2BL0C

Physarum polycephalum myosin ii regulatory domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
GDDQVSEFKEAFELFDSERTGFITKEGLQTVLKQFGVRVEPAAFNEMFNEADATGNGKIQFPEFLSMMGRRMKQTTSEDILRQAFRTFDPEGTGYIPKAALQDALLNLGDRLKPHEFAEFLGITETEKGQIRYDNFINTMFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Muscle protein
molecule keywords MAJOR PLASMODIAL MYOSIN HEAVY CHAIN
publication title Structural Evidence for Non-Canonical Binding of Ca2+ to a Canonical EF-Hand of a Conventional Myosin.
pubmed doi rcsb
source organism Physarum polycephalum
total genus 46
structure length 142
sequence length 142
ec nomenclature ec 3.6.1.32: Transferred entry: 5.6.1.8.
pdb deposition date 2005-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bl0C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bl0C02
2LAPA 1TOPA 1AUIB 5IBWA 1KSMA 3IQOA 3PSRA 3BUNB 2OS8B 1U5IB 4XJKB 1TCFA 4MEWA 1SK6D 2F33A 1XFXO 2BCBA 1Y1UA 2KYCA 1CFCA 1QLSA 1S6IA 5ER4X 1YUTA 2M1KB 1S3PA 4YBHB 1J1DA 3AKAA 3OHMB 4ORAB 1KFXL 1DF0A 2F8PA 1HQVA 3I5IB 1WRKA 1EXRA 1A03A 1Y1XA 1S6JA 4DRWA 1AK8A 4E68A 1KFUL 1OQPA 2ZN9A 1NYAA 3BQ3A 3WHUB 1W7IB 1OZSA 2MA2A 4PE0A 1UWOA 5HKWA 2JXLA 1L2OC 2K2AA 2ZRTA 1QLKA 1IRJA 2MLEC 1B9AA 1OSAA 3VRRA 1IJ6A 5DKRA 5CSFA 1MF8B 2JPTA 1QVIZ 2ZN8A 3CTNA 4MBEA 2L51A 3VRPA 1G8IA 3C1VA 1SPYA 1RJVA 2L5XB 3BUMB 4I5NB 1PSBA 2I2RE 1K9KA 5F6TA 3TS5B 4HREE 1MXLC 1SCVA 3LK0A 1TNXA 2LVKA 3TUYC 3NXAA 2F3ZA 1WRZA 2AAOA 1QV1A 2LC5A 4MZKA 2M9GA 3FS7A 4GFTA 1K90D 1YR5A 1KCYA 5JJGA 2CXJA 1B1GA 3EKJA 1CB1A 4D1EA 3AAJA 4L9MA 1ALVA 2KBMA 3EKHA 1CFFA 1NX2A 4PE4A 1IQ3A 1WDCC 1DMOA 1SR6B 1Y6WA 3I5GC 1IGVA 1NX3A 3EVRA 1F54A 4YGDB 2JRFA 4CFRA 1XK4A 1KK8B 1DT7B 1DJZA 1YRTB 3E3RA 3NSKA 1YUSA 1RTP1 1YX7A 2AUCA 2EGDA 3CR5X 4A4CA 2K7OA 2SASA 1BMOA 1KSOA 3O4YA 1R6PA 2PSRA 4OVNF 2JXCA 2L4HA 1YVHA 5J3XA 1NP8A 4MN0A 4HRGA 4PCWA 2TN4A 2ZNDA 2LE9B 4FQOA 1B8CA 1QS7A 2WC8A 2M7LA 3PALA 4M2OA 1YURA 2V53A 5TNCA 2CNPA 3DF0B 4DS7A 1QJTA 2BL0C 2HQWA 1CFPA 2M1UA 5DKNA 2JTZA 1Y1AA 2I94A 1K96A 3KF9A 5DKQA 1CMGA 2LVVA 2M8UA 2I18A 4AOMA 2OS8C 2JC2A 1GGZA 5I2OA 1F55A 2BBNA 3IF7A 1J7RA 3CS1A 1R2UA 1UHIA 3SG4A 1H4BA 2KHNA 1C7WA 1CFDA 3LK1A 2KI6C 1LVCD 2BCAA 3HCMA 4MZJA 2HQ8A 4DUQA 1SRAA 1QXPA 2KAXA 3I5IC 4MRXA 2MLFC 2KGBC 2WCEA 2KBIA 5HLOA 3VGOA 2LHLA 1A4PA 1PVAA 1A75B 1SL8A 1G4YR 1FF1A 3JVTB 3WNXB 4HSZA 1B8RA 1LINA 1MWNA 5AANA 2JT8A 4DCKA 1AJ4A 1KQVA 2NZ0A 1M39A 4YI9A 1A29A 3BYAA 2KOTA 1Y0VH 3K21A 4ZCUA 2Y5IA 1RECA 5HYDA 4PHMA 2MHHA 3BXKA 1D1OA 2KI6D 1QASA 5BPJA 5AERA 1GGWA 3EK7A 2FOTA 1YRUB 2K0JA 2KNEA 3DVMA 1NSHA 3KPXA 1JUOA 1EH2A 3PFVA 3TS5C 5CSNA 1UURA 1KQMB 2M3WA 2H61C 4QJ3B 1RROA 5K89A 1PALA 2R2IA 2QPTA 3PN7B 1F71A 3A4UB 1DJWA 2RGIA 2KDHA 1MXEA 4M2PA 4XJKA 4ZCVA 1YUUA 5HLVA 2MRDA 1SL7A 1DJIA 2CBLA 2KGRA 3LCPC 5JOLA 2PMYA 4YI8A 5KSZA 2LANA 2Q4UA 1RWYA 4AQIA 1XYDA 1SCMB 2M97A 5I8NA 1S1EA 1QATA 3GK2A 3VRQA 4CFQA 1F4OA 4IL1A 2K2FA 1K9UA 2JOJA 1SR6C 2EHBA 3CR2A 1QTXA 3RLZA 1KK8C 4PHKA 1SL9A 3LL8B 4JQ0D 4USLA 3SG7A 3ZWHA 2LVJA 1NWDA 2L50A 2WOSA 4ORCB 5I2QA 1XFZO 2LMUA 4WQ3A 3FWCA 1EJ3A 1UP5A 1K8UA 3CGAA 4PHNA 3EK4A 2LLTA 2OPOA 3JTDB 1UHJA 2LV7A 1EG3A 2BCXA 1SW8A 2K7CA 2GGMA 5D69A 1JC2A 2VRGA 3H4SE 1JF0A 2Q91A 2L4IA 3OX5A 2EC6B 1CLBA 2L98A 2KFGA 4JPZB 1FI5A 4F0ZB 2KYFA 4WQ2A 2HETA 1GQMA 5HKYA 4DIRA 2FCDA 5CSIA 1K2HA 1K93D 4N1GA 1YTZC 3SIBA 2NXQA 1IWQA 4QJ5B 2NLNA 2PRUA 3M0WA 1LA3A 2B1UA 2HPSA 1NX0A 3CZTX 1XFWO 2FJUB 2K7BA 4OCIA 3PLFB 4I5JA 1IH0A 1N2DA 5CSJA 1JFJA 2F2PA 5KTYA 2L2EA 1MUXA 3JVTC 1ZACA 1UUSA 2ZKMX 3LLEA 1SY9A 2ZNEA 4YRUA 1DGUA 1DJXA 1LXFC 2JZIA 2LP3A 3DVEA 3TDZA 1FPWA 1BJFA 1CDPA 1JF2A 2LVIA 4XYNA 1S5GY 1GJYA 3D0YB 1CTRA 1Q80A 3OB1B 1EL4A 1L7ZA 3D10A 1M46A 3WHTB 3SIAA 4GNKB 5CPVA 3DVJA 4ORBB 3DF0A 4NDCA 1PSRA 4HRHA 1BODA 1TIZA 2F2OA 1KQMC 2JT3A 4NDBA 2SCPA 3PATA 3IQQA 1V1GA 4CPVA 1TRFA 4I5KA 1QIVA 3PN7C 4R1EA 4YGBB 1KWOB 1MQ1A 2MAZA 1BF5A 3O2PA 4YGAA 2LLSA 2MBXA 3KO0A 2E30A 2KAYA 1SCMC 4YGCB 1TCOB 1QX2A 1ALWA 2LUCA 4MSPA 1LKJA 2PASA 4C0LA 2JULA 1DJYA 2A4JA 2JNFA 3TDUA 1YX8A 4BY5A 2LCPA 2BE6A 4GGNA 1CLMA 1ZMZA 3DD4A 3GK4X 1AJ5A 3BOWB 2KI4B 1A75A 1IG5A 1PVBA 1S26D 2JT0A 3AKBA 3KEVA 3GK1A 3VROA 4GUKA 2F3YA 4JWQA 2M49B 4GBAA 1RFJA 1M45A 2Y4QA 3SG3A 2K61A 1K95A 3CWGA 1DTLA 1LA0A 1YVLA 2KFFA 2H2KA 1UHNA 1J7QA 1NCZA 2HF5A 2O60A 1OZOA 5HKZA 3I5HB 1DGVA 1BOCA 3JTDC 4OV2A 2BBMA 2PALA 1ZOTB 1OMRA 4AQJA 5AFPA 1C07A 1J7OA 1BU3A 3EVVA 4YGEB 2M29A 2GV5A 3PM8A 1CDMA 1U5IA 1A2XA 3HX4A 4Q04A 1RK9A 2EC6C 4MZLA 1PULA 2QACA 1W7JB 3WXAA 1OOJA 1WY9A 3NSIA 2GGZA 2JNXA 2OTGB 1OMDA 2WCBA 2COLB 2LNKA 1AVSA 1VRKA 1FI6A 5ER5A 1DF0B 3OB2B 4P5OE 4MRYA 1NPQA 1FBVA 1BR1B 1IKUA 4PHJA 1NCXA 1G33A 3FIAA 1BLQA 3SG5A 1HT9A 3GOFA 3TZ1A 1C7VA 1OE9B 2Y1NA 4GAOA 1WLZA 3BUXB 2LM5A 1B7TY 1XK4C 1NUBA 1F4QA 3TDIA 1KFXS 2JQ6A 1SYMA 4WRIA 5B8IB 1TTXA 3SJSA 5GQQC 1XFYO 3BUOB 1S36A 4C0KA 2CCMA 1BR4B 1KFUS 4PE1A 2ZFDA 3NSOA 1ODBA 1IQ5A 4QJ4B 1SKTA 1PRWA 1QV0A 2E6WA 2M0RA 4FTGA 2H61A 3QRXA 1CM1A 2G9BA 1SMGA 1CDNA 5AXIA 4ETOA 3I5FC 3I5FB 3FWBA 1CDLA 2FCEA 2LMTA 2ZRSA 1B8LA 3BUWB 1N65A 3SG6A 5G08A 2O5GA 4MLWA 4C0JA 1KWOC 4NQGA 4ICBA 2KAVA 3OP0A 1K9PA 1F70A 2KSPA 5KU1A 4P2YB 1NIWA 1KK7Y 1B4CA 1J1EA 4I5LB 4N5XA 2BECA 1AHRA 4CLNA 2CTNA 1QX5B 2P6BB 2JU0A 2G2BA 2AMIA 2KI4C 1XO5A 2Y1MA 4NDDA 2ISDA 1L2OB 1CNPA 1OMVA 4TNCA 1ZUZA 2KFHA 1CM4A 2BE4A 4CIDA 1DJGA 2NCOA 2K8MB 5AEQA 2CT9A 1B7TZ 2D8NA 3F45A 1XA5A 1E8AA 1JFKA 4PE7A 3D0YA 4GGFC 1XFUO 1JSAA 5I2LA 1PK0D 3I5HC 2LLUA 1ZFSA 1M63B 4OR9B 1BT6A 1IJ5A 2DOQA 3NSLA 5PALA 1JBAA 2I7AA 2IS9A 1NCYA 1AP4A 4UPGA 3CLNA 3O6BA 5FYXA 3SG2A 2LUXA 1DVIA 2PVBA 2KQ6A 1JWDA 1MR8A 1MHOA 1SNLA 3TUYB 2WCFA 3DVKA 2WORA 1N0YA 3O78A 2OTGC 3AAKA 2KQYA 1S6CA 1SBJA 2LMVA 3ZNIA 1QIWA 1F8HA 1TNWA 1J55A 1EG4A 2WNDA 1WDCB 2JTTA 3RM1A 3EVUA 3A8RA 3VRNA 4M2QA 3I5GB 4PALA 1WRLA 1TNQA 1KK7Z 4GPLB 1M31A 4BY4A 1J7PA 4MVFA 2M7NA 1V1FA 1B47A 1XFVO 3BOWA 3EK8A 1XVJA 4N1FA 1CKKA 2NCPA 2K7DA 3ICBA 1K94A 1H8BA 1QVIY 1X02A 4U8DA 2BKIB 2LHIA 1DJHA 2MJWB 2L0PA 1UHKA 1WLMA 2BKHB 3MSEB 1S5GZ 1TNPA 3CR4X 2JWWA 1QX7A 1TN4A 1FW4A 4OKHA 4PDZA 3KHEA 4GGFA 1NX1A 1BG1A 3OX6A 1CMFA 4A4BA 1UHHA 5D7FA 2BL0B 2LP2A 1CLLA
chains in the Genus database with same CATH superfamily
2LAPA 1TOPA 1AUIB 5IBWA 1KSMA 3IQOA 3PSRA 3BUNB 2OS8B 1U5IB 4XJKB 1TCFA 4MEWA 1SK6D 2F33A 1XFXO 2BCBA 1Y1UA 2JPOA 2KYCA 3B7AA 1OOIX 3S0GA 1QLSA 1CFCA 1S6IA 5ER4X 1YUTA 2M1KB 1S3PA 4YBHB 1J1DA 3AKAA 3OHMB 4ORAB 1KFXL 1DF0A 2F8PA 1HQVA 3I5IB 1WRKA 1EXRA 3NGVA 1Y1XA 1A03A 1S6JA 3R72A 4DRWA 1P28A 1AK8A 4E68A 1KFUL 1OQPA 2ZN9A 3L4LA 1NYAA 1OW4A 3BQ3A 3WHUB 1W7IB 1OZSA 2MA2A 1T14A 4PE0A 1UWOA 5HKWA 2JXLA 1L2OC 2K2AA 2ZRTA 1QLKA 1IRJA 2MLEC 1B9AA 1OSAA 3VRRA 1IJ6A 5DKRA 5CSFA 2BNXA 1MF8B 2JPTA 1QVIZ 2ZN8A 3CTNA 4MBEA 2L51A 3VRPA 1G8IA 3C1VA 1SPYA 1RJVA 2L5XB 3BUMB 3PM2A 4I5NB 3D76A 1PSBA 2I2RE 1K9KA 3K1EA 5F6TA 3TS5B 2FJYA 4HREE 1MXLC 1SCVA 3LK0A 1TNXA 2PQLA 2LVKA 3TUYC 3NXAA 2F3ZA 1WRZA 2AAOA 1QV1A 2LC5A 4MZKA 2M9GA 3FS7A 4GFTA 1K90D 1YR5A 1KCYA 5JJGA 1Z2CB 2CXJA 1B1GA 3EKJA 1CB1A 4D1EA 1FPWA 3AAJA 2BAPA 1ALVA 2KBMA 2WCMA 3EKHA 4L9MA 1NX2A 4PE4A 1CFFA 1IQ3A 1WDCC 1DMOA 1SR6B 1Y6WA 3I5GC 1IGVA 1NX3A 3EVRA 1F54A 4YGDB 2JRFA 4CFRA 1XK4A 1KK8B 1DT7B 1DJZA 1YRTB 3E3RA 3NSKA 1YUSA 1RTP1 3SS3A 1YX7A 2AUCA 2EGDA 3CR5X 3D77A 2QEBA 4A4CA 2K7OA 2SASA 1BMOA 1KSOA 3O4YA 1R6PA 2PSRA 4OVNF 2JXCA 2L4HA 1YVHA 5J3XA 1NP8A 4MN0A 4HRGA 4PCWA 2TN4A 2ZNDA 2LE9B 4FQOA 1B8CA 1QS7A 2WC8A 2M7LA 3PALA 4M2OA 1YURA 2V53A 5TNCA 2CNPA 3DF0B 5FI2A 4DS7A 1QJTA 2BL0C 2HQWA 1CFPA 2M1UA 5DKNA 2JTZA 1Y1AA 2I94A 1K96A 3KF9A 5DKQA 1CMGA 2LVVA 2M8UA 2I18A 4AOMA 2OS8C 2JC2A 1GGZA 3UNWA 1TUZA 5I2OA 3EG5B 3SS5A 1F55A 1TWOA 3CZ1A 2BBNA 3IF7A 1J7RA 3CS1A 1R2UA 1UHIA 3PJIA 3SG4A 1H4BA 2KHNA 1C7WA 1CFDA 3LK1A 2KI6C 3D75A 1LVCD 2BCAA 3HCMA 4MZJA 2HQ8A 4DUQA 1SRAA 4KYNA 1QXPA 2KAXA 3I5IC 4MRXA 2MLFC 2KGBC 2WCEA 2KBIA 5HLOA 3VGOA 2LHLA 1A4PA 1PVAA 1A75B 1SL8A 1G4YR 1FF1A 3JVTB 3WNXB 4HSZA 1B8RA 1LINA 1MWNA 5AANA 2JT8A 4DCKA 1AJ4A 1KQVA 2NZ0A 1M39A 4YI9A 1A29A 3BYAA 2KOTA 1Y0VH 3K21A 4ZCUA 2Y5IA 1RECA 5HYDA 4PHMA 2MHHA 3BXKA 4INXA 2KI6D 1D1OA 1QASA 5BPJA 5AERA 1GGWA 2QEOA 3EK7A 1OOGA 2FOTA 1YRUB 2K0JA 2KNEA 3CYZA 3DVMA 1NSHA 1W9ZA 3KPXA 1JUOA 1EH2A 3PFVA 3TS5C 5CSNA 1UURA 1KQMB 3D74A 5I94A 2M3WA 2H61C 4QJ3B 1RROA 5K89A 1PALA 2R2IA 2QPTA 3PN7B 1F71A 3A4UB 1DJWA 2RGIA 2KDHA 1MXEA 4M2PA 4XJKA 4ZCVA 1YUUA 5HLVA 2MRDA 3OGNA 3DYEA 1SL7A 1DJIA 2CBLA 2KGRA 3LCPC 5JOLA 2PMYA 4YI8A 5KSZA 2LANA 2Q4UA 1RWYA 4AQIA 1XYDA 1SCMB 2M97A 5I8NA 1S1EA 1QATA 3GK2A 2WC6A 3VRQA 4CFQA 1F4OA 4IL1A 2K2FA 3B88A 1K9UA 2QDIA 2JOJA 1SR6C 5EL2A 3OBVA 2EHBA 2ERBA 3D78A 3CR2A 1QTXA 3RLZA 1KK8C 4PHKA 1SL9A 2P71A 3LL8B 4JQ0D 4USLA 1QWVA 3SG7A 3ZWHA 2LVJA 1DEKA 3FE8A 1NWDA 2L50A 2WOSA 4ORCB 3L47A 5I2QA 1XFZO 2LMUA 4WQ3A 3FWCA 1EJ3A 1UP5A 1K8UA 3CGAA 4PHNA 3EK4A 2LLTA 2OPOA 3JTDB 1UHJA 2LV7A 1EG3A 2BCXA 1SW8A 2K7CA 2GGMA 5D69A 1JC2A 2VRGA 3H4SE 1JF0A 2Q91A 5FI6A 2L4IA 3OX5A 2EC6B 1CLBA 2L98A 4OZDA 2KFGA 1LS8A 2WCKA 4JPZB 1FI5A 4F0ZB 3B87A 3RZSA 2KYFA 4WQ2A 2HETA 2YGUA 3NHIA 1GQMA 5HKYA 4DIRA 2FCDA 5CSIA 1K2HA 1K93D 4N1GA 1YTZC 3SIBA 2NXQA 1IWQA 4QJ5B 2NLNA 2PRUA 3M0WA 1LA3A 2B1UA 2HPSA 1NX0A 3CZTX 1XFWO 2FJUB 2K7BA 4OCIA 3PLFB 4I5JA 1IH0A 1N2DA 5CSJA 1JFJA 5D3OA 2F2PA 5KTYA 2L2EA 1MUXA 3JVTC 1ZACA 1UUSA 2ZKMX 3LLEA 1SY9A 2ZNEA 4YRUA 1DGUA 1DJXA 1LXFC 2JZIA 2LP3A 2QEVA 3DVEA 3TDZA 3V2LA 1BJFA 1CDPA 1JF2A 2H8VA 2LVIA 2KLDA 3B6XA 4XYNA 1S5GY 1GJYA 3NHTA 3D0YB 1CTRA 1Q80A 3OB1B 1EL4A 1L7ZA 3D10A 2WCHA 1M46A 3WHTB 1ORGA 3SIAA 4GNKB 5CPVA 3L4AA 3DVJA 4ORBB 3S0FA 3DF0A 1GM0A 1Z4HA 4NDCA 1PSRA 4HRHA 2L2CA 1TIZA 2F2OA 1BODA 1KQMC 1OOHA 2JT3A 2SCPA 3PATA 4NDBA 3IQQA 3VB1A 1V1GA 4CPVA 1TRFA 4I5KA 1QIVA 3PN7C 4R1EA 4YGBB 1TUJA 1KWOB 1MQ1A 2MAZA 1BF5A 3O2PA 4YGAA 2LLSA 3DY9A 2MBXA 3KO0A 4JD9A 2E30A 2KAYA 1SCMC 4YGCB 3O4XA 1TCOB 1QX2A 1ALWA 2LUCA 4MSPA 1LKJA 2PASA 4C0LA 2JULA 1DJYA 2A4JA 2JNFA 3TDUA 1YX8A 4BY5A 2LCPA 2BE6A 4GGNA 1CLMA 1ZMZA 3DD4A 3GK4X 1AJ5A 3BOWB 1IIOA 2KI4B 1A75A 1IG5A 1PVBA 1S26D 2JT0A 3AKBA 3KEVA 3GK1A 3VROA 4GUKA 2F3YA 4JWQA 2M49B 4GBAA 2GTEA 1RFJA 1M45A 2Y4QA 3SG3A 2K61A 1K95A 3CWGA 1DTLA 1LA0A 1YVLA 2KFFA 3S0DA 2KPHA 2H2KA 1UHNA 4IJ7A 1J7QA 1NCZA 2HF5A 2O60A 1OZOA 5HKZA 1DQEA 3I5HB 1DGVA 1BOCA 3S0AA 3JTDC 4OV2A 2BBMA 2PALA 1ZOTB 1OMRA 4AQJA 5AFPA 1C07A 1J7OA 1BU3A 3EVVA 4YGEB 2M29A 2GV5A 3PM8A 1CDMA 1U5IA 3R1VA 3CZ2A 1A2XA 3HX4A 4Q04A 1RK9A 2EC6C 4MZLA 1PULA 2QACA 1W7JB 3S0EA 1OOJA 3WXAA 1WY9A 3NSIA 2GGZA 2JNXA 2OTGB 1OMDA 2WCBA 2COLB 2LNKA 1AVSA 2K60A 1VRKA 1FI6A 5ER5A 1DF0B 3OB2B 4F7FA 4P5OE 4MRYA 1NPQA 1FBVA 1BR1B 1IKUA 2WCLA 4PHJA 1NCXA 1G33A 3FIAA 1BLQA 3SG5A 1HT9A 3GOFA 3TZ1A 3N7HA 1OE9B 3R1OA 3Q8IA 2Y1NA 3FE9A 1C7VA 4GAOA 1SSEB 1WLZA 3BUXB 2LM5A 4PT1A 1B7TY 1XK4C 2KLEA 1NUBA 1F4QA 3TDIA 1KFXS 2JQ6A 1SYMA 4WRIA 5B8IB 1TTXA 3SJSA 1DELA 5GQQC 1XFYO 3BUOB 1S36A 4C0KA 2CCMA 1BR4B 1DC1A 1KFUS 4PE1A 2ZFDA 3CDNA 3NSOA 1ODBA 1IQ5A 4QJ4B 1SKTA 1PRWA 1QV0A 2E6WA 2M0RA 4FTGA 5HL1A 4INWA 2H61A 3QRXA 1CM1A 2G9BA 1SMGA 1CDNA 5AXIA 4ETOA 3I5FC 3I5FB 3FWBA 3S0BA 1CDLA 2FCEA 2LMTA 2ZRSA 1B8LA 1XFRA 3BUWB 1N65A 3SG6A 5FI7A 5G08A 2O5GA 4MLWA 4C0JA 1KWOC 2L5YA 4NQGA 4ICBA 2KAVA 3OP0A 1K9PA 1F70A 2KSPA 5KU1A 4P2YB 1NIWA 1KK7Y 3BFBA 1B4CA 1J1EA 4I5LB 4N5XA 2BECA 1AHRA 4CLNA 2PYQA 4FQTA 2P70A 2CTNA 2WC5A 1QX5B 2P6BB 2JU0A 2G2BA 2AMIA 2KI4C 1XO5A 2Y1MA 4NDDA 2ISDA 1L2OB 1CNPA 1OMVA 4TNCA 1ZUZA 2KFHA 1CM4A 2BE4A 4CIDA 1DJGA 2NCOA 2K8MB 3BFHA 5AEQA 2CT9A 3FE6A 1B7TZ 2D8NA 3DZTA 3F45A 1XA5A 1E8AA 1JFKA 4PE7A 3D0YA 4GGFC 1XFUO 1JSAA 5I2LA 1PK0D 3I5HC 2LLUA 3CABA 1ZFSA 1M63B 3D73A 3DXLA 1BT6A 1IJ5A 4OR9B 2DOQA 3NSLA 5PALA 1JBAA 2I7AA 2IS9A 1NCYA 1AP4A 4UPGA 3CLNA 3O6BA 5FYXA 3SG2A 2LUXA 1DVIA 2PVBA 2KQ6A 3BFAA 1JWDA 1MR8A 1MHOA 1SNLA 2QEHA 3TUYB 2WCFA 3DVKA 2WORA 1N0YA 3IVTA 2WCJA 3CZ0A 3O78A 2OTGC 3AAKA 3B86A 2KQYA 1S6CA 1SBJA 2LMVA 3ZNIA 1QIWA 1F8HA 1TNWA 3SS4A 1J55A 1EG4A 2WNDA 1WDCB 2JTTA 3RM1A 3EVUA 3A8RA 3VRNA 4M2QA 3I5GB 4PALA 1WRLA 1TNQA 1KK7Z 4GPLB 1M31A 4BY4A 1J7PA 4MVFA 5DICA 2M7NA 4JKTA 1V1FA 1B47A 1XFVO 3BOWA 3EK8A 1XVJA 4N1FA 1CKKA 2NCPA 2K7DA 3ICBA 1K94A 1H8BA 1QVIY 1X02A 4U8DA 2BKIB 2LHIA 1DJHA 2MJWB 2L0PA 3QMEA 1UHKA 1WLMA 2BKHB 1OOFA 3MSEB 1S5GZ 1TNPA 3UO9A 3CR4X 2JWWA 1QX7A 1TN4A 1FW4A 4OKHA 4PDZA 3KHEA 4GGFA 1NX1A 3R1PA 1C3YA 1BG1A 3OX6A 1CMFA 4A4BA 1UHHA 3BJHA 1C3ZA 5D7FA 2BL0B 2LP2A 1CLLA
chains in the Genus database with same CATH topology
2LAPA 1TOPA 1AUIB 5IBWA 1KSMA 3IQOA 3PSRA 3BUNB 2OS8B 1U5IB 4XJKB 1TCFA 4MEWA 1SK6D 2F33A 1XFXO 2BCBA 1Y1UA 2KYCA 1CFCA 1QLSA 1S6IA 5ER4X 1YUTA 2M1KB 1S3PA 4YBHB 1J1DA 3AKAA 3OHMB 4ORAB 1KFXL 1DF0A 2F8PA 1HQVA 3I5IB 1WRKA 1EXRA 1A03A 1Y1XA 1S6JA 4DRWA 1AK8A 4E68A 1KFUL 1OQPA 2ZN9A 1NYAA 3BQ3A 3WHUB 1W7IB 1OZSA 2MA2A 4PE0A 1UWOA 5HKWA 2JXLA 1L2OC 2K2AA 2ZRTA 1QLKA 1IRJA 2MLEC 1B9AA 1OSAA 3VRRA 1IJ6A 5DKRA 5CSFA 1MF8B 2JPTA 1QVIZ 2ZN8A 3CTNA 4MBEA 2L51A 3VRPA 1G8IA 3C1VA 1SPYA 1RJVA 2L5XB 3BUMB 4I5NB 1PSBA 2I2RE 1K9KA 5F6TA 3TS5B 4HREE 1MXLC 1SCVA 3LK0A 1TNXA 2LVKA 3TUYC 3NXAA 2F3ZA 1WRZA 2AAOA 1QV1A 2LC5A 4MZKA 2M9GA 3FS7A 4GFTA 1K90D 1YR5A 1KCYA 5JJGA 2CXJA 1B1GA 3EKJA 1CB1A 4D1EA 3AAJA 4L9MA 1ALVA 2KBMA 3EKHA 1CFFA 1NX2A 4PE4A 1IQ3A 1WDCC 1DMOA 1SR6B 1Y6WA 3I5GC 1IGVA 1NX3A 3EVRA 1F54A 4YGDB 2JRFA 4CFRA 1XK4A 1KK8B 1DT7B 1DJZA 1YRTB 3E3RA 3NSKA 1YUSA 1RTP1 1YX7A 2AUCA 2EGDA 3CR5X 4A4CA 2K7OA 2SASA 1BMOA 1KSOA 3O4YA 1R6PA 2PSRA 4OVNF 2JXCA 2L4HA 1YVHA 5J3XA 1NP8A 4MN0A 4HRGA 4PCWA 2TN4A 2ZNDA 2LE9B 4FQOA 1B8CA 1QS7A 2WC8A 2M7LA 3PALA 4M2OA 1YURA 2V53A 5TNCA 2CNPA 3DF0B 4DS7A 1QJTA 2BL0C 2HQWA 1CFPA 2M1UA 5DKNA 2JTZA 1Y1AA 2I94A 1K96A 3KF9A 5DKQA 1CMGA 2LVVA 2M8UA 2I18A 4AOMA 2OS8C 2JC2A 1GGZA 5I2OA 1F55A 2BBNA 3IF7A 1J7RA 3CS1A 1R2UA 1UHIA 3SG4A 1H4BA 2KHNA 1C7WA 1CFDA 3LK1A 2KI6C 1LVCD 2BCAA 3HCMA 4MZJA 2HQ8A 4DUQA 1SRAA 1QXPA 2KAXA 3I5IC 4MRXA 2MLFC 2KGBC 2WCEA 2KBIA 5HLOA 3VGOA 2LHLA 1A4PA 1PVAA 1A75B 1SL8A 1G4YR 1FF1A 3JVTB 3WNXB 4HSZA 1B8RA 1LINA 1MWNA 5AANA 2JT8A 4DCKA 1AJ4A 1KQVA 2NZ0A 1M39A 4YI9A 1A29A 3BYAA 2KOTA 1Y0VH 3K21A 4ZCUA 2Y5IA 1RECA 5HYDA 4PHMA 2MHHA 3BXKA 1D1OA 2KI6D 1QASA 5BPJA 5AERA 1GGWA 3EK7A 2FOTA 1YRUB 2K0JA 2KNEA 3DVMA 1NSHA 3KPXA 1JUOA 1EH2A 3PFVA 3TS5C 5CSNA 1UURA 1KQMB 2M3WA 2H61C 4QJ3B 1RROA 5K89A 1PALA 2R2IA 2QPTA 3PN7B 1F71A 3A4UB 1DJWA 2RGIA 2KDHA 1MXEA 4M2PA 4XJKA 4ZCVA 1YUUA 5HLVA 2MRDA 1SL7A 1DJIA 2CBLA 2KGRA 3LCPC 5JOLA 2PMYA 4YI8A 5KSZA 2LANA 2Q4UA 1RWYA 4AQIA 1XYDA 1SCMB 2M97A 5I8NA 1S1EA 1QATA 3GK2A 3VRQA 4CFQA 1F4OA 4IL1A 2K2FA 1K9UA 2JOJA 1SR6C 2EHBA 3CR2A 1QTXA 3RLZA 1KK8C 4PHKA 1SL9A 3LL8B 4JQ0D 4USLA 3SG7A 3ZWHA 2LVJA 1NWDA 2L50A 2WOSA 4ORCB 5I2QA 1XFZO 2LMUA 4WQ3A 3FWCA 1EJ3A 1UP5A 1K8UA 3CGAA 4PHNA 3EK4A 2LLTA 2OPOA 3JTDB 1UHJA 2LV7A 1EG3A 2BCXA 1SW8A 2K7CA 2GGMA 5D69A 1JC2A 2VRGA 3H4SE 1JF0A 2Q91A 2L4IA 3OX5A 2EC6B 1CLBA 2L98A 2KFGA 4JPZB 1FI5A 4F0ZB 2KYFA 4WQ2A 2HETA 1GQMA 5HKYA 4DIRA 2FCDA 5CSIA 1K2HA 1K93D 4N1GA 1YTZC 3SIBA 2NXQA 1IWQA 4QJ5B 2NLNA 2PRUA 3M0WA 1LA3A 2B1UA 2HPSA 1NX0A 3CZTX 1XFWO 2FJUB 2K7BA 4OCIA 3PLFB 4I5JA 1IH0A 1N2DA 5CSJA 1JFJA 2F2PA 5KTYA 2L2EA 1MUXA 3JVTC 1ZACA 1UUSA 2ZKMX 3LLEA 1SY9A 2ZNEA 4YRUA 1DGUA 1DJXA 1LXFC 2JZIA 2LP3A 3DVEA 3TDZA 1FPWA 1BJFA 1CDPA 1JF2A 2LVIA 4XYNA 1S5GY 1GJYA 3D0YB 1CTRA 1Q80A 3OB1B 1EL4A 1L7ZA 3D10A 1M46A 3WHTB 3SIAA 4GNKB 5CPVA 3DVJA 4ORBB 3DF0A 4NDCA 1PSRA 4HRHA 1BODA 1TIZA 2F2OA 1KQMC 2JT3A 4NDBA 2SCPA 3PATA 3IQQA 1V1GA 4CPVA 1TRFA 4I5KA 1QIVA 3PN7C 4R1EA 4YGBB 1KWOB 1MQ1A 2MAZA 1BF5A 3O2PA 4YGAA 2LLSA 2MBXA 3KO0A 2E30A 2KAYA 1SCMC 4YGCB 1TCOB 1QX2A 1ALWA 2LUCA 4MSPA 1LKJA 2PASA 4C0LA 2JULA 1DJYA 2A4JA 2JNFA 3TDUA 1YX8A 4BY5A 2LCPA 2BE6A 4GGNA 1CLMA 1ZMZA 3DD4A 3GK4X 1AJ5A 3BOWB 2KI4B 1A75A 1IG5A 1PVBA 1S26D 2JT0A 3AKBA 3KEVA 3GK1A 3VROA 4GUKA 2F3YA 4JWQA 2M49B 4GBAA 1RFJA 1M45A 2Y4QA 3SG3A 2K61A 1K95A 3CWGA 1DTLA 1LA0A 1YVLA 2KFFA 2H2KA 1UHNA 1J7QA 1NCZA 2HF5A 2O60A 1OZOA 5HKZA 3I5HB 1DGVA 1BOCA 3JTDC 4OV2A 2BBMA 2PALA 1ZOTB 1OMRA 4AQJA 5AFPA 1C07A 1J7OA 1BU3A 3EVVA 4YGEB 2M29A 2GV5A 3PM8A 1CDMA 1U5IA 1A2XA 3HX4A 4Q04A 1RK9A 2EC6C 4MZLA 1PULA 2QACA 1W7JB 3WXAA 1OOJA 1WY9A 3NSIA 2GGZA 2JNXA 2OTGB 1OMDA 2WCBA 2COLB 2LNKA 1AVSA 1VRKA 1FI6A 5ER5A 1DF0B 3OB2B 4P5OE 4MRYA 1NPQA 1FBVA 1BR1B 1IKUA 4PHJA 1NCXA 1G33A 3FIAA 1BLQA 3SG5A 1HT9A 3GOFA 3TZ1A 1C7VA 1OE9B 2Y1NA 4GAOA 1WLZA 3BUXB 2LM5A 1B7TY 1XK4C 1NUBA 1F4QA 3TDIA 1KFXS 2JQ6A 1SYMA 4WRIA 5B8IB 1TTXA 3SJSA 5GQQC 1XFYO 3BUOB 1S36A 4C0KA 2CCMA 1BR4B 1KFUS 4PE1A 2ZFDA 3NSOA 1ODBA 1IQ5A 4QJ4B 1SKTA 1PRWA 1QV0A 2E6WA 2M0RA 4FTGA 2H61A 3QRXA 1CM1A 2G9BA 1SMGA 1CDNA 5AXIA 4ETOA 3I5FC 3I5FB 3FWBA 1CDLA 2FCEA 2LMTA 2ZRSA 1B8LA 3BUWB 1N65A 3SG6A 5G08A 2O5GA 4MLWA 4C0JA 1KWOC 4NQGA 4ICBA 2KAVA 3OP0A 1K9PA 1F70A 2KSPA 5KU1A 4P2YB 1NIWA 1KK7Y 1B4CA 1J1EA 4I5LB 4N5XA 2BECA 1AHRA 4CLNA 2CTNA 1QX5B 2P6BB 2JU0A 2G2BA 2AMIA 2KI4C 1XO5A 2Y1MA 4NDDA 2ISDA 1L2OB 1CNPA 1OMVA 4TNCA 1ZUZA 2KFHA 1CM4A 2BE4A 4CIDA 1DJGA 2NCOA 2K8MB 5AEQA 2CT9A 1B7TZ 2D8NA 3F45A 1XA5A 1E8AA 1JFKA 4PE7A 3D0YA 4GGFC 1XFUO 1JSAA 5I2LA 1PK0D 3I5HC 2LLUA 1ZFSA 1M63B 4OR9B 1BT6A 1IJ5A 2DOQA 3NSLA 5PALA 1JBAA 2I7AA 2IS9A 1NCYA 1AP4A 4UPGA 3CLNA 3O6BA 5FYXA 3SG2A 2LUXA 1DVIA 2PVBA 2KQ6A 1JWDA 1MR8A 1MHOA 1SNLA 3TUYB 2WCFA 3DVKA 2WORA 1N0YA 3O78A 2OTGC 3AAKA 2KQYA 1S6CA 1SBJA 2LMVA 3ZNIA 1QIWA 1F8HA 1TNWA 1J55A 1EG4A 2WNDA 1WDCB 2JTTA 3RM1A 3EVUA 3A8RA 3VRNA 4M2QA 3I5GB 4PALA 1WRLA 1TNQA 1KK7Z 4GPLB 1M31A 4BY4A 1J7PA 4MVFA 2M7NA 1V1FA 1B47A 1XFVO 3BOWA 3EK8A 1XVJA 4N1FA 1CKKA 2NCPA 2K7DA 3ICBA 1K94A 1H8BA 1QVIY 1X02A 4U8DA 2BKIB 2LHIA 1DJHA 2MJWB 2L0PA 1UHKA 1WLMA 2BKHB 3MSEB 1S5GZ 1TNPA 3CR4X 2JWWA 1QX7A 1TN4A 1FW4A 4OKHA 4PDZA 3KHEA 4GGFA 1NX1A 1BG1A 3OX6A 1CMFA 4A4BA 1UHHA 5D7FA 2BL0B 2LP2A 1CLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAP A;  1TOP A;  1AUI B;  5IBW A;  1KSM A;  3IQO A;  3PSR A;  3BUN B;  2OS8 B;  1U5I B;  4XJK B;  1TCF A;  4MEW A;  1SK6 D;  2F33 A;  1XFX O;  2BCB A;  1Y1U A;  2KYC A;  1CFC A;  1QLS A;  1S6I A;  5ER4 X;  1YUT A;  2M1K B;  1S3P A;  4YBH B;  1J1D A;  3AKA A;  3OHM B;  4ORA B;  1KFX L;  1DF0 A;  2F8P A;  1HQV A;  3I5I B;  1WRK A;  1EXR A;  1A03 A;  1Y1X A;  1S6J A;  4DRW A;  1AK8 A;  4E68 A;  1KFU L;  1OQP A;  2ZN9 A;  1NYA A;  3BQ3 A;  3WHU B;  1W7I B;  1OZS A;  2MA2 A;  4PE0 A;  1UWO A;  5HKW A;  2JXL A;  1L2O C;  2K2A A;  2ZRT A;  1QLK A;  1IRJ A;  2MLE C;  1B9A A;  1OSA A;  3VRR A;  1IJ6 A;  5DKR A;  5CSF A;  1MF8 B;  2JPT A;  1QVI Z;  2ZN8 A;  3CTN A;  4MBE A;  2L51 A;  3VRP A;  1G8I A;  3C1V A;  1SPY A;  1RJV A;  2L5X B;  3BUM B;  4I5N B;  1PSB A;  2I2R E;  1K9K A;  5F6T A;  3TS5 B;  4HRE E;  1MXL C;  1SCV A;  3LK0 A;  1TNX A;  2LVK A;  3TUY C;  3NXA A;  2F3Z A;  1WRZ A;  2AAO A;  1QV1 A;  2LC5 A;  4MZK A;  2M9G A;  3FS7 A;  4GFT A;  1K90 D;  1YR5 A;  1KCY A;  5JJG A;  2CXJ A;  1B1G A;  3EKJ A;  1CB1 A;  4D1E A;  3AAJ A;  4L9M A;  1ALV A;  2KBM A;  3EKH A;  1CFF A;  1NX2 A;  4PE4 A;  1IQ3 A;  1WDC C;  1DMO A;  1SR6 B;  1Y6W A;  3I5G C;  1IGV A;  1NX3 A;  3EVR A;  1F54 A;  4YGD B;  2JRF A;  4CFR A;  1XK4 A;  1KK8 B;  1DT7 B;  1DJZ A;  1YRT B;  3E3R A;  3NSK A;  1YUS A;  1RTP 1;  1YX7 A;  2AUC A;  2EGD A;  3CR5 X;  4A4C A;  2K7O A;  2SAS A;  1BMO A;  1KSO A;  3O4Y A;  1R6P A;  2PSR A;  4OVN F;  2JXC A;  2L4H A;  1YVH A;  5J3X A;  1NP8 A;  4MN0 A;  4HRG A;  4PCW A;  2TN4 A;  2ZND A;  2LE9 B;  4FQO A;  1B8C A;  1QS7 A;  2WC8 A;  2M7L A;  3PAL A;  4M2O A;  1YUR A;  2V53 A;  5TNC A;  2CNP A;  3DF0 B;  4DS7 A;  1QJT A;  2BL0 C;  2HQW A;  1CFP A;  2M1U A;  5DKN A;  2JTZ A;  1Y1A A;  2I94 A;  1K96 A;  3KF9 A;  5DKQ A;  1CMG A;  2LVV A;  2M8U A;  2I18 A;  4AOM A;  2OS8 C;  2JC2 A;  1GGZ A;  5I2O A;  1F55 A;  2BBN A;  3IF7 A;  1J7R A;  3CS1 A;  1R2U A;  1UHI A;  3SG4 A;  1H4B A;  2KHN A;  1C7W A;  1CFD A;  3LK1 A;  2KI6 C;  1LVC D;  2BCA A;  3HCM A;  4MZJ A;  2HQ8 A;  4DUQ A;  1SRA A;  1QXP A;  2KAX A;  3I5I C;  4MRX A;  2MLF C;  2KGB C;  2WCE A;  2KBI A;  5HLO A;  3VGO A;  2LHL A;  1A4P A;  1PVA A;  1A75 B;  1SL8 A;  1G4Y R;  1FF1 A;  3JVT B;  3WNX B;  4HSZ A;  1B8R A;  1LIN A;  1MWN A;  5AAN A;  2JT8 A;  4DCK A;  1AJ4 A;  1KQV A;  2NZ0 A;  1M39 A;  4YI9 A;  1A29 A;  3BYA A;  2KOT A;  1Y0V H;  3K21 A;  4ZCU A;  2Y5I A;  1REC A;  5HYD A;  4PHM A;  2MHH A;  3BXK A;  1D1O A;  2KI6 D;  1QAS A;  5BPJ A;  5AER A;  1GGW A;  3EK7 A;  2FOT A;  1YRU B;  2K0J A;  2KNE A;  3DVM A;  1NSH A;  3KPX A;  1JUO A;  1EH2 A;  3PFV A;  3TS5 C;  5CSN A;  1UUR A;  1KQM B;  2M3W A;  2H61 C;  4QJ3 B;  1RRO A;  5K89 A;  1PAL A;  2R2I A;  2QPT A;  3PN7 B;  1F71 A;  3A4U B;  1DJW A;  2RGI A;  2KDH A;  1MXE A;  4M2P A;  4XJK A;  4ZCV A;  1YUU A;  5HLV A;  2MRD A;  1SL7 A;  1DJI A;  2CBL A;  2KGR A;  3LCP C;  5JOL A;  2PMY A;  4YI8 A;  5KSZ A;  2LAN A;  2Q4U A;  1RWY A;  4AQI A;  1XYD A;  1SCM B;  2M97 A;  5I8N A;  1S1E A;  1QAT A;  3GK2 A;  3VRQ A;  4CFQ A;  1F4O A;  4IL1 A;  2K2F A;  1K9U A;  2JOJ A;  1SR6 C;  2EHB A;  3CR2 A;  1QTX A;  3RLZ A;  1KK8 C;  4PHK A;  1SL9 A;  3LL8 B;  4JQ0 D;  4USL A;  3SG7 A;  3ZWH A;  2LVJ A;  1NWD A;  2L50 A;  2WOS A;  4ORC B;  5I2Q A;  1XFZ O;  2LMU A;  4WQ3 A;  3FWC A;  1EJ3 A;  1UP5 A;  1K8U A;  3CGA A;  4PHN A;  3EK4 A;  2LLT A;  2OPO A;  3JTD B;  1UHJ A;  2LV7 A;  1EG3 A;  2BCX A;  1SW8 A;  2K7C A;  2GGM A;  5D69 A;  1JC2 A;  2VRG A;  3H4S E;  1JF0 A;  2Q91 A;  2L4I A;  3OX5 A;  2EC6 B;  1CLB A;  2L98 A;  2KFG A;  4JPZ B;  1FI5 A;  4F0Z B;  2KYF A;  4WQ2 A;  2HET A;  1GQM A;  5HKY A;  4DIR A;  2FCD A;  5CSI A;  1K2H A;  1K93 D;  4N1G A;  1YTZ C;  3SIB A;  2NXQ A;  1IWQ A;  4QJ5 B;  2NLN A;  2PRU A;  3M0W A;  1LA3 A;  2B1U A;  2HPS A;  1NX0 A;  3CZT X;  1XFW O;  2FJU B;  2K7B A;  4OCI A;  3PLF B;  4I5J A;  1IH0 A;  1N2D A;  5CSJ A;  1JFJ A;  2F2P A;  5KTY A;  2L2E A;  1MUX A;  3JVT C;  1ZAC A;  1UUS A;  2ZKM X;  3LLE A;  1SY9 A;  2ZNE A;  4YRU A;  1DGU A;  1DJX A;  1LXF C;  2JZI A;  2LP3 A;  3DVE A;  3TDZ A;  1FPW A;  1BJF A;  1CDP A;  1JF2 A;  2LVI A;  4XYN A;  1S5G Y;  1GJY A;  3D0Y B;  1CTR A;  1Q80 A;  3OB1 B;  1EL4 A;  1L7Z A;  3D10 A;  1M46 A;  3WHT B;  3SIA A;  4GNK B;  5CPV A;  3DVJ A;  4ORB B;  3DF0 A;  4NDC A;  1PSR A;  4HRH A;  1BOD A;  1TIZ A;  2F2O A;  1KQM C;  2JT3 A;  4NDB A;  2SCP A;  3PAT A;  3IQQ A;  1V1G A;  4CPV A;  1TRF A;  4I5K A;  1QIV A;  3PN7 C;  4R1E A;  4YGB B;  1KWO B;  1MQ1 A;  2MAZ A;  1BF5 A;  3O2P A;  4YGA A;  2LLS A;  2MBX A;  3KO0 A;  2E30 A;  2KAY A;  1SCM C;  4YGC B;  1TCO B;  1QX2 A;  1ALW A;  2LUC A;  4MSP A;  1LKJ A;  2PAS A;  4C0L A;  2JUL A;  1DJY A;  2A4J A;  2JNF A;  3TDU A;  1YX8 A;  4BY5 A;  2LCP A;  2BE6 A;  4GGN A;  1CLM A;  1ZMZ A;  3DD4 A;  3GK4 X;  1AJ5 A;  3BOW B;  2KI4 B;  1A75 A;  1IG5 A;  1PVB A;  1S26 D;  2JT0 A;  3AKB A;  3KEV A;  3GK1 A;  3VRO A;  4GUK A;  2F3Y A;  4JWQ A;  2M49 B;  4GBA A;  1RFJ A;  1M45 A;  2Y4Q A;  3SG3 A;  2K61 A;  1K95 A;  3CWG A;  1DTL A;  1LA0 A;  1YVL A;  2KFF A;  2H2K A;  1UHN A;  1J7Q A;  1NCZ A;  2HF5 A;  2O60 A;  1OZO A;  5HKZ A;  3I5H B;  1DGV A;  1BOC A;  3JTD C;  4OV2 A;  2BBM A;  2PAL A;  1ZOT B;  1OMR A;  4AQJ A;  5AFP A;  1C07 A;  1J7O A;  1BU3 A;  3EVV A;  4YGE B;  2M29 A;  2GV5 A;  3PM8 A;  1CDM A;  1U5I A;  1A2X A;  3HX4 A;  4Q04 A;  1RK9 A;  2EC6 C;  4MZL A;  1PUL A;  2QAC A;  1W7J B;  3WXA A;  1OOJ A;  1WY9 A;  3NSI A;  2GGZ A;  2JNX A;  2OTG B;  1OMD A;  2WCB A;  2COL B;  2LNK A;  1AVS A;  1VRK A;  1FI6 A;  5ER5 A;  1DF0 B;  3OB2 B;  4P5O E;  4MRY A;  1NPQ A;  1FBV A;  1BR1 B;  1IKU A;  4PHJ A;  1NCX A;  1G33 A;  3FIA A;  1BLQ A;  3SG5 A;  1HT9 A;  3GOF A;  3TZ1 A;  1C7V A;  1OE9 B;  2Y1N A;  4GAO A;  1WLZ A;  3BUX B;  2LM5 A;  1B7T Y;  1XK4 C;  1NUB A;  1F4Q A;  3TDI A;  1KFX S;  2JQ6 A;  1SYM A;  4WRI A;  5B8I B;  1TTX A;  3SJS A;  5GQQ C;  1XFY O;  3BUO B;  1S36 A;  4C0K A;  2CCM A;  1BR4 B;  1KFU S;  4PE1 A;  2ZFD A;  3NSO A;  1ODB A;  1IQ5 A;  4QJ4 B;  1SKT A;  1PRW A;  1QV0 A;  2E6W A;  2M0R A;  4FTG A;  2H61 A;  3QRX A;  1CM1 A;  2G9B A;  1SMG A;  1CDN A;  5AXI A;  4ETO A;  3I5F C;  3I5F B;  3FWB A;  1CDL A;  2FCE A;  2LMT A;  2ZRS A;  1B8L A;  3BUW B;  1N65 A;  3SG6 A;  5G08 A;  2O5G A;  4MLW A;  4C0J A;  1KWO C;  4NQG A;  4ICB A;  2KAV A;  3OP0 A;  1K9P A;  1F70 A;  2KSP A;  5KU1 A;  4P2Y B;  1NIW A;  1KK7 Y;  1B4C A;  1J1E A;  4I5L B;  4N5X A;  2BEC A;  1AHR A;  4CLN A;  2CTN A;  1QX5 B;  2P6B B;  2JU0 A;  2G2B A;  2AMI A;  2KI4 C;  1XO5 A;  2Y1M A;  4NDD A;  2ISD A;  1L2O B;  1CNP A;  1OMV A;  4TNC A;  1ZUZ A;  2KFH A;  1CM4 A;  2BE4 A;  4CID A;  1DJG A;  2NCO A;  2K8M B;  5AEQ A;  2CT9 A;  1B7T Z;  2D8N A;  3F45 A;  1XA5 A;  1E8A A;  1JFK A;  4PE7 A;  3D0Y A;  4GGF C;  1XFU O;  1JSA A;  5I2L A;  1PK0 D;  3I5H C;  2LLU A;  1ZFS A;  1M63 B;  4OR9 B;  1BT6 A;  1IJ5 A;  2DOQ A;  3NSL A;  5PAL A;  1JBA A;  2I7A A;  2IS9 A;  1NCY A;  1AP4 A;  4UPG A;  3CLN A;  3O6B A;  5FYX A;  3SG2 A;  2LUX A;  1DVI A;  2PVB A;  2KQ6 A;  1JWD A;  1MR8 A;  1MHO A;  1SNL A;  3TUY B;  2WCF A;  3DVK A;  2WOR A;  1N0Y A;  3O78 A;  2OTG C;  3AAK A;  2KQY A;  1S6C A;  1SBJ A;  2LMV A;  3ZNI A;  1QIW A;  1F8H A;  1TNW A;  1J55 A;  1EG4 A;  2WND A;  1WDC B;  2JTT A;  3RM1 A;  3EVU A;  3A8R A;  3VRN A;  4M2Q A;  3I5G B;  4PAL A;  1WRL A;  1TNQ A;  1KK7 Z;  4GPL B;  1M31 A;  4BY4 A;  1J7P A;  4MVF A;  2M7N A;  1V1F A;  1B47 A;  1XFV O;  3BOW A;  3EK8 A;  1XVJ A;  4N1F A;  1CKK A;  2NCP A;  2K7D A;  3ICB A;  1K94 A;  1H8B A;  1QVI Y;  1X02 A;  4U8D A;  2BKI B;  2LHI A;  1DJH A;  2MJW B;  2L0P A;  1UHK A;  1WLM A;  2BKH B;  3MSE B;  1S5G Z;  1TNP A;  3CR4 X;  2JWW A;  1QX7 A;  1TN4 A;  1FW4 A;  4OKH A;  4PDZ A;  3KHE A;  4GGF A;  1NX1 A;  1BG1 A;  3OX6 A;  1CMF A;  4A4B A;  1UHH A;  5D7F A;  2BL0 B;  2LP2 A;  1CLL A; 
#chains in the Genus database with same CATH topology
 2LAP A;  1TOP A;  1AUI B;  5IBW A;  1KSM A;  3IQO A;  3PSR A;  3BUN B;  2OS8 B;  1U5I B;  4XJK B;  1TCF A;  4MEW A;  1SK6 D;  2F33 A;  1XFX O;  2BCB A;  1Y1U A;  2JPO A;  2KYC A;  3B7A A;  1OOI X;  3S0G A;  1QLS A;  1CFC A;  1S6I A;  5ER4 X;  1YUT A;  2M1K B;  1S3P A;  4YBH B;  1J1D A;  3AKA A;  3OHM B;  4ORA B;  1KFX L;  1DF0 A;  2F8P A;  1HQV A;  3I5I B;  1WRK A;  1EXR A;  3NGV A;  1Y1X A;  1A03 A;  1S6J A;  3R72 A;  4DRW A;  1P28 A;  1AK8 A;  4E68 A;  1KFU L;  1OQP A;  2ZN9 A;  3L4L A;  1NYA A;  1OW4 A;  3BQ3 A;  3WHU B;  1W7I B;  1OZS A;  2MA2 A;  1T14 A;  4PE0 A;  1UWO A;  5HKW A;  2JXL A;  1L2O C;  2K2A A;  2ZRT A;  1QLK A;  1IRJ A;  2MLE C;  1B9A A;  1OSA A;  3VRR A;  1IJ6 A;  5DKR A;  5CSF A;  2BNX A;  1MF8 B;  2JPT A;  1QVI Z;  2ZN8 A;  3CTN A;  4MBE A;  2L51 A;  3VRP A;  1G8I A;  3C1V A;  1SPY A;  1RJV A;  2L5X B;  3BUM B;  3PM2 A;  4I5N B;  3D76 A;  1PSB A;  2I2R E;  1K9K A;  3K1E A;  5F6T A;  3TS5 B;  2FJY A;  4HRE E;  1MXL C;  1SCV A;  3LK0 A;  1TNX A;  2PQL A;  2LVK A;  3TUY C;  3NXA A;  2F3Z A;  1WRZ A;  2AAO A;  1QV1 A;  2LC5 A;  4MZK A;  2M9G A;  3FS7 A;  4GFT A;  1K90 D;  1YR5 A;  1KCY A;  5JJG A;  1Z2C B;  2CXJ A;  1B1G A;  3EKJ A;  1CB1 A;  4D1E A;  1FPW A;  3AAJ A;  2BAP A;  1ALV A;  2KBM A;  2WCM A;  3EKH A;  4L9M A;  1NX2 A;  4PE4 A;  1CFF A;  1IQ3 A;  1WDC C;  1DMO A;  1SR6 B;  1Y6W A;  3I5G C;  1IGV A;  1NX3 A;  3EVR A;  1F54 A;  4YGD B;  2JRF A;  4CFR A;  1XK4 A;  1KK8 B;  1DT7 B;  1DJZ A;  1YRT B;  3E3R A;  3NSK A;  1YUS A;  1RTP 1;  3SS3 A;  1YX7 A;  2AUC A;  2EGD A;  3CR5 X;  3D77 A;  2QEB A;  4A4C A;  2K7O A;  2SAS A;  1BMO A;  1KSO A;  3O4Y A;  1R6P A;  2PSR A;  4OVN F;  2JXC A;  2L4H A;  1YVH A;  5J3X A;  1NP8 A;  4MN0 A;  4HRG A;  4PCW A;  2TN4 A;  2ZND A;  2LE9 B;  4FQO A;  1B8C A;  1QS7 A;  2WC8 A;  2M7L A;  3PAL A;  4M2O A;  1YUR A;  2V53 A;  5TNC A;  2CNP A;  3DF0 B;  5FI2 A;  4DS7 A;  1QJT A;  2BL0 C;  2HQW A;  1CFP A;  2M1U A;  5DKN A;  2JTZ A;  1Y1A A;  2I94 A;  1K96 A;  3KF9 A;  5DKQ A;  1CMG A;  2LVV A;  2M8U A;  2I18 A;  4AOM A;  2OS8 C;  2JC2 A;  1GGZ A;  3UNW A;  1TUZ A;  5I2O A;  3EG5 B;  3SS5 A;  1F55 A;  1TWO A;  3CZ1 A;  2BBN A;  3IF7 A;  1J7R A;  3CS1 A;  1R2U A;  1UHI A;  3PJI A;  3SG4 A;  1H4B A;  2KHN A;  1C7W A;  1CFD A;  3LK1 A;  2KI6 C;  3D75 A;  1LVC D;  2BCA A;  3HCM A;  4MZJ A;  2HQ8 A;  4DUQ A;  1SRA A;  4KYN A;  1QXP A;  2KAX A;  3I5I C;  4MRX A;  2MLF C;  2KGB C;  2WCE A;  2KBI A;  5HLO A;  3VGO A;  2LHL A;  1A4P A;  1PVA A;  1A75 B;  1SL8 A;  1G4Y R;  1FF1 A;  3JVT B;  3WNX B;  4HSZ A;  1B8R A;  1LIN A;  1MWN A;  5AAN A;  2JT8 A;  4DCK A;  1AJ4 A;  1KQV A;  2NZ0 A;  1M39 A;  4YI9 A;  1A29 A;  3BYA A;  2KOT A;  1Y0V H;  3K21 A;  4ZCU A;  2Y5I A;  1REC A;  5HYD A;  4PHM A;  2MHH A;  3BXK A;  4INX A;  2KI6 D;  1D1O A;  1QAS A;  5BPJ A;  5AER A;  1GGW A;  2QEO A;  3EK7 A;  1OOG A;  2FOT A;  1YRU B;  2K0J A;  2KNE A;  3CYZ A;  3DVM A;  1NSH A;  1W9Z A;  3KPX A;  1JUO A;  1EH2 A;  3PFV A;  3TS5 C;  5CSN A;  1UUR A;  1KQM B;  3D74 A;  5I94 A;  2M3W A;  2H61 C;  4QJ3 B;  1RRO A;  5K89 A;  1PAL A;  2R2I A;  2QPT A;  3PN7 B;  1F71 A;  3A4U B;  1DJW A;  2RGI A;  2KDH A;  1MXE A;  4M2P A;  4XJK A;  4ZCV A;  1YUU A;  5HLV A;  2MRD A;  3OGN A;  3DYE A;  1SL7 A;  1DJI A;  2CBL A;  2KGR A;  3LCP C;  5JOL A;  2PMY A;  4YI8 A;  5KSZ A;  2LAN A;  2Q4U A;  1RWY A;  4AQI A;  1XYD A;  1SCM B;  2M97 A;  5I8N A;  1S1E A;  1QAT A;  3GK2 A;  2WC6 A;  3VRQ A;  4CFQ A;  1F4O A;  4IL1 A;  2K2F A;  3B88 A;  1K9U A;  2QDI A;  2JOJ A;  1SR6 C;  5EL2 A;  3OBV A;  2EHB A;  2ERB A;  3D78 A;  3CR2 A;  1QTX A;  3RLZ A;  1KK8 C;  4PHK A;  1SL9 A;  2P71 A;  3LL8 B;  4JQ0 D;  4USL A;  1QWV A;  3SG7 A;  3ZWH A;  2LVJ A;  1DEK A;  3FE8 A;  1NWD A;  2L50 A;  2WOS A;  4ORC B;  3L47 A;  5I2Q A;  1XFZ O;  2LMU A;  4WQ3 A;  3FWC A;  1EJ3 A;  1UP5 A;  1K8U A;  3CGA A;  4PHN A;  3EK4 A;  2LLT A;  2OPO A;  3JTD B;  1UHJ A;  2LV7 A;  1EG3 A;  2BCX A;  1SW8 A;  2K7C A;  2GGM A;  5D69 A;  1JC2 A;  2VRG A;  3H4S E;  1JF0 A;  2Q91 A;  5FI6 A;  2L4I A;  3OX5 A;  2EC6 B;  1CLB A;  2L98 A;  4OZD A;  2KFG A;  1LS8 A;  2WCK A;  4JPZ B;  1FI5 A;  4F0Z B;  3B87 A;  3RZS A;  2KYF A;  4WQ2 A;  2HET A;  2YGU A;  3NHI A;  1GQM A;  5HKY A;  4DIR A;  2FCD A;  5CSI A;  1K2H A;  1K93 D;  4N1G A;  1YTZ C;  3SIB A;  2NXQ A;  1IWQ A;  4QJ5 B;  2NLN A;  2PRU A;  3M0W A;  1LA3 A;  2B1U A;  2HPS A;  1NX0 A;  3CZT X;  1XFW O;  2FJU B;  2K7B A;  4OCI A;  3PLF B;  4I5J A;  1IH0 A;  1N2D A;  5CSJ A;  1JFJ A;  5D3O A;  2F2P A;  5KTY A;  2L2E A;  1MUX A;  3JVT C;  1ZAC A;  1UUS A;  2ZKM X;  3LLE A;  1SY9 A;  2ZNE A;  4YRU A;  1DGU A;  1DJX A;  1LXF C;  2JZI A;  2LP3 A;  2QEV A;  3DVE A;  3TDZ A;  3V2L A;  1BJF A;  1CDP A;  1JF2 A;  2H8V A;  2LVI A;  2KLD A;  3B6X A;  4XYN A;  1S5G Y;  1GJY A;  3NHT A;  3D0Y B;  1CTR A;  1Q80 A;  3OB1 B;  1EL4 A;  1L7Z A;  3D10 A;  2WCH A;  1M46 A;  3WHT B;  1ORG A;  3SIA A;  4GNK B;  5CPV A;  3L4A A;  3DVJ A;  4ORB B;  3S0F A;  3DF0 A;  1GM0 A;  1Z4H A;  4NDC A;  1PSR A;  4HRH A;  2L2C A;  1TIZ A;  2F2O A;  1BOD A;  1KQM C;  1OOH A;  2JT3 A;  2SCP A;  3PAT A;  4NDB A;  3IQQ A;  3VB1 A;  1V1G A;  4CPV A;  1TRF A;  4I5K A;  1QIV A;  3PN7 C;  4R1E A;  4YGB B;  1TUJ A;  1KWO B;  1MQ1 A;  2MAZ A;  1BF5 A;  3O2P A;  4YGA A;  2LLS A;  3DY9 A;  2MBX A;  3KO0 A;  4JD9 A;  2E30 A;  2KAY A;  1SCM C;  4YGC B;  3O4X A;  1TCO B;  1QX2 A;  1ALW A;  2LUC A;  4MSP A;  1LKJ A;  2PAS A;  4C0L A;  2JUL A;  1DJY A;  2A4J A;  2JNF A;  3TDU A;  1YX8 A;  4BY5 A;  2LCP A;  2BE6 A;  4GGN A;  1CLM A;  1ZMZ A;  3DD4 A;  3GK4 X;  1AJ5 A;  3BOW B;  1IIO A;  2KI4 B;  1A75 A;  1IG5 A;  1PVB A;  1S26 D;  2JT0 A;  3AKB A;  3KEV A;  3GK1 A;  3VRO A;  4GUK A;  2F3Y A;  4JWQ A;  2M49 B;  4GBA A;  2GTE A;  1RFJ A;  1M45 A;  2Y4Q A;  3SG3 A;  2K61 A;  1K95 A;  3CWG A;  1DTL A;  1LA0 A;  1YVL A;  2KFF A;  3S0D A;  2KPH A;  2H2K A;  1UHN A;  4IJ7 A;  1J7Q A;  1NCZ A;  2HF5 A;  2O60 A;  1OZO A;  5HKZ A;  1DQE A;  3I5H B;  1DGV A;  1BOC A;  3S0A A;  3JTD C;  4OV2 A;  2BBM A;  2PAL A;  1ZOT B;  1OMR A;  4AQJ A;  5AFP A;  1C07 A;  1J7O A;  1BU3 A;  3EVV A;  4YGE B;  2M29 A;  2GV5 A;  3PM8 A;  1CDM A;  1U5I A;  3R1V A;  3CZ2 A;  1A2X A;  3HX4 A;  4Q04 A;  1RK9 A;  2EC6 C;  4MZL A;  1PUL A;  2QAC A;  1W7J B;  3S0E A;  1OOJ A;  3WXA A;  1WY9 A;  3NSI A;  2GGZ A;  2JNX A;  2OTG B;  1OMD A;  2WCB A;  2COL B;  2LNK A;  1AVS A;  2K60 A;  1VRK A;  1FI6 A;  5ER5 A;  1DF0 B;  3OB2 B;  4F7F A;  4P5O E;  4MRY A;  1NPQ A;  1FBV A;  1BR1 B;  1IKU A;  2WCL A;  4PHJ A;  1NCX A;  1G33 A;  3FIA A;  1BLQ A;  3SG5 A;  1HT9 A;  3GOF A;  3TZ1 A;  3N7H A;  1OE9 B;  3R1O A;  3Q8I A;  2Y1N A;  3FE9 A;  1C7V A;  4GAO A;  1SSE B;  1WLZ A;  3BUX B;  2LM5 A;  4PT1 A;  1B7T Y;  1XK4 C;  2KLE A;  1NUB A;  1F4Q A;  3TDI A;  1KFX S;  2JQ6 A;  1SYM A;  4WRI A;  5B8I B;  1TTX A;  3SJS A;  1DEL A;  5GQQ C;  1XFY O;  3BUO B;  1S36 A;  4C0K A;  2CCM A;  1BR4 B;  1DC1 A;  1KFU S;  4PE1 A;  2ZFD A;  3CDN A;  3NSO A;  1ODB A;  1IQ5 A;  4QJ4 B;  1SKT A;  1PRW A;  1QV0 A;  2E6W A;  2M0R A;  4FTG A;  5HL1 A;  4INW A;  2H61 A;  3QRX A;  1CM1 A;  2G9B A;  1SMG A;  1CDN A;  5AXI A;  4ETO A;  3I5F C;  3I5F B;  3FWB A;  3S0B A;  1CDL A;  2FCE A;  2LMT A;  2ZRS A;  1B8L A;  1XFR A;  3BUW B;  1N65 A;  3SG6 A;  5FI7 A;  5G08 A;  2O5G A;  4MLW A;  4C0J A;  1KWO C;  2L5Y A;  4NQG A;  4ICB A;  2KAV A;  3OP0 A;  1K9P A;  1F70 A;  2KSP A;  5KU1 A;  4P2Y B;  1NIW A;  1KK7 Y;  3BFB A;  1B4C A;  1J1E A;  4I5L B;  4N5X A;  2BEC A;  1AHR A;  4CLN A;  2PYQ A;  4FQT A;  2P70 A;  2CTN A;  2WC5 A;  1QX5 B;  2P6B B;  2JU0 A;  2G2B A;  2AMI A;  2KI4 C;  1XO5 A;  2Y1M A;  4NDD A;  2ISD A;  1L2O B;  1CNP A;  1OMV A;  4TNC A;  1ZUZ A;  2KFH A;  1CM4 A;  2BE4 A;  4CID A;  1DJG A;  2NCO A;  2K8M B;  3BFH A;  5AEQ A;  2CT9 A;  3FE6 A;  1B7T Z;  2D8N A;  3DZT A;  3F45 A;  1XA5 A;  1E8A A;  1JFK A;  4PE7 A;  3D0Y A;  4GGF C;  1XFU O;  1JSA A;  5I2L A;  1PK0 D;  3I5H C;  2LLU A;  3CAB A;  1ZFS A;  1M63 B;  3D73 A;  3DXL A;  1BT6 A;  1IJ5 A;  4OR9 B;  2DOQ A;  3NSL A;  5PAL A;  1JBA A;  2I7A A;  2IS9 A;  1NCY A;  1AP4 A;  4UPG A;  3CLN A;  3O6B A;  5FYX A;  3SG2 A;  2LUX A;  1DVI A;  2PVB A;  2KQ6 A;  3BFA A;  1JWD A;  1MR8 A;  1MHO A;  1SNL A;  2QEH A;  3TUY B;  2WCF A;  3DVK A;  2WOR A;  1N0Y A;  3IVT A;  2WCJ A;  3CZ0 A;  3O78 A;  2OTG C;  3AAK A;  3B86 A;  2KQY A;  1S6C A;  1SBJ A;  2LMV A;  3ZNI A;  1QIW A;  1F8H A;  1TNW A;  3SS4 A;  1J55 A;  1EG4 A;  2WND A;  1WDC B;  2JTT A;  3RM1 A;  3EVU A;  3A8R A;  3VRN A;  4M2Q A;  3I5G B;  4PAL A;  1WRL A;  1TNQ A;  1KK7 Z;  4GPL B;  1M31 A;  4BY4 A;  1J7P A;  4MVF A;  5DIC A;  2M7N A;  4JKT A;  1V1F A;  1B47 A;  1XFV O;  3BOW A;  3EK8 A;  1XVJ A;  4N1F A;  1CKK A;  2NCP A;  2K7D A;  3ICB A;  1K94 A;  1H8B A;  1QVI Y;  1X02 A;  4U8D A;  2BKI B;  2LHI A;  1DJH A;  2MJW B;  2L0P A;  3QME A;  1UHK A;  1WLM A;  2BKH B;  1OOF A;  3MSE B;  1S5G Z;  1TNP A;  3UO9 A;  3CR4 X;  2JWW A;  1QX7 A;  1TN4 A;  1FW4 A;  4OKH A;  4PDZ A;  3KHE A;  4GGF A;  1NX1 A;  3R1P A;  1C3Y A;  1BG1 A;  3OX6 A;  1CMF A;  4A4B A;  1UHH A;  3BJH A;  1C3Z A;  5D7F A;  2BL0 B;  2LP2 A;  1CLL A; 
#chains in the Genus database with same CATH homology
 2LAP A;  1TOP A;  1AUI B;  5IBW A;  1KSM A;  3IQO A;  3PSR A;  3BUN B;  2OS8 B;  1U5I B;  4XJK B;  1TCF A;  4MEW A;  1SK6 D;  2F33 A;  1XFX O;  2BCB A;  1Y1U A;  2KYC A;  1CFC A;  1QLS A;  1S6I A;  5ER4 X;  1YUT A;  2M1K B;  1S3P A;  4YBH B;  1J1D A;  3AKA A;  3OHM B;  4ORA B;  1KFX L;  1DF0 A;  2F8P A;  1HQV A;  3I5I B;  1WRK A;  1EXR A;  1A03 A;  1Y1X A;  1S6J A;  4DRW A;  1AK8 A;  4E68 A;  1KFU L;  1OQP A;  2ZN9 A;  1NYA A;  3BQ3 A;  3WHU B;  1W7I B;  1OZS A;  2MA2 A;  4PE0 A;  1UWO A;  5HKW A;  2JXL A;  1L2O C;  2K2A A;  2ZRT A;  1QLK A;  1IRJ A;  2MLE C;  1B9A A;  1OSA A;  3VRR A;  1IJ6 A;  5DKR A;  5CSF A;  1MF8 B;  2JPT A;  1QVI Z;  2ZN8 A;  3CTN A;  4MBE A;  2L51 A;  3VRP A;  1G8I A;  3C1V A;  1SPY A;  1RJV A;  2L5X B;  3BUM B;  4I5N B;  1PSB A;  2I2R E;  1K9K A;  5F6T A;  3TS5 B;  4HRE E;  1MXL C;  1SCV A;  3LK0 A;  1TNX A;  2LVK A;  3TUY C;  3NXA A;  2F3Z A;  1WRZ A;  2AAO A;  1QV1 A;  2LC5 A;  4MZK A;  2M9G A;  3FS7 A;  4GFT A;  1K90 D;  1YR5 A;  1KCY A;  5JJG A;  2CXJ A;  1B1G A;  3EKJ A;  1CB1 A;  4D1E A;  3AAJ A;  4L9M A;  1ALV A;  2KBM A;  3EKH A;  1CFF A;  1NX2 A;  4PE4 A;  1IQ3 A;  1WDC C;  1DMO A;  1SR6 B;  1Y6W A;  3I5G C;  1IGV A;  1NX3 A;  3EVR A;  1F54 A;  4YGD B;  2JRF A;  4CFR A;  1XK4 A;  1KK8 B;  1DT7 B;  1DJZ A;  1YRT B;  3E3R A;  3NSK A;  1YUS A;  1RTP 1;  1YX7 A;  2AUC A;  2EGD A;  3CR5 X;  4A4C A;  2K7O A;  2SAS A;  1BMO A;  1KSO A;  3O4Y A;  1R6P A;  2PSR A;  4OVN F;  2JXC A;  2L4H A;  1YVH A;  5J3X A;  1NP8 A;  4MN0 A;  4HRG A;  4PCW A;  2TN4 A;  2ZND A;  2LE9 B;  4FQO A;  1B8C A;  1QS7 A;  2WC8 A;  2M7L A;  3PAL A;  4M2O A;  1YUR A;  2V53 A;  5TNC A;  2CNP A;  3DF0 B;  4DS7 A;  1QJT A;  2BL0 C;  2HQW A;  1CFP A;  2M1U A;  5DKN A;  2JTZ A;  1Y1A A;  2I94 A;  1K96 A;  3KF9 A;  5DKQ A;  1CMG A;  2LVV A;  2M8U A;  2I18 A;  4AOM A;  2OS8 C;  2JC2 A;  1GGZ A;  5I2O A;  1F55 A;  2BBN A;  3IF7 A;  1J7R A;  3CS1 A;  1R2U A;  1UHI A;  3SG4 A;  1H4B A;  2KHN A;  1C7W A;  1CFD A;  3LK1 A;  2KI6 C;  1LVC D;  2BCA A;  3HCM A;  4MZJ A;  2HQ8 A;  4DUQ A;  1SRA A;  1QXP A;  2KAX A;  3I5I C;  4MRX A;  2MLF C;  2KGB C;  2WCE A;  2KBI A;  5HLO A;  3VGO A;  2LHL A;  1A4P A;  1PVA A;  1A75 B;  1SL8 A;  1G4Y R;  1FF1 A;  3JVT B;  3WNX B;  4HSZ A;  1B8R A;  1LIN A;  1MWN A;  5AAN A;  2JT8 A;  4DCK A;  1AJ4 A;  1KQV A;  2NZ0 A;  1M39 A;  4YI9 A;  1A29 A;  3BYA A;  2KOT A;  1Y0V H;  3K21 A;  4ZCU A;  2Y5I A;  1REC A;  5HYD A;  4PHM A;  2MHH A;  3BXK A;  1D1O A;  2KI6 D;  1QAS A;  5BPJ A;  5AER A;  1GGW A;  3EK7 A;  2FOT A;  1YRU B;  2K0J A;  2KNE A;  3DVM A;  1NSH A;  3KPX A;  1JUO A;  1EH2 A;  3PFV A;  3TS5 C;  5CSN A;  1UUR A;  1KQM B;  2M3W A;  2H61 C;  4QJ3 B;  1RRO A;  5K89 A;  1PAL A;  2R2I A;  2QPT A;  3PN7 B;  1F71 A;  3A4U B;  1DJW A;  2RGI A;  2KDH A;  1MXE A;  4M2P A;  4XJK A;  4ZCV A;  1YUU A;  5HLV A;  2MRD A;  1SL7 A;  1DJI A;  2CBL A;  2KGR A;  3LCP C;  5JOL A;  2PMY A;  4YI8 A;  5KSZ A;  2LAN A;  2Q4U A;  1RWY A;  4AQI A;  1XYD A;  1SCM B;  2M97 A;  5I8N A;  1S1E A;  1QAT A;  3GK2 A;  3VRQ A;  4CFQ A;  1F4O A;  4IL1 A;  2K2F A;  1K9U A;  2JOJ A;  1SR6 C;  2EHB A;  3CR2 A;  1QTX A;  3RLZ A;  1KK8 C;  4PHK A;  1SL9 A;  3LL8 B;  4JQ0 D;  4USL A;  3SG7 A;  3ZWH A;  2LVJ A;  1NWD A;  2L50 A;  2WOS A;  4ORC B;  5I2Q A;  1XFZ O;  2LMU A;  4WQ3 A;  3FWC A;  1EJ3 A;  1UP5 A;  1K8U A;  3CGA A;  4PHN A;  3EK4 A;  2LLT A;  2OPO A;  3JTD B;  1UHJ A;  2LV7 A;  1EG3 A;  2BCX A;  1SW8 A;  2K7C A;  2GGM A;  5D69 A;  1JC2 A;  2VRG A;  3H4S E;  1JF0 A;  2Q91 A;  2L4I A;  3OX5 A;  2EC6 B;  1CLB A;  2L98 A;  2KFG A;  4JPZ B;  1FI5 A;  4F0Z B;  2KYF A;  4WQ2 A;  2HET A;  1GQM A;  5HKY A;  4DIR A;  2FCD A;  5CSI A;  1K2H A;  1K93 D;  4N1G A;  1YTZ C;  3SIB A;  2NXQ A;  1IWQ A;  4QJ5 B;  2NLN A;  2PRU A;  3M0W A;  1LA3 A;  2B1U A;  2HPS A;  1NX0 A;  3CZT X;  1XFW O;  2FJU B;  2K7B A;  4OCI A;  3PLF B;  4I5J A;  1IH0 A;  1N2D A;  5CSJ A;  1JFJ A;  2F2P A;  5KTY A;  2L2E A;  1MUX A;  3JVT C;  1ZAC A;  1UUS A;  2ZKM X;  3LLE A;  1SY9 A;  2ZNE A;  4YRU A;  1DGU A;  1DJX A;  1LXF C;  2JZI A;  2LP3 A;  3DVE A;  3TDZ A;  1FPW A;  1BJF A;  1CDP A;  1JF2 A;  2LVI A;  4XYN A;  1S5G Y;  1GJY A;  3D0Y B;  1CTR A;  1Q80 A;  3OB1 B;  1EL4 A;  1L7Z A;  3D10 A;  1M46 A;  3WHT B;  3SIA A;  4GNK B;  5CPV A;  3DVJ A;  4ORB B;  3DF0 A;  4NDC A;  1PSR A;  4HRH A;  1BOD A;  1TIZ A;  2F2O A;  1KQM C;  2JT3 A;  4NDB A;  2SCP A;  3PAT A;  3IQQ A;  1V1G A;  4CPV A;  1TRF A;  4I5K A;  1QIV A;  3PN7 C;  4R1E A;  4YGB B;  1KWO B;  1MQ1 A;  2MAZ A;  1BF5 A;  3O2P A;  4YGA A;  2LLS A;  2MBX A;  3KO0 A;  2E30 A;  2KAY A;  1SCM C;  4YGC B;  1TCO B;  1QX2 A;  1ALW A;  2LUC A;  4MSP A;  1LKJ A;  2PAS A;  4C0L A;  2JUL A;  1DJY A;  2A4J A;  2JNF A;  3TDU A;  1YX8 A;  4BY5 A;  2LCP A;  2BE6 A;  4GGN A;  1CLM A;  1ZMZ A;  3DD4 A;  3GK4 X;  1AJ5 A;  3BOW B;  2KI4 B;  1A75 A;  1IG5 A;  1PVB A;  1S26 D;  2JT0 A;  3AKB A;  3KEV A;  3GK1 A;  3VRO A;  4GUK A;  2F3Y A;  4JWQ A;  2M49 B;  4GBA A;  1RFJ A;  1M45 A;  2Y4Q A;  3SG3 A;  2K61 A;  1K95 A;  3CWG A;  1DTL A;  1LA0 A;  1YVL A;  2KFF A;  2H2K A;  1UHN A;  1J7Q A;  1NCZ A;  2HF5 A;  2O60 A;  1OZO A;  5HKZ A;  3I5H B;  1DGV A;  1BOC A;  3JTD C;  4OV2 A;  2BBM A;  2PAL A;  1ZOT B;  1OMR A;  4AQJ A;  5AFP A;  1C07 A;  1J7O A;  1BU3 A;  3EVV A;  4YGE B;  2M29 A;  2GV5 A;  3PM8 A;  1CDM A;  1U5I A;  1A2X A;  3HX4 A;  4Q04 A;  1RK9 A;  2EC6 C;  4MZL A;  1PUL A;  2QAC A;  1W7J B;  3WXA A;  1OOJ A;  1WY9 A;  3NSI A;  2GGZ A;  2JNX A;  2OTG B;  1OMD A;  2WCB A;  2COL B;  2LNK A;  1AVS A;  1VRK A;  1FI6 A;  5ER5 A;  1DF0 B;  3OB2 B;  4P5O E;  4MRY A;  1NPQ A;  1FBV A;  1BR1 B;  1IKU A;  4PHJ A;  1NCX A;  1G33 A;  3FIA A;  1BLQ A;  3SG5 A;  1HT9 A;  3GOF A;  3TZ1 A;  1C7V A;  1OE9 B;  2Y1N A;  4GAO A;  1WLZ A;  3BUX B;  2LM5 A;  1B7T Y;  1XK4 C;  1NUB A;  1F4Q A;  3TDI A;  1KFX S;  2JQ6 A;  1SYM A;  4WRI A;  5B8I B;  1TTX A;  3SJS A;  5GQQ C;  1XFY O;  3BUO B;  1S36 A;  4C0K A;  2CCM A;  1BR4 B;  1KFU S;  4PE1 A;  2ZFD A;  3NSO A;  1ODB A;  1IQ5 A;  4QJ4 B;  1SKT A;  1PRW A;  1QV0 A;  2E6W A;  2M0R A;  4FTG A;  2H61 A;  3QRX A;  1CM1 A;  2G9B A;  1SMG A;  1CDN A;  5AXI A;  4ETO A;  3I5F C;  3I5F B;  3FWB A;  1CDL A;  2FCE A;  2LMT A;  2ZRS A;  1B8L A;  3BUW B;  1N65 A;  3SG6 A;  5G08 A;  2O5G A;  4MLW A;  4C0J A;  1KWO C;  4NQG A;  4ICB A;  2KAV A;  3OP0 A;  1K9P A;  1F70 A;  2KSP A;  5KU1 A;  4P2Y B;  1NIW A;  1KK7 Y;  1B4C A;  1J1E A;  4I5L B;  4N5X A;  2BEC A;  1AHR A;  4CLN A;  2CTN A;  1QX5 B;  2P6B B;  2JU0 A;  2G2B A;  2AMI A;  2KI4 C;  1XO5 A;  2Y1M A;  4NDD A;  2ISD A;  1L2O B;  1CNP A;  1OMV A;  4TNC A;  1ZUZ A;  2KFH A;  1CM4 A;  2BE4 A;  4CID A;  1DJG A;  2NCO A;  2K8M B;  5AEQ A;  2CT9 A;  1B7T Z;  2D8N A;  3F45 A;  1XA5 A;  1E8A A;  1JFK A;  4PE7 A;  3D0Y A;  4GGF C;  1XFU O;  1JSA A;  5I2L A;  1PK0 D;  3I5H C;  2LLU A;  1ZFS A;  1M63 B;  4OR9 B;  1BT6 A;  1IJ5 A;  2DOQ A;  3NSL A;  5PAL A;  1JBA A;  2I7A A;  2IS9 A;  1NCY A;  1AP4 A;  4UPG A;  3CLN A;  3O6B A;  5FYX A;  3SG2 A;  2LUX A;  1DVI A;  2PVB A;  2KQ6 A;  1JWD A;  1MR8 A;  1MHO A;  1SNL A;  3TUY B;  2WCF A;  3DVK A;  2WOR A;  1N0Y A;  3O78 A;  2OTG C;  3AAK A;  2KQY A;  1S6C A;  1SBJ A;  2LMV A;  3ZNI A;  1QIW A;  1F8H A;  1TNW A;  1J55 A;  1EG4 A;  2WND A;  1WDC B;  2JTT A;  3RM1 A;  3EVU A;  3A8R A;  3VRN A;  4M2Q A;  3I5G B;  4PAL A;  1WRL A;  1TNQ A;  1KK7 Z;  4GPL B;  1M31 A;  4BY4 A;  1J7P A;  4MVF A;  2M7N A;  1V1F A;  1B47 A;  1XFV O;  3BOW A;  3EK8 A;  1XVJ A;  4N1F A;  1CKK A;  2NCP A;  2K7D A;  3ICB A;  1K94 A;  1H8B A;  1QVI Y;  1X02 A;  4U8D A;  2BKI B;  2LHI A;  1DJH A;  2MJW B;  2L0P A;  1UHK A;  1WLM A;  2BKH B;  3MSE B;  1S5G Z;  1TNP A;  3CR4 X;  2JWW A;  1QX7 A;  1TN4 A;  1FW4 A;  4OKH A;  4PDZ A;  3KHE A;  4GGF A;  1NX1 A;  1BG1 A;  3OX6 A;  1CMF A;  4A4B A;  1UHH A;  5D7F A;  2BL0 B;  2LP2 A;  1CLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...