1YX7A

Nmr structure of calsensin, energy minimized average structure.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
83
structure length
83
Chain Sequence
MACKVKAELEAAFKKLDANGDGYVTALELQTFMVTLDAYKALSKDKVKEASAKLIKMADKNSDGKISKEEFLNANAELLCQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calsensin
publication title Solution structure and backbone dynamics of Calsensin, an invertebrate neuronal calcium-binding protein.
pubmed doi rcsb
source organism Haemopis marmorata
molecule tags Metal binding protein
total genus 14
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yx7A00
1G4YR 1NUBA 2L98A 1KQMB 1YUUA 1KSOA 2SASA 1H8BA 1IJ5A 2JNXA 2WC8A 2K2FA 3OP0A 4FQOA 3FS7A 4C0LA 1CB1A 3LCPC 2B1UA 1JC2A 1S5GZ 1KWOB 2IS9A 1K93D 2KI4B 1QIVA 5JOLA 2K7CA 2F3ZA 1IQ3A 1A75B 2LLUA 4I5KA 4ZCUA 3I5HB 4MSPA 4A4CA 2LVIA 3I5FB 1ALWA 1SL8A 1C7WA 4OCIA 2PRUA 2OS8B 1CTRA 4Q04A 2AAOA 3FWBA 5CSIA 2Y5IA 3EK4A 4OVNF 2WCEA 5AFPA 1M39A 1TIZA 1OQPA 3A8RA 3TDUA 1AK8A 3KF9A 4YGBB 3JVTB 5HLOA 1PSBA 2L50A 5AANA 2M1KB 2KSPA 3BUXB 1RROA 2WCBA 3OB1B 4I5NB 4NDBA 2LP2A 5FYXA 5G08A 1FBVA 3RM1A 4D1EA 1IQ5A 4GFTA 1TNWA 1SW8A 1YUSA 2KFGA 1KK8B 1A75A 2M29A 1YR5A 1B7TZ 3KO0A 3TS5C 1R2UA 2A4JA 3LK1A 1M45A 2EGDA 3PATA 1NCYA 2ZNDA 3PLFB 2WNDA 4WRIA 1LA3A 4I5LB 1TCFA 1YTZC 2JPTA 1QVIZ 1OE9B 4PHMA 3VRNA 1B4CA 2TN4A 1CLMA 1DTLA 3PN7C 2DOQA 1UURA 2CCMA 1KQMC 2ZN9A 3O78A 2KAVA 1QJTA 3C1VA 2KGRA 2LMVA 1JBAA 2NZ0A 1C07A 1M63B 1SNLA 3EVRA 1FI5A 3QRXA 1XK4A 1KWOC 5I2OA 1FI6A 2KI4C 1UHHA 4HREE 3BUNB 2ISDA 4C0JA 1BF5A 3I5HC 1G33A 2JTTA 2KAYA 3I5FC 1Y0VH 1N65A 2MBXA 3WHUB 4YGCB 2PSRA 2OS8C 3VGOA 4NDDA 4R1EA 2H61C 1Y1UA 2MLEC 5CPVA 3O6BA 4U8DA 3GK2A 1MXLC 1FW4A 1S5GY 3CGAA 2Y4QA 3DVMA 2LE9B 1DF0B 2RGIA 1CDLA 4OKHA 1NX1A 4GGFC 3JVTC 1CDPA 1PVBA 3CR5X 3VRQA 2LUXA 4QJ4B 1KK7Z 3NSLA 2JXCA 3KHEA 3WHTB 5D69A 4JWQA 4DRWA 3EVUA 5B8IB 4YRUA 2K2AA 5BPJA 1TN4A 3HX4A 1W7JB 3ICBA 1IWQA 2WORA 1KCYA 1K96A 2I94A 1X02A 1XO5A 1QLKA 2CXJA 2K7DA 2F33A 1KK8C 5AEQA 1NCXA 2M49B 1F71A 1NPQA 1LINA 3EK7A 5JJGA 3KPXA 2MRDA 2L51A 1BJFA 1QV0A 4MEWA 1KFUS 2OPOA 3E3RA 1QASA 1IKUA 3NSKA 2LHLA 2KI6D 2LANA 1SL9A 2KBMA 2KGBC 3K21A 4NDCA 1SMGA 2KDHA 1A2XA 3LL8B 1UHKA 2K0JA 3AKBA 3TUYB 3KEVA 1B7TY 2R2IA 1PULA 4MZKA 2LVJA 1QXPA 2VRGA 1TNQA 1TNXA 5AERA 1AUIB 1YURA 2BCAA 1K9UA 1QVIY 4I5JA 1S26D 1SRAA 1NCZA 2F3YA 3LLEA 4ORCB 2HF5A 3H4SE 1XVJA 3OX5A 4HSZA 4MLWA 3SIAA 1PVAA 1B1GA 3BUWB 5DKRA 5HKWA 3AAJA 3O2PA 2Y1NA 2K7OA 4FTGA 1JF2A 1CM4A 1GGWA 4MRXA 2BCBA 5KSZA 2KFHA 3VRPA 1H4BA 3OX6A 1NWDA 1WDCB 3CS1A 2JU0A 1CDNA 5CSFA 4TNCA 4YGDB 1UHJA 5KU1A 1MR8A 2FJUB 3SG4A 3I5GC 4YGEB 3ZWHA 5TNCA 3SG7A 1S3PA 5HLVA 1XFYO 1BMOA 4CFQA 2BBNA 2LCPA 4GNKB 1KK7Y 2SCPA 1ZMZA 1IH0A 1XFVO 1RWYA 1EH2A 4C0KA 4QJ3B 4ORBB 1QX2A 2MAZA 2NCOA 1CFCA 1K95A 1TOPA 1Y1AA 1A03A 3TUYC 4ZCVA 5GQQC 4A4BA 3JTDB 1R6PA 1S36A 3BQ3A 3LK0A 1OSAA 1SBJA 1SR6B 4NQGA 3ZNIA 2LVVA 3EK8A 5HYDA 2FOTA 2K61A 1EG4A 1DJWA 4XYNA 4MZJA 3AKAA 1CMFA 3MSEB 1V1GA 1WRZA 4IL1A 1QIWA 2LLSA 2JT3A 4YI9A 3EKHA 4PHKA 1LA0A 2QACA 1U5IB 2AMIA 2M3WA 2NCPA 1AP4A 1HQVA 3VROA 1TNPA 2F2PA 5IBWA 1DMOA 5I8NA 3SG5A 1F4OA 2O5GA 3WXAA 1IGVA 2GGMA 2L4HA 3PFVA 1RJVA 1RFJA 1WDCC 2CTNA 2CNPA 3TDIA 1N0YA 1XFUO 3O4YA 2KYFA 1SCVA 1IJ6A 2LAPA 1PSRA 1CFPA 1OZSA 1F70A 1J7OA 2KYCA 2JC2A 2LUCA 1A29A 1XFZO 1XK4C 4XJKA 2E30A 2LV7A 1A4PA 1EG3A 3AAKA 1GGZA 1J1DA 2Q91A 3EVVA 4CLNA 2JT0A 3M0WA 2ZKMX 4YI8A 3CZTX 1U5IA 1PK0D 2F8PA 2LNKA 1EJ3A 3SG2A 1J7PA 1F8HA 1JWDA 4MVFA 4E68A 1YVHA 1ZACA 1WLZA 1YUTA 2LMTA 1L7ZA 3OHMB 1N2DA 1YX8A 1BG1A 2KAXA 4BY4A 3PSRA 1QLSA 1KFXL 4UPGA 1S6JA 3FIAA 1GJYA 1SR6C 2KOTA 2LVKA 2L5XB 1EL4A 1TCOB 5DKQA 2JWWA 4AQJA 1MF8B 1RK9A 1SY9A 1YRUB 3TDZA 1B8LA 3CTNA 1SCMB 2KQ6A 1LXFC 1QV1A 3IQQA 3VRRA 4DUQA 2L0PA 5I2QA 1CMGA 2LC5A 3SG3A 2WOSA 5J3XA 3D10A 1YX7A 1K9KA 3WNXB 4CIDA 1F55A 2BKIB 1DVIA 2COLB 4HRHA 1E8AA 1Q80A 2M97A 2LP3A 2NXQA 2OTGB 1KQVA 4DCKA 1XYDA 1S1EA 2Q4UA 5KTYA 1JFKA 1PALA 2JULA 1QX7A 2HQ8A 2JQ6A 4QJ5B 2M8UA 1SYMA 1XA5A 3NSIA 4L9MA 4CPVA 2PASA 2EHBA 3CLNA 3PN7B 1UHIA 1WY9A 1K94A 2BE6A 2LHIA 2LLTA 2CBLA 2I7AA 2L4IA 3BUOB 1SPYA 1B9AA 2G9BA 4JPZB 1NYAA 2F2OA 5AXIA 1B8RA 3A4UB 1V1FA 2PMYA 1JF0A 1TRFA 1PRWA 1NSHA 2E6WA 1F54A 1ZOTB 3GOFA 4DS7A 2BE4A 3CR4X 4ICBA 4N5XA 4N1GA 2MHHA 2QPTA 1ODBA 1CLLA 1CLBA 2BL0B 4MRYA 1QX5B 3I5IB 4PALA 4PE0A 1NX2A 1K9PA 4BY5A 1YRTB 1K8UA 2K7BA 2M9GA 1B47A 2L2EA 2BBMA 2G2BA 3IF7A 1BOCA 2JOJA 1M31A 3DD4A 4GPLB 1OZOA 3BUMB 3PM8A 1BR4B 2JT8A 3EKJA 4USLA 1C7VA 3DVJA 3OB2B 1S6IA 1UWOA 2BCXA 3DVKA 1JSAA 1S6CA 4M2QA 1DJHA 2LMUA 4PCWA 1FPWA 4M2PA 1BR1B 2PALA 5CSJA 4ORAB 1JFJA 1NP8A 2GV5A 2EC6B 2KQYA 1OMDA 2JXLA 5ER5A 1SCMC 1B8CA 3SJSA 1DJXA 2FCDA 5K89A 1OMRA 1YVLA 4HRGA 2HQWA 5I2LA 4OV2A 4YGAA 1W7IB 4YBHB 3D0YB 5D7FA 1AJ4A 3SIBA 2KNEA 1MQ1A 2MLFC 1OOJA 4DIRA 4XJKB 4GAOA 1UHNA 1L2OB 1WLMA 5DKNA 2KI6C 4JQ0D 4PHNA 2Y1MA 2OTGC 2KFFA 2LM5A 2ZN8A 3BXKA 1BODA 5HKYA 1DT7B 4CFRA 1ZUZA 1LKJA 1WRLA 2H61A 1DJGA 2MJWB 4MZLA 3NSOA 1VRKA 2ZRTA 3FWCA 1DJZA 1Y1XA 3BOWB 3GK4X 1CNPA 2JZIA 4GGNA 2MA2A 2BECA 1IRJA 3BYAA 5ER4X 1SKTA 3RLZA 4PE1A 2H2KA 4GGFA 1KSMA 1BU3A 1UP5A 4GBAA 1J1EA 4WQ2A 2CT9A 1LVCD 3IQOA 1JUOA 1ZFSA 3GK1A 2AUCA 1J7QA 1K2HA 1MWNA 1HT9A 3DF0B 3HCMA 1DJIA 4M2OA 1GQMA 1XFXO 1QATA 1IG5A 2I18A 4PE7A 4F0ZB 3PALA 2JNFA 1DGUA 3D0YA 1FF1A 2FCEA 1OMVA 2BL0C 5PALA 1CFFA 2KHNA 3I5IC 1QTXA 4OR9B 1D1OA 1BT6A 2JRFA 2K8MB 2ZFDA 1MXEA 4MN0A 1J7RA 1CFDA 4WQ3A 3BOWA 1MHOA 1MUXA 2NLNA 4P2YB 1Y6WA 1G8IA 1NX3A 2ZRSA 2D8NA 2ZNEA 1BLQA 2EC6C 4AOMA 1J55A 3JTDC 3CWGA 1AHRA 1CM1A 3CR2A 3DF0A 3I5GB 1CDMA 1UUSA 1TTXA 2M7LA 1DGVA 1KFUL 1CKKA 4GUKA 1SL7A 2I2RE 1NIWA 5CSNA 1AVSA 1QS7A 3NXAA 1KFXS 1DJYA 1RTP1 2GGZA 4AQIA 2HPSA 4PHJA 1L2OC 2M7NA 1AJ5A 5F6TA 4N1FA 3F45A 3TS5B 1RECA 1F4QA 1NX0A 2BKHB 1SK6D 1XFWO 4P5OE 4ETOA 4PE4A 1WRKA 1EXRA 3TZ1A 1DF0A 2HETA 4PDZA 2WCFA 2M1UA 2P6BB 3DVEA 4MBEA 2O60A 1ALVA 2V53A 1M46A 2PVBA 5HKZA 1K90D 2M0RA 3SG6A 2KBIA 2JTZA
chains in the Genus database with same CATH superfamily
1G4YR 1NUBA 2L98A 1KQMB 1YUUA 1LS8A 1KSOA 2SASA 1H8BA 1IJ5A 2JNXA 2WC8A 2K2FA 3OP0A 4FQOA 3FS7A 4C0LA 1CB1A 3LCPC 4OZDA 2B1UA 1JC2A 5FI7A 1S5GZ 1KWOB 2IS9A 1K93D 2KI4B 1QIVA 5JOLA 2K7CA 2F3ZA 1IQ3A 1A75B 2LLUA 4I5KA 4ZCUA 3I5HB 4MSPA 4A4CA 2LVIA 3I5FB 1ALWA 3BJHA 1SL8A 1C7WA 4OCIA 2PRUA 2OS8B 1CTRA 4Q04A 2AAOA 3FWBA 2WC5A 5CSIA 2Y5IA 3EK4A 4OVNF 2WCEA 4F7FA 5AFPA 1M39A 1TIZA 1OQPA 1C3ZA 3A8RA 3TDUA 1AK8A 2ERBA 3KF9A 4YGBB 3DXLA 3JVTB 5HLOA 1PSBA 2L50A 5AANA 2M1KB 2KSPA 3BUXB 1RROA 2WCBA 3OB1B 4I5NB 4NDBA 3B7AA 2LP2A 5FYXA 5G08A 1FBVA 3RM1A 4D1EA 1IQ5A 4GFTA 1TNWA 1SW8A 1YUSA 2KFGA 1KK8B 1A75A 3UO9A 2M29A 1YR5A 1B7TZ 3KO0A 3SS3A 3TS5C 1R2UA 2A4JA 3LK1A 1M45A 1TUJA 2EGDA 3PATA 1NCYA 2WCMA 2ZNDA 3PLFB 2WNDA 4WRIA 1LA3A 4I5LB 1TCFA 1YTZC 2JPTA 1QVIZ 1OE9B 1ORGA 4PHMA 3VRNA 1B4CA 2TN4A 1CLMA 1DTLA 3PN7C 2DOQA 3S0DA 1UURA 2CCMA 2WCKA 1OOGA 1KQMC 2ZN9A 3D76A 3O78A 3SS5A 4FQTA 2KAVA 1QJTA 3C1VA 2KGRA 2LMVA 1JBAA 2NZ0A 1C07A 1M63B 1SNLA 3D78A 3EG5B 3EVRA 3QRXA 1XK4A 1KWOC 5I2OA 1FI5A 1FI6A 2KI4C 1IIOA 1UHHA 4HREE 3BUNB 2ISDA 4C0JA 3R1OA 1BF5A 3I5HC 1G33A 2JTTA 2KAYA 3SS4A 3I5FC 1Y0VH 1N65A 2MBXA 4JD9A 3WHUB 1FPWA 4YGCB 1W9ZA 2PSRA 2OS8C 3VGOA 4NDDA 4R1EA 2H61C 1Y1UA 2MLEC 5CPVA 3O6BA 4PT1A 3GK2A 4U8DA 1MXLC 1FW4A 1S5GY 3CGAA 2Y4QA 3DVMA 2LE9B 1DF0B 2RGIA 1CDLA 4OKHA 1NX1A 3R1PA 4GGFC 3JVTC 1CDPA 1PVBA 3CR5X 3VRQA 2LUXA 4QJ4B 1KK7Z 3NSLA 2JXCA 5DICA 3KHEA 3WHTB 5D69A 4JWQA 4DRWA 3EVUA 5B8IB 4YRUA 2K2AA 5BPJA 1TN4A 3HX4A 1W7JB 3ICBA 1IWQA 2WORA 1KCYA 1K96A 2I94A 3S0GA 1DELA 1X02A 1XO5A 1QLKA 2CXJA 2K7DA 2F33A 1KK8C 5AEQA 3PM2A 1NCXA 2M49B 3CDNA 1NPQA 1F71A 1LINA 2K60A 3EK7A 5JJGA 2WC6A 3KPXA 2MRDA 2L51A 1BJFA 1QV0A 3OGNA 4MEWA 1KFUS 2OPOA 2L5YA 3E3RA 1QASA 2L2CA 1IKUA 3NSKA 2LHLA 2KI6D 1GM0A 2LANA 1SL9A 2KBMA 2KGBC 3K21A 4NDCA 1SMGA 2QEVA 2KDHA 1A2XA 3LL8B 1UHKA 2K0JA 3AKBA 3TUYB 3KEVA 1B7TY 2R2IA 3VB1A 1PULA 4MZKA 2LVJA 1QXPA 2VRGA 1TNQA 1TNXA 5AERA 1AUIB 1DQEA 1YURA 2BCAA 1K9UA 1QVIY 4I5JA 1S26D 3NHIA 3B88A 1SRAA 1NCZA 2F3YA 3LLEA 4ORCB 2HF5A 3H4SE 1XVJA 3OX5A 4HSZA 4MLWA 3SIAA 1PVAA 1B1GA 3BUWB 5DKRA 5HKWA 3AAJA 3O2PA 2Y1NA 2K7OA 4FTGA 1JF2A 1CM4A 1GGWA 4MRXA 2WCLA 2BCBA 3PJIA 5KSZA 3DZTA 2KFHA 3VRPA 2H8VA 1H4BA 3OX6A 1Z2CB 1NWDA 1WDCB 3CS1A 2JU0A 1CDNA 5CSFA 4TNCA 4YGDB 1UHJA 5KU1A 1MR8A 2FJUB 3SG4A 1P28A 3I5GC 1DEKA 4YGEB 3ZWHA 2QEOA 5TNCA 3SG7A 3QMEA 1S3PA 5HLVA 1XFYO 1BMOA 4CFQA 2BBNA 2LCPA 4GNKB 2PQLA 2WCJA 1KK7Y 2SCPA 1ZMZA 1IH0A 1XFVO 1RWYA 3S0FA 1EH2A 4C0KA 4QJ3B 4ORBB 1QX2A 2MAZA 2NCOA 1CFCA 2KLEA 1K95A 1TOPA 1Y1AA 1A03A 3TUYC 4ZCVA 5GQQC 4A4BA 3JTDB 1R6PA 1S36A 3BQ3A 3LK0A 1OSAA 1SBJA 1SR6B 4NQGA 3ZNIA 2BNXA 2LVVA 3EK8A 5HYDA 2FOTA 2K61A 3D73A 1EG4A 1DJWA 4XYNA 4MZJA 3AKAA 1CMFA 5FI2A 3MSEB 1V1GA 1WRZA 4IL1A 1QIWA 2LLSA 5FI6A 2JT3A 4YI9A 3EKHA 4PHKA 4JKTA 1LA0A 2QACA 3BFBA 1U5IB 2AMIA 2M3WA 2NCPA 3CABA 1HQVA 3NGVA 1AP4A 3FE9A 3VROA 1TNPA 2F2PA 5IBWA 4KYNA 1DMOA 5I8NA 3SG5A 1F4OA 2O5GA 3WXAA 1IGVA 2GGMA 2L4HA 3PFVA 1RJVA 1RFJA 1WDCC 2CTNA 5D3OA 2CNPA 3TDIA 3B6XA 1N0YA 1XFUO 3O4YA 2KYFA 1SCVA 3R72A 1IJ6A 3D77A 2LAPA 1PSRA 2JPOA 1CFPA 1OZSA 3BFHA 1F70A 1J7OA 2KYCA 2JC2A 2LUCA 1A29A 1XFZO 1XK4C 4XJKA 2E30A 2LV7A 1A4PA 1EG3A 3AAKA 1GGZA 1J1DA 2Q91A 3D74A 3EVVA 4CLNA 2JT0A 3M0WA 2ZKMX 4YI8A 3CZTX 1U5IA 1PK0D 2F8PA 2LNKA 1EJ3A 3SG2A 1J7PA 1F8HA 1JWDA 5EL2A 4MVFA 3N7HA 4E68A 1YVHA 1ZACA 1WLZA 1YUTA 2LMTA 1L7ZA 3OHMB 1N2DA 1YX8A 1BG1A 2KAXA 4BY4A 3PSRA 1QLSA 1KFXL 4UPGA 1S6JA 3FIAA 1GJYA 1SR6C 2KOTA 2LVKA 2L5XB 1EL4A 1SSEB 1TCOB 5DKQA 2GTEA 2JWWA 1MF8B 1RK9A 1SY9A 1YRUB 4AQJA 3TDZA 5HL1A 3RZSA 1B8LA 3CTNA 1SCMB 2KQ6A 1LXFC 1QV1A 3IQQA 3VRRA 4DUQA 2L0PA 5I2QA 1CMGA 2LC5A 3SG3A 2WOSA 5J3XA 3D10A 1YX7A 1K9KA 3WNXB 4CIDA 1F55A 2BKIB 1DVIA 2COLB 4HRHA 1E8AA 1Q80A 2M97A 2LP3A 2NXQA 2OTGB 1KQVA 3B86A 1XFRA 4DCKA 3V2LA 1XYDA 2WCHA 1S1EA 2Q4UA 5KTYA 3R1VA 1JFKA 1PALA 2JULA 1QX7A 2HQ8A 2JQ6A 3BFAA 4QJ5B 2M8UA 1SYMA 3OBVA 1XA5A 3NSIA 4L9MA 4CPVA 2PASA 2EHBA 3CLNA 3CZ0A 3PN7B 1UHIA 1WY9A 1K94A 2BE6A 2LHIA 2LLTA 2CBLA 3UNWA 2I7AA 2L4IA 3BUOB 3CYZA 1SPYA 1B9AA 2G9BA 4JPZB 1NYAA 2F2OA 5AXIA 1B8RA 3A4UB 1V1FA 2PMYA 1JF0A 1OW4A 1TRFA 1PRWA 1NSHA 2E6WA 1F54A 1ZOTB 3GOFA 4DS7A 2BE4A 2QEBA 2YGUA 3CR4X 4ICBA 4N5XA 4N1GA 1QWVA 3DY9A 2MHHA 2QPTA 1ODBA 1CLLA 1CLBA 2BL0B 4MRYA 1QX5B 3I5IB 4PALA 4PE0A 1NX2A 3L4LA 1K9PA 4BY5A 1YRTB 1K8UA 2K7BA 2M9GA 1B47A 2L2EA 2BBMA 2G2BA 3IF7A 1BOCA 2JOJA 1M31A 3DD4A 4GPLB 1OZOA 3BUMB 3PM8A 1BR4B 2JT8A 3EKJA 4USLA 1C7VA 3DVJA 3OB2B 1S6IA 1UWOA 2BCXA 3DVKA 1JSAA 1S6CA 4M2QA 1DJHA 2LMUA 3S0AA 4PCWA 1C3YA 4M2PA 1BR1B 2PALA 5CSJA 4ORAB 1JFJA 1NP8A 2GV5A 3L4AA 2BAPA 2EC6B 2KQYA 1OMDA 2JXLA 5ER5A 1SCMC 1B8CA 3SJSA 4INXA 1DJXA 1OOHA 2FCDA 1OMRA 5K89A 1YVLA 4HRGA 2HQWA 5I2LA 4OV2A 4YGAA 1W7IB 4YBHB 3D0YB 5D7FA 1AJ4A 3SIBA 2KNEA 3K1EA 1MQ1A 3L47A 2MLFC 1OOJA 4DIRA 4XJKB 4GAOA 1UHNA 1L2OB 1WLMA 1Z4HA 2KI6C 4JQ0D 4PHNA 5DKNA 2Y1MA 2OTGC 4IJ7A 4INWA 2KFFA 2LM5A 2ZN8A 3BXKA 1BODA 5HKYA 1DT7B 4CFRA 1ZUZA 1LKJA 1WRLA 2H61A 1DJGA 2MJWB 4MZLA 3NSOA 1VRKA 2ZRTA 3CZ1A 1DJZA 1Y1XA 3FWCA 3O4XA 3BOWB 3GK4X 1CNPA 2JZIA 4GGNA 2MA2A 2BECA 1IRJA 3BYAA 5ER4X 1SKTA 3RLZA 4PE1A 2H2KA 4GGFA 1KSMA 1BU3A 1UP5A 4GBAA 1J1EA 4WQ2A 2CT9A 1LVCD 3IQOA 1JUOA 1ZFSA 3GK1A 2AUCA 3FE6A 1J7QA 1MWNA 1K2HA 1HT9A 3DF0B 3HCMA 1DJIA 4M2OA 1GQMA 1XFXO 3CZ2A 1QATA 1IG5A 2I18A 4PE7A 4F0ZB 2PYQA 3PALA 5I94A 2JNFA 1DGUA 3D0YA 1FF1A 2FCEA 1OMVA 2BL0C 5PALA 1DC1A 2KHNA 1CFFA 3I5IC 1QTXA 3D75A 1OOFA 4OR9B 3S0BA 1D1OA 1BT6A 2JRFA 2KLDA 2K8MB 2ZFDA 2QDIA 1MXEA 4MN0A 1J7RA 1CFDA 3B87A 4WQ3A 3BOWA 1TUZA 1MHOA 1MUXA 2NLNA 4P2YB 1Y6WA 2P70A 1G8IA 1NX3A 3S0EA 2ZRSA 2D8NA 2ZNEA 1BLQA 2EC6C 4AOMA 1J55A 3JTDC 3CWGA 1AHRA 1CM1A 3CR2A 3DF0A 3I5GB 3NHTA 1CDMA 1UUSA 1TTXA 2M7LA 1DGVA 1KFUL 1CKKA 4GUKA 1SL7A 2I2RE 1NIWA 5CSNA 1AVSA 1QS7A 1T14A 3NXAA 1KFXS 1DJYA 1RTP1 2GGZA 4AQIA 2HPSA 4PHJA 1L2OC 1TWOA 2KPHA 2M7NA 1AJ5A 5F6TA 4N1FA 3F45A 3Q8IA 3TS5B 2QEHA 1RECA 3IVTA 1OOIX 1F4QA 1NX0A 2FJYA 3DYEA 2BKHB 1SK6D 1XFWO 4P5OE 4ETOA 4PE4A 1WRKA 1EXRA 3FE8A 3TZ1A 1DF0A 2HETA 4PDZA 2WCFA 2M1UA 2P6BB 3DVEA 4MBEA 2O60A 1ALVA 2V53A 1M46A 2P71A 2PVBA 1K90D 2M0RA 5HKZA 3SG6A 2KBIA 2JTZA
chains in the Genus database with same CATH topology
1G4YR 1NUBA 2L98A 1KQMB 1YUUA 1KSOA 2SASA 1H8BA 1IJ5A 2JNXA 2WC8A 2K2FA 3OP0A 4FQOA 3FS7A 4C0LA 1CB1A 3LCPC 2B1UA 1JC2A 1S5GZ 1KWOB 2IS9A 1K93D 2KI4B 1QIVA 5JOLA 2K7CA 2F3ZA 1IQ3A 1A75B 2LLUA 4I5KA 4ZCUA 3I5HB 4MSPA 4A4CA 2LVIA 3I5FB 1ALWA 1SL8A 1C7WA 4OCIA 2PRUA 2OS8B 1CTRA 4Q04A 2AAOA 3FWBA 5CSIA 2Y5IA 3EK4A 4OVNF 2WCEA 5AFPA 1M39A 1TIZA 1OQPA 3A8RA 3TDUA 1AK8A 3KF9A 4YGBB 3JVTB 5HLOA 1PSBA 2L50A 5AANA 2M1KB 2KSPA 3BUXB 1RROA 2WCBA 3OB1B 4I5NB 4NDBA 2LP2A 5FYXA 5G08A 1FBVA 3RM1A 4D1EA 1IQ5A 4GFTA 1TNWA 1SW8A 1YUSA 2KFGA 1KK8B 1A75A 2M29A 1YR5A 1B7TZ 3KO0A 3TS5C 1R2UA 2A4JA 3LK1A 1M45A 2EGDA 3PATA 1NCYA 2ZNDA 3PLFB 2WNDA 4WRIA 1LA3A 4I5LB 1TCFA 1YTZC 2JPTA 1QVIZ 1OE9B 4PHMA 3VRNA 1B4CA 2TN4A 1CLMA 1DTLA 3PN7C 2DOQA 1UURA 2CCMA 1KQMC 2ZN9A 3O78A 2KAVA 1QJTA 3C1VA 2KGRA 2LMVA 1JBAA 2NZ0A 1C07A 1M63B 1SNLA 3EVRA 1FI5A 3QRXA 1XK4A 1KWOC 5I2OA 1FI6A 2KI4C 1UHHA 4HREE 3BUNB 2ISDA 4C0JA 1BF5A 3I5HC 1G33A 2JTTA 2KAYA 3I5FC 1Y0VH 1N65A 2MBXA 3WHUB 4YGCB 2PSRA 2OS8C 3VGOA 4NDDA 4R1EA 2H61C 1Y1UA 2MLEC 5CPVA 3O6BA 4U8DA 3GK2A 1MXLC 1FW4A 1S5GY 3CGAA 2Y4QA 3DVMA 2LE9B 1DF0B 2RGIA 1CDLA 4OKHA 1NX1A 4GGFC 3JVTC 1CDPA 1PVBA 3CR5X 3VRQA 2LUXA 4QJ4B 1KK7Z 3NSLA 2JXCA 3KHEA 3WHTB 5D69A 4JWQA 4DRWA 3EVUA 5B8IB 4YRUA 2K2AA 5BPJA 1TN4A 3HX4A 1W7JB 3ICBA 1IWQA 2WORA 1KCYA 1K96A 2I94A 1X02A 1XO5A 1QLKA 2CXJA 2K7DA 2F33A 1KK8C 5AEQA 1NCXA 2M49B 1F71A 1NPQA 1LINA 3EK7A 5JJGA 3KPXA 2MRDA 2L51A 1BJFA 1QV0A 4MEWA 1KFUS 2OPOA 3E3RA 1QASA 1IKUA 3NSKA 2LHLA 2KI6D 2LANA 1SL9A 2KBMA 2KGBC 3K21A 4NDCA 1SMGA 2KDHA 1A2XA 3LL8B 1UHKA 2K0JA 3AKBA 3TUYB 3KEVA 1B7TY 2R2IA 1PULA 4MZKA 2LVJA 1QXPA 2VRGA 1TNQA 1TNXA 5AERA 1AUIB 1YURA 2BCAA 1K9UA 1QVIY 4I5JA 1S26D 1SRAA 1NCZA 2F3YA 3LLEA 4ORCB 2HF5A 3H4SE 1XVJA 3OX5A 4HSZA 4MLWA 3SIAA 1PVAA 1B1GA 3BUWB 5DKRA 5HKWA 3AAJA 3O2PA 2Y1NA 2K7OA 4FTGA 1JF2A 1CM4A 1GGWA 4MRXA 2BCBA 5KSZA 2KFHA 3VRPA 1H4BA 3OX6A 1NWDA 1WDCB 3CS1A 2JU0A 1CDNA 5CSFA 4TNCA 4YGDB 1UHJA 5KU1A 1MR8A 2FJUB 3SG4A 3I5GC 4YGEB 3ZWHA 5TNCA 3SG7A 1S3PA 5HLVA 1XFYO 1BMOA 4CFQA 2BBNA 2LCPA 4GNKB 1KK7Y 2SCPA 1ZMZA 1IH0A 1XFVO 1RWYA 1EH2A 4C0KA 4QJ3B 4ORBB 1QX2A 2MAZA 2NCOA 1CFCA 1K95A 1TOPA 1Y1AA 1A03A 3TUYC 4ZCVA 5GQQC 4A4BA 3JTDB 1R6PA 1S36A 3BQ3A 3LK0A 1OSAA 1SBJA 1SR6B 4NQGA 3ZNIA 2LVVA 3EK8A 5HYDA 2FOTA 2K61A 1EG4A 1DJWA 4XYNA 4MZJA 3AKAA 1CMFA 3MSEB 1V1GA 1WRZA 4IL1A 1QIWA 2LLSA 2JT3A 4YI9A 3EKHA 4PHKA 1LA0A 2QACA 1U5IB 2AMIA 2M3WA 2NCPA 1AP4A 1HQVA 3VROA 1TNPA 2F2PA 5IBWA 1DMOA 5I8NA 3SG5A 1F4OA 2O5GA 3WXAA 1IGVA 2GGMA 2L4HA 3PFVA 1RJVA 1RFJA 1WDCC 2CTNA 2CNPA 3TDIA 1N0YA 1XFUO 3O4YA 2KYFA 1SCVA 1IJ6A 2LAPA 1PSRA 1CFPA 1OZSA 1F70A 1J7OA 2KYCA 2JC2A 2LUCA 1A29A 1XFZO 1XK4C 4XJKA 2E30A 2LV7A 1A4PA 1EG3A 3AAKA 1GGZA 1J1DA 2Q91A 3EVVA 4CLNA 2JT0A 3M0WA 2ZKMX 4YI8A 3CZTX 1U5IA 1PK0D 2F8PA 2LNKA 1EJ3A 3SG2A 1J7PA 1F8HA 1JWDA 4MVFA 4E68A 1YVHA 1ZACA 1WLZA 1YUTA 2LMTA 1L7ZA 3OHMB 1N2DA 1YX8A 1BG1A 2KAXA 4BY4A 3PSRA 1QLSA 1KFXL 4UPGA 1S6JA 3FIAA 1GJYA 1SR6C 2KOTA 2LVKA 2L5XB 1EL4A 1TCOB 5DKQA 2JWWA 4AQJA 1MF8B 1RK9A 1SY9A 1YRUB 3TDZA 1B8LA 3CTNA 1SCMB 2KQ6A 1LXFC 1QV1A 3IQQA 3VRRA 4DUQA 2L0PA 5I2QA 1CMGA 2LC5A 3SG3A 2WOSA 5J3XA 3D10A 1YX7A 1K9KA 3WNXB 4CIDA 1F55A 2BKIB 1DVIA 2COLB 4HRHA 1E8AA 1Q80A 2M97A 2LP3A 2NXQA 2OTGB 1KQVA 4DCKA 1XYDA 1S1EA 2Q4UA 5KTYA 1JFKA 1PALA 2JULA 1QX7A 2HQ8A 2JQ6A 4QJ5B 2M8UA 1SYMA 1XA5A 3NSIA 4L9MA 4CPVA 2PASA 2EHBA 3CLNA 3PN7B 1UHIA 1WY9A 1K94A 2BE6A 2LHIA 2LLTA 2CBLA 2I7AA 2L4IA 3BUOB 1SPYA 1B9AA 2G9BA 4JPZB 1NYAA 2F2OA 5AXIA 1B8RA 3A4UB 1V1FA 2PMYA 1JF0A 1TRFA 1PRWA 1NSHA 2E6WA 1F54A 1ZOTB 3GOFA 4DS7A 2BE4A 3CR4X 4ICBA 4N5XA 4N1GA 2MHHA 2QPTA 1ODBA 1CLLA 1CLBA 2BL0B 4MRYA 1QX5B 3I5IB 4PALA 4PE0A 1NX2A 1K9PA 4BY5A 1YRTB 1K8UA 2K7BA 2M9GA 1B47A 2L2EA 2BBMA 2G2BA 3IF7A 1BOCA 2JOJA 1M31A 3DD4A 4GPLB 1OZOA 3BUMB 3PM8A 1BR4B 2JT8A 3EKJA 4USLA 1C7VA 3DVJA 3OB2B 1S6IA 1UWOA 2BCXA 3DVKA 1JSAA 1S6CA 4M2QA 1DJHA 2LMUA 4PCWA 1FPWA 4M2PA 1BR1B 2PALA 5CSJA 4ORAB 1JFJA 1NP8A 2GV5A 2EC6B 2KQYA 1OMDA 2JXLA 5ER5A 1SCMC 1B8CA 3SJSA 1DJXA 2FCDA 5K89A 1OMRA 1YVLA 4HRGA 2HQWA 5I2LA 4OV2A 4YGAA 1W7IB 4YBHB 3D0YB 5D7FA 1AJ4A 3SIBA 2KNEA 1MQ1A 2MLFC 1OOJA 4DIRA 4XJKB 4GAOA 1UHNA 1L2OB 1WLMA 5DKNA 2KI6C 4JQ0D 4PHNA 2Y1MA 2OTGC 2KFFA 2LM5A 2ZN8A 3BXKA 1BODA 5HKYA 1DT7B 4CFRA 1ZUZA 1LKJA 1WRLA 2H61A 1DJGA 2MJWB 4MZLA 3NSOA 1VRKA 2ZRTA 3FWCA 1DJZA 1Y1XA 3BOWB 3GK4X 1CNPA 2JZIA 4GGNA 2MA2A 2BECA 1IRJA 3BYAA 5ER4X 1SKTA 3RLZA 4PE1A 2H2KA 4GGFA 1KSMA 1BU3A 1UP5A 4GBAA 1J1EA 4WQ2A 2CT9A 1LVCD 3IQOA 1JUOA 1ZFSA 3GK1A 2AUCA 1J7QA 1K2HA 1MWNA 1HT9A 3DF0B 3HCMA 1DJIA 4M2OA 1GQMA 1XFXO 1QATA 1IG5A 2I18A 4PE7A 4F0ZB 3PALA 2JNFA 1DGUA 3D0YA 1FF1A 2FCEA 1OMVA 2BL0C 5PALA 1CFFA 2KHNA 3I5IC 1QTXA 4OR9B 1D1OA 1BT6A 2JRFA 2K8MB 2ZFDA 1MXEA 4MN0A 1J7RA 1CFDA 4WQ3A 3BOWA 1MHOA 1MUXA 2NLNA 4P2YB 1Y6WA 1G8IA 1NX3A 2ZRSA 2D8NA 2ZNEA 1BLQA 2EC6C 4AOMA 1J55A 3JTDC 3CWGA 1AHRA 1CM1A 3CR2A 3DF0A 3I5GB 1CDMA 1UUSA 1TTXA 2M7LA 1DGVA 1KFUL 1CKKA 4GUKA 1SL7A 2I2RE 1NIWA 5CSNA 1AVSA 1QS7A 3NXAA 1KFXS 1DJYA 1RTP1 2GGZA 4AQIA 2HPSA 4PHJA 1L2OC 2M7NA 1AJ5A 5F6TA 4N1FA 3F45A 3TS5B 1RECA 1F4QA 1NX0A 2BKHB 1SK6D 1XFWO 4P5OE 4ETOA 4PE4A 1WRKA 1EXRA 3TZ1A 1DF0A 2HETA 4PDZA 2WCFA 2M1UA 2P6BB 3DVEA 4MBEA 2O60A 1ALVA 2V53A 1M46A 2PVBA 5HKZA 1K90D 2M0RA 3SG6A 2KBIA 2JTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4Y R;  1NUB A;  2L98 A;  1KQM B;  1YUU A;  1KSO A;  2SAS A;  1H8B A;  1IJ5 A;  2JNX A;  2WC8 A;  2K2F A;  3OP0 A;  4FQO A;  3FS7 A;  4C0L A;  1CB1 A;  3LCP C;  2B1U A;  1JC2 A;  1S5G Z;  1KWO B;  2IS9 A;  1K93 D;  2KI4 B;  1QIV A;  5JOL A;  2K7C A;  2F3Z A;  1IQ3 A;  1A75 B;  2LLU A;  4I5K A;  4ZCU A;  3I5H B;  4MSP A;  4A4C A;  2LVI A;  3I5F B;  1ALW A;  1SL8 A;  1C7W A;  4OCI A;  2PRU A;  2OS8 B;  1CTR A;  4Q04 A;  2AAO A;  3FWB A;  5CSI A;  2Y5I A;  3EK4 A;  4OVN F;  2WCE A;  5AFP A;  1M39 A;  1TIZ A;  1OQP A;  3A8R A;  3TDU A;  1AK8 A;  3KF9 A;  4YGB B;  3JVT B;  5HLO A;  1PSB A;  2L50 A;  5AAN A;  2M1K B;  2KSP A;  3BUX B;  1RRO A;  2WCB A;  3OB1 B;  4I5N B;  4NDB A;  2LP2 A;  5FYX A;  5G08 A;  1FBV A;  3RM1 A;  4D1E A;  1IQ5 A;  4GFT A;  1TNW A;  1SW8 A;  1YUS A;  2KFG A;  1KK8 B;  1A75 A;  2M29 A;  1YR5 A;  1B7T Z;  3KO0 A;  3TS5 C;  1R2U A;  2A4J A;  3LK1 A;  1M45 A;  2EGD A;  3PAT A;  1NCY A;  2ZND A;  3PLF B;  2WND A;  4WRI A;  1LA3 A;  4I5L B;  1TCF A;  1YTZ C;  2JPT A;  1QVI Z;  1OE9 B;  4PHM A;  3VRN A;  1B4C A;  2TN4 A;  1CLM A;  1DTL A;  3PN7 C;  2DOQ A;  1UUR A;  2CCM A;  1KQM C;  2ZN9 A;  3O78 A;  2KAV A;  1QJT A;  3C1V A;  2KGR A;  2LMV A;  1JBA A;  2NZ0 A;  1C07 A;  1M63 B;  1SNL A;  3EVR A;  1FI5 A;  3QRX A;  1XK4 A;  1KWO C;  5I2O A;  1FI6 A;  2KI4 C;  1UHH A;  4HRE E;  3BUN B;  2ISD A;  4C0J A;  1BF5 A;  3I5H C;  1G33 A;  2JTT A;  2KAY A;  3I5F C;  1Y0V H;  1N65 A;  2MBX A;  3WHU B;  4YGC B;  2PSR A;  2OS8 C;  3VGO A;  4NDD A;  4R1E A;  2H61 C;  1Y1U A;  2MLE C;  5CPV A;  3O6B A;  4U8D A;  3GK2 A;  1MXL C;  1FW4 A;  1S5G Y;  3CGA A;  2Y4Q A;  3DVM A;  2LE9 B;  1DF0 B;  2RGI A;  1CDL A;  4OKH A;  1NX1 A;  4GGF C;  3JVT C;  1CDP A;  1PVB A;  3CR5 X;  3VRQ A;  2LUX A;  4QJ4 B;  1KK7 Z;  3NSL A;  2JXC A;  3KHE A;  3WHT B;  5D69 A;  4JWQ A;  4DRW A;  3EVU A;  5B8I B;  4YRU A;  2K2A A;  5BPJ A;  1TN4 A;  3HX4 A;  1W7J B;  3ICB A;  1IWQ A;  2WOR A;  1KCY A;  1K96 A;  2I94 A;  1X02 A;  1XO5 A;  1QLK A;  2CXJ A;  2K7D A;  2F33 A;  1KK8 C;  5AEQ A;  1NCX A;  2M49 B;  1F71 A;  1NPQ A;  1LIN A;  3EK7 A;  5JJG A;  3KPX A;  2MRD A;  2L51 A;  1BJF A;  1QV0 A;  4MEW A;  1KFU S;  2OPO A;  3E3R A;  1QAS A;  1IKU A;  3NSK A;  2LHL A;  2KI6 D;  2LAN A;  1SL9 A;  2KBM A;  2KGB C;  3K21 A;  4NDC A;  1SMG A;  2KDH A;  1A2X A;  3LL8 B;  1UHK A;  2K0J A;  3AKB A;  3TUY B;  3KEV A;  1B7T Y;  2R2I A;  1PUL A;  4MZK A;  2LVJ A;  1QXP A;  2VRG A;  1TNQ A;  1TNX A;  5AER A;  1AUI B;  1YUR A;  2BCA A;  1K9U A;  1QVI Y;  4I5J A;  1S26 D;  1SRA A;  1NCZ A;  2F3Y A;  3LLE A;  4ORC B;  2HF5 A;  3H4S E;  1XVJ A;  3OX5 A;  4HSZ A;  4MLW A;  3SIA A;  1PVA A;  1B1G A;  3BUW B;  5DKR A;  5HKW A;  3AAJ A;  3O2P A;  2Y1N A;  2K7O A;  4FTG A;  1JF2 A;  1CM4 A;  1GGW A;  4MRX A;  2BCB A;  5KSZ A;  2KFH A;  3VRP A;  1H4B A;  3OX6 A;  1NWD A;  1WDC B;  3CS1 A;  2JU0 A;  1CDN A;  5CSF A;  4TNC A;  4YGD B;  1UHJ A;  5KU1 A;  1MR8 A;  2FJU B;  3SG4 A;  3I5G C;  4YGE B;  3ZWH A;  5TNC A;  3SG7 A;  1S3P A;  5HLV A;  1XFY O;  1BMO A;  4CFQ A;  2BBN A;  2LCP A;  4GNK B;  1KK7 Y;  2SCP A;  1ZMZ A;  1IH0 A;  1XFV O;  1RWY A;  1EH2 A;  4C0K A;  4QJ3 B;  4ORB B;  1QX2 A;  2MAZ A;  2NCO A;  1CFC A;  1K95 A;  1TOP A;  1Y1A A;  1A03 A;  3TUY C;  4ZCV A;  5GQQ C;  4A4B A;  3JTD B;  1R6P A;  1S36 A;  3BQ3 A;  3LK0 A;  1OSA A;  1SBJ A;  1SR6 B;  4NQG A;  3ZNI A;  2LVV A;  3EK8 A;  5HYD A;  2FOT A;  2K61 A;  1EG4 A;  1DJW A;  4XYN A;  4MZJ A;  3AKA A;  1CMF A;  3MSE B;  1V1G A;  1WRZ A;  4IL1 A;  1QIW A;  2LLS A;  2JT3 A;  4YI9 A;  3EKH A;  4PHK A;  1LA0 A;  2QAC A;  1U5I B;  2AMI A;  2M3W A;  2NCP A;  1AP4 A;  1HQV A;  3VRO A;  1TNP A;  2F2P A;  5IBW A;  1DMO A;  5I8N A;  3SG5 A;  1F4O A;  2O5G A;  3WXA A;  1IGV A;  2GGM A;  2L4H A;  3PFV A;  1RJV A;  1RFJ A;  1WDC C;  2CTN A;  2CNP A;  3TDI A;  1N0Y A;  1XFU O;  3O4Y A;  2KYF A;  1SCV A;  1IJ6 A;  2LAP A;  1PSR A;  1CFP A;  1OZS A;  1F70 A;  1J7O A;  2KYC A;  2JC2 A;  2LUC A;  1A29 A;  1XFZ O;  1XK4 C;  4XJK A;  2E30 A;  2LV7 A;  1A4P A;  1EG3 A;  3AAK A;  1GGZ A;  1J1D A;  2Q91 A;  3EVV A;  4CLN A;  2JT0 A;  3M0W A;  2ZKM X;  4YI8 A;  3CZT X;  1U5I A;  1PK0 D;  2F8P A;  2LNK A;  1EJ3 A;  3SG2 A;  1J7P A;  1F8H A;  1JWD A;  4MVF A;  4E68 A;  1YVH A;  1ZAC A;  1WLZ A;  1YUT A;  2LMT A;  1L7Z A;  3OHM B;  1N2D A;  1YX8 A;  1BG1 A;  2KAX A;  4BY4 A;  3PSR A;  1QLS A;  1KFX L;  4UPG A;  1S6J A;  3FIA A;  1GJY A;  1SR6 C;  2KOT A;  2LVK A;  2L5X B;  1EL4 A;  1TCO B;  5DKQ A;  2JWW A;  4AQJ A;  1MF8 B;  1RK9 A;  1SY9 A;  1YRU B;  3TDZ A;  1B8L A;  3CTN A;  1SCM B;  2KQ6 A;  1LXF C;  1QV1 A;  3IQQ A;  3VRR A;  4DUQ A;  2L0P A;  5I2Q A;  1CMG A;  2LC5 A;  3SG3 A;  2WOS A;  5J3X A;  3D10 A;  1YX7 A;  1K9K A;  3WNX B;  4CID A;  1F55 A;  2BKI B;  1DVI A;  2COL B;  4HRH A;  1E8A A;  1Q80 A;  2M97 A;  2LP3 A;  2NXQ A;  2OTG B;  1KQV A;  4DCK A;  1XYD A;  1S1E A;  2Q4U A;  5KTY A;  1JFK A;  1PAL A;  2JUL A;  1QX7 A;  2HQ8 A;  2JQ6 A;  4QJ5 B;  2M8U A;  1SYM A;  1XA5 A;  3NSI A;  4L9M A;  4CPV A;  2PAS A;  2EHB A;  3CLN A;  3PN7 B;  1UHI A;  1WY9 A;  1K94 A;  2BE6 A;  2LHI A;  2LLT A;  2CBL A;  2I7A A;  2L4I A;  3BUO B;  1SPY A;  1B9A A;  2G9B A;  4JPZ B;  1NYA A;  2F2O A;  5AXI A;  1B8R A;  3A4U B;  1V1F A;  2PMY A;  1JF0 A;  1TRF A;  1PRW A;  1NSH A;  2E6W A;  1F54 A;  1ZOT B;  3GOF A;  4DS7 A;  2BE4 A;  3CR4 X;  4ICB A;  4N5X A;  4N1G A;  2MHH A;  2QPT A;  1ODB A;  1CLL A;  1CLB A;  2BL0 B;  4MRY A;  1QX5 B;  3I5I B;  4PAL A;  4PE0 A;  1NX2 A;  1K9P A;  4BY5 A;  1YRT B;  1K8U A;  2K7B A;  2M9G A;  1B47 A;  2L2E A;  2BBM A;  2G2B A;  3IF7 A;  1BOC A;  2JOJ A;  1M31 A;  3DD4 A;  4GPL B;  1OZO A;  3BUM B;  3PM8 A;  1BR4 B;  2JT8 A;  3EKJ A;  4USL A;  1C7V A;  3DVJ A;  3OB2 B;  1S6I A;  1UWO A;  2BCX A;  3DVK A;  1JSA A;  1S6C A;  4M2Q A;  1DJH A;  2LMU A;  4PCW A;  1FPW A;  4M2P A;  1BR1 B;  2PAL A;  5CSJ A;  4ORA B;  1JFJ A;  1NP8 A;  2GV5 A;  2EC6 B;  2KQY A;  1OMD A;  2JXL A;  5ER5 A;  1SCM C;  1B8C A;  3SJS A;  1DJX A;  2FCD A;  5K89 A;  1OMR A;  1YVL A;  4HRG A;  2HQW A;  5I2L A;  4OV2 A;  4YGA A;  1W7I B;  4YBH B;  3D0Y B;  5D7F A;  1AJ4 A;  3SIB A;  2KNE A;  1MQ1 A;  2MLF C;  1OOJ A;  4DIR A;  4XJK B;  4GAO A;  1UHN A;  1L2O B;  1WLM A;  5DKN A;  2KI6 C;  4JQ0 D;  4PHN A;  2Y1M A;  2OTG C;  2KFF A;  2LM5 A;  2ZN8 A;  3BXK A;  1BOD A;  5HKY A;  1DT7 B;  4CFR A;  1ZUZ A;  1LKJ A;  1WRL A;  2H61 A;  1DJG A;  2MJW B;  4MZL A;  3NSO A;  1VRK A;  2ZRT A;  3FWC A;  1DJZ A;  1Y1X A;  3BOW B;  3GK4 X;  1CNP A;  2JZI A;  4GGN A;  2MA2 A;  2BEC A;  1IRJ A;  3BYA A;  5ER4 X;  1SKT A;  3RLZ A;  4PE1 A;  2H2K A;  4GGF A;  1KSM A;  1BU3 A;  1UP5 A;  4GBA A;  1J1E A;  4WQ2 A;  2CT9 A;  1LVC D;  3IQO A;  1JUO A;  1ZFS A;  3GK1 A;  2AUC A;  1J7Q A;  1K2H A;  1MWN A;  1HT9 A;  3DF0 B;  3HCM A;  1DJI A;  4M2O A;  1GQM A;  1XFX O;  1QAT A;  1IG5 A;  2I18 A;  4PE7 A;  4F0Z B;  3PAL A;  2JNF A;  1DGU A;  3D0Y A;  1FF1 A;  2FCE A;  1OMV A;  2BL0 C;  5PAL A;  1CFF A;  2KHN A;  3I5I C;  1QTX A;  4OR9 B;  1D1O A;  1BT6 A;  2JRF A;  2K8M B;  2ZFD A;  1MXE A;  4MN0 A;  1J7R A;  1CFD A;  4WQ3 A;  3BOW A;  1MHO A;  1MUX A;  2NLN A;  4P2Y B;  1Y6W A;  1G8I A;  1NX3 A;  2ZRS A;  2D8N A;  2ZNE A;  1BLQ A;  2EC6 C;  4AOM A;  1J55 A;  3JTD C;  3CWG A;  1AHR A;  1CM1 A;  3CR2 A;  3DF0 A;  3I5G B;  1CDM A;  1UUS A;  1TTX A;  2M7L A;  1DGV A;  1KFU L;  1CKK A;  4GUK A;  1SL7 A;  2I2R E;  1NIW A;  5CSN A;  1AVS A;  1QS7 A;  3NXA A;  1KFX S;  1DJY A;  1RTP 1;  2GGZ A;  4AQI A;  2HPS A;  4PHJ A;  1L2O C;  2M7N A;  1AJ5 A;  5F6T A;  4N1F A;  3F45 A;  3TS5 B;  1REC A;  1F4Q A;  1NX0 A;  2BKH B;  1SK6 D;  1XFW O;  4P5O E;  4ETO A;  4PE4 A;  1WRK A;  1EXR A;  3TZ1 A;  1DF0 A;  2HET A;  4PDZ A;  2WCF A;  2M1U A;  2P6B B;  3DVE A;  4MBE A;  2O60 A;  1ALV A;  2V53 A;  1M46 A;  2PVB A;  5HKZ A;  1K90 D;  2M0R A;  3SG6 A;  2KBI A;  2JTZ A; 
#chains in the Genus database with same CATH topology
 1G4Y R;  1NUB A;  2L98 A;  1KQM B;  1YUU A;  1LS8 A;  1KSO A;  2SAS A;  1H8B A;  1IJ5 A;  2JNX A;  2WC8 A;  2K2F A;  3OP0 A;  4FQO A;  3FS7 A;  4C0L A;  1CB1 A;  3LCP C;  4OZD A;  2B1U A;  1JC2 A;  5FI7 A;  1S5G Z;  1KWO B;  2IS9 A;  1K93 D;  2KI4 B;  1QIV A;  5JOL A;  2K7C A;  2F3Z A;  1IQ3 A;  1A75 B;  2LLU A;  4I5K A;  4ZCU A;  3I5H B;  4MSP A;  4A4C A;  2LVI A;  3I5F B;  1ALW A;  3BJH A;  1SL8 A;  1C7W A;  4OCI A;  2PRU A;  2OS8 B;  1CTR A;  4Q04 A;  2AAO A;  3FWB A;  2WC5 A;  5CSI A;  2Y5I A;  3EK4 A;  4OVN F;  2WCE A;  4F7F A;  5AFP A;  1M39 A;  1TIZ A;  1OQP A;  1C3Z A;  3A8R A;  3TDU A;  1AK8 A;  2ERB A;  3KF9 A;  4YGB B;  3DXL A;  3JVT B;  5HLO A;  1PSB A;  2L50 A;  5AAN A;  2M1K B;  2KSP A;  3BUX B;  1RRO A;  2WCB A;  3OB1 B;  4I5N B;  4NDB A;  3B7A A;  2LP2 A;  5FYX A;  5G08 A;  1FBV A;  3RM1 A;  4D1E A;  1IQ5 A;  4GFT A;  1TNW A;  1SW8 A;  1YUS A;  2KFG A;  1KK8 B;  1A75 A;  3UO9 A;  2M29 A;  1YR5 A;  1B7T Z;  3KO0 A;  3SS3 A;  3TS5 C;  1R2U A;  2A4J A;  3LK1 A;  1M45 A;  1TUJ A;  2EGD A;  3PAT A;  1NCY A;  2WCM A;  2ZND A;  3PLF B;  2WND A;  4WRI A;  1LA3 A;  4I5L B;  1TCF A;  1YTZ C;  2JPT A;  1QVI Z;  1OE9 B;  1ORG A;  4PHM A;  3VRN A;  1B4C A;  2TN4 A;  1CLM A;  1DTL A;  3PN7 C;  2DOQ A;  3S0D A;  1UUR A;  2CCM A;  2WCK A;  1OOG A;  1KQM C;  2ZN9 A;  3D76 A;  3O78 A;  3SS5 A;  4FQT A;  2KAV A;  1QJT A;  3C1V A;  2KGR A;  2LMV A;  1JBA A;  2NZ0 A;  1C07 A;  1M63 B;  1SNL A;  3D78 A;  3EG5 B;  3EVR A;  3QRX A;  1XK4 A;  1KWO C;  5I2O A;  1FI5 A;  1FI6 A;  2KI4 C;  1IIO A;  1UHH A;  4HRE E;  3BUN B;  2ISD A;  4C0J A;  3R1O A;  1BF5 A;  3I5H C;  1G33 A;  2JTT A;  2KAY A;  3SS4 A;  3I5F C;  1Y0V H;  1N65 A;  2MBX A;  4JD9 A;  3WHU B;  1FPW A;  4YGC B;  1W9Z A;  2PSR A;  2OS8 C;  3VGO A;  4NDD A;  4R1E A;  2H61 C;  1Y1U A;  2MLE C;  5CPV A;  3O6B A;  4PT1 A;  3GK2 A;  4U8D A;  1MXL C;  1FW4 A;  1S5G Y;  3CGA A;  2Y4Q A;  3DVM A;  2LE9 B;  1DF0 B;  2RGI A;  1CDL A;  4OKH A;  1NX1 A;  3R1P A;  4GGF C;  3JVT C;  1CDP A;  1PVB A;  3CR5 X;  3VRQ A;  2LUX A;  4QJ4 B;  1KK7 Z;  3NSL A;  2JXC A;  5DIC A;  3KHE A;  3WHT B;  5D69 A;  4JWQ A;  4DRW A;  3EVU A;  5B8I B;  4YRU A;  2K2A A;  5BPJ A;  1TN4 A;  3HX4 A;  1W7J B;  3ICB A;  1IWQ A;  2WOR A;  1KCY A;  1K96 A;  2I94 A;  3S0G A;  1DEL A;  1X02 A;  1XO5 A;  1QLK A;  2CXJ A;  2K7D A;  2F33 A;  1KK8 C;  5AEQ A;  3PM2 A;  1NCX A;  2M49 B;  3CDN A;  1NPQ A;  1F71 A;  1LIN A;  2K60 A;  3EK7 A;  5JJG A;  2WC6 A;  3KPX A;  2MRD A;  2L51 A;  1BJF A;  1QV0 A;  3OGN A;  4MEW A;  1KFU S;  2OPO A;  2L5Y A;  3E3R A;  1QAS A;  2L2C A;  1IKU A;  3NSK A;  2LHL A;  2KI6 D;  1GM0 A;  2LAN A;  1SL9 A;  2KBM A;  2KGB C;  3K21 A;  4NDC A;  1SMG A;  2QEV A;  2KDH A;  1A2X A;  3LL8 B;  1UHK A;  2K0J A;  3AKB A;  3TUY B;  3KEV A;  1B7T Y;  2R2I A;  3VB1 A;  1PUL A;  4MZK A;  2LVJ A;  1QXP A;  2VRG A;  1TNQ A;  1TNX A;  5AER A;  1AUI B;  1DQE A;  1YUR A;  2BCA A;  1K9U A;  1QVI Y;  4I5J A;  1S26 D;  3NHI A;  3B88 A;  1SRA A;  1NCZ A;  2F3Y A;  3LLE A;  4ORC B;  2HF5 A;  3H4S E;  1XVJ A;  3OX5 A;  4HSZ A;  4MLW A;  3SIA A;  1PVA A;  1B1G A;  3BUW B;  5DKR A;  5HKW A;  3AAJ A;  3O2P A;  2Y1N A;  2K7O A;  4FTG A;  1JF2 A;  1CM4 A;  1GGW A;  4MRX A;  2WCL A;  2BCB A;  3PJI A;  5KSZ A;  3DZT A;  2KFH A;  3VRP A;  2H8V A;  1H4B A;  3OX6 A;  1Z2C B;  1NWD A;  1WDC B;  3CS1 A;  2JU0 A;  1CDN A;  5CSF A;  4TNC A;  4YGD B;  1UHJ A;  5KU1 A;  1MR8 A;  2FJU B;  3SG4 A;  1P28 A;  3I5G C;  1DEK A;  4YGE B;  3ZWH A;  2QEO A;  5TNC A;  3SG7 A;  3QME A;  1S3P A;  5HLV A;  1XFY O;  1BMO A;  4CFQ A;  2BBN A;  2LCP A;  4GNK B;  2PQL A;  2WCJ A;  1KK7 Y;  2SCP A;  1ZMZ A;  1IH0 A;  1XFV O;  1RWY A;  3S0F A;  1EH2 A;  4C0K A;  4QJ3 B;  4ORB B;  1QX2 A;  2MAZ A;  2NCO A;  1CFC A;  2KLE A;  1K95 A;  1TOP A;  1Y1A A;  1A03 A;  3TUY C;  4ZCV A;  5GQQ C;  4A4B A;  3JTD B;  1R6P A;  1S36 A;  3BQ3 A;  3LK0 A;  1OSA A;  1SBJ A;  1SR6 B;  4NQG A;  3ZNI A;  2BNX A;  2LVV A;  3EK8 A;  5HYD A;  2FOT A;  2K61 A;  3D73 A;  1EG4 A;  1DJW A;  4XYN A;  4MZJ A;  3AKA A;  1CMF A;  5FI2 A;  3MSE B;  1V1G A;  1WRZ A;  4IL1 A;  1QIW A;  2LLS A;  5FI6 A;  2JT3 A;  4YI9 A;  3EKH A;  4PHK A;  4JKT A;  1LA0 A;  2QAC A;  3BFB A;  1U5I B;  2AMI A;  2M3W A;  2NCP A;  3CAB A;  1HQV A;  3NGV A;  1AP4 A;  3FE9 A;  3VRO A;  1TNP A;  2F2P A;  5IBW A;  4KYN A;  1DMO A;  5I8N A;  3SG5 A;  1F4O A;  2O5G A;  3WXA A;  1IGV A;  2GGM A;  2L4H A;  3PFV A;  1RJV A;  1RFJ A;  1WDC C;  2CTN A;  5D3O A;  2CNP A;  3TDI A;  3B6X A;  1N0Y A;  1XFU O;  3O4Y A;  2KYF A;  1SCV A;  3R72 A;  1IJ6 A;  3D77 A;  2LAP A;  1PSR A;  2JPO A;  1CFP A;  1OZS A;  3BFH A;  1F70 A;  1J7O A;  2KYC A;  2JC2 A;  2LUC A;  1A29 A;  1XFZ O;  1XK4 C;  4XJK A;  2E30 A;  2LV7 A;  1A4P A;  1EG3 A;  3AAK A;  1GGZ A;  1J1D A;  2Q91 A;  3D74 A;  3EVV A;  4CLN A;  2JT0 A;  3M0W A;  2ZKM X;  4YI8 A;  3CZT X;  1U5I A;  1PK0 D;  2F8P A;  2LNK A;  1EJ3 A;  3SG2 A;  1J7P A;  1F8H A;  1JWD A;  5EL2 A;  4MVF A;  3N7H A;  4E68 A;  1YVH A;  1ZAC A;  1WLZ A;  1YUT A;  2LMT A;  1L7Z A;  3OHM B;  1N2D A;  1YX8 A;  1BG1 A;  2KAX A;  4BY4 A;  3PSR A;  1QLS A;  1KFX L;  4UPG A;  1S6J A;  3FIA A;  1GJY A;  1SR6 C;  2KOT A;  2LVK A;  2L5X B;  1EL4 A;  1SSE B;  1TCO B;  5DKQ A;  2GTE A;  2JWW A;  1MF8 B;  1RK9 A;  1SY9 A;  1YRU B;  4AQJ A;  3TDZ A;  5HL1 A;  3RZS A;  1B8L A;  3CTN A;  1SCM B;  2KQ6 A;  1LXF C;  1QV1 A;  3IQQ A;  3VRR A;  4DUQ A;  2L0P A;  5I2Q A;  1CMG A;  2LC5 A;  3SG3 A;  2WOS A;  5J3X A;  3D10 A;  1YX7 A;  1K9K A;  3WNX B;  4CID A;  1F55 A;  2BKI B;  1DVI A;  2COL B;  4HRH A;  1E8A A;  1Q80 A;  2M97 A;  2LP3 A;  2NXQ A;  2OTG B;  1KQV A;  3B86 A;  1XFR A;  4DCK A;  3V2L A;  1XYD A;  2WCH A;  1S1E A;  2Q4U A;  5KTY A;  3R1V A;  1JFK A;  1PAL A;  2JUL A;  1QX7 A;  2HQ8 A;  2JQ6 A;  3BFA A;  4QJ5 B;  2M8U A;  1SYM A;  3OBV A;  1XA5 A;  3NSI A;  4L9M A;  4CPV A;  2PAS A;  2EHB A;  3CLN A;  3CZ0 A;  3PN7 B;  1UHI A;  1WY9 A;  1K94 A;  2BE6 A;  2LHI A;  2LLT A;  2CBL A;  3UNW A;  2I7A A;  2L4I A;  3BUO B;  3CYZ A;  1SPY A;  1B9A A;  2G9B A;  4JPZ B;  1NYA A;  2F2O A;  5AXI A;  1B8R A;  3A4U B;  1V1F A;  2PMY A;  1JF0 A;  1OW4 A;  1TRF A;  1PRW A;  1NSH A;  2E6W A;  1F54 A;  1ZOT B;  3GOF A;  4DS7 A;  2BE4 A;  2QEB A;  2YGU A;  3CR4 X;  4ICB A;  4N5X A;  4N1G A;  1QWV A;  3DY9 A;  2MHH A;  2QPT A;  1ODB A;  1CLL A;  1CLB A;  2BL0 B;  4MRY A;  1QX5 B;  3I5I B;  4PAL A;  4PE0 A;  1NX2 A;  3L4L A;  1K9P A;  4BY5 A;  1YRT B;  1K8U A;  2K7B A;  2M9G A;  1B47 A;  2L2E A;  2BBM A;  2G2B A;  3IF7 A;  1BOC A;  2JOJ A;  1M31 A;  3DD4 A;  4GPL B;  1OZO A;  3BUM B;  3PM8 A;  1BR4 B;  2JT8 A;  3EKJ A;  4USL A;  1C7V A;  3DVJ A;  3OB2 B;  1S6I A;  1UWO A;  2BCX A;  3DVK A;  1JSA A;  1S6C A;  4M2Q A;  1DJH A;  2LMU A;  3S0A A;  4PCW A;  1C3Y A;  4M2P A;  1BR1 B;  2PAL A;  5CSJ A;  4ORA B;  1JFJ A;  1NP8 A;  2GV5 A;  3L4A A;  2BAP A;  2EC6 B;  2KQY A;  1OMD A;  2JXL A;  5ER5 A;  1SCM C;  1B8C A;  3SJS A;  4INX A;  1DJX A;  1OOH A;  2FCD A;  1OMR A;  5K89 A;  1YVL A;  4HRG A;  2HQW A;  5I2L A;  4OV2 A;  4YGA A;  1W7I B;  4YBH B;  3D0Y B;  5D7F A;  1AJ4 A;  3SIB A;  2KNE A;  3K1E A;  1MQ1 A;  3L47 A;  2MLF C;  1OOJ A;  4DIR A;  4XJK B;  4GAO A;  1UHN A;  1L2O B;  1WLM A;  1Z4H A;  2KI6 C;  4JQ0 D;  4PHN A;  5DKN A;  2Y1M A;  2OTG C;  4IJ7 A;  4INW A;  2KFF A;  2LM5 A;  2ZN8 A;  3BXK A;  1BOD A;  5HKY A;  1DT7 B;  4CFR A;  1ZUZ A;  1LKJ A;  1WRL A;  2H61 A;  1DJG A;  2MJW B;  4MZL A;  3NSO A;  1VRK A;  2ZRT A;  3CZ1 A;  1DJZ A;  1Y1X A;  3FWC A;  3O4X A;  3BOW B;  3GK4 X;  1CNP A;  2JZI A;  4GGN A;  2MA2 A;  2BEC A;  1IRJ A;  3BYA A;  5ER4 X;  1SKT A;  3RLZ A;  4PE1 A;  2H2K A;  4GGF A;  1KSM A;  1BU3 A;  1UP5 A;  4GBA A;  1J1E A;  4WQ2 A;  2CT9 A;  1LVC D;  3IQO A;  1JUO A;  1ZFS A;  3GK1 A;  2AUC A;  3FE6 A;  1J7Q A;  1MWN A;  1K2H A;  1HT9 A;  3DF0 B;  3HCM A;  1DJI A;  4M2O A;  1GQM A;  1XFX O;  3CZ2 A;  1QAT A;  1IG5 A;  2I18 A;  4PE7 A;  4F0Z B;  2PYQ A;  3PAL A;  5I94 A;  2JNF A;  1DGU A;  3D0Y A;  1FF1 A;  2FCE A;  1OMV A;  2BL0 C;  5PAL A;  1DC1 A;  2KHN A;  1CFF A;  3I5I C;  1QTX A;  3D75 A;  1OOF A;  4OR9 B;  3S0B A;  1D1O A;  1BT6 A;  2JRF A;  2KLD A;  2K8M B;  2ZFD A;  2QDI A;  1MXE A;  4MN0 A;  1J7R A;  1CFD A;  3B87 A;  4WQ3 A;  3BOW A;  1TUZ A;  1MHO A;  1MUX A;  2NLN A;  4P2Y B;  1Y6W A;  2P70 A;  1G8I A;  1NX3 A;  3S0E A;  2ZRS A;  2D8N A;  2ZNE A;  1BLQ A;  2EC6 C;  4AOM A;  1J55 A;  3JTD C;  3CWG A;  1AHR A;  1CM1 A;  3CR2 A;  3DF0 A;  3I5G B;  3NHT A;  1CDM A;  1UUS A;  1TTX A;  2M7L A;  1DGV A;  1KFU L;  1CKK A;  4GUK A;  1SL7 A;  2I2R E;  1NIW A;  5CSN A;  1AVS A;  1QS7 A;  1T14 A;  3NXA A;  1KFX S;  1DJY A;  1RTP 1;  2GGZ A;  4AQI A;  2HPS A;  4PHJ A;  1L2O C;  1TWO A;  2KPH A;  2M7N A;  1AJ5 A;  5F6T A;  4N1F A;  3F45 A;  3Q8I A;  3TS5 B;  2QEH A;  1REC A;  3IVT A;  1OOI X;  1F4Q A;  1NX0 A;  2FJY A;  3DYE A;  2BKH B;  1SK6 D;  1XFW O;  4P5O E;  4ETO A;  4PE4 A;  1WRK A;  1EXR A;  3FE8 A;  3TZ1 A;  1DF0 A;  2HET A;  4PDZ A;  2WCF A;  2M1U A;  2P6B B;  3DVE A;  4MBE A;  2O60 A;  1ALV A;  2V53 A;  1M46 A;  2P71 A;  2PVB A;  1K90 D;  2M0R A;  5HKZ A;  3SG6 A;  2KBI A;  2JTZ A; 
#chains in the Genus database with same CATH homology
 1G4Y R;  1NUB A;  2L98 A;  1KQM B;  1YUU A;  1KSO A;  2SAS A;  1H8B A;  1IJ5 A;  2JNX A;  2WC8 A;  2K2F A;  3OP0 A;  4FQO A;  3FS7 A;  4C0L A;  1CB1 A;  3LCP C;  2B1U A;  1JC2 A;  1S5G Z;  1KWO B;  2IS9 A;  1K93 D;  2KI4 B;  1QIV A;  5JOL A;  2K7C A;  2F3Z A;  1IQ3 A;  1A75 B;  2LLU A;  4I5K A;  4ZCU A;  3I5H B;  4MSP A;  4A4C A;  2LVI A;  3I5F B;  1ALW A;  1SL8 A;  1C7W A;  4OCI A;  2PRU A;  2OS8 B;  1CTR A;  4Q04 A;  2AAO A;  3FWB A;  5CSI A;  2Y5I A;  3EK4 A;  4OVN F;  2WCE A;  5AFP A;  1M39 A;  1TIZ A;  1OQP A;  3A8R A;  3TDU A;  1AK8 A;  3KF9 A;  4YGB B;  3JVT B;  5HLO A;  1PSB A;  2L50 A;  5AAN A;  2M1K B;  2KSP A;  3BUX B;  1RRO A;  2WCB A;  3OB1 B;  4I5N B;  4NDB A;  2LP2 A;  5FYX A;  5G08 A;  1FBV A;  3RM1 A;  4D1E A;  1IQ5 A;  4GFT A;  1TNW A;  1SW8 A;  1YUS A;  2KFG A;  1KK8 B;  1A75 A;  2M29 A;  1YR5 A;  1B7T Z;  3KO0 A;  3TS5 C;  1R2U A;  2A4J A;  3LK1 A;  1M45 A;  2EGD A;  3PAT A;  1NCY A;  2ZND A;  3PLF B;  2WND A;  4WRI A;  1LA3 A;  4I5L B;  1TCF A;  1YTZ C;  2JPT A;  1QVI Z;  1OE9 B;  4PHM A;  3VRN A;  1B4C A;  2TN4 A;  1CLM A;  1DTL A;  3PN7 C;  2DOQ A;  1UUR A;  2CCM A;  1KQM C;  2ZN9 A;  3O78 A;  2KAV A;  1QJT A;  3C1V A;  2KGR A;  2LMV A;  1JBA A;  2NZ0 A;  1C07 A;  1M63 B;  1SNL A;  3EVR A;  1FI5 A;  3QRX A;  1XK4 A;  1KWO C;  5I2O A;  1FI6 A;  2KI4 C;  1UHH A;  4HRE E;  3BUN B;  2ISD A;  4C0J A;  1BF5 A;  3I5H C;  1G33 A;  2JTT A;  2KAY A;  3I5F C;  1Y0V H;  1N65 A;  2MBX A;  3WHU B;  4YGC B;  2PSR A;  2OS8 C;  3VGO A;  4NDD A;  4R1E A;  2H61 C;  1Y1U A;  2MLE C;  5CPV A;  3O6B A;  4U8D A;  3GK2 A;  1MXL C;  1FW4 A;  1S5G Y;  3CGA A;  2Y4Q A;  3DVM A;  2LE9 B;  1DF0 B;  2RGI A;  1CDL A;  4OKH A;  1NX1 A;  4GGF C;  3JVT C;  1CDP A;  1PVB A;  3CR5 X;  3VRQ A;  2LUX A;  4QJ4 B;  1KK7 Z;  3NSL A;  2JXC A;  3KHE A;  3WHT B;  5D69 A;  4JWQ A;  4DRW A;  3EVU A;  5B8I B;  4YRU A;  2K2A A;  5BPJ A;  1TN4 A;  3HX4 A;  1W7J B;  3ICB A;  1IWQ A;  2WOR A;  1KCY A;  1K96 A;  2I94 A;  1X02 A;  1XO5 A;  1QLK A;  2CXJ A;  2K7D A;  2F33 A;  1KK8 C;  5AEQ A;  1NCX A;  2M49 B;  1F71 A;  1NPQ A;  1LIN A;  3EK7 A;  5JJG A;  3KPX A;  2MRD A;  2L51 A;  1BJF A;  1QV0 A;  4MEW A;  1KFU S;  2OPO A;  3E3R A;  1QAS A;  1IKU A;  3NSK A;  2LHL A;  2KI6 D;  2LAN A;  1SL9 A;  2KBM A;  2KGB C;  3K21 A;  4NDC A;  1SMG A;  2KDH A;  1A2X A;  3LL8 B;  1UHK A;  2K0J A;  3AKB A;  3TUY B;  3KEV A;  1B7T Y;  2R2I A;  1PUL A;  4MZK A;  2LVJ A;  1QXP A;  2VRG A;  1TNQ A;  1TNX A;  5AER A;  1AUI B;  1YUR A;  2BCA A;  1K9U A;  1QVI Y;  4I5J A;  1S26 D;  1SRA A;  1NCZ A;  2F3Y A;  3LLE A;  4ORC B;  2HF5 A;  3H4S E;  1XVJ A;  3OX5 A;  4HSZ A;  4MLW A;  3SIA A;  1PVA A;  1B1G A;  3BUW B;  5DKR A;  5HKW A;  3AAJ A;  3O2P A;  2Y1N A;  2K7O A;  4FTG A;  1JF2 A;  1CM4 A;  1GGW A;  4MRX A;  2BCB A;  5KSZ A;  2KFH A;  3VRP A;  1H4B A;  3OX6 A;  1NWD A;  1WDC B;  3CS1 A;  2JU0 A;  1CDN A;  5CSF A;  4TNC A;  4YGD B;  1UHJ A;  5KU1 A;  1MR8 A;  2FJU B;  3SG4 A;  3I5G C;  4YGE B;  3ZWH A;  5TNC A;  3SG7 A;  1S3P A;  5HLV A;  1XFY O;  1BMO A;  4CFQ A;  2BBN A;  2LCP A;  4GNK B;  1KK7 Y;  2SCP A;  1ZMZ A;  1IH0 A;  1XFV O;  1RWY A;  1EH2 A;  4C0K A;  4QJ3 B;  4ORB B;  1QX2 A;  2MAZ A;  2NCO A;  1CFC A;  1K95 A;  1TOP A;  1Y1A A;  1A03 A;  3TUY C;  4ZCV A;  5GQQ C;  4A4B A;  3JTD B;  1R6P A;  1S36 A;  3BQ3 A;  3LK0 A;  1OSA A;  1SBJ A;  1SR6 B;  4NQG A;  3ZNI A;  2LVV A;  3EK8 A;  5HYD A;  2FOT A;  2K61 A;  1EG4 A;  1DJW A;  4XYN A;  4MZJ A;  3AKA A;  1CMF A;  3MSE B;  1V1G A;  1WRZ A;  4IL1 A;  1QIW A;  2LLS A;  2JT3 A;  4YI9 A;  3EKH A;  4PHK A;  1LA0 A;  2QAC A;  1U5I B;  2AMI A;  2M3W A;  2NCP A;  1AP4 A;  1HQV A;  3VRO A;  1TNP A;  2F2P A;  5IBW A;  1DMO A;  5I8N A;  3SG5 A;  1F4O A;  2O5G A;  3WXA A;  1IGV A;  2GGM A;  2L4H A;  3PFV A;  1RJV A;  1RFJ A;  1WDC C;  2CTN A;  2CNP A;  3TDI A;  1N0Y A;  1XFU O;  3O4Y A;  2KYF A;  1SCV A;  1IJ6 A;  2LAP A;  1PSR A;  1CFP A;  1OZS A;  1F70 A;  1J7O A;  2KYC A;  2JC2 A;  2LUC A;  1A29 A;  1XFZ O;  1XK4 C;  4XJK A;  2E30 A;  2LV7 A;  1A4P A;  1EG3 A;  3AAK A;  1GGZ A;  1J1D A;  2Q91 A;  3EVV A;  4CLN A;  2JT0 A;  3M0W A;  2ZKM X;  4YI8 A;  3CZT X;  1U5I A;  1PK0 D;  2F8P A;  2LNK A;  1EJ3 A;  3SG2 A;  1J7P A;  1F8H A;  1JWD A;  4MVF A;  4E68 A;  1YVH A;  1ZAC A;  1WLZ A;  1YUT A;  2LMT A;  1L7Z A;  3OHM B;  1N2D A;  1YX8 A;  1BG1 A;  2KAX A;  4BY4 A;  3PSR A;  1QLS A;  1KFX L;  4UPG A;  1S6J A;  3FIA A;  1GJY A;  1SR6 C;  2KOT A;  2LVK A;  2L5X B;  1EL4 A;  1TCO B;  5DKQ A;  2JWW A;  4AQJ A;  1MF8 B;  1RK9 A;  1SY9 A;  1YRU B;  3TDZ A;  1B8L A;  3CTN A;  1SCM B;  2KQ6 A;  1LXF C;  1QV1 A;  3IQQ A;  3VRR A;  4DUQ A;  2L0P A;  5I2Q A;  1CMG A;  2LC5 A;  3SG3 A;  2WOS A;  5J3X A;  3D10 A;  1YX7 A;  1K9K A;  3WNX B;  4CID A;  1F55 A;  2BKI B;  1DVI A;  2COL B;  4HRH A;  1E8A A;  1Q80 A;  2M97 A;  2LP3 A;  2NXQ A;  2OTG B;  1KQV A;  4DCK A;  1XYD A;  1S1E A;  2Q4U A;  5KTY A;  1JFK A;  1PAL A;  2JUL A;  1QX7 A;  2HQ8 A;  2JQ6 A;  4QJ5 B;  2M8U A;  1SYM A;  1XA5 A;  3NSI A;  4L9M A;  4CPV A;  2PAS A;  2EHB A;  3CLN A;  3PN7 B;  1UHI A;  1WY9 A;  1K94 A;  2BE6 A;  2LHI A;  2LLT A;  2CBL A;  2I7A A;  2L4I A;  3BUO B;  1SPY A;  1B9A A;  2G9B A;  4JPZ B;  1NYA A;  2F2O A;  5AXI A;  1B8R A;  3A4U B;  1V1F A;  2PMY A;  1JF0 A;  1TRF A;  1PRW A;  1NSH A;  2E6W A;  1F54 A;  1ZOT B;  3GOF A;  4DS7 A;  2BE4 A;  3CR4 X;  4ICB A;  4N5X A;  4N1G A;  2MHH A;  2QPT A;  1ODB A;  1CLL A;  1CLB A;  2BL0 B;  4MRY A;  1QX5 B;  3I5I B;  4PAL A;  4PE0 A;  1NX2 A;  1K9P A;  4BY5 A;  1YRT B;  1K8U A;  2K7B A;  2M9G A;  1B47 A;  2L2E A;  2BBM A;  2G2B A;  3IF7 A;  1BOC A;  2JOJ A;  1M31 A;  3DD4 A;  4GPL B;  1OZO A;  3BUM B;  3PM8 A;  1BR4 B;  2JT8 A;  3EKJ A;  4USL A;  1C7V A;  3DVJ A;  3OB2 B;  1S6I A;  1UWO A;  2BCX A;  3DVK A;  1JSA A;  1S6C A;  4M2Q A;  1DJH A;  2LMU A;  4PCW A;  1FPW A;  4M2P A;  1BR1 B;  2PAL A;  5CSJ A;  4ORA B;  1JFJ A;  1NP8 A;  2GV5 A;  2EC6 B;  2KQY A;  1OMD A;  2JXL A;  5ER5 A;  1SCM C;  1B8C A;  3SJS A;  1DJX A;  2FCD A;  5K89 A;  1OMR A;  1YVL A;  4HRG A;  2HQW A;  5I2L A;  4OV2 A;  4YGA A;  1W7I B;  4YBH B;  3D0Y B;  5D7F A;  1AJ4 A;  3SIB A;  2KNE A;  1MQ1 A;  2MLF C;  1OOJ A;  4DIR A;  4XJK B;  4GAO A;  1UHN A;  1L2O B;  1WLM A;  5DKN A;  2KI6 C;  4JQ0 D;  4PHN A;  2Y1M A;  2OTG C;  2KFF A;  2LM5 A;  2ZN8 A;  3BXK A;  1BOD A;  5HKY A;  1DT7 B;  4CFR A;  1ZUZ A;  1LKJ A;  1WRL A;  2H61 A;  1DJG A;  2MJW B;  4MZL A;  3NSO A;  1VRK A;  2ZRT A;  3FWC A;  1DJZ A;  1Y1X A;  3BOW B;  3GK4 X;  1CNP A;  2JZI A;  4GGN A;  2MA2 A;  2BEC A;  1IRJ A;  3BYA A;  5ER4 X;  1SKT A;  3RLZ A;  4PE1 A;  2H2K A;  4GGF A;  1KSM A;  1BU3 A;  1UP5 A;  4GBA A;  1J1E A;  4WQ2 A;  2CT9 A;  1LVC D;  3IQO A;  1JUO A;  1ZFS A;  3GK1 A;  2AUC A;  1J7Q A;  1K2H A;  1MWN A;  1HT9 A;  3DF0 B;  3HCM A;  1DJI A;  4M2O A;  1GQM A;  1XFX O;  1QAT A;  1IG5 A;  2I18 A;  4PE7 A;  4F0Z B;  3PAL A;  2JNF A;  1DGU A;  3D0Y A;  1FF1 A;  2FCE A;  1OMV A;  2BL0 C;  5PAL A;  1CFF A;  2KHN A;  3I5I C;  1QTX A;  4OR9 B;  1D1O A;  1BT6 A;  2JRF A;  2K8M B;  2ZFD A;  1MXE A;  4MN0 A;  1J7R A;  1CFD A;  4WQ3 A;  3BOW A;  1MHO A;  1MUX A;  2NLN A;  4P2Y B;  1Y6W A;  1G8I A;  1NX3 A;  2ZRS A;  2D8N A;  2ZNE A;  1BLQ A;  2EC6 C;  4AOM A;  1J55 A;  3JTD C;  3CWG A;  1AHR A;  1CM1 A;  3CR2 A;  3DF0 A;  3I5G B;  1CDM A;  1UUS A;  1TTX A;  2M7L A;  1DGV A;  1KFU L;  1CKK A;  4GUK A;  1SL7 A;  2I2R E;  1NIW A;  5CSN A;  1AVS A;  1QS7 A;  3NXA A;  1KFX S;  1DJY A;  1RTP 1;  2GGZ A;  4AQI A;  2HPS A;  4PHJ A;  1L2O C;  2M7N A;  1AJ5 A;  5F6T A;  4N1F A;  3F45 A;  3TS5 B;  1REC A;  1F4Q A;  1NX0 A;  2BKH B;  1SK6 D;  1XFW O;  4P5O E;  4ETO A;  4PE4 A;  1WRK A;  1EXR A;  3TZ1 A;  1DF0 A;  2HET A;  4PDZ A;  2WCF A;  2M1U A;  2P6B B;  3DVE A;  4MBE A;  2O60 A;  1ALV A;  2V53 A;  1M46 A;  2PVB A;  5HKZ A;  1K90 D;  2M0R A;  3SG6 A;  2KBI A;  2JTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...