1YX7A

Nmr structure of calsensin, energy minimized average structure.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
83
structure length
83
Chain Sequence
MACKVKAELEAAFKKLDANGDGYVTALELQTFMVTLDAYKALSKDKVKEASAKLIKMADKNSDGKISKEEFLNANAELLCQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calsensin
publication title Solution structure and backbone dynamics of Calsensin, an invertebrate neuronal calcium-binding protein.
pubmed doi rcsb
source organism Haemopis marmorata
total genus 14
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yx7A00
1LXFC 1WRLA 1CFDA 1K2HA 2ZNDA 4OCIA 5I8NA 1IKUA 1YUSA 2BL0C 2JXCA 2K7BA 4QJ3B 1JFKA 1HQVA 1WLMA 2JXLA 4JQ0D 1NSHA 1AK8A 4WQ3A 1LA3A 2LVIA 1KFUL 2M9GA 5ER5A 4OVNF 2H61C 2JU0A 1S26D 1OSAA 3CR5X 5ER4X 1MWNA 1SK6D 2LCPA 3I5GB 1XFWO 2E30A 1YRTB 3BXKA 1TTXA 2OTGC 3TDZA 1SCMC 3O2PA 4YGAA 2F3ZA 1KK7Y 1B7TY 5CSIA 2H61A 2KI4C 1Y1XA 2MA2A 4N5XA 1YR5A 1SCVA 4CPVA 3I5IB 4FQOA 3JVTC 1J7RA 2LUXA 4C0JA 4I5LB 2V53A 1KQMB 3EK8A 1QLSA 4E68A 1DGVA 3CR4X 1G4YR 4OV2A 1L2OB 4MRYA 1JF2A 2M1UA 4XJKB 4ORAB 1TNWA 1K96A 2I18A 2M7NA 1AJ4A 2BCXA 4MLWA 1OZSA 4A4CA 2CXJA 4ETOA 2KQYA 2K61A 3AAKA 5HKZA 4DRWA 3DF0B 2LLTA 4XYNA 1IH0A 3GK4X 1CDNA 4NDCA 5F6TA 1CMFA 3CZTX 1NCYA 4ORCB 1NX1A 1NPQA 2NLNA 2WNDA 1DMOA 1CLLA 2MJWB 1KK8C 1Q80A 1WDCB 2EGDA 2JPTA 1MXEA 2BE4A 3WXAA 1F8HA 1H4BA 3O78A 1SMGA 2KGBC 3IQQA 3F45A 1PSRA 5D69A 3BUWB 2K2FA 1YUUA 5G08A 1EG4A 3SIBA 1TNPA 4GGFC 1QV0A 5CPVA 2OS8B 3BUOB 1DVIA 1FF1A 3OHMB 2IS9A 3D10A 2B1UA 2OPOA 4HREE 4AQIA 5IBWA 1CMGA 2H2KA 4MBEA 1S3PA 2QACA 3VRNA 3HX4A 2M97A 4GGFA 5B8IB 1IQ5A 4BY5A 3DVJA 1IWQA 1A29A 1VRKA 3AKAA 1OMRA 3PATA 2WCEA 1K94A 3WHUB 4DCKA 1SBJA 2KSPA 3EK7A 1IQ3A 1N0YA 1G33A 3H4SE 5HKYA 2GGMA 1DJIA 3NSOA 1J1DA 1FBVA 2M3WA 1A75B 3TDUA 2L98A 3PFVA 3VRQA 3NSLA 1QTXA 1JWDA 1UHJA 2AUCA 1YVHA 2JNFA 2G9BA 2LVVA 1YX8A 2R2IA 2HETA 2JT0A 3GOFA 3AKBA 1M45A 5JJGA 1QV1A 1U5IA 2CTNA 5TNCA 4MEWA 1JSAA 1MXLC 2BCAA 1S5GZ 1XFVO 4R1EA 1ZUZA 1TN4A 4USLA 2F2OA 3I5IC 5CSNA 1NIWA 1R6PA 2KDHA 2EC6B 2LNKA 1OE9B 2JOJA 1F71A 2JQ6A 1K90D 1GGZA 2AMIA 2K7DA 1SW8A 1L2OC 2KHNA 2L2EA 1F4QA 1B9AA 1DJWA 2ZN8A 3EK4A 3JTDB 2P6BB 2BE6A 1S6CA 1LVCD 2LHLA 1J7PA 1A2XA 1SNLA 1UHHA 1EL4A 1DF0B 1PK0D 4PALA 1PVAA 2LC5A 1V1FA 1XO5A 1CDMA 1D1OA 1SKTA 2F33A 1GJYA 2AAOA 2LMVA 1M39A 3CWGA 1UP5A 2BKIB 3PSRA 3TS5B 1LA0A 2WOSA 1MHOA 5CSFA 5DKQA 3OX5A 4PE4A 1K8UA 1SR6B 2ZN9A 1RK9A 1FW4A 1QVIY 1SL8A 1BLQA 2L50A 2TN4A 4L9MA 1PULA 4PCWA 2PMYA 3KF9A 3C1VA 1OMDA 1B8LA 2HQWA 2M8UA 1TIZA 4GBAA 1CLBA 1IGVA 1PRWA 1QASA 2JC2A 3KHEA 4AOMA 1QIWA 1B4CA 5GQQC 4CFQA 3K21A 5I2OA 2M49B 1BMOA 2M1KB 2WCFA 2JZIA 2FOTA 2KFHA 1ZFSA 5BPJA 2GGZA 1BJFA 2L0PA 2Q91A 4PE0A 5AEQA 1FI6A 1LKJA 4DS7A 2WORA 1RFJA 1KQVA 2LHIA 1NX3A 5KSZA 1NCXA 4CIDA 3VGOA 1TNQA 4OR9B 3SG5A 1B1GA 3KEVA 2ISDA 1RTP1 2L51A 2LV7A 3D0YA 3RM1A 1XFYO 5HLVA 3PALA 3IQOA 2JULA 2HPSA 2E6WA 5KTYA 3I5HB 2K8MB 2PRUA 4HSZA 2LLUA 2M29A 1DGUA 4WQ2A 2CBLA 3PN7B 1MF8B 2ZRTA 4GAOA 3WHTB 2KI6D 3I5FC 3DVKA 1SRAA 1IJ6A 3EKJA 3SIAA 1C7VA 1B8CA 1KWOB 5HLOA 4C0LA 2NXQA 1CDPA 3CS1A 2L5XB 1K9UA 4MZLA 2M7LA 1QX5B 4NDBA 2F3YA 2COLB 2G2BA 1TCFA 1JUOA 1R2UA 4ICBA 4GUKA 1K9PA 3DD4A 4GGNA 1F70A 4PE1A 1UWOA 2ZFDA 2LAPA 1A03A 1CFPA 3VROA 4MSPA 1DTLA 1L7ZA 1IJ5A 3EVRA 3GK1A 4MRXA 1BT6A 1DJYA 1DJXA 2I2RE 3BOWA 1J7QA 2O60A 3E3RA 2MLFC 2VRGA 1M31A 2KNEA 2Y5IA 2Y4QA 1IG5A 2HQ8A 5KU1A 2BECA 4CFRA 2PSRA 3GK2A 2KI4B 3EVVA 3PLFB 1FPWA 1YRUB 1AVSA 4YGBB 1QLKA 2O5GA 1C07A 2JWWA 2KAXA 2KFFA 1DT7B 1XVJA 2A4JA 1S6JA 3CLNA 4YI9A 2F8PA 2LANA 3JVTB 1CFCA 2EHBA 3TS5C 1UHIA 1UHKA 5AERA 1S36A 2DOQA 2NCPA 1YURA 2JRFA 2LVKA 5K89A 1G8IA 4MZKA 1JBAA 1W7JB 2LMUA 3I5GC 3RLZA 4I5KA 1X02A 1WY9A 2F2PA 3CR2A 4JPZB 2MRDA 2KAYA 4I5JA 3KPXA 4PHKA 2CCMA 1QIVA 3TDIA 1CDLA 1B8RA 1RECA 2KYFA 4CLNA 1Y0VH 1SYMA 1JF0A 1GQMA 1K95A 3OP0A 2LMTA 2ZKMX 3FWBA 1MUXA 4D1EA 1XK4C 2LP3A 2KGRA 1F55A 5DKNA 2SASA 1KFUS 1OQPA 2MAZA 1ALWA 1J1EA 1KQMC 2GV5A 1M46A 1YUTA 4QJ4B 1AP4A 1A4PA 2BCBA 1BU3A 3PM8A 4PE7A 1BF5A 1PSBA 4MN0A 3NSIA 1NUBA 4M2PA 3VRPA 1TCOB 5JOLA 1KSMA 1NX0A 4Q04A 1DJHA 3NSKA 1AJ5A 2QPTA 1ZACA 4PHNA 4GFTA 1BR4B 2LVJA 2KQ6A 4HRGA 2KOTA 4UPGA 1S5GY 3LL8B 3ZWHA 4PHMA 1QX7A 3CTNA 4OKHA 1S1EA 3BYAA 4XJKA 1RWYA 3VRRA 1J55A 4C0KA 1CFFA 1F54A 4GNKB 3SG3A 2KFGA 1EJ3A 2K0JA 2KYCA 2ZNEA 2KAVA 3BUNB 1OOJA 3ZNIA 1KK7Z 1B7TZ 1YTZC 3SJSA 2KBIA 3A4UB 1SPYA 1WDCC 4DIRA 1KSOA 1KWOC 1B47A 1IRJA 3DF0A 1FI5A 1E8AA 1QX2A 2JTTA 1W7IB 3BQ3A 4U8DA 2LE9B 1H8BA 1NCZA 3DVEA 1U5IB 2NCOA 2OS8C 4PDZA 1UURA 3AAJA 4F0ZB 4NQGA 5AXIA 1CM4A 3LCPC 3KO0A 4N1GA 3WNXB 2LUCA 2MHHA 4IL1A 2PALA 4ZCUA 1CB1A 1NWDA 1EXRA 1ODBA 4M2OA 3TUYB 4HRHA 3A8RA 1DJGA 1RJVA 2JT8A 3SG4A 2KBMA 1BR1B 1EG3A 2Y1MA 2JT3A 1OZOA 4QJ5B 2D8NA 1CLMA 2I7AA 1KFXS 1EH2A 4YRUA 1WRKA 2CNPA 2BKHB 3OB2B 4GPLB 3O6BA 1XYDA 4NDDA 1YVLA 1OMVA 4TNCA 3OB1B 4YI8A 4M2QA 5J3XA 2FJUB 3DVMA 2BL0B 3NXAA 1M63B 2NZ0A 1S6IA 4P2YB 5HKWA 1N2DA 1A75A 1BODA 1XFXO 4ORBB 3SG2A 4MVFA 3OX6A 1WLZA 2M0RA 1MR8A 5FYXA 1CNPA 2EC6C 4JWQA 1J7OA 1HT9A 2FCDA 1Y1UA 1KCYA 1UHNA 4YGDB 4A4BA 2Y1NA 4WRIA 3IF7A 1GGWA 1ALVA 1QXPA 2CT9A 2L4IA 2PASA 3JTDC 4I5NB 2OTGB 1NX2A 1K9KA 1LINA 1SCMB 1YX7A 1SL7A 3EVUA 1QJTA 2BBMA 2HF5A 5CSJA 4BY4A 2RGIA 2ZRSA 3FIAA 1KFXL 2I94A 1TNXA 1CKKA 1XA5A 1AUIB 2WC8A 1JC2A 1TOPA 5HYDA 2LM5A 2Q4UA 1BG1A 2MBXA 2JTZA 1SR6C 3D0YB 3MSEB 1C7WA 1RROA 1WRZA 3M0WA 1DF0A 4ZCVA 4YGCB 1ZMZA 3ICBA 3FWCA 2LP2A 3CGAA 1QATA 5PALA 3SG7A 1CM1A 3BUMB 1PALA 2SCPA 1QS7A 3TZ1A 4AQJA 1PVBA 2K2AA 2LLSA 3FS7A 4YBHB 2FCEA 2MLEC 1SL9A 1NYAA 4YGEB 1CTRA 2JNXA 2K7CA 4DUQA 5I2QA 3LK0A 1JFJA 4PHJA 3O4YA 3PN7C 1Y1AA 2BBNA 2K7OA 1DJZA 1SY9A 3LK1A 1TRFA 4N1FA 4FTGA 3SG6A 1AHRA 5AFPA 3I5FB 1KK8B 3TUYC 1NP8A 1BOCA 1XK4A 1N65A 2L4HA 3LLEA 3BOWB 2PVBA 5I2LA 4MZJA 1ZOTB 3BUXB 1UUSA 4P5OE 2KI6C 3I5HC 2WCBA 1Y6WA 1QVIZ 1V1GA 3EKHA 5D7FA 3QRXA 1K93D 5DKRA 1MQ1A 1XFUO 5AANA 1XFZO 3HCMA 1F4OA
chains in the Genus database with same CATH superfamily
1OOIX 1LXFC 1WRLA 1CFDA 1K2HA 2ZNDA 4OCIA 4PT1A 5I8NA 1IKUA 1IIOA 1YUSA 2BL0C 2JXCA 2K60A 2K7BA 2KLDA 4QJ3B 5DICA 1JFKA 1HQVA 1WLMA 2FJYA 2JXLA 3PM2A 4JQ0D 4INXA 1LS8A 1NSHA 1AK8A 4WQ3A 1LA3A 2LVIA 1KFUL 2M9GA 4F7FA 2QEVA 4OVNF 5ER5A 2H61C 2JU0A 1S26D 1OSAA 3CR5X 5ER4X 1MWNA 1SK6D 2LCPA 3I5GB 2WCHA 5EL2A 1XFWO 2E30A 1YRTB 3BJHA 3BXKA 1H4BA 1TTXA 2OTGC 3TDZA 1SCMC 3O2PA 4JD9A 4YGAA 2F3ZA 2YGUA 1KK7Y 1B7TY 5CSIA 2QDIA 3D77A 2H61A 2KI4C 1Y1XA 2MA2A 4N5XA 1YR5A 1SCVA 4CPVA 3I5IB 4FQOA 3JVTC 1J7RA 2LUXA 4C0JA 4I5LB 2V53A 1KQMB 3EK8A 1QLSA 4E68A 1DGVA 3CR4X 1G4YR 4OV2A 1L2OB 4MRYA 1JF2A 2M1UA 4XJKB 4ORAB 1OOFA 1TNWA 1K96A 2I18A 2M7NA 1AJ4A 2BCXA 4MLWA 1OZSA 4A4CA 2CXJA 4ETOA 2KQYA 2K61A 3AAKA 3L47A 5HKZA 4DRWA 3DF0B 2LLTA 4XYNA 3CYZA 3SS3A 1IH0A 3GK4X 1CDNA 4NDCA 5F6TA 3D74A 3CZTX 1NCYA 4ORCB 1CMFA 1NX1A 1NPQA 2NLNA 2WNDA 1DMOA 1CLLA 2MJWB 1KK8C 1Q80A 1WDCB 2EGDA 2JPTA 1MXEA 2BE4A 3WXAA 3EG5B 1F8HA 3O78A 1SMGA 2KGBC 3IQQA 1DEKA 1PSRA 3F45A 3R1OA 3BUWB 5D69A 2K2FA 1YUUA 5G08A 1EG4A 3SIBA 1TNPA 4GGFC 1QV0A 5CPVA 2OS8B 3BUOB 1DVIA 1FF1A 3OHMB 1Z2CB 2IS9A 3D10A 2B1UA 2OPOA 4HREE 4AQIA 5IBWA 1CMGA 2H2KA 4MBEA 1S3PA 2QACA 3VRNA 3HX4A 2M97A 2QEOA 3N7HA 3D78A 1DQEA 4GGFA 3CZ1A 5B8IB 1IQ5A 3CZ0A 4BY5A 3DVJA 1IWQA 1DELA 1A29A 1VRKA 3AKAA 3OBVA 1OMRA 3PATA 1Z4HA 2WCEA 1K94A 3WHUB 4DCKA 1SBJA 2KSPA 3EK7A 1IQ3A 3QMEA 1N0YA 1G33A 3H4SE 5HKYA 2GGMA 1DJIA 3NSOA 3SS4A 1J1DA 1FBVA 2M3WA 3B6XA 1A75B 3TDUA 2L98A 3PFVA 3VRQA 3FE9A 3NSLA 1QTXA 1JWDA 1UHJA 2AUCA 1YVHA 2JNFA 2G9BA 2LVVA 1YX8A 2R2IA 2HETA 2JT0A 3B88A 3GOFA 3AKBA 1M45A 5JJGA 1QV1A 1U5IA 2CTNA 5TNCA 4MEWA 2KPHA 1JSAA 3NGVA 1MXLC 5FI7A 2BCAA 1S5GZ 1XFVO 4R1EA 1ZUZA 3V2LA 1TN4A 4USLA 2F2OA 3IVTA 3I5IC 5CSNA 1NIWA 1R6PA 2KDHA 2EC6B 2LNKA 1OE9B 2JOJA 1F71A 2L2CA 2JQ6A 3L4AA 1K90D 1GGZA 2AMIA 2K7DA 1SW8A 1L2OC 2KHNA 2L2EA 1F4QA 1B9AA 1DJWA 2ZN8A 3EK4A 3JTDB 2P6BB 2BE6A 1S6CA 1LVCD 1TWOA 2LHLA 3OGNA 1J7PA 1A2XA 1SNLA 1UHHA 1EL4A 1DF0B 1PK0D 3R1PA 3FE6A 4PALA 1PVAA 2LC5A 1V1FA 1XO5A 1CDMA 3L4LA 1D1OA 1SKTA 2F33A 1GJYA 2AAOA 2LMVA 1M39A 3CWGA 1UP5A 2BKIB 3PSRA 3TS5B 1OOGA 1LA0A 2WOSA 1MHOA 5CSFA 5DKQA 3OX5A 4PE4A 1K8UA 1SR6B 2ZN9A 1RK9A 1FW4A 3NHIA 1QVIY 1SL8A 1BLQA 2L50A 2TN4A 4L9MA 1PULA 4PCWA 2PMYA 3KF9A 3C1VA 2WCJA 1OMDA 1B8LA 2HQWA 2M8UA 1TIZA 2WC6A 4GBAA 1CLBA 1IGVA 1PRWA 1QASA 2JC2A 3KHEA 4AOMA 1QIWA 1B4CA 5GQQC 2P71A 4CFQA 3K21A 5I2OA 2M49B 1BMOA 1C3ZA 2M1KB 2WCFA 2JZIA 2FOTA 2KFHA 1ZFSA 5BPJA 2GGZA 1BJFA 2L0PA 2Q91A 4PE0A 2JPOA 5AEQA 1FI6A 1LKJA 4DS7A 2WORA 1RFJA 2WCLA 1KQVA 2LHIA 1NX3A 5KSZA 1NCXA 4CIDA 3VGOA 1TNQA 4OR9B 3SG5A 3S0BA 3KEVA 2ISDA 1RTP1 1B1GA 2L51A 2LV7A 3D0YA 3RM1A 1XFYO 5HLVA 3PALA 3IQOA 2JULA 2HPSA 2E6WA 5KTYA 3I5HB 2K8MB 2PRUA 4HSZA 3VB1A 2LLUA 2M29A 1DGUA 1OOHA 2WCKA 2CBLA 4WQ2A 3PN7B 1MF8B 2ZRTA 4GAOA 3WHTB 2KI6D 3I5FC 3DVKA 1SRAA 1IJ6A 2P70A 3EKJA 2WC5A 3SIAA 1B8CA 1C7VA 1KWOB 5HLOA 4C0LA 2NXQA 1CDPA 3CS1A 2L5XB 1K9UA 3BFAA 4MZLA 2M7LA 1QX5B 4NDBA 2F3YA 2COLB 2G2BA 3CDNA 1TCFA 1JUOA 1R2UA 3BFHA 4ICBA 4GUKA 1K9PA 3DD4A 4GGNA 1F70A 4PE1A 1UWOA 2ZFDA 2LAPA 1A03A 4KYNA 1CFPA 3CZ2A 3VROA 4MSPA 1DTLA 1L7ZA 1IJ5A 3EVRA 3GK1A 4MRXA 1BT6A 1DJYA 1DJXA 2I2RE 3BOWA 1J7QA 2O60A 3E3RA 2MLFC 2VRGA 1M31A 2KNEA 2Y5IA 2Y4QA 1IG5A 2HQ8A 3B87A 5KU1A 1DC1A 2BECA 4CFRA 2PSRA 3GK2A 2KI4B 3EVVA 3PLFB 1FPWA 1YRUB 1AVSA 4YGBB 3B7AA 1QLKA 2O5GA 1C07A 2JWWA 2KAXA 2KFFA 1DT7B 1XVJA 2A4JA 1S6JA 3CLNA 4YI9A 2F8PA 2LANA 3JVTB 1CFCA 2EHBA 3TS5C 1UHIA 1UHKA 5AERA 1S36A 2DOQA 2NCPA 1YURA 2JRFA 2LVKA 5K89A 1G8IA 4MZKA 1JBAA 1W7JB 2LMUA 3I5GC 3RLZA 3DY9A 4I5KA 1X02A 1WY9A 2F2PA 3CR2A 1ORGA 4JPZB 2MRDA 2KAYA 4I5JA 3KPXA 3B86A 4PHKA 2CCMA 1QIVA 3TDIA 1CDLA 1B8RA 1RECA 2KYFA 4CLNA 1Y0VH 1SYMA 1JF0A 1GQMA 1K95A 3OP0A 2LMTA 2ZKMX 3FWBA 1MUXA 4D1EA 1XK4C 2LP3A 2KGRA 1F55A 5DKNA 2SASA 1KFUS 1OQPA 1T14A 2MAZA 1ALWA 1J1EA 1KQMC 2GV5A 1M46A 1YUTA 4QJ4B 1AP4A 1A4PA 2BCBA 1BU3A 3PM8A 4PE7A 3DXLA 1BF5A 1PSBA 1SSEB 4MN0A 3NSIA 1NUBA 4M2PA 3VRPA 1TCOB 5JOLA 1KSMA 1NX0A 4Q04A 1DJHA 3NSKA 1AJ5A 2QPTA 1ZACA 4PHNA 5FI6A 4GFTA 1BR4B 2LVJA 2KQ6A 4HRGA 2KOTA 4UPGA 1S5GY 3PJIA 4OZDA 1OW4A 3LL8B 3ZWHA 4PHMA 1QX7A 3CTNA 3S0AA 4OKHA 1S1EA 3BYAA 4XJKA 1RWYA 3UNWA 3VRRA 1J55A 4FQTA 4C0KA 5HL1A 1CFFA 1F54A 4GNKB 3SG3A 2KFGA 1EJ3A 2K0JA 1W9ZA 3S0DA 2KYCA 1TUJA 2KAVA 2ZNEA 1OOJA 3BUNB 1KK7Z 1B7TZ 1YTZC 3SJSA 2KBIA 3ZNIA 3A4UB 1SPYA 1WDCC 4DIRA 1KSOA 1KWOC 1B47A 1IRJA 3DF0A 3S0EA 1FI5A 1E8AA 1QX2A 3Q8IA 2JTTA 2KLEA 1W7IB 3BQ3A 4U8DA 2LE9B 1H8BA 1NCZA 3DVEA 1U5IB 2NCOA 2OS8C 4PDZA 1UURA 3AAJA 3S0FA 4F0ZB 4NQGA 5AXIA 1CM4A 3LCPC 3KO0A 4N1GA 3WNXB 2LUCA 2MHHA 1P28A 4IL1A 2PALA 4ZCUA 1CB1A 1NWDA 3R72A 1EXRA 1ODBA 4M2OA 3TUYB 4HRHA 3A8RA 1QWVA 5FI2A 1DJGA 1RJVA 2JT8A 3SG4A 2KBMA 1BR1B 1EG3A 3UO9A 2Y1MA 2JT3A 1OZOA 4QJ5B 2D8NA 1CLMA 2I7AA 1KFXS 2BNXA 4IJ7A 3K1EA 1EH2A 4YRUA 1WRKA 2CNPA 2BKHB 3OB2B 4GPLB 3O6BA 1XYDA 4NDDA 1YVLA 1OMVA 4TNCA 3OB1B 4YI8A 4M2QA 5J3XA 2FJUB 3DVMA 2BL0B 3NXAA 1M63B 3D75A 2NZ0A 1S6IA 4P2YB 5HKWA 1N2DA 1A75A 1BODA 1XFXO 4ORBB 3SG2A 3O4XA 4MVFA 2H8VA 3OX6A 3SS5A 1WLZA 2M0RA 2QEHA 1MR8A 2WCMA 5FYXA 3S0GA 1CNPA 2EC6C 4JWQA 2QEBA 1C3YA 1J7OA 1HT9A 2FCDA 1Y1UA 1KCYA 1UHNA 4YGDB 4A4BA 2Y1NA 4WRIA 2PQLA 3IF7A 1GGWA 1ALVA 1QXPA 2CT9A 2L4IA 2PASA 3JTDC 4I5NB 2OTGB 1NX2A 3RZSA 1K9KA 1LINA 1SCMB 1TUZA 1YX7A 3NHTA 1SL7A 3EVUA 1QJTA 2BBMA 2HF5A 5CSJA 4BY4A 2GTEA 2RGIA 2ZRSA 3FIAA 1KFXL 2I94A 1TNXA 1CKKA 1XA5A 1AUIB 2WC8A 1JC2A 1TOPA 3BFBA 5HYDA 2LM5A 2Q4UA 1BG1A 1XFRA 2MBXA 2JTZA 1SR6C 3D0YB 3MSEB 1C7WA 1RROA 1WRZA 3M0WA 1DF0A 4ZCVA 4YGCB 1ZMZA 3ICBA 3FWCA 2LP2A 3CGAA 1QATA 5PALA 3D73A 5D3OA 3SG7A 1CM1A 3BUMB 1PALA 2SCPA 1QS7A 3TZ1A 4AQJA 1PVBA 2K2AA 2LLSA 3FS7A 5I94A 4YBHB 2FCEA 2MLEC 1SL9A 1NYAA 4YGEB 1CTRA 2JNXA 2K7CA 1GM0A 4DUQA 5I2QA 3LK0A 1JFJA 4PHJA 3O4YA 3PN7C 1Y1AA 2BBNA 2K7OA 1DJZA 1SY9A 3LK1A 1TRFA 4N1FA 4FTGA 3SG6A 3DZTA 1AHRA 5AFPA 3I5FB 1KK8B 3TUYC 1NP8A 1BOCA 1XK4A 3R1VA 1N65A 2L4HA 3LLEA 3BOWB 2PVBA 2ERBA 5I2LA 3FE8A 4MZJA 1ZOTB 3BUXB 1UUSA 4P5OE 4INWA 2KI6C 3I5HC 2WCBA 3CABA 4JKTA 1Y6WA 1QVIZ 3DYEA 1V1GA 2PYQA 3EKHA 5D7FA 3QRXA 1K93D 3D76A 1MQ1A 2BAPA 2L5YA 1XFUO 5DKRA 5AANA 1XFZO 3HCMA 1F4OA
chains in the Genus database with same CATH topology
1LXFC 1WRLA 1CFDA 1K2HA 2ZNDA 4OCIA 5I8NA 1IKUA 1YUSA 2BL0C 2JXCA 2K7BA 4QJ3B 1JFKA 1HQVA 1WLMA 2JXLA 4JQ0D 1NSHA 1AK8A 4WQ3A 1LA3A 2LVIA 1KFUL 2M9GA 5ER5A 4OVNF 2H61C 2JU0A 1S26D 1OSAA 3CR5X 5ER4X 1MWNA 1SK6D 2LCPA 3I5GB 1XFWO 2E30A 1YRTB 3BXKA 1TTXA 2OTGC 3TDZA 1SCMC 3O2PA 4YGAA 2F3ZA 1KK7Y 1B7TY 5CSIA 2H61A 2KI4C 1Y1XA 2MA2A 4N5XA 1YR5A 1SCVA 4CPVA 3I5IB 4FQOA 3JVTC 1J7RA 2LUXA 4C0JA 4I5LB 2V53A 1KQMB 3EK8A 1QLSA 4E68A 1DGVA 3CR4X 1G4YR 4OV2A 1L2OB 4MRYA 1JF2A 2M1UA 4XJKB 4ORAB 1TNWA 1K96A 2I18A 2M7NA 1AJ4A 2BCXA 4MLWA 1OZSA 4A4CA 2CXJA 4ETOA 2KQYA 2K61A 3AAKA 5HKZA 4DRWA 3DF0B 2LLTA 4XYNA 1IH0A 3GK4X 1CDNA 4NDCA 5F6TA 1CMFA 3CZTX 1NCYA 4ORCB 1NX1A 1NPQA 2NLNA 2WNDA 1DMOA 1CLLA 2MJWB 1KK8C 1Q80A 1WDCB 2EGDA 2JPTA 1MXEA 2BE4A 3WXAA 1F8HA 1H4BA 3O78A 1SMGA 2KGBC 3IQQA 3F45A 1PSRA 5D69A 3BUWB 2K2FA 1YUUA 5G08A 1EG4A 3SIBA 1TNPA 4GGFC 1QV0A 5CPVA 2OS8B 3BUOB 1DVIA 1FF1A 3OHMB 2IS9A 3D10A 2B1UA 2OPOA 4HREE 4AQIA 5IBWA 1CMGA 2H2KA 4MBEA 1S3PA 2QACA 3VRNA 3HX4A 2M97A 4GGFA 5B8IB 1IQ5A 4BY5A 3DVJA 1IWQA 1A29A 1VRKA 3AKAA 1OMRA 3PATA 2WCEA 1K94A 3WHUB 4DCKA 1SBJA 2KSPA 3EK7A 1IQ3A 1N0YA 1G33A 3H4SE 5HKYA 2GGMA 1DJIA 3NSOA 1J1DA 1FBVA 2M3WA 1A75B 3TDUA 2L98A 3PFVA 3VRQA 3NSLA 1QTXA 1JWDA 1UHJA 2AUCA 1YVHA 2JNFA 2G9BA 2LVVA 1YX8A 2R2IA 2HETA 2JT0A 3GOFA 3AKBA 1M45A 5JJGA 1QV1A 1U5IA 2CTNA 5TNCA 4MEWA 1JSAA 1MXLC 2BCAA 1S5GZ 1XFVO 4R1EA 1ZUZA 1TN4A 4USLA 2F2OA 3I5IC 5CSNA 1NIWA 1R6PA 2KDHA 2EC6B 2LNKA 1OE9B 2JOJA 1F71A 2JQ6A 1K90D 1GGZA 2AMIA 2K7DA 1SW8A 1L2OC 2KHNA 2L2EA 1F4QA 1B9AA 1DJWA 2ZN8A 3EK4A 3JTDB 2P6BB 2BE6A 1S6CA 1LVCD 2LHLA 1J7PA 1A2XA 1SNLA 1UHHA 1EL4A 1DF0B 1PK0D 4PALA 1PVAA 2LC5A 1V1FA 1XO5A 1CDMA 1D1OA 1SKTA 2F33A 1GJYA 2AAOA 2LMVA 1M39A 3CWGA 1UP5A 2BKIB 3PSRA 3TS5B 1LA0A 2WOSA 1MHOA 5CSFA 5DKQA 3OX5A 4PE4A 1K8UA 1SR6B 2ZN9A 1RK9A 1FW4A 1QVIY 1SL8A 1BLQA 2L50A 2TN4A 4L9MA 1PULA 4PCWA 2PMYA 3KF9A 3C1VA 1OMDA 1B8LA 2HQWA 2M8UA 1TIZA 4GBAA 1CLBA 1IGVA 1PRWA 1QASA 2JC2A 3KHEA 4AOMA 1QIWA 1B4CA 5GQQC 4CFQA 3K21A 5I2OA 2M49B 1BMOA 2M1KB 2WCFA 2JZIA 2FOTA 2KFHA 1ZFSA 5BPJA 2GGZA 1BJFA 2L0PA 2Q91A 4PE0A 5AEQA 1FI6A 1LKJA 4DS7A 2WORA 1RFJA 1KQVA 2LHIA 1NX3A 5KSZA 1NCXA 4CIDA 3VGOA 1TNQA 4OR9B 3SG5A 1B1GA 3KEVA 2ISDA 1RTP1 2L51A 2LV7A 3D0YA 3RM1A 1XFYO 5HLVA 3PALA 3IQOA 2JULA 2HPSA 2E6WA 5KTYA 3I5HB 2K8MB 2PRUA 4HSZA 2LLUA 2M29A 1DGUA 4WQ2A 2CBLA 3PN7B 1MF8B 2ZRTA 4GAOA 3WHTB 2KI6D 3I5FC 3DVKA 1SRAA 1IJ6A 3EKJA 3SIAA 1C7VA 1B8CA 1KWOB 5HLOA 4C0LA 2NXQA 1CDPA 3CS1A 2L5XB 1K9UA 4MZLA 2M7LA 1QX5B 4NDBA 2F3YA 2COLB 2G2BA 1TCFA 1JUOA 1R2UA 4ICBA 4GUKA 1K9PA 3DD4A 4GGNA 1F70A 4PE1A 1UWOA 2ZFDA 2LAPA 1A03A 1CFPA 3VROA 4MSPA 1DTLA 1L7ZA 1IJ5A 3EVRA 3GK1A 4MRXA 1BT6A 1DJYA 1DJXA 2I2RE 3BOWA 1J7QA 2O60A 3E3RA 2MLFC 2VRGA 1M31A 2KNEA 2Y5IA 2Y4QA 1IG5A 2HQ8A 5KU1A 2BECA 4CFRA 2PSRA 3GK2A 2KI4B 3EVVA 3PLFB 1FPWA 1YRUB 1AVSA 4YGBB 1QLKA 2O5GA 1C07A 2JWWA 2KAXA 2KFFA 1DT7B 1XVJA 2A4JA 1S6JA 3CLNA 4YI9A 2F8PA 2LANA 3JVTB 1CFCA 2EHBA 3TS5C 1UHIA 1UHKA 5AERA 1S36A 2DOQA 2NCPA 1YURA 2JRFA 2LVKA 5K89A 1G8IA 4MZKA 1JBAA 1W7JB 2LMUA 3I5GC 3RLZA 4I5KA 1X02A 1WY9A 2F2PA 3CR2A 4JPZB 2MRDA 2KAYA 4I5JA 3KPXA 4PHKA 2CCMA 1QIVA 3TDIA 1CDLA 1B8RA 1RECA 2KYFA 4CLNA 1Y0VH 1SYMA 1JF0A 1GQMA 1K95A 3OP0A 2LMTA 2ZKMX 3FWBA 1MUXA 4D1EA 1XK4C 2LP3A 2KGRA 1F55A 5DKNA 2SASA 1KFUS 1OQPA 2MAZA 1ALWA 1J1EA 1KQMC 2GV5A 1M46A 1YUTA 4QJ4B 1AP4A 1A4PA 2BCBA 1BU3A 3PM8A 4PE7A 1BF5A 1PSBA 4MN0A 3NSIA 1NUBA 4M2PA 3VRPA 1TCOB 5JOLA 1KSMA 1NX0A 4Q04A 1DJHA 3NSKA 1AJ5A 2QPTA 1ZACA 4PHNA 4GFTA 1BR4B 2LVJA 2KQ6A 4HRGA 2KOTA 4UPGA 1S5GY 3LL8B 3ZWHA 4PHMA 1QX7A 3CTNA 4OKHA 1S1EA 3BYAA 4XJKA 1RWYA 3VRRA 1J55A 4C0KA 1CFFA 1F54A 4GNKB 3SG3A 2KFGA 1EJ3A 2K0JA 2KYCA 2ZNEA 2KAVA 3BUNB 1OOJA 3ZNIA 1KK7Z 1B7TZ 1YTZC 3SJSA 2KBIA 3A4UB 1SPYA 1WDCC 4DIRA 1KSOA 1KWOC 1B47A 1IRJA 3DF0A 1FI5A 1E8AA 1QX2A 2JTTA 1W7IB 3BQ3A 4U8DA 2LE9B 1H8BA 1NCZA 3DVEA 1U5IB 2NCOA 2OS8C 4PDZA 1UURA 3AAJA 4F0ZB 4NQGA 5AXIA 1CM4A 3LCPC 3KO0A 4N1GA 3WNXB 2LUCA 2MHHA 4IL1A 2PALA 4ZCUA 1CB1A 1NWDA 1EXRA 1ODBA 4M2OA 3TUYB 4HRHA 3A8RA 1DJGA 1RJVA 2JT8A 3SG4A 2KBMA 1BR1B 1EG3A 2Y1MA 2JT3A 1OZOA 4QJ5B 2D8NA 1CLMA 2I7AA 1KFXS 1EH2A 4YRUA 1WRKA 2CNPA 2BKHB 3OB2B 4GPLB 3O6BA 1XYDA 4NDDA 1YVLA 1OMVA 4TNCA 3OB1B 4YI8A 4M2QA 5J3XA 2FJUB 3DVMA 2BL0B 3NXAA 1M63B 2NZ0A 1S6IA 4P2YB 5HKWA 1N2DA 1A75A 1BODA 1XFXO 4ORBB 3SG2A 4MVFA 3OX6A 1WLZA 2M0RA 1MR8A 5FYXA 1CNPA 2EC6C 4JWQA 1J7OA 1HT9A 2FCDA 1Y1UA 1KCYA 1UHNA 4YGDB 4A4BA 2Y1NA 4WRIA 3IF7A 1GGWA 1ALVA 1QXPA 2CT9A 2L4IA 2PASA 3JTDC 4I5NB 2OTGB 1NX2A 1K9KA 1LINA 1SCMB 1YX7A 1SL7A 3EVUA 1QJTA 2BBMA 2HF5A 5CSJA 4BY4A 2RGIA 2ZRSA 3FIAA 1KFXL 2I94A 1TNXA 1CKKA 1XA5A 1AUIB 2WC8A 1JC2A 1TOPA 5HYDA 2LM5A 2Q4UA 1BG1A 2MBXA 2JTZA 1SR6C 3D0YB 3MSEB 1C7WA 1RROA 1WRZA 3M0WA 1DF0A 4ZCVA 4YGCB 1ZMZA 3ICBA 3FWCA 2LP2A 3CGAA 1QATA 5PALA 3SG7A 1CM1A 3BUMB 1PALA 2SCPA 1QS7A 3TZ1A 4AQJA 1PVBA 2K2AA 2LLSA 3FS7A 4YBHB 2FCEA 2MLEC 1SL9A 1NYAA 4YGEB 1CTRA 2JNXA 2K7CA 4DUQA 5I2QA 3LK0A 1JFJA 4PHJA 3O4YA 3PN7C 1Y1AA 2BBNA 2K7OA 1DJZA 1SY9A 3LK1A 1TRFA 4N1FA 4FTGA 3SG6A 1AHRA 5AFPA 3I5FB 1KK8B 3TUYC 1NP8A 1BOCA 1XK4A 1N65A 2L4HA 3LLEA 3BOWB 2PVBA 5I2LA 4MZJA 1ZOTB 3BUXB 1UUSA 4P5OE 2KI6C 3I5HC 2WCBA 1Y6WA 1QVIZ 1V1GA 3EKHA 5D7FA 3QRXA 1K93D 5DKRA 1MQ1A 1XFUO 5AANA 1XFZO 3HCMA 1F4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LXF C;  1WRL A;  1CFD A;  1K2H A;  2ZND A;  4OCI A;  5I8N A;  1IKU A;  1YUS A;  2BL0 C;  2JXC A;  2K7B A;  4QJ3 B;  1JFK A;  1HQV A;  1WLM A;  2JXL A;  4JQ0 D;  1NSH A;  1AK8 A;  4WQ3 A;  1LA3 A;  2LVI A;  1KFU L;  2M9G A;  5ER5 A;  4OVN F;  2H61 C;  2JU0 A;  1S26 D;  1OSA A;  3CR5 X;  5ER4 X;  1MWN A;  1SK6 D;  2LCP A;  3I5G B;  1XFW O;  2E30 A;  1YRT B;  3BXK A;  1TTX A;  2OTG C;  3TDZ A;  1SCM C;  3O2P A;  4YGA A;  2F3Z A;  1KK7 Y;  1B7T Y;  5CSI A;  2H61 A;  2KI4 C;  1Y1X A;  2MA2 A;  4N5X A;  1YR5 A;  1SCV A;  4CPV A;  3I5I B;  4FQO A;  3JVT C;  1J7R A;  2LUX A;  4C0J A;  4I5L B;  2V53 A;  1KQM B;  3EK8 A;  1QLS A;  4E68 A;  1DGV A;  3CR4 X;  1G4Y R;  4OV2 A;  1L2O B;  4MRY A;  1JF2 A;  2M1U A;  4XJK B;  4ORA B;  1TNW A;  1K96 A;  2I18 A;  2M7N A;  1AJ4 A;  2BCX A;  4MLW A;  1OZS A;  4A4C A;  2CXJ A;  4ETO A;  2KQY A;  2K61 A;  3AAK A;  5HKZ A;  4DRW A;  3DF0 B;  2LLT A;  4XYN A;  1IH0 A;  3GK4 X;  1CDN A;  4NDC A;  5F6T A;  1CMF A;  3CZT X;  1NCY A;  4ORC B;  1NX1 A;  1NPQ A;  2NLN A;  2WND A;  1DMO A;  1CLL A;  2MJW B;  1KK8 C;  1Q80 A;  1WDC B;  2EGD A;  2JPT A;  1MXE A;  2BE4 A;  3WXA A;  1F8H A;  1H4B A;  3O78 A;  1SMG A;  2KGB C;  3IQQ A;  3F45 A;  1PSR A;  5D69 A;  3BUW B;  2K2F A;  1YUU A;  5G08 A;  1EG4 A;  3SIB A;  1TNP A;  4GGF C;  1QV0 A;  5CPV A;  2OS8 B;  3BUO B;  1DVI A;  1FF1 A;  3OHM B;  2IS9 A;  3D10 A;  2B1U A;  2OPO A;  4HRE E;  4AQI A;  5IBW A;  1CMG A;  2H2K A;  4MBE A;  1S3P A;  2QAC A;  3VRN A;  3HX4 A;  2M97 A;  4GGF A;  5B8I B;  1IQ5 A;  4BY5 A;  3DVJ A;  1IWQ A;  1A29 A;  1VRK A;  3AKA A;  1OMR A;  3PAT A;  2WCE A;  1K94 A;  3WHU B;  4DCK A;  1SBJ A;  2KSP A;  3EK7 A;  1IQ3 A;  1N0Y A;  1G33 A;  3H4S E;  5HKY A;  2GGM A;  1DJI A;  3NSO A;  1J1D A;  1FBV A;  2M3W A;  1A75 B;  3TDU A;  2L98 A;  3PFV A;  3VRQ A;  3NSL A;  1QTX A;  1JWD A;  1UHJ A;  2AUC A;  1YVH A;  2JNF A;  2G9B A;  2LVV A;  1YX8 A;  2R2I A;  2HET A;  2JT0 A;  3GOF A;  3AKB A;  1M45 A;  5JJG A;  1QV1 A;  1U5I A;  2CTN A;  5TNC A;  4MEW A;  1JSA A;  1MXL C;  2BCA A;  1S5G Z;  1XFV O;  4R1E A;  1ZUZ A;  1TN4 A;  4USL A;  2F2O A;  3I5I C;  5CSN A;  1NIW A;  1R6P A;  2KDH A;  2EC6 B;  2LNK A;  1OE9 B;  2JOJ A;  1F71 A;  2JQ6 A;  1K90 D;  1GGZ A;  2AMI A;  2K7D A;  1SW8 A;  1L2O C;  2KHN A;  2L2E A;  1F4Q A;  1B9A A;  1DJW A;  2ZN8 A;  3EK4 A;  3JTD B;  2P6B B;  2BE6 A;  1S6C A;  1LVC D;  2LHL A;  1J7P A;  1A2X A;  1SNL A;  1UHH A;  1EL4 A;  1DF0 B;  1PK0 D;  4PAL A;  1PVA A;  2LC5 A;  1V1F A;  1XO5 A;  1CDM A;  1D1O A;  1SKT A;  2F33 A;  1GJY A;  2AAO A;  2LMV A;  1M39 A;  3CWG A;  1UP5 A;  2BKI B;  3PSR A;  3TS5 B;  1LA0 A;  2WOS A;  1MHO A;  5CSF A;  5DKQ A;  3OX5 A;  4PE4 A;  1K8U A;  1SR6 B;  2ZN9 A;  1RK9 A;  1FW4 A;  1QVI Y;  1SL8 A;  1BLQ A;  2L50 A;  2TN4 A;  4L9M A;  1PUL A;  4PCW A;  2PMY A;  3KF9 A;  3C1V A;  1OMD A;  1B8L A;  2HQW A;  2M8U A;  1TIZ A;  4GBA A;  1CLB A;  1IGV A;  1PRW A;  1QAS A;  2JC2 A;  3KHE A;  4AOM A;  1QIW A;  1B4C A;  5GQQ C;  4CFQ A;  3K21 A;  5I2O A;  2M49 B;  1BMO A;  2M1K B;  2WCF A;  2JZI A;  2FOT A;  2KFH A;  1ZFS A;  5BPJ A;  2GGZ A;  1BJF A;  2L0P A;  2Q91 A;  4PE0 A;  5AEQ A;  1FI6 A;  1LKJ A;  4DS7 A;  2WOR A;  1RFJ A;  1KQV A;  2LHI A;  1NX3 A;  5KSZ A;  1NCX A;  4CID A;  3VGO A;  1TNQ A;  4OR9 B;  3SG5 A;  1B1G A;  3KEV A;  2ISD A;  1RTP 1;  2L51 A;  2LV7 A;  3D0Y A;  3RM1 A;  1XFY O;  5HLV A;  3PAL A;  3IQO A;  2JUL A;  2HPS A;  2E6W A;  5KTY A;  3I5H B;  2K8M B;  2PRU A;  4HSZ A;  2LLU A;  2M29 A;  1DGU A;  4WQ2 A;  2CBL A;  3PN7 B;  1MF8 B;  2ZRT A;  4GAO A;  3WHT B;  2KI6 D;  3I5F C;  3DVK A;  1SRA A;  1IJ6 A;  3EKJ A;  3SIA A;  1C7V A;  1B8C A;  1KWO B;  5HLO A;  4C0L A;  2NXQ A;  1CDP A;  3CS1 A;  2L5X B;  1K9U A;  4MZL A;  2M7L A;  1QX5 B;  4NDB A;  2F3Y A;  2COL B;  2G2B A;  1TCF A;  1JUO A;  1R2U A;  4ICB A;  4GUK A;  1K9P A;  3DD4 A;  4GGN A;  1F70 A;  4PE1 A;  1UWO A;  2ZFD A;  2LAP A;  1A03 A;  1CFP A;  3VRO A;  4MSP A;  1DTL A;  1L7Z A;  1IJ5 A;  3EVR A;  3GK1 A;  4MRX A;  1BT6 A;  1DJY A;  1DJX A;  2I2R E;  3BOW A;  1J7Q A;  2O60 A;  3E3R A;  2MLF C;  2VRG A;  1M31 A;  2KNE A;  2Y5I A;  2Y4Q A;  1IG5 A;  2HQ8 A;  5KU1 A;  2BEC A;  4CFR A;  2PSR A;  3GK2 A;  2KI4 B;  3EVV A;  3PLF B;  1FPW A;  1YRU B;  1AVS A;  4YGB B;  1QLK A;  2O5G A;  1C07 A;  2JWW A;  2KAX A;  2KFF A;  1DT7 B;  1XVJ A;  2A4J A;  1S6J A;  3CLN A;  4YI9 A;  2F8P A;  2LAN A;  3JVT B;  1CFC A;  2EHB A;  3TS5 C;  1UHI A;  1UHK A;  5AER A;  1S36 A;  2DOQ A;  2NCP A;  1YUR A;  2JRF A;  2LVK A;  5K89 A;  1G8I A;  4MZK A;  1JBA A;  1W7J B;  2LMU A;  3I5G C;  3RLZ A;  4I5K A;  1X02 A;  1WY9 A;  2F2P A;  3CR2 A;  4JPZ B;  2MRD A;  2KAY A;  4I5J A;  3KPX A;  4PHK A;  2CCM A;  1QIV A;  3TDI A;  1CDL A;  1B8R A;  1REC A;  2KYF A;  4CLN A;  1Y0V H;  1SYM A;  1JF0 A;  1GQM A;  1K95 A;  3OP0 A;  2LMT A;  2ZKM X;  3FWB A;  1MUX A;  4D1E A;  1XK4 C;  2LP3 A;  2KGR A;  1F55 A;  5DKN A;  2SAS A;  1KFU S;  1OQP A;  2MAZ A;  1ALW A;  1J1E A;  1KQM C;  2GV5 A;  1M46 A;  1YUT A;  4QJ4 B;  1AP4 A;  1A4P A;  2BCB A;  1BU3 A;  3PM8 A;  4PE7 A;  1BF5 A;  1PSB A;  4MN0 A;  3NSI A;  1NUB A;  4M2P A;  3VRP A;  1TCO B;  5JOL A;  1KSM A;  1NX0 A;  4Q04 A;  1DJH A;  3NSK A;  1AJ5 A;  2QPT A;  1ZAC A;  4PHN A;  4GFT A;  1BR4 B;  2LVJ A;  2KQ6 A;  4HRG A;  2KOT A;  4UPG A;  1S5G Y;  3LL8 B;  3ZWH A;  4PHM A;  1QX7 A;  3CTN A;  4OKH A;  1S1E A;  3BYA A;  4XJK A;  1RWY A;  3VRR A;  1J55 A;  4C0K A;  1CFF A;  1F54 A;  4GNK B;  3SG3 A;  2KFG A;  1EJ3 A;  2K0J A;  2KYC A;  2ZNE A;  2KAV A;  3BUN B;  1OOJ A;  3ZNI A;  1KK7 Z;  1B7T Z;  1YTZ C;  3SJS A;  2KBI A;  3A4U B;  1SPY A;  1WDC C;  4DIR A;  1KSO A;  1KWO C;  1B47 A;  1IRJ A;  3DF0 A;  1FI5 A;  1E8A A;  1QX2 A;  2JTT A;  1W7I B;  3BQ3 A;  4U8D A;  2LE9 B;  1H8B A;  1NCZ A;  3DVE A;  1U5I B;  2NCO A;  2OS8 C;  4PDZ A;  1UUR A;  3AAJ A;  4F0Z B;  4NQG A;  5AXI A;  1CM4 A;  3LCP C;  3KO0 A;  4N1G A;  3WNX B;  2LUC A;  2MHH A;  4IL1 A;  2PAL A;  4ZCU A;  1CB1 A;  1NWD A;  1EXR A;  1ODB A;  4M2O A;  3TUY B;  4HRH A;  3A8R A;  1DJG A;  1RJV A;  2JT8 A;  3SG4 A;  2KBM A;  1BR1 B;  1EG3 A;  2Y1M A;  2JT3 A;  1OZO A;  4QJ5 B;  2D8N A;  1CLM A;  2I7A A;  1KFX S;  1EH2 A;  4YRU A;  1WRK A;  2CNP A;  2BKH B;  3OB2 B;  4GPL B;  3O6B A;  1XYD A;  4NDD A;  1YVL A;  1OMV A;  4TNC A;  3OB1 B;  4YI8 A;  4M2Q A;  5J3X A;  2FJU B;  3DVM A;  2BL0 B;  3NXA A;  1M63 B;  2NZ0 A;  1S6I A;  4P2Y B;  5HKW A;  1N2D A;  1A75 A;  1BOD A;  1XFX O;  4ORB B;  3SG2 A;  4MVF A;  3OX6 A;  1WLZ A;  2M0R A;  1MR8 A;  5FYX A;  1CNP A;  2EC6 C;  4JWQ A;  1J7O A;  1HT9 A;  2FCD A;  1Y1U A;  1KCY A;  1UHN A;  4YGD B;  4A4B A;  2Y1N A;  4WRI A;  3IF7 A;  1GGW A;  1ALV A;  1QXP A;  2CT9 A;  2L4I A;  2PAS A;  3JTD C;  4I5N B;  2OTG B;  1NX2 A;  1K9K A;  1LIN A;  1SCM B;  1YX7 A;  1SL7 A;  3EVU A;  1QJT A;  2BBM A;  2HF5 A;  5CSJ A;  4BY4 A;  2RGI A;  2ZRS A;  3FIA A;  1KFX L;  2I94 A;  1TNX A;  1CKK A;  1XA5 A;  1AUI B;  2WC8 A;  1JC2 A;  1TOP A;  5HYD A;  2LM5 A;  2Q4U A;  1BG1 A;  2MBX A;  2JTZ A;  1SR6 C;  3D0Y B;  3MSE B;  1C7W A;  1RRO A;  1WRZ A;  3M0W A;  1DF0 A;  4ZCV A;  4YGC B;  1ZMZ A;  3ICB A;  3FWC A;  2LP2 A;  3CGA A;  1QAT A;  5PAL A;  3SG7 A;  1CM1 A;  3BUM B;  1PAL A;  2SCP A;  1QS7 A;  3TZ1 A;  4AQJ A;  1PVB A;  2K2A A;  2LLS A;  3FS7 A;  4YBH B;  2FCE A;  2MLE C;  1SL9 A;  1NYA A;  4YGE B;  1CTR A;  2JNX A;  2K7C A;  4DUQ A;  5I2Q A;  3LK0 A;  1JFJ A;  4PHJ A;  3O4Y A;  3PN7 C;  1Y1A A;  2BBN A;  2K7O A;  1DJZ A;  1SY9 A;  3LK1 A;  1TRF A;  4N1F A;  4FTG A;  3SG6 A;  1AHR A;  5AFP A;  3I5F B;  1KK8 B;  3TUY C;  1NP8 A;  1BOC A;  1XK4 A;  1N65 A;  2L4H A;  3LLE A;  3BOW B;  2PVB A;  5I2L A;  4MZJ A;  1ZOT B;  3BUX B;  1UUS A;  4P5O E;  2KI6 C;  3I5H C;  2WCB A;  1Y6W A;  1QVI Z;  1V1G A;  3EKH A;  5D7F A;  3QRX A;  1K93 D;  5DKR A;  1MQ1 A;  1XFU O;  5AAN A;  1XFZ O;  3HCM A;  1F4O A; 
#chains in the Genus database with same CATH topology
 1OOI X;  1LXF C;  1WRL A;  1CFD A;  1K2H A;  2ZND A;  4OCI A;  4PT1 A;  5I8N A;  1IKU A;  1IIO A;  1YUS A;  2BL0 C;  2JXC A;  2K60 A;  2K7B A;  2KLD A;  4QJ3 B;  5DIC A;  1JFK A;  1HQV A;  1WLM A;  2FJY A;  2JXL A;  3PM2 A;  4JQ0 D;  4INX A;  1LS8 A;  1NSH A;  1AK8 A;  4WQ3 A;  1LA3 A;  2LVI A;  1KFU L;  2M9G A;  4F7F A;  2QEV A;  4OVN F;  5ER5 A;  2H61 C;  2JU0 A;  1S26 D;  1OSA A;  3CR5 X;  5ER4 X;  1MWN A;  1SK6 D;  2LCP A;  3I5G B;  2WCH A;  5EL2 A;  1XFW O;  2E30 A;  1YRT B;  3BJH A;  3BXK A;  1H4B A;  1TTX A;  2OTG C;  3TDZ A;  1SCM C;  3O2P A;  4JD9 A;  4YGA A;  2F3Z A;  2YGU A;  1KK7 Y;  1B7T Y;  5CSI A;  2QDI A;  3D77 A;  2H61 A;  2KI4 C;  1Y1X A;  2MA2 A;  4N5X A;  1YR5 A;  1SCV A;  4CPV A;  3I5I B;  4FQO A;  3JVT C;  1J7R A;  2LUX A;  4C0J A;  4I5L B;  2V53 A;  1KQM B;  3EK8 A;  1QLS A;  4E68 A;  1DGV A;  3CR4 X;  1G4Y R;  4OV2 A;  1L2O B;  4MRY A;  1JF2 A;  2M1U A;  4XJK B;  4ORA B;  1OOF A;  1TNW A;  1K96 A;  2I18 A;  2M7N A;  1AJ4 A;  2BCX A;  4MLW A;  1OZS A;  4A4C A;  2CXJ A;  4ETO A;  2KQY A;  2K61 A;  3AAK A;  3L47 A;  5HKZ A;  4DRW A;  3DF0 B;  2LLT A;  4XYN A;  3CYZ A;  3SS3 A;  1IH0 A;  3GK4 X;  1CDN A;  4NDC A;  5F6T A;  3D74 A;  3CZT X;  1NCY A;  4ORC B;  1CMF A;  1NX1 A;  1NPQ A;  2NLN A;  2WND A;  1DMO A;  1CLL A;  2MJW B;  1KK8 C;  1Q80 A;  1WDC B;  2EGD A;  2JPT A;  1MXE A;  2BE4 A;  3WXA A;  3EG5 B;  1F8H A;  3O78 A;  1SMG A;  2KGB C;  3IQQ A;  1DEK A;  1PSR A;  3F45 A;  3R1O A;  3BUW B;  5D69 A;  2K2F A;  1YUU A;  5G08 A;  1EG4 A;  3SIB A;  1TNP A;  4GGF C;  1QV0 A;  5CPV A;  2OS8 B;  3BUO B;  1DVI A;  1FF1 A;  3OHM B;  1Z2C B;  2IS9 A;  3D10 A;  2B1U A;  2OPO A;  4HRE E;  4AQI A;  5IBW A;  1CMG A;  2H2K A;  4MBE A;  1S3P A;  2QAC A;  3VRN A;  3HX4 A;  2M97 A;  2QEO A;  3N7H A;  3D78 A;  1DQE A;  4GGF A;  3CZ1 A;  5B8I B;  1IQ5 A;  3CZ0 A;  4BY5 A;  3DVJ A;  1IWQ A;  1DEL A;  1A29 A;  1VRK A;  3AKA A;  3OBV A;  1OMR A;  3PAT A;  1Z4H A;  2WCE A;  1K94 A;  3WHU B;  4DCK A;  1SBJ A;  2KSP A;  3EK7 A;  1IQ3 A;  3QME A;  1N0Y A;  1G33 A;  3H4S E;  5HKY A;  2GGM A;  1DJI A;  3NSO A;  3SS4 A;  1J1D A;  1FBV A;  2M3W A;  3B6X A;  1A75 B;  3TDU A;  2L98 A;  3PFV A;  3VRQ A;  3FE9 A;  3NSL A;  1QTX A;  1JWD A;  1UHJ A;  2AUC A;  1YVH A;  2JNF A;  2G9B A;  2LVV A;  1YX8 A;  2R2I A;  2HET A;  2JT0 A;  3B88 A;  3GOF A;  3AKB A;  1M45 A;  5JJG A;  1QV1 A;  1U5I A;  2CTN A;  5TNC A;  4MEW A;  2KPH A;  1JSA A;  3NGV A;  1MXL C;  5FI7 A;  2BCA A;  1S5G Z;  1XFV O;  4R1E A;  1ZUZ A;  3V2L A;  1TN4 A;  4USL A;  2F2O A;  3IVT A;  3I5I C;  5CSN A;  1NIW A;  1R6P A;  2KDH A;  2EC6 B;  2LNK A;  1OE9 B;  2JOJ A;  1F71 A;  2L2C A;  2JQ6 A;  3L4A A;  1K90 D;  1GGZ A;  2AMI A;  2K7D A;  1SW8 A;  1L2O C;  2KHN A;  2L2E A;  1F4Q A;  1B9A A;  1DJW A;  2ZN8 A;  3EK4 A;  3JTD B;  2P6B B;  2BE6 A;  1S6C A;  1LVC D;  1TWO A;  2LHL A;  3OGN A;  1J7P A;  1A2X A;  1SNL A;  1UHH A;  1EL4 A;  1DF0 B;  1PK0 D;  3R1P A;  3FE6 A;  4PAL A;  1PVA A;  2LC5 A;  1V1F A;  1XO5 A;  1CDM A;  3L4L A;  1D1O A;  1SKT A;  2F33 A;  1GJY A;  2AAO A;  2LMV A;  1M39 A;  3CWG A;  1UP5 A;  2BKI B;  3PSR A;  3TS5 B;  1OOG A;  1LA0 A;  2WOS A;  1MHO A;  5CSF A;  5DKQ A;  3OX5 A;  4PE4 A;  1K8U A;  1SR6 B;  2ZN9 A;  1RK9 A;  1FW4 A;  3NHI A;  1QVI Y;  1SL8 A;  1BLQ A;  2L50 A;  2TN4 A;  4L9M A;  1PUL A;  4PCW A;  2PMY A;  3KF9 A;  3C1V A;  2WCJ A;  1OMD A;  1B8L A;  2HQW A;  2M8U A;  1TIZ A;  2WC6 A;  4GBA A;  1CLB A;  1IGV A;  1PRW A;  1QAS A;  2JC2 A;  3KHE A;  4AOM A;  1QIW A;  1B4C A;  5GQQ C;  2P71 A;  4CFQ A;  3K21 A;  5I2O A;  2M49 B;  1BMO A;  1C3Z A;  2M1K B;  2WCF A;  2JZI A;  2FOT A;  2KFH A;  1ZFS A;  5BPJ A;  2GGZ A;  1BJF A;  2L0P A;  2Q91 A;  4PE0 A;  2JPO A;  5AEQ A;  1FI6 A;  1LKJ A;  4DS7 A;  2WOR A;  1RFJ A;  2WCL A;  1KQV A;  2LHI A;  1NX3 A;  5KSZ A;  1NCX A;  4CID A;  3VGO A;  1TNQ A;  4OR9 B;  3SG5 A;  3S0B A;  3KEV A;  2ISD A;  1RTP 1;  1B1G A;  2L51 A;  2LV7 A;  3D0Y A;  3RM1 A;  1XFY O;  5HLV A;  3PAL A;  3IQO A;  2JUL A;  2HPS A;  2E6W A;  5KTY A;  3I5H B;  2K8M B;  2PRU A;  4HSZ A;  3VB1 A;  2LLU A;  2M29 A;  1DGU A;  1OOH A;  2WCK A;  2CBL A;  4WQ2 A;  3PN7 B;  1MF8 B;  2ZRT A;  4GAO A;  3WHT B;  2KI6 D;  3I5F C;  3DVK A;  1SRA A;  1IJ6 A;  2P70 A;  3EKJ A;  2WC5 A;  3SIA A;  1B8C A;  1C7V A;  1KWO B;  5HLO A;  4C0L A;  2NXQ A;  1CDP A;  3CS1 A;  2L5X B;  1K9U A;  3BFA A;  4MZL A;  2M7L A;  1QX5 B;  4NDB A;  2F3Y A;  2COL B;  2G2B A;  3CDN A;  1TCF A;  1JUO A;  1R2U A;  3BFH A;  4ICB A;  4GUK A;  1K9P A;  3DD4 A;  4GGN A;  1F70 A;  4PE1 A;  1UWO A;  2ZFD A;  2LAP A;  1A03 A;  4KYN A;  1CFP A;  3CZ2 A;  3VRO A;  4MSP A;  1DTL A;  1L7Z A;  1IJ5 A;  3EVR A;  3GK1 A;  4MRX A;  1BT6 A;  1DJY A;  1DJX A;  2I2R E;  3BOW A;  1J7Q A;  2O60 A;  3E3R A;  2MLF C;  2VRG A;  1M31 A;  2KNE A;  2Y5I A;  2Y4Q A;  1IG5 A;  2HQ8 A;  3B87 A;  5KU1 A;  1DC1 A;  2BEC A;  4CFR A;  2PSR A;  3GK2 A;  2KI4 B;  3EVV A;  3PLF B;  1FPW A;  1YRU B;  1AVS A;  4YGB B;  3B7A A;  1QLK A;  2O5G A;  1C07 A;  2JWW A;  2KAX A;  2KFF A;  1DT7 B;  1XVJ A;  2A4J A;  1S6J A;  3CLN A;  4YI9 A;  2F8P A;  2LAN A;  3JVT B;  1CFC A;  2EHB A;  3TS5 C;  1UHI A;  1UHK A;  5AER A;  1S36 A;  2DOQ A;  2NCP A;  1YUR A;  2JRF A;  2LVK A;  5K89 A;  1G8I A;  4MZK A;  1JBA A;  1W7J B;  2LMU A;  3I5G C;  3RLZ A;  3DY9 A;  4I5K A;  1X02 A;  1WY9 A;  2F2P A;  3CR2 A;  1ORG A;  4JPZ B;  2MRD A;  2KAY A;  4I5J A;  3KPX A;  3B86 A;  4PHK A;  2CCM A;  1QIV A;  3TDI A;  1CDL A;  1B8R A;  1REC A;  2KYF A;  4CLN A;  1Y0V H;  1SYM A;  1JF0 A;  1GQM A;  1K95 A;  3OP0 A;  2LMT A;  2ZKM X;  3FWB A;  1MUX A;  4D1E A;  1XK4 C;  2LP3 A;  2KGR A;  1F55 A;  5DKN A;  2SAS A;  1KFU S;  1OQP A;  1T14 A;  2MAZ A;  1ALW A;  1J1E A;  1KQM C;  2GV5 A;  1M46 A;  1YUT A;  4QJ4 B;  1AP4 A;  1A4P A;  2BCB A;  1BU3 A;  3PM8 A;  4PE7 A;  3DXL A;  1BF5 A;  1PSB A;  1SSE B;  4MN0 A;  3NSI A;  1NUB A;  4M2P A;  3VRP A;  1TCO B;  5JOL A;  1KSM A;  1NX0 A;  4Q04 A;  1DJH A;  3NSK A;  1AJ5 A;  2QPT A;  1ZAC A;  4PHN A;  5FI6 A;  4GFT A;  1BR4 B;  2LVJ A;  2KQ6 A;  4HRG A;  2KOT A;  4UPG A;  1S5G Y;  3PJI A;  4OZD A;  1OW4 A;  3LL8 B;  3ZWH A;  4PHM A;  1QX7 A;  3CTN A;  3S0A A;  4OKH A;  1S1E A;  3BYA A;  4XJK A;  1RWY A;  3UNW A;  3VRR A;  1J55 A;  4FQT A;  4C0K A;  5HL1 A;  1CFF A;  1F54 A;  4GNK B;  3SG3 A;  2KFG A;  1EJ3 A;  2K0J A;  1W9Z A;  3S0D A;  2KYC A;  1TUJ A;  2KAV A;  2ZNE A;  1OOJ A;  3BUN B;  1KK7 Z;  1B7T Z;  1YTZ C;  3SJS A;  2KBI A;  3ZNI A;  3A4U B;  1SPY A;  1WDC C;  4DIR A;  1KSO A;  1KWO C;  1B47 A;  1IRJ A;  3DF0 A;  3S0E A;  1FI5 A;  1E8A A;  1QX2 A;  3Q8I A;  2JTT A;  2KLE A;  1W7I B;  3BQ3 A;  4U8D A;  2LE9 B;  1H8B A;  1NCZ A;  3DVE A;  1U5I B;  2NCO A;  2OS8 C;  4PDZ A;  1UUR A;  3AAJ A;  3S0F A;  4F0Z B;  4NQG A;  5AXI A;  1CM4 A;  3LCP C;  3KO0 A;  4N1G A;  3WNX B;  2LUC A;  2MHH A;  1P28 A;  4IL1 A;  2PAL A;  4ZCU A;  1CB1 A;  1NWD A;  3R72 A;  1EXR A;  1ODB A;  4M2O A;  3TUY B;  4HRH A;  3A8R A;  1QWV A;  5FI2 A;  1DJG A;  1RJV A;  2JT8 A;  3SG4 A;  2KBM A;  1BR1 B;  1EG3 A;  3UO9 A;  2Y1M A;  2JT3 A;  1OZO A;  4QJ5 B;  2D8N A;  1CLM A;  2I7A A;  1KFX S;  2BNX A;  4IJ7 A;  3K1E A;  1EH2 A;  4YRU A;  1WRK A;  2CNP A;  2BKH B;  3OB2 B;  4GPL B;  3O6B A;  1XYD A;  4NDD A;  1YVL A;  1OMV A;  4TNC A;  3OB1 B;  4YI8 A;  4M2Q A;  5J3X A;  2FJU B;  3DVM A;  2BL0 B;  3NXA A;  1M63 B;  3D75 A;  2NZ0 A;  1S6I A;  4P2Y B;  5HKW A;  1N2D A;  1A75 A;  1BOD A;  1XFX O;  4ORB B;  3SG2 A;  3O4X A;  4MVF A;  2H8V A;  3OX6 A;  3SS5 A;  1WLZ A;  2M0R A;  2QEH A;  1MR8 A;  2WCM A;  5FYX A;  3S0G A;  1CNP A;  2EC6 C;  4JWQ A;  2QEB A;  1C3Y A;  1J7O A;  1HT9 A;  2FCD A;  1Y1U A;  1KCY A;  1UHN A;  4YGD B;  4A4B A;  2Y1N A;  4WRI A;  2PQL A;  3IF7 A;  1GGW A;  1ALV A;  1QXP A;  2CT9 A;  2L4I A;  2PAS A;  3JTD C;  4I5N B;  2OTG B;  1NX2 A;  3RZS A;  1K9K A;  1LIN A;  1SCM B;  1TUZ A;  1YX7 A;  3NHT A;  1SL7 A;  3EVU A;  1QJT A;  2BBM A;  2HF5 A;  5CSJ A;  4BY4 A;  2GTE A;  2RGI A;  2ZRS A;  3FIA A;  1KFX L;  2I94 A;  1TNX A;  1CKK A;  1XA5 A;  1AUI B;  2WC8 A;  1JC2 A;  1TOP A;  3BFB A;  5HYD A;  2LM5 A;  2Q4U A;  1BG1 A;  1XFR A;  2MBX A;  2JTZ A;  1SR6 C;  3D0Y B;  3MSE B;  1C7W A;  1RRO A;  1WRZ A;  3M0W A;  1DF0 A;  4ZCV A;  4YGC B;  1ZMZ A;  3ICB A;  3FWC A;  2LP2 A;  3CGA A;  1QAT A;  5PAL A;  3D73 A;  5D3O A;  3SG7 A;  1CM1 A;  3BUM B;  1PAL A;  2SCP A;  1QS7 A;  3TZ1 A;  4AQJ A;  1PVB A;  2K2A A;  2LLS A;  3FS7 A;  5I94 A;  4YBH B;  2FCE A;  2MLE C;  1SL9 A;  1NYA A;  4YGE B;  1CTR A;  2JNX A;  2K7C A;  1GM0 A;  4DUQ A;  5I2Q A;  3LK0 A;  1JFJ A;  4PHJ A;  3O4Y A;  3PN7 C;  1Y1A A;  2BBN A;  2K7O A;  1DJZ A;  1SY9 A;  3LK1 A;  1TRF A;  4N1F A;  4FTG A;  3SG6 A;  3DZT A;  1AHR A;  5AFP A;  3I5F B;  1KK8 B;  3TUY C;  1NP8 A;  1BOC A;  1XK4 A;  3R1V A;  1N65 A;  2L4H A;  3LLE A;  3BOW B;  2PVB A;  2ERB A;  5I2L A;  3FE8 A;  4MZJ A;  1ZOT B;  3BUX B;  1UUS A;  4P5O E;  4INW A;  2KI6 C;  3I5H C;  2WCB A;  3CAB A;  4JKT A;  1Y6W A;  1QVI Z;  3DYE A;  1V1G A;  2PYQ A;  3EKH A;  5D7F A;  3QRX A;  1K93 D;  3D76 A;  1MQ1 A;  2BAP A;  2L5Y A;  1XFU O;  5DKR A;  5AAN A;  1XFZ O;  3HCM A;  1F4O A; 
#chains in the Genus database with same CATH homology
 1LXF C;  1WRL A;  1CFD A;  1K2H A;  2ZND A;  4OCI A;  5I8N A;  1IKU A;  1YUS A;  2BL0 C;  2JXC A;  2K7B A;  4QJ3 B;  1JFK A;  1HQV A;  1WLM A;  2JXL A;  4JQ0 D;  1NSH A;  1AK8 A;  4WQ3 A;  1LA3 A;  2LVI A;  1KFU L;  2M9G A;  5ER5 A;  4OVN F;  2H61 C;  2JU0 A;  1S26 D;  1OSA A;  3CR5 X;  5ER4 X;  1MWN A;  1SK6 D;  2LCP A;  3I5G B;  1XFW O;  2E30 A;  1YRT B;  3BXK A;  1TTX A;  2OTG C;  3TDZ A;  1SCM C;  3O2P A;  4YGA A;  2F3Z A;  1KK7 Y;  1B7T Y;  5CSI A;  2H61 A;  2KI4 C;  1Y1X A;  2MA2 A;  4N5X A;  1YR5 A;  1SCV A;  4CPV A;  3I5I B;  4FQO A;  3JVT C;  1J7R A;  2LUX A;  4C0J A;  4I5L B;  2V53 A;  1KQM B;  3EK8 A;  1QLS A;  4E68 A;  1DGV A;  3CR4 X;  1G4Y R;  4OV2 A;  1L2O B;  4MRY A;  1JF2 A;  2M1U A;  4XJK B;  4ORA B;  1TNW A;  1K96 A;  2I18 A;  2M7N A;  1AJ4 A;  2BCX A;  4MLW A;  1OZS A;  4A4C A;  2CXJ A;  4ETO A;  2KQY A;  2K61 A;  3AAK A;  5HKZ A;  4DRW A;  3DF0 B;  2LLT A;  4XYN A;  1IH0 A;  3GK4 X;  1CDN A;  4NDC A;  5F6T A;  1CMF A;  3CZT X;  1NCY A;  4ORC B;  1NX1 A;  1NPQ A;  2NLN A;  2WND A;  1DMO A;  1CLL A;  2MJW B;  1KK8 C;  1Q80 A;  1WDC B;  2EGD A;  2JPT A;  1MXE A;  2BE4 A;  3WXA A;  1F8H A;  1H4B A;  3O78 A;  1SMG A;  2KGB C;  3IQQ A;  3F45 A;  1PSR A;  5D69 A;  3BUW B;  2K2F A;  1YUU A;  5G08 A;  1EG4 A;  3SIB A;  1TNP A;  4GGF C;  1QV0 A;  5CPV A;  2OS8 B;  3BUO B;  1DVI A;  1FF1 A;  3OHM B;  2IS9 A;  3D10 A;  2B1U A;  2OPO A;  4HRE E;  4AQI A;  5IBW A;  1CMG A;  2H2K A;  4MBE A;  1S3P A;  2QAC A;  3VRN A;  3HX4 A;  2M97 A;  4GGF A;  5B8I B;  1IQ5 A;  4BY5 A;  3DVJ A;  1IWQ A;  1A29 A;  1VRK A;  3AKA A;  1OMR A;  3PAT A;  2WCE A;  1K94 A;  3WHU B;  4DCK A;  1SBJ A;  2KSP A;  3EK7 A;  1IQ3 A;  1N0Y A;  1G33 A;  3H4S E;  5HKY A;  2GGM A;  1DJI A;  3NSO A;  1J1D A;  1FBV A;  2M3W A;  1A75 B;  3TDU A;  2L98 A;  3PFV A;  3VRQ A;  3NSL A;  1QTX A;  1JWD A;  1UHJ A;  2AUC A;  1YVH A;  2JNF A;  2G9B A;  2LVV A;  1YX8 A;  2R2I A;  2HET A;  2JT0 A;  3GOF A;  3AKB A;  1M45 A;  5JJG A;  1QV1 A;  1U5I A;  2CTN A;  5TNC A;  4MEW A;  1JSA A;  1MXL C;  2BCA A;  1S5G Z;  1XFV O;  4R1E A;  1ZUZ A;  1TN4 A;  4USL A;  2F2O A;  3I5I C;  5CSN A;  1NIW A;  1R6P A;  2KDH A;  2EC6 B;  2LNK A;  1OE9 B;  2JOJ A;  1F71 A;  2JQ6 A;  1K90 D;  1GGZ A;  2AMI A;  2K7D A;  1SW8 A;  1L2O C;  2KHN A;  2L2E A;  1F4Q A;  1B9A A;  1DJW A;  2ZN8 A;  3EK4 A;  3JTD B;  2P6B B;  2BE6 A;  1S6C A;  1LVC D;  2LHL A;  1J7P A;  1A2X A;  1SNL A;  1UHH A;  1EL4 A;  1DF0 B;  1PK0 D;  4PAL A;  1PVA A;  2LC5 A;  1V1F A;  1XO5 A;  1CDM A;  1D1O A;  1SKT A;  2F33 A;  1GJY A;  2AAO A;  2LMV A;  1M39 A;  3CWG A;  1UP5 A;  2BKI B;  3PSR A;  3TS5 B;  1LA0 A;  2WOS A;  1MHO A;  5CSF A;  5DKQ A;  3OX5 A;  4PE4 A;  1K8U A;  1SR6 B;  2ZN9 A;  1RK9 A;  1FW4 A;  1QVI Y;  1SL8 A;  1BLQ A;  2L50 A;  2TN4 A;  4L9M A;  1PUL A;  4PCW A;  2PMY A;  3KF9 A;  3C1V A;  1OMD A;  1B8L A;  2HQW A;  2M8U A;  1TIZ A;  4GBA A;  1CLB A;  1IGV A;  1PRW A;  1QAS A;  2JC2 A;  3KHE A;  4AOM A;  1QIW A;  1B4C A;  5GQQ C;  4CFQ A;  3K21 A;  5I2O A;  2M49 B;  1BMO A;  2M1K B;  2WCF A;  2JZI A;  2FOT A;  2KFH A;  1ZFS A;  5BPJ A;  2GGZ A;  1BJF A;  2L0P A;  2Q91 A;  4PE0 A;  5AEQ A;  1FI6 A;  1LKJ A;  4DS7 A;  2WOR A;  1RFJ A;  1KQV A;  2LHI A;  1NX3 A;  5KSZ A;  1NCX A;  4CID A;  3VGO A;  1TNQ A;  4OR9 B;  3SG5 A;  1B1G A;  3KEV A;  2ISD A;  1RTP 1;  2L51 A;  2LV7 A;  3D0Y A;  3RM1 A;  1XFY O;  5HLV A;  3PAL A;  3IQO A;  2JUL A;  2HPS A;  2E6W A;  5KTY A;  3I5H B;  2K8M B;  2PRU A;  4HSZ A;  2LLU A;  2M29 A;  1DGU A;  4WQ2 A;  2CBL A;  3PN7 B;  1MF8 B;  2ZRT A;  4GAO A;  3WHT B;  2KI6 D;  3I5F C;  3DVK A;  1SRA A;  1IJ6 A;  3EKJ A;  3SIA A;  1C7V A;  1B8C A;  1KWO B;  5HLO A;  4C0L A;  2NXQ A;  1CDP A;  3CS1 A;  2L5X B;  1K9U A;  4MZL A;  2M7L A;  1QX5 B;  4NDB A;  2F3Y A;  2COL B;  2G2B A;  1TCF A;  1JUO A;  1R2U A;  4ICB A;  4GUK A;  1K9P A;  3DD4 A;  4GGN A;  1F70 A;  4PE1 A;  1UWO A;  2ZFD A;  2LAP A;  1A03 A;  1CFP A;  3VRO A;  4MSP A;  1DTL A;  1L7Z A;  1IJ5 A;  3EVR A;  3GK1 A;  4MRX A;  1BT6 A;  1DJY A;  1DJX A;  2I2R E;  3BOW A;  1J7Q A;  2O60 A;  3E3R A;  2MLF C;  2VRG A;  1M31 A;  2KNE A;  2Y5I A;  2Y4Q A;  1IG5 A;  2HQ8 A;  5KU1 A;  2BEC A;  4CFR A;  2PSR A;  3GK2 A;  2KI4 B;  3EVV A;  3PLF B;  1FPW A;  1YRU B;  1AVS A;  4YGB B;  1QLK A;  2O5G A;  1C07 A;  2JWW A;  2KAX A;  2KFF A;  1DT7 B;  1XVJ A;  2A4J A;  1S6J A;  3CLN A;  4YI9 A;  2F8P A;  2LAN A;  3JVT B;  1CFC A;  2EHB A;  3TS5 C;  1UHI A;  1UHK A;  5AER A;  1S36 A;  2DOQ A;  2NCP A;  1YUR A;  2JRF A;  2LVK A;  5K89 A;  1G8I A;  4MZK A;  1JBA A;  1W7J B;  2LMU A;  3I5G C;  3RLZ A;  4I5K A;  1X02 A;  1WY9 A;  2F2P A;  3CR2 A;  4JPZ B;  2MRD A;  2KAY A;  4I5J A;  3KPX A;  4PHK A;  2CCM A;  1QIV A;  3TDI A;  1CDL A;  1B8R A;  1REC A;  2KYF A;  4CLN A;  1Y0V H;  1SYM A;  1JF0 A;  1GQM A;  1K95 A;  3OP0 A;  2LMT A;  2ZKM X;  3FWB A;  1MUX A;  4D1E A;  1XK4 C;  2LP3 A;  2KGR A;  1F55 A;  5DKN A;  2SAS A;  1KFU S;  1OQP A;  2MAZ A;  1ALW A;  1J1E A;  1KQM C;  2GV5 A;  1M46 A;  1YUT A;  4QJ4 B;  1AP4 A;  1A4P A;  2BCB A;  1BU3 A;  3PM8 A;  4PE7 A;  1BF5 A;  1PSB A;  4MN0 A;  3NSI A;  1NUB A;  4M2P A;  3VRP A;  1TCO B;  5JOL A;  1KSM A;  1NX0 A;  4Q04 A;  1DJH A;  3NSK A;  1AJ5 A;  2QPT A;  1ZAC A;  4PHN A;  4GFT A;  1BR4 B;  2LVJ A;  2KQ6 A;  4HRG A;  2KOT A;  4UPG A;  1S5G Y;  3LL8 B;  3ZWH A;  4PHM A;  1QX7 A;  3CTN A;  4OKH A;  1S1E A;  3BYA A;  4XJK A;  1RWY A;  3VRR A;  1J55 A;  4C0K A;  1CFF A;  1F54 A;  4GNK B;  3SG3 A;  2KFG A;  1EJ3 A;  2K0J A;  2KYC A;  2ZNE A;  2KAV A;  3BUN B;  1OOJ A;  3ZNI A;  1KK7 Z;  1B7T Z;  1YTZ C;  3SJS A;  2KBI A;  3A4U B;  1SPY A;  1WDC C;  4DIR A;  1KSO A;  1KWO C;  1B47 A;  1IRJ A;  3DF0 A;  1FI5 A;  1E8A A;  1QX2 A;  2JTT A;  1W7I B;  3BQ3 A;  4U8D A;  2LE9 B;  1H8B A;  1NCZ A;  3DVE A;  1U5I B;  2NCO A;  2OS8 C;  4PDZ A;  1UUR A;  3AAJ A;  4F0Z B;  4NQG A;  5AXI A;  1CM4 A;  3LCP C;  3KO0 A;  4N1G A;  3WNX B;  2LUC A;  2MHH A;  4IL1 A;  2PAL A;  4ZCU A;  1CB1 A;  1NWD A;  1EXR A;  1ODB A;  4M2O A;  3TUY B;  4HRH A;  3A8R A;  1DJG A;  1RJV A;  2JT8 A;  3SG4 A;  2KBM A;  1BR1 B;  1EG3 A;  2Y1M A;  2JT3 A;  1OZO A;  4QJ5 B;  2D8N A;  1CLM A;  2I7A A;  1KFX S;  1EH2 A;  4YRU A;  1WRK A;  2CNP A;  2BKH B;  3OB2 B;  4GPL B;  3O6B A;  1XYD A;  4NDD A;  1YVL A;  1OMV A;  4TNC A;  3OB1 B;  4YI8 A;  4M2Q A;  5J3X A;  2FJU B;  3DVM A;  2BL0 B;  3NXA A;  1M63 B;  2NZ0 A;  1S6I A;  4P2Y B;  5HKW A;  1N2D A;  1A75 A;  1BOD A;  1XFX O;  4ORB B;  3SG2 A;  4MVF A;  3OX6 A;  1WLZ A;  2M0R A;  1MR8 A;  5FYX A;  1CNP A;  2EC6 C;  4JWQ A;  1J7O A;  1HT9 A;  2FCD A;  1Y1U A;  1KCY A;  1UHN A;  4YGD B;  4A4B A;  2Y1N A;  4WRI A;  3IF7 A;  1GGW A;  1ALV A;  1QXP A;  2CT9 A;  2L4I A;  2PAS A;  3JTD C;  4I5N B;  2OTG B;  1NX2 A;  1K9K A;  1LIN A;  1SCM B;  1YX7 A;  1SL7 A;  3EVU A;  1QJT A;  2BBM A;  2HF5 A;  5CSJ A;  4BY4 A;  2RGI A;  2ZRS A;  3FIA A;  1KFX L;  2I94 A;  1TNX A;  1CKK A;  1XA5 A;  1AUI B;  2WC8 A;  1JC2 A;  1TOP A;  5HYD A;  2LM5 A;  2Q4U A;  1BG1 A;  2MBX A;  2JTZ A;  1SR6 C;  3D0Y B;  3MSE B;  1C7W A;  1RRO A;  1WRZ A;  3M0W A;  1DF0 A;  4ZCV A;  4YGC B;  1ZMZ A;  3ICB A;  3FWC A;  2LP2 A;  3CGA A;  1QAT A;  5PAL A;  3SG7 A;  1CM1 A;  3BUM B;  1PAL A;  2SCP A;  1QS7 A;  3TZ1 A;  4AQJ A;  1PVB A;  2K2A A;  2LLS A;  3FS7 A;  4YBH B;  2FCE A;  2MLE C;  1SL9 A;  1NYA A;  4YGE B;  1CTR A;  2JNX A;  2K7C A;  4DUQ A;  5I2Q A;  3LK0 A;  1JFJ A;  4PHJ A;  3O4Y A;  3PN7 C;  1Y1A A;  2BBN A;  2K7O A;  1DJZ A;  1SY9 A;  3LK1 A;  1TRF A;  4N1F A;  4FTG A;  3SG6 A;  1AHR A;  5AFP A;  3I5F B;  1KK8 B;  3TUY C;  1NP8 A;  1BOC A;  1XK4 A;  1N65 A;  2L4H A;  3LLE A;  3BOW B;  2PVB A;  5I2L A;  4MZJ A;  1ZOT B;  3BUX B;  1UUS A;  4P5O E;  2KI6 C;  3I5H C;  2WCB A;  1Y6W A;  1QVI Z;  1V1G A;  3EKH A;  5D7F A;  3QRX A;  1K93 D;  5DKR A;  1MQ1 A;  1XFU O;  5AAN A;  1XFZ O;  3HCM A;  1F4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...