1YX7A

Nmr structure of calsensin, energy minimized average structure.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
83
structure length
83
Chain Sequence
b'MACKVKAELEAAFKKLDANGDGYVTALELQTFMVTLDAYKALSKDKVKEASAKLIKMADKNSDGKISKEEFLNANAELLCQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calsensin
publication title Solution structure and backbone dynamics of Calsensin, an invertebrate neuronal calcium-binding protein.
pubmed doi rcsb
source organism Haemopis marmorata
molecule tags Metal binding protein
total genus 14
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yx7A00
2KQ6A 3K21A 2OS8C 4TNCA 1JBAA 1G4YR 1DMOA 3PSRA 1NX3A 2LANA 5HKWA 1AK8A 1CFCA 1IKUA 4CLNA 2M1UA 1BF5A 2K0JA 3BXKA 3CR2A 1BR4B 1DGVA 1ZACA 4AOMA 1ALWA 1B7TY 1J7RA 1QIWA 1GGZA 2BCAA 4AQIA 2MLFC 4ZCVA 2LHIA 1LA0A 3FS7A 1SL9A 2KBMA 4CFRA 4OVNF 1IQ3A 2KAYA 1QATA 2G9BA 3CWGA 4FQOA 5F6TA 4PE7A 1F55A 2LHLA 4MZLA 3DVJA 2NZ0A 3EKJA 3MSEB 4MBEA 1LXFC 1K90D 2F2PA 2BE6A 2M8UA 4D1EA 1XK4C 2OS8B 1DF0A 1DTLA 2M7LA 2LVIA 1IGVA 2B1UA 1J7QA 1ZFSA 2TN4A 1EXRA 1Y1UA 2ISDA 1F4QA 2BBNA 3TUYB 2MAZA 3PN7C 4GGFC 2OTGB 3FWCA 4XYNA 5G08A 1WRLA 4MSPA 2HQ8A 4C0JA 5I8NA 3RLZA 3DVEA 5I2QA 3D0YB 1QLKA 1RFJA 1OE9B 3E3RA 1R6PA 1NWDA 2L5XB 1K95A 4DCKA 1XFWO 2KFGA 1AUIB 4NDDA 3EK8A 2JXCA 3RM1A 1NCZA 2K61A 4PE4A 3ICBA 1BOCA 2LVJA 1J7OA 2PMYA 1WDCC 1ZMZA 2JT8A 1SNLA 2LLUA 1QV0A 2CT9A 1PRWA 5HKZA 3I5HC 4R1EA 3EK7A 2LLSA 1YRUB 4I5LB 3ZNIA 2L51A 1CLBA 2I94A 2KAVA 4GPLB 1MHOA 2FOTA 3KEVA 4HRHA 4PHNA 1CKKA 1IQ5A 3OX6A 2CNPA 1YX7A 2JRFA 3LCPC 2FCDA 3SJSA 1AJ4A 3A8RA 2LUCA 2MLEC 2PVBA 1J55A 1B47A 2ZN8A 1M45A 3DVMA 4M2OA 5J3XA 3VRRA 1EG3A 1CFPA 1A75B 4OKHA 2GGMA 1PSRA 1VRKA 1KK8B 3DF0B 1KWOC 2JT0A 3HCMA 1TTXA 3H4SE 1B8LA 2ZRSA 3KPXA 1TCFA 1JF0A 1K9UA 1KQMC 1DJWA 1SW8A 3EK4A 5D7FA 5TNCA 4YI8A 2ZN9A 1JC2A 3I5GB 2QPTA 1UHIA 1HQVA 2BKIB 4QJ3B 1MQ1A 3OHMB 4F0ZB 2MJWB 1TNQA 4OR9B 2Q4UA 3DD4A 3CZTX 2WCBA 2PSRA 4MEWA 1DJXA 5ER5A 2JXLA 1XK4A 1XFVO 4BY5A 1TRFA 1K8UA 1CTRA 3BUWB 1XVJA 4C0KA 5HKYA 4GFTA 4PALA 1C7WA 1UHJA 1NX1A 4XJKA 2K2AA 2AAOA 1RTP1 5AEQA 1SR6B 4GGFA 2KFFA 1DF0B 3I5IC 3QRXA 1JF2A 3PLFB 1IJ5A 1S1EA 1M46A 4CPVA 2NLNA 1BODA 1QTXA 1EL4A 2CBLA 1U5IA 1B8CA 1K94A 1UWOA 2EC6C 1KFUL 4JWQA 1A29A 2V53A 3CGAA 1OZOA 3WNXB 3O78A 5I2OA 1QVIZ 2KI6D 4IL1A 1BG1A 2I18A 2O60A 4WRIA 1FBVA 2HPSA 3F45A 1V1GA 2FJUB 1SYMA 3DF0A 1B7TZ 1FI5A 2KNEA 1KK7Y 1UURA 2LC5A 2M0RA 3SG5A 2JOJA 4GAOA 1IWQA 4P2YB 1OMVA 3LL8B 2A4JA 1XFXO 2K7OA 2HF5A 1KFXS 1F8HA 1IJ6A 3ZWHA 1XA5A 1H8BA 1PALA 1PK0D 1GJYA 3I5FC 4MZKA 2PRUA 4USLA 1NP8A 1OMRA 1UP5A 1SCMB 2EGDA 2ZFDA 3SG6A 4MRYA 3TS5B 5DKNA 3VRPA 1CMGA 1YUUA 2COLB 1NIWA 1XFUO 2L98A 2K7DA 4WQ2A 4C0LA 2FCEA 1CM4A 3BUMB 1QASA 5B8IB 3KF9A 4OV2A 1X02A 1DJHA 2KI6C 5D69A 2GV5A 1MF8B 2LM5A 2BKHB 4YGCB 4DIRA 4DS7A 2KGBC 1RK9A 5K89A 1XFYO 3LLEA 2OPOA 3BOWA 2WCEA 1RECA 3PATA 1JWDA 3EVUA 1TIZA 2KOTA 2LMTA 1AVSA 2JTTA 1M31A 4ORAB 4PE0A 1QXPA 1SKTA 1M63B 2DOQA 1G8IA 1LINA 2JC2A 2G2BA 3AKAA 4ICBA 2NCPA 1YUSA 1YR5A 1MWNA 1CLMA 1IRJA 4GGNA 1S3PA 1L2OC 1PULA 2JTZA 4DRWA 3CS1A 4N1FA 1SRAA 2PALA 2M9GA 4N5XA 3DVKA 1CDLA 1OMDA 4MLWA 1SY9A 1XYDA 2BE4A 1CLLA 2JNFA 2KYCA 3SG2A 4XJKB 2H61C 1W7IB 3PN7B 2WORA 4FTGA 1CFFA 1IH0A 2BBMA 4N1GA 4YGEB 2PASA 1M39A 3VRQA 2LVVA 2ZNEA 2M97A 1NUBA 2JQ6A 2KI4C 2WOSA 5FYXA 1CMFA 1U5IB 2JNXA 2Q91A 4MN0A 1C7VA 1IG5A 2CXJA 3C1VA 1LKJA 2F33A 1SL7A 3BUNB 3EKHA 3JTDC 1LVCD 1TCOB 3FIAA 1HT9A 1XO5A 2RGIA 4ZCUA 2KSPA 5PALA 1YTZC 3GK2A 3OX5A 1CNPA 1UHHA 3TDIA 2I2RE 1CM1A 1WDCB 1OQPA 3AAJA 4U8DA 1YUTA 1G33A 1PVAA 1NCYA 4ETOA 2MHHA 1A2XA 3I5HB 3TDUA 1UUSA 1EG4A 1BU3A 2ZNDA 1YX8A 2IS9A 1YVHA 2LLTA 3SG3A 5JOLA 5ER4X 2P6BB 1RJVA 4ORCB 3VGOA 2HETA 4OCIA 2WC8A 1WLMA 2BCXA 1K9KA 3GK4X 3JVTC 4DUQA 2LMUA 1A03A 3JTDB 2D8NA 2L4HA 1S5GZ 2Y1MA 1BT6A 3PALA 1RWYA 1CDPA 2WNDA 1AHRA 1WRZA 3SG4A 1C07A 1KWOB 5DKQA 2EHBA 1J1EA 1TOPA 1Q80A 2KDHA 2M3WA 1B4CA 2R2IA 1WRKA 1OSAA 2MA2A 4MZJA 4UPGA 5IBWA 1KQMB 2M1KB 1NCXA 2WCFA 1BLQA 1NPQA 1KK7Z 4A4BA 1DJYA 1SL8A 2E6WA 3BOWB 3OP0A 4HREE 4PDZA 2BL0C 2F3ZA 2NCOA 1K96A 2JPTA 1GGWA 1DJIA 1H4BA 4PHMA 3JVTB 3NSLA 2JZIA 1S6CA 3BUOB 4Q04A 1CB1A 3BUXB 2AUCA 2NXQA 2H2KA 1N0YA 2LE9B 2JWWA 1FF1A 5AERA 2KYFA 1KFXL 3HX4A 2H61A 1QJTA 3BQ3A 3IQQA 1BR1B 1JFJA 4AQJA 5AFPA 2HQWA 2LAPA 1YURA 2SCPA 3I5IB 5DKRA 3GOFA 4NDBA 4ORBB 2KAXA 2F3YA 5CSNA 1QLSA 1S26D 3PFVA 4GNKB 3VRNA 4HSZA 2EC6B 3OB2B 3LK0A 1KSOA 3SIAA 1BJFA 2BL0B 5AXIA 1S6IA 4I5KA 5BPJA 1CDMA 2KFHA 2ZRTA 3GK1A 3LK1A 1SPYA 4GUKA 2LV7A 5HLVA 2CCMA 4CIDA 1K2HA 2L2EA 3NSOA 2MRDA 1CDNA 1QX7A 1MXEA 1QVIY 3O2PA 4A4CA 1TN4A 3TUYC 2K7CA 2O5GA 3WHUB 2OTGC 1JSAA 3NSIA 1F54A 5AANA 1ODBA 2K2FA 1F4OA 1OOJA 1ALVA 3I5FB 4I5JA 1J1DA 5CSIA 1SCVA 2L50A 5I2LA 2L0PA 2LP2A 3VROA 2JULA 4WQ3A 1RROA 1MXLC 4YBHB 1V1FA 1QV1A 1QX2A 4NDCA 1S6JA 4M2QA 1UHNA 2KHNA 2VRGA 1NYAA 3FWBA 4MRXA 1TNWA 4JPZB 5HLOA 2MBXA 1UHKA 1SBJA 1KQVA 2LNKA 1DT7B 4QJ5B 3A4UB 3PM8A 5GQQC 2KBIA 2BCBA 2QACA 1EJ3A 1FW4A 3M0WA 3TDZA 1Y0VH 2I7AA 4JQ0D 4YRUA 3KO0A 1DJGA 1YRTB 1B1GA 4P5OE 2F2OA 3WHTB 1B8RA 1Y6WA 1TNXA 2Y1NA 4YGAA 1KK8C 1JUOA 3CTNA 4L9MA 4YI9A 2Y4QA 1EH2A 2JT3A 5JJGA 1L2OB 2K7BA 2K8MB 1F70A 1Y1AA 1K93D 1XFZO 3D10A 4YGDB 1WLZA 3I5GC 3NSKA 1DVIA 3BYAA 2M7NA 2LVKA 1MUXA 2ZKMX 2E30A 3EVVA 1E8AA 4M2PA 1FPWA 2KI4B 1AP4A 4PHKA 1Y1XA 4YGBB 4E68A 1QS7A 1ZOTB 4I5NB 3SIBA 4MVFA 3AKBA 3CR4X 3EVRA 5CSJA 2KQYA 1J7PA 2LMVA 1FI6A 1NX0A 1QX5B 1SR6C 1SMGA 5KTYA 1N65A 1NX2A 1MR8A 1DJZA 3D0YA 1OZSA 2GGZA 5CPVA 1S36A 4QJ4B 3CLNA 2M49B 1AJ5A 3O4YA 4GBAA 5KSZA 2L4IA 2Y5IA 1D1OA 2SASA 1QIVA 5HYDA 1NSHA 1N2DA 1B9AA 3NXAA 1WY9A 1BMOA 4BY4A 4PE1A 1A4PA 1CFDA 3O6BA 4HRGA 1JFKA 2JU0A 4NQGA 3SG7A 4PCWA 1DGUA 1F71A 1ZUZA 3AAKA 1KSMA 1YVLA 1GQMA 2BECA 1TNPA 1S5GY 1PVBA 1R2UA 5KU1A 1SCMC 1K9PA 3TZ1A 3OB1B 2CTNA 1KFUS 1L7ZA 2M29A 2LUXA 3IQOA 3TS5C 1SK6D 4PHJA 2KGRA 1W7JB 3KHEA 2LCPA 2LP3A 4CFQA 3WXAA 1LA3A 1A75A 5CSFA 3CR5X 3IF7A 2F8PA 1PSBA 1KCYA 2AMIA
chains in the Genus database with same CATH superfamily
2KQ6A 3K21A 2OS8C 2WCHA 4TNCA 4KYNA 1JBAA 1G4YR 1DMOA 3PSRA 1NX3A 2LANA 5HKWA 1AK8A 1CFCA 1Z2CB 1IKUA 4CLNA 2M1UA 1BF5A 2K0JA 3BXKA 3CR2A 1BR4B 1DGVA 1ZACA 4AOMA 1ALWA 1B7TY 1J7RA 1QIWA 1GGZA 2BCAA 4AQIA 2MLFC 4ZCVA 2LHIA 3SS4A 1LA0A 3FS7A 1SL9A 2KBMA 4CFRA 4OVNF 1IQ3A 2KAYA 1QATA 2G9BA 3CWGA 4FQOA 5F6TA 4IJ7A 4PE7A 1F55A 2LHLA 4MZLA 3DVJA 2NZ0A 3S0AA 2FJYA 3EKJA 3MSEB 4MBEA 1LXFC 2P71A 1K90D 2F2PA 2BE6A 2M8UA 2WCJA 4D1EA 1XK4C 2OS8B 1DF0A 1DTLA 2M7LA 1C3YA 2LVIA 1OOGA 1IGVA 2B1UA 1J7QA 1ZFSA 2TN4A 1EXRA 1Y1UA 2ISDA 2H8VA 1F4QA 2BBNA 3TUYB 2MAZA 2WC6A 3PN7C 4GGFC 2OTGB 3FWCA 3VB1A 4XYNA 5G08A 1WRLA 4MSPA 2HQ8A 4C0JA 5I8NA 3RLZA 3DVEA 5I2QA 3D0YB 2PYQA 1QLKA 1RFJA 1OE9B 3E3RA 1R6PA 1NWDA 2L5XB 1K95A 4DCKA 1XFWO 2KFGA 1AUIB 4NDDA 3EK8A 2JXCA 3RM1A 1NCZA 2K61A 4PE4A 3ICBA 1BOCA 2LVJA 1J7OA 2PMYA 1WDCC 1XFRA 1ZMZA 1SNLA 2JT8A 2LLUA 1QV0A 2CT9A 1PRWA 5HKZA 3I5HC 4R1EA 3EK7A 2LLSA 1YRUB 4I5LB 3ZNIA 2L51A 1CLBA 2I94A 2KAVA 3K1EA 1MHOA 2FOTA 3KEVA 4GPLB 4HRHA 4PHNA 4FQTA 5EL2A 1CKKA 1IQ5A 1DQEA 3OX6A 1LS8A 2CNPA 1YX7A 2JRFA 3LCPC 2FCDA 3SJSA 5HL1A 1AJ4A 3A8RA 2LUCA 2MLEC 2PVBA 1J55A 1B47A 2WCLA 1M45A 1TUZA 2ZN8A 3DVMA 4M2OA 5J3XA 3VRRA 1EG3A 1CFPA 1A75B 4OKHA 2GGMA 1PSRA 1VRKA 1KK8B 3DF0B 1KWOC 2JT0A 3HCMA 1TTXA 3H4SE 1B8LA 2JPOA 2ZRSA 4PT1A 3NHIA 3KPXA 1TCFA 1JF0A 1K9UA 1KQMC 1DJWA 1SW8A 3EK4A 5D7FA 3UNWA 5TNCA 4YI8A 2ZN9A 1JC2A 3I5GB 2QPTA 1UHIA 1HQVA 1Z4HA 2BKIB 4OZDA 4QJ3B 1MQ1A 3OHMB 4F0ZB 2MJWB 1TNQA 4OR9B 2Q4UA 3DD4A 3CZTX 2WCBA 2PSRA 4MEWA 1DJXA 5ER5A 2JXLA 1XK4A 1XFVO 4BY5A 1TRFA 1K8UA 1CTRA 2WCMA 1XVJA 3BUWB 4C0KA 5HKYA 2K60A 4GFTA 4PALA 2QEBA 1C7WA 1UHJA 3CYZA 1NX1A 4XJKA 2K2AA 2AAOA 1RTP1 3BJHA 1SR6B 4GGFA 2KFFA 5AEQA 1DF0B 3B88A 3I5IC 3QRXA 1JF2A 3D76A 3PLFB 1IJ5A 1S1EA 1M46A 4CPVA 2NLNA 1BODA 1QTXA 1EL4A 2CBLA 1U5IA 1B8CA 1K94A 1UWOA 2EC6C 1KFUL 4JWQA 1A29A 2V53A 3CGAA 1OZOA 3WNXB 3O78A 3O4XA 1DEKA 5I2OA 1QVIZ 2KI6D 3SS3A 3EG5B 4IL1A 1BG1A 2I18A 2O60A 4WRIA 1FBVA 2HPSA 3F45A 2YGUA 1V1GA 2FJUB 1SYMA 3DF0A 1B7TZ 1FI5A 2KNEA 1KK7Y 1UURA 2LC5A 2M0RA 3SG5A 2JOJA 4GAOA 3RZSA 1IWQA 4P2YB 1OMVA 3LL8B 2A4JA 1XFXO 2K7OA 2HF5A 1KFXS 1F8HA 1IJ6A 3ZWHA 1XA5A 1H8BA 1PALA 1PK0D 1IIOA 1GJYA 3I5FC 4MZKA 2PRUA 4USLA 3UO9A 1NP8A 1OMRA 1UP5A 1SCMB 2EGDA 2KLEA 2ZFDA 3SG6A 3NHTA 4MRYA 3TS5B 5DKNA 3VRPA 1CMGA 1YUUA 2COLB 5D3OA 1NIWA 1XFUO 2L98A 2K7DA 3N7HA 3S0BA 4WQ2A 4C0LA 2FCEA 1CM4A 3BUMB 1QASA 5B8IB 3KF9A 4OV2A 1X02A 3D74A 1DJHA 1C3ZA 3NGVA 2KI6C 5D69A 2GV5A 1MF8B 3CZ0A 3L4LA 2LM5A 2BKHB 4YGCB 4DIRA 4DS7A 1GM0A 2KGBC 1RK9A 5K89A 1XFYO 3LLEA 2OPOA 3BOWA 2WCEA 2QEVA 1RECA 3PATA 3IVTA 1JWDA 3EVUA 1TIZA 2KOTA 2LMTA 1AVSA 2JTTA 1M31A 4ORAB 3BFHA 4PE0A 1QXPA 1SKTA 1M63B 2DOQA 1G8IA 1LINA 1TUJA 2G2BA 2JC2A 3AKAA 4ICBA 2NCPA 1YUSA 1YR5A 1MWNA 1OOHA 1CLMA 3D75A 4F7FA 1IRJA 4GGNA 1S3PA 1L2OC 1PULA 2JTZA 4DRWA 5DICA 3CS1A 4N1FA 1SRAA 2PALA 3V2LA 2M9GA 4N5XA 2BAPA 3DVKA 1CDLA 1OMDA 3FE6A 4MLWA 1SY9A 2ERBA 1XYDA 2BE4A 1CLLA 2JNFA 2KYCA 3QMEA 3SG2A 4XJKB 3S0DA 2H61C 1W7IB 3PN7B 2WORA 4FTGA 1CFFA 1IH0A 2BBMA 4N1GA 4YGEB 2PASA 1M39A 3VRQA 2LVVA 2ZNEA 2M97A 1NUBA 2JQ6A 2KI4C 2WOSA 5FYXA 1CMFA 2L5YA 1U5IB 2JNXA 2Q91A 4MN0A 1C7VA 1IG5A 2CXJA 3C1VA 1LKJA 2F33A 1SL7A 3BUNB 3EKHA 3JTDC 1LVCD 1TCOB 3FIAA 2KPHA 1HT9A 1XO5A 2RGIA 4ZCUA 2KSPA 5PALA 1YTZC 1ORGA 2QEHA 3GK2A 3CDNA 3OX5A 1UHHA 1CNPA 3TDIA 2I2RE 1CM1A 1WDCB 1OQPA 3AAJA 4U8DA 1YUTA 3FE8A 1G33A 1PVAA 2GTEA 1NCYA 4ETOA 2MHHA 3B6XA 1A2XA 3I5HB 3TDUA 1UUSA 1EG4A 1BU3A 2ZNDA 4JD9A 4JKTA 1YX8A 2IS9A 1YVHA 2LLTA 3PM2A 3SG3A 3S0FA 5JOLA 5ER4X 3R1VA 2P6BB 1RJVA 4ORCB 3VGOA 2HETA 4OCIA 2WC8A 1WLMA 2BCXA 1K9KA 3GK4X 3JVTC 4DUQA 2LMUA 1A03A 3JTDB 2D8NA 1QWVA 2L4HA 1S5GZ 2Y1MA 1BT6A 3PALA 1RWYA 1CDPA 2WNDA 5I94A 1AHRA 1WRZA 3SG4A 1C07A 1KWOB 3CABA 2EHBA 1J1EA 5DKQA 1TOPA 1Q80A 2KDHA 2M3WA 1B4CA 2R2IA 1WRKA 1OSAA 2MA2A 4MZJA 4UPGA 5IBWA 1KQMB 2M1KB 1NCXA 2WCFA 1BLQA 1NPQA 1KK7Z 4A4BA 1DJYA 1SL8A 2E6WA 3BOWB 3OP0A 4HREE 4PDZA 2BL0C 3OBVA 2F3ZA 2NCOA 1K96A 2JPTA 1GGWA 1DJIA 1H4BA 3BFAA 3JVTB 4PHMA 3B87A 3NSLA 2JZIA 1S6CA 3BUOB 4Q04A 1CB1A 3D77A 3BUXB 2AUCA 2NXQA 2H2KA 3FE9A 1N0YA 2LE9B 2JWWA 1FF1A 5AERA 3D73A 2KYFA 1KFXL 3HX4A 2H61A 1QJTA 3BQ3A 3IQQA 1BR1B 1JFJA 2L2CA 4AQJA 5AFPA 2HQWA 2LAPA 1YURA 2SCPA 2BNXA 3I5IB 5DKRA 3GOFA 4NDBA 4ORBB 2KAXA 2F3YA 5CSNA 1QLSA 1S26D 3PFVA 4GNKB 3VRNA 4HSZA 2EC6B 3OB2B 3LK0A 1KSOA 3R1OA 3SIAA 1BJFA 2BL0B 5AXIA 1S6IA 4I5KA 5BPJA 1CDMA 2KFHA 2ZRTA 3GK1A 3LK1A 1SPYA 4GUKA 2LV7A 3PJIA 2CCMA 5HLVA 1DC1A 4CIDA 1K2HA 2L2EA 3NSOA 2MRDA 1CDNA 1QX7A 1MXEA 1QVIY 2P70A 3O2PA 4A4CA 3OGNA 1TN4A 3BFBA 3TUYC 2K7CA 2O5GA 3WHUB 2OTGC 1JSAA 3NSIA 3DZTA 1F54A 5AANA 1ODBA 2K2FA 2QDIA 1F4OA 1OOJA 1ALVA 3I5FB 4I5JA 1J1DA 5CSIA 1SCVA 2L50A 5I2LA 2L0PA 2LP2A 3VROA 2JULA 4WQ3A 1RROA 3CZ2A 1MXLC 4YBHB 1V1FA 1QV1A 1QX2A 4NDCA 1S6JA 4M2QA 1UHNA 3DY9A 2KHNA 2VRGA 1NYAA 3FWBA 4MRXA 1TNWA 4JPZB 5HLOA 2MBXA 1UHKA 1SBJA 1KQVA 2LNKA 1DT7B 4QJ5B 3L47A 1OOFA 3A4UB 3PM8A 5GQQC 1OOIX 2KBIA 2BCBA 2QACA 1EJ3A 1FW4A 3M0WA 3TDZA 1Y0VH 2I7AA 4JQ0D 4YRUA 1W9ZA 5FI6A 3KO0A 1DJGA 1P28A 1YRTB 1B1GA 4P5OE 2F2OA 3L4AA 3WHTB 1B8RA 3DYEA 1SSEB 1Y6WA 1TNXA 2Y1NA 4YGAA 1KK8C 1JUOA 3CTNA 4L9MA 4YI9A 2QEOA 2Y4QA 1EH2A 2JT3A 5JJGA 1L2OB 2K7BA 2K8MB 1F70A 3DXLA 1Y1AA 1K93D 1XFZO 3D10A 4YGDB 2PQLA 1WLZA 3I5GC 3NSKA 1DVIA 2KLDA 4INXA 3BYAA 2M7NA 2LVKA 1MUXA 2ZKMX 2E30A 3EVVA 1E8AA 4M2PA 5FI2A 2KI4B 3S0GA 1AP4A 1FPWA 4PHKA 1Y1XA 3CZ1A 4YGBB 4E68A 1QS7A 1ZOTB 1T14A 2WCKA 4I5NB 3SIBA 4MVFA 3AKBA 3CR4X 3EVRA 5CSJA 2KQYA 1J7PA 2LMVA 1FI6A 1NX0A 1QX5B 1SR6C 1SMGA 4INWA 5KTYA 1N65A 1NX2A 1MR8A 1DELA 1DJZA 3D0YA 1OZSA 3Q8IA 2GGZA 5CPVA 1S36A 4QJ4B 3CLNA 2M49B 1AJ5A 3O4YA 3R72A 4GBAA 5KSZA 2L4IA 2Y5IA 1D1OA 2SASA 1QIVA 5HYDA 1NSHA 1N2DA 1B9AA 2WC5A 1WY9A 1BMOA 3NXAA 4BY4A 4PE1A 5FI7A 1A4PA 1CFDA 3O6BA 3R1PA 1JFKA 2JU0A 4HRGA 4NQGA 3SG7A 4PCWA 3S0EA 3B7AA 3SS5A 1DGUA 1TWOA 1F71A 1ZUZA 3AAKA 1OW4A 1KSMA 1YVLA 1GQMA 2BECA 1TNPA 1S5GY 1PVBA 1R2UA 5KU1A 1SCMC 1K9PA 3TZ1A 3OB1B 2CTNA 1KFUS 1L7ZA 2M29A 2LUXA 3IQOA 3TS5C 1SK6D 4PHJA 2KGRA 1W7JB 3KHEA 3D78A 2LCPA 2LP3A 3B86A 4CFQA 3WXAA 1LA3A 1A75A 5CSFA 3CR5X 3IF7A 2F8PA 1PSBA 1KCYA 2AMIA
chains in the Genus database with same CATH topology
2KQ6A 3K21A 2OS8C 4TNCA 1JBAA 1G4YR 1DMOA 3PSRA 1NX3A 2LANA 5HKWA 1AK8A 1CFCA 1IKUA 4CLNA 2M1UA 1BF5A 2K0JA 3BXKA 3CR2A 1BR4B 1DGVA 1ZACA 4AOMA 1ALWA 1B7TY 1J7RA 1QIWA 1GGZA 2BCAA 4AQIA 2MLFC 4ZCVA 2LHIA 1LA0A 3FS7A 1SL9A 2KBMA 4CFRA 4OVNF 1IQ3A 2KAYA 1QATA 2G9BA 3CWGA 4FQOA 5F6TA 4PE7A 1F55A 2LHLA 4MZLA 3DVJA 2NZ0A 3EKJA 3MSEB 4MBEA 1LXFC 1K90D 2F2PA 2BE6A 2M8UA 4D1EA 1XK4C 2OS8B 1DF0A 1DTLA 2M7LA 2LVIA 1IGVA 2B1UA 1J7QA 1ZFSA 2TN4A 1EXRA 1Y1UA 2ISDA 1F4QA 2BBNA 3TUYB 2MAZA 3PN7C 4GGFC 2OTGB 3FWCA 4XYNA 5G08A 1WRLA 4MSPA 2HQ8A 4C0JA 5I8NA 3RLZA 3DVEA 5I2QA 3D0YB 1QLKA 1RFJA 1OE9B 3E3RA 1R6PA 1NWDA 2L5XB 1K95A 4DCKA 1XFWO 2KFGA 1AUIB 4NDDA 3EK8A 2JXCA 3RM1A 1NCZA 2K61A 4PE4A 3ICBA 1BOCA 2LVJA 1J7OA 2PMYA 1WDCC 1ZMZA 2JT8A 1SNLA 2LLUA 1QV0A 2CT9A 1PRWA 5HKZA 3I5HC 4R1EA 3EK7A 2LLSA 1YRUB 4I5LB 3ZNIA 2L51A 1CLBA 2I94A 2KAVA 4GPLB 1MHOA 2FOTA 3KEVA 4HRHA 4PHNA 1CKKA 1IQ5A 3OX6A 2CNPA 1YX7A 2JRFA 3LCPC 2FCDA 3SJSA 1AJ4A 3A8RA 2LUCA 2MLEC 2PVBA 1J55A 1B47A 2ZN8A 1M45A 3DVMA 4M2OA 5J3XA 3VRRA 1EG3A 1CFPA 1A75B 4OKHA 2GGMA 1PSRA 1VRKA 1KK8B 3DF0B 1KWOC 2JT0A 3HCMA 1TTXA 3H4SE 1B8LA 2ZRSA 3KPXA 1TCFA 1JF0A 1K9UA 1KQMC 1DJWA 1SW8A 3EK4A 5D7FA 5TNCA 4YI8A 2ZN9A 1JC2A 3I5GB 2QPTA 1UHIA 1HQVA 2BKIB 4QJ3B 1MQ1A 3OHMB 4F0ZB 2MJWB 1TNQA 4OR9B 2Q4UA 3DD4A 3CZTX 2WCBA 2PSRA 4MEWA 1DJXA 5ER5A 2JXLA 1XK4A 1XFVO 4BY5A 1TRFA 1K8UA 1CTRA 3BUWB 1XVJA 4C0KA 5HKYA 4GFTA 4PALA 1C7WA 1UHJA 1NX1A 4XJKA 2K2AA 2AAOA 1RTP1 5AEQA 1SR6B 4GGFA 2KFFA 1DF0B 3I5IC 3QRXA 1JF2A 3PLFB 1IJ5A 1S1EA 1M46A 4CPVA 2NLNA 1BODA 1QTXA 1EL4A 2CBLA 1U5IA 1B8CA 1K94A 1UWOA 2EC6C 1KFUL 4JWQA 1A29A 2V53A 3CGAA 1OZOA 3WNXB 3O78A 5I2OA 1QVIZ 2KI6D 4IL1A 1BG1A 2I18A 2O60A 4WRIA 1FBVA 2HPSA 3F45A 1V1GA 2FJUB 1SYMA 3DF0A 1B7TZ 1FI5A 2KNEA 1KK7Y 1UURA 2LC5A 2M0RA 3SG5A 2JOJA 4GAOA 1IWQA 4P2YB 1OMVA 3LL8B 2A4JA 1XFXO 2K7OA 2HF5A 1KFXS 1F8HA 1IJ6A 3ZWHA 1XA5A 1H8BA 1PALA 1PK0D 1GJYA 3I5FC 4MZKA 2PRUA 4USLA 1NP8A 1OMRA 1UP5A 1SCMB 2EGDA 2ZFDA 3SG6A 4MRYA 3TS5B 5DKNA 3VRPA 1CMGA 1YUUA 2COLB 1NIWA 1XFUO 2L98A 2K7DA 4WQ2A 4C0LA 2FCEA 1CM4A 3BUMB 1QASA 5B8IB 3KF9A 4OV2A 1X02A 1DJHA 2KI6C 5D69A 2GV5A 1MF8B 2LM5A 2BKHB 4YGCB 4DIRA 4DS7A 2KGBC 1RK9A 5K89A 1XFYO 3LLEA 2OPOA 3BOWA 2WCEA 1RECA 3PATA 1JWDA 3EVUA 1TIZA 2KOTA 2LMTA 1AVSA 2JTTA 1M31A 4ORAB 4PE0A 1QXPA 1SKTA 1M63B 2DOQA 1G8IA 1LINA 2JC2A 2G2BA 3AKAA 4ICBA 2NCPA 1YUSA 1YR5A 1MWNA 1CLMA 1IRJA 4GGNA 1S3PA 1L2OC 1PULA 2JTZA 4DRWA 3CS1A 4N1FA 1SRAA 2PALA 2M9GA 4N5XA 3DVKA 1CDLA 1OMDA 4MLWA 1SY9A 1XYDA 2BE4A 1CLLA 2JNFA 2KYCA 3SG2A 4XJKB 2H61C 1W7IB 3PN7B 2WORA 4FTGA 1CFFA 1IH0A 2BBMA 4N1GA 4YGEB 2PASA 1M39A 3VRQA 2LVVA 2ZNEA 2M97A 1NUBA 2JQ6A 2KI4C 2WOSA 5FYXA 1CMFA 1U5IB 2JNXA 2Q91A 4MN0A 1C7VA 1IG5A 2CXJA 3C1VA 1LKJA 2F33A 1SL7A 3BUNB 3EKHA 3JTDC 1LVCD 1TCOB 3FIAA 1HT9A 1XO5A 2RGIA 4ZCUA 2KSPA 5PALA 1YTZC 3GK2A 3OX5A 1CNPA 1UHHA 3TDIA 2I2RE 1CM1A 1WDCB 1OQPA 3AAJA 4U8DA 1YUTA 1G33A 1PVAA 1NCYA 4ETOA 2MHHA 1A2XA 3I5HB 3TDUA 1UUSA 1EG4A 1BU3A 2ZNDA 1YX8A 2IS9A 1YVHA 2LLTA 3SG3A 5JOLA 5ER4X 2P6BB 1RJVA 4ORCB 3VGOA 2HETA 4OCIA 2WC8A 1WLMA 2BCXA 1K9KA 3GK4X 3JVTC 4DUQA 2LMUA 1A03A 3JTDB 2D8NA 2L4HA 1S5GZ 2Y1MA 1BT6A 3PALA 1RWYA 1CDPA 2WNDA 1AHRA 1WRZA 3SG4A 1C07A 1KWOB 5DKQA 2EHBA 1J1EA 1TOPA 1Q80A 2KDHA 2M3WA 1B4CA 2R2IA 1WRKA 1OSAA 2MA2A 4MZJA 4UPGA 5IBWA 1KQMB 2M1KB 1NCXA 2WCFA 1BLQA 1NPQA 1KK7Z 4A4BA 1DJYA 1SL8A 2E6WA 3BOWB 3OP0A 4HREE 4PDZA 2BL0C 2F3ZA 2NCOA 1K96A 2JPTA 1GGWA 1DJIA 1H4BA 4PHMA 3JVTB 3NSLA 2JZIA 1S6CA 3BUOB 4Q04A 1CB1A 3BUXB 2AUCA 2NXQA 2H2KA 1N0YA 2LE9B 2JWWA 1FF1A 5AERA 2KYFA 1KFXL 3HX4A 2H61A 1QJTA 3BQ3A 3IQQA 1BR1B 1JFJA 4AQJA 5AFPA 2HQWA 2LAPA 1YURA 2SCPA 3I5IB 5DKRA 3GOFA 4NDBA 4ORBB 2KAXA 2F3YA 5CSNA 1QLSA 1S26D 3PFVA 4GNKB 3VRNA 4HSZA 2EC6B 3OB2B 3LK0A 1KSOA 3SIAA 1BJFA 2BL0B 5AXIA 1S6IA 4I5KA 5BPJA 1CDMA 2KFHA 2ZRTA 3GK1A 3LK1A 1SPYA 4GUKA 2LV7A 5HLVA 2CCMA 4CIDA 1K2HA 2L2EA 3NSOA 2MRDA 1CDNA 1QX7A 1MXEA 1QVIY 3O2PA 4A4CA 1TN4A 3TUYC 2K7CA 2O5GA 3WHUB 2OTGC 1JSAA 3NSIA 1F54A 5AANA 1ODBA 2K2FA 1F4OA 1OOJA 1ALVA 3I5FB 4I5JA 1J1DA 5CSIA 1SCVA 2L50A 5I2LA 2L0PA 2LP2A 3VROA 2JULA 4WQ3A 1RROA 1MXLC 4YBHB 1V1FA 1QV1A 1QX2A 4NDCA 1S6JA 4M2QA 1UHNA 2KHNA 2VRGA 1NYAA 3FWBA 4MRXA 1TNWA 4JPZB 5HLOA 2MBXA 1UHKA 1SBJA 1KQVA 2LNKA 1DT7B 4QJ5B 3A4UB 3PM8A 5GQQC 2KBIA 2BCBA 2QACA 1EJ3A 1FW4A 3M0WA 3TDZA 1Y0VH 2I7AA 4JQ0D 4YRUA 3KO0A 1DJGA 1YRTB 1B1GA 4P5OE 2F2OA 3WHTB 1B8RA 1Y6WA 1TNXA 2Y1NA 4YGAA 1KK8C 1JUOA 3CTNA 4L9MA 4YI9A 2Y4QA 1EH2A 2JT3A 5JJGA 1L2OB 2K7BA 2K8MB 1F70A 1Y1AA 1K93D 1XFZO 3D10A 4YGDB 1WLZA 3I5GC 3NSKA 1DVIA 3BYAA 2M7NA 2LVKA 1MUXA 2ZKMX 2E30A 3EVVA 1E8AA 4M2PA 1FPWA 2KI4B 1AP4A 4PHKA 1Y1XA 4YGBB 4E68A 1QS7A 1ZOTB 4I5NB 3SIBA 4MVFA 3AKBA 3CR4X 3EVRA 5CSJA 2KQYA 1J7PA 2LMVA 1FI6A 1NX0A 1QX5B 1SR6C 1SMGA 5KTYA 1N65A 1NX2A 1MR8A 1DJZA 3D0YA 1OZSA 2GGZA 5CPVA 1S36A 4QJ4B 3CLNA 2M49B 1AJ5A 3O4YA 4GBAA 5KSZA 2L4IA 2Y5IA 1D1OA 2SASA 1QIVA 5HYDA 1NSHA 1N2DA 1B9AA 3NXAA 1WY9A 1BMOA 4BY4A 4PE1A 1A4PA 1CFDA 3O6BA 4HRGA 1JFKA 2JU0A 4NQGA 3SG7A 4PCWA 1DGUA 1F71A 1ZUZA 3AAKA 1KSMA 1YVLA 1GQMA 2BECA 1TNPA 1S5GY 1PVBA 1R2UA 5KU1A 1SCMC 1K9PA 3TZ1A 3OB1B 2CTNA 1KFUS 1L7ZA 2M29A 2LUXA 3IQOA 3TS5C 1SK6D 4PHJA 2KGRA 1W7JB 3KHEA 2LCPA 2LP3A 4CFQA 3WXAA 1LA3A 1A75A 5CSFA 3CR5X 3IF7A 2F8PA 1PSBA 1KCYA 2AMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ6 A;  3K21 A;  2OS8 C;  4TNC A;  1JBA A;  1G4Y R;  1DMO A;  3PSR A;  1NX3 A;  2LAN A;  5HKW A;  1AK8 A;  1CFC A;  1IKU A;  4CLN A;  2M1U A;  1BF5 A;  2K0J A;  3BXK A;  3CR2 A;  1BR4 B;  1DGV A;  1ZAC A;  4AOM A;  1ALW A;  1B7T Y;  1J7R A;  1QIW A;  1GGZ A;  2BCA A;  4AQI A;  2MLF C;  4ZCV A;  2LHI A;  1LA0 A;  3FS7 A;  1SL9 A;  2KBM A;  4CFR A;  4OVN F;  1IQ3 A;  2KAY A;  1QAT A;  2G9B A;  3CWG A;  4FQO A;  5F6T A;  4PE7 A;  1F55 A;  2LHL A;  4MZL A;  3DVJ A;  2NZ0 A;  3EKJ A;  3MSE B;  4MBE A;  1LXF C;  1K90 D;  2F2P A;  2BE6 A;  2M8U A;  4D1E A;  1XK4 C;  2OS8 B;  1DF0 A;  1DTL A;  2M7L A;  2LVI A;  1IGV A;  2B1U A;  1J7Q A;  1ZFS A;  2TN4 A;  1EXR A;  1Y1U A;  2ISD A;  1F4Q A;  2BBN A;  3TUY B;  2MAZ A;  3PN7 C;  4GGF C;  2OTG B;  3FWC A;  4XYN A;  5G08 A;  1WRL A;  4MSP A;  2HQ8 A;  4C0J A;  5I8N A;  3RLZ A;  3DVE A;  5I2Q A;  3D0Y B;  1QLK A;  1RFJ A;  1OE9 B;  3E3R A;  1R6P A;  1NWD A;  2L5X B;  1K95 A;  4DCK A;  1XFW O;  2KFG A;  1AUI B;  4NDD A;  3EK8 A;  2JXC A;  3RM1 A;  1NCZ A;  2K61 A;  4PE4 A;  3ICB A;  1BOC A;  2LVJ A;  1J7O A;  2PMY A;  1WDC C;  1ZMZ A;  2JT8 A;  1SNL A;  2LLU A;  1QV0 A;  2CT9 A;  1PRW A;  5HKZ A;  3I5H C;  4R1E A;  3EK7 A;  2LLS A;  1YRU B;  4I5L B;  3ZNI A;  2L51 A;  1CLB A;  2I94 A;  2KAV A;  4GPL B;  1MHO A;  2FOT A;  3KEV A;  4HRH A;  4PHN A;  1CKK A;  1IQ5 A;  3OX6 A;  2CNP A;  1YX7 A;  2JRF A;  3LCP C;  2FCD A;  3SJS A;  1AJ4 A;  3A8R A;  2LUC A;  2MLE C;  2PVB A;  1J55 A;  1B47 A;  2ZN8 A;  1M45 A;  3DVM A;  4M2O A;  5J3X A;  3VRR A;  1EG3 A;  1CFP A;  1A75 B;  4OKH A;  2GGM A;  1PSR A;  1VRK A;  1KK8 B;  3DF0 B;  1KWO C;  2JT0 A;  3HCM A;  1TTX A;  3H4S E;  1B8L A;  2ZRS A;  3KPX A;  1TCF A;  1JF0 A;  1K9U A;  1KQM C;  1DJW A;  1SW8 A;  3EK4 A;  5D7F A;  5TNC A;  4YI8 A;  2ZN9 A;  1JC2 A;  3I5G B;  2QPT A;  1UHI A;  1HQV A;  2BKI B;  4QJ3 B;  1MQ1 A;  3OHM B;  4F0Z B;  2MJW B;  1TNQ A;  4OR9 B;  2Q4U A;  3DD4 A;  3CZT X;  2WCB A;  2PSR A;  4MEW A;  1DJX A;  5ER5 A;  2JXL A;  1XK4 A;  1XFV O;  4BY5 A;  1TRF A;  1K8U A;  1CTR A;  3BUW B;  1XVJ A;  4C0K A;  5HKY A;  4GFT A;  4PAL A;  1C7W A;  1UHJ A;  1NX1 A;  4XJK A;  2K2A A;  2AAO A;  1RTP 1;  5AEQ A;  1SR6 B;  4GGF A;  2KFF A;  1DF0 B;  3I5I C;  3QRX A;  1JF2 A;  3PLF B;  1IJ5 A;  1S1E A;  1M46 A;  4CPV A;  2NLN A;  1BOD A;  1QTX A;  1EL4 A;  2CBL A;  1U5I A;  1B8C A;  1K94 A;  1UWO A;  2EC6 C;  1KFU L;  4JWQ A;  1A29 A;  2V53 A;  3CGA A;  1OZO A;  3WNX B;  3O78 A;  5I2O A;  1QVI Z;  2KI6 D;  4IL1 A;  1BG1 A;  2I18 A;  2O60 A;  4WRI A;  1FBV A;  2HPS A;  3F45 A;  1V1G A;  2FJU B;  1SYM A;  3DF0 A;  1B7T Z;  1FI5 A;  2KNE A;  1KK7 Y;  1UUR A;  2LC5 A;  2M0R A;  3SG5 A;  2JOJ A;  4GAO A;  1IWQ A;  4P2Y B;  1OMV A;  3LL8 B;  2A4J A;  1XFX O;  2K7O A;  2HF5 A;  1KFX S;  1F8H A;  1IJ6 A;  3ZWH A;  1XA5 A;  1H8B A;  1PAL A;  1PK0 D;  1GJY A;  3I5F C;  4MZK A;  2PRU A;  4USL A;  1NP8 A;  1OMR A;  1UP5 A;  1SCM B;  2EGD A;  2ZFD A;  3SG6 A;  4MRY A;  3TS5 B;  5DKN A;  3VRP A;  1CMG A;  1YUU A;  2COL B;  1NIW A;  1XFU O;  2L98 A;  2K7D A;  4WQ2 A;  4C0L A;  2FCE A;  1CM4 A;  3BUM B;  1QAS A;  5B8I B;  3KF9 A;  4OV2 A;  1X02 A;  1DJH A;  2KI6 C;  5D69 A;  2GV5 A;  1MF8 B;  2LM5 A;  2BKH B;  4YGC B;  4DIR A;  4DS7 A;  2KGB C;  1RK9 A;  5K89 A;  1XFY O;  3LLE A;  2OPO A;  3BOW A;  2WCE A;  1REC A;  3PAT A;  1JWD A;  3EVU A;  1TIZ A;  2KOT A;  2LMT A;  1AVS A;  2JTT A;  1M31 A;  4ORA B;  4PE0 A;  1QXP A;  1SKT A;  1M63 B;  2DOQ A;  1G8I A;  1LIN A;  2JC2 A;  2G2B A;  3AKA A;  4ICB A;  2NCP A;  1YUS A;  1YR5 A;  1MWN A;  1CLM A;  1IRJ A;  4GGN A;  1S3P A;  1L2O C;  1PUL A;  2JTZ A;  4DRW A;  3CS1 A;  4N1F A;  1SRA A;  2PAL A;  2M9G A;  4N5X A;  3DVK A;  1CDL A;  1OMD A;  4MLW A;  1SY9 A;  1XYD A;  2BE4 A;  1CLL A;  2JNF A;  2KYC A;  3SG2 A;  4XJK B;  2H61 C;  1W7I B;  3PN7 B;  2WOR A;  4FTG A;  1CFF A;  1IH0 A;  2BBM A;  4N1G A;  4YGE B;  2PAS A;  1M39 A;  3VRQ A;  2LVV A;  2ZNE A;  2M97 A;  1NUB A;  2JQ6 A;  2KI4 C;  2WOS A;  5FYX A;  1CMF A;  1U5I B;  2JNX A;  2Q91 A;  4MN0 A;  1C7V A;  1IG5 A;  2CXJ A;  3C1V A;  1LKJ A;  2F33 A;  1SL7 A;  3BUN B;  3EKH A;  3JTD C;  1LVC D;  1TCO B;  3FIA A;  1HT9 A;  1XO5 A;  2RGI A;  4ZCU A;  2KSP A;  5PAL A;  1YTZ C;  3GK2 A;  3OX5 A;  1CNP A;  1UHH A;  3TDI A;  2I2R E;  1CM1 A;  1WDC B;  1OQP A;  3AAJ A;  4U8D A;  1YUT A;  1G33 A;  1PVA A;  1NCY A;  4ETO A;  2MHH A;  1A2X A;  3I5H B;  3TDU A;  1UUS A;  1EG4 A;  1BU3 A;  2ZND A;  1YX8 A;  2IS9 A;  1YVH A;  2LLT A;  3SG3 A;  5JOL A;  5ER4 X;  2P6B B;  1RJV A;  4ORC B;  3VGO A;  2HET A;  4OCI A;  2WC8 A;  1WLM A;  2BCX A;  1K9K A;  3GK4 X;  3JVT C;  4DUQ A;  2LMU A;  1A03 A;  3JTD B;  2D8N A;  2L4H A;  1S5G Z;  2Y1M A;  1BT6 A;  3PAL A;  1RWY A;  1CDP A;  2WND A;  1AHR A;  1WRZ A;  3SG4 A;  1C07 A;  1KWO B;  5DKQ A;  2EHB A;  1J1E A;  1TOP A;  1Q80 A;  2KDH A;  2M3W A;  1B4C A;  2R2I A;  1WRK A;  1OSA A;  2MA2 A;  4MZJ A;  4UPG A;  5IBW A;  1KQM B;  2M1K B;  1NCX A;  2WCF A;  1BLQ A;  1NPQ A;  1KK7 Z;  4A4B A;  1DJY A;  1SL8 A;  2E6W A;  3BOW B;  3OP0 A;  4HRE E;  4PDZ A;  2BL0 C;  2F3Z A;  2NCO A;  1K96 A;  2JPT A;  1GGW A;  1DJI A;  1H4B A;  4PHM A;  3JVT B;  3NSL A;  2JZI A;  1S6C A;  3BUO B;  4Q04 A;  1CB1 A;  3BUX B;  2AUC A;  2NXQ A;  2H2K A;  1N0Y A;  2LE9 B;  2JWW A;  1FF1 A;  5AER A;  2KYF A;  1KFX L;  3HX4 A;  2H61 A;  1QJT A;  3BQ3 A;  3IQQ A;  1BR1 B;  1JFJ A;  4AQJ A;  5AFP A;  2HQW A;  2LAP A;  1YUR A;  2SCP A;  3I5I B;  5DKR A;  3GOF A;  4NDB A;  4ORB B;  2KAX A;  2F3Y A;  5CSN A;  1QLS A;  1S26 D;  3PFV A;  4GNK B;  3VRN A;  4HSZ A;  2EC6 B;  3OB2 B;  3LK0 A;  1KSO A;  3SIA A;  1BJF A;  2BL0 B;  5AXI A;  1S6I A;  4I5K A;  5BPJ A;  1CDM A;  2KFH A;  2ZRT A;  3GK1 A;  3LK1 A;  1SPY A;  4GUK A;  2LV7 A;  5HLV A;  2CCM A;  4CID A;  1K2H A;  2L2E A;  3NSO A;  2MRD A;  1CDN A;  1QX7 A;  1MXE A;  1QVI Y;  3O2P A;  4A4C A;  1TN4 A;  3TUY C;  2K7C A;  2O5G A;  3WHU B;  2OTG C;  1JSA A;  3NSI A;  1F54 A;  5AAN A;  1ODB A;  2K2F A;  1F4O A;  1OOJ A;  1ALV A;  3I5F B;  4I5J A;  1J1D A;  5CSI A;  1SCV A;  2L50 A;  5I2L A;  2L0P A;  2LP2 A;  3VRO A;  2JUL A;  4WQ3 A;  1RRO A;  1MXL C;  4YBH B;  1V1F A;  1QV1 A;  1QX2 A;  4NDC A;  1S6J A;  4M2Q A;  1UHN A;  2KHN A;  2VRG A;  1NYA A;  3FWB A;  4MRX A;  1TNW A;  4JPZ B;  5HLO A;  2MBX A;  1UHK A;  1SBJ A;  1KQV A;  2LNK A;  1DT7 B;  4QJ5 B;  3A4U B;  3PM8 A;  5GQQ C;  2KBI A;  2BCB A;  2QAC A;  1EJ3 A;  1FW4 A;  3M0W A;  3TDZ A;  1Y0V H;  2I7A A;  4JQ0 D;  4YRU A;  3KO0 A;  1DJG A;  1YRT B;  1B1G A;  4P5O E;  2F2O A;  3WHT B;  1B8R A;  1Y6W A;  1TNX A;  2Y1N A;  4YGA A;  1KK8 C;  1JUO A;  3CTN A;  4L9M A;  4YI9 A;  2Y4Q A;  1EH2 A;  2JT3 A;  5JJG A;  1L2O B;  2K7B A;  2K8M B;  1F70 A;  1Y1A A;  1K93 D;  1XFZ O;  3D10 A;  4YGD B;  1WLZ A;  3I5G C;  3NSK A;  1DVI A;  3BYA A;  2M7N A;  2LVK A;  1MUX A;  2ZKM X;  2E30 A;  3EVV A;  1E8A A;  4M2P A;  1FPW A;  2KI4 B;  1AP4 A;  4PHK A;  1Y1X A;  4YGB B;  4E68 A;  1QS7 A;  1ZOT B;  4I5N B;  3SIB A;  4MVF A;  3AKB A;  3CR4 X;  3EVR A;  5CSJ A;  2KQY A;  1J7P A;  2LMV A;  1FI6 A;  1NX0 A;  1QX5 B;  1SR6 C;  1SMG A;  5KTY A;  1N65 A;  1NX2 A;  1MR8 A;  1DJZ A;  3D0Y A;  1OZS A;  2GGZ A;  5CPV A;  1S36 A;  4QJ4 B;  3CLN A;  2M49 B;  1AJ5 A;  3O4Y A;  4GBA A;  5KSZ A;  2L4I A;  2Y5I A;  1D1O A;  2SAS A;  1QIV A;  5HYD A;  1NSH A;  1N2D A;  1B9A A;  3NXA A;  1WY9 A;  1BMO A;  4BY4 A;  4PE1 A;  1A4P A;  1CFD A;  3O6B A;  4HRG A;  1JFK A;  2JU0 A;  4NQG A;  3SG7 A;  4PCW A;  1DGU A;  1F71 A;  1ZUZ A;  3AAK A;  1KSM A;  1YVL A;  1GQM A;  2BEC A;  1TNP A;  1S5G Y;  1PVB A;  1R2U A;  5KU1 A;  1SCM C;  1K9P A;  3TZ1 A;  3OB1 B;  2CTN A;  1KFU S;  1L7Z A;  2M29 A;  2LUX A;  3IQO A;  3TS5 C;  1SK6 D;  4PHJ A;  2KGR A;  1W7J B;  3KHE A;  2LCP A;  2LP3 A;  4CFQ A;  3WXA A;  1LA3 A;  1A75 A;  5CSF A;  3CR5 X;  3IF7 A;  2F8P A;  1PSB A;  1KCY A;  2AMI A; 
#chains in the Genus database with same CATH topology
 2KQ6 A;  3K21 A;  2OS8 C;  2WCH A;  4TNC A;  4KYN A;  1JBA A;  1G4Y R;  1DMO A;  3PSR A;  1NX3 A;  2LAN A;  5HKW A;  1AK8 A;  1CFC A;  1Z2C B;  1IKU A;  4CLN A;  2M1U A;  1BF5 A;  2K0J A;  3BXK A;  3CR2 A;  1BR4 B;  1DGV A;  1ZAC A;  4AOM A;  1ALW A;  1B7T Y;  1J7R A;  1QIW A;  1GGZ A;  2BCA A;  4AQI A;  2MLF C;  4ZCV A;  2LHI A;  3SS4 A;  1LA0 A;  3FS7 A;  1SL9 A;  2KBM A;  4CFR A;  4OVN F;  1IQ3 A;  2KAY A;  1QAT A;  2G9B A;  3CWG A;  4FQO A;  5F6T A;  4IJ7 A;  4PE7 A;  1F55 A;  2LHL A;  4MZL A;  3DVJ A;  2NZ0 A;  3S0A A;  2FJY A;  3EKJ A;  3MSE B;  4MBE A;  1LXF C;  2P71 A;  1K90 D;  2F2P A;  2BE6 A;  2M8U A;  2WCJ A;  4D1E A;  1XK4 C;  2OS8 B;  1DF0 A;  1DTL A;  2M7L A;  1C3Y A;  2LVI A;  1OOG A;  1IGV A;  2B1U A;  1J7Q A;  1ZFS A;  2TN4 A;  1EXR A;  1Y1U A;  2ISD A;  2H8V A;  1F4Q A;  2BBN A;  3TUY B;  2MAZ A;  2WC6 A;  3PN7 C;  4GGF C;  2OTG B;  3FWC A;  3VB1 A;  4XYN A;  5G08 A;  1WRL A;  4MSP A;  2HQ8 A;  4C0J A;  5I8N A;  3RLZ A;  3DVE A;  5I2Q A;  3D0Y B;  2PYQ A;  1QLK A;  1RFJ A;  1OE9 B;  3E3R A;  1R6P A;  1NWD A;  2L5X B;  1K95 A;  4DCK A;  1XFW O;  2KFG A;  1AUI B;  4NDD A;  3EK8 A;  2JXC A;  3RM1 A;  1NCZ A;  2K61 A;  4PE4 A;  3ICB A;  1BOC A;  2LVJ A;  1J7O A;  2PMY A;  1WDC C;  1XFR A;  1ZMZ A;  1SNL A;  2JT8 A;  2LLU A;  1QV0 A;  2CT9 A;  1PRW A;  5HKZ A;  3I5H C;  4R1E A;  3EK7 A;  2LLS A;  1YRU B;  4I5L B;  3ZNI A;  2L51 A;  1CLB A;  2I94 A;  2KAV A;  3K1E A;  1MHO A;  2FOT A;  3KEV A;  4GPL B;  4HRH A;  4PHN A;  4FQT A;  5EL2 A;  1CKK A;  1IQ5 A;  1DQE A;  3OX6 A;  1LS8 A;  2CNP A;  1YX7 A;  2JRF A;  3LCP C;  2FCD A;  3SJS A;  5HL1 A;  1AJ4 A;  3A8R A;  2LUC A;  2MLE C;  2PVB A;  1J55 A;  1B47 A;  2WCL A;  1M45 A;  1TUZ A;  2ZN8 A;  3DVM A;  4M2O A;  5J3X A;  3VRR A;  1EG3 A;  1CFP A;  1A75 B;  4OKH A;  2GGM A;  1PSR A;  1VRK A;  1KK8 B;  3DF0 B;  1KWO C;  2JT0 A;  3HCM A;  1TTX A;  3H4S E;  1B8L A;  2JPO A;  2ZRS A;  4PT1 A;  3NHI A;  3KPX A;  1TCF A;  1JF0 A;  1K9U A;  1KQM C;  1DJW A;  1SW8 A;  3EK4 A;  5D7F A;  3UNW A;  5TNC A;  4YI8 A;  2ZN9 A;  1JC2 A;  3I5G B;  2QPT A;  1UHI A;  1HQV A;  1Z4H A;  2BKI B;  4OZD A;  4QJ3 B;  1MQ1 A;  3OHM B;  4F0Z B;  2MJW B;  1TNQ A;  4OR9 B;  2Q4U A;  3DD4 A;  3CZT X;  2WCB A;  2PSR A;  4MEW A;  1DJX A;  5ER5 A;  2JXL A;  1XK4 A;  1XFV O;  4BY5 A;  1TRF A;  1K8U A;  1CTR A;  2WCM A;  1XVJ A;  3BUW B;  4C0K A;  5HKY A;  2K60 A;  4GFT A;  4PAL A;  2QEB A;  1C7W A;  1UHJ A;  3CYZ A;  1NX1 A;  4XJK A;  2K2A A;  2AAO A;  1RTP 1;  3BJH A;  1SR6 B;  4GGF A;  2KFF A;  5AEQ A;  1DF0 B;  3B88 A;  3I5I C;  3QRX A;  1JF2 A;  3D76 A;  3PLF B;  1IJ5 A;  1S1E A;  1M46 A;  4CPV A;  2NLN A;  1BOD A;  1QTX A;  1EL4 A;  2CBL A;  1U5I A;  1B8C A;  1K94 A;  1UWO A;  2EC6 C;  1KFU L;  4JWQ A;  1A29 A;  2V53 A;  3CGA A;  1OZO A;  3WNX B;  3O78 A;  3O4X A;  1DEK A;  5I2O A;  1QVI Z;  2KI6 D;  3SS3 A;  3EG5 B;  4IL1 A;  1BG1 A;  2I18 A;  2O60 A;  4WRI A;  1FBV A;  2HPS A;  3F45 A;  2YGU A;  1V1G A;  2FJU B;  1SYM A;  3DF0 A;  1B7T Z;  1FI5 A;  2KNE A;  1KK7 Y;  1UUR A;  2LC5 A;  2M0R A;  3SG5 A;  2JOJ A;  4GAO A;  3RZS A;  1IWQ A;  4P2Y B;  1OMV A;  3LL8 B;  2A4J A;  1XFX O;  2K7O A;  2HF5 A;  1KFX S;  1F8H A;  1IJ6 A;  3ZWH A;  1XA5 A;  1H8B A;  1PAL A;  1PK0 D;  1IIO A;  1GJY A;  3I5F C;  4MZK A;  2PRU A;  4USL A;  3UO9 A;  1NP8 A;  1OMR A;  1UP5 A;  1SCM B;  2EGD A;  2KLE A;  2ZFD A;  3SG6 A;  3NHT A;  4MRY A;  3TS5 B;  5DKN A;  3VRP A;  1CMG A;  1YUU A;  2COL B;  5D3O A;  1NIW A;  1XFU O;  2L98 A;  2K7D A;  3N7H A;  3S0B A;  4WQ2 A;  4C0L A;  2FCE A;  1CM4 A;  3BUM B;  1QAS A;  5B8I B;  3KF9 A;  4OV2 A;  1X02 A;  3D74 A;  1DJH A;  1C3Z A;  3NGV A;  2KI6 C;  5D69 A;  2GV5 A;  1MF8 B;  3CZ0 A;  3L4L A;  2LM5 A;  2BKH B;  4YGC B;  4DIR A;  4DS7 A;  1GM0 A;  2KGB C;  1RK9 A;  5K89 A;  1XFY O;  3LLE A;  2OPO A;  3BOW A;  2WCE A;  2QEV A;  1REC A;  3PAT A;  3IVT A;  1JWD A;  3EVU A;  1TIZ A;  2KOT A;  2LMT A;  1AVS A;  2JTT A;  1M31 A;  4ORA B;  3BFH A;  4PE0 A;  1QXP A;  1SKT A;  1M63 B;  2DOQ A;  1G8I A;  1LIN A;  1TUJ A;  2G2B A;  2JC2 A;  3AKA A;  4ICB A;  2NCP A;  1YUS A;  1YR5 A;  1MWN A;  1OOH A;  1CLM A;  3D75 A;  4F7F A;  1IRJ A;  4GGN A;  1S3P A;  1L2O C;  1PUL A;  2JTZ A;  4DRW A;  5DIC A;  3CS1 A;  4N1F A;  1SRA A;  2PAL A;  3V2L A;  2M9G A;  4N5X A;  2BAP A;  3DVK A;  1CDL A;  1OMD A;  3FE6 A;  4MLW A;  1SY9 A;  2ERB A;  1XYD A;  2BE4 A;  1CLL A;  2JNF A;  2KYC A;  3QME A;  3SG2 A;  4XJK B;  3S0D A;  2H61 C;  1W7I B;  3PN7 B;  2WOR A;  4FTG A;  1CFF A;  1IH0 A;  2BBM A;  4N1G A;  4YGE B;  2PAS A;  1M39 A;  3VRQ A;  2LVV A;  2ZNE A;  2M97 A;  1NUB A;  2JQ6 A;  2KI4 C;  2WOS A;  5FYX A;  1CMF A;  2L5Y A;  1U5I B;  2JNX A;  2Q91 A;  4MN0 A;  1C7V A;  1IG5 A;  2CXJ A;  3C1V A;  1LKJ A;  2F33 A;  1SL7 A;  3BUN B;  3EKH A;  3JTD C;  1LVC D;  1TCO B;  3FIA A;  2KPH A;  1HT9 A;  1XO5 A;  2RGI A;  4ZCU A;  2KSP A;  5PAL A;  1YTZ C;  1ORG A;  2QEH A;  3GK2 A;  3CDN A;  3OX5 A;  1UHH A;  1CNP A;  3TDI A;  2I2R E;  1CM1 A;  1WDC B;  1OQP A;  3AAJ A;  4U8D A;  1YUT A;  3FE8 A;  1G33 A;  1PVA A;  2GTE A;  1NCY A;  4ETO A;  2MHH A;  3B6X A;  1A2X A;  3I5H B;  3TDU A;  1UUS A;  1EG4 A;  1BU3 A;  2ZND A;  4JD9 A;  4JKT A;  1YX8 A;  2IS9 A;  1YVH A;  2LLT A;  3PM2 A;  3SG3 A;  3S0F A;  5JOL A;  5ER4 X;  3R1V A;  2P6B B;  1RJV A;  4ORC B;  3VGO A;  2HET A;  4OCI A;  2WC8 A;  1WLM A;  2BCX A;  1K9K A;  3GK4 X;  3JVT C;  4DUQ A;  2LMU A;  1A03 A;  3JTD B;  2D8N A;  1QWV A;  2L4H A;  1S5G Z;  2Y1M A;  1BT6 A;  3PAL A;  1RWY A;  1CDP A;  2WND A;  5I94 A;  1AHR A;  1WRZ A;  3SG4 A;  1C07 A;  1KWO B;  3CAB A;  2EHB A;  1J1E A;  5DKQ A;  1TOP A;  1Q80 A;  2KDH A;  2M3W A;  1B4C A;  2R2I A;  1WRK A;  1OSA A;  2MA2 A;  4MZJ A;  4UPG A;  5IBW A;  1KQM B;  2M1K B;  1NCX A;  2WCF A;  1BLQ A;  1NPQ A;  1KK7 Z;  4A4B A;  1DJY A;  1SL8 A;  2E6W A;  3BOW B;  3OP0 A;  4HRE E;  4PDZ A;  2BL0 C;  3OBV A;  2F3Z A;  2NCO A;  1K96 A;  2JPT A;  1GGW A;  1DJI A;  1H4B A;  3BFA A;  3JVT B;  4PHM A;  3B87 A;  3NSL A;  2JZI A;  1S6C A;  3BUO B;  4Q04 A;  1CB1 A;  3D77 A;  3BUX B;  2AUC A;  2NXQ A;  2H2K A;  3FE9 A;  1N0Y A;  2LE9 B;  2JWW A;  1FF1 A;  5AER A;  3D73 A;  2KYF A;  1KFX L;  3HX4 A;  2H61 A;  1QJT A;  3BQ3 A;  3IQQ A;  1BR1 B;  1JFJ A;  2L2C A;  4AQJ A;  5AFP A;  2HQW A;  2LAP A;  1YUR A;  2SCP A;  2BNX A;  3I5I B;  5DKR A;  3GOF A;  4NDB A;  4ORB B;  2KAX A;  2F3Y A;  5CSN A;  1QLS A;  1S26 D;  3PFV A;  4GNK B;  3VRN A;  4HSZ A;  2EC6 B;  3OB2 B;  3LK0 A;  1KSO A;  3R1O A;  3SIA A;  1BJF A;  2BL0 B;  5AXI A;  1S6I A;  4I5K A;  5BPJ A;  1CDM A;  2KFH A;  2ZRT A;  3GK1 A;  3LK1 A;  1SPY A;  4GUK A;  2LV7 A;  3PJI A;  2CCM A;  5HLV A;  1DC1 A;  4CID A;  1K2H A;  2L2E A;  3NSO A;  2MRD A;  1CDN A;  1QX7 A;  1MXE A;  1QVI Y;  2P70 A;  3O2P A;  4A4C A;  3OGN A;  1TN4 A;  3BFB A;  3TUY C;  2K7C A;  2O5G A;  3WHU B;  2OTG C;  1JSA A;  3NSI A;  3DZT A;  1F54 A;  5AAN A;  1ODB A;  2K2F A;  2QDI A;  1F4O A;  1OOJ A;  1ALV A;  3I5F B;  4I5J A;  1J1D A;  5CSI A;  1SCV A;  2L50 A;  5I2L A;  2L0P A;  2LP2 A;  3VRO A;  2JUL A;  4WQ3 A;  1RRO A;  3CZ2 A;  1MXL C;  4YBH B;  1V1F A;  1QV1 A;  1QX2 A;  4NDC A;  1S6J A;  4M2Q A;  1UHN A;  3DY9 A;  2KHN A;  2VRG A;  1NYA A;  3FWB A;  4MRX A;  1TNW A;  4JPZ B;  5HLO A;  2MBX A;  1UHK A;  1SBJ A;  1KQV A;  2LNK A;  1DT7 B;  4QJ5 B;  3L47 A;  1OOF A;  3A4U B;  3PM8 A;  5GQQ C;  1OOI X;  2KBI A;  2BCB A;  2QAC A;  1EJ3 A;  1FW4 A;  3M0W A;  3TDZ A;  1Y0V H;  2I7A A;  4JQ0 D;  4YRU A;  1W9Z A;  5FI6 A;  3KO0 A;  1DJG A;  1P28 A;  1YRT B;  1B1G A;  4P5O E;  2F2O A;  3L4A A;  3WHT B;  1B8R A;  3DYE A;  1SSE B;  1Y6W A;  1TNX A;  2Y1N A;  4YGA A;  1KK8 C;  1JUO A;  3CTN A;  4L9M A;  4YI9 A;  2QEO A;  2Y4Q A;  1EH2 A;  2JT3 A;  5JJG A;  1L2O B;  2K7B A;  2K8M B;  1F70 A;  3DXL A;  1Y1A A;  1K93 D;  1XFZ O;  3D10 A;  4YGD B;  2PQL A;  1WLZ A;  3I5G C;  3NSK A;  1DVI A;  2KLD A;  4INX A;  3BYA A;  2M7N A;  2LVK A;  1MUX A;  2ZKM X;  2E30 A;  3EVV A;  1E8A A;  4M2P A;  5FI2 A;  2KI4 B;  3S0G A;  1AP4 A;  1FPW A;  4PHK A;  1Y1X A;  3CZ1 A;  4YGB B;  4E68 A;  1QS7 A;  1ZOT B;  1T14 A;  2WCK A;  4I5N B;  3SIB A;  4MVF A;  3AKB A;  3CR4 X;  3EVR A;  5CSJ A;  2KQY A;  1J7P A;  2LMV A;  1FI6 A;  1NX0 A;  1QX5 B;  1SR6 C;  1SMG A;  4INW A;  5KTY A;  1N65 A;  1NX2 A;  1MR8 A;  1DEL A;  1DJZ A;  3D0Y A;  1OZS A;  3Q8I A;  2GGZ A;  5CPV A;  1S36 A;  4QJ4 B;  3CLN A;  2M49 B;  1AJ5 A;  3O4Y A;  3R72 A;  4GBA A;  5KSZ A;  2L4I A;  2Y5I A;  1D1O A;  2SAS A;  1QIV A;  5HYD A;  1NSH A;  1N2D A;  1B9A A;  2WC5 A;  1WY9 A;  1BMO A;  3NXA A;  4BY4 A;  4PE1 A;  5FI7 A;  1A4P A;  1CFD A;  3O6B A;  3R1P A;  1JFK A;  2JU0 A;  4HRG A;  4NQG A;  3SG7 A;  4PCW A;  3S0E A;  3B7A A;  3SS5 A;  1DGU A;  1TWO A;  1F71 A;  1ZUZ A;  3AAK A;  1OW4 A;  1KSM A;  1YVL A;  1GQM A;  2BEC A;  1TNP A;  1S5G Y;  1PVB A;  1R2U A;  5KU1 A;  1SCM C;  1K9P A;  3TZ1 A;  3OB1 B;  2CTN A;  1KFU S;  1L7Z A;  2M29 A;  2LUX A;  3IQO A;  3TS5 C;  1SK6 D;  4PHJ A;  2KGR A;  1W7J B;  3KHE A;  3D78 A;  2LCP A;  2LP3 A;  3B86 A;  4CFQ A;  3WXA A;  1LA3 A;  1A75 A;  5CSF A;  3CR5 X;  3IF7 A;  2F8P A;  1PSB A;  1KCY A;  2AMI A; 
#chains in the Genus database with same CATH homology
 2KQ6 A;  3K21 A;  2OS8 C;  4TNC A;  1JBA A;  1G4Y R;  1DMO A;  3PSR A;  1NX3 A;  2LAN A;  5HKW A;  1AK8 A;  1CFC A;  1IKU A;  4CLN A;  2M1U A;  1BF5 A;  2K0J A;  3BXK A;  3CR2 A;  1BR4 B;  1DGV A;  1ZAC A;  4AOM A;  1ALW A;  1B7T Y;  1J7R A;  1QIW A;  1GGZ A;  2BCA A;  4AQI A;  2MLF C;  4ZCV A;  2LHI A;  1LA0 A;  3FS7 A;  1SL9 A;  2KBM A;  4CFR A;  4OVN F;  1IQ3 A;  2KAY A;  1QAT A;  2G9B A;  3CWG A;  4FQO A;  5F6T A;  4PE7 A;  1F55 A;  2LHL A;  4MZL A;  3DVJ A;  2NZ0 A;  3EKJ A;  3MSE B;  4MBE A;  1LXF C;  1K90 D;  2F2P A;  2BE6 A;  2M8U A;  4D1E A;  1XK4 C;  2OS8 B;  1DF0 A;  1DTL A;  2M7L A;  2LVI A;  1IGV A;  2B1U A;  1J7Q A;  1ZFS A;  2TN4 A;  1EXR A;  1Y1U A;  2ISD A;  1F4Q A;  2BBN A;  3TUY B;  2MAZ A;  3PN7 C;  4GGF C;  2OTG B;  3FWC A;  4XYN A;  5G08 A;  1WRL A;  4MSP A;  2HQ8 A;  4C0J A;  5I8N A;  3RLZ A;  3DVE A;  5I2Q A;  3D0Y B;  1QLK A;  1RFJ A;  1OE9 B;  3E3R A;  1R6P A;  1NWD A;  2L5X B;  1K95 A;  4DCK A;  1XFW O;  2KFG A;  1AUI B;  4NDD A;  3EK8 A;  2JXC A;  3RM1 A;  1NCZ A;  2K61 A;  4PE4 A;  3ICB A;  1BOC A;  2LVJ A;  1J7O A;  2PMY A;  1WDC C;  1ZMZ A;  2JT8 A;  1SNL A;  2LLU A;  1QV0 A;  2CT9 A;  1PRW A;  5HKZ A;  3I5H C;  4R1E A;  3EK7 A;  2LLS A;  1YRU B;  4I5L B;  3ZNI A;  2L51 A;  1CLB A;  2I94 A;  2KAV A;  4GPL B;  1MHO A;  2FOT A;  3KEV A;  4HRH A;  4PHN A;  1CKK A;  1IQ5 A;  3OX6 A;  2CNP A;  1YX7 A;  2JRF A;  3LCP C;  2FCD A;  3SJS A;  1AJ4 A;  3A8R A;  2LUC A;  2MLE C;  2PVB A;  1J55 A;  1B47 A;  2ZN8 A;  1M45 A;  3DVM A;  4M2O A;  5J3X A;  3VRR A;  1EG3 A;  1CFP A;  1A75 B;  4OKH A;  2GGM A;  1PSR A;  1VRK A;  1KK8 B;  3DF0 B;  1KWO C;  2JT0 A;  3HCM A;  1TTX A;  3H4S E;  1B8L A;  2ZRS A;  3KPX A;  1TCF A;  1JF0 A;  1K9U A;  1KQM C;  1DJW A;  1SW8 A;  3EK4 A;  5D7F A;  5TNC A;  4YI8 A;  2ZN9 A;  1JC2 A;  3I5G B;  2QPT A;  1UHI A;  1HQV A;  2BKI B;  4QJ3 B;  1MQ1 A;  3OHM B;  4F0Z B;  2MJW B;  1TNQ A;  4OR9 B;  2Q4U A;  3DD4 A;  3CZT X;  2WCB A;  2PSR A;  4MEW A;  1DJX A;  5ER5 A;  2JXL A;  1XK4 A;  1XFV O;  4BY5 A;  1TRF A;  1K8U A;  1CTR A;  3BUW B;  1XVJ A;  4C0K A;  5HKY A;  4GFT A;  4PAL A;  1C7W A;  1UHJ A;  1NX1 A;  4XJK A;  2K2A A;  2AAO A;  1RTP 1;  5AEQ A;  1SR6 B;  4GGF A;  2KFF A;  1DF0 B;  3I5I C;  3QRX A;  1JF2 A;  3PLF B;  1IJ5 A;  1S1E A;  1M46 A;  4CPV A;  2NLN A;  1BOD A;  1QTX A;  1EL4 A;  2CBL A;  1U5I A;  1B8C A;  1K94 A;  1UWO A;  2EC6 C;  1KFU L;  4JWQ A;  1A29 A;  2V53 A;  3CGA A;  1OZO A;  3WNX B;  3O78 A;  5I2O A;  1QVI Z;  2KI6 D;  4IL1 A;  1BG1 A;  2I18 A;  2O60 A;  4WRI A;  1FBV A;  2HPS A;  3F45 A;  1V1G A;  2FJU B;  1SYM A;  3DF0 A;  1B7T Z;  1FI5 A;  2KNE A;  1KK7 Y;  1UUR A;  2LC5 A;  2M0R A;  3SG5 A;  2JOJ A;  4GAO A;  1IWQ A;  4P2Y B;  1OMV A;  3LL8 B;  2A4J A;  1XFX O;  2K7O A;  2HF5 A;  1KFX S;  1F8H A;  1IJ6 A;  3ZWH A;  1XA5 A;  1H8B A;  1PAL A;  1PK0 D;  1GJY A;  3I5F C;  4MZK A;  2PRU A;  4USL A;  1NP8 A;  1OMR A;  1UP5 A;  1SCM B;  2EGD A;  2ZFD A;  3SG6 A;  4MRY A;  3TS5 B;  5DKN A;  3VRP A;  1CMG A;  1YUU A;  2COL B;  1NIW A;  1XFU O;  2L98 A;  2K7D A;  4WQ2 A;  4C0L A;  2FCE A;  1CM4 A;  3BUM B;  1QAS A;  5B8I B;  3KF9 A;  4OV2 A;  1X02 A;  1DJH A;  2KI6 C;  5D69 A;  2GV5 A;  1MF8 B;  2LM5 A;  2BKH B;  4YGC B;  4DIR A;  4DS7 A;  2KGB C;  1RK9 A;  5K89 A;  1XFY O;  3LLE A;  2OPO A;  3BOW A;  2WCE A;  1REC A;  3PAT A;  1JWD A;  3EVU A;  1TIZ A;  2KOT A;  2LMT A;  1AVS A;  2JTT A;  1M31 A;  4ORA B;  4PE0 A;  1QXP A;  1SKT A;  1M63 B;  2DOQ A;  1G8I A;  1LIN A;  2JC2 A;  2G2B A;  3AKA A;  4ICB A;  2NCP A;  1YUS A;  1YR5 A;  1MWN A;  1CLM A;  1IRJ A;  4GGN A;  1S3P A;  1L2O C;  1PUL A;  2JTZ A;  4DRW A;  3CS1 A;  4N1F A;  1SRA A;  2PAL A;  2M9G A;  4N5X A;  3DVK A;  1CDL A;  1OMD A;  4MLW A;  1SY9 A;  1XYD A;  2BE4 A;  1CLL A;  2JNF A;  2KYC A;  3SG2 A;  4XJK B;  2H61 C;  1W7I B;  3PN7 B;  2WOR A;  4FTG A;  1CFF A;  1IH0 A;  2BBM A;  4N1G A;  4YGE B;  2PAS A;  1M39 A;  3VRQ A;  2LVV A;  2ZNE A;  2M97 A;  1NUB A;  2JQ6 A;  2KI4 C;  2WOS A;  5FYX A;  1CMF A;  1U5I B;  2JNX A;  2Q91 A;  4MN0 A;  1C7V A;  1IG5 A;  2CXJ A;  3C1V A;  1LKJ A;  2F33 A;  1SL7 A;  3BUN B;  3EKH A;  3JTD C;  1LVC D;  1TCO B;  3FIA A;  1HT9 A;  1XO5 A;  2RGI A;  4ZCU A;  2KSP A;  5PAL A;  1YTZ C;  3GK2 A;  3OX5 A;  1CNP A;  1UHH A;  3TDI A;  2I2R E;  1CM1 A;  1WDC B;  1OQP A;  3AAJ A;  4U8D A;  1YUT A;  1G33 A;  1PVA A;  1NCY A;  4ETO A;  2MHH A;  1A2X A;  3I5H B;  3TDU A;  1UUS A;  1EG4 A;  1BU3 A;  2ZND A;  1YX8 A;  2IS9 A;  1YVH A;  2LLT A;  3SG3 A;  5JOL A;  5ER4 X;  2P6B B;  1RJV A;  4ORC B;  3VGO A;  2HET A;  4OCI A;  2WC8 A;  1WLM A;  2BCX A;  1K9K A;  3GK4 X;  3JVT C;  4DUQ A;  2LMU A;  1A03 A;  3JTD B;  2D8N A;  2L4H A;  1S5G Z;  2Y1M A;  1BT6 A;  3PAL A;  1RWY A;  1CDP A;  2WND A;  1AHR A;  1WRZ A;  3SG4 A;  1C07 A;  1KWO B;  5DKQ A;  2EHB A;  1J1E A;  1TOP A;  1Q80 A;  2KDH A;  2M3W A;  1B4C A;  2R2I A;  1WRK A;  1OSA A;  2MA2 A;  4MZJ A;  4UPG A;  5IBW A;  1KQM B;  2M1K B;  1NCX A;  2WCF A;  1BLQ A;  1NPQ A;  1KK7 Z;  4A4B A;  1DJY A;  1SL8 A;  2E6W A;  3BOW B;  3OP0 A;  4HRE E;  4PDZ A;  2BL0 C;  2F3Z A;  2NCO A;  1K96 A;  2JPT A;  1GGW A;  1DJI A;  1H4B A;  4PHM A;  3JVT B;  3NSL A;  2JZI A;  1S6C A;  3BUO B;  4Q04 A;  1CB1 A;  3BUX B;  2AUC A;  2NXQ A;  2H2K A;  1N0Y A;  2LE9 B;  2JWW A;  1FF1 A;  5AER A;  2KYF A;  1KFX L;  3HX4 A;  2H61 A;  1QJT A;  3BQ3 A;  3IQQ A;  1BR1 B;  1JFJ A;  4AQJ A;  5AFP A;  2HQW A;  2LAP A;  1YUR A;  2SCP A;  3I5I B;  5DKR A;  3GOF A;  4NDB A;  4ORB B;  2KAX A;  2F3Y A;  5CSN A;  1QLS A;  1S26 D;  3PFV A;  4GNK B;  3VRN A;  4HSZ A;  2EC6 B;  3OB2 B;  3LK0 A;  1KSO A;  3SIA A;  1BJF A;  2BL0 B;  5AXI A;  1S6I A;  4I5K A;  5BPJ A;  1CDM A;  2KFH A;  2ZRT A;  3GK1 A;  3LK1 A;  1SPY A;  4GUK A;  2LV7 A;  5HLV A;  2CCM A;  4CID A;  1K2H A;  2L2E A;  3NSO A;  2MRD A;  1CDN A;  1QX7 A;  1MXE A;  1QVI Y;  3O2P A;  4A4C A;  1TN4 A;  3TUY C;  2K7C A;  2O5G A;  3WHU B;  2OTG C;  1JSA A;  3NSI A;  1F54 A;  5AAN A;  1ODB A;  2K2F A;  1F4O A;  1OOJ A;  1ALV A;  3I5F B;  4I5J A;  1J1D A;  5CSI A;  1SCV A;  2L50 A;  5I2L A;  2L0P A;  2LP2 A;  3VRO A;  2JUL A;  4WQ3 A;  1RRO A;  1MXL C;  4YBH B;  1V1F A;  1QV1 A;  1QX2 A;  4NDC A;  1S6J A;  4M2Q A;  1UHN A;  2KHN A;  2VRG A;  1NYA A;  3FWB A;  4MRX A;  1TNW A;  4JPZ B;  5HLO A;  2MBX A;  1UHK A;  1SBJ A;  1KQV A;  2LNK A;  1DT7 B;  4QJ5 B;  3A4U B;  3PM8 A;  5GQQ C;  2KBI A;  2BCB A;  2QAC A;  1EJ3 A;  1FW4 A;  3M0W A;  3TDZ A;  1Y0V H;  2I7A A;  4JQ0 D;  4YRU A;  3KO0 A;  1DJG A;  1YRT B;  1B1G A;  4P5O E;  2F2O A;  3WHT B;  1B8R A;  1Y6W A;  1TNX A;  2Y1N A;  4YGA A;  1KK8 C;  1JUO A;  3CTN A;  4L9M A;  4YI9 A;  2Y4Q A;  1EH2 A;  2JT3 A;  5JJG A;  1L2O B;  2K7B A;  2K8M B;  1F70 A;  1Y1A A;  1K93 D;  1XFZ O;  3D10 A;  4YGD B;  1WLZ A;  3I5G C;  3NSK A;  1DVI A;  3BYA A;  2M7N A;  2LVK A;  1MUX A;  2ZKM X;  2E30 A;  3EVV A;  1E8A A;  4M2P A;  1FPW A;  2KI4 B;  1AP4 A;  4PHK A;  1Y1X A;  4YGB B;  4E68 A;  1QS7 A;  1ZOT B;  4I5N B;  3SIB A;  4MVF A;  3AKB A;  3CR4 X;  3EVR A;  5CSJ A;  2KQY A;  1J7P A;  2LMV A;  1FI6 A;  1NX0 A;  1QX5 B;  1SR6 C;  1SMG A;  5KTY A;  1N65 A;  1NX2 A;  1MR8 A;  1DJZ A;  3D0Y A;  1OZS A;  2GGZ A;  5CPV A;  1S36 A;  4QJ4 B;  3CLN A;  2M49 B;  1AJ5 A;  3O4Y A;  4GBA A;  5KSZ A;  2L4I A;  2Y5I A;  1D1O A;  2SAS A;  1QIV A;  5HYD A;  1NSH A;  1N2D A;  1B9A A;  3NXA A;  1WY9 A;  1BMO A;  4BY4 A;  4PE1 A;  1A4P A;  1CFD A;  3O6B A;  4HRG A;  1JFK A;  2JU0 A;  4NQG A;  3SG7 A;  4PCW A;  1DGU A;  1F71 A;  1ZUZ A;  3AAK A;  1KSM A;  1YVL A;  1GQM A;  2BEC A;  1TNP A;  1S5G Y;  1PVB A;  1R2U A;  5KU1 A;  1SCM C;  1K9P A;  3TZ1 A;  3OB1 B;  2CTN A;  1KFU S;  1L7Z A;  2M29 A;  2LUX A;  3IQO A;  3TS5 C;  1SK6 D;  4PHJ A;  2KGR A;  1W7J B;  3KHE A;  2LCP A;  2LP3 A;  4CFQ A;  3WXA A;  1LA3 A;  1A75 A;  5CSF A;  3CR5 X;  3IF7 A;  2F8P A;  1PSB A;  1KCY A;  2AMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...