1KK8C

Scallop myosin (s1-adp-befx) in the actin-detached conformation
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
154
structure length
154
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords Myosin Heavy Chain, Striated muscle
total genus 48
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8C02
3HX4A 3IQOA 3OX6A 2BBNA 4MN0A 1FF1A 4M2PA 3O4YA 2ZRSA 2V53A 1DJIA 2EC6B 1OOJA 1AUIB 2LLSA 3I5HB 5HKZA 1NWDA 4U8DA 1BT6A 1ZUZA 3BYAA 1UHIA 4OV2A 4NDBA 1TNPA 3CR5X 4WQ3A 1J1EA 1SR6C 5FYXA 1MWNA 1S6CA 2CBLA 3AKBA 2ISDA 3EVRA 1F54A 4GGFA 2Y5IA 3BQ3A 3LLEA 4PHNA 1KQMC 5HLOA 2FCDA 4CFRA 1NP8A 4HREE 3PN7C 1WRZA 2LC5A 2LVJA 1S26D 3IQQA 5D69A 2M3WA 2B1UA 1NPQA 4GFTA 4GGFC 1J7RA 4PHJA 3BUWB 1WRKA 1G8IA 2CNPA 1DJXA 1PSRA 1UHKA 4ZCUA 1SBJA 1DF0B 1DGUA 1QX2A 1NIWA 1RWYA 5BPJA 1IGVA 1S5GY 3I5GB 3SG2A 4ETOA 1A03A 1F71A 1YURA 1NYAA 1YX8A 1YVLA 5KSZA 1F55A 2CCMA 4D1EA 1QJTA 1QX7A 3VRNA 3JVTB 5ER4X 1LA3A 4HRGA 1NSHA 3A8RA 1ZMZA 2JOJA 4GBAA 1KK7Z 1B47A 1IWQA 2KGRA 3KO0A 1XFZO 4DUQA 3BUNB 3EK4A 3CR4X 1ODBA 1Y6WA 2LNKA 1YRTB 1AJ4A 1EG4A 2HF5A 3BUXB 2R2IA 1RTP1 2IS9A 1KFXS 4MZKA 1TNWA 1N2DA 1A2XA 1ZACA 5CSIA 1RJVA 2ZNDA 3BOWB 2Q4UA 4L9MA 1MF8B 2LMUA 2F3YA 3I5IB 1KFUS 4QJ4B 2PMYA 1GGZA 4YRUA 5TNCA 1XFVO 2OS8C 1WY9A 2P6BB 3I5FC 3SIAA 3SG4A 3M0WA 4I5LB 1LVCD 3PALA 2CTNA 3D10A 2M7NA 3AKAA 3CGAA 4MLWA 1J7PA 2KSPA 1DTLA 5ER5A 1B9AA 1XFXO 2ZNEA 4M2OA 2OTGB 5JOLA 1SKTA 4BY4A 1CDPA 4M2QA 2LUXA 2QACA 4OR9B 2EGDA 1JWDA 2M7LA 1TN4A 4DCKA 1W7JB 1M63B 3C1VA 1S5GZ 2JULA 1DMOA 3O2PA 2JT3A 3FWCA 5CSFA 4YBHB 5KTYA 1BU3A 1TTXA 2KYFA 4YGCB 2WNDA 2K2AA 2L2EA 2WC8A 5HYDA 3JTDC 1KCYA 1KWOC 2COLB 2NXQA 1L2OB 4MRXA 2M9GA 4P5OE 5I2LA 4A4CA 2ZN8A 1WRLA 3CR2A 3QRXA 1K9UA 1CM4A 3D0YB 1WDCC 3WHUB 4PCWA 1TIZA 2WCFA 2MBXA 1Y1XA 1MR8A 3GOFA 3KPXA 1QIWA 1QV1A 1F4QA 4ORBB 1A29A 5DKQA 2KQ6A 4C0LA 1QIVA 1S6JA 1PVBA 2LMVA 1OZSA 2BCAA 2BCXA 1SCVA 2SASA 1CFPA 1NCXA 4JQ0D 4ORAB 1SCMB 4PHKA 3WNXB 1QVIZ 1F8HA 2KHNA 1MUXA 1M31A 1MXLC 2AAOA 3VROA 1Y1UA 1YRUB 1IQ3A 3DVMA 3NSIA 4YGDB 1CM1A 2JTZA 1W7IB 2CXJA 1V1FA 2JQ6A 2MLEC 3DVEA 1C7VA 1A4PA 1CDLA 2H61A 2MJWB 3H4SE 4OCIA 2I18A 2LE9B 1D1OA 3WHTB 1PSBA 2JNXA 2FCEA 1OSAA 1CLLA 2MAZA 3DVJA 3DVKA 1BR1B 5HKYA 3TS5C 4AOMA 1DJYA 2K7DA 2M29A 1XVJA 2BKHB 5AFPA 2FOTA 1K95A 4AQIA 1SL7A 4USLA 1DJWA 5D7FA 1CLBA 2QPTA 2WOSA 1AVSA 1N65A 1JF2A 4NDCA 1S6IA 2LLTA 3BOWA 4MVFA 1K90D 1JSAA 1A75A 4N1GA 4YI8A 2M49B 2F2PA 1E8AA 3EVUA 1S3PA 1NCYA 3VRPA 1BODA 1QLKA 2NCOA 2OPOA 4ZCVA 4DS7A 4XJKA 1CB1A 1SMGA 5F6TA 1BF5A 3JVTC 1HT9A 3ICBA 4YGEB 1JC2A 1CMGA 2KI4B 5AEQA 1PALA 1UURA 1X02A 2LANA 4OVNF 2K2FA 1G33A 2KGBC 4QJ5B 4C0KA 1C07A 4F0ZB 1KK7Y 1TNXA 1MXEA 4DIRA 1U5IA 3PSRA 1DT7B 1NX2A 2JZIA 1H4BA 1ZFSA 2PVBA 1XFWO 3FWBA 3TZ1A 2PRUA 2ZN9A 1CMFA 1J7OA 1HQVA 2L0PA 4MZLA 4I5KA 2KAXA 2M97A 1SL9A 4Q04A 1NX3A 3SJSA 1LA0A 1YUUA 3I5FB 1RROA 4I5JA 1IG5A 4PALA 1CFCA 2NZ0A 3DF0A 1K93D 4CFQA 3AAJA 3SG5A 3NSKA 2K61A 1BOCA 2K8MB 3WXAA 1K9PA 1JFJA 3TUYB 1QVIY 1SR6B 5JJGA 5I2QA 1AP4A 2BL0C 1Y1AA 3RLZA 2G9BA 1SRAA 1UHHA 2ZFDA 2LVKA 4WQ2A 3OB1B 1KK8C 2O5GA 1XK4C 5DKNA 1M45A 2LP2A 2AUCA 1JFKA 3O78A 5PALA 2VRGA 2H2KA 4JWQA 2PSRA 4YGAA 2KFGA 1RK9A 1BLQA 1CFFA 2LMTA 3SG3A 2MHHA 2HETA 2EC6C 1IH0A 2D8NA 2FJUB 1AJ5A 1UWOA 1V1GA 4GNKB 4HSZA 2HPSA 1OQPA 1DF0A 1YUSA 1LINA 3D0YA 4AQJA 1MQ1A 1SPYA 2ZKMX 4MRYA 2LUCA 5K89A 1TOPA 2F2OA 2M1KB 1BR4B 2M0RA 1JUOA 3A4UB 3TDUA 4GPLB 4PE0A 3PN7B 1R2UA 1PK0D 1PRWA 3PFVA 2JT0A 1XFUO 3PM8A 5AERA 1XO5A 1KFUL 3OB2B 2M1UA 1UUSA 3F45A 1SNLA 2KYCA 1SY9A 3ZNIA 3I5IC 2Y1NA 1M39A 2L4HA 1GJYA 1KFXL 1LKJA 2KBMA 1DGVA 1J7QA 4GUKA 3LK1A 3TDZA 1XYDA 2BE4A 1B1GA 3SIBA 1TCOB 1BMOA 3EKHA 4C0JA 3E3RA 2Y4QA 2HQWA 5HLVA 2M8UA 2O60A 1TNQA 4ICBA 2KFFA 1OMVA 1QTXA 3OP0A 1CDMA 2H61C 5AXIA 1MHOA 3GK4X 1SW8A 1IJ5A 4MBEA 5DKRA 3SG6A 1XFYO 1QASA 2JPTA 3GK2A 2KQYA 1IJ6A 2TN4A 2K7OA 4CLNA 2KFHA 2L51A 1CKKA 1B4CA 1CFDA 1YX7A 4P2YB 1QS7A 3EK8A 3NSOA 3GK1A 2KAVA 2DOQA 4A4BA 2LM5A 2G2BA 1EXRA 5B8IB 2OS8B 1SL8A 2MA2A 2CT9A 2AMIA 3IF7A 4IL1A 2JU0A 1B8LA 1CTRA 3I5HC 1EG3A 4MSPA 5G08A 4FQOA 1K9KA 1OMRA 1FBVA 4MZJA 4PDZA 2K7CA 3DF0B 1NX0A 1WLMA 3NSLA 3NXAA 2GV5A 1TRFA 5CPVA 1OZOA 1KQMB 2MRDA 1KSOA 2WCEA 2HQ8A 1U5IB 1C7WA 2I7AA 3AAKA 3CWGA 1BJFA 4CIDA 1NUBA 1L7ZA 1B8CA 2SCPA 4N5XA 4QJ3B 2KOTA 4TNCA 2LP3A 2KI6D 2LAPA 1J1DA 3JTDB 3VGOA 2ZRTA 5I2OA 1IQ5A 2LLUA 2LCPA 3I5GC 1L2OC 4XYNA 3EKJA 1DJHA 4MEWA 1RECA 4JPZB 1YTZC 5IBWA 1H8BA 3HCMA 4YI9A 5I8NA 1A75B 2JNFA 4PE4A 1EJ3A 1FW4A 3MSEB 1KSMA 2KDHA 1CLMA 1QV0A 2L4IA 3OHMB 4N1FA 4OKHA 3TUYC 1KQVA 2F8PA 2F3ZA 2L50A 2E30A 2NCPA 3FIAA 1RFJA 1QX5B 2LVIA 3BXKA 2NLNA 4I5NB 2BL0B 2JXCA 1CDNA 4CPVA 1ZOTB 4NDDA 3BUOB 1QXPA 1LXFC 1ALVA 4GAOA 1SK6D 2I2RE 2PASA 1FI6A 4PHMA 1SCMC 2LV7A 1KK8B 2BBMA 2JC2A 4BY5A 1B8RA 1PVAA 3RM1A 1QATA 1YUTA 1AHRA 2LHIA 4R1EA 2JWWA 1JF0A 4GGNA 1IRJA 1NX1A 4UPGA 1BG1A 3EVVA 2E6WA 1OE9B 2BCBA 2JXLA 5CSNA 1GGWA 1AK8A 2I94A 1K2HA 1QLSA 1JBAA 1SYMA 3ZWHA 2WORA 1OMDA 1R6PA 2LVVA 2K0JA 2KI6C 2OTGC 1K96A 4DRWA 2JT8A 3KHEA 1S36A 4ORCB 1K94A 2RGIA 5GQQC 1Y0VH 2BE6A 1IKUA 1B7TZ 1EL4A 2L5XB 4WRIA 4PE1A 3TS5B 2LHLA 2EHBA 3FS7A 4FTGA 3LL8B 1FI5A 1XA5A 2BKIB 1B7TY 2BECA 5CSJA 3OX5A 2GGMA 1K8UA 2PALA 1DJGA 3VRRA 1UP5A 4NQGA 5AANA 3KEVA 1DJZA 2KNEA 1DVIA 3TDIA 3VRQA 1TCFA 1FPWA 1F4OA 1KWOB 1GQMA 2A4JA 3CLNA 3KF9A 1EH2A 2JRFA 3O6BA 4PE7A 1S1EA 5KU1A 2KAYA 1UHJA 1YR5A 2F33A 1WDCB 1J55A 2K7BA 1N0YA 1F70A 4HRHA 4E68A 2KBIA 3DD4A 3CTNA 3EK7A 1NCZA 2Y1MA 1UHNA 1G4YR 2KI4C 2MLFC 4YGBB 1XK4A 3K21A 1WLZA 2WCBA 3BUMB 3PATA 2Q91A 3CS1A 5J3XA 2L98A 3LK0A 1M46A 4XJKB 2JTTA 3SG7A 1Q80A 1ALWA 1VRKA 1YVHA 2GGZA 3CZTX 1PULA 1CNPA 5HKWA 3LCPC 3PLFB
chains in the Genus database with same CATH superfamily
3HX4A 3IQOA 3OX6A 2BBNA 4MN0A 1W9ZA 1QWVA 1FF1A 4M2PA 3O4YA 2ZRSA 2V53A 1DJIA 2EC6B 1OOJA 1AUIB 2LLSA 3I5HB 2BNXA 5HKZA 1NWDA 4U8DA 1BT6A 1ZUZA 3BYAA 1UHIA 2KLEA 4OV2A 4NDBA 1TNPA 3CR5X 4WQ3A 1J1EA 1SR6C 5FYXA 3FE6A 1MWNA 1S6CA 2CBLA 3AKBA 2ISDA 3EVRA 1F54A 4GGFA 2Y5IA 3BQ3A 3LLEA 4PHNA 1KQMC 3BFBA 2FCDA 5HLOA 4CFRA 1NP8A 4HREE 2GTEA 3PN7C 1WRZA 2LC5A 2LVJA 1S26D 3IQQA 5D69A 2M3WA 3S0GA 2B1UA 1NPQA 4GFTA 3CZ0A 4GGFC 1J7RA 4PHJA 3BUWB 1WRKA 1P28A 2QEHA 1G8IA 2CNPA 1DJXA 1PSRA 1UHKA 4ZCUA 1SBJA 1DF0B 1DGUA 1QX2A 1NIWA 1RWYA 5BPJA 1IGVA 1S5GY 3I5GB 3SG2A 4ETOA 1A03A 1F71A 1YURA 1NYAA 1YX8A 3UNWA 1YVLA 5KSZA 1F55A 2CCMA 3PM2A 4D1EA 1QJTA 1QX7A 3VRNA 3JVTB 5ER4X 1LA3A 4HRGA 1NSHA 3A8RA 1ZMZA 2JOJA 4GBAA 1KK7Z 1B47A 2K60A 1IWQA 2KGRA 1OOIX 1OOHA 1XFZO 3KO0A 3BUNB 3EK4A 4DUQA 3CR4X 1ODBA 1Y6WA 2LNKA 1YRTB 1AJ4A 1EG4A 2HF5A 3BUXB 2R2IA 1RTP1 3NGVA 2IS9A 3R1OA 1KFXS 4MZKA 1TNWA 1N2DA 1C3ZA 1A2XA 3R72A 1ZACA 5CSIA 1RJVA 2ZNDA 3BOWB 2Q4UA 4L9MA 4INXA 1MF8B 2LMUA 2F3YA 3I5IB 1KFUS 1DELA 2PMYA 1GGZA 2ERBA 4QJ4B 4YRUA 5TNCA 2P70A 1XFVO 2OS8C 1WY9A 2P6BB 3I5FC 3SIAA 3SG4A 3M0WA 4I5LB 1LVCD 3PALA 2CTNA 3D10A 2M7NA 3AKAA 3CGAA 1TUJA 2QEVA 4MLWA 1J7PA 2KSPA 1DTLA 5ER5A 1B9AA 1XFXO 2ZNEA 4M2OA 2OTGB 5JOLA 1SKTA 4BY4A 1CDPA 4M2QA 2LUXA 2QACA 4OR9B 2EGDA 3N7HA 1JWDA 2M7LA 1TN4A 4DCKA 1W7JB 1M63B 3C1VA 1S5GZ 2JULA 1DMOA 3O2PA 2JT3A 3D78A 3FWCA 5CSFA 4YBHB 3UO9A 5KTYA 1BU3A 1TTXA 2KYFA 4YGCB 2WNDA 3B88A 2K2AA 2L2EA 2WC8A 5HYDA 3JTDC 1KCYA 1KWOC 2COLB 2NXQA 1L2OB 4MRXA 2M9GA 4P5OE 5I2LA 4A4CA 2ZN8A 1WRLA 3CR2A 3QRXA 3O4XA 1K9UA 1CM4A 1C3YA 3D0YB 1WDCC 1TUZA 3WHUB 4PCWA 1TIZA 2WCFA 2MBXA 1Y1XA 1MR8A 3GOFA 3KPXA 1QIWA 1QV1A 1F4QA 4ORBB 1A29A 5DKQA 2KQ6A 4C0LA 1QIVA 1S6JA 1PVBA 2LMVA 1OZSA 1XFRA 2BCAA 2BCXA 2QEBA 1SCVA 2SASA 1CFPA 1NCXA 4JQ0D 3NHTA 4ORAB 1SCMB 4PHKA 3WNXB 1QVIZ 1F8HA 2KHNA 1MUXA 1M31A 1MXLC 2AAOA 2WCLA 3VROA 3B87A 5I94A 1Y1UA 1YRUB 1IQ3A 3DVMA 3NSIA 4YGDB 1CM1A 2JTZA 1W7IB 3OGNA 2CXJA 1V1FA 2JQ6A 2MLEC 3DVEA 1C7VA 1A4PA 1CDLA 4INWA 2H61A 2MJWB 3H4SE 4OCIA 2I18A 2LE9B 1D1OA 3WHTB 1SSEB 1PSBA 2JNXA 2FCEA 1OSAA 1CLLA 2MAZA 3CZ1A 3DVJA 3DVKA 1ORGA 1BR1B 5HKYA 3TS5C 4AOMA 1DJYA 2K7DA 2M29A 1XVJA 2BKHB 5AFPA 2FOTA 1K95A 4AQIA 1SL7A 4USLA 1DJWA 5D7FA 1CLBA 2QPTA 2WOSA 1AVSA 1N65A 1JF2A 4NDCA 3D74A 1S6IA 2LLTA 4FQTA 3BOWA 3Q8IA 4MVFA 3BFHA 1K90D 1JSAA 1A75A 4N1GA 4YI8A 2M49B 5FI6A 2F2PA 1E8AA 3EVUA 1S3PA 1NCYA 3D73A 3VRPA 1BODA 1QLKA 2NCOA 2OPOA 4ZCVA 4DS7A 4XJKA 1CB1A 1SMGA 5F6TA 1BF5A 3JVTC 1HT9A 3L47A 3ICBA 4YGEB 4PT1A 1JC2A 1CMGA 2KI4B 5AEQA 1PALA 1DQEA 1UURA 1X02A 2LANA 2K2FA 1G33A 2KGBC 4OVNF 4C0KA 4QJ5B 4F0ZB 1C07A 1KK7Y 1TNXA 1MXEA 4DIRA 1U5IA 3PSRA 1DT7B 1NX2A 2JZIA 2FJYA 1H4BA 2WCJA 1ZFSA 2PVBA 3CZ2A 1XFWO 3FWBA 5EL2A 3TZ1A 2PRUA 2ZN9A 1CMFA 4KYNA 2KLDA 1J7OA 1HQVA 2L0PA 4MZLA 4I5KA 2KAXA 2M97A 1SL9A 4Q04A 1NX3A 3SJSA 1LA0A 1YUUA 3I5FB 3FE8A 1RROA 4I5JA 1IG5A 4PALA 1CFCA 3S0AA 2NZ0A 3DF0A 1K93D 2YGUA 3AAJA 3SG5A 4CFQA 3NSKA 2K61A 1BOCA 2K8MB 3WXAA 1K9PA 1JFJA 3TUYB 1QVIY 1SR6B 5JJGA 5I2QA 1AP4A 2BL0C 4F7FA 1Y1AA 3RLZA 2G9BA 1SRAA 1T14A 1UHHA 2ZFDA 2LVKA 4WQ2A 3OB1B 1KK8C 2O5GA 1XK4C 5DKNA 1M45A 2LP2A 2AUCA 1LS8A 1JFKA 3O78A 2PQLA 5PALA 3R1PA 2QEOA 2VRGA 2H2KA 4JWQA 1OOGA 2PSRA 2KFGA 1RK9A 4YGAA 1BLQA 2LMTA 1CFFA 3SG3A 2MHHA 3SS4A 2HETA 2EC6C 1IH0A 2D8NA 2FJUB 1AJ5A 1UWOA 1V1GA 4GNKB 4HSZA 2HPSA 1OQPA 1DF0A 3S0EA 1YUSA 1LINA 3D0YA 4AQJA 1MQ1A 1SPYA 2ZKMX 3B7AA 4MRYA 2JPOA 2LUCA 2WCKA 1TOPA 2F2OA 2M1KB 3VB1A 5K89A 1BR4B 2M0RA 1JUOA 3A4UB 3TDUA 3OBVA 4GPLB 2WCHA 4PE0A 3QMEA 3PN7B 1R2UA 1PK0D 1PRWA 3PFVA 2JT0A 1XFUO 3PM8A 5AERA 1XO5A 1KFUL 3OB2B 2M1UA 1UUSA 3F45A 1SNLA 2KYCA 1SY9A 3ZNIA 3I5IC 2Y1NA 1M39A 1OOFA 2L4HA 1GJYA 1KFXL 1TWOA 1LKJA 2KBMA 1DGVA 1J7QA 4GUKA 3LK1A 3TDZA 2BE4A 1XYDA 1B1GA 2L5YA 3SIBA 1TCOB 3V2LA 1BMOA 3EKHA 4C0JA 3E3RA 2Y4QA 2HQWA 5HLVA 3L4AA 2M8UA 2O60A 1TNQA 4ICBA 2KFFA 1OMVA 1QTXA 3OP0A 1CDMA 2H61C 5AXIA 1MHOA 3GK4X 1SW8A 1IJ5A 4JD9A 4MBEA 5DKRA 3SG6A 1XFYO 3DY9A 1QASA 2JPTA 3GK2A 2KQYA 1IJ6A 2TN4A 2K7OA 4CLNA 2KFHA 2L51A 1CKKA 4JKTA 1B4CA 1CFDA 1YX7A 4P2YB 1QS7A 3EK8A 3NSOA 2KPHA 3GK1A 2KAVA 2DOQA 2H8VA 4A4BA 2LM5A 2G2BA 1EXRA 5B8IB 2OS8B 1SL8A 3L4LA 2MA2A 3CYZA 2CT9A 2AMIA 3IF7A 4IL1A 2JU0A 1B8LA 1CTRA 3I5HC 1EG3A 2P71A 4MSPA 5G08A 4FQOA 1K9KA 1OMRA 1FBVA 4MZJA 4PDZA 2K7CA 3DF0B 1NX0A 1WLMA 3NSLA 3NXAA 2GV5A 2WC6A 1TRFA 5CPVA 5DICA 1OZOA 3RZSA 1KQMB 2WCMA 2MRDA 3BFAA 1KSOA 2WCEA 2HQ8A 1U5IB 1C7WA 2I7AA 3AAKA 3CWGA 1BJFA 4CIDA 1NUBA 1L7ZA 3BJHA 1B8CA 1DEKA 2SCPA 4N5XA 4QJ3B 2KOTA 4TNCA 2LP3A 2KI6D 2LAPA 1J1DA 3JTDB 3VGOA 2ZRTA 5I2OA 1IQ5A 2LLUA 2LCPA 3D77A 3I5GC 1L2OC 4XYNA 3EKJA 1DJHA 4MEWA 1RECA 4JPZB 1YTZC 5IBWA 1H8BA 3HCMA 4YI9A 5I8NA 1A75B 2JNFA 4PE4A 1EJ3A 1FW4A 3MSEB 1KSMA 2KDHA 1CLMA 1QV0A 2L4IA 3OHMB 4N1FA 4OKHA 3TUYC 1KQVA 2F3ZA 2F8PA 2L50A 2E30A 2NCPA 3FIAA 5HL1A 1RFJA 1QX5B 2LVIA 3BXKA 2NLNA 1OW4A 2BL0B 2JXCA 4I5NB 4CPVA 1ZOTB 1CDNA 4NDDA 3BUOB 1QXPA 3CDNA 1LXFC 1ALVA 2WC5A 3FE9A 4GAOA 1SK6D 3DXLA 2I2RE 3K1EA 2PASA 1FI6A 4PHMA 1SCMC 3DYEA 2LV7A 4IJ7A 1KK8B 2BBMA 2JC2A 4BY5A 1B8RA 1PVAA 3RM1A 1QATA 1YUTA 1AHRA 2LHIA 4R1EA 2JWWA 1JF0A 4GGNA 1IRJA 1NX1A 5FI2A 4UPGA 1BG1A 3EVVA 2E6WA 1OE9B 2BCBA 2JXLA 5CSNA 1GGWA 1DC1A 1AK8A 2I94A 1K2HA 1QLSA 2QDIA 3B86A 5D3OA 1JBAA 4OZDA 3SS5A 2PYQA 1SYMA 3ZWHA 2WORA 1OMDA 1R6PA 2BAPA 2LVVA 2K0JA 2KI6C 2OTGC 1K96A 3EG5B 4DRWA 2JT8A 3KHEA 1S36A 4ORCB 1K94A 2RGIA 5GQQC 1Z2CB 1Y0VH 2BE6A 1IKUA 1B7TZ 1EL4A 2L5XB 4WRIA 4PE1A 3TS5B 2LHLA 2EHBA 3FS7A 3B6XA 4FTGA 3LL8B 3S0DA 1FI5A 1XA5A 2BKIB 1B7TY 2BECA 5CSJA 3OX5A 2GGMA 1K8UA 2PALA 1DJGA 3VRRA 1UP5A 4NQGA 3CABA 3KEVA 5AANA 1DJZA 2KNEA 1DVIA 3TDIA 3VRQA 1TCFA 3S0BA 1FPWA 1F4OA 1KWOB 1GQMA 2A4JA 3CLNA 3KF9A 1EH2A 2JRFA 3O6BA 4PE7A 1S1EA 5KU1A 2KAYA 1UHJA 1YR5A 3NHIA 3DZTA 2F33A 1WDCB 1J55A 2K7BA 3S0FA 1N0YA 1F70A 4HRHA 4E68A 3IVTA 2KBIA 3DD4A 3CTNA 2L2CA 3EK7A 1NCZA 2Y1MA 5FI7A 1UHNA 3R1VA 1Z4HA 1G4YR 2KI4C 2MLFC 3D76A 4YGBB 1XK4A 3K21A 1GM0A 1WLZA 2WCBA 3BUMB 3PATA 2Q91A 3CS1A 5J3XA 2L98A 3SS3A 3LK0A 1IIOA 1M46A 4XJKB 2JTTA 3SG7A 3PJIA 1Q80A 1ALWA 1VRKA 1YVHA 2GGZA 3CZTX 1PULA 3D75A 1CNPA 5HKWA 3LCPC 3PLFB
chains in the Genus database with same CATH topology
3HX4A 3IQOA 3OX6A 2BBNA 4MN0A 1FF1A 4M2PA 3O4YA 2ZRSA 2V53A 1DJIA 2EC6B 1OOJA 1AUIB 2LLSA 3I5HB 5HKZA 1NWDA 4U8DA 1BT6A 1ZUZA 3BYAA 1UHIA 4OV2A 4NDBA 1TNPA 3CR5X 4WQ3A 1J1EA 1SR6C 5FYXA 1MWNA 1S6CA 2CBLA 3AKBA 2ISDA 3EVRA 1F54A 4GGFA 2Y5IA 3BQ3A 3LLEA 4PHNA 1KQMC 5HLOA 2FCDA 4CFRA 1NP8A 4HREE 3PN7C 1WRZA 2LC5A 2LVJA 1S26D 3IQQA 5D69A 2M3WA 2B1UA 1NPQA 4GFTA 4GGFC 1J7RA 4PHJA 3BUWB 1WRKA 1G8IA 2CNPA 1DJXA 1PSRA 1UHKA 4ZCUA 1SBJA 1DF0B 1DGUA 1QX2A 1NIWA 1RWYA 5BPJA 1IGVA 1S5GY 3I5GB 3SG2A 4ETOA 1A03A 1F71A 1YURA 1NYAA 1YX8A 1YVLA 5KSZA 1F55A 2CCMA 4D1EA 1QJTA 1QX7A 3VRNA 3JVTB 5ER4X 1LA3A 4HRGA 1NSHA 3A8RA 1ZMZA 2JOJA 4GBAA 1KK7Z 1B47A 1IWQA 2KGRA 3KO0A 1XFZO 4DUQA 3BUNB 3EK4A 3CR4X 1ODBA 1Y6WA 2LNKA 1YRTB 1AJ4A 1EG4A 2HF5A 3BUXB 2R2IA 1RTP1 2IS9A 1KFXS 4MZKA 1TNWA 1N2DA 1A2XA 1ZACA 5CSIA 1RJVA 2ZNDA 3BOWB 2Q4UA 4L9MA 1MF8B 2LMUA 2F3YA 3I5IB 1KFUS 4QJ4B 2PMYA 1GGZA 4YRUA 5TNCA 1XFVO 2OS8C 1WY9A 2P6BB 3I5FC 3SIAA 3SG4A 3M0WA 4I5LB 1LVCD 3PALA 2CTNA 3D10A 2M7NA 3AKAA 3CGAA 4MLWA 1J7PA 2KSPA 1DTLA 5ER5A 1B9AA 1XFXO 2ZNEA 4M2OA 2OTGB 5JOLA 1SKTA 4BY4A 1CDPA 4M2QA 2LUXA 2QACA 4OR9B 2EGDA 1JWDA 2M7LA 1TN4A 4DCKA 1W7JB 1M63B 3C1VA 1S5GZ 2JULA 1DMOA 3O2PA 2JT3A 3FWCA 5CSFA 4YBHB 5KTYA 1BU3A 1TTXA 2KYFA 4YGCB 2WNDA 2K2AA 2L2EA 2WC8A 5HYDA 3JTDC 1KCYA 1KWOC 2COLB 2NXQA 1L2OB 4MRXA 2M9GA 4P5OE 5I2LA 4A4CA 2ZN8A 1WRLA 3CR2A 3QRXA 1K9UA 1CM4A 3D0YB 1WDCC 3WHUB 4PCWA 1TIZA 2WCFA 2MBXA 1Y1XA 1MR8A 3GOFA 3KPXA 1QIWA 1QV1A 1F4QA 4ORBB 1A29A 5DKQA 2KQ6A 4C0LA 1QIVA 1S6JA 1PVBA 2LMVA 1OZSA 2BCAA 2BCXA 1SCVA 2SASA 1CFPA 1NCXA 4JQ0D 4ORAB 1SCMB 4PHKA 3WNXB 1QVIZ 1F8HA 2KHNA 1MUXA 1M31A 1MXLC 2AAOA 3VROA 1Y1UA 1YRUB 1IQ3A 3DVMA 3NSIA 4YGDB 1CM1A 2JTZA 1W7IB 2CXJA 1V1FA 2JQ6A 2MLEC 3DVEA 1C7VA 1A4PA 1CDLA 2H61A 2MJWB 3H4SE 4OCIA 2I18A 2LE9B 1D1OA 3WHTB 1PSBA 2JNXA 2FCEA 1OSAA 1CLLA 2MAZA 3DVJA 3DVKA 1BR1B 5HKYA 3TS5C 4AOMA 1DJYA 2K7DA 2M29A 1XVJA 2BKHB 5AFPA 2FOTA 1K95A 4AQIA 1SL7A 4USLA 1DJWA 5D7FA 1CLBA 2QPTA 2WOSA 1AVSA 1N65A 1JF2A 4NDCA 1S6IA 2LLTA 3BOWA 4MVFA 1K90D 1JSAA 1A75A 4N1GA 4YI8A 2M49B 2F2PA 1E8AA 3EVUA 1S3PA 1NCYA 3VRPA 1BODA 1QLKA 2NCOA 2OPOA 4ZCVA 4DS7A 4XJKA 1CB1A 1SMGA 5F6TA 1BF5A 3JVTC 1HT9A 3ICBA 4YGEB 1JC2A 1CMGA 2KI4B 5AEQA 1PALA 1UURA 1X02A 2LANA 4OVNF 2K2FA 1G33A 2KGBC 4QJ5B 4C0KA 1C07A 4F0ZB 1KK7Y 1TNXA 1MXEA 4DIRA 1U5IA 3PSRA 1DT7B 1NX2A 2JZIA 1H4BA 1ZFSA 2PVBA 1XFWO 3FWBA 3TZ1A 2PRUA 2ZN9A 1CMFA 1J7OA 1HQVA 2L0PA 4MZLA 4I5KA 2KAXA 2M97A 1SL9A 4Q04A 1NX3A 3SJSA 1LA0A 1YUUA 3I5FB 1RROA 4I5JA 1IG5A 4PALA 1CFCA 2NZ0A 3DF0A 1K93D 4CFQA 3AAJA 3SG5A 3NSKA 2K61A 1BOCA 2K8MB 3WXAA 1K9PA 1JFJA 3TUYB 1QVIY 1SR6B 5JJGA 5I2QA 1AP4A 2BL0C 1Y1AA 3RLZA 2G9BA 1SRAA 1UHHA 2ZFDA 2LVKA 4WQ2A 3OB1B 1KK8C 2O5GA 1XK4C 5DKNA 1M45A 2LP2A 2AUCA 1JFKA 3O78A 5PALA 2VRGA 2H2KA 4JWQA 2PSRA 4YGAA 2KFGA 1RK9A 1BLQA 1CFFA 2LMTA 3SG3A 2MHHA 2HETA 2EC6C 1IH0A 2D8NA 2FJUB 1AJ5A 1UWOA 1V1GA 4GNKB 4HSZA 2HPSA 1OQPA 1DF0A 1YUSA 1LINA 3D0YA 4AQJA 1MQ1A 1SPYA 2ZKMX 4MRYA 2LUCA 5K89A 1TOPA 2F2OA 2M1KB 1BR4B 2M0RA 1JUOA 3A4UB 3TDUA 4GPLB 4PE0A 3PN7B 1R2UA 1PK0D 1PRWA 3PFVA 2JT0A 1XFUO 3PM8A 5AERA 1XO5A 1KFUL 3OB2B 2M1UA 1UUSA 3F45A 1SNLA 2KYCA 1SY9A 3ZNIA 3I5IC 2Y1NA 1M39A 2L4HA 1GJYA 1KFXL 1LKJA 2KBMA 1DGVA 1J7QA 4GUKA 3LK1A 3TDZA 1XYDA 2BE4A 1B1GA 3SIBA 1TCOB 1BMOA 3EKHA 4C0JA 3E3RA 2Y4QA 2HQWA 5HLVA 2M8UA 2O60A 1TNQA 4ICBA 2KFFA 1OMVA 1QTXA 3OP0A 1CDMA 2H61C 5AXIA 1MHOA 3GK4X 1SW8A 1IJ5A 4MBEA 5DKRA 3SG6A 1XFYO 1QASA 2JPTA 3GK2A 2KQYA 1IJ6A 2TN4A 2K7OA 4CLNA 2KFHA 2L51A 1CKKA 1B4CA 1CFDA 1YX7A 4P2YB 1QS7A 3EK8A 3NSOA 3GK1A 2KAVA 2DOQA 4A4BA 2LM5A 2G2BA 1EXRA 5B8IB 2OS8B 1SL8A 2MA2A 2CT9A 2AMIA 3IF7A 4IL1A 2JU0A 1B8LA 1CTRA 3I5HC 1EG3A 4MSPA 5G08A 4FQOA 1K9KA 1OMRA 1FBVA 4MZJA 4PDZA 2K7CA 3DF0B 1NX0A 1WLMA 3NSLA 3NXAA 2GV5A 1TRFA 5CPVA 1OZOA 1KQMB 2MRDA 1KSOA 2WCEA 2HQ8A 1U5IB 1C7WA 2I7AA 3AAKA 3CWGA 1BJFA 4CIDA 1NUBA 1L7ZA 1B8CA 2SCPA 4N5XA 4QJ3B 2KOTA 4TNCA 2LP3A 2KI6D 2LAPA 1J1DA 3JTDB 3VGOA 2ZRTA 5I2OA 1IQ5A 2LLUA 2LCPA 3I5GC 1L2OC 4XYNA 3EKJA 1DJHA 4MEWA 1RECA 4JPZB 1YTZC 5IBWA 1H8BA 3HCMA 4YI9A 5I8NA 1A75B 2JNFA 4PE4A 1EJ3A 1FW4A 3MSEB 1KSMA 2KDHA 1CLMA 1QV0A 2L4IA 3OHMB 4N1FA 4OKHA 3TUYC 1KQVA 2F8PA 2F3ZA 2L50A 2E30A 2NCPA 3FIAA 1RFJA 1QX5B 2LVIA 3BXKA 2NLNA 4I5NB 2BL0B 2JXCA 1CDNA 4CPVA 1ZOTB 4NDDA 3BUOB 1QXPA 1LXFC 1ALVA 4GAOA 1SK6D 2I2RE 2PASA 1FI6A 4PHMA 1SCMC 2LV7A 1KK8B 2BBMA 2JC2A 4BY5A 1B8RA 1PVAA 3RM1A 1QATA 1YUTA 1AHRA 2LHIA 4R1EA 2JWWA 1JF0A 4GGNA 1IRJA 1NX1A 4UPGA 1BG1A 3EVVA 2E6WA 1OE9B 2BCBA 2JXLA 5CSNA 1GGWA 1AK8A 2I94A 1K2HA 1QLSA 1JBAA 1SYMA 3ZWHA 2WORA 1OMDA 1R6PA 2LVVA 2K0JA 2KI6C 2OTGC 1K96A 4DRWA 2JT8A 3KHEA 1S36A 4ORCB 1K94A 2RGIA 5GQQC 1Y0VH 2BE6A 1IKUA 1B7TZ 1EL4A 2L5XB 4WRIA 4PE1A 3TS5B 2LHLA 2EHBA 3FS7A 4FTGA 3LL8B 1FI5A 1XA5A 2BKIB 1B7TY 2BECA 5CSJA 3OX5A 2GGMA 1K8UA 2PALA 1DJGA 3VRRA 1UP5A 4NQGA 5AANA 3KEVA 1DJZA 2KNEA 1DVIA 3TDIA 3VRQA 1TCFA 1FPWA 1F4OA 1KWOB 1GQMA 2A4JA 3CLNA 3KF9A 1EH2A 2JRFA 3O6BA 4PE7A 1S1EA 5KU1A 2KAYA 1UHJA 1YR5A 2F33A 1WDCB 1J55A 2K7BA 1N0YA 1F70A 4HRHA 4E68A 2KBIA 3DD4A 3CTNA 3EK7A 1NCZA 2Y1MA 1UHNA 1G4YR 2KI4C 2MLFC 4YGBB 1XK4A 3K21A 1WLZA 2WCBA 3BUMB 3PATA 2Q91A 3CS1A 5J3XA 2L98A 3LK0A 1M46A 4XJKB 2JTTA 3SG7A 1Q80A 1ALWA 1VRKA 1YVHA 2GGZA 3CZTX 1PULA 1CNPA 5HKWA 3LCPC 3PLFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HX4 A;  3IQO A;  3OX6 A;  2BBN A;  4MN0 A;  1FF1 A;  4M2P A;  3O4Y A;  2ZRS A;  2V53 A;  1DJI A;  2EC6 B;  1OOJ A;  1AUI B;  2LLS A;  3I5H B;  5HKZ A;  1NWD A;  4U8D A;  1BT6 A;  1ZUZ A;  3BYA A;  1UHI A;  4OV2 A;  4NDB A;  1TNP A;  3CR5 X;  4WQ3 A;  1J1E A;  1SR6 C;  5FYX A;  1MWN A;  1S6C A;  2CBL A;  3AKB A;  2ISD A;  3EVR A;  1F54 A;  4GGF A;  2Y5I A;  3BQ3 A;  3LLE A;  4PHN A;  1KQM C;  5HLO A;  2FCD A;  4CFR A;  1NP8 A;  4HRE E;  3PN7 C;  1WRZ A;  2LC5 A;  2LVJ A;  1S26 D;  3IQQ A;  5D69 A;  2M3W A;  2B1U A;  1NPQ A;  4GFT A;  4GGF C;  1J7R A;  4PHJ A;  3BUW B;  1WRK A;  1G8I A;  2CNP A;  1DJX A;  1PSR A;  1UHK A;  4ZCU A;  1SBJ A;  1DF0 B;  1DGU A;  1QX2 A;  1NIW A;  1RWY A;  5BPJ A;  1IGV A;  1S5G Y;  3I5G B;  3SG2 A;  4ETO A;  1A03 A;  1F71 A;  1YUR A;  1NYA A;  1YX8 A;  1YVL A;  5KSZ A;  1F55 A;  2CCM A;  4D1E A;  1QJT A;  1QX7 A;  3VRN A;  3JVT B;  5ER4 X;  1LA3 A;  4HRG A;  1NSH A;  3A8R A;  1ZMZ A;  2JOJ A;  4GBA A;  1KK7 Z;  1B47 A;  1IWQ A;  2KGR A;  3KO0 A;  1XFZ O;  4DUQ A;  3BUN B;  3EK4 A;  3CR4 X;  1ODB A;  1Y6W A;  2LNK A;  1YRT B;  1AJ4 A;  1EG4 A;  2HF5 A;  3BUX B;  2R2I A;  1RTP 1;  2IS9 A;  1KFX S;  4MZK A;  1TNW A;  1N2D A;  1A2X A;  1ZAC A;  5CSI A;  1RJV A;  2ZND A;  3BOW B;  2Q4U A;  4L9M A;  1MF8 B;  2LMU A;  2F3Y A;  3I5I B;  1KFU S;  4QJ4 B;  2PMY A;  1GGZ A;  4YRU A;  5TNC A;  1XFV O;  2OS8 C;  1WY9 A;  2P6B B;  3I5F C;  3SIA A;  3SG4 A;  3M0W A;  4I5L B;  1LVC D;  3PAL A;  2CTN A;  3D10 A;  2M7N A;  3AKA A;  3CGA A;  4MLW A;  1J7P A;  2KSP A;  1DTL A;  5ER5 A;  1B9A A;  1XFX O;  2ZNE A;  4M2O A;  2OTG B;  5JOL A;  1SKT A;  4BY4 A;  1CDP A;  4M2Q A;  2LUX A;  2QAC A;  4OR9 B;  2EGD A;  1JWD A;  2M7L A;  1TN4 A;  4DCK A;  1W7J B;  1M63 B;  3C1V A;  1S5G Z;  2JUL A;  1DMO A;  3O2P A;  2JT3 A;  3FWC A;  5CSF A;  4YBH B;  5KTY A;  1BU3 A;  1TTX A;  2KYF A;  4YGC B;  2WND A;  2K2A A;  2L2E A;  2WC8 A;  5HYD A;  3JTD C;  1KCY A;  1KWO C;  2COL B;  2NXQ A;  1L2O B;  4MRX A;  2M9G A;  4P5O E;  5I2L A;  4A4C A;  2ZN8 A;  1WRL A;  3CR2 A;  3QRX A;  1K9U A;  1CM4 A;  3D0Y B;  1WDC C;  3WHU B;  4PCW A;  1TIZ A;  2WCF A;  2MBX A;  1Y1X A;  1MR8 A;  3GOF A;  3KPX A;  1QIW A;  1QV1 A;  1F4Q A;  4ORB B;  1A29 A;  5DKQ A;  2KQ6 A;  4C0L A;  1QIV A;  1S6J A;  1PVB A;  2LMV A;  1OZS A;  2BCA A;  2BCX A;  1SCV A;  2SAS A;  1CFP A;  1NCX A;  4JQ0 D;  4ORA B;  1SCM B;  4PHK A;  3WNX B;  1QVI Z;  1F8H A;  2KHN A;  1MUX A;  1M31 A;  1MXL C;  2AAO A;  3VRO A;  1Y1U A;  1YRU B;  1IQ3 A;  3DVM A;  3NSI A;  4YGD B;  1CM1 A;  2JTZ A;  1W7I B;  2CXJ A;  1V1F A;  2JQ6 A;  2MLE C;  3DVE A;  1C7V A;  1A4P A;  1CDL A;  2H61 A;  2MJW B;  3H4S E;  4OCI A;  2I18 A;  2LE9 B;  1D1O A;  3WHT B;  1PSB A;  2JNX A;  2FCE A;  1OSA A;  1CLL A;  2MAZ A;  3DVJ A;  3DVK A;  1BR1 B;  5HKY A;  3TS5 C;  4AOM A;  1DJY A;  2K7D A;  2M29 A;  1XVJ A;  2BKH B;  5AFP A;  2FOT A;  1K95 A;  4AQI A;  1SL7 A;  4USL A;  1DJW A;  5D7F A;  1CLB A;  2QPT A;  2WOS A;  1AVS A;  1N65 A;  1JF2 A;  4NDC A;  1S6I A;  2LLT A;  3BOW A;  4MVF A;  1K90 D;  1JSA A;  1A75 A;  4N1G A;  4YI8 A;  2M49 B;  2F2P A;  1E8A A;  3EVU A;  1S3P A;  1NCY A;  3VRP A;  1BOD A;  1QLK A;  2NCO A;  2OPO A;  4ZCV A;  4DS7 A;  4XJK A;  1CB1 A;  1SMG A;  5F6T A;  1BF5 A;  3JVT C;  1HT9 A;  3ICB A;  4YGE B;  1JC2 A;  1CMG A;  2KI4 B;  5AEQ A;  1PAL A;  1UUR A;  1X02 A;  2LAN A;  4OVN F;  2K2F A;  1G33 A;  2KGB C;  4QJ5 B;  4C0K A;  1C07 A;  4F0Z B;  1KK7 Y;  1TNX A;  1MXE A;  4DIR A;  1U5I A;  3PSR A;  1DT7 B;  1NX2 A;  2JZI A;  1H4B A;  1ZFS A;  2PVB A;  1XFW O;  3FWB A;  3TZ1 A;  2PRU A;  2ZN9 A;  1CMF A;  1J7O A;  1HQV A;  2L0P A;  4MZL A;  4I5K A;  2KAX A;  2M97 A;  1SL9 A;  4Q04 A;  1NX3 A;  3SJS A;  1LA0 A;  1YUU A;  3I5F B;  1RRO A;  4I5J A;  1IG5 A;  4PAL A;  1CFC A;  2NZ0 A;  3DF0 A;  1K93 D;  4CFQ A;  3AAJ A;  3SG5 A;  3NSK A;  2K61 A;  1BOC A;  2K8M B;  3WXA A;  1K9P A;  1JFJ A;  3TUY B;  1QVI Y;  1SR6 B;  5JJG A;  5I2Q A;  1AP4 A;  2BL0 C;  1Y1A A;  3RLZ A;  2G9B A;  1SRA A;  1UHH A;  2ZFD A;  2LVK A;  4WQ2 A;  3OB1 B;  1KK8 C;  2O5G A;  1XK4 C;  5DKN A;  1M45 A;  2LP2 A;  2AUC A;  1JFK A;  3O78 A;  5PAL A;  2VRG A;  2H2K A;  4JWQ A;  2PSR A;  4YGA A;  2KFG A;  1RK9 A;  1BLQ A;  1CFF A;  2LMT A;  3SG3 A;  2MHH A;  2HET A;  2EC6 C;  1IH0 A;  2D8N A;  2FJU B;  1AJ5 A;  1UWO A;  1V1G A;  4GNK B;  4HSZ A;  2HPS A;  1OQP A;  1DF0 A;  1YUS A;  1LIN A;  3D0Y A;  4AQJ A;  1MQ1 A;  1SPY A;  2ZKM X;  4MRY A;  2LUC A;  5K89 A;  1TOP A;  2F2O A;  2M1K B;  1BR4 B;  2M0R A;  1JUO A;  3A4U B;  3TDU A;  4GPL B;  4PE0 A;  3PN7 B;  1R2U A;  1PK0 D;  1PRW A;  3PFV A;  2JT0 A;  1XFU O;  3PM8 A;  5AER A;  1XO5 A;  1KFU L;  3OB2 B;  2M1U A;  1UUS A;  3F45 A;  1SNL A;  2KYC A;  1SY9 A;  3ZNI A;  3I5I C;  2Y1N A;  1M39 A;  2L4H A;  1GJY A;  1KFX L;  1LKJ A;  2KBM A;  1DGV A;  1J7Q A;  4GUK A;  3LK1 A;  3TDZ A;  1XYD A;  2BE4 A;  1B1G A;  3SIB A;  1TCO B;  1BMO A;  3EKH A;  4C0J A;  3E3R A;  2Y4Q A;  2HQW A;  5HLV A;  2M8U A;  2O60 A;  1TNQ A;  4ICB A;  2KFF A;  1OMV A;  1QTX A;  3OP0 A;  1CDM A;  2H61 C;  5AXI A;  1MHO A;  3GK4 X;  1SW8 A;  1IJ5 A;  4MBE A;  5DKR A;  3SG6 A;  1XFY O;  1QAS A;  2JPT A;  3GK2 A;  2KQY A;  1IJ6 A;  2TN4 A;  2K7O A;  4CLN A;  2KFH A;  2L51 A;  1CKK A;  1B4C A;  1CFD A;  1YX7 A;  4P2Y B;  1QS7 A;  3EK8 A;  3NSO A;  3GK1 A;  2KAV A;  2DOQ A;  4A4B A;  2LM5 A;  2G2B A;  1EXR A;  5B8I B;  2OS8 B;  1SL8 A;  2MA2 A;  2CT9 A;  2AMI A;  3IF7 A;  4IL1 A;  2JU0 A;  1B8L A;  1CTR A;  3I5H C;  1EG3 A;  4MSP A;  5G08 A;  4FQO A;  1K9K A;  1OMR A;  1FBV A;  4MZJ A;  4PDZ A;  2K7C A;  3DF0 B;  1NX0 A;  1WLM A;  3NSL A;  3NXA A;  2GV5 A;  1TRF A;  5CPV A;  1OZO A;  1KQM B;  2MRD A;  1KSO A;  2WCE A;  2HQ8 A;  1U5I B;  1C7W A;  2I7A A;  3AAK A;  3CWG A;  1BJF A;  4CID A;  1NUB A;  1L7Z A;  1B8C A;  2SCP A;  4N5X A;  4QJ3 B;  2KOT A;  4TNC A;  2LP3 A;  2KI6 D;  2LAP A;  1J1D A;  3JTD B;  3VGO A;  2ZRT A;  5I2O A;  1IQ5 A;  2LLU A;  2LCP A;  3I5G C;  1L2O C;  4XYN A;  3EKJ A;  1DJH A;  4MEW A;  1REC A;  4JPZ B;  1YTZ C;  5IBW A;  1H8B A;  3HCM A;  4YI9 A;  5I8N A;  1A75 B;  2JNF A;  4PE4 A;  1EJ3 A;  1FW4 A;  3MSE B;  1KSM A;  2KDH A;  1CLM A;  1QV0 A;  2L4I A;  3OHM B;  4N1F A;  4OKH A;  3TUY C;  1KQV A;  2F8P A;  2F3Z A;  2L50 A;  2E30 A;  2NCP A;  3FIA A;  1RFJ A;  1QX5 B;  2LVI A;  3BXK A;  2NLN A;  4I5N B;  2BL0 B;  2JXC A;  1CDN A;  4CPV A;  1ZOT B;  4NDD A;  3BUO B;  1QXP A;  1LXF C;  1ALV A;  4GAO A;  1SK6 D;  2I2R E;  2PAS A;  1FI6 A;  4PHM A;  1SCM C;  2LV7 A;  1KK8 B;  2BBM A;  2JC2 A;  4BY5 A;  1B8R A;  1PVA A;  3RM1 A;  1QAT A;  1YUT A;  1AHR A;  2LHI A;  4R1E A;  2JWW A;  1JF0 A;  4GGN A;  1IRJ A;  1NX1 A;  4UPG A;  1BG1 A;  3EVV A;  2E6W A;  1OE9 B;  2BCB A;  2JXL A;  5CSN A;  1GGW A;  1AK8 A;  2I94 A;  1K2H A;  1QLS A;  1JBA A;  1SYM A;  3ZWH A;  2WOR A;  1OMD A;  1R6P A;  2LVV A;  2K0J A;  2KI6 C;  2OTG C;  1K96 A;  4DRW A;  2JT8 A;  3KHE A;  1S36 A;  4ORC B;  1K94 A;  2RGI A;  5GQQ C;  1Y0V H;  2BE6 A;  1IKU A;  1B7T Z;  1EL4 A;  2L5X B;  4WRI A;  4PE1 A;  3TS5 B;  2LHL A;  2EHB A;  3FS7 A;  4FTG A;  3LL8 B;  1FI5 A;  1XA5 A;  2BKI B;  1B7T Y;  2BEC A;  5CSJ A;  3OX5 A;  2GGM A;  1K8U A;  2PAL A;  1DJG A;  3VRR A;  1UP5 A;  4NQG A;  5AAN A;  3KEV A;  1DJZ A;  2KNE A;  1DVI A;  3TDI A;  3VRQ A;  1TCF A;  1FPW A;  1F4O A;  1KWO B;  1GQM A;  2A4J A;  3CLN A;  3KF9 A;  1EH2 A;  2JRF A;  3O6B A;  4PE7 A;  1S1E A;  5KU1 A;  2KAY A;  1UHJ A;  1YR5 A;  2F33 A;  1WDC B;  1J55 A;  2K7B A;  1N0Y A;  1F70 A;  4HRH A;  4E68 A;  2KBI A;  3DD4 A;  3CTN A;  3EK7 A;  1NCZ A;  2Y1M A;  1UHN A;  1G4Y R;  2KI4 C;  2MLF C;  4YGB B;  1XK4 A;  3K21 A;  1WLZ A;  2WCB A;  3BUM B;  3PAT A;  2Q91 A;  3CS1 A;  5J3X A;  2L98 A;  3LK0 A;  1M46 A;  4XJK B;  2JTT A;  3SG7 A;  1Q80 A;  1ALW A;  1VRK A;  1YVH A;  2GGZ A;  3CZT X;  1PUL A;  1CNP A;  5HKW A;  3LCP C;  3PLF B; 
#chains in the Genus database with same CATH topology
 3HX4 A;  3IQO A;  3OX6 A;  2BBN A;  4MN0 A;  1W9Z A;  1QWV A;  1FF1 A;  4M2P A;  3O4Y A;  2ZRS A;  2V53 A;  1DJI A;  2EC6 B;  1OOJ A;  1AUI B;  2LLS A;  3I5H B;  2BNX A;  5HKZ A;  1NWD A;  4U8D A;  1BT6 A;  1ZUZ A;  3BYA A;  1UHI A;  2KLE A;  4OV2 A;  4NDB A;  1TNP A;  3CR5 X;  4WQ3 A;  1J1E A;  1SR6 C;  5FYX A;  3FE6 A;  1MWN A;  1S6C A;  2CBL A;  3AKB A;  2ISD A;  3EVR A;  1F54 A;  4GGF A;  2Y5I A;  3BQ3 A;  3LLE A;  4PHN A;  1KQM C;  3BFB A;  2FCD A;  5HLO A;  4CFR A;  1NP8 A;  4HRE E;  2GTE A;  3PN7 C;  1WRZ A;  2LC5 A;  2LVJ A;  1S26 D;  3IQQ A;  5D69 A;  2M3W A;  3S0G A;  2B1U A;  1NPQ A;  4GFT A;  3CZ0 A;  4GGF C;  1J7R A;  4PHJ A;  3BUW B;  1WRK A;  1P28 A;  2QEH A;  1G8I A;  2CNP A;  1DJX A;  1PSR A;  1UHK A;  4ZCU A;  1SBJ A;  1DF0 B;  1DGU A;  1QX2 A;  1NIW A;  1RWY A;  5BPJ A;  1IGV A;  1S5G Y;  3I5G B;  3SG2 A;  4ETO A;  1A03 A;  1F71 A;  1YUR A;  1NYA A;  1YX8 A;  3UNW A;  1YVL A;  5KSZ A;  1F55 A;  2CCM A;  3PM2 A;  4D1E A;  1QJT A;  1QX7 A;  3VRN A;  3JVT B;  5ER4 X;  1LA3 A;  4HRG A;  1NSH A;  3A8R A;  1ZMZ A;  2JOJ A;  4GBA A;  1KK7 Z;  1B47 A;  2K60 A;  1IWQ A;  2KGR A;  1OOI X;  1OOH A;  1XFZ O;  3KO0 A;  3BUN B;  3EK4 A;  4DUQ A;  3CR4 X;  1ODB A;  1Y6W A;  2LNK A;  1YRT B;  1AJ4 A;  1EG4 A;  2HF5 A;  3BUX B;  2R2I A;  1RTP 1;  3NGV A;  2IS9 A;  3R1O A;  1KFX S;  4MZK A;  1TNW A;  1N2D A;  1C3Z A;  1A2X A;  3R72 A;  1ZAC A;  5CSI A;  1RJV A;  2ZND A;  3BOW B;  2Q4U A;  4L9M A;  4INX A;  1MF8 B;  2LMU A;  2F3Y A;  3I5I B;  1KFU S;  1DEL A;  2PMY A;  1GGZ A;  2ERB A;  4QJ4 B;  4YRU A;  5TNC A;  2P70 A;  1XFV O;  2OS8 C;  1WY9 A;  2P6B B;  3I5F C;  3SIA A;  3SG4 A;  3M0W A;  4I5L B;  1LVC D;  3PAL A;  2CTN A;  3D10 A;  2M7N A;  3AKA A;  3CGA A;  1TUJ A;  2QEV A;  4MLW A;  1J7P A;  2KSP A;  1DTL A;  5ER5 A;  1B9A A;  1XFX O;  2ZNE A;  4M2O A;  2OTG B;  5JOL A;  1SKT A;  4BY4 A;  1CDP A;  4M2Q A;  2LUX A;  2QAC A;  4OR9 B;  2EGD A;  3N7H A;  1JWD A;  2M7L A;  1TN4 A;  4DCK A;  1W7J B;  1M63 B;  3C1V A;  1S5G Z;  2JUL A;  1DMO A;  3O2P A;  2JT3 A;  3D78 A;  3FWC A;  5CSF A;  4YBH B;  3UO9 A;  5KTY A;  1BU3 A;  1TTX A;  2KYF A;  4YGC B;  2WND A;  3B88 A;  2K2A A;  2L2E A;  2WC8 A;  5HYD A;  3JTD C;  1KCY A;  1KWO C;  2COL B;  2NXQ A;  1L2O B;  4MRX A;  2M9G A;  4P5O E;  5I2L A;  4A4C A;  2ZN8 A;  1WRL A;  3CR2 A;  3QRX A;  3O4X A;  1K9U A;  1CM4 A;  1C3Y A;  3D0Y B;  1WDC C;  1TUZ A;  3WHU B;  4PCW A;  1TIZ A;  2WCF A;  2MBX A;  1Y1X A;  1MR8 A;  3GOF A;  3KPX A;  1QIW A;  1QV1 A;  1F4Q A;  4ORB B;  1A29 A;  5DKQ A;  2KQ6 A;  4C0L A;  1QIV A;  1S6J A;  1PVB A;  2LMV A;  1OZS A;  1XFR A;  2BCA A;  2BCX A;  2QEB A;  1SCV A;  2SAS A;  1CFP A;  1NCX A;  4JQ0 D;  3NHT A;  4ORA B;  1SCM B;  4PHK A;  3WNX B;  1QVI Z;  1F8H A;  2KHN A;  1MUX A;  1M31 A;  1MXL C;  2AAO A;  2WCL A;  3VRO A;  3B87 A;  5I94 A;  1Y1U A;  1YRU B;  1IQ3 A;  3DVM A;  3NSI A;  4YGD B;  1CM1 A;  2JTZ A;  1W7I B;  3OGN A;  2CXJ A;  1V1F A;  2JQ6 A;  2MLE C;  3DVE A;  1C7V A;  1A4P A;  1CDL A;  4INW A;  2H61 A;  2MJW B;  3H4S E;  4OCI A;  2I18 A;  2LE9 B;  1D1O A;  3WHT B;  1SSE B;  1PSB A;  2JNX A;  2FCE A;  1OSA A;  1CLL A;  2MAZ A;  3CZ1 A;  3DVJ A;  3DVK A;  1ORG A;  1BR1 B;  5HKY A;  3TS5 C;  4AOM A;  1DJY A;  2K7D A;  2M29 A;  1XVJ A;  2BKH B;  5AFP A;  2FOT A;  1K95 A;  4AQI A;  1SL7 A;  4USL A;  1DJW A;  5D7F A;  1CLB A;  2QPT A;  2WOS A;  1AVS A;  1N65 A;  1JF2 A;  4NDC A;  3D74 A;  1S6I A;  2LLT A;  4FQT A;  3BOW A;  3Q8I A;  4MVF A;  3BFH A;  1K90 D;  1JSA A;  1A75 A;  4N1G A;  4YI8 A;  2M49 B;  5FI6 A;  2F2P A;  1E8A A;  3EVU A;  1S3P A;  1NCY A;  3D73 A;  3VRP A;  1BOD A;  1QLK A;  2NCO A;  2OPO A;  4ZCV A;  4DS7 A;  4XJK A;  1CB1 A;  1SMG A;  5F6T A;  1BF5 A;  3JVT C;  1HT9 A;  3L47 A;  3ICB A;  4YGE B;  4PT1 A;  1JC2 A;  1CMG A;  2KI4 B;  5AEQ A;  1PAL A;  1DQE A;  1UUR A;  1X02 A;  2LAN A;  2K2F A;  1G33 A;  2KGB C;  4OVN F;  4C0K A;  4QJ5 B;  4F0Z B;  1C07 A;  1KK7 Y;  1TNX A;  1MXE A;  4DIR A;  1U5I A;  3PSR A;  1DT7 B;  1NX2 A;  2JZI A;  2FJY A;  1H4B A;  2WCJ A;  1ZFS A;  2PVB A;  3CZ2 A;  1XFW O;  3FWB A;  5EL2 A;  3TZ1 A;  2PRU A;  2ZN9 A;  1CMF A;  4KYN A;  2KLD A;  1J7O A;  1HQV A;  2L0P A;  4MZL A;  4I5K A;  2KAX A;  2M97 A;  1SL9 A;  4Q04 A;  1NX3 A;  3SJS A;  1LA0 A;  1YUU A;  3I5F B;  3FE8 A;  1RRO A;  4I5J A;  1IG5 A;  4PAL A;  1CFC A;  3S0A A;  2NZ0 A;  3DF0 A;  1K93 D;  2YGU A;  3AAJ A;  3SG5 A;  4CFQ A;  3NSK A;  2K61 A;  1BOC A;  2K8M B;  3WXA A;  1K9P A;  1JFJ A;  3TUY B;  1QVI Y;  1SR6 B;  5JJG A;  5I2Q A;  1AP4 A;  2BL0 C;  4F7F A;  1Y1A A;  3RLZ A;  2G9B A;  1SRA A;  1T14 A;  1UHH A;  2ZFD A;  2LVK A;  4WQ2 A;  3OB1 B;  1KK8 C;  2O5G A;  1XK4 C;  5DKN A;  1M45 A;  2LP2 A;  2AUC A;  1LS8 A;  1JFK A;  3O78 A;  2PQL A;  5PAL A;  3R1P A;  2QEO A;  2VRG A;  2H2K A;  4JWQ A;  1OOG A;  2PSR A;  2KFG A;  1RK9 A;  4YGA A;  1BLQ A;  2LMT A;  1CFF A;  3SG3 A;  2MHH A;  3SS4 A;  2HET A;  2EC6 C;  1IH0 A;  2D8N A;  2FJU B;  1AJ5 A;  1UWO A;  1V1G A;  4GNK B;  4HSZ A;  2HPS A;  1OQP A;  1DF0 A;  3S0E A;  1YUS A;  1LIN A;  3D0Y A;  4AQJ A;  1MQ1 A;  1SPY A;  2ZKM X;  3B7A A;  4MRY A;  2JPO A;  2LUC A;  2WCK A;  1TOP A;  2F2O A;  2M1K B;  3VB1 A;  5K89 A;  1BR4 B;  2M0R A;  1JUO A;  3A4U B;  3TDU A;  3OBV A;  4GPL B;  2WCH A;  4PE0 A;  3QME A;  3PN7 B;  1R2U A;  1PK0 D;  1PRW A;  3PFV A;  2JT0 A;  1XFU O;  3PM8 A;  5AER A;  1XO5 A;  1KFU L;  3OB2 B;  2M1U A;  1UUS A;  3F45 A;  1SNL A;  2KYC A;  1SY9 A;  3ZNI A;  3I5I C;  2Y1N A;  1M39 A;  1OOF A;  2L4H A;  1GJY A;  1KFX L;  1TWO A;  1LKJ A;  2KBM A;  1DGV A;  1J7Q A;  4GUK A;  3LK1 A;  3TDZ A;  2BE4 A;  1XYD A;  1B1G A;  2L5Y A;  3SIB A;  1TCO B;  3V2L A;  1BMO A;  3EKH A;  4C0J A;  3E3R A;  2Y4Q A;  2HQW A;  5HLV A;  3L4A A;  2M8U A;  2O60 A;  1TNQ A;  4ICB A;  2KFF A;  1OMV A;  1QTX A;  3OP0 A;  1CDM A;  2H61 C;  5AXI A;  1MHO A;  3GK4 X;  1SW8 A;  1IJ5 A;  4JD9 A;  4MBE A;  5DKR A;  3SG6 A;  1XFY O;  3DY9 A;  1QAS A;  2JPT A;  3GK2 A;  2KQY A;  1IJ6 A;  2TN4 A;  2K7O A;  4CLN A;  2KFH A;  2L51 A;  1CKK A;  4JKT A;  1B4C A;  1CFD A;  1YX7 A;  4P2Y B;  1QS7 A;  3EK8 A;  3NSO A;  2KPH A;  3GK1 A;  2KAV A;  2DOQ A;  2H8V A;  4A4B A;  2LM5 A;  2G2B A;  1EXR A;  5B8I B;  2OS8 B;  1SL8 A;  3L4L A;  2MA2 A;  3CYZ A;  2CT9 A;  2AMI A;  3IF7 A;  4IL1 A;  2JU0 A;  1B8L A;  1CTR A;  3I5H C;  1EG3 A;  2P71 A;  4MSP A;  5G08 A;  4FQO A;  1K9K A;  1OMR A;  1FBV A;  4MZJ A;  4PDZ A;  2K7C A;  3DF0 B;  1NX0 A;  1WLM A;  3NSL A;  3NXA A;  2GV5 A;  2WC6 A;  1TRF A;  5CPV A;  5DIC A;  1OZO A;  3RZS A;  1KQM B;  2WCM A;  2MRD A;  3BFA A;  1KSO A;  2WCE A;  2HQ8 A;  1U5I B;  1C7W A;  2I7A A;  3AAK A;  3CWG A;  1BJF A;  4CID A;  1NUB A;  1L7Z A;  3BJH A;  1B8C A;  1DEK A;  2SCP A;  4N5X A;  4QJ3 B;  2KOT A;  4TNC A;  2LP3 A;  2KI6 D;  2LAP A;  1J1D A;  3JTD B;  3VGO A;  2ZRT A;  5I2O A;  1IQ5 A;  2LLU A;  2LCP A;  3D77 A;  3I5G C;  1L2O C;  4XYN A;  3EKJ A;  1DJH A;  4MEW A;  1REC A;  4JPZ B;  1YTZ C;  5IBW A;  1H8B A;  3HCM A;  4YI9 A;  5I8N A;  1A75 B;  2JNF A;  4PE4 A;  1EJ3 A;  1FW4 A;  3MSE B;  1KSM A;  2KDH A;  1CLM A;  1QV0 A;  2L4I A;  3OHM B;  4N1F A;  4OKH A;  3TUY C;  1KQV A;  2F3Z A;  2F8P A;  2L50 A;  2E30 A;  2NCP A;  3FIA A;  5HL1 A;  1RFJ A;  1QX5 B;  2LVI A;  3BXK A;  2NLN A;  1OW4 A;  2BL0 B;  2JXC A;  4I5N B;  4CPV A;  1ZOT B;  1CDN A;  4NDD A;  3BUO B;  1QXP A;  3CDN A;  1LXF C;  1ALV A;  2WC5 A;  3FE9 A;  4GAO A;  1SK6 D;  3DXL A;  2I2R E;  3K1E A;  2PAS A;  1FI6 A;  4PHM A;  1SCM C;  3DYE A;  2LV7 A;  4IJ7 A;  1KK8 B;  2BBM A;  2JC2 A;  4BY5 A;  1B8R A;  1PVA A;  3RM1 A;  1QAT A;  1YUT A;  1AHR A;  2LHI A;  4R1E A;  2JWW A;  1JF0 A;  4GGN A;  1IRJ A;  1NX1 A;  5FI2 A;  4UPG A;  1BG1 A;  3EVV A;  2E6W A;  1OE9 B;  2BCB A;  2JXL A;  5CSN A;  1GGW A;  1DC1 A;  1AK8 A;  2I94 A;  1K2H A;  1QLS A;  2QDI A;  3B86 A;  5D3O A;  1JBA A;  4OZD A;  3SS5 A;  2PYQ A;  1SYM A;  3ZWH A;  2WOR A;  1OMD A;  1R6P A;  2BAP A;  2LVV A;  2K0J A;  2KI6 C;  2OTG C;  1K96 A;  3EG5 B;  4DRW A;  2JT8 A;  3KHE A;  1S36 A;  4ORC B;  1K94 A;  2RGI A;  5GQQ C;  1Z2C B;  1Y0V H;  2BE6 A;  1IKU A;  1B7T Z;  1EL4 A;  2L5X B;  4WRI A;  4PE1 A;  3TS5 B;  2LHL A;  2EHB A;  3FS7 A;  3B6X A;  4FTG A;  3LL8 B;  3S0D A;  1FI5 A;  1XA5 A;  2BKI B;  1B7T Y;  2BEC A;  5CSJ A;  3OX5 A;  2GGM A;  1K8U A;  2PAL A;  1DJG A;  3VRR A;  1UP5 A;  4NQG A;  3CAB A;  3KEV A;  5AAN A;  1DJZ A;  2KNE A;  1DVI A;  3TDI A;  3VRQ A;  1TCF A;  3S0B A;  1FPW A;  1F4O A;  1KWO B;  1GQM A;  2A4J A;  3CLN A;  3KF9 A;  1EH2 A;  2JRF A;  3O6B A;  4PE7 A;  1S1E A;  5KU1 A;  2KAY A;  1UHJ A;  1YR5 A;  3NHI A;  3DZT A;  2F33 A;  1WDC B;  1J55 A;  2K7B A;  3S0F A;  1N0Y A;  1F70 A;  4HRH A;  4E68 A;  3IVT A;  2KBI A;  3DD4 A;  3CTN A;  2L2C A;  3EK7 A;  1NCZ A;  2Y1M A;  5FI7 A;  1UHN A;  3R1V A;  1Z4H A;  1G4Y R;  2KI4 C;  2MLF C;  3D76 A;  4YGB B;  1XK4 A;  3K21 A;  1GM0 A;  1WLZ A;  2WCB A;  3BUM B;  3PAT A;  2Q91 A;  3CS1 A;  5J3X A;  2L98 A;  3SS3 A;  3LK0 A;  1IIO A;  1M46 A;  4XJK B;  2JTT A;  3SG7 A;  3PJI A;  1Q80 A;  1ALW A;  1VRK A;  1YVH A;  2GGZ A;  3CZT X;  1PUL A;  3D75 A;  1CNP A;  5HKW A;  3LCP C;  3PLF B; 
#chains in the Genus database with same CATH homology
 3HX4 A;  3IQO A;  3OX6 A;  2BBN A;  4MN0 A;  1FF1 A;  4M2P A;  3O4Y A;  2ZRS A;  2V53 A;  1DJI A;  2EC6 B;  1OOJ A;  1AUI B;  2LLS A;  3I5H B;  5HKZ A;  1NWD A;  4U8D A;  1BT6 A;  1ZUZ A;  3BYA A;  1UHI A;  4OV2 A;  4NDB A;  1TNP A;  3CR5 X;  4WQ3 A;  1J1E A;  1SR6 C;  5FYX A;  1MWN A;  1S6C A;  2CBL A;  3AKB A;  2ISD A;  3EVR A;  1F54 A;  4GGF A;  2Y5I A;  3BQ3 A;  3LLE A;  4PHN A;  1KQM C;  5HLO A;  2FCD A;  4CFR A;  1NP8 A;  4HRE E;  3PN7 C;  1WRZ A;  2LC5 A;  2LVJ A;  1S26 D;  3IQQ A;  5D69 A;  2M3W A;  2B1U A;  1NPQ A;  4GFT A;  4GGF C;  1J7R A;  4PHJ A;  3BUW B;  1WRK A;  1G8I A;  2CNP A;  1DJX A;  1PSR A;  1UHK A;  4ZCU A;  1SBJ A;  1DF0 B;  1DGU A;  1QX2 A;  1NIW A;  1RWY A;  5BPJ A;  1IGV A;  1S5G Y;  3I5G B;  3SG2 A;  4ETO A;  1A03 A;  1F71 A;  1YUR A;  1NYA A;  1YX8 A;  1YVL A;  5KSZ A;  1F55 A;  2CCM A;  4D1E A;  1QJT A;  1QX7 A;  3VRN A;  3JVT B;  5ER4 X;  1LA3 A;  4HRG A;  1NSH A;  3A8R A;  1ZMZ A;  2JOJ A;  4GBA A;  1KK7 Z;  1B47 A;  1IWQ A;  2KGR A;  3KO0 A;  1XFZ O;  4DUQ A;  3BUN B;  3EK4 A;  3CR4 X;  1ODB A;  1Y6W A;  2LNK A;  1YRT B;  1AJ4 A;  1EG4 A;  2HF5 A;  3BUX B;  2R2I A;  1RTP 1;  2IS9 A;  1KFX S;  4MZK A;  1TNW A;  1N2D A;  1A2X A;  1ZAC A;  5CSI A;  1RJV A;  2ZND A;  3BOW B;  2Q4U A;  4L9M A;  1MF8 B;  2LMU A;  2F3Y A;  3I5I B;  1KFU S;  4QJ4 B;  2PMY A;  1GGZ A;  4YRU A;  5TNC A;  1XFV O;  2OS8 C;  1WY9 A;  2P6B B;  3I5F C;  3SIA A;  3SG4 A;  3M0W A;  4I5L B;  1LVC D;  3PAL A;  2CTN A;  3D10 A;  2M7N A;  3AKA A;  3CGA A;  4MLW A;  1J7P A;  2KSP A;  1DTL A;  5ER5 A;  1B9A A;  1XFX O;  2ZNE A;  4M2O A;  2OTG B;  5JOL A;  1SKT A;  4BY4 A;  1CDP A;  4M2Q A;  2LUX A;  2QAC A;  4OR9 B;  2EGD A;  1JWD A;  2M7L A;  1TN4 A;  4DCK A;  1W7J B;  1M63 B;  3C1V A;  1S5G Z;  2JUL A;  1DMO A;  3O2P A;  2JT3 A;  3FWC A;  5CSF A;  4YBH B;  5KTY A;  1BU3 A;  1TTX A;  2KYF A;  4YGC B;  2WND A;  2K2A A;  2L2E A;  2WC8 A;  5HYD A;  3JTD C;  1KCY A;  1KWO C;  2COL B;  2NXQ A;  1L2O B;  4MRX A;  2M9G A;  4P5O E;  5I2L A;  4A4C A;  2ZN8 A;  1WRL A;  3CR2 A;  3QRX A;  1K9U A;  1CM4 A;  3D0Y B;  1WDC C;  3WHU B;  4PCW A;  1TIZ A;  2WCF A;  2MBX A;  1Y1X A;  1MR8 A;  3GOF A;  3KPX A;  1QIW A;  1QV1 A;  1F4Q A;  4ORB B;  1A29 A;  5DKQ A;  2KQ6 A;  4C0L A;  1QIV A;  1S6J A;  1PVB A;  2LMV A;  1OZS A;  2BCA A;  2BCX A;  1SCV A;  2SAS A;  1CFP A;  1NCX A;  4JQ0 D;  4ORA B;  1SCM B;  4PHK A;  3WNX B;  1QVI Z;  1F8H A;  2KHN A;  1MUX A;  1M31 A;  1MXL C;  2AAO A;  3VRO A;  1Y1U A;  1YRU B;  1IQ3 A;  3DVM A;  3NSI A;  4YGD B;  1CM1 A;  2JTZ A;  1W7I B;  2CXJ A;  1V1F A;  2JQ6 A;  2MLE C;  3DVE A;  1C7V A;  1A4P A;  1CDL A;  2H61 A;  2MJW B;  3H4S E;  4OCI A;  2I18 A;  2LE9 B;  1D1O A;  3WHT B;  1PSB A;  2JNX A;  2FCE A;  1OSA A;  1CLL A;  2MAZ A;  3DVJ A;  3DVK A;  1BR1 B;  5HKY A;  3TS5 C;  4AOM A;  1DJY A;  2K7D A;  2M29 A;  1XVJ A;  2BKH B;  5AFP A;  2FOT A;  1K95 A;  4AQI A;  1SL7 A;  4USL A;  1DJW A;  5D7F A;  1CLB A;  2QPT A;  2WOS A;  1AVS A;  1N65 A;  1JF2 A;  4NDC A;  1S6I A;  2LLT A;  3BOW A;  4MVF A;  1K90 D;  1JSA A;  1A75 A;  4N1G A;  4YI8 A;  2M49 B;  2F2P A;  1E8A A;  3EVU A;  1S3P A;  1NCY A;  3VRP A;  1BOD A;  1QLK A;  2NCO A;  2OPO A;  4ZCV A;  4DS7 A;  4XJK A;  1CB1 A;  1SMG A;  5F6T A;  1BF5 A;  3JVT C;  1HT9 A;  3ICB A;  4YGE B;  1JC2 A;  1CMG A;  2KI4 B;  5AEQ A;  1PAL A;  1UUR A;  1X02 A;  2LAN A;  4OVN F;  2K2F A;  1G33 A;  2KGB C;  4QJ5 B;  4C0K A;  1C07 A;  4F0Z B;  1KK7 Y;  1TNX A;  1MXE A;  4DIR A;  1U5I A;  3PSR A;  1DT7 B;  1NX2 A;  2JZI A;  1H4B A;  1ZFS A;  2PVB A;  1XFW O;  3FWB A;  3TZ1 A;  2PRU A;  2ZN9 A;  1CMF A;  1J7O A;  1HQV A;  2L0P A;  4MZL A;  4I5K A;  2KAX A;  2M97 A;  1SL9 A;  4Q04 A;  1NX3 A;  3SJS A;  1LA0 A;  1YUU A;  3I5F B;  1RRO A;  4I5J A;  1IG5 A;  4PAL A;  1CFC A;  2NZ0 A;  3DF0 A;  1K93 D;  4CFQ A;  3AAJ A;  3SG5 A;  3NSK A;  2K61 A;  1BOC A;  2K8M B;  3WXA A;  1K9P A;  1JFJ A;  3TUY B;  1QVI Y;  1SR6 B;  5JJG A;  5I2Q A;  1AP4 A;  2BL0 C;  1Y1A A;  3RLZ A;  2G9B A;  1SRA A;  1UHH A;  2ZFD A;  2LVK A;  4WQ2 A;  3OB1 B;  1KK8 C;  2O5G A;  1XK4 C;  5DKN A;  1M45 A;  2LP2 A;  2AUC A;  1JFK A;  3O78 A;  5PAL A;  2VRG A;  2H2K A;  4JWQ A;  2PSR A;  4YGA A;  2KFG A;  1RK9 A;  1BLQ A;  1CFF A;  2LMT A;  3SG3 A;  2MHH A;  2HET A;  2EC6 C;  1IH0 A;  2D8N A;  2FJU B;  1AJ5 A;  1UWO A;  1V1G A;  4GNK B;  4HSZ A;  2HPS A;  1OQP A;  1DF0 A;  1YUS A;  1LIN A;  3D0Y A;  4AQJ A;  1MQ1 A;  1SPY A;  2ZKM X;  4MRY A;  2LUC A;  5K89 A;  1TOP A;  2F2O A;  2M1K B;  1BR4 B;  2M0R A;  1JUO A;  3A4U B;  3TDU A;  4GPL B;  4PE0 A;  3PN7 B;  1R2U A;  1PK0 D;  1PRW A;  3PFV A;  2JT0 A;  1XFU O;  3PM8 A;  5AER A;  1XO5 A;  1KFU L;  3OB2 B;  2M1U A;  1UUS A;  3F45 A;  1SNL A;  2KYC A;  1SY9 A;  3ZNI A;  3I5I C;  2Y1N A;  1M39 A;  2L4H A;  1GJY A;  1KFX L;  1LKJ A;  2KBM A;  1DGV A;  1J7Q A;  4GUK A;  3LK1 A;  3TDZ A;  1XYD A;  2BE4 A;  1B1G A;  3SIB A;  1TCO B;  1BMO A;  3EKH A;  4C0J A;  3E3R A;  2Y4Q A;  2HQW A;  5HLV A;  2M8U A;  2O60 A;  1TNQ A;  4ICB A;  2KFF A;  1OMV A;  1QTX A;  3OP0 A;  1CDM A;  2H61 C;  5AXI A;  1MHO A;  3GK4 X;  1SW8 A;  1IJ5 A;  4MBE A;  5DKR A;  3SG6 A;  1XFY O;  1QAS A;  2JPT A;  3GK2 A;  2KQY A;  1IJ6 A;  2TN4 A;  2K7O A;  4CLN A;  2KFH A;  2L51 A;  1CKK A;  1B4C A;  1CFD A;  1YX7 A;  4P2Y B;  1QS7 A;  3EK8 A;  3NSO A;  3GK1 A;  2KAV A;  2DOQ A;  4A4B A;  2LM5 A;  2G2B A;  1EXR A;  5B8I B;  2OS8 B;  1SL8 A;  2MA2 A;  2CT9 A;  2AMI A;  3IF7 A;  4IL1 A;  2JU0 A;  1B8L A;  1CTR A;  3I5H C;  1EG3 A;  4MSP A;  5G08 A;  4FQO A;  1K9K A;  1OMR A;  1FBV A;  4MZJ A;  4PDZ A;  2K7C A;  3DF0 B;  1NX0 A;  1WLM A;  3NSL A;  3NXA A;  2GV5 A;  1TRF A;  5CPV A;  1OZO A;  1KQM B;  2MRD A;  1KSO A;  2WCE A;  2HQ8 A;  1U5I B;  1C7W A;  2I7A A;  3AAK A;  3CWG A;  1BJF A;  4CID A;  1NUB A;  1L7Z A;  1B8C A;  2SCP A;  4N5X A;  4QJ3 B;  2KOT A;  4TNC A;  2LP3 A;  2KI6 D;  2LAP A;  1J1D A;  3JTD B;  3VGO A;  2ZRT A;  5I2O A;  1IQ5 A;  2LLU A;  2LCP A;  3I5G C;  1L2O C;  4XYN A;  3EKJ A;  1DJH A;  4MEW A;  1REC A;  4JPZ B;  1YTZ C;  5IBW A;  1H8B A;  3HCM A;  4YI9 A;  5I8N A;  1A75 B;  2JNF A;  4PE4 A;  1EJ3 A;  1FW4 A;  3MSE B;  1KSM A;  2KDH A;  1CLM A;  1QV0 A;  2L4I A;  3OHM B;  4N1F A;  4OKH A;  3TUY C;  1KQV A;  2F8P A;  2F3Z A;  2L50 A;  2E30 A;  2NCP A;  3FIA A;  1RFJ A;  1QX5 B;  2LVI A;  3BXK A;  2NLN A;  4I5N B;  2BL0 B;  2JXC A;  1CDN A;  4CPV A;  1ZOT B;  4NDD A;  3BUO B;  1QXP A;  1LXF C;  1ALV A;  4GAO A;  1SK6 D;  2I2R E;  2PAS A;  1FI6 A;  4PHM A;  1SCM C;  2LV7 A;  1KK8 B;  2BBM A;  2JC2 A;  4BY5 A;  1B8R A;  1PVA A;  3RM1 A;  1QAT A;  1YUT A;  1AHR A;  2LHI A;  4R1E A;  2JWW A;  1JF0 A;  4GGN A;  1IRJ A;  1NX1 A;  4UPG A;  1BG1 A;  3EVV A;  2E6W A;  1OE9 B;  2BCB A;  2JXL A;  5CSN A;  1GGW A;  1AK8 A;  2I94 A;  1K2H A;  1QLS A;  1JBA A;  1SYM A;  3ZWH A;  2WOR A;  1OMD A;  1R6P A;  2LVV A;  2K0J A;  2KI6 C;  2OTG C;  1K96 A;  4DRW A;  2JT8 A;  3KHE A;  1S36 A;  4ORC B;  1K94 A;  2RGI A;  5GQQ C;  1Y0V H;  2BE6 A;  1IKU A;  1B7T Z;  1EL4 A;  2L5X B;  4WRI A;  4PE1 A;  3TS5 B;  2LHL A;  2EHB A;  3FS7 A;  4FTG A;  3LL8 B;  1FI5 A;  1XA5 A;  2BKI B;  1B7T Y;  2BEC A;  5CSJ A;  3OX5 A;  2GGM A;  1K8U A;  2PAL A;  1DJG A;  3VRR A;  1UP5 A;  4NQG A;  5AAN A;  3KEV A;  1DJZ A;  2KNE A;  1DVI A;  3TDI A;  3VRQ A;  1TCF A;  1FPW A;  1F4O A;  1KWO B;  1GQM A;  2A4J A;  3CLN A;  3KF9 A;  1EH2 A;  2JRF A;  3O6B A;  4PE7 A;  1S1E A;  5KU1 A;  2KAY A;  1UHJ A;  1YR5 A;  2F33 A;  1WDC B;  1J55 A;  2K7B A;  1N0Y A;  1F70 A;  4HRH A;  4E68 A;  2KBI A;  3DD4 A;  3CTN A;  3EK7 A;  1NCZ A;  2Y1M A;  1UHN A;  1G4Y R;  2KI4 C;  2MLF C;  4YGB B;  1XK4 A;  3K21 A;  1WLZ A;  2WCB A;  3BUM B;  3PAT A;  2Q91 A;  3CS1 A;  5J3X A;  2L98 A;  3LK0 A;  1M46 A;  4XJK B;  2JTT A;  3SG7 A;  1Q80 A;  1ALW A;  1VRK A;  1YVH A;  2GGZ A;  3CZT X;  1PUL A;  1CNP A;  5HKW A;  3LCP C;  3PLF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...