1KFXL 1IRJA 4PE0A 2LP2A 1QATA 2LM5A 1PSBA 1XFWO 2MHHA 4PDZA 1S36A 5BPJA 2L0PA 1WDCC 3EVUA 1K9KA 1KQMC 2LC5A 2D8NA 1NX1A 4XJKB 2KBIA 2M7NA 1MUXA 4GPLB 4CFQA 2M9GA 3NSOA 2JPTA 1A2XA 1EJ3A 4YGAA 2MLEC 1SR6B 3AAKA 3C1VA 1PVBA 2Q91A 1B47A 1Y0VH 5PALA 4GUKA 4DCKA 3VRNA 2KI6C 2G9BA 1B8LA 2K7CA 1ODBA 1CFDA 3PM8A 3TDIA 2K2FA 1JC2A 3CTNA 1NCXA 1YUUA 2LANA 3AKAA 1XFXO 4M2QA 1KSOA 1PULA 2KSPA 1OMRA 1Q80A 1SL9A 5AERA 1J7RA 1OMDA 3SG4A 2COLB 1AK8A 1KWOC 1CDLA 1SCMB 1KK8B 1QLKA 2BCAA 5I2QA 4I5NB 1CDNA 2BKIB 5TNCA 1RTP1 1GJYA 2ZN8A 4QJ3B 1SKTA 3DVJA 2BCBA 2LAPA 4N1GA 2LVVA 2NXQA 1E8AA 2WC8A 1SL8A 4QJ4B 1S5GZ 1KSMA 1SPYA 1XFUO 1F55A 4Q04A 1PRWA 1H4BA 1AJ5A 2BKHB 1F4OA 1GGZA 2BCXA 2L4HA 2E30A 2M1KB 1QVIZ 1K9PA 3D10A 1RK9A 5HKZA 1K9UA 1C07A 5ER4X 1CMFA 1MXEA 1S1EA 4JQ0D 1G8IA 1EL4A 3WHUB 3D0YA 1JBAA 2AAOA 1BMOA 4ICBA 4GNKB 1QLSA 3GK1A 2F33A 1QX7A 2PALA 3OX5A 2JXLA 3PSRA 1OOJA 1QIWA 3DF0A 1OSAA 5D7FA 3SG3A 1SRAA 3O2PA 1IQ5A 2OTGC 3BOWB 3DVKA 5K89A 1XFVO 4I5LB 1UUSA 3KF9A 5DKQA 3H4SE 2MAZA 1MR8A 1QV0A 5FYXA 3ZWHA 4GGFA 1CLBA 4BY4A 1WRKA 1PSRA 3PFVA 4HRHA 3SIAA 3CR5X 1N65A 5AFPA 1NSHA 4AOMA 1DGUA 1LVCD 2KBMA 3F45A 2LP3A 2AMIA 1BR1B 3VRRA 1F70A 3BUNB 1KCYA 1MXLC 3VROA 1MHOA 2LHIA 3M0WA 5AXIA 1JFJA 4MLWA 4YI8A 2LLSA 1UWOA 4YBHB 4C0KA 4U8DA 3LL8B 1SR6C 2PSRA 5CSJA 1NP8A 1QVIY 1ALVA 1BOCA 4MRXA 5GQQC 2Y1MA 2NCOA 4MN0A 1TTXA 3CR4X 1YUTA 2ZKMX 2KQ6A 1WLMA 2I2RE 1PVAA 1QV1A 2ZRTA 3CS1A 3ZNIA 5JJGA 1K8UA 3PLFB 1OQPA 2M7LA 2L98A 1YURA 2CCMA 2PMYA 3WHTB 4DS7A 1SCMC 3HCMA 1KK8C 1YVHA 1KK7Y
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TS5 C;  3EK4 A;  4TNC A;  4AQI A;  3TUY C;  2NLN A;  4DIR A;  3FIA A;  3OHM B;  1UP5 A;  1Y1X A;  2LNK A;  1NWD A;  1BT6 A;  2O5G A;  2LLT A;  1DJI A;  2WCB A;  3I5F B;  5KTY A;  2L51 A;  3GK2 A;  2LVJ A;  1CFP A;  1RRO A;  2KAY A;  1H8B A;  5JOL A;  1S6J A;  3OB1 B;  4XJK A;  1UUR A;  2LCP A;  2BBM A;  1SMG A;  3IQQ A;  4MZL A;  2EHB A;  1CDM A;  1NX3 A;  4CFR A;  1QTX A;  4E68 A;  5HKY A;  2SCP A;  1TNX A;  1KQV A;  2R2I A;  4PE4 A;  2FOT A;  3CLN A;  3TDZ A;  4HRG A;  1UHN A;  3IF7 A;  3PAT A;  5ER5 A;  1DVI A;  4BY5 A;  2F3Z A;  1W7J B;  1CM4 A;  4PHN A;  2F2P A;  3KPX A;  2CNP A;  2SAS A;  4GGN A;  1SCV A;  2TN4 A;  1D1O A;  1FF1 A;  1YR5 A;  1WLZ A;  2LE9 B;  2GV5 A;  1V1G A;  1ZFS A;  2ZNE A;  1NPQ A;  2JT0 A;  4USL A;  1AHR A;  3RLZ A;  3VRQ A;  1M45 A;  2I18 A;  2KI6 D;  4MBE A;  4MVF A;  2I94 A;  4OCI A;  1EG3 A;  1SYM A;  2WOS A;  1CFF A;  1XFZ O;  4MZK A;  1NCY A;  1A75 B;  1UHJ A;  2M3W A;  1B1G A;  1NYA A;  4GGF C;  1SBJ A;  4YGD B;  2AUC A;  3BYA A;  2OS8 C;  1ZAC A;  3SJS A;  5F6T A;  1BR4 B;  4A4B A;  1K95 A;  2JRF A;  2O60 A;  2KFH A;  2JTT A;  1BU3 A;  1TOP A;  1NX0 A;  1G4Y R;  4WRI A;  1S26 D;  3PN7 B;  4DUQ A;  1EH2 A;  2L50 A;  1VRK A;  4MRY A;  2BE6 A;  1IQ3 A;  2K2A A;  2HET A;  1N2D A;  1IJ6 A;  2JUL A;  2KFF A;  1XA5 A;  1S6I A;  2FCE A;  2L5X B;  5CSN A;  1B7T Z;  2HQ8 A;  5DKN A;  4C0L A;  1A4P A;  2BEC A;  4YGB B;  3WNX B;  4ORB B;  1AJ4 A;  3BOW A;  2M0R A;  1SNL A;  2HQW A;  1F8H A;  3SG2 A;  4PHK A;  1R2U A;  2Y5I A;  1OZS A;  2LMU A;  1QAS A;  2NCP A;  4FTG A;  1C7W A;  1SK6 D;  2KNE A;  4GBA A;  1DTL A;  1KK7 Z;  2K0J A;  2WND A;  3KEV A;  1FPW A;  1M31 A;  3O4Y A;  1JWD A;  1J7P A;  1X02 A;  4R1E A;  2HF5 A;  5G08 A;  3A4U B;  1GQM A;  3BUO B;  1W7I B;  3EK8 A;  4PAL A;  1K90 D;  4XYN A;  1J1D A;  1B8R A;  1MF8 B;  1CM1 A;  4NDD A;  2ZRS A;  4I5J A;  2I7A A;  4ETO A;  2BL0 B;  3NSL A;  2PVB A;  1QS7 A;  2BBN A;  4YRU A;  1TN4 A;  1DJZ A;  1QX5 B;  2KYF A;  3EKH A;  2LMV A;  4YGC B;  1QIV A;  1UHK A;  3IQO A;  1NIW A;  3A8R A;  4OR9 B;  2ZND A;  4CID A;  4UPG A;  1DMO A;  3JVT B;  1WY9 A;  1TCO B;  2EC6 B;  1DF0 B;  2JQ6 A;  1IJ5 A;  1TCF A;  4OVN F;  1J1E A;  2FCD A;  3AKB A;  2F8P A;  2ZFD A;  1PK0 D;  1B7T Y;  2Q4U A;  1JUO A;  1BJF A;  2K7D A;  4HRE E;  2CXJ A;  2MA2 A;  4FQO A;  2LVK A;  1REC A;  2JNX A;  2IS9 A;  2Y1N A;  2LLU A;  3FS7 A;  1CMG A;  1IKU A;  1FBV A;  1SY9 A;  4CLN A;  3OB2 B;  1LXF C;  2KAX A;  2LUX A;  2KI4 B;  1S6C A;  2P6B B;  1DJG A;  2B1U A;  4ORA B;  1M39 A;  1QX2 A;  4PE1 A;  3BUM B;  1J7Q A;  1XFY O;  3AAJ A;  4NDB A;  4F0Z B;  3OP0 A;  3BQ3 A;  4ZCV A;  1FI6 A;  2H61 A;  2JXC A;  2MJW B;  3FWC A;  3I5H B;  1NUB A;  1CLL A;  1HQV A;  2LHL A;  1K2H A;  4ORC B;  4WQ3 A;  3BUX B;  2PRU A;  3K21 A;  4NQG A;  1AUI B;  5HYD A;  3VRP A;  4PHM A;  3KHE A;  1KFU L;  1U5I A;  3LLE A;  3RM1 A;  5I2O A;  1JFK A;  3VGO A;  1IWQ A;  2JNF A;  5CPV A;  2G2B A;  3NSK A;  1F54 A;  2M8U A;  3BXK A;  3LK0 A;  5CSF A;  1YRU B;  1TNW A;  1U5I B;  1JSA A;  3JTD B;  2F2O A;  1RFJ A;  1XVJ A;  2QPT A;  2KGR A;  1SL7 A;  2ISD A;  4MEW A;  5I8N A;  1B4C A;  1LA0 A;  1EXR A;  2K7O A;  5D69 A;  2OPO A;  4I5K A;  2L2E A;  2BE4 A;  1GGW A;  2V53 A;  5DKR A;  1YRT B;  1K93 D;  1A75 A;  2CT9 A;  2QAC A;  4YGE B;  1A29 A;  1YTZ C;  1V1F A;  3GK4 X;  1KFU S;  1YVL A;  1JF2 A;  2JT8 A;  1Y6W A;  4DRW A;  3I5I B;  1B9A A;  1K96 A;  2HPS A;  3SG7 A;  4CPV A;  1IG5 A;  2DOQ A;  4HSZ A;  1CNP A;  1F71 A;  3TZ1 A;  2BL0 C;  3I5G B;  1OMV A;  1G33 A;  2CTN A;  1L2O B;  5AAN A;  1OE9 B;  4MSP A;  3GOF A;  1AVS A;  2JWW A;  4JPZ B;  2MBX A;  3BUW B;  3EKJ A;  3CWG A;  4L9M A;  1DJW A;  1BOD A;  1KFX S;  2LUC A;  1L7Z A;  3JVT C;  4GFT A;  1UHH A;  3EVV A;  2EC6 C;  3DVE A;  1UHI A;  2KYC A;  1J7O A;  4N1F A;  1XYD A;  4QJ5 B;  3SG6 A;  1WRL A;  2KGB C;  4P5O E;  4NDC A;  3TS5 B;  1YX8 A;  4PHJ A;  3SG5 A;  3TUY B;  1N0Y A;  5IBW A;  1ZOT B;  1CTR A;  3HX4 A;  4MZJ A;  2EGD A;  1S3P A;  1JF0 A;  1M63 B;  4M2P A;  2PAS A;  1TNQ A;  2KI4 C;  1XO5 A;  1LA3 A;  1CDP A;  1OZO A;  2JTZ A;  1FI5 A;  3CZT X;  2KFG A;  2LV7 A;  3I5F C;  5J3X A;  2Y4Q A;  1TNP A;  3I5H C;  2L4I A;  1DGV A;  2H2K A;  1WDC B;  1YX7 A;  1KQM B;  4N5X A;  1YUS A;  3DD4 A;  4C0J A;  3TDU A;  1Y1U A;  2KAV A;  2MLF C;  1CLM A;  2JU0 A;  2WOR A;  4P2Y B;  1B8C A;  3NXA A;  2H61 C;  3EK7 A;  1LIN A;  1HT9 A;  1NCZ A;  2LVI A;  2M1U A;  3D0Y B;  1DJH A;  2F3Y A;  1BG1 A;  3KO0 A;  1F4Q A;  1DF0 A;  3JTD C;  3O78 A;  1XK4 C;  3EVR A;  1RWY A;  1TRF A;  2JT3 A;  4PCW A;  3DF0 B;  4ZCU A;  5KSZ A;  1MWN A;  4AQJ A;  2K61 A;  4M2O A;  5HKW A;  4PE7 A;  3LCP C;  4D1E A;  1EG4 A;  2NZ0 A;  2M29 A;  1CFC A;  2RGI A;  4YI9 A;  1J55 A;  3FWB A;  1IH0 A;  5B8I B;  3O6B A;  2GGM A;  2LMT A;  1KWO B;  1IGV A;  1LKJ A;  1SW8 A;  2ZN9 A;  2VRG A;  3I5I C;  2M49 B;  2JZI A;  2KQY A;  2OS8 B;  1S5G Y;  1ZUZ A;  1DJX A;  2CBL A;  3WXA A;  2GGZ A;  3E3R A;  1QJT A;  3I5G C;  3PAL A;  1L2O C;  5CSI A;  3OX6 A;  3SIB A;  5HLO A;  3MSE B;  1MQ1 A;  2KDH A;  2K7B A;  1DT7 B;  1NX2 A;  2KHN A;  4IL1 A;  4OV2 A;  1BLQ A;  3PN7 C;  1DJY A;  2WCF A;  1TIZ A;  1Y1A A;  1RJV A;  1WRZ A;  3DVM A;  4JWQ A;  4WQ2 A;  1CKK A;  1M46 A;  4OKH A;  2KOT A;  2MRD A;  3NSI A;  1QXP A;  1AP4 A;  1XK4 A;  1A03 A;  1FW4 A;  3ICB A;  1CB1 A;  1K94 A;  2JOJ A;  2A4J A;  2FJU B;  5KU1 A;  1PAL A;  3QRX A;  5I2L A;  2OTG B;  3CR2 A;  2K8M B;  2E6W A;  1C7V A;  5AEQ A;  3LK1 A;  2JC2 A;  4GAO A;  4A4C A;  1BF5 A;  1ALW A;  1ZMZ A;  2M97 A;  1R6P A;  3CGA A;  2WCE A;  5HLV A;  1KFX L;  1IRJ A;  4PE0 A;  2LP2 A;  1QAT A;  2LM5 A;  1PSB A;  1XFW O;  2MHH A;  4PDZ A;  1S36 A;  5BPJ A;  2L0P A;  1WDC C;  3EVU A;  1K9K A;  1KQM C;  2LC5 A;  2D8N A;  1NX1 A;  4XJK B;  2KBI A;  2M7N A;  1MUX A;  4GPL B;  4CFQ A;  2M9G A;  3NSO A;  2JPT A;  1A2X A;  1EJ3 A;  4YGA A;  2MLE C;  1SR6 B;  3AAK A;  3C1V A;  1PVB A;  2Q91 A;  1B47 A;  1Y0V H;  5PAL A;  4GUK A;  4DCK A;  3VRN A;  2KI6 C;  2G9B A;  1B8L A;  2K7C A;  1ODB A;  1CFD A;  3PM8 A;  3TDI A;  2K2F A;  1JC2 A;  3CTN A;  1NCX A;  1YUU A;  2LAN A;  3AKA A;  1XFX O;  4M2Q A;  1KSO A;  1PUL A;  2KSP A;  1OMR A;  1Q80 A;  1SL9 A;  5AER A;  1J7R A;  1OMD A;  3SG4 A;  2COL B;  1AK8 A;  1KWO C;  1CDL A;  1SCM B;  1KK8 B;  1QLK A;  2BCA A;  5I2Q A;  4I5N B;  1CDN A;  2BKI B;  5TNC A;  1RTP 1;  1GJY A;  2ZN8 A;  4QJ3 B;  1SKT A;  3DVJ A;  2BCB A;  2LAP A;  4N1G A;  2LVV A;  2NXQ A;  1E8A A;  2WC8 A;  1SL8 A;  4QJ4 B;  1S5G Z;  1KSM A;  1SPY A;  1XFU O;  1F55 A;  4Q04 A;  1PRW A;  1H4B A;  1AJ5 A;  2BKH B;  1F4O A;  1GGZ A;  2BCX A;  2L4H A;  2E30 A;  2M1K B;  1QVI Z;  1K9P A;  3D10 A;  1RK9 A;  5HKZ A;  1K9U A;  1C07 A;  5ER4 X;  1CMF A;  1MXE A;  1S1E A;  4JQ0 D;  1G8I A;  1EL4 A;  3WHU B;  3D0Y A;  1JBA A;  2AAO A;  1BMO A;  4ICB A;  4GNK B;  1QLS A;  3GK1 A;  2F33 A;  1QX7 A;  2PAL A;  3OX5 A;  2JXL A;  3PSR A;  1OOJ A;  1QIW A;  3DF0 A;  1OSA A;  5D7F A;  3SG3 A;  1SRA A;  3O2P A;  1IQ5 A;  2OTG C;  3BOW B;  3DVK A;  5K89 A;  1XFV O;  4I5L B;  1UUS A;  3KF9 A;  5DKQ A;  3H4S E;  2MAZ A;  1MR8 A;  1QV0 A;  5FYX A;  3ZWH A;  4GGF A;  1CLB A;  4BY4 A;  1WRK A;  1PSR A;  3PFV A;  4HRH A;  3SIA A;  3CR5 X;  1N65 A;  5AFP A;  1NSH A;  4AOM A;  1DGU A;  1LVC D;  2KBM A;  3F45 A;  2LP3 A;  2AMI A;  1BR1 B;  3VRR A;  1F70 A;  3BUN B;  1KCY A;  1MXL C;  3VRO A;  1MHO A;  2LHI A;  3M0W A;  5AXI A;  1JFJ A;  4MLW A;  4YI8 A;  2LLS A;  1UWO A;  4YBH B;  4C0K A;  4U8D A;  3LL8 B;  1SR6 C;  2PSR A;  5CSJ A;  1NP8 A;  1QVI Y;  1ALV A;  1BOC A;  4MRX A;  5GQQ C;  2Y1M A;  2NCO A;  4MN0 A;  1TTX A;  3CR4 X;  1YUT A;  2ZKM X;  2KQ6 A;  1WLM A;  2I2R E;  1PVA A;  1QV1 A;  2ZRT A;  3CS1 A;  3ZNI A;  5JJG A;  1K8U A;  3PLF B;  1OQP A;  2M7L A;  2L98 A;  1YUR A;  2CCM A;  2PMY A;  3WHT B;  4DS7 A;  1SCM C;  3HCM A;  1KK8 C;  1YVH A;  1KK7 Y; 
#chains in the Genus database with same CATH topology
 3TS5 C;  3EK4 A;  4TNC A;  4AQI A;  3TUY C;  2NLN A;  2KPH A;  4DIR A;  3FIA A;  3OHM B;  1UP5 A;  1Y1X A;  2LNK A;  1NWD A;  1BT6 A;  2O5G A;  2LLT A;  2FJY A;  1DJI A;  2WCB A;  3B88 A;  3I5F B;  5KTY A;  2L51 A;  3GK2 A;  2LVJ A;  1CFP A;  1RRO A;  2KAY A;  1H8B A;  5JOL A;  1S6J A;  3OB1 B;  4XJK A;  1OW4 A;  1UUR A;  2BBM A;  1SMG A;  2LCP A;  3IQQ A;  4MZL A;  2EHB A;  1CDM A;  1NX3 A;  4CFR A;  1QTX A;  4E68 A;  5HKY A;  2SCP A;  3DYE A;  1TNX A;  1KQV A;  2R2I A;  4PE4 A;  2FOT A;  3CLN A;  3TDZ A;  4HRG A;  1UHN A;  3IF7 A;  3PAT A;  5ER5 A;  1DVI A;  4BY5 A;  2F3Z A;  1W7J B;  1CM4 A;  1P28 A;  4PHN A;  2F2P A;  3KPX A;  2CNP A;  5I94 A;  2SAS A;  3CYZ A;  4GGN A;  1SCV A;  2TN4 A;  1D1O A;  1FF1 A;  1YR5 A;  1WLZ A;  2LE9 B;  2GV5 A;  1V1G A;  1ZFS A;  3SS5 A;  2ZNE A;  1NPQ A;  2JT0 A;  4USL A;  3S0D A;  1AHR A;  3RLZ A;  3VRQ A;  1M45 A;  2I18 A;  2KI6 D;  4MBE A;  4MVF A;  2I94 A;  4OCI A;  1EG3 A;  1SYM A;  2WOS A;  1CFF A;  3L4L A;  1XFZ O;  4MZK A;  1NCY A;  1A75 B;  1UHJ A;  2M3W A;  1B1G A;  1NYA A;  5FI6 A;  4GGF C;  1SBJ A;  4YGD B;  2AUC A;  1C3Z A;  3BYA A;  2OS8 C;  1ZAC A;  2WCM A;  3SJS A;  5F6T A;  1BR4 B;  4A4B A;  1K95 A;  2JRF A;  2O60 A;  2KFH A;  2JTT A;  1BU3 A;  1TOP A;  1NX0 A;  1G4Y R;  4WRI A;  3L4A A;  2GTE A;  1S26 D;  3PN7 B;  4DUQ A;  1EH2 A;  2L50 A;  1VRK A;  4MRY A;  2BE6 A;  1IQ3 A;  2K2A A;  3V2L A;  2HET A;  3QME A;  1N2D A;  1IJ6 A;  2JUL A;  5EL2 A;  1DC1 A;  2KFF A;  1OOG A;  1S6I A;  1XA5 A;  2FCE A;  2L5X B;  3L47 A;  1B7T Z;  2HQ8 A;  3B7A A;  5CSN A;  5DKN A;  4C0L A;  1A4P A;  3D74 A;  2BEC A;  4YGB B;  3WNX B;  4ORB B;  1AJ4 A;  3BOW A;  2M0R A;  1SNL A;  2HQW A;  3S0B A;  3SG2 A;  1F8H A;  4PHK A;  1R2U A;  2Y5I A;  1OZS A;  2LMU A;  1QAS A;  2NCP A;  4FTG A;  1C7W A;  1SK6 D;  2KNE A;  4GBA A;  1DTL A;  1KK7 Z;  2K0J A;  2WND A;  3CZ1 A;  3KEV A;  3UO9 A;  1FPW A;  1M31 A;  3O4Y A;  1JWD A;  1J7P A;  1X02 A;  4R1E A;  2HF5 A;  5G08 A;  3A4U B;  1GQM A;  3BUO B;  1W7I B;  3EK8 A;  4PAL A;  1K90 D;  4XYN A;  1J1D A;  1B8R A;  1MF8 B;  1CM1 A;  3S0E A;  4NDD A;  2ZRS A;  4I5J A;  2I7A A;  4ETO A;  2BL0 B;  3NSL A;  2PVB A;  1QS7 A;  2BBN A;  4YRU A;  1TN4 A;  1DJZ A;  2WCH A;  1QX5 B;  2KYF A;  3EKH A;  2LMV A;  4YGC B;  1QIV A;  1UHK A;  5DIC A;  3IQO A;  1NIW A;  3A8R A;  2ERB A;  4OR9 B;  2ZND A;  4CID A;  4UPG A;  1DMO A;  3JVT B;  1WY9 A;  1TCO B;  2EC6 B;  1DF0 B;  2JQ6 A;  1IJ5 A;  1TCF A;  2QDI A;  4OVN F;  1J1E A;  2FCD A;  2WC5 A;  3AKB A;  2F8P A;  2ZFD A;  1PK0 D;  1B7T Y;  2Q4U A;  1JUO A;  1BJF A;  2K7D A;  3BJH A;  4HRE E;  2CXJ A;  2MA2 A;  4FQO A;  2LVK A;  1REC A;  4INW A;  2JNX A;  2IS9 A;  2Y1N A;  2LLU A;  3FS7 A;  1CMG A;  3R1O A;  1IKU A;  1FBV A;  3N7H A;  2K60 A;  1SY9 A;  4CLN A;  1Z4H A;  3OB2 B;  1LXF C;  2KAX A;  2LUX A;  2KI4 B;  1S6C A;  2P6B B;  1DJG A;  2B1U A;  4ORA B;  1M39 A;  1QX2 A;  4PE1 A;  3BUM B;  1J7Q A;  1XFY O;  2L5Y A;  3AAJ A;  4NDB A;  4F0Z B;  3OP0 A;  3BQ3 A;  3D76 A;  4ZCV A;  1DEL A;  1FI6 A;  2H61 A;  2JXC A;  2MJW B;  3FWC A;  3I5H B;  1NUB A;  1IIO A;  1CLL A;  1HQV A;  2LHL A;  2BNX A;  1K2H A;  4ORC B;  4WQ3 A;  3BUX B;  2PRU A;  3K21 A;  4NQG A;  1AUI B;  5HYD A;  3VRP A;  3OBV A;  4PHM A;  3KHE A;  4OZD A;  1KFU L;  1U5I A;  3D77 A;  3LLE A;  3RM1 A;  5FI7 A;  5I2O A;  1JFK A;  3VGO A;  1IWQ A;  2JNF A;  5CPV A;  2G2B A;  3NSK A;  2H8V A;  1F54 A;  2M8U A;  3BXK A;  3LK0 A;  2YGU A;  5CSF A;  1YRU B;  1TNW A;  1U5I B;  1JSA A;  3JTD B;  2F2O A;  1RFJ A;  1XVJ A;  3UNW A;  2QPT A;  3D78 A;  2KGR A;  1SL7 A;  2ISD A;  4MEW A;  5I8N A;  2WCK A;  3S0A A;  1LA0 A;  1EXR A;  1B4C A;  3RZS A;  2K7O A;  5D69 A;  2OPO A;  4I5K A;  2L2E A;  4INX A;  2BE4 A;  1GGW A;  2V53 A;  5DKR A;  1YRT B;  1K93 D;  1A75 A;  2CT9 A;  2QAC A;  4YGE B;  1A29 A;  1YTZ C;  1V1F A;  3GK4 X;  1KFU S;  1YVL A;  1JF2 A;  2JT8 A;  1Y6W A;  4DRW A;  3I5I B;  1B9A A;  1K96 A;  2HPS A;  3CZ2 A;  3SG7 A;  4CPV A;  1IG5 A;  2DOQ A;  4HSZ A;  1CNP A;  1F71 A;  3TZ1 A;  2BL0 C;  3I5G B;  1OMV A;  1G33 A;  2CTN A;  1L2O B;  5AAN A;  1OE9 B;  3S0F A;  4MSP A;  3FE8 A;  3GOF A;  1AVS A;  2JWW A;  4JPZ B;  2MBX A;  2L2C A;  3BUW B;  1LS8 A;  3CWG A;  3EKJ A;  4L9M A;  1DJW A;  1BOD A;  1KFX S;  2LUC A;  1L7Z A;  3JVT C;  4GFT A;  1UHH A;  4PT1 A;  3EVV A;  2EC6 C;  3DVE A;  1UHI A;  2KYC A;  3BFA A;  5FI2 A;  1J7O A;  4N1F A;  1XYD A;  4KYN A;  4QJ5 B;  2PYQ A;  3SG6 A;  1WRL A;  2KGB C;  4P5O E;  4NDC A;  3TS5 B;  1YX8 A;  4PHJ A;  3SG5 A;  3TUY B;  1N0Y A;  5IBW A;  1ZOT B;  1CTR A;  3CDN A;  3HX4 A;  4MZJ A;  1OOI X;  2EGD A;  1S3P A;  3FE6 A;  1JF0 A;  1M63 B;  4M2P A;  2PAS A;  1TNQ A;  2KI4 C;  1XO5 A;  1LA3 A;  1CDP A;  1OZO A;  3BFB A;  2JTZ A;  1FI5 A;  3CZT X;  3EG5 B;  2QEV A;  2KFG A;  2LV7 A;  3I5F C;  1DQE A;  5J3X A;  2Y4Q A;  1TNP A;  3I5H C;  2L4I A;  1DGV A;  2H2K A;  1WDC B;  1YX7 A;  1KQM B;  4N5X A;  1YUS A;  3DD4 A;  4C0J A;  3TDU A;  1Y1U A;  2KAV A;  2MLF C;  1CLM A;  2JU0 A;  2WOR A;  4P2Y B;  1B8C A;  3B6X A;  3NXA A;  3NHI A;  2H61 C;  3EK7 A;  3FE9 A;  1LIN A;  1HT9 A;  1NCZ A;  4IJ7 A;  2LVI A;  2QEB A;  2M1U A;  3D0Y B;  1DJH A;  2F3Y A;  3SS4 A;  1BG1 A;  3KO0 A;  1F4Q A;  1DF0 A;  3JTD C;  3O78 A;  1XK4 C;  3EVR A;  1RWY A;  1TRF A;  2JT3 A;  4PCW A;  3DF0 B;  3S0G A;  4ZCU A;  5KSZ A;  1OOF A;  1MWN A;  3BFH A;  2K61 A;  4M2O A;  5HKW A;  4AQJ A;  4PE7 A;  3LCP C;  4D1E A;  1EG4 A;  2NZ0 A;  2M29 A;  1CFC A;  2RGI A;  3DXL A;  4YI9 A;  1J55 A;  3FWB A;  1IH0 A;  5B8I B;  2P70 A;  3D73 A;  3O6B A;  2GGM A;  2LMT A;  1KWO B;  1IGV A;  1LKJ A;  2QEO A;  1SW8 A;  2ZN9 A;  2VRG A;  3I5I C;  2M49 B;  1W9Z A;  2JZI A;  2KQY A;  2OS8 B;  1S5G Y;  1ZUZ A;  1DJX A;  2CBL A;  3WXA A;  2GGZ A;  2P71 A;  3E3R A;  2JPO A;  1QJT A;  3I5G C;  3PAL A;  1L2O C;  5CSI A;  3R1V A;  3OX6 A;  3SS3 A;  3SIB A;  5HLO A;  2WCL A;  1MQ1 A;  2KDH A;  3MSE B;  2K7B A;  1DT7 B;  1NX2 A;  2KHN A;  4IL1 A;  4OV2 A;  1BLQ A;  3PN7 C;  1DJY A;  2WCF A;  1TIZ A;  1Y1A A;  1RJV A;  1WRZ A;  3DVM A;  4JWQ A;  4WQ2 A;  1CKK A;  1M46 A;  4OKH A;  2KOT A;  2MRD A;  3NSI A;  1QXP A;  1AP4 A;  1XK4 A;  1A03 A;  1FW4 A;  3ICB A;  1CB1 A;  1K94 A;  2JOJ A;  3Q8I A;  2A4J A;  2FJU B;  5KU1 A;  3NHT A;  1PAL A;  3QRX A;  5I2L A;  2OTG B;  2WC6 A;  3CR2 A;  2K8M B;  2E6W A;  1C7V A;  2WCJ A;  4F7F A;  5AEQ A;  3LK1 A;  2JC2 A;  4GAO A;  4A4C A;  1BF5 A;  2KLE A;  1ALW A;  4JKT A;  1TWO A;  1ZMZ A;  2M97 A;  1R6P A;  3CGA A;  2WCE A;  5HLV A;  1KFX L;  1IRJ A;  4PE0 A;  2PQL A;  2LP2 A;  3PM2 A;  4JD9 A;  1QAT A;  1GM0 A;  2LM5 A;  1PSB A;  1XFW O;  2MHH A;  4PDZ A;  1S36 A;  5BPJ A;  2L0P A;  1WDC C;  3EVU A;  1K9K A;  1KQM C;  2LC5 A;  2D8N A;  1NX1 A;  4XJK B;  2KBI A;  3NGV A;  2M7N A;  1MUX A;  4GPL B;  4CFQ A;  2M9G A;  3NSO A;  1SSE B;  2JPT A;  1A2X A;  1EJ3 A;  4YGA A;  5D3O A;  2MLE C;  1SR6 B;  3AAK A;  1XFR A;  1PVB A;  2Q91 A;  3C1V A;  1B47 A;  1Y0V H;  5PAL A;  4GUK A;  4DCK A;  3VRN A;  2KI6 C;  2G9B A;  1B8L A;  3O4X A;  2K7C A;  1ODB A;  1CFD A;  4FQT A;  1ORG A;  3PM8 A;  2K2F A;  3TDI A;  1JC2 A;  3CTN A;  1NCX A;  1YUU A;  2LAN A;  3AKA A;  3DY9 A;  1XFX O;  4M2Q A;  1KSO A;  1PUL A;  2KSP A;  1OMR A;  1Q80 A;  1SL9 A;  5AER A;  1J7R A;  1OMD A;  3SG4 A;  2COL B;  3D75 A;  1KWO C;  1CDL A;  1SCM B;  1KK8 B;  3R1P A;  1AK8 A;  1QLK A;  2BCA A;  5I2Q A;  4I5N B;  1CDN A;  2BKI B;  5TNC A;  1RTP 1;  1GJY A;  2ZN8 A;  4QJ3 B;  1SKT A;  3DVJ A;  1QWV A;  1T14 A;  2BCB A;  2LAP A;  4N1G A;  2LVV A;  2NXQ A;  1E8A A;  2WC8 A;  1SL8 A;  3K1E A;  4QJ4 B;  1S5G Z;  1KSM A;  1SPY A;  1XFU O;  1F55 A;  3R72 A;  4Q04 A;  1PRW A;  1H4B A;  1AJ5 A;  2BKH B;  1F4O A;  1GGZ A;  5HL1 A;  2BCX A;  2L4H A;  2E30 A;  2M1K B;  3CZ0 A;  1DEK A;  1QVI Z;  3PJI A;  1K9P A;  3D10 A;  1RK9 A;  5HKZ A;  1K9U A;  1C07 A;  5ER4 X;  1CMF A;  1MXE A;  1S1E A;  4JQ0 D;  1G8I A;  1EL4 A;  3WHU B;  3D0Y A;  1JBA A;  2AAO A;  1BMO A;  4ICB A;  4GNK B;  1Z2C B;  3B87 A;  1QLS A;  3GK1 A;  2F33 A;  1QX7 A;  1C3Y A;  2PAL A;  3OX5 A;  2JXL A;  3PSR A;  1OOJ A;  1QIW A;  3DF0 A;  1OSA A;  5D7F A;  3B86 A;  3SG3 A;  1SRA A;  3O2P A;  1IQ5 A;  3VB1 A;  1TUJ A;  2BAP A;  2OTG C;  3BOW B;  3DVK A;  5K89 A;  1XFV O;  4I5L B;  1UUS A;  3KF9 A;  5DKQ A;  3H4S E;  2MAZ A;  1MR8 A;  1QV0 A;  3IVT A;  5FYX A;  3ZWH A;  4GGF A;  1CLB A;  4BY4 A;  1WRK A;  1PSR A;  3PFV A;  4HRH A;  3SIA A;  3CR5 X;  1N65 A;  5AFP A;  1NSH A;  4AOM A;  1DGU A;  1LVC D;  2KBM A;  3F45 A;  2LP3 A;  2AMI A;  1BR1 B;  3VRR A;  1F70 A;  3BUN B;  1KCY A;  3OGN A;  1MXL C;  3VRO A;  1MHO A;  2LHI A;  3M0W A;  5AXI A;  1JFJ A;  4MLW A;  4YI8 A;  2LLS A;  1UWO A;  4YBH B;  4C0K A;  4U8D A;  3LL8 B;  1SR6 C;  2PSR A;  5CSJ A;  1NP8 A;  1QVI Y;  2KLD A;  3CAB A;  1ALV A;  1BOC A;  4MRX A;  5GQQ C;  2Y1M A;  2NCO A;  4MN0 A;  1TTX A;  3CR4 X;  1YUT A;  2ZKM X;  2KQ6 A;  2QEH A;  1WLM A;  2I2R E;  1PVA A;  1QV1 A;  2ZRT A;  3CS1 A;  3ZNI A;  5JJG A;  1K8U A;  3PLF B;  1OQP A;  2M7L A;  2L98 A;  1YUR A;  2CCM A;  2PMY A;  3WHT B;  3DZT A;  4DS7 A;  1TUZ A;  1OOH A;  1SCM C;  3HCM A;  1KK8 C;  1YVH A;  1KK7 Y; 
#chains in the Genus database with same CATH homology
 3TS5 C;  3EK4 A;  4TNC A;  4AQI A;  3TUY C;  2NLN A;  4DIR A;  3FIA A;  3OHM B;  1UP5 A;  1Y1X A;  2LNK A;  1NWD A;  1BT6 A;  2O5G A;  2LLT A;  1DJI A;  2WCB A;  3I5F B;  5KTY A;  2L51 A;  3GK2 A;  2LVJ A;  1CFP A;  1RRO A;  2KAY A;  1H8B A;  5JOL A;  1S6J A;  3OB1 B;  4XJK A;  1UUR A;  2LCP A;  2BBM A;  1SMG A;  3IQQ A;  4MZL A;  2EHB A;  1CDM A;  1NX3 A;  4CFR A;  1QTX A;  4E68 A;  5HKY A;  2SCP A;  1TNX A;  1KQV A;  2R2I A;  4PE4 A;  2FOT A;  3CLN A;  3TDZ A;  4HRG A;  1UHN A;  3IF7 A;  3PAT A;  5ER5 A;  1DVI A;  4BY5 A;  2F3Z A;  1W7J B;  1CM4 A;  4PHN A;  2F2P A;  3KPX A;  2CNP A;  2SAS A;  4GGN A;  1SCV A;  2TN4 A;  1D1O A;  1FF1 A;  1YR5 A;  1WLZ A;  2LE9 B;  2GV5 A;  1V1G A;  1ZFS A;  2ZNE A;  1NPQ A;  2JT0 A;  4USL A;  1AHR A;  3RLZ A;  3VRQ A;  1M45 A;  2I18 A;  2KI6 D;  4MBE A;  4MVF A;  2I94 A;  4OCI A;  1EG3 A;  1SYM A;  2WOS A;  1CFF A;  1XFZ O;  4MZK A;  1NCY A;  1A75 B;  1UHJ A;  2M3W A;  1B1G A;  1NYA A;  4GGF C;  1SBJ A;  4YGD B;  2AUC A;  3BYA A;  2OS8 C;  1ZAC A;  3SJS A;  5F6T A;  1BR4 B;  4A4B A;  1K95 A;  2JRF A;  2O60 A;  2KFH A;  2JTT A;  1BU3 A;  1TOP A;  1NX0 A;  1G4Y R;  4WRI A;  1S26 D;  3PN7 B;  4DUQ A;  1EH2 A;  2L50 A;  1VRK A;  4MRY A;  2BE6 A;  1IQ3 A;  2K2A A;  2HET A;  1N2D A;  1IJ6 A;  2JUL A;  2KFF A;  1XA5 A;  1S6I A;  2FCE A;  2L5X B;  5CSN A;  1B7T Z;  2HQ8 A;  5DKN A;  4C0L A;  1A4P A;  2BEC A;  4YGB B;  3WNX B;  4ORB B;  1AJ4 A;  3BOW A;  2M0R A;  1SNL A;  2HQW A;  1F8H A;  3SG2 A;  4PHK A;  1R2U A;  2Y5I A;  1OZS A;  2LMU A;  1QAS A;  2NCP A;  4FTG A;  1C7W A;  1SK6 D;  2KNE A;  4GBA A;  1DTL A;  1KK7 Z;  2K0J A;  2WND A;  3KEV A;  1FPW A;  1M31 A;  3O4Y A;  1JWD A;  1J7P A;  1X02 A;  4R1E A;  2HF5 A;  5G08 A;  3A4U B;  1GQM A;  3BUO B;  1W7I B;  3EK8 A;  4PAL A;  1K90 D;  4XYN A;  1J1D A;  1B8R A;  1MF8 B;  1CM1 A;  4NDD A;  2ZRS A;  4I5J A;  2I7A A;  4ETO A;  2BL0 B;  3NSL A;  2PVB A;  1QS7 A;  2BBN A;  4YRU A;  1TN4 A;  1DJZ A;  1QX5 B;  2KYF A;  3EKH A;  2LMV A;  4YGC B;  1QIV A;  1UHK A;  3IQO A;  1NIW A;  3A8R A;  4OR9 B;  2ZND A;  4CID A;  4UPG A;  1DMO A;  3JVT B;  1WY9 A;  1TCO B;  2EC6 B;  1DF0 B;  2JQ6 A;  1IJ5 A;  1TCF A;  4OVN F;  1J1E A;  2FCD A;  3AKB A;  2F8P A;  2ZFD A;  1PK0 D;  1B7T Y;  2Q4U A;  1JUO A;  1BJF A;  2K7D A;  4HRE E;  2CXJ A;  2MA2 A;  4FQO A;  2LVK A;  1REC A;  2JNX A;  2IS9 A;  2Y1N A;  2LLU A;  3FS7 A;  1CMG A;  1IKU A;  1FBV A;  1SY9 A;  4CLN A;  3OB2 B;  1LXF C;  2KAX A;  2LUX A;  2KI4 B;  1S6C A;  2P6B B;  1DJG A;  2B1U A;  4ORA B;  1M39 A;  1QX2 A;  4PE1 A;  3BUM B;  1J7Q A;  1XFY O;  3AAJ A;  4NDB A;  4F0Z B;  3OP0 A;  3BQ3 A;  4ZCV A;  1FI6 A;  2H61 A;  2JXC A;  2MJW B;  3FWC A;  3I5H B;  1NUB A;  1CLL A;  1HQV A;  2LHL A;  1K2H A;  4ORC B;  4WQ3 A;  3BUX B;  2PRU A;  3K21 A;  4NQG A;  1AUI B;  5HYD A;  3VRP A;  4PHM A;  3KHE A;  1KFU L;  1U5I A;  3LLE A;  3RM1 A;  5I2O A;  1JFK A;  3VGO A;  1IWQ A;  2JNF A;  5CPV A;  2G2B A;  3NSK A;  1F54 A;  2M8U A;  3BXK A;  3LK0 A;  5CSF A;  1YRU B;  1TNW A;  1U5I B;  1JSA A;  3JTD B;  2F2O A;  1RFJ A;  1XVJ A;  2QPT A;  2KGR A;  1SL7 A;  2ISD A;  4MEW A;  5I8N A;  1B4C A;  1LA0 A;  1EXR A;  2K7O A;  5D69 A;  2OPO A;  4I5K A;  2L2E A;  2BE4 A;  1GGW A;  2V53 A;  5DKR A;  1YRT B;  1K93 D;  1A75 A;  2CT9 A;  2QAC A;  4YGE B;  1A29 A;  1YTZ C;  1V1F A;  3GK4 X;  1KFU S;  1YVL A;  1JF2 A;  2JT8 A;  1Y6W A;  4DRW A;  3I5I B;  1B9A A;  1K96 A;  2HPS A;  3SG7 A;  4CPV A;  1IG5 A;  2DOQ A;  4HSZ A;  1CNP A;  1F71 A;  3TZ1 A;  2BL0 C;  3I5G B;  1OMV A;  1G33 A;  2CTN A;  1L2O B;  5AAN A;  1OE9 B;  4MSP A;  3GOF A;  1AVS A;  2JWW A;  4JPZ B;  2MBX A;  3BUW B;  3EKJ A;  3CWG A;  4L9M A;  1DJW A;  1BOD A;  1KFX S;  2LUC A;  1L7Z A;  3JVT C;  4GFT A;  1UHH A;  3EVV A;  2EC6 C;  3DVE A;  1UHI A;  2KYC A;  1J7O A;  4N1F A;  1XYD A;  4QJ5 B;  3SG6 A;  1WRL A;  2KGB C;  4P5O E;  4NDC A;  3TS5 B;  1YX8 A;  4PHJ A;  3SG5 A;  3TUY B;  1N0Y A;  5IBW A;  1ZOT B;  1CTR A;  3HX4 A;  4MZJ A;  2EGD A;  1S3P A;  1JF0 A;  1M63 B;  4M2P A;  2PAS A;  1TNQ A;  2KI4 C;  1XO5 A;  1LA3 A;  1CDP A;  1OZO A;  2JTZ A;  1FI5 A;  3CZT X;  2KFG A;  2LV7 A;  3I5F C;  5J3X A;  2Y4Q A;  1TNP A;  3I5H C;  2L4I A;  1DGV A;  2H2K A;  1WDC B;  1YX7 A;  1KQM B;  4N5X A;  1YUS A;  3DD4 A;  4C0J A;  3TDU A;  1Y1U A;  2KAV A;  2MLF C;  1CLM A;  2JU0 A;  2WOR A;  4P2Y B;  1B8C A;  3NXA A;  2H61 C;  3EK7 A;  1LIN A;  1HT9 A;  1NCZ A;  2LVI A;  2M1U A;  3D0Y B;  1DJH A;  2F3Y A;  1BG1 A;  3KO0 A;  1F4Q A;  1DF0 A;  3JTD C;  3O78 A;  1XK4 C;  3EVR A;  1RWY A;  1TRF A;  2JT3 A;  4PCW A;  3DF0 B;  4ZCU A;  5KSZ A;  1MWN A;  4AQJ A;  2K61 A;  4M2O A;  5HKW A;  4PE7 A;  3LCP C;  4D1E A;  1EG4 A;  2NZ0 A;  2M29 A;  1CFC A;  2RGI A;  4YI9 A;  1J55 A;  3FWB A;  1IH0 A;  5B8I B;  3O6B A;  2GGM A;  2LMT A;  1KWO B;  1IGV A;  1LKJ A;  1SW8 A;  2ZN9 A;  2VRG A;  3I5I C;  2M49 B;  2JZI A;  2KQY A;  2OS8 B;  1S5G Y;  1ZUZ A;  1DJX A;  2CBL A;  3WXA A;  2GGZ A;  3E3R A;  1QJT A;  3I5G C;  3PAL A;  1L2O C;  5CSI A;  3OX6 A;  3SIB A;  5HLO A;  3MSE B;  1MQ1 A;  2KDH A;  2K7B A;  1DT7 B;  1NX2 A;  2KHN A;  4IL1 A;  4OV2 A;  1BLQ A;  3PN7 C;  1DJY A;  2WCF A;  1TIZ A;  1Y1A A;  1RJV A;  1WRZ A;  3DVM A;  4JWQ A;  4WQ2 A;  1CKK A;  1M46 A;  4OKH A;  2KOT A;  2MRD A;  3NSI A;  1QXP A;  1AP4 A;  1XK4 A;  1A03 A;  1FW4 A;  3ICB A;  1CB1 A;  1K94 A;  2JOJ A;  2A4J A;  2FJU B;  5KU1 A;  1PAL A;  3QRX A;  5I2L A;  2OTG B;  3CR2 A;  2K8M B;  2E6W A;  1C7V A;  5AEQ A;  3LK1 A;  2JC2 A;  4GAO A;  4A4C A;  1BF5 A;  1ALW A;  1ZMZ A;  2M97 A;  1R6P A;  3CGA A;  2WCE A;  5HLV A;  1KFX L;  1IRJ A;  4PE0 A;  2LP2 A;  1QAT A;  2LM5 A;  1PSB A;  1XFW O;  2MHH A;  4PDZ A;  1S36 A;  5BPJ A;  2L0P A;  1WDC C;  3EVU A;  1K9K A;  1KQM C;  2LC5 A;  2D8N A;  1NX1 A;  4XJK B;  2KBI A;  2M7N A;  1MUX A;  4GPL B;  4CFQ A;  2M9G A;  3NSO A;  2JPT A;  1A2X A;  1EJ3 A;  4YGA A;  2MLE C;  1SR6 B;  3AAK A;  3C1V A;  1PVB A;  2Q91 A;  1B47 A;  1Y0V H;  5PAL A;  4GUK A;  4DCK A;  3VRN A;  2KI6 C;  2G9B A;  1B8L A;  2K7C A;  1ODB A;  1CFD A;  3PM8 A;  3TDI A;  2K2F A;  1JC2 A;  3CTN A;  1NCX A;  1YUU A;  2LAN A;  3AKA A;  1XFX O;  4M2Q A;  1KSO A;  1PUL A;  2KSP A;  1OMR A;  1Q80 A;  1SL9 A;  5AER A;  1J7R A;  1OMD A;  3SG4 A;  2COL B;  1AK8 A;  1KWO C;  1CDL A;  1SCM B;  1KK8 B;  1QLK A;  2BCA A;  5I2Q A;  4I5N B;  1CDN A;  2BKI B;  5TNC A;  1RTP 1;  1GJY A;  2ZN8 A;  4QJ3 B;  1SKT A;  3DVJ A;  2BCB A;  2LAP A;  4N1G A;  2LVV A;  2NXQ A;  1E8A A;  2WC8 A;  1SL8 A;  4QJ4 B;  1S5G Z;  1KSM A;  1SPY A;  1XFU O;  1F55 A;  4Q04 A;  1PRW A;  1H4B A;  1AJ5 A;  2BKH B;  1F4O A;  1GGZ A;  2BCX A;  2L4H A;  2E30 A;  2M1K B;  1QVI Z;  1K9P A;  3D10 A;  1RK9 A;  5HKZ A;  1K9U A;  1C07 A;  5ER4 X;  1CMF A;  1MXE A;  1S1E A;  4JQ0 D;  1G8I A;  1EL4 A;  3WHU B;  3D0Y A;  1JBA A;  2AAO A;  1BMO A;  4ICB A;  4GNK B;  1QLS A;  3GK1 A;  2F33 A;  1QX7 A;  2PAL A;  3OX5 A;  2JXL A;  3PSR A;  1OOJ A;  1QIW A;  3DF0 A;  1OSA A;  5D7F A;  3SG3 A;  1SRA A;  3O2P A;  1IQ5 A;  2OTG C;  3BOW B;  3DVK A;  5K89 A;  1XFV O;  4I5L B;  1UUS A;  3KF9 A;  5DKQ A;  3H4S E;  2MAZ A;  1MR8 A;  1QV0 A;  5FYX A;  3ZWH A;  4GGF A;  1CLB A;  4BY4 A;  1WRK A;  1PSR A;  3PFV A;  4HRH A;  3SIA A;  3CR5 X;  1N65 A;  5AFP A;  1NSH A;  4AOM A;  1DGU A;  1LVC D;  2KBM A;  3F45 A;  2LP3 A;  2AMI A;  1BR1 B;  3VRR A;  1F70 A;  3BUN B;  1KCY A;  1MXL C;  3VRO A;  1MHO A;  2LHI A;  3M0W A;  5AXI A;  1JFJ A;  4MLW A;  4YI8 A;  2LLS A;  1UWO A;  4YBH B;  4C0K A;  4U8D A;  3LL8 B;  1SR6 C;  2PSR A;  5CSJ A;  1NP8 A;  1QVI Y;  1ALV A;  1BOC A;  4MRX A;  5GQQ C;  2Y1M A;  2NCO A;  4MN0 A;  1TTX A;  3CR4 X;  1YUT A;  2ZKM X;  2KQ6 A;  1WLM A;  2I2R E;  1PVA A;  1QV1 A;  2ZRT A;  3CS1 A;  3ZNI A;  5JJG A;  1K8U A;  3PLF B;  1OQP A;  2M7L A;  2L98 A;  1YUR A;  2CCM A;  2PMY A;  3WHT B;  4DS7 A;  1SCM C;  3HCM A;  1KK8 C;  1YVH A;  1KK7 Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...