5CSJA

S100b-rsk1 crystal structure b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
GSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 31
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5csjA00
1R6PA 1S5GZ 1YRTB 4PHMA 1B8CA 5AERA 1UWOA 5AFPA 3IQOA 2BE4A 2ZNDA 1KQMC 1ODBA 1PVAA 2H61C 2KOTA 2WOSA 3WNXB 4JWQA 1NCXA 2LNKA 4GFTA 1KK7Y 2Y5IA 1ZMZA 1LA3A 2E30A 3JVTB 2KGRA 4FTGA 2NCOA 4PE4A 3SIBA 4PALA 2F2PA 2KDHA 4PHNA 2JTTA 2KYCA 3AKAA 4PHJA 1B4CA 1CMFA 1G4YR 2CTNA 2D8NA 4N1GA 2LLSA 3TUYC 1A75B 2L4HA 1OMDA 1QXPA 1KFXL 4MVFA 1JF2A 1JFKA 2JULA 1SCMC 2WCEA 4AOMA 2FCDA 5K89A 3OX6A 4I5LB 3VRQA 1K90D 1KK8C 3WHUB 2K0JA 2M29A 2OPOA 2H2KA 2I2RE 5D69A 1U5IA 1QV0A 4I5NB 2KNEA 2COLB 2JT8A 1SR6B 5DKNA 1S5GY 4P5OE 1C7WA 2BL0C 3TS5C 1DJGA 1MWNA 5IBWA 2MA2A 3D0YB 1N65A 3BUOB 2EC6C 1TRFA 4I5JA 5HKWA 2JT0A 1K8UA 1DGVA 1BODA 1N0YA 1EG4A 2M9GA 3FIAA 5JOLA 1W7IB 3OB1B 2LMUA 4OCIA 1ALVA 1WRZA 2HPSA 1CLBA 1UURA 3PM8A 1S6IA 1DJXA 2KAYA 1JSAA 1MXEA 1QVIZ 3EKHA 3OB2B 1AK8A 4MLWA 3A8RA 2CNPA 3NSKA 3VRPA 1IRJA 1WRKA 4GGNA 4Q04A 3TDZA 3H4SE 3O78A 1CMGA 1J55A 2VRGA 2EGDA 1IQ3A 3BXKA 1TNXA 3SG5A 3M0WA 3OP0A 1FI5A 4PE1A 2LM5A 3JVTC 4YGCB 1NX3A 1EG3A 2L4IA 4OV2A 1CLMA 2LVKA 2Y1MA 2L2EA 3BUWB 4CFRA 1AP4A 1YUSA 1YVLA 2M97A 1SL9A 2DOQA 1CB1A 2LVVA 2OS8B 1MXLC 1KFXS 1CTRA 4AQJA 1SBJA 5AXIA 2JU0A 2KQ6A 4DS7A 1EL4A 1J7PA 2JC2A 2F8PA 2LP3A 1GQMA 3EK8A 1GJYA 1BR4B 1QTXA 1BMOA 5AEQA 3I5HB 1H8BA 1IG5A 1W7JB 2BCXA 4DIRA 4JPZB 1SR6C 4NDBA 4ORCB 3ZNIA 2M0RA 5I2QA 2WCBA 4DCKA 1XFVO 4MZJA 4MSPA 1QX2A 2RGIA 2KBIA 3SJSA 4A4BA 3GK2A 1YX8A 1WDCB 1B9AA 2MBXA 1B47A 1NCYA 2LUXA 3SG7A 2KFHA 2PSRA 2SASA 3I5GB 4BY4A 1DVIA 3C1VA 1AHRA 1J7RA 4GAOA 5BPJA 1EXRA 3EKJA 4GGFA 1YR5A 5HLOA 2JTZA 1CM1A 3BQ3A 3FWCA 1AJ5A 1PULA 2LVIA 1QLSA 1YUTA 2K2AA 1Y1UA 1F4OA 4ORBB 2AMIA 1Y1XA 2E6WA 1DF0A 1S6CA 2MJWB 1NYAA 2M49B 3D10A 5HLVA 2L0PA 2M7NA 1LA0A 3PSRA 1S1EA 5HKYA 5F6TA 5DKQA 2ZKMX 2CT9A 1FI6A 3BYAA 1B7TZ 1UUSA 2LP2A 2HQWA 4USLA 1PSRA 3AAJA 4P2YB 1TCOB 3BOWB 1NWDA 2OS8C 1IWQA 2O60A 2BKHB 2OTGB 1M45A 1CM4A 2JPTA 1F8HA 1TCFA 1NX0A 2KFGA 3I5HC 2K7OA 4PCWA 2LCPA 5J3XA 3LK0A 2F3ZA 4MRYA 1OMRA 5CSFA 1VRKA 4ZCUA 3PALA 1J1DA 1TNQA 3DVMA 1NIWA 5FYXA 4A4CA 1WDCC 2BBMA 4ETOA 2EHBA 2PVBA 4MBEA 1CDMA 3I5GC 1KQVA 5KSZA 2JNXA 1HQVA 2H61A 1HT9A 3CZTX 1RTP1 1D1OA 3DVEA 3LCPC 1M31A 1CDPA 3PLFB 2R2IA 1K9PA 1EJ3A 2ZN8A 3DVKA 1JC2A 3NSLA 3ICBA 1CDLA 3HCMA 4MEWA 4ORAB 4YRUA 2CCMA 1XFYO 1YX7A 1NX2A 1OSAA 2HETA 1TNPA 1BR1B 1UP5A 4HREE 3SG3A 2JT3A 2TN4A 2KBMA 2L5XB 1F4QA 4N5XA 4XJKA 2BKIB 1F55A 2LLUA 2IS9A 2ZNEA 1ZACA 1XFZO 1QIVA 2WORA 3FS7A 5CPVA 1FBVA 4HRHA 1BOCA 5I2LA 2PMYA 1OZOA 2JXCA 1JF0A 1JBAA 1WY9A 2PALA 3WHTB 1PSBA 1K9KA 2QACA 1OOJA 1IH0A 1MR8A 1ZFSA 1QX5B 1QV1A 2OTGC 3PATA 3LLEA 4F0ZB 1LXFC 2LC5A 3TDUA 1PVBA 4ICBA 1NUBA 3VRRA 4YGDB 4GBAA 3SIAA 3I5FB 4CPVA 1M39A 1NSHA 2JXLA 4IL1A 4MZLA 4WQ3A 2K2FA 1A4PA 5CSJA 1TOPA 3VRNA 2KFFA 4OKHA 1YTZC 2KQYA 2WC8A 2FCEA 3HX4A 3EK4A 1SY9A 3TDIA 4YI9A 1QLKA 1K95A 1V1GA 2GGZA 2JZIA 3GOFA 1NX1A 1C07A 4NDDA 1TTXA 2QPTA 1QASA 3RLZA 4CIDA 3WXAA 2F3YA 1DJIA 2WCFA 4GNKB 2LANA 1SKTA 1SRAA 4N1FA 1H4BA 4C0KA 2O5GA 1UHNA 1Q80A 1TNWA 2V53A 3RM1A 1QVIY 2NLNA 2NXQA 4GUKA 2K7CA 1DGUA 4YGAA 1XA5A 2HF5A 1S36A 2BE6A 4WQ2A 1KFUL 2AUCA 2GV5A 1XK4C 1X02A 2LLTA 2PASA 1F70A 3PFVA 3O6BA 2KAXA 1ZUZA 2MRDA 1BJFA 2Y4QA 1ZOTB 1SL8A 2LHLA 1G33A 2ISDA 2ZN9A 3KF9A 2FJUB 3PN7B 2G2BA 4NQGA 4YBHB 3LL8B 1L2OB 3I5FC 4HRGA 1LKJA 1U5IB 1QJTA 1OE9B 4TNCA 1DT7B 1S26D 4YI8A 5CSIA 1RROA 3EVVA 1R2UA 3EVRA 4MZKA 4UPGA 5ER5A 2NZ0A 2CBLA 3BUNB 4XJKB 5B8IB 1S3PA 1SW8A 2Q4UA 2I18A 3AKBA 1F54A 4CLNA 1M63B 2KI6D 4DUQA 1KWOB 3CR4X 3KEVA 4BY5A 3O2PA 1A03A 3K21A 1KSOA 1UHKA 3CTNA 1DJZA 1TIZA 3AAKA 3TZ1A 1WRLA 2JOJA 5GQQC 2M1UA 2WNDA 1JUOA 1IKUA 4NDCA 2MAZA 2ZRSA 2LHIA 4M2OA 1KFUS 5AANA 2M7LA 1SK6D 2ZFDA 3BUMB 1RWYA 1PRWA 1PALA 1YUUA 2B1UA 3DVJA 3DF0A 1NP8A 1NCZA 3MSEB 3OX5A 4HSZA 1B7TY 4XYNA 2Q91A 3LK1A 1K9UA 1SCVA 3IQQA 2CXJA 1EH2A 3PN7C 4GPLB 1WLMA 1L2OC 1SYMA 1L7ZA 2PRUA 2BBNA 1WLZA 3NXAA 1DJYA 1YRUB 4JQ0D 1AVSA 2K7BA 1GGWA 1K2HA 1S6JA 4MN0A 2L50A 2LVJA 2MLEC 4QJ3B 1CLLA 2I7AA 4OR9B 3FWBA 1JWDA 2KAVA 1QS7A 2LMTA 5HYDA 1BG1A 3I5IB 1RJVA 2I94A 1CNPA 1OQPA 1YURA 1XFWO 1KWOC 1OMVA 3CGAA 3JTDB 3ZWHA 1RECA 2MLFC 1XYDA 5JJGA 5I8NA 4C0LA 1K94A 1DTLA 1OZSA 4U8DA 4CFQA 1QATA 2KHNA 1QX7A 5TNCA 2KI4B 2F33A 1YVHA 1K96A 3BOWA 3CR2A 2KI6C 2M8UA 3KPXA 4M2PA 4PDZA 4AQIA 1DF0B 3OHMB 1FPWA 3BUXB 3GK4X 3SG4A 1J1EA 3KHEA 3O4YA 2K7DA 2BCBA 1IGVA 1SNLA 3GK1A 1IJ6A 2L98A 2KSPA 1SL7A 5DKRA 4OVNF 1FF1A 1A29A 5CSNA 4WRIA 2LV7A 1LINA 1ALWA 2K61A 2KYFA 1XFUO 1B1GA 1FW4A 4PE7A 4QJ4B 2FOTA 1UHJA 1A75A 1MUXA 1F71A 1B8RA 3NSIA 5I2OA 2LUCA 2JWWA 2MHHA 4L9MA 1BU3A 4QJ5B 1E8AA 1CKKA 5PALA 3F45A 1B8LA 1IQ5A 2LAPA 4R1EA 2M1KB 4YGEB 5HKZA 2JNFA 1CFCA 3EVUA 3I5IC 3NSOA 4DRWA 1MQ1A 1CFDA 2BECA 5G08A 1PK0D 3KO0A 1BLQA 3D0YA 1A2XA 3SG2A 2K8MB 1DMOA 1XFXO 2JQ6A 2M3WA 4FQOA 4MRXA 5KU1A 1KQMB 2L51A 3JTDC 1JFJA 3DF0B 4GGFC 4PE0A 2LE9B 1XK4A 1AJ4A 2AAOA 1J7OA 1UHHA 2NCPA 1KCYA 1CFPA 3EK7A 1MF8B 2KI4C 1KSMA 2ZRTA 2A4JA 1DJWA 1C7VA 1Y1AA 2F2OA 1MHOA 1UHIA 3TUYB 3VROA 2GGMA 4PHKA 3QRXA 1SCMB 3IF7A 3CLNA 4YGBB 5D7FA 2KGBC 3CR5X 1IJ5A 2G9BA 1GGZA 1KK8B 1DJHA 1LVCD 1KK7Z 4I5KA 1J7QA 1V1FA 1Y0VH 1G8IA 2JRFA 3VGOA 1M46A 2Y1NA 1BF5A 1AUIB 3CS1A 1BT6A 1RFJA 2P6BB 2SCPA 3CWGA 4M2QA 4E68A 2BL0B 3TS5B 1SPYA 2BCAA 5ER4X 1QIWA 3A4UB 1CFFA 2EC6B 4D1EA 1TN4A 3E3RA 1K93D 1NPQA 5KTYA 1Y6WA 4ZCVA 1CDNA 1RK9A 1XO5A 2HQ8A 4C0JA 1XVJA 1SMGA 1N2DA 2LMVA 3DD4A 3SG6A
chains in the Genus database with same CATH superfamily
1R6PA 1S5GZ 1YRTB 4PHMA 2WCJA 1B8CA 5AERA 1UWOA 5AFPA 3IQOA 2BE4A 2ZNDA 1KQMC 1ODBA 1PVAA 2H61C 2KOTA 2WOSA 3WNXB 3SS3A 4JWQA 1NCXA 2LNKA 4GFTA 1KK7Y 2Y5IA 1ZMZA 1LA3A 2E30A 3JVTB 2KGRA 4FTGA 2NCOA 4PE4A 3SIBA 4PALA 2F2PA 2KDHA 2P71A 4PHNA 2JTTA 2KYCA 3AKAA 4PHJA 3S0FA 1B4CA 1CMFA 3OGNA 2GTEA 2KLEA 1G4YR 2CTNA 2D8NA 4N1GA 2LLSA 3TUYC 1A75B 2L4HA 1DQEA 1OMDA 1QXPA 3B7AA 1KFXL 4MVFA 1JF2A 1JFKA 2JULA 1SCMC 2WCEA 4AOMA 2FCDA 5K89A 3V2LA 3OX6A 2BNXA 4I5LB 3VRQA 1K90D 1KK8C 3WHUB 2K0JA 2M29A 2OPOA 2H2KA 2I2RE 5D69A 1U5IA 1QV0A 4I5NB 2KNEA 2COLB 2JT8A 1SR6B 5DKNA 1S5GY 4P5OE 1C7WA 2BL0C 3OBVA 1DJGA 1MWNA 3TS5C 5IBWA 2MA2A 3D0YB 1N65A 3BUOB 2EC6C 1TRFA 4I5JA 5HKWA 2JT0A 1K8UA 1DGVA 1BODA 1N0YA 1EG4A 2M9GA 3FIAA 2KPHA 5JOLA 1W7IB 3NHTA 3OB1B 2LMUA 4OCIA 1ALVA 1WRZA 2HPSA 1CLBA 1UURA 3PM8A 1S6IA 1DJXA 2KAYA 3RZSA 1JSAA 1MXEA 1QVIZ 3EKHA 3OB2B 1AK8A 4MLWA 2QEOA 3A8RA 2CNPA 3NSKA 3VRPA 1IRJA 1WRKA 4GGNA 4Q04A 3TDZA 3H4SE 3O78A 1CMGA 1ORGA 1J55A 2VRGA 2EGDA 1IQ3A 3BXKA 1TNXA 3SG5A 3M0WA 3OP0A 1FI5A 4PE1A 2LM5A 3JVTC 4YGCB 1NX3A 1EG3A 2L4IA 4OV2A 1CLMA 2LVKA 2Y1MA 2L2EA 3BUWB 3N7HA 4CFRA 1AP4A 1YUSA 1YVLA 2M97A 1SL9A 2DOQA 1CB1A 3S0BA 2LVVA 2OS8B 1MXLC 3DXLA 1KFXS 1CTRA 4AQJA 1SBJA 5AXIA 2JU0A 2KQ6A 4DS7A 1EL4A 1J7PA 2JC2A 2F8PA 2LP3A 1GQMA 3EK8A 1GJYA 1BR4B 1QTXA 1BMOA 3L4LA 5AEQA 3I5HB 2WCHA 1H8BA 3B88A 1IG5A 2QDIA 1W7JB 2BCXA 4DIRA 4JPZB 1SR6C 4NDBA 4ORCB 3ZNIA 2M0RA 5I2QA 2WCBA 4DCKA 1XFVO 3D77A 4MZJA 4MSPA 1QX2A 2RGIA 2KBIA 4PT1A 3SJSA 4A4BA 3GK2A 1YX8A 3O4XA 1WDCB 1B9AA 2MBXA 1B47A 3B6XA 1NCYA 2LUXA 3SG7A 2KFHA 2PSRA 2SASA 3I5GB 4BY4A 1DVIA 3C1VA 1AHRA 1J7RA 4GAOA 5BPJA 1EXRA 3EKJA 4GGFA 1YR5A 3CZ2A 2JTZA 5HLOA 1CM1A 3BQ3A 3FWCA 1AJ5A 1PULA 2LVIA 1QLSA 1YUTA 2K2AA 3K1EA 1Y1UA 1F4OA 4ORBB 2AMIA 1Y1XA 2E6WA 2PYQA 1DF0A 1S6CA 2MJWB 5FI2A 1NYAA 2M49B 3D10A 5HLVA 2L0PA 2M7NA 1LA0A 3PSRA 1S1EA 5HKYA 5F6TA 5DKQA 3QMEA 4INWA 2ZKMX 3FE8A 2CT9A 1FI6A 3BYAA 1B7TZ 1UUSA 2LP2A 2HQWA 4USLA 1PSRA 1IH0A 3AAJA 4P2YB 1TCOB 4F7FA 3BOWB 1NWDA 2OS8C 1IWQA 2O60A 2BKHB 2OTGB 3EG5B 1M45A 1CM4A 2JPTA 1F8HA 1TCFA 1NX0A 2KFGA 3I5HC 2K7OA 4PCWA 2LCPA 5J3XA 3LK0A 2F3ZA 3PM2A 4MRYA 1OMRA 3NGVA 1VRKA 5CSFA 3D73A 1J1DA 3PALA 4ZCUA 1TNQA 3DVMA 1NIWA 5FYXA 4A4CA 1WDCC 2BBMA 4ETOA 2EHBA 2WC6A 1GM0A 2PVBA 4MBEA 1CDMA 3I5GC 1KQVA 5KSZA 2JNXA 1HQVA 2H61A 3S0EA 1HT9A 3CZTX 1RTP1 1D1OA 3DVEA 3S0DA 3LCPC 1M31A 1CDPA 3PLFB 2R2IA 1K9PA 1EJ3A 2ZN8A 3DVKA 1JC2A 3NSLA 3ICBA 1CDLA 3HCMA 4MEWA 4IJ7A 4ORAB 2CCMA 4YRUA 1XFYO 1YX7A 1NX2A 1OSAA 2HETA 3D74A 1OW4A 1BR1B 1TNPA 1UP5A 4HREE 3SG3A 2JT3A 2TN4A 3PJIA 2KBMA 4FQTA 2L5XB 2K60A 1F4QA 4N5XA 4XJKA 2BKIB 1F55A 2LLUA 2IS9A 2ZNEA 1ZACA 1XFZO 1QIVA 2WORA 3FS7A 5CPVA 1FBVA 4HRHA 1BOCA 5I2LA 2PMYA 1OZOA 2JXCA 1JF0A 1JBAA 2QEHA 1WY9A 2PALA 5FI6A 3WHTB 2QEVA 1PSBA 1K9KA 2QACA 1OOJA 3CZ1A 1MR8A 1ZFSA 1QX5B 1QV1A 2OTGC 3PATA 3BJHA 3LLEA 4F0ZB 1LXFC 1TUZA 2LC5A 3TDUA 1PVBA 4ICBA 1NUBA 3VRRA 4YGDB 4GBAA 3SIAA 3I5FB 4CPVA 1M39A 1NSHA 2ERBA 2JXLA 1W9ZA 4IL1A 2K2FA 1A4PA 4MZLA 1TOPA 4WQ3A 2KFFA 4OKHA 5CSJA 3VRNA 1YTZC 2KQYA 2WC8A 2FCEA 3HX4A 3EK4A 1SY9A 3TDIA 4YI9A 3DY9A 1QLKA 1K95A 1V1GA 2GGZA 2JZIA 3GOFA 1NX1A 1C07A 4NDDA 1TTXA 2QPTA 1OOFA 1QASA 1QWVA 3RLZA 4CIDA 3WXAA 3UNWA 2F3YA 1DJIA 1SSEB 1DC1A 2WCFA 4GNKB 2LANA 1SKTA 1SRAA 4INXA 4N1FA 2WC5A 1H4BA 4C0KA 2O5GA 1UHNA 1Z4HA 1Q80A 1TNWA 2V53A 3RM1A 1QVIY 2NLNA 2NXQA 4GUKA 2K7CA 1DGUA 4YGAA 1LS8A 1OOIX 1XA5A 2HF5A 1IIOA 3UO9A 1S36A 2BE6A 4WQ2A 1KFUL 2AUCA 2GV5A 4JKTA 1XK4C 1X02A 2LLTA 2PASA 5DICA 3PFVA 3S0AA 1F70A 3O6BA 1DEKA 2KAXA 1ZUZA 2MRDA 1BJFA 2Y4QA 1ZOTB 1SL8A 2LHLA 1G33A 2ISDA 2ZN9A 3KF9A 2FJUB 3PN7B 2G2BA 4NQGA 4YBHB 3LL8B 1L2OB 2PQLA 3I5FC 4HRGA 1LKJA 4JD9A 2YGUA 1U5IB 1QJTA 1OE9B 1OOHA 4TNCA 1DT7B 1S26D 2WCMA 4YI8A 5CSIA 1RROA 3EVVA 1R2UA 3EVRA 4MZKA 4UPGA 5ER5A 2NZ0A 2CBLA 3BUNB 4XJKB 5B8IB 1S3PA 1SW8A 2Q4UA 2I18A 3AKBA 1F54A 3S0GA 4CLNA 1M63B 2KI6D 4DUQA 1KWOB 3CR4X 3KEVA 4BY5A 3O2PA 1A03A 3K21A 1KSOA 1UHKA 3CTNA 1DJZA 3R72A 1TIZA 3AAKA 3TZ1A 1WRLA 2JOJA 3BFAA 5GQQC 2BAPA 2M1UA 3DZTA 2WNDA 3B86A 1JUOA 1IKUA 4NDCA 2MAZA 2ZRSA 2LHIA 5FI7A 4M2OA 1KFUS 5AANA 2M7LA 1SK6D 2ZFDA 3BUMB 1RWYA 1PRWA 1PALA 1YUUA 2B1UA 3DVJA 3DF0A 1NP8A 1NCZA 3MSEB 3OX5A 4HSZA 1B7TY 4XYNA 2Q91A 3LK1A 1C3ZA 1K9UA 1SCVA 3IQQA 2CXJA 3SS4A 3PN7C 4GPLB 1EH2A 1WLMA 1L2OC 1P28A 1SYMA 4KYNA 1L7ZA 2PRUA 2BBNA 1WLZA 3NXAA 1DJYA 1YRUB 4JQ0D 1AVSA 2K7BA 1GGWA 1K2HA 1S6JA 4MN0A 2L50A 2LVJA 2MLEC 4QJ3B 1CLLA 1DELA 3SS5A 2I7AA 4OR9B 3FWBA 2WCLA 3D78A 1JWDA 2KAVA 1QS7A 2LMTA 5HYDA 1BG1A 3I5IB 1RJVA 4OZDA 2I94A 1CNPA 1OQPA 1YURA 1XFWO 3L47A 3FE6A 1KWOC 1OMVA 3CGAA 3JTDB 3CZ0A 3ZWHA 1RECA 2MLFC 1XYDA 3CDNA 5JJGA 1T14A 5I8NA 4C0LA 1K94A 1DTLA 3BFBA 1OZSA 4U8DA 4CFQA 1QATA 2KHNA 1QX7A 3B87A 2KI4B 5TNCA 2F33A 1YVHA 1K96A 2H8VA 3BOWA 2KI6C 2M8UA 3CR2A 3KPXA 4M2PA 3R1OA 4PDZA 1DF0B 3OHMB 4AQIA 3BUXB 3GK4X 1FPWA 3SG4A 5I94A 1J1EA 3KHEA 3D76A 3IVTA 3O4YA 2L2CA 3R1PA 2K7DA 2BCBA 1IGVA 1SNLA 3GK1A 1IJ6A 2L98A 2KSPA 1SL7A 5DKRA 3D75A 4OVNF 1A29A 5CSNA 1FF1A 4WRIA 2LV7A 3DYEA 1LINA 1ALWA 2K61A 2KYFA 1XFUO 1B1GA 1FW4A 4PE7A 3R1VA 4QJ4B 2FOTA 1TUJA 1UHJA 1A75A 1MUXA 1F71A 1B8RA 3NSIA 5I2OA 2LUCA 2JWWA 2MHHA 2WCKA 1XFRA 1BU3A 4L9MA 4QJ5B 1E8AA 1CKKA 2JPOA 2QEBA 5PALA 3F45A 1B8LA 3VB1A 1IQ5A 2LAPA 4R1EA 3CABA 2M1KB 4YGEB 5HKZA 2JNFA 1CFCA 3EVUA 3I5IC 3NSOA 4DRWA 1MQ1A 1CFDA 2BECA 5G08A 1PK0D 3KO0A 1BLQA 3D0YA 1A2XA 3SG2A 2K8MB 3CYZA 1DMOA 1XFXO 2JQ6A 2M3WA 4FQOA 4MRXA 5KU1A 1KQMB 1OOGA 2L51A 3JTDC 1JFJA 3DF0B 4GGFC 3NHIA 1TWOA 4PE0A 2LE9B 1XK4A 1AJ4A 2AAOA 1J7OA 1UHHA 2NCPA 1KCYA 1CFPA 3EK7A 1MF8B 2KI4C 1KSMA 2ZRTA 2A4JA 1DJWA 1C7VA 1Y1AA 2F2OA 1MHOA 1UHIA 3TUYB 3VROA 2GGMA 4PHKA 3QRXA 1SCMB 3IF7A 3CLNA 4YGBB 2P70A 5D7FA 2KGBC 3CR5X 1IJ5A 2G9BA 3BFHA 1GGZA 1KK8B 1DJHA 1LVCD 1KK7Z 3L4AA 4I5KA 1J7QA 1V1FA 5EL2A 1Y0VH 1G8IA 2JRFA 3VGOA 1M46A 5HL1A 2FJYA 2Y1NA 1BF5A 3Q8IA 1AUIB 3CS1A 1BT6A 1RFJA 2P6BB 2SCPA 3CWGA 4M2QA 4E68A 2BL0B 3TS5B 1SPYA 2KLDA 3FE9A 2BCAA 5D3OA 5ER4X 1Z2CB 1QIWA 3A4UB 1CFFA 2EC6B 1C3YA 4D1EA 1TN4A 3E3RA 1K93D 2L5YA 1NPQA 5KTYA 1Y6WA 4ZCVA 1CDNA 1RK9A 1XO5A 2HQ8A 4C0JA 1XVJA 1SMGA 1N2DA 2LMVA 3DD4A 3SG6A
chains in the Genus database with same CATH topology
1R6PA 1S5GZ 1YRTB 4PHMA 1B8CA 5AERA 1UWOA 5AFPA 3IQOA 2BE4A 2ZNDA 1KQMC 1ODBA 1PVAA 2H61C 2KOTA 2WOSA 3WNXB 4JWQA 1NCXA 2LNKA 4GFTA 1KK7Y 2Y5IA 1ZMZA 1LA3A 2E30A 3JVTB 2KGRA 4FTGA 2NCOA 4PE4A 3SIBA 4PALA 2F2PA 2KDHA 4PHNA 2JTTA 2KYCA 3AKAA 4PHJA 1B4CA 1CMFA 1G4YR 2CTNA 2D8NA 4N1GA 2LLSA 3TUYC 1A75B 2L4HA 1OMDA 1QXPA 1KFXL 4MVFA 1JF2A 1JFKA 2JULA 1SCMC 2WCEA 4AOMA 2FCDA 5K89A 3OX6A 4I5LB 3VRQA 1K90D 1KK8C 3WHUB 2K0JA 2M29A 2OPOA 2H2KA 2I2RE 5D69A 1U5IA 1QV0A 4I5NB 2KNEA 2COLB 2JT8A 1SR6B 5DKNA 1S5GY 4P5OE 1C7WA 2BL0C 3TS5C 1DJGA 1MWNA 5IBWA 2MA2A 3D0YB 1N65A 3BUOB 2EC6C 1TRFA 4I5JA 5HKWA 2JT0A 1K8UA 1DGVA 1BODA 1N0YA 1EG4A 2M9GA 3FIAA 5JOLA 1W7IB 3OB1B 2LMUA 4OCIA 1ALVA 1WRZA 2HPSA 1CLBA 1UURA 3PM8A 1S6IA 1DJXA 2KAYA 1JSAA 1MXEA 1QVIZ 3EKHA 3OB2B 1AK8A 4MLWA 3A8RA 2CNPA 3NSKA 3VRPA 1IRJA 1WRKA 4GGNA 4Q04A 3TDZA 3H4SE 3O78A 1CMGA 1J55A 2VRGA 2EGDA 1IQ3A 3BXKA 1TNXA 3SG5A 3M0WA 3OP0A 1FI5A 4PE1A 2LM5A 3JVTC 4YGCB 1NX3A 1EG3A 2L4IA 4OV2A 1CLMA 2LVKA 2Y1MA 2L2EA 3BUWB 4CFRA 1AP4A 1YUSA 1YVLA 2M97A 1SL9A 2DOQA 1CB1A 2LVVA 2OS8B 1MXLC 1KFXS 1CTRA 4AQJA 1SBJA 5AXIA 2JU0A 2KQ6A 4DS7A 1EL4A 1J7PA 2JC2A 2F8PA 2LP3A 1GQMA 3EK8A 1GJYA 1BR4B 1QTXA 1BMOA 5AEQA 3I5HB 1H8BA 1IG5A 1W7JB 2BCXA 4DIRA 4JPZB 1SR6C 4NDBA 4ORCB 3ZNIA 2M0RA 5I2QA 2WCBA 4DCKA 1XFVO 4MZJA 4MSPA 1QX2A 2RGIA 2KBIA 3SJSA 4A4BA 3GK2A 1YX8A 1WDCB 1B9AA 2MBXA 1B47A 1NCYA 2LUXA 3SG7A 2KFHA 2PSRA 2SASA 3I5GB 4BY4A 1DVIA 3C1VA 1AHRA 1J7RA 4GAOA 5BPJA 1EXRA 3EKJA 4GGFA 1YR5A 5HLOA 2JTZA 1CM1A 3BQ3A 3FWCA 1AJ5A 1PULA 2LVIA 1QLSA 1YUTA 2K2AA 1Y1UA 1F4OA 4ORBB 2AMIA 1Y1XA 2E6WA 1DF0A 1S6CA 2MJWB 1NYAA 2M49B 3D10A 5HLVA 2L0PA 2M7NA 1LA0A 3PSRA 1S1EA 5HKYA 5F6TA 5DKQA 2ZKMX 2CT9A 1FI6A 3BYAA 1B7TZ 1UUSA 2LP2A 2HQWA 4USLA 1PSRA 3AAJA 4P2YB 1TCOB 3BOWB 1NWDA 2OS8C 1IWQA 2O60A 2BKHB 2OTGB 1M45A 1CM4A 2JPTA 1F8HA 1TCFA 1NX0A 2KFGA 3I5HC 2K7OA 4PCWA 2LCPA 5J3XA 3LK0A 2F3ZA 4MRYA 1OMRA 5CSFA 1VRKA 4ZCUA 3PALA 1J1DA 1TNQA 3DVMA 1NIWA 5FYXA 4A4CA 1WDCC 2BBMA 4ETOA 2EHBA 2PVBA 4MBEA 1CDMA 3I5GC 1KQVA 5KSZA 2JNXA 1HQVA 2H61A 1HT9A 3CZTX 1RTP1 1D1OA 3DVEA 3LCPC 1M31A 1CDPA 3PLFB 2R2IA 1K9PA 1EJ3A 2ZN8A 3DVKA 1JC2A 3NSLA 3ICBA 1CDLA 3HCMA 4MEWA 4ORAB 4YRUA 2CCMA 1XFYO 1YX7A 1NX2A 1OSAA 2HETA 1TNPA 1BR1B 1UP5A 4HREE 3SG3A 2JT3A 2TN4A 2KBMA 2L5XB 1F4QA 4N5XA 4XJKA 2BKIB 1F55A 2LLUA 2IS9A 2ZNEA 1ZACA 1XFZO 1QIVA 2WORA 3FS7A 5CPVA 1FBVA 4HRHA 1BOCA 5I2LA 2PMYA 1OZOA 2JXCA 1JF0A 1JBAA 1WY9A 2PALA 3WHTB 1PSBA 1K9KA 2QACA 1OOJA 1IH0A 1MR8A 1ZFSA 1QX5B 1QV1A 2OTGC 3PATA 3LLEA 4F0ZB 1LXFC 2LC5A 3TDUA 1PVBA 4ICBA 1NUBA 3VRRA 4YGDB 4GBAA 3SIAA 3I5FB 4CPVA 1M39A 1NSHA 2JXLA 4IL1A 4MZLA 4WQ3A 2K2FA 1A4PA 5CSJA 1TOPA 3VRNA 2KFFA 4OKHA 1YTZC 2KQYA 2WC8A 2FCEA 3HX4A 3EK4A 1SY9A 3TDIA 4YI9A 1QLKA 1K95A 1V1GA 2GGZA 2JZIA 3GOFA 1NX1A 1C07A 4NDDA 1TTXA 2QPTA 1QASA 3RLZA 4CIDA 3WXAA 2F3YA 1DJIA 2WCFA 4GNKB 2LANA 1SKTA 1SRAA 4N1FA 1H4BA 4C0KA 2O5GA 1UHNA 1Q80A 1TNWA 2V53A 3RM1A 1QVIY 2NLNA 2NXQA 4GUKA 2K7CA 1DGUA 4YGAA 1XA5A 2HF5A 1S36A 2BE6A 4WQ2A 1KFUL 2AUCA 2GV5A 1XK4C 1X02A 2LLTA 2PASA 1F70A 3PFVA 3O6BA 2KAXA 1ZUZA 2MRDA 1BJFA 2Y4QA 1ZOTB 1SL8A 2LHLA 1G33A 2ISDA 2ZN9A 3KF9A 2FJUB 3PN7B 2G2BA 4NQGA 4YBHB 3LL8B 1L2OB 3I5FC 4HRGA 1LKJA 1U5IB 1QJTA 1OE9B 4TNCA 1DT7B 1S26D 4YI8A 5CSIA 1RROA 3EVVA 1R2UA 3EVRA 4MZKA 4UPGA 5ER5A 2NZ0A 2CBLA 3BUNB 4XJKB 5B8IB 1S3PA 1SW8A 2Q4UA 2I18A 3AKBA 1F54A 4CLNA 1M63B 2KI6D 4DUQA 1KWOB 3CR4X 3KEVA 4BY5A 3O2PA 1A03A 3K21A 1KSOA 1UHKA 3CTNA 1DJZA 1TIZA 3AAKA 3TZ1A 1WRLA 2JOJA 5GQQC 2M1UA 2WNDA 1JUOA 1IKUA 4NDCA 2MAZA 2ZRSA 2LHIA 4M2OA 1KFUS 5AANA 2M7LA 1SK6D 2ZFDA 3BUMB 1RWYA 1PRWA 1PALA 1YUUA 2B1UA 3DVJA 3DF0A 1NP8A 1NCZA 3MSEB 3OX5A 4HSZA 1B7TY 4XYNA 2Q91A 3LK1A 1K9UA 1SCVA 3IQQA 2CXJA 1EH2A 3PN7C 4GPLB 1WLMA 1L2OC 1SYMA 1L7ZA 2PRUA 2BBNA 1WLZA 3NXAA 1DJYA 1YRUB 4JQ0D 1AVSA 2K7BA 1GGWA 1K2HA 1S6JA 4MN0A 2L50A 2LVJA 2MLEC 4QJ3B 1CLLA 2I7AA 4OR9B 3FWBA 1JWDA 2KAVA 1QS7A 2LMTA 5HYDA 1BG1A 3I5IB 1RJVA 2I94A 1CNPA 1OQPA 1YURA 1XFWO 1KWOC 1OMVA 3CGAA 3JTDB 3ZWHA 1RECA 2MLFC 1XYDA 5JJGA 5I8NA 4C0LA 1K94A 1DTLA 1OZSA 4U8DA 4CFQA 1QATA 2KHNA 1QX7A 5TNCA 2KI4B 2F33A 1YVHA 1K96A 3BOWA 3CR2A 2KI6C 2M8UA 3KPXA 4M2PA 4PDZA 4AQIA 1DF0B 3OHMB 1FPWA 3BUXB 3GK4X 3SG4A 1J1EA 3KHEA 3O4YA 2K7DA 2BCBA 1IGVA 1SNLA 3GK1A 1IJ6A 2L98A 2KSPA 1SL7A 5DKRA 4OVNF 1FF1A 1A29A 5CSNA 4WRIA 2LV7A 1LINA 1ALWA 2K61A 2KYFA 1XFUO 1B1GA 1FW4A 4PE7A 4QJ4B 2FOTA 1UHJA 1A75A 1MUXA 1F71A 1B8RA 3NSIA 5I2OA 2LUCA 2JWWA 2MHHA 4L9MA 1BU3A 4QJ5B 1E8AA 1CKKA 5PALA 3F45A 1B8LA 1IQ5A 2LAPA 4R1EA 2M1KB 4YGEB 5HKZA 2JNFA 1CFCA 3EVUA 3I5IC 3NSOA 4DRWA 1MQ1A 1CFDA 2BECA 5G08A 1PK0D 3KO0A 1BLQA 3D0YA 1A2XA 3SG2A 2K8MB 1DMOA 1XFXO 2JQ6A 2M3WA 4FQOA 4MRXA 5KU1A 1KQMB 2L51A 3JTDC 1JFJA 3DF0B 4GGFC 4PE0A 2LE9B 1XK4A 1AJ4A 2AAOA 1J7OA 1UHHA 2NCPA 1KCYA 1CFPA 3EK7A 1MF8B 2KI4C 1KSMA 2ZRTA 2A4JA 1DJWA 1C7VA 1Y1AA 2F2OA 1MHOA 1UHIA 3TUYB 3VROA 2GGMA 4PHKA 3QRXA 1SCMB 3IF7A 3CLNA 4YGBB 5D7FA 2KGBC 3CR5X 1IJ5A 2G9BA 1GGZA 1KK8B 1DJHA 1LVCD 1KK7Z 4I5KA 1J7QA 1V1FA 1Y0VH 1G8IA 2JRFA 3VGOA 1M46A 2Y1NA 1BF5A 1AUIB 3CS1A 1BT6A 1RFJA 2P6BB 2SCPA 3CWGA 4M2QA 4E68A 2BL0B 3TS5B 1SPYA 2BCAA 5ER4X 1QIWA 3A4UB 1CFFA 2EC6B 4D1EA 1TN4A 3E3RA 1K93D 1NPQA 5KTYA 1Y6WA 4ZCVA 1CDNA 1RK9A 1XO5A 2HQ8A 4C0JA 1XVJA 1SMGA 1N2DA 2LMVA 3DD4A 3SG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6P A;  1S5G Z;  1YRT B;  4PHM A;  1B8C A;  5AER A;  1UWO A;  5AFP A;  3IQO A;  2BE4 A;  2ZND A;  1KQM C;  1ODB A;  1PVA A;  2H61 C;  2KOT A;  2WOS A;  3WNX B;  4JWQ A;  1NCX A;  2LNK A;  4GFT A;  1KK7 Y;  2Y5I A;  1ZMZ A;  1LA3 A;  2E30 A;  3JVT B;  2KGR A;  4FTG A;  2NCO A;  4PE4 A;  3SIB A;  4PAL A;  2F2P A;  2KDH A;  4PHN A;  2JTT A;  2KYC A;  3AKA A;  4PHJ A;  1B4C A;  1CMF A;  1G4Y R;  2CTN A;  2D8N A;  4N1G A;  2LLS A;  3TUY C;  1A75 B;  2L4H A;  1OMD A;  1QXP A;  1KFX L;  4MVF A;  1JF2 A;  1JFK A;  2JUL A;  1SCM C;  2WCE A;  4AOM A;  2FCD A;  5K89 A;  3OX6 A;  4I5L B;  3VRQ A;  1K90 D;  1KK8 C;  3WHU B;  2K0J A;  2M29 A;  2OPO A;  2H2K A;  2I2R E;  5D69 A;  1U5I A;  1QV0 A;  4I5N B;  2KNE A;  2COL B;  2JT8 A;  1SR6 B;  5DKN A;  1S5G Y;  4P5O E;  1C7W A;  2BL0 C;  3TS5 C;  1DJG A;  1MWN A;  5IBW A;  2MA2 A;  3D0Y B;  1N65 A;  3BUO B;  2EC6 C;  1TRF A;  4I5J A;  5HKW A;  2JT0 A;  1K8U A;  1DGV A;  1BOD A;  1N0Y A;  1EG4 A;  2M9G A;  3FIA A;  5JOL A;  1W7I B;  3OB1 B;  2LMU A;  4OCI A;  1ALV A;  1WRZ A;  2HPS A;  1CLB A;  1UUR A;  3PM8 A;  1S6I A;  1DJX A;  2KAY A;  1JSA A;  1MXE A;  1QVI Z;  3EKH A;  3OB2 B;  1AK8 A;  4MLW A;  3A8R A;  2CNP A;  3NSK A;  3VRP A;  1IRJ A;  1WRK A;  4GGN A;  4Q04 A;  3TDZ A;  3H4S E;  3O78 A;  1CMG A;  1J55 A;  2VRG A;  2EGD A;  1IQ3 A;  3BXK A;  1TNX A;  3SG5 A;  3M0W A;  3OP0 A;  1FI5 A;  4PE1 A;  2LM5 A;  3JVT C;  4YGC B;  1NX3 A;  1EG3 A;  2L4I A;  4OV2 A;  1CLM A;  2LVK A;  2Y1M A;  2L2E A;  3BUW B;  4CFR A;  1AP4 A;  1YUS A;  1YVL A;  2M97 A;  1SL9 A;  2DOQ A;  1CB1 A;  2LVV A;  2OS8 B;  1MXL C;  1KFX S;  1CTR A;  4AQJ A;  1SBJ A;  5AXI A;  2JU0 A;  2KQ6 A;  4DS7 A;  1EL4 A;  1J7P A;  2JC2 A;  2F8P A;  2LP3 A;  1GQM A;  3EK8 A;  1GJY A;  1BR4 B;  1QTX A;  1BMO A;  5AEQ A;  3I5H B;  1H8B A;  1IG5 A;  1W7J B;  2BCX A;  4DIR A;  4JPZ B;  1SR6 C;  4NDB A;  4ORC B;  3ZNI A;  2M0R A;  5I2Q A;  2WCB A;  4DCK A;  1XFV O;  4MZJ A;  4MSP A;  1QX2 A;  2RGI A;  2KBI A;  3SJS A;  4A4B A;  3GK2 A;  1YX8 A;  1WDC B;  1B9A A;  2MBX A;  1B47 A;  1NCY A;  2LUX A;  3SG7 A;  2KFH A;  2PSR A;  2SAS A;  3I5G B;  4BY4 A;  1DVI A;  3C1V A;  1AHR A;  1J7R A;  4GAO A;  5BPJ A;  1EXR A;  3EKJ A;  4GGF A;  1YR5 A;  5HLO A;  2JTZ A;  1CM1 A;  3BQ3 A;  3FWC A;  1AJ5 A;  1PUL A;  2LVI A;  1QLS A;  1YUT A;  2K2A A;  1Y1U A;  1F4O A;  4ORB B;  2AMI A;  1Y1X A;  2E6W A;  1DF0 A;  1S6C A;  2MJW B;  1NYA A;  2M49 B;  3D10 A;  5HLV A;  2L0P A;  2M7N A;  1LA0 A;  3PSR A;  1S1E A;  5HKY A;  5F6T A;  5DKQ A;  2ZKM X;  2CT9 A;  1FI6 A;  3BYA A;  1B7T Z;  1UUS A;  2LP2 A;  2HQW A;  4USL A;  1PSR A;  3AAJ A;  4P2Y B;  1TCO B;  3BOW B;  1NWD A;  2OS8 C;  1IWQ A;  2O60 A;  2BKH B;  2OTG B;  1M45 A;  1CM4 A;  2JPT A;  1F8H A;  1TCF A;  1NX0 A;  2KFG A;  3I5H C;  2K7O A;  4PCW A;  2LCP A;  5J3X A;  3LK0 A;  2F3Z A;  4MRY A;  1OMR A;  5CSF A;  1VRK A;  4ZCU A;  3PAL A;  1J1D A;  1TNQ A;  3DVM A;  1NIW A;  5FYX A;  4A4C A;  1WDC C;  2BBM A;  4ETO A;  2EHB A;  2PVB A;  4MBE A;  1CDM A;  3I5G C;  1KQV A;  5KSZ A;  2JNX A;  1HQV A;  2H61 A;  1HT9 A;  3CZT X;  1RTP 1;  1D1O A;  3DVE A;  3LCP C;  1M31 A;  1CDP A;  3PLF B;  2R2I A;  1K9P A;  1EJ3 A;  2ZN8 A;  3DVK A;  1JC2 A;  3NSL A;  3ICB A;  1CDL A;  3HCM A;  4MEW A;  4ORA B;  4YRU A;  2CCM A;  1XFY O;  1YX7 A;  1NX2 A;  1OSA A;  2HET A;  1TNP A;  1BR1 B;  1UP5 A;  4HRE E;  3SG3 A;  2JT3 A;  2TN4 A;  2KBM A;  2L5X B;  1F4Q A;  4N5X A;  4XJK A;  2BKI B;  1F55 A;  2LLU A;  2IS9 A;  2ZNE A;  1ZAC A;  1XFZ O;  1QIV A;  2WOR A;  3FS7 A;  5CPV A;  1FBV A;  4HRH A;  1BOC A;  5I2L A;  2PMY A;  1OZO A;  2JXC A;  1JF0 A;  1JBA A;  1WY9 A;  2PAL A;  3WHT B;  1PSB A;  1K9K A;  2QAC A;  1OOJ A;  1IH0 A;  1MR8 A;  1ZFS A;  1QX5 B;  1QV1 A;  2OTG C;  3PAT A;  3LLE A;  4F0Z B;  1LXF C;  2LC5 A;  3TDU A;  1PVB A;  4ICB A;  1NUB A;  3VRR A;  4YGD B;  4GBA A;  3SIA A;  3I5F B;  4CPV A;  1M39 A;  1NSH A;  2JXL A;  4IL1 A;  4MZL A;  4WQ3 A;  2K2F A;  1A4P A;  5CSJ A;  1TOP A;  3VRN A;  2KFF A;  4OKH A;  1YTZ C;  2KQY A;  2WC8 A;  2FCE A;  3HX4 A;  3EK4 A;  1SY9 A;  3TDI A;  4YI9 A;  1QLK A;  1K95 A;  1V1G A;  2GGZ A;  2JZI A;  3GOF A;  1NX1 A;  1C07 A;  4NDD A;  1TTX A;  2QPT A;  1QAS A;  3RLZ A;  4CID A;  3WXA A;  2F3Y A;  1DJI A;  2WCF A;  4GNK B;  2LAN A;  1SKT A;  1SRA A;  4N1F A;  1H4B A;  4C0K A;  2O5G A;  1UHN A;  1Q80 A;  1TNW A;  2V53 A;  3RM1 A;  1QVI Y;  2NLN A;  2NXQ A;  4GUK A;  2K7C A;  1DGU A;  4YGA A;  1XA5 A;  2HF5 A;  1S36 A;  2BE6 A;  4WQ2 A;  1KFU L;  2AUC A;  2GV5 A;  1XK4 C;  1X02 A;  2LLT A;  2PAS A;  1F70 A;  3PFV A;  3O6B A;  2KAX A;  1ZUZ A;  2MRD A;  1BJF A;  2Y4Q A;  1ZOT B;  1SL8 A;  2LHL A;  1G33 A;  2ISD A;  2ZN9 A;  3KF9 A;  2FJU B;  3PN7 B;  2G2B A;  4NQG A;  4YBH B;  3LL8 B;  1L2O B;  3I5F C;  4HRG A;  1LKJ A;  1U5I B;  1QJT A;  1OE9 B;  4TNC A;  1DT7 B;  1S26 D;  4YI8 A;  5CSI A;  1RRO A;  3EVV A;  1R2U A;  3EVR A;  4MZK A;  4UPG A;  5ER5 A;  2NZ0 A;  2CBL A;  3BUN B;  4XJK B;  5B8I B;  1S3P A;  1SW8 A;  2Q4U A;  2I18 A;  3AKB A;  1F54 A;  4CLN A;  1M63 B;  2KI6 D;  4DUQ A;  1KWO B;  3CR4 X;  3KEV A;  4BY5 A;  3O2P A;  1A03 A;  3K21 A;  1KSO A;  1UHK A;  3CTN A;  1DJZ A;  1TIZ A;  3AAK A;  3TZ1 A;  1WRL A;  2JOJ A;  5GQQ C;  2M1U A;  2WND A;  1JUO A;  1IKU A;  4NDC A;  2MAZ A;  2ZRS A;  2LHI A;  4M2O A;  1KFU S;  5AAN A;  2M7L A;  1SK6 D;  2ZFD A;  3BUM B;  1RWY A;  1PRW A;  1PAL A;  1YUU A;  2B1U A;  3DVJ A;  3DF0 A;  1NP8 A;  1NCZ A;  3MSE B;  3OX5 A;  4HSZ A;  1B7T Y;  4XYN A;  2Q91 A;  3LK1 A;  1K9U A;  1SCV A;  3IQQ A;  2CXJ A;  1EH2 A;  3PN7 C;  4GPL B;  1WLM A;  1L2O C;  1SYM A;  1L7Z A;  2PRU A;  2BBN A;  1WLZ A;  3NXA A;  1DJY A;  1YRU B;  4JQ0 D;  1AVS A;  2K7B A;  1GGW A;  1K2H A;  1S6J A;  4MN0 A;  2L50 A;  2LVJ A;  2MLE C;  4QJ3 B;  1CLL A;  2I7A A;  4OR9 B;  3FWB A;  1JWD A;  2KAV A;  1QS7 A;  2LMT A;  5HYD A;  1BG1 A;  3I5I B;  1RJV A;  2I94 A;  1CNP A;  1OQP A;  1YUR A;  1XFW O;  1KWO C;  1OMV A;  3CGA A;  3JTD B;  3ZWH A;  1REC A;  2MLF C;  1XYD A;  5JJG A;  5I8N A;  4C0L A;  1K94 A;  1DTL A;  1OZS A;  4U8D A;  4CFQ A;  1QAT A;  2KHN A;  1QX7 A;  5TNC A;  2KI4 B;  2F33 A;  1YVH A;  1K96 A;  3BOW A;  3CR2 A;  2KI6 C;  2M8U A;  3KPX A;  4M2P A;  4PDZ A;  4AQI A;  1DF0 B;  3OHM B;  1FPW A;  3BUX B;  3GK4 X;  3SG4 A;  1J1E A;  3KHE A;  3O4Y A;  2K7D A;  2BCB A;  1IGV A;  1SNL A;  3GK1 A;  1IJ6 A;  2L98 A;  2KSP A;  1SL7 A;  5DKR A;  4OVN F;  1FF1 A;  1A29 A;  5CSN A;  4WRI A;  2LV7 A;  1LIN A;  1ALW A;  2K61 A;  2KYF A;  1XFU O;  1B1G A;  1FW4 A;  4PE7 A;  4QJ4 B;  2FOT A;  1UHJ A;  1A75 A;  1MUX A;  1F71 A;  1B8R A;  3NSI A;  5I2O A;  2LUC A;  2JWW A;  2MHH A;  4L9M A;  1BU3 A;  4QJ5 B;  1E8A A;  1CKK A;  5PAL A;  3F45 A;  1B8L A;  1IQ5 A;  2LAP A;  4R1E A;  2M1K B;  4YGE B;  5HKZ A;  2JNF A;  1CFC A;  3EVU A;  3I5I C;  3NSO A;  4DRW A;  1MQ1 A;  1CFD A;  2BEC A;  5G08 A;  1PK0 D;  3KO0 A;  1BLQ A;  3D0Y A;  1A2X A;  3SG2 A;  2K8M B;  1DMO A;  1XFX O;  2JQ6 A;  2M3W A;  4FQO A;  4MRX A;  5KU1 A;  1KQM B;  2L51 A;  3JTD C;  1JFJ A;  3DF0 B;  4GGF C;  4PE0 A;  2LE9 B;  1XK4 A;  1AJ4 A;  2AAO A;  1J7O A;  1UHH A;  2NCP A;  1KCY A;  1CFP A;  3EK7 A;  1MF8 B;  2KI4 C;  1KSM A;  2ZRT A;  2A4J A;  1DJW A;  1C7V A;  1Y1A A;  2F2O A;  1MHO A;  1UHI A;  3TUY B;  3VRO A;  2GGM A;  4PHK A;  3QRX A;  1SCM B;  3IF7 A;  3CLN A;  4YGB B;  5D7F A;  2KGB C;  3CR5 X;  1IJ5 A;  2G9B A;  1GGZ A;  1KK8 B;  1DJH A;  1LVC D;  1KK7 Z;  4I5K A;  1J7Q A;  1V1F A;  1Y0V H;  1G8I A;  2JRF A;  3VGO A;  1M46 A;  2Y1N A;  1BF5 A;  1AUI B;  3CS1 A;  1BT6 A;  1RFJ A;  2P6B B;  2SCP A;  3CWG A;  4M2Q A;  4E68 A;  2BL0 B;  3TS5 B;  1SPY A;  2BCA A;  5ER4 X;  1QIW A;  3A4U B;  1CFF A;  2EC6 B;  4D1E A;  1TN4 A;  3E3R A;  1K93 D;  1NPQ A;  5KTY A;  1Y6W A;  4ZCV A;  1CDN A;  1RK9 A;  1XO5 A;  2HQ8 A;  4C0J A;  1XVJ A;  1SMG A;  1N2D A;  2LMV A;  3DD4 A;  3SG6 A; 
#chains in the Genus database with same CATH topology
 1R6P A;  1S5G Z;  1YRT B;  4PHM A;  2WCJ A;  1B8C A;  5AER A;  1UWO A;  5AFP A;  3IQO A;  2BE4 A;  2ZND A;  1KQM C;  1ODB A;  1PVA A;  2H61 C;  2KOT A;  2WOS A;  3WNX B;  3SS3 A;  4JWQ A;  1NCX A;  2LNK A;  4GFT A;  1KK7 Y;  2Y5I A;  1ZMZ A;  1LA3 A;  2E30 A;  3JVT B;  2KGR A;  4FTG A;  2NCO A;  4PE4 A;  3SIB A;  4PAL A;  2F2P A;  2KDH A;  2P71 A;  4PHN A;  2JTT A;  2KYC A;  3AKA A;  4PHJ A;  3S0F A;  1B4C A;  1CMF A;  3OGN A;  2GTE A;  2KLE A;  1G4Y R;  2CTN A;  2D8N A;  4N1G A;  2LLS A;  3TUY C;  1A75 B;  2L4H A;  1DQE A;  1OMD A;  1QXP A;  3B7A A;  1KFX L;  4MVF A;  1JF2 A;  1JFK A;  2JUL A;  1SCM C;  2WCE A;  4AOM A;  2FCD A;  5K89 A;  3V2L A;  3OX6 A;  2BNX A;  4I5L B;  3VRQ A;  1K90 D;  1KK8 C;  3WHU B;  2K0J A;  2M29 A;  2OPO A;  2H2K A;  2I2R E;  5D69 A;  1U5I A;  1QV0 A;  4I5N B;  2KNE A;  2COL B;  2JT8 A;  1SR6 B;  5DKN A;  1S5G Y;  4P5O E;  1C7W A;  2BL0 C;  3OBV A;  1DJG A;  1MWN A;  3TS5 C;  5IBW A;  2MA2 A;  3D0Y B;  1N65 A;  3BUO B;  2EC6 C;  1TRF A;  4I5J A;  5HKW A;  2JT0 A;  1K8U A;  1DGV A;  1BOD A;  1N0Y A;  1EG4 A;  2M9G A;  3FIA A;  2KPH A;  5JOL A;  1W7I B;  3NHT A;  3OB1 B;  2LMU A;  4OCI A;  1ALV A;  1WRZ A;  2HPS A;  1CLB A;  1UUR A;  3PM8 A;  1S6I A;  1DJX A;  2KAY A;  3RZS A;  1JSA A;  1MXE A;  1QVI Z;  3EKH A;  3OB2 B;  1AK8 A;  4MLW A;  2QEO A;  3A8R A;  2CNP A;  3NSK A;  3VRP A;  1IRJ A;  1WRK A;  4GGN A;  4Q04 A;  3TDZ A;  3H4S E;  3O78 A;  1CMG A;  1ORG A;  1J55 A;  2VRG A;  2EGD A;  1IQ3 A;  3BXK A;  1TNX A;  3SG5 A;  3M0W A;  3OP0 A;  1FI5 A;  4PE1 A;  2LM5 A;  3JVT C;  4YGC B;  1NX3 A;  1EG3 A;  2L4I A;  4OV2 A;  1CLM A;  2LVK A;  2Y1M A;  2L2E A;  3BUW B;  3N7H A;  4CFR A;  1AP4 A;  1YUS A;  1YVL A;  2M97 A;  1SL9 A;  2DOQ A;  1CB1 A;  3S0B A;  2LVV A;  2OS8 B;  1MXL C;  3DXL A;  1KFX S;  1CTR A;  4AQJ A;  1SBJ A;  5AXI A;  2JU0 A;  2KQ6 A;  4DS7 A;  1EL4 A;  1J7P A;  2JC2 A;  2F8P A;  2LP3 A;  1GQM A;  3EK8 A;  1GJY A;  1BR4 B;  1QTX A;  1BMO A;  3L4L A;  5AEQ A;  3I5H B;  2WCH A;  1H8B A;  3B88 A;  1IG5 A;  2QDI A;  1W7J B;  2BCX A;  4DIR A;  4JPZ B;  1SR6 C;  4NDB A;  4ORC B;  3ZNI A;  2M0R A;  5I2Q A;  2WCB A;  4DCK A;  1XFV O;  3D77 A;  4MZJ A;  4MSP A;  1QX2 A;  2RGI A;  2KBI A;  4PT1 A;  3SJS A;  4A4B A;  3GK2 A;  1YX8 A;  3O4X A;  1WDC B;  1B9A A;  2MBX A;  1B47 A;  3B6X A;  1NCY A;  2LUX A;  3SG7 A;  2KFH A;  2PSR A;  2SAS A;  3I5G B;  4BY4 A;  1DVI A;  3C1V A;  1AHR A;  1J7R A;  4GAO A;  5BPJ A;  1EXR A;  3EKJ A;  4GGF A;  1YR5 A;  3CZ2 A;  2JTZ A;  5HLO A;  1CM1 A;  3BQ3 A;  3FWC A;  1AJ5 A;  1PUL A;  2LVI A;  1QLS A;  1YUT A;  2K2A A;  3K1E A;  1Y1U A;  1F4O A;  4ORB B;  2AMI A;  1Y1X A;  2E6W A;  2PYQ A;  1DF0 A;  1S6C A;  2MJW B;  5FI2 A;  1NYA A;  2M49 B;  3D10 A;  5HLV A;  2L0P A;  2M7N A;  1LA0 A;  3PSR A;  1S1E A;  5HKY A;  5F6T A;  5DKQ A;  3QME A;  4INW A;  2ZKM X;  3FE8 A;  2CT9 A;  1FI6 A;  3BYA A;  1B7T Z;  1UUS A;  2LP2 A;  2HQW A;  4USL A;  1PSR A;  1IH0 A;  3AAJ A;  4P2Y B;  1TCO B;  4F7F A;  3BOW B;  1NWD A;  2OS8 C;  1IWQ A;  2O60 A;  2BKH B;  2OTG B;  3EG5 B;  1M45 A;  1CM4 A;  2JPT A;  1F8H A;  1TCF A;  1NX0 A;  2KFG A;  3I5H C;  2K7O A;  4PCW A;  2LCP A;  5J3X A;  3LK0 A;  2F3Z A;  3PM2 A;  4MRY A;  1OMR A;  3NGV A;  1VRK A;  5CSF A;  3D73 A;  1J1D A;  3PAL A;  4ZCU A;  1TNQ A;  3DVM A;  1NIW A;  5FYX A;  4A4C A;  1WDC C;  2BBM A;  4ETO A;  2EHB A;  2WC6 A;  1GM0 A;  2PVB A;  4MBE A;  1CDM A;  3I5G C;  1KQV A;  5KSZ A;  2JNX A;  1HQV A;  2H61 A;  3S0E A;  1HT9 A;  3CZT X;  1RTP 1;  1D1O A;  3DVE A;  3S0D A;  3LCP C;  1M31 A;  1CDP A;  3PLF B;  2R2I A;  1K9P A;  1EJ3 A;  2ZN8 A;  3DVK A;  1JC2 A;  3NSL A;  3ICB A;  1CDL A;  3HCM A;  4MEW A;  4IJ7 A;  4ORA B;  2CCM A;  4YRU A;  1XFY O;  1YX7 A;  1NX2 A;  1OSA A;  2HET A;  3D74 A;  1OW4 A;  1BR1 B;  1TNP A;  1UP5 A;  4HRE E;  3SG3 A;  2JT3 A;  2TN4 A;  3PJI A;  2KBM A;  4FQT A;  2L5X B;  2K60 A;  1F4Q A;  4N5X A;  4XJK A;  2BKI B;  1F55 A;  2LLU A;  2IS9 A;  2ZNE A;  1ZAC A;  1XFZ O;  1QIV A;  2WOR A;  3FS7 A;  5CPV A;  1FBV A;  4HRH A;  1BOC A;  5I2L A;  2PMY A;  1OZO A;  2JXC A;  1JF0 A;  1JBA A;  2QEH A;  1WY9 A;  2PAL A;  5FI6 A;  3WHT B;  2QEV A;  1PSB A;  1K9K A;  2QAC A;  1OOJ A;  3CZ1 A;  1MR8 A;  1ZFS A;  1QX5 B;  1QV1 A;  2OTG C;  3PAT A;  3BJH A;  3LLE A;  4F0Z B;  1LXF C;  1TUZ A;  2LC5 A;  3TDU A;  1PVB A;  4ICB A;  1NUB A;  3VRR A;  4YGD B;  4GBA A;  3SIA A;  3I5F B;  4CPV A;  1M39 A;  1NSH A;  2ERB A;  2JXL A;  1W9Z A;  4IL1 A;  2K2F A;  1A4P A;  4MZL A;  1TOP A;  4WQ3 A;  2KFF A;  4OKH A;  5CSJ A;  3VRN A;  1YTZ C;  2KQY A;  2WC8 A;  2FCE A;  3HX4 A;  3EK4 A;  1SY9 A;  3TDI A;  4YI9 A;  3DY9 A;  1QLK A;  1K95 A;  1V1G A;  2GGZ A;  2JZI A;  3GOF A;  1NX1 A;  1C07 A;  4NDD A;  1TTX A;  2QPT A;  1OOF A;  1QAS A;  1QWV A;  3RLZ A;  4CID A;  3WXA A;  3UNW A;  2F3Y A;  1DJI A;  1SSE B;  1DC1 A;  2WCF A;  4GNK B;  2LAN A;  1SKT A;  1SRA A;  4INX A;  4N1F A;  2WC5 A;  1H4B A;  4C0K A;  2O5G A;  1UHN A;  1Z4H A;  1Q80 A;  1TNW A;  2V53 A;  3RM1 A;  1QVI Y;  2NLN A;  2NXQ A;  4GUK A;  2K7C A;  1DGU A;  4YGA A;  1LS8 A;  1OOI X;  1XA5 A;  2HF5 A;  1IIO A;  3UO9 A;  1S36 A;  2BE6 A;  4WQ2 A;  1KFU L;  2AUC A;  2GV5 A;  4JKT A;  1XK4 C;  1X02 A;  2LLT A;  2PAS A;  5DIC A;  3PFV A;  3S0A A;  1F70 A;  3O6B A;  1DEK A;  2KAX A;  1ZUZ A;  2MRD A;  1BJF A;  2Y4Q A;  1ZOT B;  1SL8 A;  2LHL A;  1G33 A;  2ISD A;  2ZN9 A;  3KF9 A;  2FJU B;  3PN7 B;  2G2B A;  4NQG A;  4YBH B;  3LL8 B;  1L2O B;  2PQL A;  3I5F C;  4HRG A;  1LKJ A;  4JD9 A;  2YGU A;  1U5I B;  1QJT A;  1OE9 B;  1OOH A;  4TNC A;  1DT7 B;  1S26 D;  2WCM A;  4YI8 A;  5CSI A;  1RRO A;  3EVV A;  1R2U A;  3EVR A;  4MZK A;  4UPG A;  5ER5 A;  2NZ0 A;  2CBL A;  3BUN B;  4XJK B;  5B8I B;  1S3P A;  1SW8 A;  2Q4U A;  2I18 A;  3AKB A;  1F54 A;  3S0G A;  4CLN A;  1M63 B;  2KI6 D;  4DUQ A;  1KWO B;  3CR4 X;  3KEV A;  4BY5 A;  3O2P A;  1A03 A;  3K21 A;  1KSO A;  1UHK A;  3CTN A;  1DJZ A;  3R72 A;  1TIZ A;  3AAK A;  3TZ1 A;  1WRL A;  2JOJ A;  3BFA A;  5GQQ C;  2BAP A;  2M1U A;  3DZT A;  2WND A;  3B86 A;  1JUO A;  1IKU A;  4NDC A;  2MAZ A;  2ZRS A;  2LHI A;  5FI7 A;  4M2O A;  1KFU S;  5AAN A;  2M7L A;  1SK6 D;  2ZFD A;  3BUM B;  1RWY A;  1PRW A;  1PAL A;  1YUU A;  2B1U A;  3DVJ A;  3DF0 A;  1NP8 A;  1NCZ A;  3MSE B;  3OX5 A;  4HSZ A;  1B7T Y;  4XYN A;  2Q91 A;  3LK1 A;  1C3Z A;  1K9U A;  1SCV A;  3IQQ A;  2CXJ A;  3SS4 A;  3PN7 C;  4GPL B;  1EH2 A;  1WLM A;  1L2O C;  1P28 A;  1SYM A;  4KYN A;  1L7Z A;  2PRU A;  2BBN A;  1WLZ A;  3NXA A;  1DJY A;  1YRU B;  4JQ0 D;  1AVS A;  2K7B A;  1GGW A;  1K2H A;  1S6J A;  4MN0 A;  2L50 A;  2LVJ A;  2MLE C;  4QJ3 B;  1CLL A;  1DEL A;  3SS5 A;  2I7A A;  4OR9 B;  3FWB A;  2WCL A;  3D78 A;  1JWD A;  2KAV A;  1QS7 A;  2LMT A;  5HYD A;  1BG1 A;  3I5I B;  1RJV A;  4OZD A;  2I94 A;  1CNP A;  1OQP A;  1YUR A;  1XFW O;  3L47 A;  3FE6 A;  1KWO C;  1OMV A;  3CGA A;  3JTD B;  3CZ0 A;  3ZWH A;  1REC A;  2MLF C;  1XYD A;  3CDN A;  5JJG A;  1T14 A;  5I8N A;  4C0L A;  1K94 A;  1DTL A;  3BFB A;  1OZS A;  4U8D A;  4CFQ A;  1QAT A;  2KHN A;  1QX7 A;  3B87 A;  2KI4 B;  5TNC A;  2F33 A;  1YVH A;  1K96 A;  2H8V A;  3BOW A;  2KI6 C;  2M8U A;  3CR2 A;  3KPX A;  4M2P A;  3R1O A;  4PDZ A;  1DF0 B;  3OHM B;  4AQI A;  3BUX B;  3GK4 X;  1FPW A;  3SG4 A;  5I94 A;  1J1E A;  3KHE A;  3D76 A;  3IVT A;  3O4Y A;  2L2C A;  3R1P A;  2K7D A;  2BCB A;  1IGV A;  1SNL A;  3GK1 A;  1IJ6 A;  2L98 A;  2KSP A;  1SL7 A;  5DKR A;  3D75 A;  4OVN F;  1A29 A;  5CSN A;  1FF1 A;  4WRI A;  2LV7 A;  3DYE A;  1LIN A;  1ALW A;  2K61 A;  2KYF A;  1XFU O;  1B1G A;  1FW4 A;  4PE7 A;  3R1V A;  4QJ4 B;  2FOT A;  1TUJ A;  1UHJ A;  1A75 A;  1MUX A;  1F71 A;  1B8R A;  3NSI A;  5I2O A;  2LUC A;  2JWW A;  2MHH A;  2WCK A;  1XFR A;  1BU3 A;  4L9M A;  4QJ5 B;  1E8A A;  1CKK A;  2JPO A;  2QEB A;  5PAL A;  3F45 A;  1B8L A;  3VB1 A;  1IQ5 A;  2LAP A;  4R1E A;  3CAB A;  2M1K B;  4YGE B;  5HKZ A;  2JNF A;  1CFC A;  3EVU A;  3I5I C;  3NSO A;  4DRW A;  1MQ1 A;  1CFD A;  2BEC A;  5G08 A;  1PK0 D;  3KO0 A;  1BLQ A;  3D0Y A;  1A2X A;  3SG2 A;  2K8M B;  3CYZ A;  1DMO A;  1XFX O;  2JQ6 A;  2M3W A;  4FQO A;  4MRX A;  5KU1 A;  1KQM B;  1OOG A;  2L51 A;  3JTD C;  1JFJ A;  3DF0 B;  4GGF C;  3NHI A;  1TWO A;  4PE0 A;  2LE9 B;  1XK4 A;  1AJ4 A;  2AAO A;  1J7O A;  1UHH A;  2NCP A;  1KCY A;  1CFP A;  3EK7 A;  1MF8 B;  2KI4 C;  1KSM A;  2ZRT A;  2A4J A;  1DJW A;  1C7V A;  1Y1A A;  2F2O A;  1MHO A;  1UHI A;  3TUY B;  3VRO A;  2GGM A;  4PHK A;  3QRX A;  1SCM B;  3IF7 A;  3CLN A;  4YGB B;  2P70 A;  5D7F A;  2KGB C;  3CR5 X;  1IJ5 A;  2G9B A;  3BFH A;  1GGZ A;  1KK8 B;  1DJH A;  1LVC D;  1KK7 Z;  3L4A A;  4I5K A;  1J7Q A;  1V1F A;  5EL2 A;  1Y0V H;  1G8I A;  2JRF A;  3VGO A;  1M46 A;  5HL1 A;  2FJY A;  2Y1N A;  1BF5 A;  3Q8I A;  1AUI B;  3CS1 A;  1BT6 A;  1RFJ A;  2P6B B;  2SCP A;  3CWG A;  4M2Q A;  4E68 A;  2BL0 B;  3TS5 B;  1SPY A;  2KLD A;  3FE9 A;  2BCA A;  5D3O A;  5ER4 X;  1Z2C B;  1QIW A;  3A4U B;  1CFF A;  2EC6 B;  1C3Y A;  4D1E A;  1TN4 A;  3E3R A;  1K93 D;  2L5Y A;  1NPQ A;  5KTY A;  1Y6W A;  4ZCV A;  1CDN A;  1RK9 A;  1XO5 A;  2HQ8 A;  4C0J A;  1XVJ A;  1SMG A;  1N2D A;  2LMV A;  3DD4 A;  3SG6 A; 
#chains in the Genus database with same CATH homology
 1R6P A;  1S5G Z;  1YRT B;  4PHM A;  1B8C A;  5AER A;  1UWO A;  5AFP A;  3IQO A;  2BE4 A;  2ZND A;  1KQM C;  1ODB A;  1PVA A;  2H61 C;  2KOT A;  2WOS A;  3WNX B;  4JWQ A;  1NCX A;  2LNK A;  4GFT A;  1KK7 Y;  2Y5I A;  1ZMZ A;  1LA3 A;  2E30 A;  3JVT B;  2KGR A;  4FTG A;  2NCO A;  4PE4 A;  3SIB A;  4PAL A;  2F2P A;  2KDH A;  4PHN A;  2JTT A;  2KYC A;  3AKA A;  4PHJ A;  1B4C A;  1CMF A;  1G4Y R;  2CTN A;  2D8N A;  4N1G A;  2LLS A;  3TUY C;  1A75 B;  2L4H A;  1OMD A;  1QXP A;  1KFX L;  4MVF A;  1JF2 A;  1JFK A;  2JUL A;  1SCM C;  2WCE A;  4AOM A;  2FCD A;  5K89 A;  3OX6 A;  4I5L B;  3VRQ A;  1K90 D;  1KK8 C;  3WHU B;  2K0J A;  2M29 A;  2OPO A;  2H2K A;  2I2R E;  5D69 A;  1U5I A;  1QV0 A;  4I5N B;  2KNE A;  2COL B;  2JT8 A;  1SR6 B;  5DKN A;  1S5G Y;  4P5O E;  1C7W A;  2BL0 C;  3TS5 C;  1DJG A;  1MWN A;  5IBW A;  2MA2 A;  3D0Y B;  1N65 A;  3BUO B;  2EC6 C;  1TRF A;  4I5J A;  5HKW A;  2JT0 A;  1K8U A;  1DGV A;  1BOD A;  1N0Y A;  1EG4 A;  2M9G A;  3FIA A;  5JOL A;  1W7I B;  3OB1 B;  2LMU A;  4OCI A;  1ALV A;  1WRZ A;  2HPS A;  1CLB A;  1UUR A;  3PM8 A;  1S6I A;  1DJX A;  2KAY A;  1JSA A;  1MXE A;  1QVI Z;  3EKH A;  3OB2 B;  1AK8 A;  4MLW A;  3A8R A;  2CNP A;  3NSK A;  3VRP A;  1IRJ A;  1WRK A;  4GGN A;  4Q04 A;  3TDZ A;  3H4S E;  3O78 A;  1CMG A;  1J55 A;  2VRG A;  2EGD A;  1IQ3 A;  3BXK A;  1TNX A;  3SG5 A;  3M0W A;  3OP0 A;  1FI5 A;  4PE1 A;  2LM5 A;  3JVT C;  4YGC B;  1NX3 A;  1EG3 A;  2L4I A;  4OV2 A;  1CLM A;  2LVK A;  2Y1M A;  2L2E A;  3BUW B;  4CFR A;  1AP4 A;  1YUS A;  1YVL A;  2M97 A;  1SL9 A;  2DOQ A;  1CB1 A;  2LVV A;  2OS8 B;  1MXL C;  1KFX S;  1CTR A;  4AQJ A;  1SBJ A;  5AXI A;  2JU0 A;  2KQ6 A;  4DS7 A;  1EL4 A;  1J7P A;  2JC2 A;  2F8P A;  2LP3 A;  1GQM A;  3EK8 A;  1GJY A;  1BR4 B;  1QTX A;  1BMO A;  5AEQ A;  3I5H B;  1H8B A;  1IG5 A;  1W7J B;  2BCX A;  4DIR A;  4JPZ B;  1SR6 C;  4NDB A;  4ORC B;  3ZNI A;  2M0R A;  5I2Q A;  2WCB A;  4DCK A;  1XFV O;  4MZJ A;  4MSP A;  1QX2 A;  2RGI A;  2KBI A;  3SJS A;  4A4B A;  3GK2 A;  1YX8 A;  1WDC B;  1B9A A;  2MBX A;  1B47 A;  1NCY A;  2LUX A;  3SG7 A;  2KFH A;  2PSR A;  2SAS A;  3I5G B;  4BY4 A;  1DVI A;  3C1V A;  1AHR A;  1J7R A;  4GAO A;  5BPJ A;  1EXR A;  3EKJ A;  4GGF A;  1YR5 A;  5HLO A;  2JTZ A;  1CM1 A;  3BQ3 A;  3FWC A;  1AJ5 A;  1PUL A;  2LVI A;  1QLS A;  1YUT A;  2K2A A;  1Y1U A;  1F4O A;  4ORB B;  2AMI A;  1Y1X A;  2E6W A;  1DF0 A;  1S6C A;  2MJW B;  1NYA A;  2M49 B;  3D10 A;  5HLV A;  2L0P A;  2M7N A;  1LA0 A;  3PSR A;  1S1E A;  5HKY A;  5F6T A;  5DKQ A;  2ZKM X;  2CT9 A;  1FI6 A;  3BYA A;  1B7T Z;  1UUS A;  2LP2 A;  2HQW A;  4USL A;  1PSR A;  3AAJ A;  4P2Y B;  1TCO B;  3BOW B;  1NWD A;  2OS8 C;  1IWQ A;  2O60 A;  2BKH B;  2OTG B;  1M45 A;  1CM4 A;  2JPT A;  1F8H A;  1TCF A;  1NX0 A;  2KFG A;  3I5H C;  2K7O A;  4PCW A;  2LCP A;  5J3X A;  3LK0 A;  2F3Z A;  4MRY A;  1OMR A;  5CSF A;  1VRK A;  4ZCU A;  3PAL A;  1J1D A;  1TNQ A;  3DVM A;  1NIW A;  5FYX A;  4A4C A;  1WDC C;  2BBM A;  4ETO A;  2EHB A;  2PVB A;  4MBE A;  1CDM A;  3I5G C;  1KQV A;  5KSZ A;  2JNX A;  1HQV A;  2H61 A;  1HT9 A;  3CZT X;  1RTP 1;  1D1O A;  3DVE A;  3LCP C;  1M31 A;  1CDP A;  3PLF B;  2R2I A;  1K9P A;  1EJ3 A;  2ZN8 A;  3DVK A;  1JC2 A;  3NSL A;  3ICB A;  1CDL A;  3HCM A;  4MEW A;  4ORA B;  4YRU A;  2CCM A;  1XFY O;  1YX7 A;  1NX2 A;  1OSA A;  2HET A;  1TNP A;  1BR1 B;  1UP5 A;  4HRE E;  3SG3 A;  2JT3 A;  2TN4 A;  2KBM A;  2L5X B;  1F4Q A;  4N5X A;  4XJK A;  2BKI B;  1F55 A;  2LLU A;  2IS9 A;  2ZNE A;  1ZAC A;  1XFZ O;  1QIV A;  2WOR A;  3FS7 A;  5CPV A;  1FBV A;  4HRH A;  1BOC A;  5I2L A;  2PMY A;  1OZO A;  2JXC A;  1JF0 A;  1JBA A;  1WY9 A;  2PAL A;  3WHT B;  1PSB A;  1K9K A;  2QAC A;  1OOJ A;  1IH0 A;  1MR8 A;  1ZFS A;  1QX5 B;  1QV1 A;  2OTG C;  3PAT A;  3LLE A;  4F0Z B;  1LXF C;  2LC5 A;  3TDU A;  1PVB A;  4ICB A;  1NUB A;  3VRR A;  4YGD B;  4GBA A;  3SIA A;  3I5F B;  4CPV A;  1M39 A;  1NSH A;  2JXL A;  4IL1 A;  4MZL A;  4WQ3 A;  2K2F A;  1A4P A;  5CSJ A;  1TOP A;  3VRN A;  2KFF A;  4OKH A;  1YTZ C;  2KQY A;  2WC8 A;  2FCE A;  3HX4 A;  3EK4 A;  1SY9 A;  3TDI A;  4YI9 A;  1QLK A;  1K95 A;  1V1G A;  2GGZ A;  2JZI A;  3GOF A;  1NX1 A;  1C07 A;  4NDD A;  1TTX A;  2QPT A;  1QAS A;  3RLZ A;  4CID A;  3WXA A;  2F3Y A;  1DJI A;  2WCF A;  4GNK B;  2LAN A;  1SKT A;  1SRA A;  4N1F A;  1H4B A;  4C0K A;  2O5G A;  1UHN A;  1Q80 A;  1TNW A;  2V53 A;  3RM1 A;  1QVI Y;  2NLN A;  2NXQ A;  4GUK A;  2K7C A;  1DGU A;  4YGA A;  1XA5 A;  2HF5 A;  1S36 A;  2BE6 A;  4WQ2 A;  1KFU L;  2AUC A;  2GV5 A;  1XK4 C;  1X02 A;  2LLT A;  2PAS A;  1F70 A;  3PFV A;  3O6B A;  2KAX A;  1ZUZ A;  2MRD A;  1BJF A;  2Y4Q A;  1ZOT B;  1SL8 A;  2LHL A;  1G33 A;  2ISD A;  2ZN9 A;  3KF9 A;  2FJU B;  3PN7 B;  2G2B A;  4NQG A;  4YBH B;  3LL8 B;  1L2O B;  3I5F C;  4HRG A;  1LKJ A;  1U5I B;  1QJT A;  1OE9 B;  4TNC A;  1DT7 B;  1S26 D;  4YI8 A;  5CSI A;  1RRO A;  3EVV A;  1R2U A;  3EVR A;  4MZK A;  4UPG A;  5ER5 A;  2NZ0 A;  2CBL A;  3BUN B;  4XJK B;  5B8I B;  1S3P A;  1SW8 A;  2Q4U A;  2I18 A;  3AKB A;  1F54 A;  4CLN A;  1M63 B;  2KI6 D;  4DUQ A;  1KWO B;  3CR4 X;  3KEV A;  4BY5 A;  3O2P A;  1A03 A;  3K21 A;  1KSO A;  1UHK A;  3CTN A;  1DJZ A;  1TIZ A;  3AAK A;  3TZ1 A;  1WRL A;  2JOJ A;  5GQQ C;  2M1U A;  2WND A;  1JUO A;  1IKU A;  4NDC A;  2MAZ A;  2ZRS A;  2LHI A;  4M2O A;  1KFU S;  5AAN A;  2M7L A;  1SK6 D;  2ZFD A;  3BUM B;  1RWY A;  1PRW A;  1PAL A;  1YUU A;  2B1U A;  3DVJ A;  3DF0 A;  1NP8 A;  1NCZ A;  3MSE B;  3OX5 A;  4HSZ A;  1B7T Y;  4XYN A;  2Q91 A;  3LK1 A;  1K9U A;  1SCV A;  3IQQ A;  2CXJ A;  1EH2 A;  3PN7 C;  4GPL B;  1WLM A;  1L2O C;  1SYM A;  1L7Z A;  2PRU A;  2BBN A;  1WLZ A;  3NXA A;  1DJY A;  1YRU B;  4JQ0 D;  1AVS A;  2K7B A;  1GGW A;  1K2H A;  1S6J A;  4MN0 A;  2L50 A;  2LVJ A;  2MLE C;  4QJ3 B;  1CLL A;  2I7A A;  4OR9 B;  3FWB A;  1JWD A;  2KAV A;  1QS7 A;  2LMT A;  5HYD A;  1BG1 A;  3I5I B;  1RJV A;  2I94 A;  1CNP A;  1OQP A;  1YUR A;  1XFW O;  1KWO C;  1OMV A;  3CGA A;  3JTD B;  3ZWH A;  1REC A;  2MLF C;  1XYD A;  5JJG A;  5I8N A;  4C0L A;  1K94 A;  1DTL A;  1OZS A;  4U8D A;  4CFQ A;  1QAT A;  2KHN A;  1QX7 A;  5TNC A;  2KI4 B;  2F33 A;  1YVH A;  1K96 A;  3BOW A;  3CR2 A;  2KI6 C;  2M8U A;  3KPX A;  4M2P A;  4PDZ A;  4AQI A;  1DF0 B;  3OHM B;  1FPW A;  3BUX B;  3GK4 X;  3SG4 A;  1J1E A;  3KHE A;  3O4Y A;  2K7D A;  2BCB A;  1IGV A;  1SNL A;  3GK1 A;  1IJ6 A;  2L98 A;  2KSP A;  1SL7 A;  5DKR A;  4OVN F;  1FF1 A;  1A29 A;  5CSN A;  4WRI A;  2LV7 A;  1LIN A;  1ALW A;  2K61 A;  2KYF A;  1XFU O;  1B1G A;  1FW4 A;  4PE7 A;  4QJ4 B;  2FOT A;  1UHJ A;  1A75 A;  1MUX A;  1F71 A;  1B8R A;  3NSI A;  5I2O A;  2LUC A;  2JWW A;  2MHH A;  4L9M A;  1BU3 A;  4QJ5 B;  1E8A A;  1CKK A;  5PAL A;  3F45 A;  1B8L A;  1IQ5 A;  2LAP A;  4R1E A;  2M1K B;  4YGE B;  5HKZ A;  2JNF A;  1CFC A;  3EVU A;  3I5I C;  3NSO A;  4DRW A;  1MQ1 A;  1CFD A;  2BEC A;  5G08 A;  1PK0 D;  3KO0 A;  1BLQ A;  3D0Y A;  1A2X A;  3SG2 A;  2K8M B;  1DMO A;  1XFX O;  2JQ6 A;  2M3W A;  4FQO A;  4MRX A;  5KU1 A;  1KQM B;  2L51 A;  3JTD C;  1JFJ A;  3DF0 B;  4GGF C;  4PE0 A;  2LE9 B;  1XK4 A;  1AJ4 A;  2AAO A;  1J7O A;  1UHH A;  2NCP A;  1KCY A;  1CFP A;  3EK7 A;  1MF8 B;  2KI4 C;  1KSM A;  2ZRT A;  2A4J A;  1DJW A;  1C7V A;  1Y1A A;  2F2O A;  1MHO A;  1UHI A;  3TUY B;  3VRO A;  2GGM A;  4PHK A;  3QRX A;  1SCM B;  3IF7 A;  3CLN A;  4YGB B;  5D7F A;  2KGB C;  3CR5 X;  1IJ5 A;  2G9B A;  1GGZ A;  1KK8 B;  1DJH A;  1LVC D;  1KK7 Z;  4I5K A;  1J7Q A;  1V1F A;  1Y0V H;  1G8I A;  2JRF A;  3VGO A;  1M46 A;  2Y1N A;  1BF5 A;  1AUI B;  3CS1 A;  1BT6 A;  1RFJ A;  2P6B B;  2SCP A;  3CWG A;  4M2Q A;  4E68 A;  2BL0 B;  3TS5 B;  1SPY A;  2BCA A;  5ER4 X;  1QIW A;  3A4U B;  1CFF A;  2EC6 B;  4D1E A;  1TN4 A;  3E3R A;  1K93 D;  1NPQ A;  5KTY A;  1Y6W A;  4ZCV A;  1CDN A;  1RK9 A;  1XO5 A;  2HQ8 A;  4C0J A;  1XVJ A;  1SMG A;  1N2D A;  2LMV A;  3DD4 A;  3SG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...