1KK8C

Scallop myosin (s1-adp-befx) in the actin-detached conformation
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
154
structure length
154
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin Heavy Chain, Striated muscle
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
total genus 48
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8C02
1SPYA 1ZOTB 1N0YA 2G9BA 1QVIY 5DKRA 2BKHB 1F70A 2KFFA 2PASA 1AHRA 1SL8A 3O78A 3CR2A 2PRUA 2DOQA 4GUKA 1QV1A 4MZLA 2LVIA 2JT8A 3PATA 2L4IA 1XFWO 3VRPA 1YX8A 3KEVA 4GPLB 1K96A 5JJGA 4YRUA 1J7QA 1CLBA 1X02A 2H61A 2IS9A 3LL8B 4DIRA 4OV2A 3LCPC 2BKIB 1JF2A 1LA0A 1WDCB 1YUSA 4I5NB 4N5XA 5KSZA 1TN4A 1NX0A 1D1OA 2JU0A 3OX5A 1S5GZ 3WXAA 1J1EA 1S36A 3A4UB 1J7RA 3PSRA 1BLQA 1M39A 4A4CA 4QJ3B 3VROA 1UP5A 5DKNA 2LLSA 2JQ6A 2KQYA 3JVTB 1YVLA 3BQ3A 2FCDA 3KO0A 4ICBA 4WQ2A 1J7PA 1UHHA 1PVAA 3DF0A 4MRXA 2M9GA 2MBXA 2BCXA 1A29A 2B1UA 4YGCB 3BOWB 1E8AA 4NDBA 2ZRTA 2LMTA 3FWCA 2MHHA 4PALA 2LCPA 4OVNF 4Q04A 1NCXA 1AK8A 3TDUA 4OKHA 4N1GA 1S5GY 4CFQA 3TUYB 1R2UA 1S3PA 3OP0A 3BUOB 1TCOB 1CTRA 1EL4A 3NXAA 3PLFB 2L0PA 5CSIA 1SL9A 2JZIA 4M2PA 1JC2A 2A4JA 1K9PA 1JWDA 2Q4UA 1K8UA 3F45A 1B7TY 1YURA 3O4YA 1B8RA 2QPTA 1YVHA 2JTTA 1TCFA 2MLFC 1K2HA 3CZTX 4YGAA 1Q80A 5KU1A 1TNWA 2EGDA 1XYDA 1FW4A 4C0LA 1UHNA 2F3ZA 2K7BA 2KFHA 2ZRSA 3TDZA 2RGIA 5GQQC 4MRYA 3O2PA 1GGZA 2L50A 1KK8C 1XFVO 1QATA 1QV0A 3KHEA 1KK7Z 1DJHA 2FCEA 2NLNA 3SJSA 4MEWA 2LUCA 4ZCVA 3WNXB 1XFYO 1CLMA 4HREE 5K89A 4GAOA 1QX5B 1J55A 2JOJA 4GGNA 3BYAA 1K9UA 1N65A 1SCMB 3QRXA 3I5GB 4BY4A 5CSFA 1C7WA 2KOTA 1MWNA 3LLEA 1JSAA 4YBHB 1CDLA 4JQ0D 2NCOA 4PE0A 1R6PA 1RJVA 3EKHA 1CDMA 2CTNA 2F3YA 5ER4X 1IRJA 2LNKA 1KWOB 1MUXA 1XK4A 1LXFC 3BUXB 1A75B 1S6JA 1LKJA 3H4SE 3EVUA 4M2QA 2LMUA 1BT6A 3BUNB 1BODA 1OMVA 2PVBA 3HX4A 1CFCA 1IWQA 1CLLA 1IG5A 2KYCA 1UURA 1CMGA 2L51A 4PHJA 1L2OB 4XYNA 2BCAA 4L9MA 3TDIA 2CT9A 3CTNA 3EK8A 4JWQA 1YX7A 2KI6C 1ODBA 2MJWB 1UHKA 1YTZC 1F55A 1KFUL 4GNKB 3D10A 5I8NA 1DJWA 1DF0A 1XFUO 1ALWA 2R2IA 1DVIA 1DJZA 1JFKA 3M0WA 1TTXA 1WRLA 2AAOA 4GBAA 1XVJA 1CNPA 5HLOA 5B8IB 1IQ3A 1DT7B 2KI4C 1PK0D 1QIVA 4PE1A 1BJFA 2WNDA 1GQMA 4FQOA 4I5JA 3DVMA 1B47A 4NDDA 2JTZA 2NXQA 3LK0A 1KSOA 1ZUZA 2WC8A 1DGUA 5PALA 2JT3A 1G33A 3EK7A 4PCWA 2WORA 3BXKA 2PMYA 2KBMA 2ZN9A 3OHMB 2HQ8A 1CB1A 2M7LA 4MZKA 3CWGA 4PE7A 3GK1A 1QIWA 2BBMA 1BR1B 4ORCB 3IQQA 4DUQA 1RTP1 4WRIA 1TIZA 3TZ1A 3VRQA 2L98A 3NSKA 5ER5A 2Y5IA 3GK2A 1AJ5A 2O5GA 1A03A 3I5FC 2BBNA 2NZ0A 3VRRA 2BECA 1B4CA 2SCPA 1RFJA 1OMDA 1S6CA 1DTLA 2F8PA 2M0RA 1K90D 3AAJA 1QXPA 1BF5A 1OMRA 1SR6C 1V1GA 1NWDA 2H61C 2OTGC 3JTDC 2VRGA 1SR6B 2M97A 3CLNA 2FOTA 2I94A 1LINA 2AMIA 1CFFA 3JTDB 1OOJA 2G2BA 4I5LB 2JULA 2ZNEA 3HCMA 1NYAA 4ORAB 3RLZA 4GGFA 2F33A 1M63B 3BOWA 1WY9A 1SK6D 5DKQA 1F4OA 4NDCA 1GJYA 1SBJA 3DVEA 4PHKA 3AAKA 2WCFA 1JFJA 2KNEA 2LE9B 3AKAA 3FIAA 1SYMA 1AVSA 1UWOA 4TNCA 2M8UA 2LVJA 5D7FA 1OQPA 3DF0B 3OX6A 4MLWA 2PALA 3DVKA 2BL0C 2O60A 1OZSA 2JRFA 4C0JA 4AQIA 1W7IB 1KFXS 2GGMA 5HKWA 1RWYA 4PHNA 4GFTA 4M2OA 1Y0VH 2GV5A 1NX1A 1J7OA 2PSRA 2LHIA 2E6WA 1K94A 1YR5A 1PULA 2LMVA 1KFUS 1L7ZA 1YRUB 2F2OA 4U8DA 5AFPA 1SKTA 1KK8B 5BPJA 1MQ1A 1M31A 4P2YB 2E30A 1TNXA 2HETA 2KGRA 1EG4A 4UPGA 1Y1UA 3EVVA 5G08A 1XA5A 2MA2A 5I2LA 4CLNA 2JXCA 1TNQA 1CKKA 1JF0A 2MAZA 2HPSA 2JT0A 2NCPA 3PM8A 1QTXA 5JOLA 1KK7Y 2CNPA 2M3WA 2HF5A 1NSHA 4HRGA 5I2QA 5FYXA 1NX3A 2OS8C 1DJIA 2OS8B 2F2PA 2LLTA 4IL1A 5HYDA 1NPQA 4R1EA 3PALA 1F4QA 2I2RE 2L2EA 3GOFA 4USLA 2KYFA 2CBLA 1A75A 1KQMC 2K2AA 2LP3A 2P6BB 3D0YB 3I5HC 1EH2A 2ZKMX 3NSIA 1Y6WA 1KFXL 2I18A 4MVFA 1OE9B 1XK4C 3SG6A 1H4BA 4MN0A 5D69A 4JPZB 1VRKA 4PE4A 1YUUA 1SNLA 1QX2A 3C1VA 1DMOA 1BMOA 1S1EA 2K8MB 4F0ZB 3PN7C 1U5IB 4DRWA 1IH0A 3ZWHA 1ZMZA 1DJYA 3PN7B 3GK4X 4DCKA 1G4YR 1RROA 1RECA 2JPTA 3CR4X 1PSRA 1PRWA 2BE4A 4XJKB 4YGEB 1CFPA 2EHBA 1F8HA 2K7OA 4D1EA 2KI4B 1EG3A 1CM1A 1MF8B 2LAPA 1QVIZ 1S6IA 4HSZA 1QX7A 2LVVA 3SIAA 1GGWA 4ETOA 2MRDA 1YRTB 1SY9A 2KAYA 4I5KA 3CR5X 4MSPA 2CCMA 1ZACA 2LVKA 3KF9A 4YGBB 4MBEA 4CPVA 2M49B 3ZNIA 4YGDB 2V53A 1KCYA 3SG5A 1IKUA 1QS7A 2SASA 3LK1A 2JWWA 5AANA 2LP2A 4CIDA 3A8RA 1AJ4A 1QASA 1NCYA 2EC6C 1CDNA 1BOCA 1MHOA 3CS1A 1OZOA 3IQOA 2EC6B 5CSJA 2ISDA 3I5FB 2LUXA 2Y4QA 3WHUB 2CXJA 1B8LA 1EJ3A 4FTGA 5KTYA 4P5OE 2I7AA 2LHLA 1W7JB 1SCVA 1PVBA 2WOSA 5TNCA 1J1DA 4AOMA 2M1UA 2D8NA 2KBIA 2TN4A 5I2OA 1Y1XA 2OTGB 1NX2A 2M29A 3DVJA 1WDCC 3SG2A 3BUWB 2K61A 2KGBC 4PHMA 1S26D 2LANA 1JBAA 1Y1AA 3SG4A 1YUTA 1PSBA 3FWBA 2Q91A 3DD4A 2K7DA 5CPVA 1TRFA 1QLKA 3JVTC 3SG7A 3VGOA 2JXLA 1UHIA 1FI6A 2GGZA 1C7VA 4GGFC 3TS5C 1B7TZ 4ZCUA 2JC2A 1SMGA 2M7NA 5AEQA 1LA3A 4E68A 1UHJA 5HKZA 4ORBB 3TS5B 1NCZA 1B9AA 1NP8A 2BL0B 3WHTB 2WCBA 1FPWA 3RM1A 1SW8A 3TUYC 1V1FA 1A4PA 2KHNA 2LLUA 4YI8A 2KSPA 1IQ5A 1FI5A 1FF1A 3MSEB 2KAVA 3EVRA 2K2FA 3KPXA 1UUSA 2JNXA 4A4BA 1CDPA 1LVCD 2KFGA 2OPOA 1AUIB 3PFVA 1WRKA 3NSOA 2ZN8A 5CSNA 1NUBA 2ZNDA 3OB2B 1JUOA 1M45A 2FJUB 1XFXO 1M46A 2LM5A 5AERA 1SL7A 2L4HA 5AXIA 3K21A 1ZFSA 4OCIA 1HQVA 2M1KB 4CFRA 1F54A 1BG1A 2ZFDA 1CMFA 3E3RA 1ALVA 1XFZO 1MXEA 1N2DA 1SCMC 3I5GC 4MZJA 2L5XB 1XO5A 1IGVA 2JNFA 5HLVA 3FS7A 1EXRA 3EK4A 1CM4A 2QACA 1RK9A 4YI9A 1KQMB 1TOPA 3ICBA 3IF7A 3D0YA 1DGVA 4C0KA 3I5HB 2KAXA 1DJGA 2LC5A 2KI6D 1A2XA 1BU3A 1K95A 1KWOC 2HQWA 2Y1NA 4OR9B 2AUCA 4PDZA 1OSAA 1IJ6A 3SG3A 1F71A 2WCEA 1G8IA 4HRHA 1MXLC 4DS7A 4QJ5B 3BUMB 4AQJA 4QJ4B 1SRAA 1WLZA 5IBWA 1KQVA 1FBVA 1TNPA 1U5IA 2K7CA 1CFDA 1QJTA 1DJXA 1IJ5A 1L2OC 2COLB 1B8CA 1HT9A 2Y1MA 3NSLA 1K93D 3CGAA 4XJKA 1B1GA 2BCBA 2BE6A 3EKJA 4N1FA 5J3XA 4WQ3A 1K9KA 1DF0B 2KQ6A 1MR8A 1PALA 3AKBA 5HKYA 4NQGA 5F6TA 1WLMA 1C07A 4BY5A 3I5IC 1WRZA 2H2KA 1KSMA 2LV7A 3VRNA 1BR4B 3O6BA 3I5IB 1NIWA 3OB1B 2K0JA 2MLEC 1AP4A 3SIBA 2KDHA 1H8BA 1QLSA
chains in the Genus database with same CATH superfamily
1SPYA 1ZOTB 1N0YA 2G9BA 3BJHA 1QVIY 5DKRA 2BKHB 1F70A 2KFFA 2PASA 1AHRA 1SL8A 3O78A 3CR2A 2PRUA 2DOQA 4GUKA 4JD9A 1QV1A 4MZLA 2LVIA 2JT8A 3PATA 2L4IA 1XFWO 3VRPA 1YX8A 3KEVA 4GPLB 1K96A 3FE9A 5JJGA 4YRUA 1J7QA 1CLBA 1X02A 3R1PA 2H61A 2IS9A 3LL8B 4DIRA 4OV2A 3LCPC 2BKIB 1JF2A 1LA0A 1WDCB 1YUSA 4I5NB 4N5XA 5KSZA 1TN4A 1NX0A 3B6XA 4F7FA 2JU0A 3OX5A 3DZTA 1D1OA 1S5GZ 3WXAA 1J1EA 1S36A 2KPHA 3A4UB 1J7RA 3PSRA 1BLQA 1M39A 4A4CA 2BAPA 4QJ3B 3VROA 1UP5A 5DKNA 2LLSA 2JQ6A 2KQYA 3JVTB 1YVLA 3BQ3A 2FCDA 2L2CA 3KO0A 4ICBA 4WQ2A 1UHHA 3BFBA 1J7PA 1PVAA 3DF0A 3DY9A 2M9GA 4MRXA 2MBXA 2K60A 2BCXA 1A29A 2B1UA 4YGCB 3BOWB 1E8AA 4NDBA 2ZRTA 2LMTA 2WCKA 2MHHA 3FWCA 4PALA 2LCPA 4OVNF 4Q04A 1NCXA 4IJ7A 3FE8A 1AK8A 3TDUA 4OKHA 4N1GA 1S5GY 4CFQA 3TUYB 1R2UA 1S3PA 3OP0A 3BUOB 1TCOB 1CTRA 1EL4A 3NXAA 2WCLA 2L0PA 3PLFB 1SL9A 2JZIA 4M2PA 5CSIA 1JC2A 2A4JA 1K9PA 1JWDA 2Q4UA 1K8UA 3F45A 1B7TY 1YURA 3O4YA 1B8RA 2QPTA 1YVHA 2JTTA 1TCFA 2MLFC 1K2HA 3CZTX 3D78A 1Q80A 4YGAA 5KU1A 5FI6A 1TNWA 2WCHA 3IVTA 2EGDA 1XYDA 1FW4A 1XFRA 1UHNA 4C0LA 2F3ZA 2K7BA 2KFHA 2ZRSA 2H8VA 2RGIA 5GQQC 4MRYA 3O2PA 3TDZA 1GGZA 2L50A 3PM2A 1KK8C 1XFVO 1LS8A 1QATA 1QV0A 2GTEA 3KHEA 3SIBA 1KK7Z 1DJHA 2FCEA 2NLNA 3SJSA 4MEWA 2LUCA 4ZCVA 3WNXB 1XFYO 1CLMA 4HREE 5K89A 3B86A 4GAOA 1QX5B 1J55A 2JOJA 4GGNA 3BFAA 3BYAA 1K9UA 1N65A 1SCMB 3QRXA 3I5GB 4BY4A 5CSFA 1C7WA 2KOTA 1MWNA 3LLEA 1JSAA 4YBHB 1CDLA 1OW4A 3QMEA 4JQ0D 2NCOA 4PE0A 1R6PA 3OGNA 1RJVA 3EKHA 1CDMA 2CTNA 3BFHA 2F3YA 5ER4X 1IRJA 4PT1A 2LNKA 5EL2A 1KWOB 1MUXA 1XK4A 3S0BA 1LXFC 3BUXB 1A75B 1S6JA 1LKJA 3H4SE 3EVUA 3N7HA 3PJIA 4M2QA 2LMUA 1BT6A 3BUNB 1BODA 1OMVA 2PVBA 3HX4A 1CFCA 1IWQA 1F8HA 1CLLA 1IG5A 2P70A 2KYCA 1UURA 1CMGA 2L51A 4PHJA 1L2OB 4XYNA 3D76A 2BCAA 4L9MA 3TDIA 2CT9A 3CTNA 3EK8A 4JWQA 1YX7A 2KI6C 1ODBA 1QWVA 2MJWB 1UHKA 2QDIA 1YTZC 1F55A 1KFUL 4GNKB 3D10A 5I8NA 1DJWA 1DF0A 1XFUO 1ALWA 2R2IA 1DVIA 1DJZA 1JFKA 2JPOA 3M0WA 1TTXA 1WRLA 2AAOA 4GBAA 1XVJA 1CNPA 5HLOA 5B8IB 1IQ3A 1DT7B 1SSEB 2KI4C 1PK0D 1QIVA 4PE1A 3B7AA 1BJFA 2WNDA 1GQMA 4FQOA 4I5JA 3DVMA 1B47A 4NDDA 2JTZA 2NXQA 2KLEA 3LK0A 1KSOA 1ZUZA 2WC8A 1DGUA 5PALA 1TUZA 2JT3A 3RZSA 1G33A 3EK7A 4PCWA 2WORA 3BXKA 2PMYA 2KBMA 2ZN9A 3OHMB 2HQ8A 1CB1A 2M7LA 4MZKA 3CABA 1Z4HA 3CWGA 4PE7A 3GK1A 1QIWA 2BBMA 1BR1B 4ORCB 3IQQA 4DUQA 1RTP1 4WRIA 1TIZA 3TZ1A 3VRQA 2L98A 3NSKA 5ER5A 2Y5IA 3GK2A 1AJ5A 2O5GA 2QEOA 1A03A 3I5FC 2BBNA 2NZ0A 1IIOA 3VRRA 2BECA 1B4CA 2SCPA 1RFJA 1OMDA 1S6CA 1DTLA 2F8PA 2M0RA 1K90D 3AAJA 3UNWA 1QXPA 1BF5A 1OMRA 1SR6C 1V1GA 3UO9A 1NWDA 2H61C 2OTGC 3JTDC 2VRGA 1SR6B 2M97A 3CLNA 2FOTA 2I94A 1LINA 2AMIA 1CFFA 3JTDB 1OOJA 2G2BA 4I5LB 1TUJA 2JULA 2ZNEA 3HCMA 1NYAA 4ORAB 3RLZA 4GGFA 2F33A 1M63B 3BOWA 1WY9A 1SK6D 3DYEA 3OBVA 5DKQA 2QEHA 1F4OA 4NDCA 1GJYA 1SBJA 3DVEA 4PHKA 3AAKA 2WCFA 1JFJA 2KNEA 2LE9B 3AKAA 3FIAA 3S0DA 1P28A 1SYMA 1AVSA 1UWOA 4TNCA 2M8UA 2LVJA 5D7FA 2KLDA 1OQPA 3DF0B 3OX6A 4MLWA 4FQTA 2PALA 2PYQA 2WCJA 3DVKA 2BL0C 2O60A 1OZSA 2JRFA 4C0JA 2WC6A 4AQIA 1W7IB 1KFXS 2GGMA 5HKWA 1RWYA 4PHNA 3CZ2A 4GFTA 4INWA 4M2OA 1Y0VH 2GV5A 1NX1A 1J7OA 1OOIX 2PSRA 2LHIA 2E6WA 1K94A 1YR5A 1PULA 3R1OA 1OOFA 2LMVA 1KFUS 1L7ZA 1YRUB 2F2OA 4U8DA 5DICA 3V2LA 3D77A 1SKTA 1KK8B 5AFPA 1C3YA 5BPJA 1MQ1A 1M31A 2PQLA 4P2YB 2E30A 1TNXA 2HETA 2KGRA 1EG4A 4UPGA 2ERBA 1Y1UA 3EVVA 3S0EA 5G08A 1XA5A 2MA2A 5I2LA 4CLNA 3CZ1A 2JXCA 3B88A 1TNQA 3D75A 2BNXA 1CKKA 1JF0A 2MAZA 2HPSA 2JT0A 2NCPA 3PM8A 3R72A 1QTXA 5JOLA 5I94A 1KK7Y 2CNPA 2M3WA 2HF5A 1NSHA 4HRGA 5I2QA 5FYXA 1NX3A 2OS8C 1DJIA 3S0GA 2OS8B 2F2PA 2LLTA 4IL1A 5HYDA 1NPQA 4R1EA 3PALA 1F4QA 2I2RE 2L2EA 3GOFA 4KYNA 4USLA 2KYFA 2WCMA 3K1EA 2CBLA 1A75A 1KQMC 2K2AA 2LP3A 4JKTA 3SS4A 2P6BB 3D0YB 3I5HC 1EH2A 2ZKMX 3NSIA 1Y6WA 1KFXL 2I18A 4MVFA 1OE9B 1XK4C 3SG6A 1H4BA 4MN0A 5D69A 4JPZB 1VRKA 4PE4A 1YUUA 1SNLA 1QX2A 3C1VA 1DMOA 1BMOA 1S1EA 1DQEA 2K8MB 4F0ZB 3PN7C 1U5IB 4DRWA 3SS5A 1IH0A 3ZWHA 1ZMZA 1DJYA 3PN7B 3GK4X 4DCKA 5FI2A 1G4YR 1RROA 1RECA 2JPTA 3CR4X 1PSRA 1PRWA 2BE4A 3NGVA 4XJKB 4YGEB 2EHBA 1CFPA 2K7OA 4D1EA 2KI4B 1EG3A 1CM1A 1MF8B 5FI7A 2LAPA 1QVIZ 1S6IA 2WC5A 1QX7A 2LVVA 4HSZA 3SIAA 1GGWA 1W9ZA 4ETOA 2MRDA 1YRTB 1SY9A 2KAYA 4I5KA 3CR5X 4MSPA 1TWOA 2CCMA 1ZACA 2LVKA 1DEKA 3KF9A 4YGBB 4MBEA 4CPVA 2M49B 3ZNIA 1Z2CB 4YGDB 2V53A 1KCYA 3NHTA 3L4AA 1DC1A 3SG5A 1IKUA 1QS7A 2SASA 3LK1A 2JWWA 5AANA 2LP2A 4CIDA 3A8RA 1AJ4A 1QASA 1NCYA 2EC6C 1CDNA 1BOCA 1MHOA 3CS1A 1OZOA 3IQOA 2EC6B 5CSJA 2ISDA 3I5FB 2LUXA 2Y4QA 3D73A 3WHUB 2CXJA 1B8LA 1EJ3A 4FTGA 5KTYA 3CDNA 2YGUA 2I7AA 2LHLA 1W7JB 1SCVA 3D74A 4P5OE 1PVBA 2WOSA 5TNCA 1J1DA 4AOMA 2M1UA 2D8NA 2KBIA 2TN4A 3SS3A 3B87A 5I2OA 1Y1XA 2OTGB 1NX2A 2M29A 3DVJA 1WDCC 3SG2A 3BUWB 2K61A 3Q8IA 2KGBC 4PHMA 1S26D 2LANA 3CZ0A 1JBAA 1Y1AA 3SG4A 2QEVA 1YUTA 1PSBA 3FWBA 2Q91A 3DD4A 2K7DA 5CPVA 1TRFA 1QLKA 3JVTC 3SG7A 3VGOA 2JXLA 2QEBA 1UHIA 1FI6A 2GGZA 1C7VA 4GGFC 3TS5C 1B7TZ 4ZCUA 2JC2A 1SMGA 2M7NA 5AEQA 1LA3A 4E68A 1UHJA 5HKZA 4ORBB 3TS5B 3VB1A 1NCZA 1B9AA 1NP8A 2BL0B 3WHTB 2WCBA 1FPWA 3RM1A 1SW8A 3TUYC 1V1FA 1A4PA 1T14A 2KHNA 2LLUA 4YI8A 2KSPA 1IQ5A 1FI5A 1FF1A 3MSEB 2KAVA 3EVRA 2K2FA 3KPXA 1UUSA 2JNXA 3FE6A 4A4BA 1CDPA 1LVCD 2KFGA 2OPOA 1AUIB 3PFVA 1WRKA 3NSOA 2ZN8A 5CSNA 1NUBA 2ZNDA 3OB2B 1JUOA 3L4LA 1M45A 2FJUB 1XFXO 5HL1A 1M46A 3S0FA 2LM5A 1GM0A 5AERA 1SL7A 2L4HA 5AXIA 3K21A 1ZFSA 3DXLA 4OCIA 1HQVA 1C3ZA 2M1KB 4CFRA 1F54A 1BG1A 2ZFDA 1CMFA 3E3RA 3NHIA 3R1VA 1ALVA 1XFZO 1MXEA 1N2DA 3CYZA 1SCMC 3I5GC 4MZJA 2L5XB 1XO5A 1IGVA 2JNFA 2P71A 2L5YA 5HLVA 3FS7A 5D3OA 1EXRA 3EK4A 1CM4A 2QACA 1RK9A 4YI9A 1KQMB 2FJYA 1TOPA 3ICBA 3IF7A 3D0YA 1DGVA 4C0KA 3I5HB 2KAXA 1DJGA 2LC5A 2KI6D 4OZDA 1A2XA 1BU3A 1K95A 3L47A 1KWOC 2HQWA 2Y1NA 4OR9B 2AUCA 4PDZA 1OSAA 1IJ6A 3SG3A 1F71A 2WCEA 1G8IA 4HRHA 1MXLC 3S0AA 4DS7A 4QJ5B 3BUMB 4AQJA 4QJ4B 1SRAA 1WLZA 5IBWA 1KQVA 1DELA 1FBVA 1TNPA 1U5IA 2K7CA 4INXA 1CFDA 1QJTA 1DJXA 1IJ5A 1L2OC 2COLB 1B8CA 1HT9A 2Y1MA 3NSLA 1K93D 3CGAA 4XJKA 1B1GA 2BCBA 2BE6A 3EKJA 3O4XA 4N1FA 5J3XA 4WQ3A 1K9KA 1OOHA 1DF0B 2KQ6A 1MR8A 1PALA 3AKBA 5HKYA 4NQGA 5F6TA 1WLMA 1C07A 3EG5B 4BY5A 3I5IC 1WRZA 2H2KA 1KSMA 2LV7A 3VRNA 1BR4B 3O6BA 1ORGA 3I5IB 1NIWA 3OB1B 2K0JA 2MLEC 1AP4A 1OOGA 2KDHA 1H8BA 1QLSA
chains in the Genus database with same CATH topology
1SPYA 1ZOTB 1N0YA 2G9BA 1QVIY 5DKRA 2BKHB 1F70A 2KFFA 2PASA 1AHRA 1SL8A 3O78A 3CR2A 2PRUA 2DOQA 4GUKA 1QV1A 4MZLA 2LVIA 2JT8A 3PATA 2L4IA 1XFWO 3VRPA 1YX8A 3KEVA 4GPLB 1K96A 5JJGA 4YRUA 1J7QA 1CLBA 1X02A 2H61A 2IS9A 3LL8B 4DIRA 4OV2A 3LCPC 2BKIB 1JF2A 1LA0A 1WDCB 1YUSA 4I5NB 4N5XA 5KSZA 1TN4A 1NX0A 1D1OA 2JU0A 3OX5A 1S5GZ 3WXAA 1J1EA 1S36A 3A4UB 1J7RA 3PSRA 1BLQA 1M39A 4A4CA 4QJ3B 3VROA 1UP5A 5DKNA 2LLSA 2JQ6A 2KQYA 3JVTB 1YVLA 3BQ3A 2FCDA 3KO0A 4ICBA 4WQ2A 1J7PA 1UHHA 1PVAA 3DF0A 4MRXA 2M9GA 2MBXA 2BCXA 1A29A 2B1UA 4YGCB 3BOWB 1E8AA 4NDBA 2ZRTA 2LMTA 3FWCA 2MHHA 4PALA 2LCPA 4OVNF 4Q04A 1NCXA 1AK8A 3TDUA 4OKHA 4N1GA 1S5GY 4CFQA 3TUYB 1R2UA 1S3PA 3OP0A 3BUOB 1TCOB 1CTRA 1EL4A 3NXAA 3PLFB 2L0PA 5CSIA 1SL9A 2JZIA 4M2PA 1JC2A 2A4JA 1K9PA 1JWDA 2Q4UA 1K8UA 3F45A 1B7TY 1YURA 3O4YA 1B8RA 2QPTA 1YVHA 2JTTA 1TCFA 2MLFC 1K2HA 3CZTX 4YGAA 1Q80A 5KU1A 1TNWA 2EGDA 1XYDA 1FW4A 4C0LA 1UHNA 2F3ZA 2K7BA 2KFHA 2ZRSA 3TDZA 2RGIA 5GQQC 4MRYA 3O2PA 1GGZA 2L50A 1KK8C 1XFVO 1QATA 1QV0A 3KHEA 1KK7Z 1DJHA 2FCEA 2NLNA 3SJSA 4MEWA 2LUCA 4ZCVA 3WNXB 1XFYO 1CLMA 4HREE 5K89A 4GAOA 1QX5B 1J55A 2JOJA 4GGNA 3BYAA 1K9UA 1N65A 1SCMB 3QRXA 3I5GB 4BY4A 5CSFA 1C7WA 2KOTA 1MWNA 3LLEA 1JSAA 4YBHB 1CDLA 4JQ0D 2NCOA 4PE0A 1R6PA 1RJVA 3EKHA 1CDMA 2CTNA 2F3YA 5ER4X 1IRJA 2LNKA 1KWOB 1MUXA 1XK4A 1LXFC 3BUXB 1A75B 1S6JA 1LKJA 3H4SE 3EVUA 4M2QA 2LMUA 1BT6A 3BUNB 1BODA 1OMVA 2PVBA 3HX4A 1CFCA 1IWQA 1CLLA 1IG5A 2KYCA 1UURA 1CMGA 2L51A 4PHJA 1L2OB 4XYNA 2BCAA 4L9MA 3TDIA 2CT9A 3CTNA 3EK8A 4JWQA 1YX7A 2KI6C 1ODBA 2MJWB 1UHKA 1YTZC 1F55A 1KFUL 4GNKB 3D10A 5I8NA 1DJWA 1DF0A 1XFUO 1ALWA 2R2IA 1DVIA 1DJZA 1JFKA 3M0WA 1TTXA 1WRLA 2AAOA 4GBAA 1XVJA 1CNPA 5HLOA 5B8IB 1IQ3A 1DT7B 2KI4C 1PK0D 1QIVA 4PE1A 1BJFA 2WNDA 1GQMA 4FQOA 4I5JA 3DVMA 1B47A 4NDDA 2JTZA 2NXQA 3LK0A 1KSOA 1ZUZA 2WC8A 1DGUA 5PALA 2JT3A 1G33A 3EK7A 4PCWA 2WORA 3BXKA 2PMYA 2KBMA 2ZN9A 3OHMB 2HQ8A 1CB1A 2M7LA 4MZKA 3CWGA 4PE7A 3GK1A 1QIWA 2BBMA 1BR1B 4ORCB 3IQQA 4DUQA 1RTP1 4WRIA 1TIZA 3TZ1A 3VRQA 2L98A 3NSKA 5ER5A 2Y5IA 3GK2A 1AJ5A 2O5GA 1A03A 3I5FC 2BBNA 2NZ0A 3VRRA 2BECA 1B4CA 2SCPA 1RFJA 1OMDA 1S6CA 1DTLA 2F8PA 2M0RA 1K90D 3AAJA 1QXPA 1BF5A 1OMRA 1SR6C 1V1GA 1NWDA 2H61C 2OTGC 3JTDC 2VRGA 1SR6B 2M97A 3CLNA 2FOTA 2I94A 1LINA 2AMIA 1CFFA 3JTDB 1OOJA 2G2BA 4I5LB 2JULA 2ZNEA 3HCMA 1NYAA 4ORAB 3RLZA 4GGFA 2F33A 1M63B 3BOWA 1WY9A 1SK6D 5DKQA 1F4OA 4NDCA 1GJYA 1SBJA 3DVEA 4PHKA 3AAKA 2WCFA 1JFJA 2KNEA 2LE9B 3AKAA 3FIAA 1SYMA 1AVSA 1UWOA 4TNCA 2M8UA 2LVJA 5D7FA 1OQPA 3DF0B 3OX6A 4MLWA 2PALA 3DVKA 2BL0C 2O60A 1OZSA 2JRFA 4C0JA 4AQIA 1W7IB 1KFXS 2GGMA 5HKWA 1RWYA 4PHNA 4GFTA 4M2OA 1Y0VH 2GV5A 1NX1A 1J7OA 2PSRA 2LHIA 2E6WA 1K94A 1YR5A 1PULA 2LMVA 1KFUS 1L7ZA 1YRUB 2F2OA 4U8DA 5AFPA 1SKTA 1KK8B 5BPJA 1MQ1A 1M31A 4P2YB 2E30A 1TNXA 2HETA 2KGRA 1EG4A 4UPGA 1Y1UA 3EVVA 5G08A 1XA5A 2MA2A 5I2LA 4CLNA 2JXCA 1TNQA 1CKKA 1JF0A 2MAZA 2HPSA 2JT0A 2NCPA 3PM8A 1QTXA 5JOLA 1KK7Y 2CNPA 2M3WA 2HF5A 1NSHA 4HRGA 5I2QA 5FYXA 1NX3A 2OS8C 1DJIA 2OS8B 2F2PA 2LLTA 4IL1A 5HYDA 1NPQA 4R1EA 3PALA 1F4QA 2I2RE 2L2EA 3GOFA 4USLA 2KYFA 2CBLA 1A75A 1KQMC 2K2AA 2LP3A 2P6BB 3D0YB 3I5HC 1EH2A 2ZKMX 3NSIA 1Y6WA 1KFXL 2I18A 4MVFA 1OE9B 1XK4C 3SG6A 1H4BA 4MN0A 5D69A 4JPZB 1VRKA 4PE4A 1YUUA 1SNLA 1QX2A 3C1VA 1DMOA 1BMOA 1S1EA 2K8MB 4F0ZB 3PN7C 1U5IB 4DRWA 1IH0A 3ZWHA 1ZMZA 1DJYA 3PN7B 3GK4X 4DCKA 1G4YR 1RROA 1RECA 2JPTA 3CR4X 1PSRA 1PRWA 2BE4A 4XJKB 4YGEB 1CFPA 2EHBA 1F8HA 2K7OA 4D1EA 2KI4B 1EG3A 1CM1A 1MF8B 2LAPA 1QVIZ 1S6IA 4HSZA 1QX7A 2LVVA 3SIAA 1GGWA 4ETOA 2MRDA 1YRTB 1SY9A 2KAYA 4I5KA 3CR5X 4MSPA 2CCMA 1ZACA 2LVKA 3KF9A 4YGBB 4MBEA 4CPVA 2M49B 3ZNIA 4YGDB 2V53A 1KCYA 3SG5A 1IKUA 1QS7A 2SASA 3LK1A 2JWWA 5AANA 2LP2A 4CIDA 3A8RA 1AJ4A 1QASA 1NCYA 2EC6C 1CDNA 1BOCA 1MHOA 3CS1A 1OZOA 3IQOA 2EC6B 5CSJA 2ISDA 3I5FB 2LUXA 2Y4QA 3WHUB 2CXJA 1B8LA 1EJ3A 4FTGA 5KTYA 4P5OE 2I7AA 2LHLA 1W7JB 1SCVA 1PVBA 2WOSA 5TNCA 1J1DA 4AOMA 2M1UA 2D8NA 2KBIA 2TN4A 5I2OA 1Y1XA 2OTGB 1NX2A 2M29A 3DVJA 1WDCC 3SG2A 3BUWB 2K61A 2KGBC 4PHMA 1S26D 2LANA 1JBAA 1Y1AA 3SG4A 1YUTA 1PSBA 3FWBA 2Q91A 3DD4A 2K7DA 5CPVA 1TRFA 1QLKA 3JVTC 3SG7A 3VGOA 2JXLA 1UHIA 1FI6A 2GGZA 1C7VA 4GGFC 3TS5C 1B7TZ 4ZCUA 2JC2A 1SMGA 2M7NA 5AEQA 1LA3A 4E68A 1UHJA 5HKZA 4ORBB 3TS5B 1NCZA 1B9AA 1NP8A 2BL0B 3WHTB 2WCBA 1FPWA 3RM1A 1SW8A 3TUYC 1V1FA 1A4PA 2KHNA 2LLUA 4YI8A 2KSPA 1IQ5A 1FI5A 1FF1A 3MSEB 2KAVA 3EVRA 2K2FA 3KPXA 1UUSA 2JNXA 4A4BA 1CDPA 1LVCD 2KFGA 2OPOA 1AUIB 3PFVA 1WRKA 3NSOA 2ZN8A 5CSNA 1NUBA 2ZNDA 3OB2B 1JUOA 1M45A 2FJUB 1XFXO 1M46A 2LM5A 5AERA 1SL7A 2L4HA 5AXIA 3K21A 1ZFSA 4OCIA 1HQVA 2M1KB 4CFRA 1F54A 1BG1A 2ZFDA 1CMFA 3E3RA 1ALVA 1XFZO 1MXEA 1N2DA 1SCMC 3I5GC 4MZJA 2L5XB 1XO5A 1IGVA 2JNFA 5HLVA 3FS7A 1EXRA 3EK4A 1CM4A 2QACA 1RK9A 4YI9A 1KQMB 1TOPA 3ICBA 3IF7A 3D0YA 1DGVA 4C0KA 3I5HB 2KAXA 1DJGA 2LC5A 2KI6D 1A2XA 1BU3A 1K95A 1KWOC 2HQWA 2Y1NA 4OR9B 2AUCA 4PDZA 1OSAA 1IJ6A 3SG3A 1F71A 2WCEA 1G8IA 4HRHA 1MXLC 4DS7A 4QJ5B 3BUMB 4AQJA 4QJ4B 1SRAA 1WLZA 5IBWA 1KQVA 1FBVA 1TNPA 1U5IA 2K7CA 1CFDA 1QJTA 1DJXA 1IJ5A 1L2OC 2COLB 1B8CA 1HT9A 2Y1MA 3NSLA 1K93D 3CGAA 4XJKA 1B1GA 2BCBA 2BE6A 3EKJA 4N1FA 5J3XA 4WQ3A 1K9KA 1DF0B 2KQ6A 1MR8A 1PALA 3AKBA 5HKYA 4NQGA 5F6TA 1WLMA 1C07A 4BY5A 3I5IC 1WRZA 2H2KA 1KSMA 2LV7A 3VRNA 1BR4B 3O6BA 3I5IB 1NIWA 3OB1B 2K0JA 2MLEC 1AP4A 3SIBA 2KDHA 1H8BA 1QLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPY A;  1ZOT B;  1N0Y A;  2G9B A;  1QVI Y;  5DKR A;  2BKH B;  1F70 A;  2KFF A;  2PAS A;  1AHR A;  1SL8 A;  3O78 A;  3CR2 A;  2PRU A;  2DOQ A;  4GUK A;  1QV1 A;  4MZL A;  2LVI A;  2JT8 A;  3PAT A;  2L4I A;  1XFW O;  3VRP A;  1YX8 A;  3KEV A;  4GPL B;  1K96 A;  5JJG A;  4YRU A;  1J7Q A;  1CLB A;  1X02 A;  2H61 A;  2IS9 A;  3LL8 B;  4DIR A;  4OV2 A;  3LCP C;  2BKI B;  1JF2 A;  1LA0 A;  1WDC B;  1YUS A;  4I5N B;  4N5X A;  5KSZ A;  1TN4 A;  1NX0 A;  1D1O A;  2JU0 A;  3OX5 A;  1S5G Z;  3WXA A;  1J1E A;  1S36 A;  3A4U B;  1J7R A;  3PSR A;  1BLQ A;  1M39 A;  4A4C A;  4QJ3 B;  3VRO A;  1UP5 A;  5DKN A;  2LLS A;  2JQ6 A;  2KQY A;  3JVT B;  1YVL A;  3BQ3 A;  2FCD A;  3KO0 A;  4ICB A;  4WQ2 A;  1J7P A;  1UHH A;  1PVA A;  3DF0 A;  4MRX A;  2M9G A;  2MBX A;  2BCX A;  1A29 A;  2B1U A;  4YGC B;  3BOW B;  1E8A A;  4NDB A;  2ZRT A;  2LMT A;  3FWC A;  2MHH A;  4PAL A;  2LCP A;  4OVN F;  4Q04 A;  1NCX A;  1AK8 A;  3TDU A;  4OKH A;  4N1G A;  1S5G Y;  4CFQ A;  3TUY B;  1R2U A;  1S3P A;  3OP0 A;  3BUO B;  1TCO B;  1CTR A;  1EL4 A;  3NXA A;  3PLF B;  2L0P A;  5CSI A;  1SL9 A;  2JZI A;  4M2P A;  1JC2 A;  2A4J A;  1K9P A;  1JWD A;  2Q4U A;  1K8U A;  3F45 A;  1B7T Y;  1YUR A;  3O4Y A;  1B8R A;  2QPT A;  1YVH A;  2JTT A;  1TCF A;  2MLF C;  1K2H A;  3CZT X;  4YGA A;  1Q80 A;  5KU1 A;  1TNW A;  2EGD A;  1XYD A;  1FW4 A;  4C0L A;  1UHN A;  2F3Z A;  2K7B A;  2KFH A;  2ZRS A;  3TDZ A;  2RGI A;  5GQQ C;  4MRY A;  3O2P A;  1GGZ A;  2L50 A;  1KK8 C;  1XFV O;  1QAT A;  1QV0 A;  3KHE A;  1KK7 Z;  1DJH A;  2FCE A;  2NLN A;  3SJS A;  4MEW A;  2LUC A;  4ZCV A;  3WNX B;  1XFY O;  1CLM A;  4HRE E;  5K89 A;  4GAO A;  1QX5 B;  1J55 A;  2JOJ A;  4GGN A;  3BYA A;  1K9U A;  1N65 A;  1SCM B;  3QRX A;  3I5G B;  4BY4 A;  5CSF A;  1C7W A;  2KOT A;  1MWN A;  3LLE A;  1JSA A;  4YBH B;  1CDL A;  4JQ0 D;  2NCO A;  4PE0 A;  1R6P A;  1RJV A;  3EKH A;  1CDM A;  2CTN A;  2F3Y A;  5ER4 X;  1IRJ A;  2LNK A;  1KWO B;  1MUX A;  1XK4 A;  1LXF C;  3BUX B;  1A75 B;  1S6J A;  1LKJ A;  3H4S E;  3EVU A;  4M2Q A;  2LMU A;  1BT6 A;  3BUN B;  1BOD A;  1OMV A;  2PVB A;  3HX4 A;  1CFC A;  1IWQ A;  1CLL A;  1IG5 A;  2KYC A;  1UUR A;  1CMG A;  2L51 A;  4PHJ A;  1L2O B;  4XYN A;  2BCA A;  4L9M A;  3TDI A;  2CT9 A;  3CTN A;  3EK8 A;  4JWQ A;  1YX7 A;  2KI6 C;  1ODB A;  2MJW B;  1UHK A;  1YTZ C;  1F55 A;  1KFU L;  4GNK B;  3D10 A;  5I8N A;  1DJW A;  1DF0 A;  1XFU O;  1ALW A;  2R2I A;  1DVI A;  1DJZ A;  1JFK A;  3M0W A;  1TTX A;  1WRL A;  2AAO A;  4GBA A;  1XVJ A;  1CNP A;  5HLO A;  5B8I B;  1IQ3 A;  1DT7 B;  2KI4 C;  1PK0 D;  1QIV A;  4PE1 A;  1BJF A;  2WND A;  1GQM A;  4FQO A;  4I5J A;  3DVM A;  1B47 A;  4NDD A;  2JTZ A;  2NXQ A;  3LK0 A;  1KSO A;  1ZUZ A;  2WC8 A;  1DGU A;  5PAL A;  2JT3 A;  1G33 A;  3EK7 A;  4PCW A;  2WOR A;  3BXK A;  2PMY A;  2KBM A;  2ZN9 A;  3OHM B;  2HQ8 A;  1CB1 A;  2M7L A;  4MZK A;  3CWG A;  4PE7 A;  3GK1 A;  1QIW A;  2BBM A;  1BR1 B;  4ORC B;  3IQQ A;  4DUQ A;  1RTP 1;  4WRI A;  1TIZ A;  3TZ1 A;  3VRQ A;  2L98 A;  3NSK A;  5ER5 A;  2Y5I A;  3GK2 A;  1AJ5 A;  2O5G A;  1A03 A;  3I5F C;  2BBN A;  2NZ0 A;  3VRR A;  2BEC A;  1B4C A;  2SCP A;  1RFJ A;  1OMD A;  1S6C A;  1DTL A;  2F8P A;  2M0R A;  1K90 D;  3AAJ A;  1QXP A;  1BF5 A;  1OMR A;  1SR6 C;  1V1G A;  1NWD A;  2H61 C;  2OTG C;  3JTD C;  2VRG A;  1SR6 B;  2M97 A;  3CLN A;  2FOT A;  2I94 A;  1LIN A;  2AMI A;  1CFF A;  3JTD B;  1OOJ A;  2G2B A;  4I5L B;  2JUL A;  2ZNE A;  3HCM A;  1NYA A;  4ORA B;  3RLZ A;  4GGF A;  2F33 A;  1M63 B;  3BOW A;  1WY9 A;  1SK6 D;  5DKQ A;  1F4O A;  4NDC A;  1GJY A;  1SBJ A;  3DVE A;  4PHK A;  3AAK A;  2WCF A;  1JFJ A;  2KNE A;  2LE9 B;  3AKA A;  3FIA A;  1SYM A;  1AVS A;  1UWO A;  4TNC A;  2M8U A;  2LVJ A;  5D7F A;  1OQP A;  3DF0 B;  3OX6 A;  4MLW A;  2PAL A;  3DVK A;  2BL0 C;  2O60 A;  1OZS A;  2JRF A;  4C0J A;  4AQI A;  1W7I B;  1KFX S;  2GGM A;  5HKW A;  1RWY A;  4PHN A;  4GFT A;  4M2O A;  1Y0V H;  2GV5 A;  1NX1 A;  1J7O A;  2PSR A;  2LHI A;  2E6W A;  1K94 A;  1YR5 A;  1PUL A;  2LMV A;  1KFU S;  1L7Z A;  1YRU B;  2F2O A;  4U8D A;  5AFP A;  1SKT A;  1KK8 B;  5BPJ A;  1MQ1 A;  1M31 A;  4P2Y B;  2E30 A;  1TNX A;  2HET A;  2KGR A;  1EG4 A;  4UPG A;  1Y1U A;  3EVV A;  5G08 A;  1XA5 A;  2MA2 A;  5I2L A;  4CLN A;  2JXC A;  1TNQ A;  1CKK A;  1JF0 A;  2MAZ A;  2HPS A;  2JT0 A;  2NCP A;  3PM8 A;  1QTX A;  5JOL A;  1KK7 Y;  2CNP A;  2M3W A;  2HF5 A;  1NSH A;  4HRG A;  5I2Q A;  5FYX A;  1NX3 A;  2OS8 C;  1DJI A;  2OS8 B;  2F2P A;  2LLT A;  4IL1 A;  5HYD A;  1NPQ A;  4R1E A;  3PAL A;  1F4Q A;  2I2R E;  2L2E A;  3GOF A;  4USL A;  2KYF A;  2CBL A;  1A75 A;  1KQM C;  2K2A A;  2LP3 A;  2P6B B;  3D0Y B;  3I5H C;  1EH2 A;  2ZKM X;  3NSI A;  1Y6W A;  1KFX L;  2I18 A;  4MVF A;  1OE9 B;  1XK4 C;  3SG6 A;  1H4B A;  4MN0 A;  5D69 A;  4JPZ B;  1VRK A;  4PE4 A;  1YUU A;  1SNL A;  1QX2 A;  3C1V A;  1DMO A;  1BMO A;  1S1E A;  2K8M B;  4F0Z B;  3PN7 C;  1U5I B;  4DRW A;  1IH0 A;  3ZWH A;  1ZMZ A;  1DJY A;  3PN7 B;  3GK4 X;  4DCK A;  1G4Y R;  1RRO A;  1REC A;  2JPT A;  3CR4 X;  1PSR A;  1PRW A;  2BE4 A;  4XJK B;  4YGE B;  1CFP A;  2EHB A;  1F8H A;  2K7O A;  4D1E A;  2KI4 B;  1EG3 A;  1CM1 A;  1MF8 B;  2LAP A;  1QVI Z;  1S6I A;  4HSZ A;  1QX7 A;  2LVV A;  3SIA A;  1GGW A;  4ETO A;  2MRD A;  1YRT B;  1SY9 A;  2KAY A;  4I5K A;  3CR5 X;  4MSP A;  2CCM A;  1ZAC A;  2LVK A;  3KF9 A;  4YGB B;  4MBE A;  4CPV A;  2M49 B;  3ZNI A;  4YGD B;  2V53 A;  1KCY A;  3SG5 A;  1IKU A;  1QS7 A;  2SAS A;  3LK1 A;  2JWW A;  5AAN A;  2LP2 A;  4CID A;  3A8R A;  1AJ4 A;  1QAS A;  1NCY A;  2EC6 C;  1CDN A;  1BOC A;  1MHO A;  3CS1 A;  1OZO A;  3IQO A;  2EC6 B;  5CSJ A;  2ISD A;  3I5F B;  2LUX A;  2Y4Q A;  3WHU B;  2CXJ A;  1B8L A;  1EJ3 A;  4FTG A;  5KTY A;  4P5O E;  2I7A A;  2LHL A;  1W7J B;  1SCV A;  1PVB A;  2WOS A;  5TNC A;  1J1D A;  4AOM A;  2M1U A;  2D8N A;  2KBI A;  2TN4 A;  5I2O A;  1Y1X A;  2OTG B;  1NX2 A;  2M29 A;  3DVJ A;  1WDC C;  3SG2 A;  3BUW B;  2K61 A;  2KGB C;  4PHM A;  1S26 D;  2LAN A;  1JBA A;  1Y1A A;  3SG4 A;  1YUT A;  1PSB A;  3FWB A;  2Q91 A;  3DD4 A;  2K7D A;  5CPV A;  1TRF A;  1QLK A;  3JVT C;  3SG7 A;  3VGO A;  2JXL A;  1UHI A;  1FI6 A;  2GGZ A;  1C7V A;  4GGF C;  3TS5 C;  1B7T Z;  4ZCU A;  2JC2 A;  1SMG A;  2M7N A;  5AEQ A;  1LA3 A;  4E68 A;  1UHJ A;  5HKZ A;  4ORB B;  3TS5 B;  1NCZ A;  1B9A A;  1NP8 A;  2BL0 B;  3WHT B;  2WCB A;  1FPW A;  3RM1 A;  1SW8 A;  3TUY C;  1V1F A;  1A4P A;  2KHN A;  2LLU A;  4YI8 A;  2KSP A;  1IQ5 A;  1FI5 A;  1FF1 A;  3MSE B;  2KAV A;  3EVR A;  2K2F A;  3KPX A;  1UUS A;  2JNX A;  4A4B A;  1CDP A;  1LVC D;  2KFG A;  2OPO A;  1AUI B;  3PFV A;  1WRK A;  3NSO A;  2ZN8 A;  5CSN A;  1NUB A;  2ZND A;  3OB2 B;  1JUO A;  1M45 A;  2FJU B;  1XFX O;  1M46 A;  2LM5 A;  5AER A;  1SL7 A;  2L4H A;  5AXI A;  3K21 A;  1ZFS A;  4OCI A;  1HQV A;  2M1K B;  4CFR A;  1F54 A;  1BG1 A;  2ZFD A;  1CMF A;  3E3R A;  1ALV A;  1XFZ O;  1MXE A;  1N2D A;  1SCM C;  3I5G C;  4MZJ A;  2L5X B;  1XO5 A;  1IGV A;  2JNF A;  5HLV A;  3FS7 A;  1EXR A;  3EK4 A;  1CM4 A;  2QAC A;  1RK9 A;  4YI9 A;  1KQM B;  1TOP A;  3ICB A;  3IF7 A;  3D0Y A;  1DGV A;  4C0K A;  3I5H B;  2KAX A;  1DJG A;  2LC5 A;  2KI6 D;  1A2X A;  1BU3 A;  1K95 A;  1KWO C;  2HQW A;  2Y1N A;  4OR9 B;  2AUC A;  4PDZ A;  1OSA A;  1IJ6 A;  3SG3 A;  1F71 A;  2WCE A;  1G8I A;  4HRH A;  1MXL C;  4DS7 A;  4QJ5 B;  3BUM B;  4AQJ A;  4QJ4 B;  1SRA A;  1WLZ A;  5IBW A;  1KQV A;  1FBV A;  1TNP A;  1U5I A;  2K7C A;  1CFD A;  1QJT A;  1DJX A;  1IJ5 A;  1L2O C;  2COL B;  1B8C A;  1HT9 A;  2Y1M A;  3NSL A;  1K93 D;  3CGA A;  4XJK A;  1B1G A;  2BCB A;  2BE6 A;  3EKJ A;  4N1F A;  5J3X A;  4WQ3 A;  1K9K A;  1DF0 B;  2KQ6 A;  1MR8 A;  1PAL A;  3AKB A;  5HKY A;  4NQG A;  5F6T A;  1WLM A;  1C07 A;  4BY5 A;  3I5I C;  1WRZ A;  2H2K A;  1KSM A;  2LV7 A;  3VRN A;  1BR4 B;  3O6B A;  3I5I B;  1NIW A;  3OB1 B;  2K0J A;  2MLE C;  1AP4 A;  3SIB A;  2KDH A;  1H8B A;  1QLS A; 
#chains in the Genus database with same CATH topology
 1SPY A;  1ZOT B;  1N0Y A;  2G9B A;  3BJH A;  1QVI Y;  5DKR A;  2BKH B;  1F70 A;  2KFF A;  2PAS A;  1AHR A;  1SL8 A;  3O78 A;  3CR2 A;  2PRU A;  2DOQ A;  4GUK A;  4JD9 A;  1QV1 A;  4MZL A;  2LVI A;  2JT8 A;  3PAT A;  2L4I A;  1XFW O;  3VRP A;  1YX8 A;  3KEV A;  4GPL B;  1K96 A;  3FE9 A;  5JJG A;  4YRU A;  1J7Q A;  1CLB A;  1X02 A;  3R1P A;  2H61 A;  2IS9 A;  3LL8 B;  4DIR A;  4OV2 A;  3LCP C;  2BKI B;  1JF2 A;  1LA0 A;  1WDC B;  1YUS A;  4I5N B;  4N5X A;  5KSZ A;  1TN4 A;  1NX0 A;  3B6X A;  4F7F A;  2JU0 A;  3OX5 A;  3DZT A;  1D1O A;  1S5G Z;  3WXA A;  1J1E A;  1S36 A;  2KPH A;  3A4U B;  1J7R A;  3PSR A;  1BLQ A;  1M39 A;  4A4C A;  2BAP A;  4QJ3 B;  3VRO A;  1UP5 A;  5DKN A;  2LLS A;  2JQ6 A;  2KQY A;  3JVT B;  1YVL A;  3BQ3 A;  2FCD A;  2L2C A;  3KO0 A;  4ICB A;  4WQ2 A;  1UHH A;  3BFB A;  1J7P A;  1PVA A;  3DF0 A;  3DY9 A;  2M9G A;  4MRX A;  2MBX A;  2K60 A;  2BCX A;  1A29 A;  2B1U A;  4YGC B;  3BOW B;  1E8A A;  4NDB A;  2ZRT A;  2LMT A;  2WCK A;  2MHH A;  3FWC A;  4PAL A;  2LCP A;  4OVN F;  4Q04 A;  1NCX A;  4IJ7 A;  3FE8 A;  1AK8 A;  3TDU A;  4OKH A;  4N1G A;  1S5G Y;  4CFQ A;  3TUY B;  1R2U A;  1S3P A;  3OP0 A;  3BUO B;  1TCO B;  1CTR A;  1EL4 A;  3NXA A;  2WCL A;  2L0P A;  3PLF B;  1SL9 A;  2JZI A;  4M2P A;  5CSI A;  1JC2 A;  2A4J A;  1K9P A;  1JWD A;  2Q4U A;  1K8U A;  3F45 A;  1B7T Y;  1YUR A;  3O4Y A;  1B8R A;  2QPT A;  1YVH A;  2JTT A;  1TCF A;  2MLF C;  1K2H A;  3CZT X;  3D78 A;  1Q80 A;  4YGA A;  5KU1 A;  5FI6 A;  1TNW A;  2WCH A;  3IVT A;  2EGD A;  1XYD A;  1FW4 A;  1XFR A;  1UHN A;  4C0L A;  2F3Z A;  2K7B A;  2KFH A;  2ZRS A;  2H8V A;  2RGI A;  5GQQ C;  4MRY A;  3O2P A;  3TDZ A;  1GGZ A;  2L50 A;  3PM2 A;  1KK8 C;  1XFV O;  1LS8 A;  1QAT A;  1QV0 A;  2GTE A;  3KHE A;  3SIB A;  1KK7 Z;  1DJH A;  2FCE A;  2NLN A;  3SJS A;  4MEW A;  2LUC A;  4ZCV A;  3WNX B;  1XFY O;  1CLM A;  4HRE E;  5K89 A;  3B86 A;  4GAO A;  1QX5 B;  1J55 A;  2JOJ A;  4GGN A;  3BFA A;  3BYA A;  1K9U A;  1N65 A;  1SCM B;  3QRX A;  3I5G B;  4BY4 A;  5CSF A;  1C7W A;  2KOT A;  1MWN A;  3LLE A;  1JSA A;  4YBH B;  1CDL A;  1OW4 A;  3QME A;  4JQ0 D;  2NCO A;  4PE0 A;  1R6P A;  3OGN A;  1RJV A;  3EKH A;  1CDM A;  2CTN A;  3BFH A;  2F3Y A;  5ER4 X;  1IRJ A;  4PT1 A;  2LNK A;  5EL2 A;  1KWO B;  1MUX A;  1XK4 A;  3S0B A;  1LXF C;  3BUX B;  1A75 B;  1S6J A;  1LKJ A;  3H4S E;  3EVU A;  3N7H A;  3PJI A;  4M2Q A;  2LMU A;  1BT6 A;  3BUN B;  1BOD A;  1OMV A;  2PVB A;  3HX4 A;  1CFC A;  1IWQ A;  1F8H A;  1CLL A;  1IG5 A;  2P70 A;  2KYC A;  1UUR A;  1CMG A;  2L51 A;  4PHJ A;  1L2O B;  4XYN A;  3D76 A;  2BCA A;  4L9M A;  3TDI A;  2CT9 A;  3CTN A;  3EK8 A;  4JWQ A;  1YX7 A;  2KI6 C;  1ODB A;  1QWV A;  2MJW B;  1UHK A;  2QDI A;  1YTZ C;  1F55 A;  1KFU L;  4GNK B;  3D10 A;  5I8N A;  1DJW A;  1DF0 A;  1XFU O;  1ALW A;  2R2I A;  1DVI A;  1DJZ A;  1JFK A;  2JPO A;  3M0W A;  1TTX A;  1WRL A;  2AAO A;  4GBA A;  1XVJ A;  1CNP A;  5HLO A;  5B8I B;  1IQ3 A;  1DT7 B;  1SSE B;  2KI4 C;  1PK0 D;  1QIV A;  4PE1 A;  3B7A A;  1BJF A;  2WND A;  1GQM A;  4FQO A;  4I5J A;  3DVM A;  1B47 A;  4NDD A;  2JTZ A;  2NXQ A;  2KLE A;  3LK0 A;  1KSO A;  1ZUZ A;  2WC8 A;  1DGU A;  5PAL A;  1TUZ A;  2JT3 A;  3RZS A;  1G33 A;  3EK7 A;  4PCW A;  2WOR A;  3BXK A;  2PMY A;  2KBM A;  2ZN9 A;  3OHM B;  2HQ8 A;  1CB1 A;  2M7L A;  4MZK A;  3CAB A;  1Z4H A;  3CWG A;  4PE7 A;  3GK1 A;  1QIW A;  2BBM A;  1BR1 B;  4ORC B;  3IQQ A;  4DUQ A;  1RTP 1;  4WRI A;  1TIZ A;  3TZ1 A;  3VRQ A;  2L98 A;  3NSK A;  5ER5 A;  2Y5I A;  3GK2 A;  1AJ5 A;  2O5G A;  2QEO A;  1A03 A;  3I5F C;  2BBN A;  2NZ0 A;  1IIO A;  3VRR A;  2BEC A;  1B4C A;  2SCP A;  1RFJ A;  1OMD A;  1S6C A;  1DTL A;  2F8P A;  2M0R A;  1K90 D;  3AAJ A;  3UNW A;  1QXP A;  1BF5 A;  1OMR A;  1SR6 C;  1V1G A;  3UO9 A;  1NWD A;  2H61 C;  2OTG C;  3JTD C;  2VRG A;  1SR6 B;  2M97 A;  3CLN A;  2FOT A;  2I94 A;  1LIN A;  2AMI A;  1CFF A;  3JTD B;  1OOJ A;  2G2B A;  4I5L B;  1TUJ A;  2JUL A;  2ZNE A;  3HCM A;  1NYA A;  4ORA B;  3RLZ A;  4GGF A;  2F33 A;  1M63 B;  3BOW A;  1WY9 A;  1SK6 D;  3DYE A;  3OBV A;  5DKQ A;  2QEH A;  1F4O A;  4NDC A;  1GJY A;  1SBJ A;  3DVE A;  4PHK A;  3AAK A;  2WCF A;  1JFJ A;  2KNE A;  2LE9 B;  3AKA A;  3FIA A;  3S0D A;  1P28 A;  1SYM A;  1AVS A;  1UWO A;  4TNC A;  2M8U A;  2LVJ A;  5D7F A;  2KLD A;  1OQP A;  3DF0 B;  3OX6 A;  4MLW A;  4FQT A;  2PAL A;  2PYQ A;  2WCJ A;  3DVK A;  2BL0 C;  2O60 A;  1OZS A;  2JRF A;  4C0J A;  2WC6 A;  4AQI A;  1W7I B;  1KFX S;  2GGM A;  5HKW A;  1RWY A;  4PHN A;  3CZ2 A;  4GFT A;  4INW A;  4M2O A;  1Y0V H;  2GV5 A;  1NX1 A;  1J7O A;  1OOI X;  2PSR A;  2LHI A;  2E6W A;  1K94 A;  1YR5 A;  1PUL A;  3R1O A;  1OOF A;  2LMV A;  1KFU S;  1L7Z A;  1YRU B;  2F2O A;  4U8D A;  5DIC A;  3V2L A;  3D77 A;  1SKT A;  1KK8 B;  5AFP A;  1C3Y A;  5BPJ A;  1MQ1 A;  1M31 A;  2PQL A;  4P2Y B;  2E30 A;  1TNX A;  2HET A;  2KGR A;  1EG4 A;  4UPG A;  2ERB A;  1Y1U A;  3EVV A;  3S0E A;  5G08 A;  1XA5 A;  2MA2 A;  5I2L A;  4CLN A;  3CZ1 A;  2JXC A;  3B88 A;  1TNQ A;  3D75 A;  2BNX A;  1CKK A;  1JF0 A;  2MAZ A;  2HPS A;  2JT0 A;  2NCP A;  3PM8 A;  3R72 A;  1QTX A;  5JOL A;  5I94 A;  1KK7 Y;  2CNP A;  2M3W A;  2HF5 A;  1NSH A;  4HRG A;  5I2Q A;  5FYX A;  1NX3 A;  2OS8 C;  1DJI A;  3S0G A;  2OS8 B;  2F2P A;  2LLT A;  4IL1 A;  5HYD A;  1NPQ A;  4R1E A;  3PAL A;  1F4Q A;  2I2R E;  2L2E A;  3GOF A;  4KYN A;  4USL A;  2KYF A;  2WCM A;  3K1E A;  2CBL A;  1A75 A;  1KQM C;  2K2A A;  2LP3 A;  4JKT A;  3SS4 A;  2P6B B;  3D0Y B;  3I5H C;  1EH2 A;  2ZKM X;  3NSI A;  1Y6W A;  1KFX L;  2I18 A;  4MVF A;  1OE9 B;  1XK4 C;  3SG6 A;  1H4B A;  4MN0 A;  5D69 A;  4JPZ B;  1VRK A;  4PE4 A;  1YUU A;  1SNL A;  1QX2 A;  3C1V A;  1DMO A;  1BMO A;  1S1E A;  1DQE A;  2K8M B;  4F0Z B;  3PN7 C;  1U5I B;  4DRW A;  3SS5 A;  1IH0 A;  3ZWH A;  1ZMZ A;  1DJY A;  3PN7 B;  3GK4 X;  4DCK A;  5FI2 A;  1G4Y R;  1RRO A;  1REC A;  2JPT A;  3CR4 X;  1PSR A;  1PRW A;  2BE4 A;  3NGV A;  4XJK B;  4YGE B;  2EHB A;  1CFP A;  2K7O A;  4D1E A;  2KI4 B;  1EG3 A;  1CM1 A;  1MF8 B;  5FI7 A;  2LAP A;  1QVI Z;  1S6I A;  2WC5 A;  1QX7 A;  2LVV A;  4HSZ A;  3SIA A;  1GGW A;  1W9Z A;  4ETO A;  2MRD A;  1YRT B;  1SY9 A;  2KAY A;  4I5K A;  3CR5 X;  4MSP A;  1TWO A;  2CCM A;  1ZAC A;  2LVK A;  1DEK A;  3KF9 A;  4YGB B;  4MBE A;  4CPV A;  2M49 B;  3ZNI A;  1Z2C B;  4YGD B;  2V53 A;  1KCY A;  3NHT A;  3L4A A;  1DC1 A;  3SG5 A;  1IKU A;  1QS7 A;  2SAS A;  3LK1 A;  2JWW A;  5AAN A;  2LP2 A;  4CID A;  3A8R A;  1AJ4 A;  1QAS A;  1NCY A;  2EC6 C;  1CDN A;  1BOC A;  1MHO A;  3CS1 A;  1OZO A;  3IQO A;  2EC6 B;  5CSJ A;  2ISD A;  3I5F B;  2LUX A;  2Y4Q A;  3D73 A;  3WHU B;  2CXJ A;  1B8L A;  1EJ3 A;  4FTG A;  5KTY A;  3CDN A;  2YGU A;  2I7A A;  2LHL A;  1W7J B;  1SCV A;  3D74 A;  4P5O E;  1PVB A;  2WOS A;  5TNC A;  1J1D A;  4AOM A;  2M1U A;  2D8N A;  2KBI A;  2TN4 A;  3SS3 A;  3B87 A;  5I2O A;  1Y1X A;  2OTG B;  1NX2 A;  2M29 A;  3DVJ A;  1WDC C;  3SG2 A;  3BUW B;  2K61 A;  3Q8I A;  2KGB C;  4PHM A;  1S26 D;  2LAN A;  3CZ0 A;  1JBA A;  1Y1A A;  3SG4 A;  2QEV A;  1YUT A;  1PSB A;  3FWB A;  2Q91 A;  3DD4 A;  2K7D A;  5CPV A;  1TRF A;  1QLK A;  3JVT C;  3SG7 A;  3VGO A;  2JXL A;  2QEB A;  1UHI A;  1FI6 A;  2GGZ A;  1C7V A;  4GGF C;  3TS5 C;  1B7T Z;  4ZCU A;  2JC2 A;  1SMG A;  2M7N A;  5AEQ A;  1LA3 A;  4E68 A;  1UHJ A;  5HKZ A;  4ORB B;  3TS5 B;  3VB1 A;  1NCZ A;  1B9A A;  1NP8 A;  2BL0 B;  3WHT B;  2WCB A;  1FPW A;  3RM1 A;  1SW8 A;  3TUY C;  1V1F A;  1A4P A;  1T14 A;  2KHN A;  2LLU A;  4YI8 A;  2KSP A;  1IQ5 A;  1FI5 A;  1FF1 A;  3MSE B;  2KAV A;  3EVR A;  2K2F A;  3KPX A;  1UUS A;  2JNX A;  3FE6 A;  4A4B A;  1CDP A;  1LVC D;  2KFG A;  2OPO A;  1AUI B;  3PFV A;  1WRK A;  3NSO A;  2ZN8 A;  5CSN A;  1NUB A;  2ZND A;  3OB2 B;  1JUO A;  3L4L A;  1M45 A;  2FJU B;  1XFX O;  5HL1 A;  1M46 A;  3S0F A;  2LM5 A;  1GM0 A;  5AER A;  1SL7 A;  2L4H A;  5AXI A;  3K21 A;  1ZFS A;  3DXL A;  4OCI A;  1HQV A;  1C3Z A;  2M1K B;  4CFR A;  1F54 A;  1BG1 A;  2ZFD A;  1CMF A;  3E3R A;  3NHI A;  3R1V A;  1ALV A;  1XFZ O;  1MXE A;  1N2D A;  3CYZ A;  1SCM C;  3I5G C;  4MZJ A;  2L5X B;  1XO5 A;  1IGV A;  2JNF A;  2P71 A;  2L5Y A;  5HLV A;  3FS7 A;  5D3O A;  1EXR A;  3EK4 A;  1CM4 A;  2QAC A;  1RK9 A;  4YI9 A;  1KQM B;  2FJY A;  1TOP A;  3ICB A;  3IF7 A;  3D0Y A;  1DGV A;  4C0K A;  3I5H B;  2KAX A;  1DJG A;  2LC5 A;  2KI6 D;  4OZD A;  1A2X A;  1BU3 A;  1K95 A;  3L47 A;  1KWO C;  2HQW A;  2Y1N A;  4OR9 B;  2AUC A;  4PDZ A;  1OSA A;  1IJ6 A;  3SG3 A;  1F71 A;  2WCE A;  1G8I A;  4HRH A;  1MXL C;  3S0A A;  4DS7 A;  4QJ5 B;  3BUM B;  4AQJ A;  4QJ4 B;  1SRA A;  1WLZ A;  5IBW A;  1KQV A;  1DEL A;  1FBV A;  1TNP A;  1U5I A;  2K7C A;  4INX A;  1CFD A;  1QJT A;  1DJX A;  1IJ5 A;  1L2O C;  2COL B;  1B8C A;  1HT9 A;  2Y1M A;  3NSL A;  1K93 D;  3CGA A;  4XJK A;  1B1G A;  2BCB A;  2BE6 A;  3EKJ A;  3O4X A;  4N1F A;  5J3X A;  4WQ3 A;  1K9K A;  1OOH A;  1DF0 B;  2KQ6 A;  1MR8 A;  1PAL A;  3AKB A;  5HKY A;  4NQG A;  5F6T A;  1WLM A;  1C07 A;  3EG5 B;  4BY5 A;  3I5I C;  1WRZ A;  2H2K A;  1KSM A;  2LV7 A;  3VRN A;  1BR4 B;  3O6B A;  1ORG A;  3I5I B;  1NIW A;  3OB1 B;  2K0J A;  2MLE C;  1AP4 A;  1OOG A;  2KDH A;  1H8B A;  1QLS A; 
#chains in the Genus database with same CATH homology
 1SPY A;  1ZOT B;  1N0Y A;  2G9B A;  1QVI Y;  5DKR A;  2BKH B;  1F70 A;  2KFF A;  2PAS A;  1AHR A;  1SL8 A;  3O78 A;  3CR2 A;  2PRU A;  2DOQ A;  4GUK A;  1QV1 A;  4MZL A;  2LVI A;  2JT8 A;  3PAT A;  2L4I A;  1XFW O;  3VRP A;  1YX8 A;  3KEV A;  4GPL B;  1K96 A;  5JJG A;  4YRU A;  1J7Q A;  1CLB A;  1X02 A;  2H61 A;  2IS9 A;  3LL8 B;  4DIR A;  4OV2 A;  3LCP C;  2BKI B;  1JF2 A;  1LA0 A;  1WDC B;  1YUS A;  4I5N B;  4N5X A;  5KSZ A;  1TN4 A;  1NX0 A;  1D1O A;  2JU0 A;  3OX5 A;  1S5G Z;  3WXA A;  1J1E A;  1S36 A;  3A4U B;  1J7R A;  3PSR A;  1BLQ A;  1M39 A;  4A4C A;  4QJ3 B;  3VRO A;  1UP5 A;  5DKN A;  2LLS A;  2JQ6 A;  2KQY A;  3JVT B;  1YVL A;  3BQ3 A;  2FCD A;  3KO0 A;  4ICB A;  4WQ2 A;  1J7P A;  1UHH A;  1PVA A;  3DF0 A;  4MRX A;  2M9G A;  2MBX A;  2BCX A;  1A29 A;  2B1U A;  4YGC B;  3BOW B;  1E8A A;  4NDB A;  2ZRT A;  2LMT A;  3FWC A;  2MHH A;  4PAL A;  2LCP A;  4OVN F;  4Q04 A;  1NCX A;  1AK8 A;  3TDU A;  4OKH A;  4N1G A;  1S5G Y;  4CFQ A;  3TUY B;  1R2U A;  1S3P A;  3OP0 A;  3BUO B;  1TCO B;  1CTR A;  1EL4 A;  3NXA A;  3PLF B;  2L0P A;  5CSI A;  1SL9 A;  2JZI A;  4M2P A;  1JC2 A;  2A4J A;  1K9P A;  1JWD A;  2Q4U A;  1K8U A;  3F45 A;  1B7T Y;  1YUR A;  3O4Y A;  1B8R A;  2QPT A;  1YVH A;  2JTT A;  1TCF A;  2MLF C;  1K2H A;  3CZT X;  4YGA A;  1Q80 A;  5KU1 A;  1TNW A;  2EGD A;  1XYD A;  1FW4 A;  4C0L A;  1UHN A;  2F3Z A;  2K7B A;  2KFH A;  2ZRS A;  3TDZ A;  2RGI A;  5GQQ C;  4MRY A;  3O2P A;  1GGZ A;  2L50 A;  1KK8 C;  1XFV O;  1QAT A;  1QV0 A;  3KHE A;  1KK7 Z;  1DJH A;  2FCE A;  2NLN A;  3SJS A;  4MEW A;  2LUC A;  4ZCV A;  3WNX B;  1XFY O;  1CLM A;  4HRE E;  5K89 A;  4GAO A;  1QX5 B;  1J55 A;  2JOJ A;  4GGN A;  3BYA A;  1K9U A;  1N65 A;  1SCM B;  3QRX A;  3I5G B;  4BY4 A;  5CSF A;  1C7W A;  2KOT A;  1MWN A;  3LLE A;  1JSA A;  4YBH B;  1CDL A;  4JQ0 D;  2NCO A;  4PE0 A;  1R6P A;  1RJV A;  3EKH A;  1CDM A;  2CTN A;  2F3Y A;  5ER4 X;  1IRJ A;  2LNK A;  1KWO B;  1MUX A;  1XK4 A;  1LXF C;  3BUX B;  1A75 B;  1S6J A;  1LKJ A;  3H4S E;  3EVU A;  4M2Q A;  2LMU A;  1BT6 A;  3BUN B;  1BOD A;  1OMV A;  2PVB A;  3HX4 A;  1CFC A;  1IWQ A;  1CLL A;  1IG5 A;  2KYC A;  1UUR A;  1CMG A;  2L51 A;  4PHJ A;  1L2O B;  4XYN A;  2BCA A;  4L9M A;  3TDI A;  2CT9 A;  3CTN A;  3EK8 A;  4JWQ A;  1YX7 A;  2KI6 C;  1ODB A;  2MJW B;  1UHK A;  1YTZ C;  1F55 A;  1KFU L;  4GNK B;  3D10 A;  5I8N A;  1DJW A;  1DF0 A;  1XFU O;  1ALW A;  2R2I A;  1DVI A;  1DJZ A;  1JFK A;  3M0W A;  1TTX A;  1WRL A;  2AAO A;  4GBA A;  1XVJ A;  1CNP A;  5HLO A;  5B8I B;  1IQ3 A;  1DT7 B;  2KI4 C;  1PK0 D;  1QIV A;  4PE1 A;  1BJF A;  2WND A;  1GQM A;  4FQO A;  4I5J A;  3DVM A;  1B47 A;  4NDD A;  2JTZ A;  2NXQ A;  3LK0 A;  1KSO A;  1ZUZ A;  2WC8 A;  1DGU A;  5PAL A;  2JT3 A;  1G33 A;  3EK7 A;  4PCW A;  2WOR A;  3BXK A;  2PMY A;  2KBM A;  2ZN9 A;  3OHM B;  2HQ8 A;  1CB1 A;  2M7L A;  4MZK A;  3CWG A;  4PE7 A;  3GK1 A;  1QIW A;  2BBM A;  1BR1 B;  4ORC B;  3IQQ A;  4DUQ A;  1RTP 1;  4WRI A;  1TIZ A;  3TZ1 A;  3VRQ A;  2L98 A;  3NSK A;  5ER5 A;  2Y5I A;  3GK2 A;  1AJ5 A;  2O5G A;  1A03 A;  3I5F C;  2BBN A;  2NZ0 A;  3VRR A;  2BEC A;  1B4C A;  2SCP A;  1RFJ A;  1OMD A;  1S6C A;  1DTL A;  2F8P A;  2M0R A;  1K90 D;  3AAJ A;  1QXP A;  1BF5 A;  1OMR A;  1SR6 C;  1V1G A;  1NWD A;  2H61 C;  2OTG C;  3JTD C;  2VRG A;  1SR6 B;  2M97 A;  3CLN A;  2FOT A;  2I94 A;  1LIN A;  2AMI A;  1CFF A;  3JTD B;  1OOJ A;  2G2B A;  4I5L B;  2JUL A;  2ZNE A;  3HCM A;  1NYA A;  4ORA B;  3RLZ A;  4GGF A;  2F33 A;  1M63 B;  3BOW A;  1WY9 A;  1SK6 D;  5DKQ A;  1F4O A;  4NDC A;  1GJY A;  1SBJ A;  3DVE A;  4PHK A;  3AAK A;  2WCF A;  1JFJ A;  2KNE A;  2LE9 B;  3AKA A;  3FIA A;  1SYM A;  1AVS A;  1UWO A;  4TNC A;  2M8U A;  2LVJ A;  5D7F A;  1OQP A;  3DF0 B;  3OX6 A;  4MLW A;  2PAL A;  3DVK A;  2BL0 C;  2O60 A;  1OZS A;  2JRF A;  4C0J A;  4AQI A;  1W7I B;  1KFX S;  2GGM A;  5HKW A;  1RWY A;  4PHN A;  4GFT A;  4M2O A;  1Y0V H;  2GV5 A;  1NX1 A;  1J7O A;  2PSR A;  2LHI A;  2E6W A;  1K94 A;  1YR5 A;  1PUL A;  2LMV A;  1KFU S;  1L7Z A;  1YRU B;  2F2O A;  4U8D A;  5AFP A;  1SKT A;  1KK8 B;  5BPJ A;  1MQ1 A;  1M31 A;  4P2Y B;  2E30 A;  1TNX A;  2HET A;  2KGR A;  1EG4 A;  4UPG A;  1Y1U A;  3EVV A;  5G08 A;  1XA5 A;  2MA2 A;  5I2L A;  4CLN A;  2JXC A;  1TNQ A;  1CKK A;  1JF0 A;  2MAZ A;  2HPS A;  2JT0 A;  2NCP A;  3PM8 A;  1QTX A;  5JOL A;  1KK7 Y;  2CNP A;  2M3W A;  2HF5 A;  1NSH A;  4HRG A;  5I2Q A;  5FYX A;  1NX3 A;  2OS8 C;  1DJI A;  2OS8 B;  2F2P A;  2LLT A;  4IL1 A;  5HYD A;  1NPQ A;  4R1E A;  3PAL A;  1F4Q A;  2I2R E;  2L2E A;  3GOF A;  4USL A;  2KYF A;  2CBL A;  1A75 A;  1KQM C;  2K2A A;  2LP3 A;  2P6B B;  3D0Y B;  3I5H C;  1EH2 A;  2ZKM X;  3NSI A;  1Y6W A;  1KFX L;  2I18 A;  4MVF A;  1OE9 B;  1XK4 C;  3SG6 A;  1H4B A;  4MN0 A;  5D69 A;  4JPZ B;  1VRK A;  4PE4 A;  1YUU A;  1SNL A;  1QX2 A;  3C1V A;  1DMO A;  1BMO A;  1S1E A;  2K8M B;  4F0Z B;  3PN7 C;  1U5I B;  4DRW A;  1IH0 A;  3ZWH A;  1ZMZ A;  1DJY A;  3PN7 B;  3GK4 X;  4DCK A;  1G4Y R;  1RRO A;  1REC A;  2JPT A;  3CR4 X;  1PSR A;  1PRW A;  2BE4 A;  4XJK B;  4YGE B;  1CFP A;  2EHB A;  1F8H A;  2K7O A;  4D1E A;  2KI4 B;  1EG3 A;  1CM1 A;  1MF8 B;  2LAP A;  1QVI Z;  1S6I A;  4HSZ A;  1QX7 A;  2LVV A;  3SIA A;  1GGW A;  4ETO A;  2MRD A;  1YRT B;  1SY9 A;  2KAY A;  4I5K A;  3CR5 X;  4MSP A;  2CCM A;  1ZAC A;  2LVK A;  3KF9 A;  4YGB B;  4MBE A;  4CPV A;  2M49 B;  3ZNI A;  4YGD B;  2V53 A;  1KCY A;  3SG5 A;  1IKU A;  1QS7 A;  2SAS A;  3LK1 A;  2JWW A;  5AAN A;  2LP2 A;  4CID A;  3A8R A;  1AJ4 A;  1QAS A;  1NCY A;  2EC6 C;  1CDN A;  1BOC A;  1MHO A;  3CS1 A;  1OZO A;  3IQO A;  2EC6 B;  5CSJ A;  2ISD A;  3I5F B;  2LUX A;  2Y4Q A;  3WHU B;  2CXJ A;  1B8L A;  1EJ3 A;  4FTG A;  5KTY A;  4P5O E;  2I7A A;  2LHL A;  1W7J B;  1SCV A;  1PVB A;  2WOS A;  5TNC A;  1J1D A;  4AOM A;  2M1U A;  2D8N A;  2KBI A;  2TN4 A;  5I2O A;  1Y1X A;  2OTG B;  1NX2 A;  2M29 A;  3DVJ A;  1WDC C;  3SG2 A;  3BUW B;  2K61 A;  2KGB C;  4PHM A;  1S26 D;  2LAN A;  1JBA A;  1Y1A A;  3SG4 A;  1YUT A;  1PSB A;  3FWB A;  2Q91 A;  3DD4 A;  2K7D A;  5CPV A;  1TRF A;  1QLK A;  3JVT C;  3SG7 A;  3VGO A;  2JXL A;  1UHI A;  1FI6 A;  2GGZ A;  1C7V A;  4GGF C;  3TS5 C;  1B7T Z;  4ZCU A;  2JC2 A;  1SMG A;  2M7N A;  5AEQ A;  1LA3 A;  4E68 A;  1UHJ A;  5HKZ A;  4ORB B;  3TS5 B;  1NCZ A;  1B9A A;  1NP8 A;  2BL0 B;  3WHT B;  2WCB A;  1FPW A;  3RM1 A;  1SW8 A;  3TUY C;  1V1F A;  1A4P A;  2KHN A;  2LLU A;  4YI8 A;  2KSP A;  1IQ5 A;  1FI5 A;  1FF1 A;  3MSE B;  2KAV A;  3EVR A;  2K2F A;  3KPX A;  1UUS A;  2JNX A;  4A4B A;  1CDP A;  1LVC D;  2KFG A;  2OPO A;  1AUI B;  3PFV A;  1WRK A;  3NSO A;  2ZN8 A;  5CSN A;  1NUB A;  2ZND A;  3OB2 B;  1JUO A;  1M45 A;  2FJU B;  1XFX O;  1M46 A;  2LM5 A;  5AER A;  1SL7 A;  2L4H A;  5AXI A;  3K21 A;  1ZFS A;  4OCI A;  1HQV A;  2M1K B;  4CFR A;  1F54 A;  1BG1 A;  2ZFD A;  1CMF A;  3E3R A;  1ALV A;  1XFZ O;  1MXE A;  1N2D A;  1SCM C;  3I5G C;  4MZJ A;  2L5X B;  1XO5 A;  1IGV A;  2JNF A;  5HLV A;  3FS7 A;  1EXR A;  3EK4 A;  1CM4 A;  2QAC A;  1RK9 A;  4YI9 A;  1KQM B;  1TOP A;  3ICB A;  3IF7 A;  3D0Y A;  1DGV A;  4C0K A;  3I5H B;  2KAX A;  1DJG A;  2LC5 A;  2KI6 D;  1A2X A;  1BU3 A;  1K95 A;  1KWO C;  2HQW A;  2Y1N A;  4OR9 B;  2AUC A;  4PDZ A;  1OSA A;  1IJ6 A;  3SG3 A;  1F71 A;  2WCE A;  1G8I A;  4HRH A;  1MXL C;  4DS7 A;  4QJ5 B;  3BUM B;  4AQJ A;  4QJ4 B;  1SRA A;  1WLZ A;  5IBW A;  1KQV A;  1FBV A;  1TNP A;  1U5I A;  2K7C A;  1CFD A;  1QJT A;  1DJX A;  1IJ5 A;  1L2O C;  2COL B;  1B8C A;  1HT9 A;  2Y1M A;  3NSL A;  1K93 D;  3CGA A;  4XJK A;  1B1G A;  2BCB A;  2BE6 A;  3EKJ A;  4N1F A;  5J3X A;  4WQ3 A;  1K9K A;  1DF0 B;  2KQ6 A;  1MR8 A;  1PAL A;  3AKB A;  5HKY A;  4NQG A;  5F6T A;  1WLM A;  1C07 A;  4BY5 A;  3I5I C;  1WRZ A;  2H2K A;  1KSM A;  2LV7 A;  3VRN A;  1BR4 B;  3O6B A;  3I5I B;  1NIW A;  3OB1 B;  2K0J A;  2MLE C;  1AP4 A;  3SIB A;  2KDH A;  1H8B A;  1QLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...