5CSJA

S100b-rsk1 crystal structure b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
GSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 31
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5csjA00
1SR6B 1N2DA 2IS9A 3CR2A 1NPQA 5IBWA 1TN4A 5PALA 2LUXA 5KSZA 1U5IA 1JF0A 1CNPA 3AAJA 1JSAA 1PALA 1H8BA 3SIBA 2HPSA 1AUIB 3SG3A 2F2PA 1W7IB 4CPVA 2MLEC 2LVIA 1XYDA 1J7PA 1SL7A 3AAKA 2I94A 5KTYA 1BJFA 4I5LB 3JTDC 2KOTA 3JTDB 3DVKA 1WDCB 2ZKMX 1CLBA 2L50A 1SMGA 2LP2A 3PN7B 1CB1A 4DIRA 2O5GA 4I5KA 1NP8A 2DOQA 3CTNA 1KSMA 2MAZA 5G08A 1UUSA 2ISDA 2L51A 3K21A 2K7BA 3TUYB 3TUYC 3GOFA 5CSNA 1QATA 1GJYA 3JVTC 1SBJA 4ORCB 1K9PA 3BUWB 1RJVA 5DKRA 1AP4A 1K96A 1JWDA 1X02A 1J1DA 1FW4A 3CR4X 2PVBA 4CLNA 1XFZO 3TDUA 2JQ6A 1TNQA 1YRUB 1TCFA 2M3WA 1DJIA 4PHJA 2JTTA 2FCEA 3O2PA 1NX1A 4MSPA 1S6JA 1CDPA 4M2PA 4ORAB 4YRUA 1W7JB 2ZNDA 2OTGC 2Y1MA 1PK0D 2OTGB 3DF0B 1CDNA 1DF0A 1GGWA 2OPOA 1B8CA 1F4QA 3EKJA 2I7AA 1ZACA 1LKJA 1NWDA 2M9GA 3ICBA 1CFCA 1H4BA 3WHUB 3BQ3A 3BUXB 2K7DA 2H61A 3BUMB 4ICBA 3BXKA 4GGFC 5HYDA 3BYAA 1TNPA 3A4UB 1B7TZ 1FI6A 4ETOA 2Y5IA 1UHJA 4M2OA 1PVBA 1RFJA 2A4JA 3KF9A 4NQGA 1DT7B 1CFFA 1J7RA 3CS1A 1BOCA 1K90D 4WQ2A 4CFRA 2NXQA 3HCMA 5J3XA 1LVCD 1YTZC 4M2QA 3LK0A 4GUKA 3DD4A 4GFTA 5DKQA 2MJWB 4N1GA 1YUSA 2M49B 4PE4A 1XA5A 2LAPA 3I5IC 3I5IB 1UHHA 1QTXA 1CM4A 2K61A 2R2IA 2Q4UA 2M1UA 5CSIA 1A29A 5D69A 3DVEA 4ZCVA 1TCOB 1R2UA 4NDBA 3SG7A 2KGRA 2LVJA 1B8LA 1MWNA 2JXCA 2LLUA 2KAVA 2LHLA 2F8PA 4MZLA 2WORA 5ER5A 1S3PA 1N0YA 1L2OC 1L2OB 2LE9B 1OZSA 2I18A 1YX7A 2LMVA 1LXFC 1PRWA 2KBMA 2PMYA 2G2BA 2JWWA 5AANA 4PE0A 1ALVA 1Q80A 2P6BB 4GAOA 1SCMB 2G9BA 5GQQC 1C7WA 1WY9A 3LCPC 1YUTA 2EC6C 1ZUZA 2EC6B 2K2FA 1B7TY 1K9UA 4DS7A 1TTXA 1RK9A 1K94A 1KQMC 2JU0A 4OCIA 1D1OA 4WQ3A 1K9KA 1E8AA 1SR6C 1EG3A 4PE7A 2FJUB 3PALA 1KWOB 1LA0A 1QIWA 1SKTA 1ZFSA 1CFPA 5I8NA 1NX0A 3FWBA 2CBLA 3OB1B 1DJYA 5HLOA 1IKUA 4D1EA 1TNWA 5D7FA 3PFVA 4CIDA 1CM1A 2KBIA 3RLZA 1EJ3A 2FOTA 3O4YA 2LM5A 1CDLA 2E30A 1LINA 2KQ6A 3OHMB 2KHNA 3TDIA 2RGIA 1KFXS 3ZWHA 1IQ3A 2M97A 1EG4A 4YGDB 2NCPA 1PSRA 2Y1NA 3VRPA 3QRXA 1WDCC 3TDZA 3EVUA 5BPJA 2JT8A 1OE9B 3EK4A 3PN7C 3ZNIA 1K2HA 1SPYA 3CWGA 4XYNA 5AXIA 2CXJA 1L7ZA 1DVIA 3PM8A 4YGCB 1KFUS 1ZMZA 1WLZA 4BY4A 2BBNA 4MEWA 4Q04A 1RTP1 2CNPA 4MLWA 4AQIA 2AUCA 1QLKA 4C0JA 3GK1A 1S5GZ 4YI9A 2CCMA 1DGUA 2LLTA 3LL8B 1S36A 1F71A 5HKWA 1XK4C 2MLFC 2M1KB 1OMRA 2KFHA 4QJ4B 2M7NA 1MQ1A 1OMVA 1LA3A 1YURA 1XK4A 2GV5A 3I5FC 3I5FB 4OV2A 2F3YA 4NDDA 1IWQA 3AKAA 1QX2A 4OKHA 1F8HA 4HRHA 1KQVA 5ER4X 1XFWO 4XJKA 2QPTA 3A8RA 1K95A 1KK8C 1KK8B 2CTNA 2I2RE 4ORBB 1DF0B 1CMFA 1BT6A 2KAXA 4QJ3B 3RM1A 2WNDA 2B1UA 4NDCA 2FCDA 2LV7A 2H61C 1J55A 1B47A 2H2KA 1TNXA 3PLFB 2LP3A 5B8IB 1QXPA 5KU1A 4MN0A 3SIAA 2JULA 3EKHA 4AQJA 4YGBB 1DJZA 3D0YB 3NXAA 1Y6WA 2OS8B 1WRLA 4PE1A 2JPTA 1B8RA 1DJXA 3SJSA 4A4CA 1F70A 3PATA 3D0YA 2E6WA 2LC5A 2KYFA 1XVJA 3BOWB 3TS5C 3OX5A 3TS5B 2BL0C 1AHRA 2BL0B 3IF7A 4MRYA 1M45A 3OX6A 1G8IA 2HETA 4L9MA 2O60A 3BOWA 1CLLA 4PALA 1SW8A 1RROA 3BUOB 2K2AA 1MHOA 1Y1AA 2EGDA 1BR1B 4DUQA 1TRFA 2M29A 2LHIA 3SG2A 1A4PA 4IL1A 1S5GY 1PULA 1OMDA 1DJWA 1YRTB 2WCEA 3LK1A 1JF2A 2NCOA 1YUUA 3SG4A 5TNCA 1YVLA 5DKNA 4U8DA 2ZN8A 2BBMA 1F4OA 1MR8A 2CT9A 1OZOA 2JNXA 1AVSA 2WCFA 5HKYA 2KQYA 1NCXA 2JZIA 2LVVA 4YI8A 5CSJA 5JJGA 2KI6C 1NUBA 3NSLA 2BCBA 2QACA 3M0WA 2LUCA 2F2OA 2M0RA 5CPVA 3CGAA 2L0PA 1UURA 2L98A 5F6TA 1GGZA 1AK8A 2JRFA 3VGOA 3EK7A 1SY9A 2PALA 1OSAA 3KPXA 1SCMC 3LLEA 1B1GA 2SCPA 3CZTX 1MXEA 1EXRA 1AJ5A 1OOJA 1A75B 1PSBA 4MZKA 2D8NA 2SASA 5HKZA 1J7OA 1A75A 3KEVA 3NSOA 1MF8B 1UHKA 3VRRA 1J7QA 2VRGA 2BE6A 3IQQA 1KWOC 2JT3A 1KK7Z 2GGZA 3C1VA 3WXAA 1JUOA 4HREE 4USLA 4WRIA 2K7CA 1IG5A 2MHHA 1EH2A 1NX2A 1DJHA 2ZRSA 4FQOA 2KYCA 2LLSA 2ZFDA 2KAYA 3O78A 2MBXA 5I2OA 4TNCA 1BG1A 1IRJA 2WCBA 4P5OE 4YBHB 1M31A 2AMIA 1V1FA 3IQOA 1BODA 3DVJA 1DMOA 4HSZA 4MRXA 2PRUA 1HT9A 3CLNA 4N5XA 4FTGA 2JOJA 4MVFA 4QJ5B 1C7VA 2LMUA 1QJTA 1NYAA 2MA2A 1NX3A 1S26D 4HRGA 5HLVA 2BKIB 3NSKA 4A4BA 2KI4C 1UWOA 2KI4B 4YGAA 1IH0A 1CKKA 1M63B 3SG6A 2ZRTA 1R6PA 3D10A 4MZJA 1YX8A 4E68A 1DTLA 2COLB 1AJ4A 2KI6D 1A03A 1M39A 2HQWA 2L2EA 1QV0A 4PHNA 1JBAA 3DVMA 1QASA 1FBVA 2M8UA 3HX4A 4DRWA 2KFFA 4GPLB 5AEQA 4GGNA 1XO5A 5K89A 2K7OA 3FS7A 1C07A 1ZOTB 5AERA 3WNXB 4XJKB 1BMOA 1SNLA 4OR9B 1VRKA 1BR4B 2ZN9A 2K0JA 3AKBA 3GK2A 1NCYA 3EK8A 2EHBA 4I5JA 4JQ0D 1CDMA 1KK7Y 1V1GA 2ZNEA 1UHIA 1A2XA 3JVTB 4BY5A 2BCXA 2KDHA 1NCZA 1SL9A 2JC2A 2L4IA 1RECA 2WC8A 1CTRA 1GQMA 1SL8A 1XFVO 2F33A 1ODBA 3WHTB 2TN4A 4F0ZB 1EL4A 1Y0VH 2LNKA 2LVKA 1Y1UA 2OS8C 1G4YR 3I5GC 3E3RA 3I5GB 1DGVA 2LCPA 3EVRA 3MSEB 2K8MB 1K8UA 4GNKB 3VROA 2V53A 4P2YB 3SG5A 1DJGA 2Q91A 1IGVA 4PDZA 1SRAA 1PVAA 1QVIZ 4OVNF 1M46A 3DF0A 2JNFA 2JTZA 1MXLC 1SYMA 2GGMA 2KSPA 1BU3A 1G33A 4AOMA 3PSRA 1QX5B 3F45A 4PHKA 1MUXA 4YGEB 2LMTA 1XFXO 1NIWA 3CR5X 5JOLA 4DCKA 1IJ6A 4I5NB 1TOPA 1QS7A 4GGFA 3FIAA 1WRZA 1UP5A 2MRDA 3NSIA 2KGBC 1WLMA 1SK6D 1KFXL 3I5HC 2AAOA 1RWYA 3I5HB 3TZ1A 1JFKA 1WRKA 1FF1A 4MBEA 5FYXA 2L5XB 4C0LA 1IQ5A 1CFDA 2LANA 4R1EA 4C0KA 3H4SE 1S6IA 1BF5A 1KSOA 1XFYO 3GK4X 1KFUL 2PASA 4JPZB 4UPGA 1FI5A 2KNEA 4CFQA 4N1FA 5I2QA 1QIVA 2KFGA 1KCYA 1JFJA 3O6BA 2NZ0A 3KO0A 4PHMA 2HQ8A 1S1EA 2BCAA 1K93D 4PCWA 1F54A 4JWQA 1HQVA 1YVHA 1FPWA 2WOSA 1J1EA 2L4HA 1SCVA 5AFPA 2JXLA 2BECA 1BLQA 1QVIY 1TIZA 1QLSA 1YR5A 2PSRA 3VRQA 2Y4QA 3OB2B 1NSHA 1F55A 1OQPA 3BUNB 1CLMA 3KHEA 1CMGA 4ZCUA 1B9AA 2M7LA 1IJ5A 1S6CA 3EVVA 1JC2A 5I2LA 3OP0A 1Y1XA 4GBAA 2BKHB 1ALWA 2BE4A 2JT0A 3VRNA 3FWCA 1N65A 2NLNA 1QX7A 1KQMB 1XFUO 1QV1A 1UHNA 2F3ZA 5CSFA 2HF5A 1B4CA 1U5IB
chains in the Genus database with same CATH superfamily
1SR6B 1N2DA 2IS9A 3CR2A 1NPQA 1DQEA 1TN4A 1LS8A 5PALA 2LUXA 5IBWA 5KSZA 1U5IA 1JF0A 1OOIX 1CNPA 3CABA 3AAJA 1B4CA 1JSAA 1PALA 1H8BA 3SIBA 2HPSA 1AUIB 3SG3A 2F2PA 1W7IB 4CPVA 3PJIA 2MLEC 2LVIA 1XYDA 1J7PA 1SL7A 3AAKA 1Z2CB 2I94A 5KTYA 1BJFA 4I5LB 2BAPA 3JTDC 2KOTA 3JTDB 3DVKA 1WDCB 2ZKMX 1CLBA 2L50A 4IJ7A 1SMGA 2LP2A 3PN7B 1CB1A 4DIRA 3EG5B 2O5GA 4I5KA 1NP8A 2P71A 2DOQA 3CTNA 1KSMA 2MAZA 5G08A 1UUSA 4JKTA 2ISDA 3R72A 2KLEA 2L51A 3K21A 2K7BA 4FQTA 3TUYB 3TUYC 3D75A 3GOFA 5CSNA 4OZDA 1QATA 5I94A 1GJYA 3JVTC 1SBJA 4ORCB 4F7FA 1K9PA 3BUWB 1RJVA 5DKRA 1AP4A 1K96A 1JWDA 1X02A 1J1DA 1FW4A 3CR4X 2PVBA 4CLNA 1XFZO 3TDUA 2JQ6A 2BNXA 1TNQA 1YRUB 1TCFA 2M3WA 1DJIA 1DC1A 4PHJA 2JTTA 2FCEA 3O2PA 1NX1A 4MSPA 1S6JA 1CDPA 4M2PA 4ORAB 4YRUA 1W7JB 2ZNDA 2OTGC 2Y1MA 1PK0D 2OTGB 3DF0B 1CDNA 1DF0A 1GGWA 2OPOA 1B8CA 1F4QA 3EKJA 2I7AA 1ZACA 1LKJA 1NWDA 2M9GA 3ICBA 1CFCA 1H4BA 3WHUB 5FI7A 3BQ3A 3BUXB 2K7DA 2PQLA 2H61A 3BUMB 4ICBA 3BXKA 4GGFC 5HYDA 3CZ2A 3BYAA 4KYNA 1TNPA 3A4UB 1ORGA 1B7TZ 1FI6A 4ETOA 2Y5IA 1UHJA 4M2OA 1PVBA 1RFJA 2A4JA 3CDNA 3KF9A 4NQGA 1DT7B 1CFFA 1J7RA 3CS1A 1BOCA 1K90D 3B87A 3B88A 2QEVA 4WQ2A 4CFRA 2NXQA 3HCMA 5J3XA 1LVCD 1OOGA 1YTZC 4M2QA 3LK0A 3Q8IA 4GUKA 3DD4A 4GFTA 3DZTA 2MJWB 5DKQA 4N1GA 1YUSA 2M49B 4PE4A 1XA5A 2LAPA 3I5IC 3I5IB 1UHHA 1QTXA 1CM4A 2K61A 2R2IA 2Q4UA 2M1UA 5CSIA 1A29A 3CZ0A 5D69A 3DVEA 4ZCVA 1TCOB 1R2UA 4NDBA 3SG7A 2KGRA 2LVJA 1B8LA 1MWNA 2JXCA 2LLUA 2KAVA 2LHLA 2F8PA 4MZLA 2WORA 5ER5A 1S3PA 1N0YA 3SS3A 1L2OC 3DYEA 1L2OB 2LE9B 1OZSA 2I18A 1YX7A 3B6XA 2LMVA 1LXFC 1PRWA 2KBMA 2PMYA 2G2BA 2JWWA 5AANA 4PE0A 1ALVA 1Q80A 2P6BB 4GAOA 1SCMB 2G9BA 5GQQC 1C7WA 1WY9A 3LCPC 1YUTA 2EC6C 1ZUZA 2EC6B 2K2FA 1B7TY 1K9UA 3D74A 3NHTA 4DS7A 1TTXA 1RK9A 1K94A 1KQMC 2JU0A 4OCIA 1D1OA 4WQ3A 1K9KA 3S0AA 1E8AA 1SR6C 1EG3A 4PE7A 2FJUB 3PALA 1KWOB 1LA0A 1QIWA 1SKTA 1T14A 1ZFSA 2QDIA 1NX0A 5I8NA 1CFPA 3CZ1A 3UO9A 3FWBA 2CBLA 3OB1B 1DJYA 5HLOA 1IKUA 4D1EA 1TNWA 5D7FA 3PFVA 4CIDA 1CM1A 2KBIA 3RLZA 1EJ3A 2FOTA 3O4YA 3V2LA 2LM5A 1CDLA 2E30A 1LINA 2KQ6A 3OHMB 2WC5A 2KHNA 3TDIA 2RGIA 1KFXS 3B86A 3ZWHA 1IQ3A 2M97A 1EG4A 4YGDB 2NCPA 1PSRA 2Y1NA 3VRPA 3QRXA 1WDCC 3TDZA 3EVUA 5BPJA 2JT8A 1OE9B 3EK4A 3PN7C 3ZNIA 1K2HA 1SPYA 3CWGA 4XYNA 3PM2A 5AXIA 2CXJA 1L7ZA 1DVIA 3PM8A 4YGCB 1KFUS 1ZMZA 1WLZA 4BY4A 2BBNA 2L5YA 4MEWA 4Q04A 3S0GA 1RTP1 2CNPA 4MLWA 4AQIA 2AUCA 1QLKA 4C0JA 3GK1A 3R1PA 1S5GZ 4YI9A 2CCMA 1DGUA 2LLTA 3LL8B 1S36A 1F71A 5HKWA 1TUZA 1XK4C 2MLFC 2M1KB 1OMRA 2KFHA 4QJ4B 2M7NA 1MQ1A 1OMVA 1LA3A 1YURA 1XK4A 3UNWA 1TWOA 2GV5A 3I5FC 3I5FB 4OV2A 2WCHA 2F3YA 4NDDA 2WCJA 1IWQA 3AKAA 1QX2A 3IVTA 4OKHA 1F8HA 4HRHA 1KQVA 5ER4X 4PT1A 1XFWO 4XJKA 1OOFA 2QPTA 3A8RA 1K95A 1KK8C 1KK8B 2CTNA 2I2RE 4ORBB 3OBVA 1DF0B 1CMFA 1BT6A 2KAXA 4QJ3B 3RM1A 2WNDA 4INXA 2B1UA 4NDCA 2FCDA 2LV7A 2H61C 1J55A 1B47A 1OOHA 2H2KA 1TNXA 3PLFB 2QEBA 2LP3A 3BFAA 5B8IB 1QXPA 5KU1A 4MN0A 3SIAA 1Z4HA 2JULA 3EKHA 4AQJA 4YGBB 1DJZA 3D0YB 3NXAA 1Y6WA 2OS8B 1WRLA 4PE1A 2JPTA 1B8RA 1DJXA 3K1EA 3OGNA 3SJSA 3PATA 4A4CA 1F70A 3D0YA 3B7AA 2E6WA 2LC5A 2KYFA 1XVJA 3BOWB 3TS5C 3OX5A 3TS5B 1AHRA 2BL0C 2BL0B 3IF7A 4MRYA 1M45A 3OX6A 1G8IA 2HETA 4L9MA 2O60A 3BOWA 2WCLA 1CLLA 3D78A 1SW8A 1RROA 3BUOB 4PALA 2K2AA 1C3ZA 1MHOA 1QWVA 1TUJA 1Y1AA 2EGDA 1BR1B 4DUQA 1TRFA 2KPHA 3NGVA 2M29A 2LHIA 3SG2A 1A4PA 4IL1A 1S5GY 1PULA 1OMDA 1DJWA 1YRTB 2WCEA 3LK1A 2WCKA 2JPOA 5D3OA 1JF2A 2NCOA 1YUUA 3SG4A 5TNCA 1YVLA 3D76A 5DKNA 4U8DA 2ZN8A 3R1VA 2BBMA 1F4OA 1MR8A 2CT9A 1OZOA 1P28A 1AVSA 2JNXA 2WCFA 2KQYA 1NCXA 2JZIA 2LVVA 4YI8A 3SS5A 5HKYA 5CSJA 5JJGA 2KI6C 1NUBA 3NSLA 2BCBA 3CYZA 2QACA 3M0WA 3BFHA 2LUCA 2F2OA 2M0RA 3L47A 5CPVA 2WC6A 3CGAA 2L0PA 1W9ZA 1UURA 2L98A 5F6TA 1GGZA 1AK8A 2JRFA 3VGOA 3EK7A 1SY9A 2PALA 1OSAA 3KPXA 1SCMC 3LLEA 1B1GA 2H8VA 2SCPA 3CZTX 1MXEA 1EXRA 1AJ5A 1OOJA 1A75B 1PSBA 4MZKA 2D8NA 2SASA 2PYQA 5HKZA 1J7OA 1A75A 3KEVA 5EL2A 3NSOA 1MF8B 1UHKA 2QEHA 3VRRA 1J7QA 2VRGA 2BE6A 3IQQA 1KWOC 2JT3A 3S0EA 1KK7Z 2GGZA 3C1VA 3WXAA 3O4XA 1JUOA 4HREE 4USLA 4WRIA 2K7CA 1IG5A 2MHHA 1C3YA 1EH2A 1NX2A 1DJHA 2ZRSA 4FQOA 2KYCA 2LLSA 2ZFDA 2KAYA 3O78A 2MBXA 4JD9A 4TNCA 3SS4A 1IRJA 5I2OA 2WCBA 4P5OE 4YBHB 1M31A 2AMIA 1V1FA 3IQOA 1BODA 3DVJA 3R1OA 4HSZA 4MRXA 2PRUA 1HT9A 1DMOA 3CLNA 4N5XA 4FTGA 2JOJA 4MVFA 4QJ5B 1C7VA 1GM0A 2LMUA 1QJTA 1NYAA 2MA2A 1NX3A 1S26D 4HRGA 2KLDA 1DELA 5HLVA 2BKIB 3NSKA 4A4BA 2KI4C 1UWOA 2KI4B 4YGAA 1IH0A 3QMEA 1M63B 1CKKA 3SG6A 2ZRTA 1R6PA 3D10A 2P70A 4MZJA 1YX8A 4E68A 1DTLA 2COLB 1AJ4A 2KI6D 1A03A 1M39A 2HQWA 2L2EA 1QV0A 4PHNA 5DICA 1JBAA 3DVMA 1QASA 1FBVA 2M8UA 3HX4A 4DRWA 2KFFA 4GPLB 5AEQA 4GGNA 1XO5A 5K89A 2K7OA 3FS7A 1C07A 1ZOTB 5AERA 3WNXB 4XJKB 1BMOA 1SNLA 4OR9B 1VRKA 1BR4B 2ZN9A 5FI2A 1SSEB 2K0JA 3AKBA 3GK2A 1NCYA 3EK8A 3BFBA 2EHBA 4I5JA 4JQ0D 1CDMA 3NHIA 1KK7Y 1V1GA 2ZNEA 1UHIA 1A2XA 3JVTB 4BY5A 1BG1A 2FJYA 2BCXA 2KDHA 1NCZA 1SL9A 2JC2A 3FE9A 2L4IA 2WCMA 1RECA 2WC8A 1CTRA 1GQMA 1SL8A 1XFVO 2ERBA 2F33A 1ODBA 3L4AA 3WHTB 2TN4A 4F0ZB 1EL4A 1Y0VH 2LNKA 2LVKA 1Y1UA 2OS8C 1G4YR 3I5GC 3E3RA 3I5GB 1DGVA 2LCPA 3EVRA 3MSEB 5FI6A 2K8MB 1K8UA 4GNKB 3VROA 2V53A 2YGUA 4P2YB 3SG5A 1DJGA 2Q91A 1IGVA 4PDZA 1SRAA 2QEOA 1PVAA 1QVIZ 4OVNF 1M46A 3DF0A 2JNFA 2JTZA 1MXLC 1SYMA 2GGMA 2KSPA 1BU3A 1G33A 4AOMA 3PSRA 1QX5B 3F45A 4PHKA 1MUXA 4YGEB 2LMTA 1XFXO 1NIWA 3CR5X 5JOLA 4DCKA 1IJ6A 3D73A 4I5NB 1TOPA 1QS7A 4GGFA 3FIAA 1WRZA 1UP5A 2MRDA 3L4LA 3NSIA 2KGBC 1WLMA 1SK6D 1KFXL 3I5HC 2AAOA 1RWYA 3I5HB 3TZ1A 1JFKA 1WRKA 1FF1A 4MBEA 5FYXA 2L5XB 4C0LA 1IQ5A 1CFDA 2LANA 4R1EA 4C0KA 3H4SE 1S6IA 3D77A 1BF5A 1IIOA 1KSOA 1XFYO 3BJHA 3GK4X 1KFUL 3RZSA 2PASA 4JPZB 4UPGA 1FI5A 3FE6A 3VB1A 2KNEA 4CFQA 3DY9A 4N1FA 5I2QA 1QIVA 2KFGA 1KCYA 1JFJA 1OW4A 3O6BA 2NZ0A 3KO0A 3N7HA 3S0BA 4PHMA 2GTEA 2HQ8A 1S1EA 2BCAA 1K93D 4INWA 4PCWA 1F54A 4JWQA 1HQVA 1YVHA 1FPWA 2WOSA 1J1EA 2L4HA 1SCVA 5AFPA 2JXLA 2BECA 1BLQA 1QVIY 1TIZA 1QLSA 1YR5A 2PSRA 3VRQA 2Y4QA 3OB2B 1NSHA 1XFRA 1F55A 1OQPA 3BUNB 1CLMA 3KHEA 3S0DA 4ZCUA 1CMGA 1B9AA 3S0FA 2M7LA 1IJ5A 3DXLA 1S6CA 3EVVA 1JC2A 5HL1A 5I2LA 3OP0A 1Y1XA 4GBAA 2BKHB 1ALWA 2BE4A 2JT0A 2K60A 3FWCA 3VRNA 1N65A 2NLNA 2L2CA 1QX7A 1KQMB 1XFUO 1QV1A 1UHNA 2F3ZA 3FE8A 5CSFA 2HF5A 1DEKA 1U5IB
chains in the Genus database with same CATH topology
1SR6B 1N2DA 2IS9A 3CR2A 1NPQA 5IBWA 1TN4A 5PALA 2LUXA 5KSZA 1U5IA 1JF0A 1CNPA 3AAJA 1JSAA 1PALA 1H8BA 3SIBA 2HPSA 1AUIB 3SG3A 2F2PA 1W7IB 4CPVA 2MLEC 2LVIA 1XYDA 1J7PA 1SL7A 3AAKA 2I94A 5KTYA 1BJFA 4I5LB 3JTDC 2KOTA 3JTDB 3DVKA 1WDCB 2ZKMX 1CLBA 2L50A 1SMGA 2LP2A 3PN7B 1CB1A 4DIRA 2O5GA 4I5KA 1NP8A 2DOQA 3CTNA 1KSMA 2MAZA 5G08A 1UUSA 2ISDA 2L51A 3K21A 2K7BA 3TUYB 3TUYC 3GOFA 5CSNA 1QATA 1GJYA 3JVTC 1SBJA 4ORCB 1K9PA 3BUWB 1RJVA 5DKRA 1AP4A 1K96A 1JWDA 1X02A 1J1DA 1FW4A 3CR4X 2PVBA 4CLNA 1XFZO 3TDUA 2JQ6A 1TNQA 1YRUB 1TCFA 2M3WA 1DJIA 4PHJA 2JTTA 2FCEA 3O2PA 1NX1A 4MSPA 1S6JA 1CDPA 4M2PA 4ORAB 4YRUA 1W7JB 2ZNDA 2OTGC 2Y1MA 1PK0D 2OTGB 3DF0B 1CDNA 1DF0A 1GGWA 2OPOA 1B8CA 1F4QA 3EKJA 2I7AA 1ZACA 1LKJA 1NWDA 2M9GA 3ICBA 1CFCA 1H4BA 3WHUB 3BQ3A 3BUXB 2K7DA 2H61A 3BUMB 4ICBA 3BXKA 4GGFC 5HYDA 3BYAA 1TNPA 3A4UB 1B7TZ 1FI6A 4ETOA 2Y5IA 1UHJA 4M2OA 1PVBA 1RFJA 2A4JA 3KF9A 4NQGA 1DT7B 1CFFA 1J7RA 3CS1A 1BOCA 1K90D 4WQ2A 4CFRA 2NXQA 3HCMA 5J3XA 1LVCD 1YTZC 4M2QA 3LK0A 4GUKA 3DD4A 4GFTA 5DKQA 2MJWB 4N1GA 1YUSA 2M49B 4PE4A 1XA5A 2LAPA 3I5IC 3I5IB 1UHHA 1QTXA 1CM4A 2K61A 2R2IA 2Q4UA 2M1UA 5CSIA 1A29A 5D69A 3DVEA 4ZCVA 1TCOB 1R2UA 4NDBA 3SG7A 2KGRA 2LVJA 1B8LA 1MWNA 2JXCA 2LLUA 2KAVA 2LHLA 2F8PA 4MZLA 2WORA 5ER5A 1S3PA 1N0YA 1L2OC 1L2OB 2LE9B 1OZSA 2I18A 1YX7A 2LMVA 1LXFC 1PRWA 2KBMA 2PMYA 2G2BA 2JWWA 5AANA 4PE0A 1ALVA 1Q80A 2P6BB 4GAOA 1SCMB 2G9BA 5GQQC 1C7WA 1WY9A 3LCPC 1YUTA 2EC6C 1ZUZA 2EC6B 2K2FA 1B7TY 1K9UA 4DS7A 1TTXA 1RK9A 1K94A 1KQMC 2JU0A 4OCIA 1D1OA 4WQ3A 1K9KA 1E8AA 1SR6C 1EG3A 4PE7A 2FJUB 3PALA 1KWOB 1LA0A 1QIWA 1SKTA 1ZFSA 1CFPA 5I8NA 1NX0A 3FWBA 2CBLA 3OB1B 1DJYA 5HLOA 1IKUA 4D1EA 1TNWA 5D7FA 3PFVA 4CIDA 1CM1A 2KBIA 3RLZA 1EJ3A 2FOTA 3O4YA 2LM5A 1CDLA 2E30A 1LINA 2KQ6A 3OHMB 2KHNA 3TDIA 2RGIA 1KFXS 3ZWHA 1IQ3A 2M97A 1EG4A 4YGDB 2NCPA 1PSRA 2Y1NA 3VRPA 3QRXA 1WDCC 3TDZA 3EVUA 5BPJA 2JT8A 1OE9B 3EK4A 3PN7C 3ZNIA 1K2HA 1SPYA 3CWGA 4XYNA 5AXIA 2CXJA 1L7ZA 1DVIA 3PM8A 4YGCB 1KFUS 1ZMZA 1WLZA 4BY4A 2BBNA 4MEWA 4Q04A 1RTP1 2CNPA 4MLWA 4AQIA 2AUCA 1QLKA 4C0JA 3GK1A 1S5GZ 4YI9A 2CCMA 1DGUA 2LLTA 3LL8B 1S36A 1F71A 5HKWA 1XK4C 2MLFC 2M1KB 1OMRA 2KFHA 4QJ4B 2M7NA 1MQ1A 1OMVA 1LA3A 1YURA 1XK4A 2GV5A 3I5FC 3I5FB 4OV2A 2F3YA 4NDDA 1IWQA 3AKAA 1QX2A 4OKHA 1F8HA 4HRHA 1KQVA 5ER4X 1XFWO 4XJKA 2QPTA 3A8RA 1K95A 1KK8C 1KK8B 2CTNA 2I2RE 4ORBB 1DF0B 1CMFA 1BT6A 2KAXA 4QJ3B 3RM1A 2WNDA 2B1UA 4NDCA 2FCDA 2LV7A 2H61C 1J55A 1B47A 2H2KA 1TNXA 3PLFB 2LP3A 5B8IB 1QXPA 5KU1A 4MN0A 3SIAA 2JULA 3EKHA 4AQJA 4YGBB 1DJZA 3D0YB 3NXAA 1Y6WA 2OS8B 1WRLA 4PE1A 2JPTA 1B8RA 1DJXA 3SJSA 4A4CA 1F70A 3PATA 3D0YA 2E6WA 2LC5A 2KYFA 1XVJA 3BOWB 3TS5C 3OX5A 3TS5B 2BL0C 1AHRA 2BL0B 3IF7A 4MRYA 1M45A 3OX6A 1G8IA 2HETA 4L9MA 2O60A 3BOWA 1CLLA 4PALA 1SW8A 1RROA 3BUOB 2K2AA 1MHOA 1Y1AA 2EGDA 1BR1B 4DUQA 1TRFA 2M29A 2LHIA 3SG2A 1A4PA 4IL1A 1S5GY 1PULA 1OMDA 1DJWA 1YRTB 2WCEA 3LK1A 1JF2A 2NCOA 1YUUA 3SG4A 5TNCA 1YVLA 5DKNA 4U8DA 2ZN8A 2BBMA 1F4OA 1MR8A 2CT9A 1OZOA 2JNXA 1AVSA 2WCFA 5HKYA 2KQYA 1NCXA 2JZIA 2LVVA 4YI8A 5CSJA 5JJGA 2KI6C 1NUBA 3NSLA 2BCBA 2QACA 3M0WA 2LUCA 2F2OA 2M0RA 5CPVA 3CGAA 2L0PA 1UURA 2L98A 5F6TA 1GGZA 1AK8A 2JRFA 3VGOA 3EK7A 1SY9A 2PALA 1OSAA 3KPXA 1SCMC 3LLEA 1B1GA 2SCPA 3CZTX 1MXEA 1EXRA 1AJ5A 1OOJA 1A75B 1PSBA 4MZKA 2D8NA 2SASA 5HKZA 1J7OA 1A75A 3KEVA 3NSOA 1MF8B 1UHKA 3VRRA 1J7QA 2VRGA 2BE6A 3IQQA 1KWOC 2JT3A 1KK7Z 2GGZA 3C1VA 3WXAA 1JUOA 4HREE 4USLA 4WRIA 2K7CA 1IG5A 2MHHA 1EH2A 1NX2A 1DJHA 2ZRSA 4FQOA 2KYCA 2LLSA 2ZFDA 2KAYA 3O78A 2MBXA 5I2OA 4TNCA 1BG1A 1IRJA 2WCBA 4P5OE 4YBHB 1M31A 2AMIA 1V1FA 3IQOA 1BODA 3DVJA 1DMOA 4HSZA 4MRXA 2PRUA 1HT9A 3CLNA 4N5XA 4FTGA 2JOJA 4MVFA 4QJ5B 1C7VA 2LMUA 1QJTA 1NYAA 2MA2A 1NX3A 1S26D 4HRGA 5HLVA 2BKIB 3NSKA 4A4BA 2KI4C 1UWOA 2KI4B 4YGAA 1IH0A 1CKKA 1M63B 3SG6A 2ZRTA 1R6PA 3D10A 4MZJA 1YX8A 4E68A 1DTLA 2COLB 1AJ4A 2KI6D 1A03A 1M39A 2HQWA 2L2EA 1QV0A 4PHNA 1JBAA 3DVMA 1QASA 1FBVA 2M8UA 3HX4A 4DRWA 2KFFA 4GPLB 5AEQA 4GGNA 1XO5A 5K89A 2K7OA 3FS7A 1C07A 1ZOTB 5AERA 3WNXB 4XJKB 1BMOA 1SNLA 4OR9B 1VRKA 1BR4B 2ZN9A 2K0JA 3AKBA 3GK2A 1NCYA 3EK8A 2EHBA 4I5JA 4JQ0D 1CDMA 1KK7Y 1V1GA 2ZNEA 1UHIA 1A2XA 3JVTB 4BY5A 2BCXA 2KDHA 1NCZA 1SL9A 2JC2A 2L4IA 1RECA 2WC8A 1CTRA 1GQMA 1SL8A 1XFVO 2F33A 1ODBA 3WHTB 2TN4A 4F0ZB 1EL4A 1Y0VH 2LNKA 2LVKA 1Y1UA 2OS8C 1G4YR 3I5GC 3E3RA 3I5GB 1DGVA 2LCPA 3EVRA 3MSEB 2K8MB 1K8UA 4GNKB 3VROA 2V53A 4P2YB 3SG5A 1DJGA 2Q91A 1IGVA 4PDZA 1SRAA 1PVAA 1QVIZ 4OVNF 1M46A 3DF0A 2JNFA 2JTZA 1MXLC 1SYMA 2GGMA 2KSPA 1BU3A 1G33A 4AOMA 3PSRA 1QX5B 3F45A 4PHKA 1MUXA 4YGEB 2LMTA 1XFXO 1NIWA 3CR5X 5JOLA 4DCKA 1IJ6A 4I5NB 1TOPA 1QS7A 4GGFA 3FIAA 1WRZA 1UP5A 2MRDA 3NSIA 2KGBC 1WLMA 1SK6D 1KFXL 3I5HC 2AAOA 1RWYA 3I5HB 3TZ1A 1JFKA 1WRKA 1FF1A 4MBEA 5FYXA 2L5XB 4C0LA 1IQ5A 1CFDA 2LANA 4R1EA 4C0KA 3H4SE 1S6IA 1BF5A 1KSOA 1XFYO 3GK4X 1KFUL 2PASA 4JPZB 4UPGA 1FI5A 2KNEA 4CFQA 4N1FA 5I2QA 1QIVA 2KFGA 1KCYA 1JFJA 3O6BA 2NZ0A 3KO0A 4PHMA 2HQ8A 1S1EA 2BCAA 1K93D 4PCWA 1F54A 4JWQA 1HQVA 1YVHA 1FPWA 2WOSA 1J1EA 2L4HA 1SCVA 5AFPA 2JXLA 2BECA 1BLQA 1QVIY 1TIZA 1QLSA 1YR5A 2PSRA 3VRQA 2Y4QA 3OB2B 1NSHA 1F55A 1OQPA 3BUNB 1CLMA 3KHEA 1CMGA 4ZCUA 1B9AA 2M7LA 1IJ5A 1S6CA 3EVVA 1JC2A 5I2LA 3OP0A 1Y1XA 4GBAA 2BKHB 1ALWA 2BE4A 2JT0A 3VRNA 3FWCA 1N65A 2NLNA 1QX7A 1KQMB 1XFUO 1QV1A 1UHNA 2F3ZA 5CSFA 2HF5A 1B4CA 1U5IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SR6 B;  1N2D A;  2IS9 A;  3CR2 A;  1NPQ A;  5IBW A;  1TN4 A;  5PAL A;  2LUX A;  5KSZ A;  1U5I A;  1JF0 A;  1CNP A;  3AAJ A;  1JSA A;  1PAL A;  1H8B A;  3SIB A;  2HPS A;  1AUI B;  3SG3 A;  2F2P A;  1W7I B;  4CPV A;  2MLE C;  2LVI A;  1XYD A;  1J7P A;  1SL7 A;  3AAK A;  2I94 A;  5KTY A;  1BJF A;  4I5L B;  3JTD C;  2KOT A;  3JTD B;  3DVK A;  1WDC B;  2ZKM X;  1CLB A;  2L50 A;  1SMG A;  2LP2 A;  3PN7 B;  1CB1 A;  4DIR A;  2O5G A;  4I5K A;  1NP8 A;  2DOQ A;  3CTN A;  1KSM A;  2MAZ A;  5G08 A;  1UUS A;  2ISD A;  2L51 A;  3K21 A;  2K7B A;  3TUY B;  3TUY C;  3GOF A;  5CSN A;  1QAT A;  1GJY A;  3JVT C;  1SBJ A;  4ORC B;  1K9P A;  3BUW B;  1RJV A;  5DKR A;  1AP4 A;  1K96 A;  1JWD A;  1X02 A;  1J1D A;  1FW4 A;  3CR4 X;  2PVB A;  4CLN A;  1XFZ O;  3TDU A;  2JQ6 A;  1TNQ A;  1YRU B;  1TCF A;  2M3W A;  1DJI A;  4PHJ A;  2JTT A;  2FCE A;  3O2P A;  1NX1 A;  4MSP A;  1S6J A;  1CDP A;  4M2P A;  4ORA B;  4YRU A;  1W7J B;  2ZND A;  2OTG C;  2Y1M A;  1PK0 D;  2OTG B;  3DF0 B;  1CDN A;  1DF0 A;  1GGW A;  2OPO A;  1B8C A;  1F4Q A;  3EKJ A;  2I7A A;  1ZAC A;  1LKJ A;  1NWD A;  2M9G A;  3ICB A;  1CFC A;  1H4B A;  3WHU B;  3BQ3 A;  3BUX B;  2K7D A;  2H61 A;  3BUM B;  4ICB A;  3BXK A;  4GGF C;  5HYD A;  3BYA A;  1TNP A;  3A4U B;  1B7T Z;  1FI6 A;  4ETO A;  2Y5I A;  1UHJ A;  4M2O A;  1PVB A;  1RFJ A;  2A4J A;  3KF9 A;  4NQG A;  1DT7 B;  1CFF A;  1J7R A;  3CS1 A;  1BOC A;  1K90 D;  4WQ2 A;  4CFR A;  2NXQ A;  3HCM A;  5J3X A;  1LVC D;  1YTZ C;  4M2Q A;  3LK0 A;  4GUK A;  3DD4 A;  4GFT A;  5DKQ A;  2MJW B;  4N1G A;  1YUS A;  2M49 B;  4PE4 A;  1XA5 A;  2LAP A;  3I5I C;  3I5I B;  1UHH A;  1QTX A;  1CM4 A;  2K61 A;  2R2I A;  2Q4U A;  2M1U A;  5CSI A;  1A29 A;  5D69 A;  3DVE A;  4ZCV A;  1TCO B;  1R2U A;  4NDB A;  3SG7 A;  2KGR A;  2LVJ A;  1B8L A;  1MWN A;  2JXC A;  2LLU A;  2KAV A;  2LHL A;  2F8P A;  4MZL A;  2WOR A;  5ER5 A;  1S3P A;  1N0Y A;  1L2O C;  1L2O B;  2LE9 B;  1OZS A;  2I18 A;  1YX7 A;  2LMV A;  1LXF C;  1PRW A;  2KBM A;  2PMY A;  2G2B A;  2JWW A;  5AAN A;  4PE0 A;  1ALV A;  1Q80 A;  2P6B B;  4GAO A;  1SCM B;  2G9B A;  5GQQ C;  1C7W A;  1WY9 A;  3LCP C;  1YUT A;  2EC6 C;  1ZUZ A;  2EC6 B;  2K2F A;  1B7T Y;  1K9U A;  4DS7 A;  1TTX A;  1RK9 A;  1K94 A;  1KQM C;  2JU0 A;  4OCI A;  1D1O A;  4WQ3 A;  1K9K A;  1E8A A;  1SR6 C;  1EG3 A;  4PE7 A;  2FJU B;  3PAL A;  1KWO B;  1LA0 A;  1QIW A;  1SKT A;  1ZFS A;  1CFP A;  5I8N A;  1NX0 A;  3FWB A;  2CBL A;  3OB1 B;  1DJY A;  5HLO A;  1IKU A;  4D1E A;  1TNW A;  5D7F A;  3PFV A;  4CID A;  1CM1 A;  2KBI A;  3RLZ A;  1EJ3 A;  2FOT A;  3O4Y A;  2LM5 A;  1CDL A;  2E30 A;  1LIN A;  2KQ6 A;  3OHM B;  2KHN A;  3TDI A;  2RGI A;  1KFX S;  3ZWH A;  1IQ3 A;  2M97 A;  1EG4 A;  4YGD B;  2NCP A;  1PSR A;  2Y1N A;  3VRP A;  3QRX A;  1WDC C;  3TDZ A;  3EVU A;  5BPJ A;  2JT8 A;  1OE9 B;  3EK4 A;  3PN7 C;  3ZNI A;  1K2H A;  1SPY A;  3CWG A;  4XYN A;  5AXI A;  2CXJ A;  1L7Z A;  1DVI A;  3PM8 A;  4YGC B;  1KFU S;  1ZMZ A;  1WLZ A;  4BY4 A;  2BBN A;  4MEW A;  4Q04 A;  1RTP 1;  2CNP A;  4MLW A;  4AQI A;  2AUC A;  1QLK A;  4C0J A;  3GK1 A;  1S5G Z;  4YI9 A;  2CCM A;  1DGU A;  2LLT A;  3LL8 B;  1S36 A;  1F71 A;  5HKW A;  1XK4 C;  2MLF C;  2M1K B;  1OMR A;  2KFH A;  4QJ4 B;  2M7N A;  1MQ1 A;  1OMV A;  1LA3 A;  1YUR A;  1XK4 A;  2GV5 A;  3I5F C;  3I5F B;  4OV2 A;  2F3Y A;  4NDD A;  1IWQ A;  3AKA A;  1QX2 A;  4OKH A;  1F8H A;  4HRH A;  1KQV A;  5ER4 X;  1XFW O;  4XJK A;  2QPT A;  3A8R A;  1K95 A;  1KK8 C;  1KK8 B;  2CTN A;  2I2R E;  4ORB B;  1DF0 B;  1CMF A;  1BT6 A;  2KAX A;  4QJ3 B;  3RM1 A;  2WND A;  2B1U A;  4NDC A;  2FCD A;  2LV7 A;  2H61 C;  1J55 A;  1B47 A;  2H2K A;  1TNX A;  3PLF B;  2LP3 A;  5B8I B;  1QXP A;  5KU1 A;  4MN0 A;  3SIA A;  2JUL A;  3EKH A;  4AQJ A;  4YGB B;  1DJZ A;  3D0Y B;  3NXA A;  1Y6W A;  2OS8 B;  1WRL A;  4PE1 A;  2JPT A;  1B8R A;  1DJX A;  3SJS A;  4A4C A;  1F70 A;  3PAT A;  3D0Y A;  2E6W A;  2LC5 A;  2KYF A;  1XVJ A;  3BOW B;  3TS5 C;  3OX5 A;  3TS5 B;  2BL0 C;  1AHR A;  2BL0 B;  3IF7 A;  4MRY A;  1M45 A;  3OX6 A;  1G8I A;  2HET A;  4L9M A;  2O60 A;  3BOW A;  1CLL A;  4PAL A;  1SW8 A;  1RRO A;  3BUO B;  2K2A A;  1MHO A;  1Y1A A;  2EGD A;  1BR1 B;  4DUQ A;  1TRF A;  2M29 A;  2LHI A;  3SG2 A;  1A4P A;  4IL1 A;  1S5G Y;  1PUL A;  1OMD A;  1DJW A;  1YRT B;  2WCE A;  3LK1 A;  1JF2 A;  2NCO A;  1YUU A;  3SG4 A;  5TNC A;  1YVL A;  5DKN A;  4U8D A;  2ZN8 A;  2BBM A;  1F4O A;  1MR8 A;  2CT9 A;  1OZO A;  2JNX A;  1AVS A;  2WCF A;  5HKY A;  2KQY A;  1NCX A;  2JZI A;  2LVV A;  4YI8 A;  5CSJ A;  5JJG A;  2KI6 C;  1NUB A;  3NSL A;  2BCB A;  2QAC A;  3M0W A;  2LUC A;  2F2O A;  2M0R A;  5CPV A;  3CGA A;  2L0P A;  1UUR A;  2L98 A;  5F6T A;  1GGZ A;  1AK8 A;  2JRF A;  3VGO A;  3EK7 A;  1SY9 A;  2PAL A;  1OSA A;  3KPX A;  1SCM C;  3LLE A;  1B1G A;  2SCP A;  3CZT X;  1MXE A;  1EXR A;  1AJ5 A;  1OOJ A;  1A75 B;  1PSB A;  4MZK A;  2D8N A;  2SAS A;  5HKZ A;  1J7O A;  1A75 A;  3KEV A;  3NSO A;  1MF8 B;  1UHK A;  3VRR A;  1J7Q A;  2VRG A;  2BE6 A;  3IQQ A;  1KWO C;  2JT3 A;  1KK7 Z;  2GGZ A;  3C1V A;  3WXA A;  1JUO A;  4HRE E;  4USL A;  4WRI A;  2K7C A;  1IG5 A;  2MHH A;  1EH2 A;  1NX2 A;  1DJH A;  2ZRS A;  4FQO A;  2KYC A;  2LLS A;  2ZFD A;  2KAY A;  3O78 A;  2MBX A;  5I2O A;  4TNC A;  1BG1 A;  1IRJ A;  2WCB A;  4P5O E;  4YBH B;  1M31 A;  2AMI A;  1V1F A;  3IQO A;  1BOD A;  3DVJ A;  1DMO A;  4HSZ A;  4MRX A;  2PRU A;  1HT9 A;  3CLN A;  4N5X A;  4FTG A;  2JOJ A;  4MVF A;  4QJ5 B;  1C7V A;  2LMU A;  1QJT A;  1NYA A;  2MA2 A;  1NX3 A;  1S26 D;  4HRG A;  5HLV A;  2BKI B;  3NSK A;  4A4B A;  2KI4 C;  1UWO A;  2KI4 B;  4YGA A;  1IH0 A;  1CKK A;  1M63 B;  3SG6 A;  2ZRT A;  1R6P A;  3D10 A;  4MZJ A;  1YX8 A;  4E68 A;  1DTL A;  2COL B;  1AJ4 A;  2KI6 D;  1A03 A;  1M39 A;  2HQW A;  2L2E A;  1QV0 A;  4PHN A;  1JBA A;  3DVM A;  1QAS A;  1FBV A;  2M8U A;  3HX4 A;  4DRW A;  2KFF A;  4GPL B;  5AEQ A;  4GGN A;  1XO5 A;  5K89 A;  2K7O A;  3FS7 A;  1C07 A;  1ZOT B;  5AER A;  3WNX B;  4XJK B;  1BMO A;  1SNL A;  4OR9 B;  1VRK A;  1BR4 B;  2ZN9 A;  2K0J A;  3AKB A;  3GK2 A;  1NCY A;  3EK8 A;  2EHB A;  4I5J A;  4JQ0 D;  1CDM A;  1KK7 Y;  1V1G A;  2ZNE A;  1UHI A;  1A2X A;  3JVT B;  4BY5 A;  2BCX A;  2KDH A;  1NCZ A;  1SL9 A;  2JC2 A;  2L4I A;  1REC A;  2WC8 A;  1CTR A;  1GQM A;  1SL8 A;  1XFV O;  2F33 A;  1ODB A;  3WHT B;  2TN4 A;  4F0Z B;  1EL4 A;  1Y0V H;  2LNK A;  2LVK A;  1Y1U A;  2OS8 C;  1G4Y R;  3I5G C;  3E3R A;  3I5G B;  1DGV A;  2LCP A;  3EVR A;  3MSE B;  2K8M B;  1K8U A;  4GNK B;  3VRO A;  2V53 A;  4P2Y B;  3SG5 A;  1DJG A;  2Q91 A;  1IGV A;  4PDZ A;  1SRA A;  1PVA A;  1QVI Z;  4OVN F;  1M46 A;  3DF0 A;  2JNF A;  2JTZ A;  1MXL C;  1SYM A;  2GGM A;  2KSP A;  1BU3 A;  1G33 A;  4AOM A;  3PSR A;  1QX5 B;  3F45 A;  4PHK A;  1MUX A;  4YGE B;  2LMT A;  1XFX O;  1NIW A;  3CR5 X;  5JOL A;  4DCK A;  1IJ6 A;  4I5N B;  1TOP A;  1QS7 A;  4GGF A;  3FIA A;  1WRZ A;  1UP5 A;  2MRD A;  3NSI A;  2KGB C;  1WLM A;  1SK6 D;  1KFX L;  3I5H C;  2AAO A;  1RWY A;  3I5H B;  3TZ1 A;  1JFK A;  1WRK A;  1FF1 A;  4MBE A;  5FYX A;  2L5X B;  4C0L A;  1IQ5 A;  1CFD A;  2LAN A;  4R1E A;  4C0K A;  3H4S E;  1S6I A;  1BF5 A;  1KSO A;  1XFY O;  3GK4 X;  1KFU L;  2PAS A;  4JPZ B;  4UPG A;  1FI5 A;  2KNE A;  4CFQ A;  4N1F A;  5I2Q A;  1QIV A;  2KFG A;  1KCY A;  1JFJ A;  3O6B A;  2NZ0 A;  3KO0 A;  4PHM A;  2HQ8 A;  1S1E A;  2BCA A;  1K93 D;  4PCW A;  1F54 A;  4JWQ A;  1HQV A;  1YVH A;  1FPW A;  2WOS A;  1J1E A;  2L4H A;  1SCV A;  5AFP A;  2JXL A;  2BEC A;  1BLQ A;  1QVI Y;  1TIZ A;  1QLS A;  1YR5 A;  2PSR A;  3VRQ A;  2Y4Q A;  3OB2 B;  1NSH A;  1F55 A;  1OQP A;  3BUN B;  1CLM A;  3KHE A;  1CMG A;  4ZCU A;  1B9A A;  2M7L A;  1IJ5 A;  1S6C A;  3EVV A;  1JC2 A;  5I2L A;  3OP0 A;  1Y1X A;  4GBA A;  2BKH B;  1ALW A;  2BE4 A;  2JT0 A;  3VRN A;  3FWC A;  1N65 A;  2NLN A;  1QX7 A;  1KQM B;  1XFU O;  1QV1 A;  1UHN A;  2F3Z A;  5CSF A;  2HF5 A;  1B4C A;  1U5I B; 
#chains in the Genus database with same CATH topology
 1SR6 B;  1N2D A;  2IS9 A;  3CR2 A;  1NPQ A;  1DQE A;  1TN4 A;  1LS8 A;  5PAL A;  2LUX A;  5IBW A;  5KSZ A;  1U5I A;  1JF0 A;  1OOI X;  1CNP A;  3CAB A;  3AAJ A;  1B4C A;  1JSA A;  1PAL A;  1H8B A;  3SIB A;  2HPS A;  1AUI B;  3SG3 A;  2F2P A;  1W7I B;  4CPV A;  3PJI A;  2MLE C;  2LVI A;  1XYD A;  1J7P A;  1SL7 A;  3AAK A;  1Z2C B;  2I94 A;  5KTY A;  1BJF A;  4I5L B;  2BAP A;  3JTD C;  2KOT A;  3JTD B;  3DVK A;  1WDC B;  2ZKM X;  1CLB A;  2L50 A;  4IJ7 A;  1SMG A;  2LP2 A;  3PN7 B;  1CB1 A;  4DIR A;  3EG5 B;  2O5G A;  4I5K A;  1NP8 A;  2P71 A;  2DOQ A;  3CTN A;  1KSM A;  2MAZ A;  5G08 A;  1UUS A;  4JKT A;  2ISD A;  3R72 A;  2KLE A;  2L51 A;  3K21 A;  2K7B A;  4FQT A;  3TUY B;  3TUY C;  3D75 A;  3GOF A;  5CSN A;  4OZD A;  1QAT A;  5I94 A;  1GJY A;  3JVT C;  1SBJ A;  4ORC B;  4F7F A;  1K9P A;  3BUW B;  1RJV A;  5DKR A;  1AP4 A;  1K96 A;  1JWD A;  1X02 A;  1J1D A;  1FW4 A;  3CR4 X;  2PVB A;  4CLN A;  1XFZ O;  3TDU A;  2JQ6 A;  2BNX A;  1TNQ A;  1YRU B;  1TCF A;  2M3W A;  1DJI A;  1DC1 A;  4PHJ A;  2JTT A;  2FCE A;  3O2P A;  1NX1 A;  4MSP A;  1S6J A;  1CDP A;  4M2P A;  4ORA B;  4YRU A;  1W7J B;  2ZND A;  2OTG C;  2Y1M A;  1PK0 D;  2OTG B;  3DF0 B;  1CDN A;  1DF0 A;  1GGW A;  2OPO A;  1B8C A;  1F4Q A;  3EKJ A;  2I7A A;  1ZAC A;  1LKJ A;  1NWD A;  2M9G A;  3ICB A;  1CFC A;  1H4B A;  3WHU B;  5FI7 A;  3BQ3 A;  3BUX B;  2K7D A;  2PQL A;  2H61 A;  3BUM B;  4ICB A;  3BXK A;  4GGF C;  5HYD A;  3CZ2 A;  3BYA A;  4KYN A;  1TNP A;  3A4U B;  1ORG A;  1B7T Z;  1FI6 A;  4ETO A;  2Y5I A;  1UHJ A;  4M2O A;  1PVB A;  1RFJ A;  2A4J A;  3CDN A;  3KF9 A;  4NQG A;  1DT7 B;  1CFF A;  1J7R A;  3CS1 A;  1BOC A;  1K90 D;  3B87 A;  3B88 A;  2QEV A;  4WQ2 A;  4CFR A;  2NXQ A;  3HCM A;  5J3X A;  1LVC D;  1OOG A;  1YTZ C;  4M2Q A;  3LK0 A;  3Q8I A;  4GUK A;  3DD4 A;  4GFT A;  3DZT A;  2MJW B;  5DKQ A;  4N1G A;  1YUS A;  2M49 B;  4PE4 A;  1XA5 A;  2LAP A;  3I5I C;  3I5I B;  1UHH A;  1QTX A;  1CM4 A;  2K61 A;  2R2I A;  2Q4U A;  2M1U A;  5CSI A;  1A29 A;  3CZ0 A;  5D69 A;  3DVE A;  4ZCV A;  1TCO B;  1R2U A;  4NDB A;  3SG7 A;  2KGR A;  2LVJ A;  1B8L A;  1MWN A;  2JXC A;  2LLU A;  2KAV A;  2LHL A;  2F8P A;  4MZL A;  2WOR A;  5ER5 A;  1S3P A;  1N0Y A;  3SS3 A;  1L2O C;  3DYE A;  1L2O B;  2LE9 B;  1OZS A;  2I18 A;  1YX7 A;  3B6X A;  2LMV A;  1LXF C;  1PRW A;  2KBM A;  2PMY A;  2G2B A;  2JWW A;  5AAN A;  4PE0 A;  1ALV A;  1Q80 A;  2P6B B;  4GAO A;  1SCM B;  2G9B A;  5GQQ C;  1C7W A;  1WY9 A;  3LCP C;  1YUT A;  2EC6 C;  1ZUZ A;  2EC6 B;  2K2F A;  1B7T Y;  1K9U A;  3D74 A;  3NHT A;  4DS7 A;  1TTX A;  1RK9 A;  1K94 A;  1KQM C;  2JU0 A;  4OCI A;  1D1O A;  4WQ3 A;  1K9K A;  3S0A A;  1E8A A;  1SR6 C;  1EG3 A;  4PE7 A;  2FJU B;  3PAL A;  1KWO B;  1LA0 A;  1QIW A;  1SKT A;  1T14 A;  1ZFS A;  2QDI A;  1NX0 A;  5I8N A;  1CFP A;  3CZ1 A;  3UO9 A;  3FWB A;  2CBL A;  3OB1 B;  1DJY A;  5HLO A;  1IKU A;  4D1E A;  1TNW A;  5D7F A;  3PFV A;  4CID A;  1CM1 A;  2KBI A;  3RLZ A;  1EJ3 A;  2FOT A;  3O4Y A;  3V2L A;  2LM5 A;  1CDL A;  2E30 A;  1LIN A;  2KQ6 A;  3OHM B;  2WC5 A;  2KHN A;  3TDI A;  2RGI A;  1KFX S;  3B86 A;  3ZWH A;  1IQ3 A;  2M97 A;  1EG4 A;  4YGD B;  2NCP A;  1PSR A;  2Y1N A;  3VRP A;  3QRX A;  1WDC C;  3TDZ A;  3EVU A;  5BPJ A;  2JT8 A;  1OE9 B;  3EK4 A;  3PN7 C;  3ZNI A;  1K2H A;  1SPY A;  3CWG A;  4XYN A;  3PM2 A;  5AXI A;  2CXJ A;  1L7Z A;  1DVI A;  3PM8 A;  4YGC B;  1KFU S;  1ZMZ A;  1WLZ A;  4BY4 A;  2BBN A;  2L5Y A;  4MEW A;  4Q04 A;  3S0G A;  1RTP 1;  2CNP A;  4MLW A;  4AQI A;  2AUC A;  1QLK A;  4C0J A;  3GK1 A;  3R1P A;  1S5G Z;  4YI9 A;  2CCM A;  1DGU A;  2LLT A;  3LL8 B;  1S36 A;  1F71 A;  5HKW A;  1TUZ A;  1XK4 C;  2MLF C;  2M1K B;  1OMR A;  2KFH A;  4QJ4 B;  2M7N A;  1MQ1 A;  1OMV A;  1LA3 A;  1YUR A;  1XK4 A;  3UNW A;  1TWO A;  2GV5 A;  3I5F C;  3I5F B;  4OV2 A;  2WCH A;  2F3Y A;  4NDD A;  2WCJ A;  1IWQ A;  3AKA A;  1QX2 A;  3IVT A;  4OKH A;  1F8H A;  4HRH A;  1KQV A;  5ER4 X;  4PT1 A;  1XFW O;  4XJK A;  1OOF A;  2QPT A;  3A8R A;  1K95 A;  1KK8 C;  1KK8 B;  2CTN A;  2I2R E;  4ORB B;  3OBV A;  1DF0 B;  1CMF A;  1BT6 A;  2KAX A;  4QJ3 B;  3RM1 A;  2WND A;  4INX A;  2B1U A;  4NDC A;  2FCD A;  2LV7 A;  2H61 C;  1J55 A;  1B47 A;  1OOH A;  2H2K A;  1TNX A;  3PLF B;  2QEB A;  2LP3 A;  3BFA A;  5B8I B;  1QXP A;  5KU1 A;  4MN0 A;  3SIA A;  1Z4H A;  2JUL A;  3EKH A;  4AQJ A;  4YGB B;  1DJZ A;  3D0Y B;  3NXA A;  1Y6W A;  2OS8 B;  1WRL A;  4PE1 A;  2JPT A;  1B8R A;  1DJX A;  3K1E A;  3OGN A;  3SJS A;  3PAT A;  4A4C A;  1F70 A;  3D0Y A;  3B7A A;  2E6W A;  2LC5 A;  2KYF A;  1XVJ A;  3BOW B;  3TS5 C;  3OX5 A;  3TS5 B;  1AHR A;  2BL0 C;  2BL0 B;  3IF7 A;  4MRY A;  1M45 A;  3OX6 A;  1G8I A;  2HET A;  4L9M A;  2O60 A;  3BOW A;  2WCL A;  1CLL A;  3D78 A;  1SW8 A;  1RRO A;  3BUO B;  4PAL A;  2K2A A;  1C3Z A;  1MHO A;  1QWV A;  1TUJ A;  1Y1A A;  2EGD A;  1BR1 B;  4DUQ A;  1TRF A;  2KPH A;  3NGV A;  2M29 A;  2LHI A;  3SG2 A;  1A4P A;  4IL1 A;  1S5G Y;  1PUL A;  1OMD A;  1DJW A;  1YRT B;  2WCE A;  3LK1 A;  2WCK A;  2JPO A;  5D3O A;  1JF2 A;  2NCO A;  1YUU A;  3SG4 A;  5TNC A;  1YVL A;  3D76 A;  5DKN A;  4U8D A;  2ZN8 A;  3R1V A;  2BBM A;  1F4O A;  1MR8 A;  2CT9 A;  1OZO A;  1P28 A;  1AVS A;  2JNX A;  2WCF A;  2KQY A;  1NCX A;  2JZI A;  2LVV A;  4YI8 A;  3SS5 A;  5HKY A;  5CSJ A;  5JJG A;  2KI6 C;  1NUB A;  3NSL A;  2BCB A;  3CYZ A;  2QAC A;  3M0W A;  3BFH A;  2LUC A;  2F2O A;  2M0R A;  3L47 A;  5CPV A;  2WC6 A;  3CGA A;  2L0P A;  1W9Z A;  1UUR A;  2L98 A;  5F6T A;  1GGZ A;  1AK8 A;  2JRF A;  3VGO A;  3EK7 A;  1SY9 A;  2PAL A;  1OSA A;  3KPX A;  1SCM C;  3LLE A;  1B1G A;  2H8V A;  2SCP A;  3CZT X;  1MXE A;  1EXR A;  1AJ5 A;  1OOJ A;  1A75 B;  1PSB A;  4MZK A;  2D8N A;  2SAS A;  2PYQ A;  5HKZ A;  1J7O A;  1A75 A;  3KEV A;  5EL2 A;  3NSO A;  1MF8 B;  1UHK A;  2QEH A;  3VRR A;  1J7Q A;  2VRG A;  2BE6 A;  3IQQ A;  1KWO C;  2JT3 A;  3S0E A;  1KK7 Z;  2GGZ A;  3C1V A;  3WXA A;  3O4X A;  1JUO A;  4HRE E;  4USL A;  4WRI A;  2K7C A;  1IG5 A;  2MHH A;  1C3Y A;  1EH2 A;  1NX2 A;  1DJH A;  2ZRS A;  4FQO A;  2KYC A;  2LLS A;  2ZFD A;  2KAY A;  3O78 A;  2MBX A;  4JD9 A;  4TNC A;  3SS4 A;  1IRJ A;  5I2O A;  2WCB A;  4P5O E;  4YBH B;  1M31 A;  2AMI A;  1V1F A;  3IQO A;  1BOD A;  3DVJ A;  3R1O A;  4HSZ A;  4MRX A;  2PRU A;  1HT9 A;  1DMO A;  3CLN A;  4N5X A;  4FTG A;  2JOJ A;  4MVF A;  4QJ5 B;  1C7V A;  1GM0 A;  2LMU A;  1QJT A;  1NYA A;  2MA2 A;  1NX3 A;  1S26 D;  4HRG A;  2KLD A;  1DEL A;  5HLV A;  2BKI B;  3NSK A;  4A4B A;  2KI4 C;  1UWO A;  2KI4 B;  4YGA A;  1IH0 A;  3QME A;  1M63 B;  1CKK A;  3SG6 A;  2ZRT A;  1R6P A;  3D10 A;  2P70 A;  4MZJ A;  1YX8 A;  4E68 A;  1DTL A;  2COL B;  1AJ4 A;  2KI6 D;  1A03 A;  1M39 A;  2HQW A;  2L2E A;  1QV0 A;  4PHN A;  5DIC A;  1JBA A;  3DVM A;  1QAS A;  1FBV A;  2M8U A;  3HX4 A;  4DRW A;  2KFF A;  4GPL B;  5AEQ A;  4GGN A;  1XO5 A;  5K89 A;  2K7O A;  3FS7 A;  1C07 A;  1ZOT B;  5AER A;  3WNX B;  4XJK B;  1BMO A;  1SNL A;  4OR9 B;  1VRK A;  1BR4 B;  2ZN9 A;  5FI2 A;  1SSE B;  2K0J A;  3AKB A;  3GK2 A;  1NCY A;  3EK8 A;  3BFB A;  2EHB A;  4I5J A;  4JQ0 D;  1CDM A;  3NHI A;  1KK7 Y;  1V1G A;  2ZNE A;  1UHI A;  1A2X A;  3JVT B;  4BY5 A;  1BG1 A;  2FJY A;  2BCX A;  2KDH A;  1NCZ A;  1SL9 A;  2JC2 A;  3FE9 A;  2L4I A;  2WCM A;  1REC A;  2WC8 A;  1CTR A;  1GQM A;  1SL8 A;  1XFV O;  2ERB A;  2F33 A;  1ODB A;  3L4A A;  3WHT B;  2TN4 A;  4F0Z B;  1EL4 A;  1Y0V H;  2LNK A;  2LVK A;  1Y1U A;  2OS8 C;  1G4Y R;  3I5G C;  3E3R A;  3I5G B;  1DGV A;  2LCP A;  3EVR A;  3MSE B;  5FI6 A;  2K8M B;  1K8U A;  4GNK B;  3VRO A;  2V53 A;  2YGU A;  4P2Y B;  3SG5 A;  1DJG A;  2Q91 A;  1IGV A;  4PDZ A;  1SRA A;  2QEO A;  1PVA A;  1QVI Z;  4OVN F;  1M46 A;  3DF0 A;  2JNF A;  2JTZ A;  1MXL C;  1SYM A;  2GGM A;  2KSP A;  1BU3 A;  1G33 A;  4AOM A;  3PSR A;  1QX5 B;  3F45 A;  4PHK A;  1MUX A;  4YGE B;  2LMT A;  1XFX O;  1NIW A;  3CR5 X;  5JOL A;  4DCK A;  1IJ6 A;  3D73 A;  4I5N B;  1TOP A;  1QS7 A;  4GGF A;  3FIA A;  1WRZ A;  1UP5 A;  2MRD A;  3L4L A;  3NSI A;  2KGB C;  1WLM A;  1SK6 D;  1KFX L;  3I5H C;  2AAO A;  1RWY A;  3I5H B;  3TZ1 A;  1JFK A;  1WRK A;  1FF1 A;  4MBE A;  5FYX A;  2L5X B;  4C0L A;  1IQ5 A;  1CFD A;  2LAN A;  4R1E A;  4C0K A;  3H4S E;  1S6I A;  3D77 A;  1BF5 A;  1IIO A;  1KSO A;  1XFY O;  3BJH A;  3GK4 X;  1KFU L;  3RZS A;  2PAS A;  4JPZ B;  4UPG A;  1FI5 A;  3FE6 A;  3VB1 A;  2KNE A;  4CFQ A;  3DY9 A;  4N1F A;  5I2Q A;  1QIV A;  2KFG A;  1KCY A;  1JFJ A;  1OW4 A;  3O6B A;  2NZ0 A;  3KO0 A;  3N7H A;  3S0B A;  4PHM A;  2GTE A;  2HQ8 A;  1S1E A;  2BCA A;  1K93 D;  4INW A;  4PCW A;  1F54 A;  4JWQ A;  1HQV A;  1YVH A;  1FPW A;  2WOS A;  1J1E A;  2L4H A;  1SCV A;  5AFP A;  2JXL A;  2BEC A;  1BLQ A;  1QVI Y;  1TIZ A;  1QLS A;  1YR5 A;  2PSR A;  3VRQ A;  2Y4Q A;  3OB2 B;  1NSH A;  1XFR A;  1F55 A;  1OQP A;  3BUN B;  1CLM A;  3KHE A;  3S0D A;  4ZCU A;  1CMG A;  1B9A A;  3S0F A;  2M7L A;  1IJ5 A;  3DXL A;  1S6C A;  3EVV A;  1JC2 A;  5HL1 A;  5I2L A;  3OP0 A;  1Y1X A;  4GBA A;  2BKH B;  1ALW A;  2BE4 A;  2JT0 A;  2K60 A;  3FWC A;  3VRN A;  1N65 A;  2NLN A;  2L2C A;  1QX7 A;  1KQM B;  1XFU O;  1QV1 A;  1UHN A;  2F3Z A;  3FE8 A;  5CSF A;  2HF5 A;  1DEK A;  1U5I B; 
#chains in the Genus database with same CATH homology
 1SR6 B;  1N2D A;  2IS9 A;  3CR2 A;  1NPQ A;  5IBW A;  1TN4 A;  5PAL A;  2LUX A;  5KSZ A;  1U5I A;  1JF0 A;  1CNP A;  3AAJ A;  1JSA A;  1PAL A;  1H8B A;  3SIB A;  2HPS A;  1AUI B;  3SG3 A;  2F2P A;  1W7I B;  4CPV A;  2MLE C;  2LVI A;  1XYD A;  1J7P A;  1SL7 A;  3AAK A;  2I94 A;  5KTY A;  1BJF A;  4I5L B;  3JTD C;  2KOT A;  3JTD B;  3DVK A;  1WDC B;  2ZKM X;  1CLB A;  2L50 A;  1SMG A;  2LP2 A;  3PN7 B;  1CB1 A;  4DIR A;  2O5G A;  4I5K A;  1NP8 A;  2DOQ A;  3CTN A;  1KSM A;  2MAZ A;  5G08 A;  1UUS A;  2ISD A;  2L51 A;  3K21 A;  2K7B A;  3TUY B;  3TUY C;  3GOF A;  5CSN A;  1QAT A;  1GJY A;  3JVT C;  1SBJ A;  4ORC B;  1K9P A;  3BUW B;  1RJV A;  5DKR A;  1AP4 A;  1K96 A;  1JWD A;  1X02 A;  1J1D A;  1FW4 A;  3CR4 X;  2PVB A;  4CLN A;  1XFZ O;  3TDU A;  2JQ6 A;  1TNQ A;  1YRU B;  1TCF A;  2M3W A;  1DJI A;  4PHJ A;  2JTT A;  2FCE A;  3O2P A;  1NX1 A;  4MSP A;  1S6J A;  1CDP A;  4M2P A;  4ORA B;  4YRU A;  1W7J B;  2ZND A;  2OTG C;  2Y1M A;  1PK0 D;  2OTG B;  3DF0 B;  1CDN A;  1DF0 A;  1GGW A;  2OPO A;  1B8C A;  1F4Q A;  3EKJ A;  2I7A A;  1ZAC A;  1LKJ A;  1NWD A;  2M9G A;  3ICB A;  1CFC A;  1H4B A;  3WHU B;  3BQ3 A;  3BUX B;  2K7D A;  2H61 A;  3BUM B;  4ICB A;  3BXK A;  4GGF C;  5HYD A;  3BYA A;  1TNP A;  3A4U B;  1B7T Z;  1FI6 A;  4ETO A;  2Y5I A;  1UHJ A;  4M2O A;  1PVB A;  1RFJ A;  2A4J A;  3KF9 A;  4NQG A;  1DT7 B;  1CFF A;  1J7R A;  3CS1 A;  1BOC A;  1K90 D;  4WQ2 A;  4CFR A;  2NXQ A;  3HCM A;  5J3X A;  1LVC D;  1YTZ C;  4M2Q A;  3LK0 A;  4GUK A;  3DD4 A;  4GFT A;  5DKQ A;  2MJW B;  4N1G A;  1YUS A;  2M49 B;  4PE4 A;  1XA5 A;  2LAP A;  3I5I C;  3I5I B;  1UHH A;  1QTX A;  1CM4 A;  2K61 A;  2R2I A;  2Q4U A;  2M1U A;  5CSI A;  1A29 A;  5D69 A;  3DVE A;  4ZCV A;  1TCO B;  1R2U A;  4NDB A;  3SG7 A;  2KGR A;  2LVJ A;  1B8L A;  1MWN A;  2JXC A;  2LLU A;  2KAV A;  2LHL A;  2F8P A;  4MZL A;  2WOR A;  5ER5 A;  1S3P A;  1N0Y A;  1L2O C;  1L2O B;  2LE9 B;  1OZS A;  2I18 A;  1YX7 A;  2LMV A;  1LXF C;  1PRW A;  2KBM A;  2PMY A;  2G2B A;  2JWW A;  5AAN A;  4PE0 A;  1ALV A;  1Q80 A;  2P6B B;  4GAO A;  1SCM B;  2G9B A;  5GQQ C;  1C7W A;  1WY9 A;  3LCP C;  1YUT A;  2EC6 C;  1ZUZ A;  2EC6 B;  2K2F A;  1B7T Y;  1K9U A;  4DS7 A;  1TTX A;  1RK9 A;  1K94 A;  1KQM C;  2JU0 A;  4OCI A;  1D1O A;  4WQ3 A;  1K9K A;  1E8A A;  1SR6 C;  1EG3 A;  4PE7 A;  2FJU B;  3PAL A;  1KWO B;  1LA0 A;  1QIW A;  1SKT A;  1ZFS A;  1CFP A;  5I8N A;  1NX0 A;  3FWB A;  2CBL A;  3OB1 B;  1DJY A;  5HLO A;  1IKU A;  4D1E A;  1TNW A;  5D7F A;  3PFV A;  4CID A;  1CM1 A;  2KBI A;  3RLZ A;  1EJ3 A;  2FOT A;  3O4Y A;  2LM5 A;  1CDL A;  2E30 A;  1LIN A;  2KQ6 A;  3OHM B;  2KHN A;  3TDI A;  2RGI A;  1KFX S;  3ZWH A;  1IQ3 A;  2M97 A;  1EG4 A;  4YGD B;  2NCP A;  1PSR A;  2Y1N A;  3VRP A;  3QRX A;  1WDC C;  3TDZ A;  3EVU A;  5BPJ A;  2JT8 A;  1OE9 B;  3EK4 A;  3PN7 C;  3ZNI A;  1K2H A;  1SPY A;  3CWG A;  4XYN A;  5AXI A;  2CXJ A;  1L7Z A;  1DVI A;  3PM8 A;  4YGC B;  1KFU S;  1ZMZ A;  1WLZ A;  4BY4 A;  2BBN A;  4MEW A;  4Q04 A;  1RTP 1;  2CNP A;  4MLW A;  4AQI A;  2AUC A;  1QLK A;  4C0J A;  3GK1 A;  1S5G Z;  4YI9 A;  2CCM A;  1DGU A;  2LLT A;  3LL8 B;  1S36 A;  1F71 A;  5HKW A;  1XK4 C;  2MLF C;  2M1K B;  1OMR A;  2KFH A;  4QJ4 B;  2M7N A;  1MQ1 A;  1OMV A;  1LA3 A;  1YUR A;  1XK4 A;  2GV5 A;  3I5F C;  3I5F B;  4OV2 A;  2F3Y A;  4NDD A;  1IWQ A;  3AKA A;  1QX2 A;  4OKH A;  1F8H A;  4HRH A;  1KQV A;  5ER4 X;  1XFW O;  4XJK A;  2QPT A;  3A8R A;  1K95 A;  1KK8 C;  1KK8 B;  2CTN A;  2I2R E;  4ORB B;  1DF0 B;  1CMF A;  1BT6 A;  2KAX A;  4QJ3 B;  3RM1 A;  2WND A;  2B1U A;  4NDC A;  2FCD A;  2LV7 A;  2H61 C;  1J55 A;  1B47 A;  2H2K A;  1TNX A;  3PLF B;  2LP3 A;  5B8I B;  1QXP A;  5KU1 A;  4MN0 A;  3SIA A;  2JUL A;  3EKH A;  4AQJ A;  4YGB B;  1DJZ A;  3D0Y B;  3NXA A;  1Y6W A;  2OS8 B;  1WRL A;  4PE1 A;  2JPT A;  1B8R A;  1DJX A;  3SJS A;  4A4C A;  1F70 A;  3PAT A;  3D0Y A;  2E6W A;  2LC5 A;  2KYF A;  1XVJ A;  3BOW B;  3TS5 C;  3OX5 A;  3TS5 B;  2BL0 C;  1AHR A;  2BL0 B;  3IF7 A;  4MRY A;  1M45 A;  3OX6 A;  1G8I A;  2HET A;  4L9M A;  2O60 A;  3BOW A;  1CLL A;  4PAL A;  1SW8 A;  1RRO A;  3BUO B;  2K2A A;  1MHO A;  1Y1A A;  2EGD A;  1BR1 B;  4DUQ A;  1TRF A;  2M29 A;  2LHI A;  3SG2 A;  1A4P A;  4IL1 A;  1S5G Y;  1PUL A;  1OMD A;  1DJW A;  1YRT B;  2WCE A;  3LK1 A;  1JF2 A;  2NCO A;  1YUU A;  3SG4 A;  5TNC A;  1YVL A;  5DKN A;  4U8D A;  2ZN8 A;  2BBM A;  1F4O A;  1MR8 A;  2CT9 A;  1OZO A;  2JNX A;  1AVS A;  2WCF A;  5HKY A;  2KQY A;  1NCX A;  2JZI A;  2LVV A;  4YI8 A;  5CSJ A;  5JJG A;  2KI6 C;  1NUB A;  3NSL A;  2BCB A;  2QAC A;  3M0W A;  2LUC A;  2F2O A;  2M0R A;  5CPV A;  3CGA A;  2L0P A;  1UUR A;  2L98 A;  5F6T A;  1GGZ A;  1AK8 A;  2JRF A;  3VGO A;  3EK7 A;  1SY9 A;  2PAL A;  1OSA A;  3KPX A;  1SCM C;  3LLE A;  1B1G A;  2SCP A;  3CZT X;  1MXE A;  1EXR A;  1AJ5 A;  1OOJ A;  1A75 B;  1PSB A;  4MZK A;  2D8N A;  2SAS A;  5HKZ A;  1J7O A;  1A75 A;  3KEV A;  3NSO A;  1MF8 B;  1UHK A;  3VRR A;  1J7Q A;  2VRG A;  2BE6 A;  3IQQ A;  1KWO C;  2JT3 A;  1KK7 Z;  2GGZ A;  3C1V A;  3WXA A;  1JUO A;  4HRE E;  4USL A;  4WRI A;  2K7C A;  1IG5 A;  2MHH A;  1EH2 A;  1NX2 A;  1DJH A;  2ZRS A;  4FQO A;  2KYC A;  2LLS A;  2ZFD A;  2KAY A;  3O78 A;  2MBX A;  5I2O A;  4TNC A;  1BG1 A;  1IRJ A;  2WCB A;  4P5O E;  4YBH B;  1M31 A;  2AMI A;  1V1F A;  3IQO A;  1BOD A;  3DVJ A;  1DMO A;  4HSZ A;  4MRX A;  2PRU A;  1HT9 A;  3CLN A;  4N5X A;  4FTG A;  2JOJ A;  4MVF A;  4QJ5 B;  1C7V A;  2LMU A;  1QJT A;  1NYA A;  2MA2 A;  1NX3 A;  1S26 D;  4HRG A;  5HLV A;  2BKI B;  3NSK A;  4A4B A;  2KI4 C;  1UWO A;  2KI4 B;  4YGA A;  1IH0 A;  1CKK A;  1M63 B;  3SG6 A;  2ZRT A;  1R6P A;  3D10 A;  4MZJ A;  1YX8 A;  4E68 A;  1DTL A;  2COL B;  1AJ4 A;  2KI6 D;  1A03 A;  1M39 A;  2HQW A;  2L2E A;  1QV0 A;  4PHN A;  1JBA A;  3DVM A;  1QAS A;  1FBV A;  2M8U A;  3HX4 A;  4DRW A;  2KFF A;  4GPL B;  5AEQ A;  4GGN A;  1XO5 A;  5K89 A;  2K7O A;  3FS7 A;  1C07 A;  1ZOT B;  5AER A;  3WNX B;  4XJK B;  1BMO A;  1SNL A;  4OR9 B;  1VRK A;  1BR4 B;  2ZN9 A;  2K0J A;  3AKB A;  3GK2 A;  1NCY A;  3EK8 A;  2EHB A;  4I5J A;  4JQ0 D;  1CDM A;  1KK7 Y;  1V1G A;  2ZNE A;  1UHI A;  1A2X A;  3JVT B;  4BY5 A;  2BCX A;  2KDH A;  1NCZ A;  1SL9 A;  2JC2 A;  2L4I A;  1REC A;  2WC8 A;  1CTR A;  1GQM A;  1SL8 A;  1XFV O;  2F33 A;  1ODB A;  3WHT B;  2TN4 A;  4F0Z B;  1EL4 A;  1Y0V H;  2LNK A;  2LVK A;  1Y1U A;  2OS8 C;  1G4Y R;  3I5G C;  3E3R A;  3I5G B;  1DGV A;  2LCP A;  3EVR A;  3MSE B;  2K8M B;  1K8U A;  4GNK B;  3VRO A;  2V53 A;  4P2Y B;  3SG5 A;  1DJG A;  2Q91 A;  1IGV A;  4PDZ A;  1SRA A;  1PVA A;  1QVI Z;  4OVN F;  1M46 A;  3DF0 A;  2JNF A;  2JTZ A;  1MXL C;  1SYM A;  2GGM A;  2KSP A;  1BU3 A;  1G33 A;  4AOM A;  3PSR A;  1QX5 B;  3F45 A;  4PHK A;  1MUX A;  4YGE B;  2LMT A;  1XFX O;  1NIW A;  3CR5 X;  5JOL A;  4DCK A;  1IJ6 A;  4I5N B;  1TOP A;  1QS7 A;  4GGF A;  3FIA A;  1WRZ A;  1UP5 A;  2MRD A;  3NSI A;  2KGB C;  1WLM A;  1SK6 D;  1KFX L;  3I5H C;  2AAO A;  1RWY A;  3I5H B;  3TZ1 A;  1JFK A;  1WRK A;  1FF1 A;  4MBE A;  5FYX A;  2L5X B;  4C0L A;  1IQ5 A;  1CFD A;  2LAN A;  4R1E A;  4C0K A;  3H4S E;  1S6I A;  1BF5 A;  1KSO A;  1XFY O;  3GK4 X;  1KFU L;  2PAS A;  4JPZ B;  4UPG A;  1FI5 A;  2KNE A;  4CFQ A;  4N1F A;  5I2Q A;  1QIV A;  2KFG A;  1KCY A;  1JFJ A;  3O6B A;  2NZ0 A;  3KO0 A;  4PHM A;  2HQ8 A;  1S1E A;  2BCA A;  1K93 D;  4PCW A;  1F54 A;  4JWQ A;  1HQV A;  1YVH A;  1FPW A;  2WOS A;  1J1E A;  2L4H A;  1SCV A;  5AFP A;  2JXL A;  2BEC A;  1BLQ A;  1QVI Y;  1TIZ A;  1QLS A;  1YR5 A;  2PSR A;  3VRQ A;  2Y4Q A;  3OB2 B;  1NSH A;  1F55 A;  1OQP A;  3BUN B;  1CLM A;  3KHE A;  1CMG A;  4ZCU A;  1B9A A;  2M7L A;  1IJ5 A;  1S6C A;  3EVV A;  1JC2 A;  5I2L A;  3OP0 A;  1Y1X A;  4GBA A;  2BKH B;  1ALW A;  2BE4 A;  2JT0 A;  3VRN A;  3FWC A;  1N65 A;  2NLN A;  1QX7 A;  1KQM B;  1XFU O;  1QV1 A;  1UHN A;  2F3Z A;  5CSF A;  2HF5 A;  1B4C A;  1U5I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...