1KK8C

Scallop myosin (s1-adp-befx) in the actin-detached conformation
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
154
structure length
154
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin Heavy Chain, Striated muscle
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 48
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8C02
2LV7A 3IQQA 4OR9B 4ZCVA 1J1DA 3F45A 1B7TZ 1IQ5A 3VGOA 3CWGA 3KO0A 3WNXB 1MQ1A 2MA2A 1QIVA 4MEWA 2AMIA 3KPXA 3D0YA 3GK2A 3HCMA 4F0ZB 2LVIA 4IL1A 2NLNA 5D69A 3VRNA 5HKYA 1Y1XA 1NCZA 1F55A 4WQ2A 1ZUZA 2NCPA 4CPVA 4GFTA 3CR4X 3KF9A 1AUIB 3D0YB 3I5IB 1EG3A 1SKTA 1SW8A 2JZIA 1HQVA 2B1UA 1AJ5A 3CZTX 1U5IA 2Y1NA 1MHOA 1FI5A 2ZNEA 2BCXA 2L2EA 1U5IB 3IQOA 1PALA 5AXIA 5AFPA 2FJUB 2KBIA 4CFQA 2O60A 3OB2B 2E30A 2JTTA 1UP5A 2JXLA 1IJ5A 5HYDA 2LC5A 3IF7A 1DJWA 5GQQC 3PFVA 1DJXA 1IG5A 1QASA 4MZKA 1FW4A 1B8RA 1S6CA 1S5GZ 1BLQA 2L51A 2F3ZA 2JNXA 2JPTA 3CLNA 1Y0VH 2JT0A 2GGZA 5I8NA 1GJYA 1K96A 1S6JA 4GGFC 2MBXA 5AERA 1FBVA 1X02A 4USLA 1MXLC 2JT3A 4N5XA 3DVEA 1XO5A 2KI6C 1GQMA 2BL0C 3ICBA 1WRLA 4C0KA 2IS9A 4M2PA 1JFKA 2M3WA 3PN7B 1RWYA 5IBWA 1KCYA 4R1EA 3KHEA 2K7OA 1QTXA 5TNCA 2HF5A 2HQ8A 2BBNA 4C0LA 1RROA 3VRPA 2MAZA 2KDHA 2QACA 3O6BA 1XFVO 4OCIA 1DGVA 1Y1UA 1PVBA 4YI9A 1WLZA 1TNPA 1TTXA 1IH0A 3AAKA 2BKIB 1M45A 1CFFA 1XK4A 3SG7A 4OKHA 2OTGB 3TDUA 1BR4B 2MRDA 4I5KA 1M31A 1B1GA 1TIZA 4MSPA 1LVCD 2LMUA 2LUCA 2LP3A 1G8IA 1UHJA 1SL9A 1ALVA 2WNDA 3CGAA 5HLVA 4PE1A 1NSHA 3JTDC 5G08A 5ER5A 4DIRA 2AAOA 3GK1A 1YUUA 1PK0D 1DF0A 1GGWA 2FCDA 1NX0A 3FS7A 1QXPA 2EHBA 2L4IA 1YRUB 3LLEA 4I5JA 4QJ3B 3EVRA 2EC6B 1F8HA 2WORA 3NSLA 3PSRA 1S6IA 1DJHA 1QVIY 2F33A 3SIAA 3TUYB 1OMDA 4WRIA 2JNFA 2NZ0A 1SCVA 1B47A 1XFUO 1C07A 4YRUA 4HREE 1YUSA 4PHKA 1KWOB 4MN0A 2EC6C 1H4BA 2KQ6A 2VRGA 2BCAA 4OVNF 3TUYC 2BE4A 3SG6A 1BR1B 1A4PA 1LA3A 1K9UA 3OP0A 1LA0A 1AVSA 2CTNA 2MHHA 2NXQA 3CR5X 4PCWA 2L4HA 1QV0A 1MUXA 2LLTA 4Q04A 3C1VA 3TDZA 1KFUL 1PULA 1SCMB 2ZN8A 4QJ5B 1F4OA 4YGCB 3BOWB 5AEQA 4PE0A 1CDPA 3FWBA 1CMGA 2LHIA 4YI8A 5K89A 1K90D 5D7FA 1NX3A 1YX8A 1SCMC 1KFXL 3AAJA 2Y1MA 3BUXB 4MBEA 1V1FA 2JT8A 2KGBC 1D1OA 1YVHA 1NCYA 1K8UA 1BT6A 4XYNA 3CR2A 2KFHA 1DTLA 1QX5B 2JXCA 4YGBB 2KBMA 1TNWA 3BUOB 4PE4A 3EVVA 1SNLA 5F6TA 3ZNIA 2F2OA 2JQ6A 2K7DA 1QX2A 2Y5IA 1S1EA 1QATA 1ZACA 3O78A 2JRFA 2PVBA 1N0YA 4GUKA 5AANA 3PM8A 3I5GB 1OQPA 2K7CA 1JBAA 2M1UA 1YVLA 1TOPA 1DT7B 5KTYA 2KAVA 3I5IC 1JWDA 1NUBA 4E68A 1F4QA 3O4YA 1ZMZA 1MR8A 1Y1AA 2BE6A 2PALA 3I5GC 5JOLA 2KAYA 2M7LA 2V53A 4D1EA 1EL4A 3GK4X 4HRHA 3SG2A 4ICBA 2KFFA 1A29A 2RGIA 1K94A 2JU0A 2LNKA 2I18A 1IWQA 3NSKA 1BOCA 1XFWO 2JOJA 1FPWA 3WHTB 2LVVA 4HRGA 2LCPA 4QJ4B 3I5HB 5J3XA 1CDMA 1K95A 4M2QA 2H61A 1Q80A 1SRAA 1L2OB 1UURA 4ETOA 4JWQA 1XFXO 1CNPA 1M39A 4GPLB 2KSPA 1LINA 3VROA 1F71A 1KSMA 2ZFDA 1KQVA 1K9PA 1NX2A 1UHIA 3FIAA 1KK7Z 1LXFC 4TNCA 3M0WA 2L50A 1UHKA 2GV5A 1WRKA 1L2OC 2BCBA 2M9GA 2O5GA 4XJKA 3JVTB 1M46A 1ZOTB 1CFCA 5DKQA 1NCXA 5KU1A 2LHLA 1OMVA 1UHHA 2JWWA 1K93D 2ZRTA 3SG4A 4XJKB 1OZSA 4YGDB 4P2YB 1CFPA 3PN7C 4AQIA 3JVTC 1EXRA 2PRUA 1A2XA 1V1GA 1S36A 1SY9A 2BECA 2G9BA 2GGMA 4FTGA 3LL8B 1NYAA 1B4CA 4M2OA 5JJGA 1KK8B 2WCEA 5CSIA 5DKNA 2KYCA 2LLSA 3SJSA 1CLMA 1PRWA 2LAPA 4NDBA 2HPSA 1BU3A 2LANA 3SG5A 4JPZB 3TDIA 4CLNA 3LK1A 4NDCA 1PSBA 5HKZA 2OTGC 1IJ6A 1F70A 1K9KA 2KHNA 3BYAA 1RFJA 1AHRA 1XK4C 4MRYA 2K2FA 2PSRA 1CLBA 1DF0B 1AK8A 1CM1A 2MJWB 1GGZA 2G2BA 1RJVA 1N2DA 4YGAA 2WCBA 3OHMB 1XA5A 2LMVA 5CPVA 1C7WA 3OX6A 2KAXA 3VRQA 1KSOA 2FCEA 1BJFA 1ODBA 2F2PA 4GNKB 1RTP1 1PVAA 3I5FB 2K61A 4YGEB 4DRWA 2OS8B 3CS1A 1KQMB 2MLFC 2LMTA 2KYFA 1IQ3A 1KWOC 1CDLA 3BQ3A 3EKJA 5BPJA 3EVUA 3LCPC 2M1KB 4DS7A 1J7PA 1LKJA 1XFYO 1SPYA 2M8UA 3RM1A 1OMRA 1B7TY 2CXJA 1QVIZ 2LE9B 1CFDA 3DF0A 4ZCUA 4PALA 1J1EA 2KGRA 3KEVA 1RECA 1QLSA 1SBJA 2CBLA 3D10A 1TNQA 1UHNA 4I5LB 1BMOA 2JTZA 3DF0B 2ZNDA 3AKBA 1DJZA 1EH2A 2R2IA 2P6BB 1RK9A 4AQJA 1CMFA 2JC2A 1J7RA 1PSRA 2I94A 3H4SE 1NP8A 1TN4A 1EG4A 2BKHB 2LP2A 1DGUA 5I2LA 4MZLA 1QS7A 1NX1A 4AOMA 1UUSA 2PMYA 1C7VA 2I2RE 2KOTA 4PHNA 2LVKA 4L9MA 4GGNA 3PALA 4OV2A 4MRXA 1QIWA 2D8NA 3A8RA 2JULA 3QRXA 1MXEA 1OOJA 2LUXA 3BXKA 4CIDA 1DMOA 1FF1A 2Y4QA 1A75A 1NWDA 1SL8A 1JC2A 1SMGA 3BUMB 1DVIA 1JUOA 1SK6D 4PHMA 2CNPA 1YR5A 2Q4UA 4UPGA 4ORBB 2L98A 2LLUA 1A75B 1R2UA 2ZKMX 1YX7A 1NIWA 4ORAB 3ZWHA 2DOQA 1S5GY 1IGVA 2HETA 2PASA 2K7BA 3PLFB 1YUTA 2QPTA 5ER4X 1M63B 3NSOA 1BF5A 1W7JB 4FQOA 4A4CA 2M29A 5CSJA 1HT9A 1CDNA 3DVMA 5HKWA 1KK7Y 4A4BA 2H2KA 1FI6A 1Y6WA 5I2QA 1A03A 4GGFA 3I5HC 2ZRSA 4ORCB 4PHJA 1QV1A 1J55A 3EK4A 2H61C 3GOFA 2BL0B 1L7ZA 4YBHB 2HQWA 4JQ0D 4NDDA 3CTNA 2BBMA 2ZN9A 4DCKA 1CTRA 1TCFA 1VRKA 1J7QA 1B8LA 4GAOA 4MLWA 4P5OE 3WHUB 3E3RA 4NQGA 2L0PA 2OPOA 2K0JA 5HLOA 2TN4A 3DVKA 1EJ3A 2M7NA 1UWOA 1BODA 1NPQA 1TRFA 4U8DA 3BUWB 3NSIA 5DKRA 5B8IB 1B8CA 4MVFA 3OX5A 1F54A 4C0JA 2KNEA 2K8MB 5CSNA 4CFRA 4N1FA 2KI4B 1CLLA 3EKHA 4PDZA 1SL7A 1WRZA 2EGDA 1KK8C 1J7OA 1TCOB 1CB1A 3RLZA 1XYDA 2WC8A 4GBAA 4WQ3A 1H8BA 2L5XB 4HSZA 3EK8A 3TS5B 1R6PA 1DJYA 2LM5A 3JTDB 3VRRA 1IKUA 3O2PA 2KI6D 1WY9A 1WDCB 2KI4C 3NXAA 2FOTA 2CT9A 1JSAA 3A4UB 1S3PA 4PE7A 3TZ1A 2I7AA 1OZOA 3TS5C 2KFGA 1XVJA 2Q91A 5CSFA 2CCMA 1W7IB 1WDCC 2KQYA 3WXAA 1AP4A 4I5NB 1SYMA 2COLB 1K2HA 3DVJA 2MLEC 3MSEB 1JF0A 1OE9B 1KFUS 1BG1A 3EK7A 1E8AA 2M49B 1WLMA 1JFJA 4BY5A 3LK0A 3DD4A 5PALA 1S26D 1AJ4A 4DUQA 3I5FC 1G4YR 1OSAA 2WOSA 3SG3A 2OS8C 2AUCA 2LVJA 1IRJA 1KQMC 2SASA 1SR6B 1KFXS 1JF2A 1QJTA 1MWNA 2F8PA 1YURA 1ALWA 1DJGA 2F3YA 1TNXA 1N65A 3K21A 3BUNB 3AKAA 5KSZA 2K2AA 1MF8B 2WCFA 3HX4A 5FYXA 4BY4A 1DJIA 1ZFSA 3BOWA 1CKKA 2ISDA 3FWCA 1SR6C 1XFZO 1QLKA 4N1GA 2A4JA 1QX7A 4MZJA 3SIBA 1YTZC 1B9AA 2SCPA 1G33A 1YRTB 2E6WA 2M0RA 5I2OA 3OB1B 3PATA 2M97A 2NCOA 1CM4A
chains in the Genus database with same CATH superfamily
2KLEA 2LV7A 3BFAA 3IQQA 4OR9B 4ZCVA 1J1DA 3F45A 1B7TZ 1IQ5A 3VGOA 3CWGA 3KO0A 3WNXB 1MQ1A 2K60A 1QIVA 2MA2A 4MEWA 2AMIA 3KPXA 3D0YA 3GK2A 3S0BA 3HCMA 4F0ZB 2LVIA 4IL1A 3FE9A 2NLNA 5D69A 3VRNA 5HKYA 1Y1XA 1NCZA 1OOGA 1F55A 4WQ2A 1ZUZA 2NCPA 4CPVA 3NGVA 4GFTA 3CR4X 3KF9A 1AUIB 3D0YB 3I5IB 1EG3A 1SKTA 1SW8A 2JZIA 1HQVA 2B1UA 3K1EA 1AJ5A 3CZTX 4INXA 1U5IA 2Y1NA 1MHOA 2PYQA 1FI5A 3B87A 2ZNEA 2BCXA 2L2EA 1U5IB 3IQOA 3IVTA 2QEBA 1PALA 5AXIA 2QEOA 2FJUB 5AFPA 2KBIA 4CFQA 2O60A 3OB2B 2E30A 2JTTA 1UP5A 2JXLA 1IJ5A 3EG5B 3D77A 5HYDA 2LC5A 5HL1A 3IF7A 1DJWA 3DXLA 5GQQC 3PFVA 1W9ZA 1DJXA 4OZDA 1IG5A 1QASA 4MZKA 1FW4A 4PT1A 1B8RA 1S6CA 3V2LA 1S5GZ 1BLQA 2L51A 2F3ZA 2ERBA 2JNXA 2JPTA 3CLNA 1Y0VH 2JT0A 2GGZA 5I8NA 1GJYA 1K96A 1S6JA 4GGFC 2MBXA 5AERA 1FBVA 1X02A 4USLA 1MXLC 2JT3A 4N5XA 3DVEA 1XO5A 2KI6C 1GQMA 2WCHA 2BL0C 3ICBA 1WRLA 4C0KA 2IS9A 4M2PA 3DZTA 1JFKA 2M3WA 3PN7B 1RWYA 5IBWA 1KCYA 4R1EA 3KHEA 2K7OA 1QTXA 5TNCA 2HF5A 2HQ8A 2BBNA 4C0LA 3L4AA 3R1PA 1RROA 3VRPA 2MAZA 2KDHA 2QACA 3O6BA 1XFVO 4OCIA 1DGVA 1Y1UA 1PVBA 4YI9A 1WLZA 1TNPA 1TTXA 1IH0A 3AAKA 2BKIB 1M45A 1CFFA 1XK4A 3SG7A 3CYZA 2OTGB 4OKHA 3TDUA 1BR4B 2MRDA 4I5KA 1M31A 1Z2CB 1TIZA 1B1GA 4MSPA 1LVCD 2LMUA 2LUCA 2LP3A 2WCKA 1G8IA 1UHJA 1SL9A 1ALVA 2WNDA 3CGAA 5HLVA 4PE1A 1NSHA 3JTDC 5G08A 5ER5A 4DIRA 2AAOA 2YGUA 3GK1A 1YUUA 1PK0D 1DF0A 2P71A 1GGWA 2FCDA 5DICA 1NX0A 3FS7A 1QXPA 2EHBA 2L4IA 1YRUB 3LLEA 4I5JA 4QJ3B 3EVRA 2EC6B 1F8HA 2WORA 3NSLA 3PSRA 1S6IA 1DJHA 1QVIY 2F33A 3SIAA 3TUYB 1OMDA 4WRIA 2JNFA 2NZ0A 1SCVA 1B47A 1XFUO 1C07A 4YRUA 3CZ0A 4HREE 1YUSA 4PHKA 1KWOB 1Z4HA 4MN0A 2EC6C 1H4BA 2KQ6A 2VRGA 2BCAA 4OVNF 3TUYC 2BE4A 3SG6A 1BR1B 1A4PA 1LA3A 1K9UA 3OP0A 1LA0A 1AVSA 2CTNA 2MHHA 2NXQA 3CR5X 4PCWA 2FJYA 2L4HA 1QV0A 1MUXA 2LLTA 4Q04A 3C1VA 3TDZA 1KFUL 1PULA 1SCMB 2ZN8A 4QJ5B 1F4OA 4YGCB 3BOWB 3B86A 5AEQA 4PE0A 1CDPA 3FWBA 1CMGA 2LHIA 3DYEA 4YI8A 3CDNA 5K89A 1K90D 5D7FA 1NX3A 1YX8A 1SCMC 1KFXL 3AAJA 2Y1MA 3BUXB 4MBEA 1V1FA 2JT8A 2KGBC 1D1OA 1YVHA 1NCYA 1K8UA 1BT6A 4XYNA 3CR2A 2KFHA 1DTLA 3L47A 1QX5B 2JXCA 4YGBB 2KBMA 1TNWA 3BUOB 4PE4A 3EVVA 1SNLA 5F6TA 3ZNIA 2F2OA 2JQ6A 2K7DA 1QX2A 2Y5IA 1S1EA 1QATA 1ZACA 3O78A 2JRFA 2PVBA 1N0YA 4GUKA 1OOFA 3PM8A 5AANA 3I5GB 1OQPA 2K7CA 1JBAA 2M1UA 1YVLA 1TOPA 5FI2A 1DT7B 5KTYA 2KAVA 3I5IC 1JWDA 1NUBA 4E68A 1F4QA 2PQLA 3O4YA 2JPOA 1ZMZA 1MR8A 1Y1AA 2BE6A 2PALA 3I5GC 5JOLA 2KAYA 2M7LA 2V53A 4D1EA 1EL4A 3GK4X 4HRHA 3SG2A 4ICBA 2KFFA 1A29A 2RGIA 1K94A 2JU0A 2LNKA 1XFRA 2I18A 1IWQA 3BJHA 3NSKA 1BOCA 1C3ZA 1XFWO 2JOJA 1FPWA 3PM2A 2LVVA 3WHTB 4HRGA 2LCPA 4QJ4B 3I5HB 5J3XA 1CDMA 1K95A 4M2QA 2H61A 3NHIA 3D74A 1Q80A 1SRAA 1L2OB 1UURA 4ETOA 4JWQA 3SS3A 1XFXO 1CNPA 1TWOA 1M39A 4GPLB 2KSPA 1LINA 3VROA 3UNWA 1F71A 1KSMA 2ZFDA 3B88A 1K9PA 1NX2A 1UHIA 3FIAA 5I94A 1KQVA 1KK7Z 1DQEA 1LXFC 4TNCA 3M0WA 2L50A 1UHKA 2GV5A 1WRKA 1L2OC 2BCBA 2M9GA 2O5GA 4XJKA 3JVTB 1M46A 3CZ1A 1ZOTB 3OBVA 1CFCA 3S0DA 5DKQA 1NCXA 5KU1A 2LHLA 1OMVA 1UHHA 2JWWA 1K93D 2ZRTA 3SG4A 4XJKB 2QEHA 1OZSA 4YGDB 4P2YB 1CFPA 3PN7C 3DY9A 4AQIA 3JVTC 1EXRA 2PRUA 3NHTA 1A2XA 1V1GA 1S36A 1SY9A 2BECA 2G9BA 2GGMA 4FTGA 4F7FA 3LL8B 1NYAA 1B4CA 4M2OA 5JJGA 1KK8B 2WCEA 3N7HA 5CSIA 2KYCA 2LLSA 1ORGA 1CLMA 5DKNA 1PRWA 2LAPA 3SJSA 4NDBA 2HPSA 1BU3A 3D75A 2LANA 3SG5A 4JPZB 3TDIA 4CLNA 3LK1A 4NDCA 1PSBA 5HKZA 2OTGC 1IJ6A 1SSEB 1TUZA 3B7AA 1F70A 1K9KA 2KHNA 3BYAA 1RFJA 1AHRA 1XK4C 4MRYA 2K2FA 2PSRA 1CLBA 2WC6A 1DF0B 1AK8A 1CM1A 2MJWB 1GGZA 2G2BA 1RJVA 1N2DA 4YGAA 2WCBA 3OHMB 3S0EA 1XA5A 2LMVA 5CPVA 1C7WA 3OX6A 2KAXA 2KLDA 1IIOA 3VRQA 1KSOA 2FCEA 1BJFA 1ODBA 2F2PA 4GNKB 1RTP1 1PVAA 3I5FB 2K61A 4YGEB 4DRWA 2L5YA 2OS8B 3R1VA 3CS1A 1KQMB 2MLFC 2LMTA 3D78A 2KYFA 1IQ3A 1KWOC 1CDLA 3BQ3A 4JKTA 3EKJA 5BPJA 3EVUA 4FQTA 3LCPC 2M1KB 3D73A 4DS7A 1J7PA 1LKJA 1XFYO 1SPYA 2M8UA 3QMEA 3RM1A 1OMRA 1B7TY 2CXJA 1T14A 1QVIZ 2LE9B 1CFDA 2WC5A 3DF0A 4KYNA 4PALA 4ZCUA 1J1EA 2KGRA 3KEVA 1RECA 1QLSA 1SBJA 2CBLA 3D10A 3PJIA 1TNQA 1UHNA 3R1OA 4I5LB 1BMOA 2JTZA 3DF0B 2ZNDA 3AKBA 1DJZA 5EL2A 1EH2A 2R2IA 2P6BB 1RK9A 4AQJA 1P28A 1CMFA 2JC2A 2H8VA 1J7RA 1LS8A 1PSRA 2I94A 3H4SE 1NP8A 1TN4A 1EG4A 1OW4A 2BKHB 2LP2A 1DGUA 5I2LA 4MZLA 1QS7A 1NX1A 5FI7A 1UUSA 4AOMA 2PMYA 1C7VA 2I2RE 2KOTA 4PHNA 2LVKA 4L9MA 4GGNA 3PALA 4OV2A 1DEKA 4MRXA 1QIWA 2D8NA 3A8RA 3BFBA 2JULA 2L2CA 3QRXA 1MXEA 1OOJA 2LUXA 3BXKA 4JD9A 4CIDA 1DMOA 1FF1A 2Y4QA 1A75A 1NWDA 1SL8A 3R72A 1JC2A 1SMGA 3BUMB 1DVIA 1JUOA 1SK6D 4INWA 3OGNA 4PHMA 2CNPA 1YR5A 2Q4UA 4UPGA 4ORBB 2L98A 2LLUA 1A75B 1R2UA 2ZKMX 1YX7A 1DC1A 1NIWA 4ORAB 3Q8IA 3ZWHA 2DOQA 1S5GY 1IGVA 2HETA 2PASA 2K7BA 3PLFB 1YUTA 2QPTA 5ER4X 1M63B 3NSOA 1BF5A 1W7JB 3UO9A 4FQOA 1C3YA 4A4CA 1QWVA 1GM0A 2M29A 5CSJA 2WCLA 1HT9A 1CDNA 3DVMA 5HKWA 1KK7Y 4A4BA 2H2KA 3S0GA 2WCMA 1FI6A 1Y6WA 5I2QA 1A03A 4GGFA 3SS4A 3I5HC 2ZRSA 4ORCB 4PHJA 1QV1A 2GTEA 1J55A 3EK4A 3BFHA 3FE8A 2H61C 3GOFA 2BL0B 1L7ZA 4YBHB 2HQWA 4JQ0D 4NDDA 3CTNA 2BBMA 2ZN9A 4DCKA 1CTRA 1TCFA 3B6XA 1VRKA 1J7QA 1B8LA 4GAOA 4MLWA 4P5OE 4IJ7A 3WHUB 3E3RA 3L4LA 4NQGA 2L0PA 2OPOA 2K0JA 5HLOA 2TN4A 3DVKA 1EJ3A 2M7NA 1UWOA 1BODA 1NPQA 3D76A 1TRFA 4U8DA 3BUWB 3NSIA 5D3OA 5DKRA 5B8IB 2KPHA 1B8CA 4MVFA 3OX5A 1F54A 4C0JA 2KNEA 3FE6A 2K8MB 3CZ2A 5CSNA 4CFRA 4N1FA 2KI4B 1CLLA 3EKHA 3O4XA 4PDZA 1SL7A 3S0AA 1WRZA 2EGDA 1KK8C 1J7OA 1TCOB 1CB1A 3RLZA 1XYDA 2WC8A 4GBAA 4WQ3A 1H8BA 2L5XB 4HSZA 1OOIX 3EK8A 1R6PA 1DJYA 2LM5A 3JTDB 3TS5B 3VRRA 1IKUA 3O2PA 2KI6D 1WY9A 1WDCB 2KI4C 3NXAA 2FOTA 2QEVA 2CT9A 1JSAA 3A4UB 1S3PA 4PE7A 3TZ1A 2I7AA 1OZOA 3TS5C 2KFGA 1XVJA 2Q91A 5CSFA 3RZSA 2CCMA 1W7IB 1WDCC 2KQYA 2QDIA 5FI6A 3WXAA 4I5NB 1AP4A 1SYMA 2COLB 1K2HA 3CABA 3DVJA 2MLEC 3MSEB 1JF0A 1OE9B 1KFUS 3SS5A 3EK7A 1BG1A 1E8AA 2M49B 1WLMA 1JFJA 4BY5A 3LK0A 3DD4A 5PALA 1S26D 1AJ4A 4DUQA 3I5FC 1G4YR 1OSAA 2WOSA 3SG3A 2OS8C 2AUCA 2LVJA 1IRJA 1KQMC 2SASA 2WCJA 1SR6B 1KFXS 1JF2A 1QJTA 1MWNA 2F8PA 1YURA 1ALWA 1DJGA 2F3YA 1TNXA 1N65A 3K21A 3BUNB 3AKAA 3VB1A 5KSZA 2K2AA 1MF8B 2WCFA 2P70A 1OOHA 3HX4A 5FYXA 4BY4A 1DJIA 1ZFSA 1DELA 3BOWA 1CKKA 2ISDA 3FWCA 1SR6C 3S0FA 1XFZO 1QLKA 1TUJA 4N1GA 2A4JA 1QX7A 4MZJA 3SIBA 1YTZC 1B9AA 2BNXA 2SCPA 1G33A 1YRTB 2E6WA 2M0RA 2BAPA 5I2OA 3OB1B 3PATA 2M97A 2NCOA 1CM4A
chains in the Genus database with same CATH topology
2LV7A 3IQQA 4OR9B 4ZCVA 1J1DA 3F45A 1B7TZ 1IQ5A 3VGOA 3CWGA 3KO0A 3WNXB 1MQ1A 2MA2A 1QIVA 4MEWA 2AMIA 3KPXA 3D0YA 3GK2A 3HCMA 4F0ZB 2LVIA 4IL1A 2NLNA 5D69A 3VRNA 5HKYA 1Y1XA 1NCZA 1F55A 4WQ2A 1ZUZA 2NCPA 4CPVA 4GFTA 3CR4X 3KF9A 1AUIB 3D0YB 3I5IB 1EG3A 1SKTA 1SW8A 2JZIA 1HQVA 2B1UA 1AJ5A 3CZTX 1U5IA 2Y1NA 1MHOA 1FI5A 2ZNEA 2BCXA 2L2EA 1U5IB 3IQOA 1PALA 5AXIA 5AFPA 2FJUB 2KBIA 4CFQA 2O60A 3OB2B 2E30A 2JTTA 1UP5A 2JXLA 1IJ5A 5HYDA 2LC5A 3IF7A 1DJWA 5GQQC 3PFVA 1DJXA 1IG5A 1QASA 4MZKA 1FW4A 1B8RA 1S6CA 1S5GZ 1BLQA 2L51A 2F3ZA 2JNXA 2JPTA 3CLNA 1Y0VH 2JT0A 2GGZA 5I8NA 1GJYA 1K96A 1S6JA 4GGFC 2MBXA 5AERA 1FBVA 1X02A 4USLA 1MXLC 2JT3A 4N5XA 3DVEA 1XO5A 2KI6C 1GQMA 2BL0C 3ICBA 1WRLA 4C0KA 2IS9A 4M2PA 1JFKA 2M3WA 3PN7B 1RWYA 5IBWA 1KCYA 4R1EA 3KHEA 2K7OA 1QTXA 5TNCA 2HF5A 2HQ8A 2BBNA 4C0LA 1RROA 3VRPA 2MAZA 2KDHA 2QACA 3O6BA 1XFVO 4OCIA 1DGVA 1Y1UA 1PVBA 4YI9A 1WLZA 1TNPA 1TTXA 1IH0A 3AAKA 2BKIB 1M45A 1CFFA 1XK4A 3SG7A 4OKHA 2OTGB 3TDUA 1BR4B 2MRDA 4I5KA 1M31A 1B1GA 1TIZA 4MSPA 1LVCD 2LMUA 2LUCA 2LP3A 1G8IA 1UHJA 1SL9A 1ALVA 2WNDA 3CGAA 5HLVA 4PE1A 1NSHA 3JTDC 5G08A 5ER5A 4DIRA 2AAOA 3GK1A 1YUUA 1PK0D 1DF0A 1GGWA 2FCDA 1NX0A 3FS7A 1QXPA 2EHBA 2L4IA 1YRUB 3LLEA 4I5JA 4QJ3B 3EVRA 2EC6B 1F8HA 2WORA 3NSLA 3PSRA 1S6IA 1DJHA 1QVIY 2F33A 3SIAA 3TUYB 1OMDA 4WRIA 2JNFA 2NZ0A 1SCVA 1B47A 1XFUO 1C07A 4YRUA 4HREE 1YUSA 4PHKA 1KWOB 4MN0A 2EC6C 1H4BA 2KQ6A 2VRGA 2BCAA 4OVNF 3TUYC 2BE4A 3SG6A 1BR1B 1A4PA 1LA3A 1K9UA 3OP0A 1LA0A 1AVSA 2CTNA 2MHHA 2NXQA 3CR5X 4PCWA 2L4HA 1QV0A 1MUXA 2LLTA 4Q04A 3C1VA 3TDZA 1KFUL 1PULA 1SCMB 2ZN8A 4QJ5B 1F4OA 4YGCB 3BOWB 5AEQA 4PE0A 1CDPA 3FWBA 1CMGA 2LHIA 4YI8A 5K89A 1K90D 5D7FA 1NX3A 1YX8A 1SCMC 1KFXL 3AAJA 2Y1MA 3BUXB 4MBEA 1V1FA 2JT8A 2KGBC 1D1OA 1YVHA 1NCYA 1K8UA 1BT6A 4XYNA 3CR2A 2KFHA 1DTLA 1QX5B 2JXCA 4YGBB 2KBMA 1TNWA 3BUOB 4PE4A 3EVVA 1SNLA 5F6TA 3ZNIA 2F2OA 2JQ6A 2K7DA 1QX2A 2Y5IA 1S1EA 1QATA 1ZACA 3O78A 2JRFA 2PVBA 1N0YA 4GUKA 5AANA 3PM8A 3I5GB 1OQPA 2K7CA 1JBAA 2M1UA 1YVLA 1TOPA 1DT7B 5KTYA 2KAVA 3I5IC 1JWDA 1NUBA 4E68A 1F4QA 3O4YA 1ZMZA 1MR8A 1Y1AA 2BE6A 2PALA 3I5GC 5JOLA 2KAYA 2M7LA 2V53A 4D1EA 1EL4A 3GK4X 4HRHA 3SG2A 4ICBA 2KFFA 1A29A 2RGIA 1K94A 2JU0A 2LNKA 2I18A 1IWQA 3NSKA 1BOCA 1XFWO 2JOJA 1FPWA 3WHTB 2LVVA 4HRGA 2LCPA 4QJ4B 3I5HB 5J3XA 1CDMA 1K95A 4M2QA 2H61A 1Q80A 1SRAA 1L2OB 1UURA 4ETOA 4JWQA 1XFXO 1CNPA 1M39A 4GPLB 2KSPA 1LINA 3VROA 1F71A 1KSMA 2ZFDA 1KQVA 1K9PA 1NX2A 1UHIA 3FIAA 1KK7Z 1LXFC 4TNCA 3M0WA 2L50A 1UHKA 2GV5A 1WRKA 1L2OC 2BCBA 2M9GA 2O5GA 4XJKA 3JVTB 1M46A 1ZOTB 1CFCA 5DKQA 1NCXA 5KU1A 2LHLA 1OMVA 1UHHA 2JWWA 1K93D 2ZRTA 3SG4A 4XJKB 1OZSA 4YGDB 4P2YB 1CFPA 3PN7C 4AQIA 3JVTC 1EXRA 2PRUA 1A2XA 1V1GA 1S36A 1SY9A 2BECA 2G9BA 2GGMA 4FTGA 3LL8B 1NYAA 1B4CA 4M2OA 5JJGA 1KK8B 2WCEA 5CSIA 5DKNA 2KYCA 2LLSA 3SJSA 1CLMA 1PRWA 2LAPA 4NDBA 2HPSA 1BU3A 2LANA 3SG5A 4JPZB 3TDIA 4CLNA 3LK1A 4NDCA 1PSBA 5HKZA 2OTGC 1IJ6A 1F70A 1K9KA 2KHNA 3BYAA 1RFJA 1AHRA 1XK4C 4MRYA 2K2FA 2PSRA 1CLBA 1DF0B 1AK8A 1CM1A 2MJWB 1GGZA 2G2BA 1RJVA 1N2DA 4YGAA 2WCBA 3OHMB 1XA5A 2LMVA 5CPVA 1C7WA 3OX6A 2KAXA 3VRQA 1KSOA 2FCEA 1BJFA 1ODBA 2F2PA 4GNKB 1RTP1 1PVAA 3I5FB 2K61A 4YGEB 4DRWA 2OS8B 3CS1A 1KQMB 2MLFC 2LMTA 2KYFA 1IQ3A 1KWOC 1CDLA 3BQ3A 3EKJA 5BPJA 3EVUA 3LCPC 2M1KB 4DS7A 1J7PA 1LKJA 1XFYO 1SPYA 2M8UA 3RM1A 1OMRA 1B7TY 2CXJA 1QVIZ 2LE9B 1CFDA 3DF0A 4ZCUA 4PALA 1J1EA 2KGRA 3KEVA 1RECA 1QLSA 1SBJA 2CBLA 3D10A 1TNQA 1UHNA 4I5LB 1BMOA 2JTZA 3DF0B 2ZNDA 3AKBA 1DJZA 1EH2A 2R2IA 2P6BB 1RK9A 4AQJA 1CMFA 2JC2A 1J7RA 1PSRA 2I94A 3H4SE 1NP8A 1TN4A 1EG4A 2BKHB 2LP2A 1DGUA 5I2LA 4MZLA 1QS7A 1NX1A 4AOMA 1UUSA 2PMYA 1C7VA 2I2RE 2KOTA 4PHNA 2LVKA 4L9MA 4GGNA 3PALA 4OV2A 4MRXA 1QIWA 2D8NA 3A8RA 2JULA 3QRXA 1MXEA 1OOJA 2LUXA 3BXKA 4CIDA 1DMOA 1FF1A 2Y4QA 1A75A 1NWDA 1SL8A 1JC2A 1SMGA 3BUMB 1DVIA 1JUOA 1SK6D 4PHMA 2CNPA 1YR5A 2Q4UA 4UPGA 4ORBB 2L98A 2LLUA 1A75B 1R2UA 2ZKMX 1YX7A 1NIWA 4ORAB 3ZWHA 2DOQA 1S5GY 1IGVA 2HETA 2PASA 2K7BA 3PLFB 1YUTA 2QPTA 5ER4X 1M63B 3NSOA 1BF5A 1W7JB 4FQOA 4A4CA 2M29A 5CSJA 1HT9A 1CDNA 3DVMA 5HKWA 1KK7Y 4A4BA 2H2KA 1FI6A 1Y6WA 5I2QA 1A03A 4GGFA 3I5HC 2ZRSA 4ORCB 4PHJA 1QV1A 1J55A 3EK4A 2H61C 3GOFA 2BL0B 1L7ZA 4YBHB 2HQWA 4JQ0D 4NDDA 3CTNA 2BBMA 2ZN9A 4DCKA 1CTRA 1TCFA 1VRKA 1J7QA 1B8LA 4GAOA 4MLWA 4P5OE 3WHUB 3E3RA 4NQGA 2L0PA 2OPOA 2K0JA 5HLOA 2TN4A 3DVKA 1EJ3A 2M7NA 1UWOA 1BODA 1NPQA 1TRFA 4U8DA 3BUWB 3NSIA 5DKRA 5B8IB 1B8CA 4MVFA 3OX5A 1F54A 4C0JA 2KNEA 2K8MB 5CSNA 4CFRA 4N1FA 2KI4B 1CLLA 3EKHA 4PDZA 1SL7A 1WRZA 2EGDA 1KK8C 1J7OA 1TCOB 1CB1A 3RLZA 1XYDA 2WC8A 4GBAA 4WQ3A 1H8BA 2L5XB 4HSZA 3EK8A 3TS5B 1R6PA 1DJYA 2LM5A 3JTDB 3VRRA 1IKUA 3O2PA 2KI6D 1WY9A 1WDCB 2KI4C 3NXAA 2FOTA 2CT9A 1JSAA 3A4UB 1S3PA 4PE7A 3TZ1A 2I7AA 1OZOA 3TS5C 2KFGA 1XVJA 2Q91A 5CSFA 2CCMA 1W7IB 1WDCC 2KQYA 3WXAA 1AP4A 4I5NB 1SYMA 2COLB 1K2HA 3DVJA 2MLEC 3MSEB 1JF0A 1OE9B 1KFUS 1BG1A 3EK7A 1E8AA 2M49B 1WLMA 1JFJA 4BY5A 3LK0A 3DD4A 5PALA 1S26D 1AJ4A 4DUQA 3I5FC 1G4YR 1OSAA 2WOSA 3SG3A 2OS8C 2AUCA 2LVJA 1IRJA 1KQMC 2SASA 1SR6B 1KFXS 1JF2A 1QJTA 1MWNA 2F8PA 1YURA 1ALWA 1DJGA 2F3YA 1TNXA 1N65A 3K21A 3BUNB 3AKAA 5KSZA 2K2AA 1MF8B 2WCFA 3HX4A 5FYXA 4BY4A 1DJIA 1ZFSA 3BOWA 1CKKA 2ISDA 3FWCA 1SR6C 1XFZO 1QLKA 4N1GA 2A4JA 1QX7A 4MZJA 3SIBA 1YTZC 1B9AA 2SCPA 1G33A 1YRTB 2E6WA 2M0RA 5I2OA 3OB1B 3PATA 2M97A 2NCOA 1CM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LV7 A;  3IQQ A;  4OR9 B;  4ZCV A;  1J1D A;  3F45 A;  1B7T Z;  1IQ5 A;  3VGO A;  3CWG A;  3KO0 A;  3WNX B;  1MQ1 A;  2MA2 A;  1QIV A;  4MEW A;  2AMI A;  3KPX A;  3D0Y A;  3GK2 A;  3HCM A;  4F0Z B;  2LVI A;  4IL1 A;  2NLN A;  5D69 A;  3VRN A;  5HKY A;  1Y1X A;  1NCZ A;  1F55 A;  4WQ2 A;  1ZUZ A;  2NCP A;  4CPV A;  4GFT A;  3CR4 X;  3KF9 A;  1AUI B;  3D0Y B;  3I5I B;  1EG3 A;  1SKT A;  1SW8 A;  2JZI A;  1HQV A;  2B1U A;  1AJ5 A;  3CZT X;  1U5I A;  2Y1N A;  1MHO A;  1FI5 A;  2ZNE A;  2BCX A;  2L2E A;  1U5I B;  3IQO A;  1PAL A;  5AXI A;  5AFP A;  2FJU B;  2KBI A;  4CFQ A;  2O60 A;  3OB2 B;  2E30 A;  2JTT A;  1UP5 A;  2JXL A;  1IJ5 A;  5HYD A;  2LC5 A;  3IF7 A;  1DJW A;  5GQQ C;  3PFV A;  1DJX A;  1IG5 A;  1QAS A;  4MZK A;  1FW4 A;  1B8R A;  1S6C A;  1S5G Z;  1BLQ A;  2L51 A;  2F3Z A;  2JNX A;  2JPT A;  3CLN A;  1Y0V H;  2JT0 A;  2GGZ A;  5I8N A;  1GJY A;  1K96 A;  1S6J A;  4GGF C;  2MBX A;  5AER A;  1FBV A;  1X02 A;  4USL A;  1MXL C;  2JT3 A;  4N5X A;  3DVE A;  1XO5 A;  2KI6 C;  1GQM A;  2BL0 C;  3ICB A;  1WRL A;  4C0K A;  2IS9 A;  4M2P A;  1JFK A;  2M3W A;  3PN7 B;  1RWY A;  5IBW A;  1KCY A;  4R1E A;  3KHE A;  2K7O A;  1QTX A;  5TNC A;  2HF5 A;  2HQ8 A;  2BBN A;  4C0L A;  1RRO A;  3VRP A;  2MAZ A;  2KDH A;  2QAC A;  3O6B A;  1XFV O;  4OCI A;  1DGV A;  1Y1U A;  1PVB A;  4YI9 A;  1WLZ A;  1TNP A;  1TTX A;  1IH0 A;  3AAK A;  2BKI B;  1M45 A;  1CFF A;  1XK4 A;  3SG7 A;  4OKH A;  2OTG B;  3TDU A;  1BR4 B;  2MRD A;  4I5K A;  1M31 A;  1B1G A;  1TIZ A;  4MSP A;  1LVC D;  2LMU A;  2LUC A;  2LP3 A;  1G8I A;  1UHJ A;  1SL9 A;  1ALV A;  2WND A;  3CGA A;  5HLV A;  4PE1 A;  1NSH A;  3JTD C;  5G08 A;  5ER5 A;  4DIR A;  2AAO A;  3GK1 A;  1YUU A;  1PK0 D;  1DF0 A;  1GGW A;  2FCD A;  1NX0 A;  3FS7 A;  1QXP A;  2EHB A;  2L4I A;  1YRU B;  3LLE A;  4I5J A;  4QJ3 B;  3EVR A;  2EC6 B;  1F8H A;  2WOR A;  3NSL A;  3PSR A;  1S6I A;  1DJH A;  1QVI Y;  2F33 A;  3SIA A;  3TUY B;  1OMD A;  4WRI A;  2JNF A;  2NZ0 A;  1SCV A;  1B47 A;  1XFU O;  1C07 A;  4YRU A;  4HRE E;  1YUS A;  4PHK A;  1KWO B;  4MN0 A;  2EC6 C;  1H4B A;  2KQ6 A;  2VRG A;  2BCA A;  4OVN F;  3TUY C;  2BE4 A;  3SG6 A;  1BR1 B;  1A4P A;  1LA3 A;  1K9U A;  3OP0 A;  1LA0 A;  1AVS A;  2CTN A;  2MHH A;  2NXQ A;  3CR5 X;  4PCW A;  2L4H A;  1QV0 A;  1MUX A;  2LLT A;  4Q04 A;  3C1V A;  3TDZ A;  1KFU L;  1PUL A;  1SCM B;  2ZN8 A;  4QJ5 B;  1F4O A;  4YGC B;  3BOW B;  5AEQ A;  4PE0 A;  1CDP A;  3FWB A;  1CMG A;  2LHI A;  4YI8 A;  5K89 A;  1K90 D;  5D7F A;  1NX3 A;  1YX8 A;  1SCM C;  1KFX L;  3AAJ A;  2Y1M A;  3BUX B;  4MBE A;  1V1F A;  2JT8 A;  2KGB C;  1D1O A;  1YVH A;  1NCY A;  1K8U A;  1BT6 A;  4XYN A;  3CR2 A;  2KFH A;  1DTL A;  1QX5 B;  2JXC A;  4YGB B;  2KBM A;  1TNW A;  3BUO B;  4PE4 A;  3EVV A;  1SNL A;  5F6T A;  3ZNI A;  2F2O A;  2JQ6 A;  2K7D A;  1QX2 A;  2Y5I A;  1S1E A;  1QAT A;  1ZAC A;  3O78 A;  2JRF A;  2PVB A;  1N0Y A;  4GUK A;  5AAN A;  3PM8 A;  3I5G B;  1OQP A;  2K7C A;  1JBA A;  2M1U A;  1YVL A;  1TOP A;  1DT7 B;  5KTY A;  2KAV A;  3I5I C;  1JWD A;  1NUB A;  4E68 A;  1F4Q A;  3O4Y A;  1ZMZ A;  1MR8 A;  1Y1A A;  2BE6 A;  2PAL A;  3I5G C;  5JOL A;  2KAY A;  2M7L A;  2V53 A;  4D1E A;  1EL4 A;  3GK4 X;  4HRH A;  3SG2 A;  4ICB A;  2KFF A;  1A29 A;  2RGI A;  1K94 A;  2JU0 A;  2LNK A;  2I18 A;  1IWQ A;  3NSK A;  1BOC A;  1XFW O;  2JOJ A;  1FPW A;  3WHT B;  2LVV A;  4HRG A;  2LCP A;  4QJ4 B;  3I5H B;  5J3X A;  1CDM A;  1K95 A;  4M2Q A;  2H61 A;  1Q80 A;  1SRA A;  1L2O B;  1UUR A;  4ETO A;  4JWQ A;  1XFX O;  1CNP A;  1M39 A;  4GPL B;  2KSP A;  1LIN A;  3VRO A;  1F71 A;  1KSM A;  2ZFD A;  1KQV A;  1K9P A;  1NX2 A;  1UHI A;  3FIA A;  1KK7 Z;  1LXF C;  4TNC A;  3M0W A;  2L50 A;  1UHK A;  2GV5 A;  1WRK A;  1L2O C;  2BCB A;  2M9G A;  2O5G A;  4XJK A;  3JVT B;  1M46 A;  1ZOT B;  1CFC A;  5DKQ A;  1NCX A;  5KU1 A;  2LHL A;  1OMV A;  1UHH A;  2JWW A;  1K93 D;  2ZRT A;  3SG4 A;  4XJK B;  1OZS A;  4YGD B;  4P2Y B;  1CFP A;  3PN7 C;  4AQI A;  3JVT C;  1EXR A;  2PRU A;  1A2X A;  1V1G A;  1S36 A;  1SY9 A;  2BEC A;  2G9B A;  2GGM A;  4FTG A;  3LL8 B;  1NYA A;  1B4C A;  4M2O A;  5JJG A;  1KK8 B;  2WCE A;  5CSI A;  5DKN A;  2KYC A;  2LLS A;  3SJS A;  1CLM A;  1PRW A;  2LAP A;  4NDB A;  2HPS A;  1BU3 A;  2LAN A;  3SG5 A;  4JPZ B;  3TDI A;  4CLN A;  3LK1 A;  4NDC A;  1PSB A;  5HKZ A;  2OTG C;  1IJ6 A;  1F70 A;  1K9K A;  2KHN A;  3BYA A;  1RFJ A;  1AHR A;  1XK4 C;  4MRY A;  2K2F A;  2PSR A;  1CLB A;  1DF0 B;  1AK8 A;  1CM1 A;  2MJW B;  1GGZ A;  2G2B A;  1RJV A;  1N2D A;  4YGA A;  2WCB A;  3OHM B;  1XA5 A;  2LMV A;  5CPV A;  1C7W A;  3OX6 A;  2KAX A;  3VRQ A;  1KSO A;  2FCE A;  1BJF A;  1ODB A;  2F2P A;  4GNK B;  1RTP 1;  1PVA A;  3I5F B;  2K61 A;  4YGE B;  4DRW A;  2OS8 B;  3CS1 A;  1KQM B;  2MLF C;  2LMT A;  2KYF A;  1IQ3 A;  1KWO C;  1CDL A;  3BQ3 A;  3EKJ A;  5BPJ A;  3EVU A;  3LCP C;  2M1K B;  4DS7 A;  1J7P A;  1LKJ A;  1XFY O;  1SPY A;  2M8U A;  3RM1 A;  1OMR A;  1B7T Y;  2CXJ A;  1QVI Z;  2LE9 B;  1CFD A;  3DF0 A;  4ZCU A;  4PAL A;  1J1E A;  2KGR A;  3KEV A;  1REC A;  1QLS A;  1SBJ A;  2CBL A;  3D10 A;  1TNQ A;  1UHN A;  4I5L B;  1BMO A;  2JTZ A;  3DF0 B;  2ZND A;  3AKB A;  1DJZ A;  1EH2 A;  2R2I A;  2P6B B;  1RK9 A;  4AQJ A;  1CMF A;  2JC2 A;  1J7R A;  1PSR A;  2I94 A;  3H4S E;  1NP8 A;  1TN4 A;  1EG4 A;  2BKH B;  2LP2 A;  1DGU A;  5I2L A;  4MZL A;  1QS7 A;  1NX1 A;  4AOM A;  1UUS A;  2PMY A;  1C7V A;  2I2R E;  2KOT A;  4PHN A;  2LVK A;  4L9M A;  4GGN A;  3PAL A;  4OV2 A;  4MRX A;  1QIW A;  2D8N A;  3A8R A;  2JUL A;  3QRX A;  1MXE A;  1OOJ A;  2LUX A;  3BXK A;  4CID A;  1DMO A;  1FF1 A;  2Y4Q A;  1A75 A;  1NWD A;  1SL8 A;  1JC2 A;  1SMG A;  3BUM B;  1DVI A;  1JUO A;  1SK6 D;  4PHM A;  2CNP A;  1YR5 A;  2Q4U A;  4UPG A;  4ORB B;  2L98 A;  2LLU A;  1A75 B;  1R2U A;  2ZKM X;  1YX7 A;  1NIW A;  4ORA B;  3ZWH A;  2DOQ A;  1S5G Y;  1IGV A;  2HET A;  2PAS A;  2K7B A;  3PLF B;  1YUT A;  2QPT A;  5ER4 X;  1M63 B;  3NSO A;  1BF5 A;  1W7J B;  4FQO A;  4A4C A;  2M29 A;  5CSJ A;  1HT9 A;  1CDN A;  3DVM A;  5HKW A;  1KK7 Y;  4A4B A;  2H2K A;  1FI6 A;  1Y6W A;  5I2Q A;  1A03 A;  4GGF A;  3I5H C;  2ZRS A;  4ORC B;  4PHJ A;  1QV1 A;  1J55 A;  3EK4 A;  2H61 C;  3GOF A;  2BL0 B;  1L7Z A;  4YBH B;  2HQW A;  4JQ0 D;  4NDD A;  3CTN A;  2BBM A;  2ZN9 A;  4DCK A;  1CTR A;  1TCF A;  1VRK A;  1J7Q A;  1B8L A;  4GAO A;  4MLW A;  4P5O E;  3WHU B;  3E3R A;  4NQG A;  2L0P A;  2OPO A;  2K0J A;  5HLO A;  2TN4 A;  3DVK A;  1EJ3 A;  2M7N A;  1UWO A;  1BOD A;  1NPQ A;  1TRF A;  4U8D A;  3BUW B;  3NSI A;  5DKR A;  5B8I B;  1B8C A;  4MVF A;  3OX5 A;  1F54 A;  4C0J A;  2KNE A;  2K8M B;  5CSN A;  4CFR A;  4N1F A;  2KI4 B;  1CLL A;  3EKH A;  4PDZ A;  1SL7 A;  1WRZ A;  2EGD A;  1KK8 C;  1J7O A;  1TCO B;  1CB1 A;  3RLZ A;  1XYD A;  2WC8 A;  4GBA A;  4WQ3 A;  1H8B A;  2L5X B;  4HSZ A;  3EK8 A;  3TS5 B;  1R6P A;  1DJY A;  2LM5 A;  3JTD B;  3VRR A;  1IKU A;  3O2P A;  2KI6 D;  1WY9 A;  1WDC B;  2KI4 C;  3NXA A;  2FOT A;  2CT9 A;  1JSA A;  3A4U B;  1S3P A;  4PE7 A;  3TZ1 A;  2I7A A;  1OZO A;  3TS5 C;  2KFG A;  1XVJ A;  2Q91 A;  5CSF A;  2CCM A;  1W7I B;  1WDC C;  2KQY A;  3WXA A;  1AP4 A;  4I5N B;  1SYM A;  2COL B;  1K2H A;  3DVJ A;  2MLE C;  3MSE B;  1JF0 A;  1OE9 B;  1KFU S;  1BG1 A;  3EK7 A;  1E8A A;  2M49 B;  1WLM A;  1JFJ A;  4BY5 A;  3LK0 A;  3DD4 A;  5PAL A;  1S26 D;  1AJ4 A;  4DUQ A;  3I5F C;  1G4Y R;  1OSA A;  2WOS A;  3SG3 A;  2OS8 C;  2AUC A;  2LVJ A;  1IRJ A;  1KQM C;  2SAS A;  1SR6 B;  1KFX S;  1JF2 A;  1QJT A;  1MWN A;  2F8P A;  1YUR A;  1ALW A;  1DJG A;  2F3Y A;  1TNX A;  1N65 A;  3K21 A;  3BUN B;  3AKA A;  5KSZ A;  2K2A A;  1MF8 B;  2WCF A;  3HX4 A;  5FYX A;  4BY4 A;  1DJI A;  1ZFS A;  3BOW A;  1CKK A;  2ISD A;  3FWC A;  1SR6 C;  1XFZ O;  1QLK A;  4N1G A;  2A4J A;  1QX7 A;  4MZJ A;  3SIB A;  1YTZ C;  1B9A A;  2SCP A;  1G33 A;  1YRT B;  2E6W A;  2M0R A;  5I2O A;  3OB1 B;  3PAT A;  2M97 A;  2NCO A;  1CM4 A; 
#chains in the Genus database with same CATH topology
 2KLE A;  2LV7 A;  3BFA A;  3IQQ A;  4OR9 B;  4ZCV A;  1J1D A;  3F45 A;  1B7T Z;  1IQ5 A;  3VGO A;  3CWG A;  3KO0 A;  3WNX B;  1MQ1 A;  2K60 A;  1QIV A;  2MA2 A;  4MEW A;  2AMI A;  3KPX A;  3D0Y A;  3GK2 A;  3S0B A;  3HCM A;  4F0Z B;  2LVI A;  4IL1 A;  3FE9 A;  2NLN A;  5D69 A;  3VRN A;  5HKY A;  1Y1X A;  1NCZ A;  1OOG A;  1F55 A;  4WQ2 A;  1ZUZ A;  2NCP A;  4CPV A;  3NGV A;  4GFT A;  3CR4 X;  3KF9 A;  1AUI B;  3D0Y B;  3I5I B;  1EG3 A;  1SKT A;  1SW8 A;  2JZI A;  1HQV A;  2B1U A;  3K1E A;  1AJ5 A;  3CZT X;  4INX A;  1U5I A;  2Y1N A;  1MHO A;  2PYQ A;  1FI5 A;  3B87 A;  2ZNE A;  2BCX A;  2L2E A;  1U5I B;  3IQO A;  3IVT A;  2QEB A;  1PAL A;  5AXI A;  2QEO A;  2FJU B;  5AFP A;  2KBI A;  4CFQ A;  2O60 A;  3OB2 B;  2E30 A;  2JTT A;  1UP5 A;  2JXL A;  1IJ5 A;  3EG5 B;  3D77 A;  5HYD A;  2LC5 A;  5HL1 A;  3IF7 A;  1DJW A;  3DXL A;  5GQQ C;  3PFV A;  1W9Z A;  1DJX A;  4OZD A;  1IG5 A;  1QAS A;  4MZK A;  1FW4 A;  4PT1 A;  1B8R A;  1S6C A;  3V2L A;  1S5G Z;  1BLQ A;  2L51 A;  2F3Z A;  2ERB A;  2JNX A;  2JPT A;  3CLN A;  1Y0V H;  2JT0 A;  2GGZ A;  5I8N A;  1GJY A;  1K96 A;  1S6J A;  4GGF C;  2MBX A;  5AER A;  1FBV A;  1X02 A;  4USL A;  1MXL C;  2JT3 A;  4N5X A;  3DVE A;  1XO5 A;  2KI6 C;  1GQM A;  2WCH A;  2BL0 C;  3ICB A;  1WRL A;  4C0K A;  2IS9 A;  4M2P A;  3DZT A;  1JFK A;  2M3W A;  3PN7 B;  1RWY A;  5IBW A;  1KCY A;  4R1E A;  3KHE A;  2K7O A;  1QTX A;  5TNC A;  2HF5 A;  2HQ8 A;  2BBN A;  4C0L A;  3L4A A;  3R1P A;  1RRO A;  3VRP A;  2MAZ A;  2KDH A;  2QAC A;  3O6B A;  1XFV O;  4OCI A;  1DGV A;  1Y1U A;  1PVB A;  4YI9 A;  1WLZ A;  1TNP A;  1TTX A;  1IH0 A;  3AAK A;  2BKI B;  1M45 A;  1CFF A;  1XK4 A;  3SG7 A;  3CYZ A;  2OTG B;  4OKH A;  3TDU A;  1BR4 B;  2MRD A;  4I5K A;  1M31 A;  1Z2C B;  1TIZ A;  1B1G A;  4MSP A;  1LVC D;  2LMU A;  2LUC A;  2LP3 A;  2WCK A;  1G8I A;  1UHJ A;  1SL9 A;  1ALV A;  2WND A;  3CGA A;  5HLV A;  4PE1 A;  1NSH A;  3JTD C;  5G08 A;  5ER5 A;  4DIR A;  2AAO A;  2YGU A;  3GK1 A;  1YUU A;  1PK0 D;  1DF0 A;  2P71 A;  1GGW A;  2FCD A;  5DIC A;  1NX0 A;  3FS7 A;  1QXP A;  2EHB A;  2L4I A;  1YRU B;  3LLE A;  4I5J A;  4QJ3 B;  3EVR A;  2EC6 B;  1F8H A;  2WOR A;  3NSL A;  3PSR A;  1S6I A;  1DJH A;  1QVI Y;  2F33 A;  3SIA A;  3TUY B;  1OMD A;  4WRI A;  2JNF A;  2NZ0 A;  1SCV A;  1B47 A;  1XFU O;  1C07 A;  4YRU A;  3CZ0 A;  4HRE E;  1YUS A;  4PHK A;  1KWO B;  1Z4H A;  4MN0 A;  2EC6 C;  1H4B A;  2KQ6 A;  2VRG A;  2BCA A;  4OVN F;  3TUY C;  2BE4 A;  3SG6 A;  1BR1 B;  1A4P A;  1LA3 A;  1K9U A;  3OP0 A;  1LA0 A;  1AVS A;  2CTN A;  2MHH A;  2NXQ A;  3CR5 X;  4PCW A;  2FJY A;  2L4H A;  1QV0 A;  1MUX A;  2LLT A;  4Q04 A;  3C1V A;  3TDZ A;  1KFU L;  1PUL A;  1SCM B;  2ZN8 A;  4QJ5 B;  1F4O A;  4YGC B;  3BOW B;  3B86 A;  5AEQ A;  4PE0 A;  1CDP A;  3FWB A;  1CMG A;  2LHI A;  3DYE A;  4YI8 A;  3CDN A;  5K89 A;  1K90 D;  5D7F A;  1NX3 A;  1YX8 A;  1SCM C;  1KFX L;  3AAJ A;  2Y1M A;  3BUX B;  4MBE A;  1V1F A;  2JT8 A;  2KGB C;  1D1O A;  1YVH A;  1NCY A;  1K8U A;  1BT6 A;  4XYN A;  3CR2 A;  2KFH A;  1DTL A;  3L47 A;  1QX5 B;  2JXC A;  4YGB B;  2KBM A;  1TNW A;  3BUO B;  4PE4 A;  3EVV A;  1SNL A;  5F6T A;  3ZNI A;  2F2O A;  2JQ6 A;  2K7D A;  1QX2 A;  2Y5I A;  1S1E A;  1QAT A;  1ZAC A;  3O78 A;  2JRF A;  2PVB A;  1N0Y A;  4GUK A;  1OOF A;  3PM8 A;  5AAN A;  3I5G B;  1OQP A;  2K7C A;  1JBA A;  2M1U A;  1YVL A;  1TOP A;  5FI2 A;  1DT7 B;  5KTY A;  2KAV A;  3I5I C;  1JWD A;  1NUB A;  4E68 A;  1F4Q A;  2PQL A;  3O4Y A;  2JPO A;  1ZMZ A;  1MR8 A;  1Y1A A;  2BE6 A;  2PAL A;  3I5G C;  5JOL A;  2KAY A;  2M7L A;  2V53 A;  4D1E A;  1EL4 A;  3GK4 X;  4HRH A;  3SG2 A;  4ICB A;  2KFF A;  1A29 A;  2RGI A;  1K94 A;  2JU0 A;  2LNK A;  1XFR A;  2I18 A;  1IWQ A;  3BJH A;  3NSK A;  1BOC A;  1C3Z A;  1XFW O;  2JOJ A;  1FPW A;  3PM2 A;  2LVV A;  3WHT B;  4HRG A;  2LCP A;  4QJ4 B;  3I5H B;  5J3X A;  1CDM A;  1K95 A;  4M2Q A;  2H61 A;  3NHI A;  3D74 A;  1Q80 A;  1SRA A;  1L2O B;  1UUR A;  4ETO A;  4JWQ A;  3SS3 A;  1XFX O;  1CNP A;  1TWO A;  1M39 A;  4GPL B;  2KSP A;  1LIN A;  3VRO A;  3UNW A;  1F71 A;  1KSM A;  2ZFD A;  3B88 A;  1K9P A;  1NX2 A;  1UHI A;  3FIA A;  5I94 A;  1KQV A;  1KK7 Z;  1DQE A;  1LXF C;  4TNC A;  3M0W A;  2L50 A;  1UHK A;  2GV5 A;  1WRK A;  1L2O C;  2BCB A;  2M9G A;  2O5G A;  4XJK A;  3JVT B;  1M46 A;  3CZ1 A;  1ZOT B;  3OBV A;  1CFC A;  3S0D A;  5DKQ A;  1NCX A;  5KU1 A;  2LHL A;  1OMV A;  1UHH A;  2JWW A;  1K93 D;  2ZRT A;  3SG4 A;  4XJK B;  2QEH A;  1OZS A;  4YGD B;  4P2Y B;  1CFP A;  3PN7 C;  3DY9 A;  4AQI A;  3JVT C;  1EXR A;  2PRU A;  3NHT A;  1A2X A;  1V1G A;  1S36 A;  1SY9 A;  2BEC A;  2G9B A;  2GGM A;  4FTG A;  4F7F A;  3LL8 B;  1NYA A;  1B4C A;  4M2O A;  5JJG A;  1KK8 B;  2WCE A;  3N7H A;  5CSI A;  2KYC A;  2LLS A;  1ORG A;  1CLM A;  5DKN A;  1PRW A;  2LAP A;  3SJS A;  4NDB A;  2HPS A;  1BU3 A;  3D75 A;  2LAN A;  3SG5 A;  4JPZ B;  3TDI A;  4CLN A;  3LK1 A;  4NDC A;  1PSB A;  5HKZ A;  2OTG C;  1IJ6 A;  1SSE B;  1TUZ A;  3B7A A;  1F70 A;  1K9K A;  2KHN A;  3BYA A;  1RFJ A;  1AHR A;  1XK4 C;  4MRY A;  2K2F A;  2PSR A;  1CLB A;  2WC6 A;  1DF0 B;  1AK8 A;  1CM1 A;  2MJW B;  1GGZ A;  2G2B A;  1RJV A;  1N2D A;  4YGA A;  2WCB A;  3OHM B;  3S0E A;  1XA5 A;  2LMV A;  5CPV A;  1C7W A;  3OX6 A;  2KAX A;  2KLD A;  1IIO A;  3VRQ A;  1KSO A;  2FCE A;  1BJF A;  1ODB A;  2F2P A;  4GNK B;  1RTP 1;  1PVA A;  3I5F B;  2K61 A;  4YGE B;  4DRW A;  2L5Y A;  2OS8 B;  3R1V A;  3CS1 A;  1KQM B;  2MLF C;  2LMT A;  3D78 A;  2KYF A;  1IQ3 A;  1KWO C;  1CDL A;  3BQ3 A;  4JKT A;  3EKJ A;  5BPJ A;  3EVU A;  4FQT A;  3LCP C;  2M1K B;  3D73 A;  4DS7 A;  1J7P A;  1LKJ A;  1XFY O;  1SPY A;  2M8U A;  3QME A;  3RM1 A;  1OMR A;  1B7T Y;  2CXJ A;  1T14 A;  1QVI Z;  2LE9 B;  1CFD A;  2WC5 A;  3DF0 A;  4KYN A;  4PAL A;  4ZCU A;  1J1E A;  2KGR A;  3KEV A;  1REC A;  1QLS A;  1SBJ A;  2CBL A;  3D10 A;  3PJI A;  1TNQ A;  1UHN A;  3R1O A;  4I5L B;  1BMO A;  2JTZ A;  3DF0 B;  2ZND A;  3AKB A;  1DJZ A;  5EL2 A;  1EH2 A;  2R2I A;  2P6B B;  1RK9 A;  4AQJ A;  1P28 A;  1CMF A;  2JC2 A;  2H8V A;  1J7R A;  1LS8 A;  1PSR A;  2I94 A;  3H4S E;  1NP8 A;  1TN4 A;  1EG4 A;  1OW4 A;  2BKH B;  2LP2 A;  1DGU A;  5I2L A;  4MZL A;  1QS7 A;  1NX1 A;  5FI7 A;  1UUS A;  4AOM A;  2PMY A;  1C7V A;  2I2R E;  2KOT A;  4PHN A;  2LVK A;  4L9M A;  4GGN A;  3PAL A;  4OV2 A;  1DEK A;  4MRX A;  1QIW A;  2D8N A;  3A8R A;  3BFB A;  2JUL A;  2L2C A;  3QRX A;  1MXE A;  1OOJ A;  2LUX A;  3BXK A;  4JD9 A;  4CID A;  1DMO A;  1FF1 A;  2Y4Q A;  1A75 A;  1NWD A;  1SL8 A;  3R72 A;  1JC2 A;  1SMG A;  3BUM B;  1DVI A;  1JUO A;  1SK6 D;  4INW A;  3OGN A;  4PHM A;  2CNP A;  1YR5 A;  2Q4U A;  4UPG A;  4ORB B;  2L98 A;  2LLU A;  1A75 B;  1R2U A;  2ZKM X;  1YX7 A;  1DC1 A;  1NIW A;  4ORA B;  3Q8I A;  3ZWH A;  2DOQ A;  1S5G Y;  1IGV A;  2HET A;  2PAS A;  2K7B A;  3PLF B;  1YUT A;  2QPT A;  5ER4 X;  1M63 B;  3NSO A;  1BF5 A;  1W7J B;  3UO9 A;  4FQO A;  1C3Y A;  4A4C A;  1QWV A;  1GM0 A;  2M29 A;  5CSJ A;  2WCL A;  1HT9 A;  1CDN A;  3DVM A;  5HKW A;  1KK7 Y;  4A4B A;  2H2K A;  3S0G A;  2WCM A;  1FI6 A;  1Y6W A;  5I2Q A;  1A03 A;  4GGF A;  3SS4 A;  3I5H C;  2ZRS A;  4ORC B;  4PHJ A;  1QV1 A;  2GTE A;  1J55 A;  3EK4 A;  3BFH A;  3FE8 A;  2H61 C;  3GOF A;  2BL0 B;  1L7Z A;  4YBH B;  2HQW A;  4JQ0 D;  4NDD A;  3CTN A;  2BBM A;  2ZN9 A;  4DCK A;  1CTR A;  1TCF A;  3B6X A;  1VRK A;  1J7Q A;  1B8L A;  4GAO A;  4MLW A;  4P5O E;  4IJ7 A;  3WHU B;  3E3R A;  3L4L A;  4NQG A;  2L0P A;  2OPO A;  2K0J A;  5HLO A;  2TN4 A;  3DVK A;  1EJ3 A;  2M7N A;  1UWO A;  1BOD A;  1NPQ A;  3D76 A;  1TRF A;  4U8D A;  3BUW B;  3NSI A;  5D3O A;  5DKR A;  5B8I B;  2KPH A;  1B8C A;  4MVF A;  3OX5 A;  1F54 A;  4C0J A;  2KNE A;  3FE6 A;  2K8M B;  3CZ2 A;  5CSN A;  4CFR A;  4N1F A;  2KI4 B;  1CLL A;  3EKH A;  3O4X A;  4PDZ A;  1SL7 A;  3S0A A;  1WRZ A;  2EGD A;  1KK8 C;  1J7O A;  1TCO B;  1CB1 A;  3RLZ A;  1XYD A;  2WC8 A;  4GBA A;  4WQ3 A;  1H8B A;  2L5X B;  4HSZ A;  1OOI X;  3EK8 A;  1R6P A;  1DJY A;  2LM5 A;  3JTD B;  3TS5 B;  3VRR A;  1IKU A;  3O2P A;  2KI6 D;  1WY9 A;  1WDC B;  2KI4 C;  3NXA A;  2FOT A;  2QEV A;  2CT9 A;  1JSA A;  3A4U B;  1S3P A;  4PE7 A;  3TZ1 A;  2I7A A;  1OZO A;  3TS5 C;  2KFG A;  1XVJ A;  2Q91 A;  5CSF A;  3RZS A;  2CCM A;  1W7I B;  1WDC C;  2KQY A;  2QDI A;  5FI6 A;  3WXA A;  4I5N B;  1AP4 A;  1SYM A;  2COL B;  1K2H A;  3CAB A;  3DVJ A;  2MLE C;  3MSE B;  1JF0 A;  1OE9 B;  1KFU S;  3SS5 A;  3EK7 A;  1BG1 A;  1E8A A;  2M49 B;  1WLM A;  1JFJ A;  4BY5 A;  3LK0 A;  3DD4 A;  5PAL A;  1S26 D;  1AJ4 A;  4DUQ A;  3I5F C;  1G4Y R;  1OSA A;  2WOS A;  3SG3 A;  2OS8 C;  2AUC A;  2LVJ A;  1IRJ A;  1KQM C;  2SAS A;  2WCJ A;  1SR6 B;  1KFX S;  1JF2 A;  1QJT A;  1MWN A;  2F8P A;  1YUR A;  1ALW A;  1DJG A;  2F3Y A;  1TNX A;  1N65 A;  3K21 A;  3BUN B;  3AKA A;  3VB1 A;  5KSZ A;  2K2A A;  1MF8 B;  2WCF A;  2P70 A;  1OOH A;  3HX4 A;  5FYX A;  4BY4 A;  1DJI A;  1ZFS A;  1DEL A;  3BOW A;  1CKK A;  2ISD A;  3FWC A;  1SR6 C;  3S0F A;  1XFZ O;  1QLK A;  1TUJ A;  4N1G A;  2A4J A;  1QX7 A;  4MZJ A;  3SIB A;  1YTZ C;  1B9A A;  2BNX A;  2SCP A;  1G33 A;  1YRT B;  2E6W A;  2M0R A;  2BAP A;  5I2O A;  3OB1 B;  3PAT A;  2M97 A;  2NCO A;  1CM4 A; 
#chains in the Genus database with same CATH homology
 2LV7 A;  3IQQ A;  4OR9 B;  4ZCV A;  1J1D A;  3F45 A;  1B7T Z;  1IQ5 A;  3VGO A;  3CWG A;  3KO0 A;  3WNX B;  1MQ1 A;  2MA2 A;  1QIV A;  4MEW A;  2AMI A;  3KPX A;  3D0Y A;  3GK2 A;  3HCM A;  4F0Z B;  2LVI A;  4IL1 A;  2NLN A;  5D69 A;  3VRN A;  5HKY A;  1Y1X A;  1NCZ A;  1F55 A;  4WQ2 A;  1ZUZ A;  2NCP A;  4CPV A;  4GFT A;  3CR4 X;  3KF9 A;  1AUI B;  3D0Y B;  3I5I B;  1EG3 A;  1SKT A;  1SW8 A;  2JZI A;  1HQV A;  2B1U A;  1AJ5 A;  3CZT X;  1U5I A;  2Y1N A;  1MHO A;  1FI5 A;  2ZNE A;  2BCX A;  2L2E A;  1U5I B;  3IQO A;  1PAL A;  5AXI A;  5AFP A;  2FJU B;  2KBI A;  4CFQ A;  2O60 A;  3OB2 B;  2E30 A;  2JTT A;  1UP5 A;  2JXL A;  1IJ5 A;  5HYD A;  2LC5 A;  3IF7 A;  1DJW A;  5GQQ C;  3PFV A;  1DJX A;  1IG5 A;  1QAS A;  4MZK A;  1FW4 A;  1B8R A;  1S6C A;  1S5G Z;  1BLQ A;  2L51 A;  2F3Z A;  2JNX A;  2JPT A;  3CLN A;  1Y0V H;  2JT0 A;  2GGZ A;  5I8N A;  1GJY A;  1K96 A;  1S6J A;  4GGF C;  2MBX A;  5AER A;  1FBV A;  1X02 A;  4USL A;  1MXL C;  2JT3 A;  4N5X A;  3DVE A;  1XO5 A;  2KI6 C;  1GQM A;  2BL0 C;  3ICB A;  1WRL A;  4C0K A;  2IS9 A;  4M2P A;  1JFK A;  2M3W A;  3PN7 B;  1RWY A;  5IBW A;  1KCY A;  4R1E A;  3KHE A;  2K7O A;  1QTX A;  5TNC A;  2HF5 A;  2HQ8 A;  2BBN A;  4C0L A;  1RRO A;  3VRP A;  2MAZ A;  2KDH A;  2QAC A;  3O6B A;  1XFV O;  4OCI A;  1DGV A;  1Y1U A;  1PVB A;  4YI9 A;  1WLZ A;  1TNP A;  1TTX A;  1IH0 A;  3AAK A;  2BKI B;  1M45 A;  1CFF A;  1XK4 A;  3SG7 A;  4OKH A;  2OTG B;  3TDU A;  1BR4 B;  2MRD A;  4I5K A;  1M31 A;  1B1G A;  1TIZ A;  4MSP A;  1LVC D;  2LMU A;  2LUC A;  2LP3 A;  1G8I A;  1UHJ A;  1SL9 A;  1ALV A;  2WND A;  3CGA A;  5HLV A;  4PE1 A;  1NSH A;  3JTD C;  5G08 A;  5ER5 A;  4DIR A;  2AAO A;  3GK1 A;  1YUU A;  1PK0 D;  1DF0 A;  1GGW A;  2FCD A;  1NX0 A;  3FS7 A;  1QXP A;  2EHB A;  2L4I A;  1YRU B;  3LLE A;  4I5J A;  4QJ3 B;  3EVR A;  2EC6 B;  1F8H A;  2WOR A;  3NSL A;  3PSR A;  1S6I A;  1DJH A;  1QVI Y;  2F33 A;  3SIA A;  3TUY B;  1OMD A;  4WRI A;  2JNF A;  2NZ0 A;  1SCV A;  1B47 A;  1XFU O;  1C07 A;  4YRU A;  4HRE E;  1YUS A;  4PHK A;  1KWO B;  4MN0 A;  2EC6 C;  1H4B A;  2KQ6 A;  2VRG A;  2BCA A;  4OVN F;  3TUY C;  2BE4 A;  3SG6 A;  1BR1 B;  1A4P A;  1LA3 A;  1K9U A;  3OP0 A;  1LA0 A;  1AVS A;  2CTN A;  2MHH A;  2NXQ A;  3CR5 X;  4PCW A;  2L4H A;  1QV0 A;  1MUX A;  2LLT A;  4Q04 A;  3C1V A;  3TDZ A;  1KFU L;  1PUL A;  1SCM B;  2ZN8 A;  4QJ5 B;  1F4O A;  4YGC B;  3BOW B;  5AEQ A;  4PE0 A;  1CDP A;  3FWB A;  1CMG A;  2LHI A;  4YI8 A;  5K89 A;  1K90 D;  5D7F A;  1NX3 A;  1YX8 A;  1SCM C;  1KFX L;  3AAJ A;  2Y1M A;  3BUX B;  4MBE A;  1V1F A;  2JT8 A;  2KGB C;  1D1O A;  1YVH A;  1NCY A;  1K8U A;  1BT6 A;  4XYN A;  3CR2 A;  2KFH A;  1DTL A;  1QX5 B;  2JXC A;  4YGB B;  2KBM A;  1TNW A;  3BUO B;  4PE4 A;  3EVV A;  1SNL A;  5F6T A;  3ZNI A;  2F2O A;  2JQ6 A;  2K7D A;  1QX2 A;  2Y5I A;  1S1E A;  1QAT A;  1ZAC A;  3O78 A;  2JRF A;  2PVB A;  1N0Y A;  4GUK A;  5AAN A;  3PM8 A;  3I5G B;  1OQP A;  2K7C A;  1JBA A;  2M1U A;  1YVL A;  1TOP A;  1DT7 B;  5KTY A;  2KAV A;  3I5I C;  1JWD A;  1NUB A;  4E68 A;  1F4Q A;  3O4Y A;  1ZMZ A;  1MR8 A;  1Y1A A;  2BE6 A;  2PAL A;  3I5G C;  5JOL A;  2KAY A;  2M7L A;  2V53 A;  4D1E A;  1EL4 A;  3GK4 X;  4HRH A;  3SG2 A;  4ICB A;  2KFF A;  1A29 A;  2RGI A;  1K94 A;  2JU0 A;  2LNK A;  2I18 A;  1IWQ A;  3NSK A;  1BOC A;  1XFW O;  2JOJ A;  1FPW A;  3WHT B;  2LVV A;  4HRG A;  2LCP A;  4QJ4 B;  3I5H B;  5J3X A;  1CDM A;  1K95 A;  4M2Q A;  2H61 A;  1Q80 A;  1SRA A;  1L2O B;  1UUR A;  4ETO A;  4JWQ A;  1XFX O;  1CNP A;  1M39 A;  4GPL B;  2KSP A;  1LIN A;  3VRO A;  1F71 A;  1KSM A;  2ZFD A;  1KQV A;  1K9P A;  1NX2 A;  1UHI A;  3FIA A;  1KK7 Z;  1LXF C;  4TNC A;  3M0W A;  2L50 A;  1UHK A;  2GV5 A;  1WRK A;  1L2O C;  2BCB A;  2M9G A;  2O5G A;  4XJK A;  3JVT B;  1M46 A;  1ZOT B;  1CFC A;  5DKQ A;  1NCX A;  5KU1 A;  2LHL A;  1OMV A;  1UHH A;  2JWW A;  1K93 D;  2ZRT A;  3SG4 A;  4XJK B;  1OZS A;  4YGD B;  4P2Y B;  1CFP A;  3PN7 C;  4AQI A;  3JVT C;  1EXR A;  2PRU A;  1A2X A;  1V1G A;  1S36 A;  1SY9 A;  2BEC A;  2G9B A;  2GGM A;  4FTG A;  3LL8 B;  1NYA A;  1B4C A;  4M2O A;  5JJG A;  1KK8 B;  2WCE A;  5CSI A;  5DKN A;  2KYC A;  2LLS A;  3SJS A;  1CLM A;  1PRW A;  2LAP A;  4NDB A;  2HPS A;  1BU3 A;  2LAN A;  3SG5 A;  4JPZ B;  3TDI A;  4CLN A;  3LK1 A;  4NDC A;  1PSB A;  5HKZ A;  2OTG C;  1IJ6 A;  1F70 A;  1K9K A;  2KHN A;  3BYA A;  1RFJ A;  1AHR A;  1XK4 C;  4MRY A;  2K2F A;  2PSR A;  1CLB A;  1DF0 B;  1AK8 A;  1CM1 A;  2MJW B;  1GGZ A;  2G2B A;  1RJV A;  1N2D A;  4YGA A;  2WCB A;  3OHM B;  1XA5 A;  2LMV A;  5CPV A;  1C7W A;  3OX6 A;  2KAX A;  3VRQ A;  1KSO A;  2FCE A;  1BJF A;  1ODB A;  2F2P A;  4GNK B;  1RTP 1;  1PVA A;  3I5F B;  2K61 A;  4YGE B;  4DRW A;  2OS8 B;  3CS1 A;  1KQM B;  2MLF C;  2LMT A;  2KYF A;  1IQ3 A;  1KWO C;  1CDL A;  3BQ3 A;  3EKJ A;  5BPJ A;  3EVU A;  3LCP C;  2M1K B;  4DS7 A;  1J7P A;  1LKJ A;  1XFY O;  1SPY A;  2M8U A;  3RM1 A;  1OMR A;  1B7T Y;  2CXJ A;  1QVI Z;  2LE9 B;  1CFD A;  3DF0 A;  4ZCU A;  4PAL A;  1J1E A;  2KGR A;  3KEV A;  1REC A;  1QLS A;  1SBJ A;  2CBL A;  3D10 A;  1TNQ A;  1UHN A;  4I5L B;  1BMO A;  2JTZ A;  3DF0 B;  2ZND A;  3AKB A;  1DJZ A;  1EH2 A;  2R2I A;  2P6B B;  1RK9 A;  4AQJ A;  1CMF A;  2JC2 A;  1J7R A;  1PSR A;  2I94 A;  3H4S E;  1NP8 A;  1TN4 A;  1EG4 A;  2BKH B;  2LP2 A;  1DGU A;  5I2L A;  4MZL A;  1QS7 A;  1NX1 A;  4AOM A;  1UUS A;  2PMY A;  1C7V A;  2I2R E;  2KOT A;  4PHN A;  2LVK A;  4L9M A;  4GGN A;  3PAL A;  4OV2 A;  4MRX A;  1QIW A;  2D8N A;  3A8R A;  2JUL A;  3QRX A;  1MXE A;  1OOJ A;  2LUX A;  3BXK A;  4CID A;  1DMO A;  1FF1 A;  2Y4Q A;  1A75 A;  1NWD A;  1SL8 A;  1JC2 A;  1SMG A;  3BUM B;  1DVI A;  1JUO A;  1SK6 D;  4PHM A;  2CNP A;  1YR5 A;  2Q4U A;  4UPG A;  4ORB B;  2L98 A;  2LLU A;  1A75 B;  1R2U A;  2ZKM X;  1YX7 A;  1NIW A;  4ORA B;  3ZWH A;  2DOQ A;  1S5G Y;  1IGV A;  2HET A;  2PAS A;  2K7B A;  3PLF B;  1YUT A;  2QPT A;  5ER4 X;  1M63 B;  3NSO A;  1BF5 A;  1W7J B;  4FQO A;  4A4C A;  2M29 A;  5CSJ A;  1HT9 A;  1CDN A;  3DVM A;  5HKW A;  1KK7 Y;  4A4B A;  2H2K A;  1FI6 A;  1Y6W A;  5I2Q A;  1A03 A;  4GGF A;  3I5H C;  2ZRS A;  4ORC B;  4PHJ A;  1QV1 A;  1J55 A;  3EK4 A;  2H61 C;  3GOF A;  2BL0 B;  1L7Z A;  4YBH B;  2HQW A;  4JQ0 D;  4NDD A;  3CTN A;  2BBM A;  2ZN9 A;  4DCK A;  1CTR A;  1TCF A;  1VRK A;  1J7Q A;  1B8L A;  4GAO A;  4MLW A;  4P5O E;  3WHU B;  3E3R A;  4NQG A;  2L0P A;  2OPO A;  2K0J A;  5HLO A;  2TN4 A;  3DVK A;  1EJ3 A;  2M7N A;  1UWO A;  1BOD A;  1NPQ A;  1TRF A;  4U8D A;  3BUW B;  3NSI A;  5DKR A;  5B8I B;  1B8C A;  4MVF A;  3OX5 A;  1F54 A;  4C0J A;  2KNE A;  2K8M B;  5CSN A;  4CFR A;  4N1F A;  2KI4 B;  1CLL A;  3EKH A;  4PDZ A;  1SL7 A;  1WRZ A;  2EGD A;  1KK8 C;  1J7O A;  1TCO B;  1CB1 A;  3RLZ A;  1XYD A;  2WC8 A;  4GBA A;  4WQ3 A;  1H8B A;  2L5X B;  4HSZ A;  3EK8 A;  3TS5 B;  1R6P A;  1DJY A;  2LM5 A;  3JTD B;  3VRR A;  1IKU A;  3O2P A;  2KI6 D;  1WY9 A;  1WDC B;  2KI4 C;  3NXA A;  2FOT A;  2CT9 A;  1JSA A;  3A4U B;  1S3P A;  4PE7 A;  3TZ1 A;  2I7A A;  1OZO A;  3TS5 C;  2KFG A;  1XVJ A;  2Q91 A;  5CSF A;  2CCM A;  1W7I B;  1WDC C;  2KQY A;  3WXA A;  1AP4 A;  4I5N B;  1SYM A;  2COL B;  1K2H A;  3DVJ A;  2MLE C;  3MSE B;  1JF0 A;  1OE9 B;  1KFU S;  1BG1 A;  3EK7 A;  1E8A A;  2M49 B;  1WLM A;  1JFJ A;  4BY5 A;  3LK0 A;  3DD4 A;  5PAL A;  1S26 D;  1AJ4 A;  4DUQ A;  3I5F C;  1G4Y R;  1OSA A;  2WOS A;  3SG3 A;  2OS8 C;  2AUC A;  2LVJ A;  1IRJ A;  1KQM C;  2SAS A;  1SR6 B;  1KFX S;  1JF2 A;  1QJT A;  1MWN A;  2F8P A;  1YUR A;  1ALW A;  1DJG A;  2F3Y A;  1TNX A;  1N65 A;  3K21 A;  3BUN B;  3AKA A;  5KSZ A;  2K2A A;  1MF8 B;  2WCF A;  3HX4 A;  5FYX A;  4BY4 A;  1DJI A;  1ZFS A;  3BOW A;  1CKK A;  2ISD A;  3FWC A;  1SR6 C;  1XFZ O;  1QLK A;  4N1G A;  2A4J A;  1QX7 A;  4MZJ A;  3SIB A;  1YTZ C;  1B9A A;  2SCP A;  1G33 A;  1YRT B;  2E6W A;  2M0R A;  5I2O A;  3OB1 B;  3PAT A;  2M97 A;  2NCO A;  1CM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...