2BL0C

Physarum polycephalum myosin ii regulatory domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
GDDQVSEFKEAFELFDSERTGFITKEGLQTVLKQFGVRVEPAAFNEMFNEADATGNGKIQFPEFLSMMGRRMKQTTSEDILRQAFRTFDPEGTGYIPKAALQDALLNLGDRLKPHEFAEFLGITETEKGQIRYDNFINTMFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR PLASMODIAL MYOSIN HEAVY CHAIN
publication title Structural Evidence for Non-Canonical Binding of Ca2+ to a Canonical EF-Hand of a Conventional Myosin.
pubmed doi rcsb
source organism Physarum polycephalum
molecule tags Muscle protein
total genus 46
structure length 142
sequence length 142
ec nomenclature ec 3.6.1.32: Transferred entry: 5.6.1.8.
pdb deposition date 2005-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bl0C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bl0C02
2F8PA 1EL4A 1UHIA 2F2PA 3CR4X 4I5LB 1IRJA 1YVHA 1IJ6A 5PALA 1J7RA 5ER4X 1IKUA 5D7FA 3I5IB 2LP2A 3BOWA 2AUCA 2H61C 3PLFB 1JC2A 1EH2A 1E8AA 1Y6WA 1XFVO 3TDUA 1AUIB 1ZUZA 3I5GB 2HQWA 1KWOC 1H4BA 3ICBA 3O6BA 5KTYA 1NPQA 2ZFDA 4GNKB 1WRZA 2K0JA 1NX3A 5J3XA 1PVBA 1CDMA 3JTDC 1KFXS 1HQVA 1YX7A 4FQOA 4GPLB 4JPZB 1CDNA 1FI5A 1B7TY 3EK8A 5I8NA 1QVIZ 4YI8A 1RWYA 1XFUO 3I5HB 1TOPA 2CT9A 1U5IA 2KFFA 4C0JA 4D1EA 3PATA 5KU1A 1SK6D 1DJHA 2F33A 3KHEA 3SG7A 3TS5B 1S26D 3VRQA 4Q04A 1CFCA 2KQYA 1XFZO 3SJSA 1Y1UA 3A4UB 2LHLA 2OPOA 1RFJA 1LINA 1OE9B 3OB2B 2LVVA 1B4CA 2K2FA 1CMGA 1MQ1A 2M7LA 1L2OB 5B8IB 2FOTA 4GGFA 2PASA 4C0LA 1FW4A 2O60A 2KI4B 2K2AA 2V53A 2BE6A 2M0RA 2LUCA 1B8RA 4YGCB 1V1GA 3PN7C 1IH0A 3IQQA 2M9GA 1NSHA 2F3ZA 2M7NA 1S6IA 3VGOA 1GQMA 3BUXB 3TZ1A 1CFDA 2FJUB 2MJWB 1LA3A 1GGWA 1XFXO 1QLKA 3QRXA 3KPXA 1Y0VH 3EKHA 3VRNA 3AKBA 2A4JA 2KGRA 1B7TZ 4YGAA 1RECA 4USLA 1BLQA 2E30A 3DF0A 3WHTB 4YGDB 2LE9B 1RJVA 1QS7A 2PSRA 2K61A 2KOTA 5IBWA 3AAKA 2OS8C 1WDCB 2WORA 2ZNEA 1TCFA 1MR8A 3HX4A 3NSOA 4AOMA 3ZNIA 4ORAB 2F3YA 1DJXA 1NYAA 4PALA 3PSRA 4OR9B 2M29A 3WXAA 1NX2A 1XK4C 2M49B 2JTZA 1J7PA 1TNPA 2TN4A 2ZKMX 2MLEC 2O5GA 2AAOA 1QTXA 1SKTA 2JZIA 1DJGA 3LLEA 1M63B 2JRFA 3RM1A 1V1FA 2NZ0A 1IQ3A 1KQMC 1XO5A 1UHKA 3CWGA 3O2PA 1CB1A 5BPJA 3VROA 2L4IA 2ZRSA 5AEQA 5G08A 1AJ5A 1YRUB 1M31A 2LUXA 1FPWA 4N1GA 1AVSA 1B8CA 3A8RA 4QJ3B 1MF8B 4M2QA 1SW8A 1LVCD 4WQ2A 1YURA 3JVTB 1QV1A 1QVIY 2M1UA 2KFHA 2JQ6A 4MLWA 1M39A 1M46A 4AQIA 2CTNA 3TUYB 2PVBA 3HCMA 1CM4A 1YRTB 5I2LA 2L50A 1XYDA 1KWOB 2L5XB 4GAOA 2Q4UA 1BF5A 5JOLA 2VRGA 3F45A 3I5FC 5AERA 1M45A 1TIZA 5DKRA 1OMDA 3EVUA 4P2YB 3JTDB 1W7IB 3EK7A 2ZN9A 2CBLA 5GQQC 3CTNA 5TNCA 2LNKA 4PHNA 1XA5A 1EJ3A 4HRGA 2KAXA 1A75A 1DVIA 1A4PA 2WOSA 1WRKA 2KYCA 3CLNA 1UHJA 4ETOA 4MN0A 2LP3A 3H4SE 4NQGA 3D0YA 2MBXA 1K93D 1QX7A 1PRWA 1S6CA 2NXQA 1NX0A 1TTXA 3C1VA 2EHBA 1OMRA 2OTGB 3CZTX 3LK1A 3SG6A 1KFUL 3SG3A 3OX5A 1TNQA 2BE4A 3IQOA 2WCFA 2BCBA 2JPTA 4DRWA 1BR4B 1DGVA 2DOQA 2QACA 2P6BB 2H61A 4CFRA 1NCZA 1SCMB 3LK0A 2NCPA 1NCXA 1EG3A 3D10A 2MA2A 1WY9A 2BBNA 2KI6C 1LXFC 5DKNA 1IWQA 3BUWB 1K9KA 1KSMA 4GBAA 2BKIB 2K7BA 1UWOA 3M0WA 1BU3A 3BXKA 1SY9A 1ZACA 1SMGA 4MZLA 2KGBC 2E6WA 1NCYA 2BL0B 2KNEA 2Y4QA 2LVIA 4MVFA 5K89A 2GGMA 2L2EA 4GGFC 4PHJA 1CDLA 1K9UA 1KSOA 3BUMB 4XJKB 4F0ZB 5CSNA 1CLBA 1EXRA 2HQ8A 1TRFA 4I5NB 1IG5A 3GK4X 2KAVA 3NSLA 4GFTA 1LKJA 3BUNB 1GGZA 2MAZA 1JF0A 1NIWA 1QV0A 2Y1NA 1F54A 1S5GZ 3RLZA 1G4YR 2LMVA 2BKHB 2IS9A 1ZFSA 3BYAA 2LV7A 2JXLA 1A2XA 2MRDA 3EVVA 4NDDA 4YI9A 2L4HA 1YUTA 3I5HC 1ZMZA 2COLB 1CMFA 2Y1MA 4A4BA 1Y1AA 1K2HA 2WCBA 1BODA 5AXIA 4YBHB 4PHMA 1KQMB 2LC5A 2LVKA 1F70A 2LLSA 1UUSA 4PCWA 2JNFA 1YTZC 3DVEA 2PALA 1BMOA 1ALWA 2M97A 1SRAA 1DJWA 1ODBA 1K96A 3GK2A 3PM8A 1DF0B 2AMIA 1KFUS 1KQVA 1YUUA 1FI6A 1W7JB 1YR5A 1CM1A 2KQ6A 1Y1XA 4OV2A 3LCPC 3KEVA 2K7CA 1JSAA 1SCVA 1NUBA 4P5OE 1JFJA 2ZRTA 3WNXB 3E3RA 1KK8C 2JXCA 4HSZA 1NWDA 1IJ5A 1Q80A 2EGDA 1SPYA 3KO0A 2LM5A 1IQ5A 2GV5A 4PE1A 1TNWA 2KBMA 1XK4A 3I5FB 3AAJA 2KFGA 5JJGA 1CNPA 1KFXL 2BBMA 1WRLA 2JWWA 3CS1A 2D8NA 5CSJA 4OVNF 4WQ3A 4PE4A 1C7VA 5D69A 1UHNA 1F4OA 3TDIA 1MXEA 1K90D 2JTTA 2NLNA 3SG2A 1SYMA 5AFPA 2M3WA 2BECA 4MSPA 4U8DA 3CGAA 1R6PA 2L0PA 1VRKA 5CSIA 1G8IA 3BOWB 3IF7A 2G9BA 1BJFA 1DF0A 1RROA 2NCOA 1QIWA 1QASA 2SCPA 5HLOA 1NX1A 1UURA 4A4CA 1PSRA 3FS7A 2JOJA 3PALA 4PE0A 2L98A 2BCAA 2B1UA 2FCDA 1XFWO 4PHKA 1TCOB 1YX8A 3BUOB 3DVMA 4DCKA 1EG4A 1OOJA 1QX5B 4MBEA 1J1EA 4PE7A 4M2PA 1BG1A 1KK7Y 1N2DA 1QATA 3AKAA 1FF1A 4DIRA 2EC6C 2LMUA 1QIVA 1GJYA 4L9MA 4NDCA 1X02A 3SIBA 1CDPA 2CCMA 3PFVA 1PALA 1SL7A 4ORCB 4R1EA 1WLZA 3FWBA 1CFPA 5HYDA 1DJYA 1S5GY 1DTLA 3K21A 5I2QA 1B1GA 1QLSA 1JUOA 3ZWHA 1UP5A 4MRXA 3JVTC 2LVJA 3SIAA 2KDHA 1B8LA 1SR6C 2HETA 1K94A 1PSBA 3GOFA 3PN7B 5ER5A 3TUYC 1K95A 2M1KB 4C0KA 1AHRA 2LHIA 4FTGA 1N0YA 2JULA 4DS7A 1D1OA 1PULA 3KF9A 3SG5A 3O4YA 4WRIA 4GUKA 3EVRA 4QJ5B 2I2RE 1B47A 2LANA 2KSPA 4DUQA 2JNXA 2KHNA 1RK9A 1SL8A 2K7OA 2KAYA 4ORBB 4N5XA 1JF2A 1G33A 2WC8A 2JT0A 3DF0B 2LAPA 2KI6D 1AP4A 1QJTA 1KK7Z 2OS8B 3I5IC 3NXAA 1MHOA 2G2BA 4I5JA 3DVKA 4ZCVA 1DGUA 1C7WA 1TN4A 1F4QA 3EK4A 3I5GC 4HREE 2QPTA 1L7ZA 4BY5A 5I2OA 2I18A 1N65A 2R2IA 1S36A 1OZSA 4I5KA 2OTGC 3SG4A 2FCEA 1WLMA 4OKHA 1YVLA 4JQ0D 4JWQA 4UPGA 4YRUA 2ZN8A 4IL1A 2Y5IA 4YGBB 1CFFA 1MWNA 2LLUA 1SCMC 1TNXA 1BT6A 2JC2A 2LCPA 3FWCA 1RTP1 1H8BA 3TS5C 1J1DA 4M2OA 2SASA 1FBVA 4CIDA 3BQ3A 1CKKA 1K9PA 1KK8B 1OSAA 2MHHA 4OCIA 1IGVA 1MUXA 1ZOTB 4NDBA 2HF5A 5HKWA 2K7DA 1QX2A 5HLVA 4QJ4B 1YUSA 3DD4A 1AJ4A 5FYXA 3MSEB 3VRRA 1L2OC 2F2OA 1DJIA 1SNLA 4TNCA 2BL0C 1S1EA 3NSIA 5AANA 5CSFA 2RGIA 4XJKA 1NP8A 2K8MB 2KI4C 1J7OA 1F55A 1JWDA 3OHMB 3WHUB 1F71A 2ZNDA 5HKYA 4BY4A 4GGNA 2LLTA 2JU0A 1DJZA 1HT9A 1OQPA 2LMTA 4MRYA 2I94A 3FIAA 5KSZA 1CLMA 1JBAA 2ISDA 1XVJA 4ZCUA 1K8UA 1OMVA 2HPSA 2I7AA 3OP0A 5HKZA 4CPVA 5DKQA 4PDZA 2KBIA 4MZJA 2MLFC 3OX6A 4MZKA 1F8HA 3NSKA 1WDCC 2H2KA 3CR5X 2JT8A 1OZOA 2WNDA 4ICBA 1A75B 1S6JA 5CPVA 2EC6B 1UHHA 3OB1B 1DMOA 1C07A 1B9AA 1MXLC 2JT3A 3GK1A 2KYFA 2Q91A 1BOCA 4N1FA 1R2UA 3D0YB 2PRUA 2BCXA 1QXPA 4AQJA 1JFKA 1LA0A 3CR2A 4E68A 3EKJA 1XFYO 1J7QA 1ALVA 3O78A 1SR6B 4XYNA 4HRHA 1SL9A 1A03A 1CTRA 1KCYA 1U5IB 1BR1B 1SBJA 1A29A 1DT7B 3VRPA 4CFQA 2CXJA 1CLLA 2WCEA 4MEWA 1PK0D 3TDZA 2GGZA 2CNPA 2PMYA 4CLNA 1AK8A 5F6TA 1J55A 2L51A 3LL8B 2M8UA 3DVJA 1PVAA 4YGEB 1S3PA
chains in the Genus database with same CATH superfamily
2F8PA 1EL4A 1UHIA 2F2PA 1OOGA 3CR4X 4I5LB 1IRJA 1YVHA 4INXA 1IJ6A 5PALA 1J7RA 1DEKA 5ER4X 1IKUA 5D7FA 3I5IB 2LP2A 3BOWA 2AUCA 2H61C 3PLFB 1JC2A 1EH2A 1E8AA 1Y6WA 1XFVO 3TDUA 1AUIB 1ZUZA 3I5GB 2HQWA 1KWOC 1H4BA 3NHIA 2K60A 3ICBA 3O6BA 1NPQA 2ZFDA 5KTYA 4GNKB 1WRZA 2K0JA 1NX3A 5J3XA 1PVBA 1CDMA 3JTDC 1KFXS 1HQVA 1YX7A 4FQOA 4GPLB 4JPZB 1T14A 1CDNA 1B7TY 3EK8A 5I8NA 1QVIZ 4YI8A 1C3ZA 1RWYA 1XFUO 3I5HB 1TOPA 2CT9A 1U5IA 2KFFA 4C0JA 4D1EA 3PATA 5KU1A 1SK6D 1DJHA 2F33A 3KHEA 3SG7A 3TS5B 3D75A 1S26D 3VRQA 4Q04A 1CFCA 2KQYA 1XFZO 3L4LA 3SJSA 1Y1UA 3A4UB 2LHLA 2OPOA 1RFJA 2P70A 1LINA 1OE9B 3B88A 3OB2B 2LVVA 1B4CA 2K2FA 1CMGA 1MQ1A 3FE6A 1L2OB 2M7LA 2FOTA 4GGFA 5B8IB 2PASA 3Q8IA 4C0LA 1FW4A 3SS4A 3O4XA 2O60A 2QDIA 2KI4B 2K2AA 2V53A 3BFBA 2BE6A 2PQLA 2M0RA 2LUCA 1B8RA 4YGCB 1V1GA 3PN7C 1Z4HA 3IQQA 2M9GA 1NSHA 2F3ZA 1IH0A 2M7NA 1S6IA 3VGOA 1GQMA 3BUXB 3TZ1A 1CFDA 2FJUB 2MJWB 1LA3A 1GGWA 1XFXO 3CABA 1QLKA 3QRXA 3KPXA 1Y0VH 3EKHA 3VRNA 3AKBA 2A4JA 2KGRA 1B7TZ 4YGAA 1RECA 4USLA 1BLQA 2E30A 3L4AA 3DF0A 3S0BA 4YGDB 3WHTB 2LE9B 1RJVA 1QS7A 1C3YA 2PSRA 3SS3A 2K61A 2KOTA 5IBWA 3AAKA 2OS8C 1WDCB 2WORA 2ZNEA 1TCFA 1MR8A 3HX4A 3NSOA 4AOMA 3ZNIA 4ORAB 2F3YA 3CZ0A 2KPHA 1DJXA 1NYAA 4PALA 3PSRA 3L47A 4OR9B 2M29A 3WXAA 1NX2A 1XK4C 2M49B 2JTZA 1J7PA 1TNPA 2TN4A 2ZKMX 2MLEC 2O5GA 2AAOA 1QTXA 1SKTA 2JZIA 1DJGA 3LLEA 1M63B 2JRFA 3RM1A 3S0GA 1V1FA 2NZ0A 4OZDA 1IQ3A 1KQMC 1XO5A 1UHKA 3CWGA 3B7AA 3O2PA 1CB1A 4KYNA 5BPJA 3VROA 2L4IA 2ZRSA 5AEQA 5G08A 1AJ5A 1YRUB 1M31A 2H8VA 2LUXA 3D73A 1FPWA 4N1GA 1AVSA 1B8CA 3A8RA 4QJ3B 1MF8B 3N7HA 4M2QA 1SW8A 1LVCD 4WQ2A 1YURA 3JVTB 1QV1A 1QVIY 2M1UA 2KFHA 2JQ6A 4MLWA 1M39A 2QEHA 1M46A 4AQIA 2YGUA 2CTNA 3TUYB 2PVBA 3HCMA 2L2CA 3FE9A 4IJ7A 1CM4A 1TUZA 1YRTB 5I2LA 2L50A 1XYDA 1KWOB 2L5XB 4GAOA 3VB1A 2Q4UA 1BF5A 1P28A 5JOLA 2VRGA 3F45A 3I5FC 5AERA 1M45A 1TIZA 5DKRA 1OMDA 3EVUA 4P2YB 3JTDB 1W7IB 3EK7A 2ZN9A 2CBLA 1Z2CB 5GQQC 3CTNA 5TNCA 2LNKA 4PHNA 3CZ1A 1XA5A 1EJ3A 4HRGA 3DXLA 5DICA 2KAXA 1A75A 1DVIA 1A4PA 2WOSA 1WRKA 2KYCA 3CLNA 1UHJA 4ETOA 4MN0A 2LP3A 3H4SE 2BNXA 4NQGA 3D0YA 2MBXA 1K93D 1QX7A 1PRWA 1S6CA 2NXQA 1NX0A 1TTXA 3C1VA 2EHBA 1OMRA 2OTGB 2L5YA 3CZTX 3LK1A 3SG6A 1XFRA 1KFUL 3SG3A 2BAPA 3OX5A 1TNQA 2BE4A 3IQOA 2WCFA 2BCBA 2JPTA 4DRWA 1BR4B 1DGVA 2DOQA 2WCKA 2QACA 2P6BB 2QEBA 2H61A 4CFRA 1NCZA 1SCMB 3LK0A 5HL1A 2NCPA 1NCXA 1QWVA 1EG3A 3D10A 2MA2A 1WY9A 2BBNA 2KI6C 1LXFC 5DKNA 1IWQA 3BUWB 1K9KA 1KSMA 3BFAA 4GBAA 2BKIB 2K7BA 1UWOA 3M0WA 1BU3A 3BXKA 1SY9A 1ZACA 1SMGA 4MZLA 2KGBC 2E6WA 1NCYA 2BL0B 2JPOA 2KNEA 2Y4QA 2LVIA 3D77A 4MVFA 5K89A 2GGMA 5FI7A 2L2EA 4GGFC 4PHJA 1OOHA 1CDLA 1K9UA 1KSOA 3BUMB 4XJKB 4F0ZB 5CSNA 1CLBA 1EXRA 2HQ8A 1TRFA 4I5NB 1IG5A 3GK4X 2KAVA 3NSLA 4GFTA 1LKJA 1GM0A 3BUNB 1GGZA 2MAZA 1JF0A 1NIWA 1QV0A 2Y1NA 1F54A 1S5GZ 3RLZA 1G4YR 2LMVA 2BKHB 2IS9A 1ZFSA 3BYAA 2LV7A 2JXLA 1A2XA 2MRDA 3EVVA 4NDDA 4YI9A 2L4HA 1YUTA 3I5HC 1ZMZA 2COLB 3NHTA 1CMFA 2Y1MA 4A4BA 1Y1AA 4JD9A 1K2HA 2WCBA 1BODA 5AXIA 4YBHB 3DZTA 1KQMB 4PHMA 2LC5A 2LVKA 1F70A 2LLSA 1DQEA 1UUSA 2P71A 4PCWA 3UNWA 2JNFA 1YTZC 3DVEA 2PALA 1BMOA 1ALWA 2M97A 2WC5A 1SRAA 3S0EA 1DJWA 1ODBA 1K96A 3GK2A 3PM8A 1DF0B 2AMIA 1KFUS 1KQVA 1W9ZA 1YUUA 1FI6A 1W7JB 1YR5A 1CM1A 2KQ6A 1Y1XA 2WCLA 3IVTA 3LCPC 4OV2A 4JKTA 3KEVA 2K7CA 1JSAA 1SCVA 1NUBA 4P5OE 1JFJA 2ZRTA 3WNXB 3E3RA 1KK8C 2JXCA 4HSZA 1NWDA 1IJ5A 1Q80A 4FQTA 2EGDA 2WCJA 1SPYA 3KO0A 2LM5A 1IQ5A 2GV5A 4PE1A 1TNWA 2KBMA 1XK4A 3I5FB 3AAJA 2KFGA 2QEOA 3CYZA 5JJGA 1KFXL 2BBMA 3B86A 1CNPA 1WRLA 2JWWA 3UO9A 3CS1A 2D8NA 5CSJA 1OOFA 1IIOA 4OVNF 4WQ3A 4PE4A 1C7VA 5D69A 1UHNA 1F4OA 3TDIA 1MXEA 1K90D 2JTTA 2NLNA 3SG2A 1SYMA 5AFPA 2M3WA 2BECA 4MSPA 4U8DA 3CGAA 1R6PA 2L0PA 1VRKA 3B6XA 4PT1A 5CSIA 1G8IA 3BOWB 3IF7A 2G9BA 1BJFA 1DF0A 1RROA 2NCOA 1QIWA 1QASA 2SCPA 5HLOA 3OBVA 1NX1A 1UURA 4A4CA 1PSRA 3FS7A 3S0AA 2JOJA 3RZSA 3PALA 4PE0A 2L98A 2BCAA 2B1UA 2FCDA 1XFWO 4PHKA 1TCOB 1YX8A 3BUOB 3DVMA 4DCKA 1EG4A 1OOJA 1QX5B 4MBEA 1J1EA 4PE7A 4M2PA 1BG1A 1KK7Y 1N2DA 1QATA 3S0FA 3AKAA 1FF1A 4DIRA 2EC6C 2LMUA 1QIVA 3V2LA 1GJYA 5FI2A 4L9MA 3SS5A 3FE8A 4NDCA 1X02A 1TUJA 3DYEA 3SIBA 1CDPA 2CCMA 3PFVA 1PALA 1SL7A 4ORCB 4R1EA 1WLZA 5FI6A 3FWBA 1CFPA 5HYDA 1DJYA 1DELA 1DTLA 1S5GY 3K21A 4F7FA 5I2QA 1B1GA 1QLSA 1JUOA 3EG5B 1UP5A 3ZWHA 4MRXA 3JVTC 2LVJA 3SIAA 2KDHA 1B8LA 1SR6C 2HETA 1K94A 3D74A 1PSBA 3GOFA 3PN7B 5ER5A 3TUYC 1K95A 3D78A 2M1KB 4C0KA 1AHRA 1OOIX 2LHIA 4FTGA 1N0YA 2JULA 4DS7A 1D1OA 1PULA 3KF9A 3SG5A 3O4YA 4WRIA 4GUKA 3EVRA 4QJ5B 1TWOA 2I2RE 1B47A 2LANA 2KSPA 4DUQA 2JNXA 2KHNA 1RK9A 1SL8A 2K7OA 2QEVA 3K1EA 2KAYA 4ORBB 4N5XA 1OW4A 1JF2A 1G33A 2WC8A 2JT0A 2GTEA 3DF0B 2LAPA 3CDNA 2KI6D 1AP4A 1QJTA 2WC6A 1KK7Z 2OS8B 3I5IC 3NXAA 1MHOA 2G2BA 4I5JA 3DVKA 4ZCVA 1DGUA 1C7WA 1TN4A 1F4QA 3EK4A 2KLDA 3I5GC 4HREE 2QPTA 1L7ZA 4BY5A 5I2OA 2I18A 1N65A 2R2IA 3QMEA 1S36A 1OZSA 4I5KA 2OTGC 3SG4A 2FCEA 1WLMA 4OKHA 1YVLA 4JQ0D 4JWQA 4UPGA 4YRUA 2ZN8A 3R72A 1SSEB 4IL1A 2Y5IA 4YGBB 1CFFA 1MWNA 2LLUA 1SCMC 1TNXA 1BT6A 2JC2A 2LCPA 3FWCA 1RTP1 1H8BA 3TS5C 1J1DA 4M2OA 2SASA 1FBVA 3CZ2A 4CIDA 3BQ3A 1CKKA 1K9PA 1KK8B 1OSAA 2MHHA 2ERBA 4OCIA 1IGVA 1MUXA 1ZOTB 3DY9A 4INWA 4NDBA 2HF5A 5HKWA 2K7DA 1QX2A 5HLVA 4QJ4B 1YUSA 2WCMA 3DD4A 1AJ4A 3BFHA 3MSEB 5FYXA 3VRRA 1L2OC 2F2OA 1DJIA 1SNLA 4TNCA 2BL0C 1S1EA 3NSIA 1DC1A 5AANA 5CSFA 2RGIA 4XJKA 1NP8A 2FJYA 2K8MB 2KI4C 1J7OA 1F55A 1JWDA 3OHMB 3WHUB 1F71A 2WCHA 2ZNDA 5HKYA 4BY4A 4GGNA 2LLTA 2JU0A 1DJZA 1HT9A 1LS8A 3R1OA 1OQPA 2LMTA 4MRYA 2I94A 3FIAA 5KSZA 3OGNA 1CLMA 3D76A 1JBAA 2ISDA 1XVJA 4ZCUA 1K8UA 1OMVA 2HPSA 2I7AA 3OP0A 5EL2A 5HKZA 4CPVA 5DKQA 4PDZA 2KBIA 4MZJA 2MLFC 3BJHA 3OX6A 4MZKA 1F8HA 3NSKA 1WDCC 2H2KA 3CR5X 2JT8A 1OZOA 2WNDA 4ICBA 1A75B 2KLEA 1S6JA 5CPVA 2EC6B 1UHHA 3OB1B 1DMOA 1C07A 1B9AA 1MXLC 2JT3A 3GK1A 2KYFA 2Q91A 1BOCA 4N1FA 1R2UA 3PJIA 3S0DA 3R1VA 3D0YB 2PRUA 2BCXA 1QXPA 4AQJA 1JFKA 1ORGA 1LA0A 3CR2A 3NGVA 4E68A 3EKJA 1XFYO 1J7QA 1ALVA 3O78A 1SR6B 4XYNA 4HRHA 1FI5A 1SL9A 1A03A 1CTRA 1KCYA 1U5IB 1BR1B 1SBJA 1A29A 1DT7B 3VRPA 4CFQA 2CXJA 5D3OA 1CLLA 2WCEA 4MEWA 1PK0D 3TDZA 2GGZA 3R1PA 3B87A 2CNPA 2PMYA 3PM2A 4CLNA 1AK8A 5F6TA 1J55A 2L51A 3LL8B 5I94A 2M8UA 2PYQA 3DVJA 1PVAA 4YGEB 1S3PA
chains in the Genus database with same CATH topology
2F8PA 1EL4A 1UHIA 2F2PA 3CR4X 4I5LB 1IRJA 1YVHA 1IJ6A 5PALA 1J7RA 5ER4X 1IKUA 5D7FA 3I5IB 2LP2A 3BOWA 2AUCA 2H61C 3PLFB 1JC2A 1EH2A 1E8AA 1Y6WA 1XFVO 3TDUA 1AUIB 1ZUZA 3I5GB 2HQWA 1KWOC 1H4BA 3ICBA 3O6BA 5KTYA 1NPQA 2ZFDA 4GNKB 1WRZA 2K0JA 1NX3A 5J3XA 1PVBA 1CDMA 3JTDC 1KFXS 1HQVA 1YX7A 4FQOA 4GPLB 4JPZB 1CDNA 1FI5A 1B7TY 3EK8A 5I8NA 1QVIZ 4YI8A 1RWYA 1XFUO 3I5HB 1TOPA 2CT9A 1U5IA 2KFFA 4C0JA 4D1EA 3PATA 5KU1A 1SK6D 1DJHA 2F33A 3KHEA 3SG7A 3TS5B 1S26D 3VRQA 4Q04A 1CFCA 2KQYA 1XFZO 3SJSA 1Y1UA 3A4UB 2LHLA 2OPOA 1RFJA 1LINA 1OE9B 3OB2B 2LVVA 1B4CA 2K2FA 1CMGA 1MQ1A 2M7LA 1L2OB 5B8IB 2FOTA 4GGFA 2PASA 4C0LA 1FW4A 2O60A 2KI4B 2K2AA 2V53A 2BE6A 2M0RA 2LUCA 1B8RA 4YGCB 1V1GA 3PN7C 1IH0A 3IQQA 2M9GA 1NSHA 2F3ZA 2M7NA 1S6IA 3VGOA 1GQMA 3BUXB 3TZ1A 1CFDA 2FJUB 2MJWB 1LA3A 1GGWA 1XFXO 1QLKA 3QRXA 3KPXA 1Y0VH 3EKHA 3VRNA 3AKBA 2A4JA 2KGRA 1B7TZ 4YGAA 1RECA 4USLA 1BLQA 2E30A 3DF0A 3WHTB 4YGDB 2LE9B 1RJVA 1QS7A 2PSRA 2K61A 2KOTA 5IBWA 3AAKA 2OS8C 1WDCB 2WORA 2ZNEA 1TCFA 1MR8A 3HX4A 3NSOA 4AOMA 3ZNIA 4ORAB 2F3YA 1DJXA 1NYAA 4PALA 3PSRA 4OR9B 2M29A 3WXAA 1NX2A 1XK4C 2M49B 2JTZA 1J7PA 1TNPA 2TN4A 2ZKMX 2MLEC 2O5GA 2AAOA 1QTXA 1SKTA 2JZIA 1DJGA 3LLEA 1M63B 2JRFA 3RM1A 1V1FA 2NZ0A 1IQ3A 1KQMC 1XO5A 1UHKA 3CWGA 3O2PA 1CB1A 5BPJA 3VROA 2L4IA 2ZRSA 5AEQA 5G08A 1AJ5A 1YRUB 1M31A 2LUXA 1FPWA 4N1GA 1AVSA 1B8CA 3A8RA 4QJ3B 1MF8B 4M2QA 1SW8A 1LVCD 4WQ2A 1YURA 3JVTB 1QV1A 1QVIY 2M1UA 2KFHA 2JQ6A 4MLWA 1M39A 1M46A 4AQIA 2CTNA 3TUYB 2PVBA 3HCMA 1CM4A 1YRTB 5I2LA 2L50A 1XYDA 1KWOB 2L5XB 4GAOA 2Q4UA 1BF5A 5JOLA 2VRGA 3F45A 3I5FC 5AERA 1M45A 1TIZA 5DKRA 1OMDA 3EVUA 4P2YB 3JTDB 1W7IB 3EK7A 2ZN9A 2CBLA 5GQQC 3CTNA 5TNCA 2LNKA 4PHNA 1XA5A 1EJ3A 4HRGA 2KAXA 1A75A 1DVIA 1A4PA 2WOSA 1WRKA 2KYCA 3CLNA 1UHJA 4ETOA 4MN0A 2LP3A 3H4SE 4NQGA 3D0YA 2MBXA 1K93D 1QX7A 1PRWA 1S6CA 2NXQA 1NX0A 1TTXA 3C1VA 2EHBA 1OMRA 2OTGB 3CZTX 3LK1A 3SG6A 1KFUL 3SG3A 3OX5A 1TNQA 2BE4A 3IQOA 2WCFA 2BCBA 2JPTA 4DRWA 1BR4B 1DGVA 2DOQA 2QACA 2P6BB 2H61A 4CFRA 1NCZA 1SCMB 3LK0A 2NCPA 1NCXA 1EG3A 3D10A 2MA2A 1WY9A 2BBNA 2KI6C 1LXFC 5DKNA 1IWQA 3BUWB 1K9KA 1KSMA 4GBAA 2BKIB 2K7BA 1UWOA 3M0WA 1BU3A 3BXKA 1SY9A 1ZACA 1SMGA 4MZLA 2KGBC 2E6WA 1NCYA 2BL0B 2KNEA 2Y4QA 2LVIA 4MVFA 5K89A 2GGMA 2L2EA 4GGFC 4PHJA 1CDLA 1K9UA 1KSOA 3BUMB 4XJKB 4F0ZB 5CSNA 1CLBA 1EXRA 2HQ8A 1TRFA 4I5NB 1IG5A 3GK4X 2KAVA 3NSLA 4GFTA 1LKJA 3BUNB 1GGZA 2MAZA 1JF0A 1NIWA 1QV0A 2Y1NA 1F54A 1S5GZ 3RLZA 1G4YR 2LMVA 2BKHB 2IS9A 1ZFSA 3BYAA 2LV7A 2JXLA 1A2XA 2MRDA 3EVVA 4NDDA 4YI9A 2L4HA 1YUTA 3I5HC 1ZMZA 2COLB 1CMFA 2Y1MA 4A4BA 1Y1AA 1K2HA 2WCBA 1BODA 5AXIA 4YBHB 4PHMA 1KQMB 2LC5A 2LVKA 1F70A 2LLSA 1UUSA 4PCWA 2JNFA 1YTZC 3DVEA 2PALA 1BMOA 1ALWA 2M97A 1SRAA 1DJWA 1ODBA 1K96A 3GK2A 3PM8A 1DF0B 2AMIA 1KFUS 1KQVA 1YUUA 1FI6A 1W7JB 1YR5A 1CM1A 2KQ6A 1Y1XA 4OV2A 3LCPC 3KEVA 2K7CA 1JSAA 1SCVA 1NUBA 4P5OE 1JFJA 2ZRTA 3WNXB 3E3RA 1KK8C 2JXCA 4HSZA 1NWDA 1IJ5A 1Q80A 2EGDA 1SPYA 3KO0A 2LM5A 1IQ5A 2GV5A 4PE1A 1TNWA 2KBMA 1XK4A 3I5FB 3AAJA 2KFGA 5JJGA 1CNPA 1KFXL 2BBMA 1WRLA 2JWWA 3CS1A 2D8NA 5CSJA 4OVNF 4WQ3A 4PE4A 1C7VA 5D69A 1UHNA 1F4OA 3TDIA 1MXEA 1K90D 2JTTA 2NLNA 3SG2A 1SYMA 5AFPA 2M3WA 2BECA 4MSPA 4U8DA 3CGAA 1R6PA 2L0PA 1VRKA 5CSIA 1G8IA 3BOWB 3IF7A 2G9BA 1BJFA 1DF0A 1RROA 2NCOA 1QIWA 1QASA 2SCPA 5HLOA 1NX1A 1UURA 4A4CA 1PSRA 3FS7A 2JOJA 3PALA 4PE0A 2L98A 2BCAA 2B1UA 2FCDA 1XFWO 4PHKA 1TCOB 1YX8A 3BUOB 3DVMA 4DCKA 1EG4A 1OOJA 1QX5B 4MBEA 1J1EA 4PE7A 4M2PA 1BG1A 1KK7Y 1N2DA 1QATA 3AKAA 1FF1A 4DIRA 2EC6C 2LMUA 1QIVA 1GJYA 4L9MA 4NDCA 1X02A 3SIBA 1CDPA 2CCMA 3PFVA 1PALA 1SL7A 4ORCB 4R1EA 1WLZA 3FWBA 1CFPA 5HYDA 1DJYA 1S5GY 1DTLA 3K21A 5I2QA 1B1GA 1QLSA 1JUOA 3ZWHA 1UP5A 4MRXA 3JVTC 2LVJA 3SIAA 2KDHA 1B8LA 1SR6C 2HETA 1K94A 1PSBA 3GOFA 3PN7B 5ER5A 3TUYC 1K95A 2M1KB 4C0KA 1AHRA 2LHIA 4FTGA 1N0YA 2JULA 4DS7A 1D1OA 1PULA 3KF9A 3SG5A 3O4YA 4WRIA 4GUKA 3EVRA 4QJ5B 2I2RE 1B47A 2LANA 2KSPA 4DUQA 2JNXA 2KHNA 1RK9A 1SL8A 2K7OA 2KAYA 4ORBB 4N5XA 1JF2A 1G33A 2WC8A 2JT0A 3DF0B 2LAPA 2KI6D 1AP4A 1QJTA 1KK7Z 2OS8B 3I5IC 3NXAA 1MHOA 2G2BA 4I5JA 3DVKA 4ZCVA 1DGUA 1C7WA 1TN4A 1F4QA 3EK4A 3I5GC 4HREE 2QPTA 1L7ZA 4BY5A 5I2OA 2I18A 1N65A 2R2IA 1S36A 1OZSA 4I5KA 2OTGC 3SG4A 2FCEA 1WLMA 4OKHA 1YVLA 4JQ0D 4JWQA 4UPGA 4YRUA 2ZN8A 4IL1A 2Y5IA 4YGBB 1CFFA 1MWNA 2LLUA 1SCMC 1TNXA 1BT6A 2JC2A 2LCPA 3FWCA 1RTP1 1H8BA 3TS5C 1J1DA 4M2OA 2SASA 1FBVA 4CIDA 3BQ3A 1CKKA 1K9PA 1KK8B 1OSAA 2MHHA 4OCIA 1IGVA 1MUXA 1ZOTB 4NDBA 2HF5A 5HKWA 2K7DA 1QX2A 5HLVA 4QJ4B 1YUSA 3DD4A 1AJ4A 5FYXA 3MSEB 3VRRA 1L2OC 2F2OA 1DJIA 1SNLA 4TNCA 2BL0C 1S1EA 3NSIA 5AANA 5CSFA 2RGIA 4XJKA 1NP8A 2K8MB 2KI4C 1J7OA 1F55A 1JWDA 3OHMB 3WHUB 1F71A 2ZNDA 5HKYA 4BY4A 4GGNA 2LLTA 2JU0A 1DJZA 1HT9A 1OQPA 2LMTA 4MRYA 2I94A 3FIAA 5KSZA 1CLMA 1JBAA 2ISDA 1XVJA 4ZCUA 1K8UA 1OMVA 2HPSA 2I7AA 3OP0A 5HKZA 4CPVA 5DKQA 4PDZA 2KBIA 4MZJA 2MLFC 3OX6A 4MZKA 1F8HA 3NSKA 1WDCC 2H2KA 3CR5X 2JT8A 1OZOA 2WNDA 4ICBA 1A75B 1S6JA 5CPVA 2EC6B 1UHHA 3OB1B 1DMOA 1C07A 1B9AA 1MXLC 2JT3A 3GK1A 2KYFA 2Q91A 1BOCA 4N1FA 1R2UA 3D0YB 2PRUA 2BCXA 1QXPA 4AQJA 1JFKA 1LA0A 3CR2A 4E68A 3EKJA 1XFYO 1J7QA 1ALVA 3O78A 1SR6B 4XYNA 4HRHA 1SL9A 1A03A 1CTRA 1KCYA 1U5IB 1BR1B 1SBJA 1A29A 1DT7B 3VRPA 4CFQA 2CXJA 1CLLA 2WCEA 4MEWA 1PK0D 3TDZA 2GGZA 2CNPA 2PMYA 4CLNA 1AK8A 5F6TA 1J55A 2L51A 3LL8B 2M8UA 3DVJA 1PVAA 4YGEB 1S3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8P A;  1EL4 A;  1UHI A;  2F2P A;  3CR4 X;  4I5L B;  1IRJ A;  1YVH A;  1IJ6 A;  5PAL A;  1J7R A;  5ER4 X;  1IKU A;  5D7F A;  3I5I B;  2LP2 A;  3BOW A;  2AUC A;  2H61 C;  3PLF B;  1JC2 A;  1EH2 A;  1E8A A;  1Y6W A;  1XFV O;  3TDU A;  1AUI B;  1ZUZ A;  3I5G B;  2HQW A;  1KWO C;  1H4B A;  3ICB A;  3O6B A;  5KTY A;  1NPQ A;  2ZFD A;  4GNK B;  1WRZ A;  2K0J A;  1NX3 A;  5J3X A;  1PVB A;  1CDM A;  3JTD C;  1KFX S;  1HQV A;  1YX7 A;  4FQO A;  4GPL B;  4JPZ B;  1CDN A;  1FI5 A;  1B7T Y;  3EK8 A;  5I8N A;  1QVI Z;  4YI8 A;  1RWY A;  1XFU O;  3I5H B;  1TOP A;  2CT9 A;  1U5I A;  2KFF A;  4C0J A;  4D1E A;  3PAT A;  5KU1 A;  1SK6 D;  1DJH A;  2F33 A;  3KHE A;  3SG7 A;  3TS5 B;  1S26 D;  3VRQ A;  4Q04 A;  1CFC A;  2KQY A;  1XFZ O;  3SJS A;  1Y1U A;  3A4U B;  2LHL A;  2OPO A;  1RFJ A;  1LIN A;  1OE9 B;  3OB2 B;  2LVV A;  1B4C A;  2K2F A;  1CMG A;  1MQ1 A;  2M7L A;  1L2O B;  5B8I B;  2FOT A;  4GGF A;  2PAS A;  4C0L A;  1FW4 A;  2O60 A;  2KI4 B;  2K2A A;  2V53 A;  2BE6 A;  2M0R A;  2LUC A;  1B8R A;  4YGC B;  1V1G A;  3PN7 C;  1IH0 A;  3IQQ A;  2M9G A;  1NSH A;  2F3Z A;  2M7N A;  1S6I A;  3VGO A;  1GQM A;  3BUX B;  3TZ1 A;  1CFD A;  2FJU B;  2MJW B;  1LA3 A;  1GGW A;  1XFX O;  1QLK A;  3QRX A;  3KPX A;  1Y0V H;  3EKH A;  3VRN A;  3AKB A;  2A4J A;  2KGR A;  1B7T Z;  4YGA A;  1REC A;  4USL A;  1BLQ A;  2E30 A;  3DF0 A;  3WHT B;  4YGD B;  2LE9 B;  1RJV A;  1QS7 A;  2PSR A;  2K61 A;  2KOT A;  5IBW A;  3AAK A;  2OS8 C;  1WDC B;  2WOR A;  2ZNE A;  1TCF A;  1MR8 A;  3HX4 A;  3NSO A;  4AOM A;  3ZNI A;  4ORA B;  2F3Y A;  1DJX A;  1NYA A;  4PAL A;  3PSR A;  4OR9 B;  2M29 A;  3WXA A;  1NX2 A;  1XK4 C;  2M49 B;  2JTZ A;  1J7P A;  1TNP A;  2TN4 A;  2ZKM X;  2MLE C;  2O5G A;  2AAO A;  1QTX A;  1SKT A;  2JZI A;  1DJG A;  3LLE A;  1M63 B;  2JRF A;  3RM1 A;  1V1F A;  2NZ0 A;  1IQ3 A;  1KQM C;  1XO5 A;  1UHK A;  3CWG A;  3O2P A;  1CB1 A;  5BPJ A;  3VRO A;  2L4I A;  2ZRS A;  5AEQ A;  5G08 A;  1AJ5 A;  1YRU B;  1M31 A;  2LUX A;  1FPW A;  4N1G A;  1AVS A;  1B8C A;  3A8R A;  4QJ3 B;  1MF8 B;  4M2Q A;  1SW8 A;  1LVC D;  4WQ2 A;  1YUR A;  3JVT B;  1QV1 A;  1QVI Y;  2M1U A;  2KFH A;  2JQ6 A;  4MLW A;  1M39 A;  1M46 A;  4AQI A;  2CTN A;  3TUY B;  2PVB A;  3HCM A;  1CM4 A;  1YRT B;  5I2L A;  2L50 A;  1XYD A;  1KWO B;  2L5X B;  4GAO A;  2Q4U A;  1BF5 A;  5JOL A;  2VRG A;  3F45 A;  3I5F C;  5AER A;  1M45 A;  1TIZ A;  5DKR A;  1OMD A;  3EVU A;  4P2Y B;  3JTD B;  1W7I B;  3EK7 A;  2ZN9 A;  2CBL A;  5GQQ C;  3CTN A;  5TNC A;  2LNK A;  4PHN A;  1XA5 A;  1EJ3 A;  4HRG A;  2KAX A;  1A75 A;  1DVI A;  1A4P A;  2WOS A;  1WRK A;  2KYC A;  3CLN A;  1UHJ A;  4ETO A;  4MN0 A;  2LP3 A;  3H4S E;  4NQG A;  3D0Y A;  2MBX A;  1K93 D;  1QX7 A;  1PRW A;  1S6C A;  2NXQ A;  1NX0 A;  1TTX A;  3C1V A;  2EHB A;  1OMR A;  2OTG B;  3CZT X;  3LK1 A;  3SG6 A;  1KFU L;  3SG3 A;  3OX5 A;  1TNQ A;  2BE4 A;  3IQO A;  2WCF A;  2BCB A;  2JPT A;  4DRW A;  1BR4 B;  1DGV A;  2DOQ A;  2QAC A;  2P6B B;  2H61 A;  4CFR A;  1NCZ A;  1SCM B;  3LK0 A;  2NCP A;  1NCX A;  1EG3 A;  3D10 A;  2MA2 A;  1WY9 A;  2BBN A;  2KI6 C;  1LXF C;  5DKN A;  1IWQ A;  3BUW B;  1K9K A;  1KSM A;  4GBA A;  2BKI B;  2K7B A;  1UWO A;  3M0W A;  1BU3 A;  3BXK A;  1SY9 A;  1ZAC A;  1SMG A;  4MZL A;  2KGB C;  2E6W A;  1NCY A;  2BL0 B;  2KNE A;  2Y4Q A;  2LVI A;  4MVF A;  5K89 A;  2GGM A;  2L2E A;  4GGF C;  4PHJ A;  1CDL A;  1K9U A;  1KSO A;  3BUM B;  4XJK B;  4F0Z B;  5CSN A;  1CLB A;  1EXR A;  2HQ8 A;  1TRF A;  4I5N B;  1IG5 A;  3GK4 X;  2KAV A;  3NSL A;  4GFT A;  1LKJ A;  3BUN B;  1GGZ A;  2MAZ A;  1JF0 A;  1NIW A;  1QV0 A;  2Y1N A;  1F54 A;  1S5G Z;  3RLZ A;  1G4Y R;  2LMV A;  2BKH B;  2IS9 A;  1ZFS A;  3BYA A;  2LV7 A;  2JXL A;  1A2X A;  2MRD A;  3EVV A;  4NDD A;  4YI9 A;  2L4H A;  1YUT A;  3I5H C;  1ZMZ A;  2COL B;  1CMF A;  2Y1M A;  4A4B A;  1Y1A A;  1K2H A;  2WCB A;  1BOD A;  5AXI A;  4YBH B;  4PHM A;  1KQM B;  2LC5 A;  2LVK A;  1F70 A;  2LLS A;  1UUS A;  4PCW A;  2JNF A;  1YTZ C;  3DVE A;  2PAL A;  1BMO A;  1ALW A;  2M97 A;  1SRA A;  1DJW A;  1ODB A;  1K96 A;  3GK2 A;  3PM8 A;  1DF0 B;  2AMI A;  1KFU S;  1KQV A;  1YUU A;  1FI6 A;  1W7J B;  1YR5 A;  1CM1 A;  2KQ6 A;  1Y1X A;  4OV2 A;  3LCP C;  3KEV A;  2K7C A;  1JSA A;  1SCV A;  1NUB A;  4P5O E;  1JFJ A;  2ZRT A;  3WNX B;  3E3R A;  1KK8 C;  2JXC A;  4HSZ A;  1NWD A;  1IJ5 A;  1Q80 A;  2EGD A;  1SPY A;  3KO0 A;  2LM5 A;  1IQ5 A;  2GV5 A;  4PE1 A;  1TNW A;  2KBM A;  1XK4 A;  3I5F B;  3AAJ A;  2KFG A;  5JJG A;  1CNP A;  1KFX L;  2BBM A;  1WRL A;  2JWW A;  3CS1 A;  2D8N A;  5CSJ A;  4OVN F;  4WQ3 A;  4PE4 A;  1C7V A;  5D69 A;  1UHN A;  1F4O A;  3TDI A;  1MXE A;  1K90 D;  2JTT A;  2NLN A;  3SG2 A;  1SYM A;  5AFP A;  2M3W A;  2BEC A;  4MSP A;  4U8D A;  3CGA A;  1R6P A;  2L0P A;  1VRK A;  5CSI A;  1G8I A;  3BOW B;  3IF7 A;  2G9B A;  1BJF A;  1DF0 A;  1RRO A;  2NCO A;  1QIW A;  1QAS A;  2SCP A;  5HLO A;  1NX1 A;  1UUR A;  4A4C A;  1PSR A;  3FS7 A;  2JOJ A;  3PAL A;  4PE0 A;  2L98 A;  2BCA A;  2B1U A;  2FCD A;  1XFW O;  4PHK A;  1TCO B;  1YX8 A;  3BUO B;  3DVM A;  4DCK A;  1EG4 A;  1OOJ A;  1QX5 B;  4MBE A;  1J1E A;  4PE7 A;  4M2P A;  1BG1 A;  1KK7 Y;  1N2D A;  1QAT A;  3AKA A;  1FF1 A;  4DIR A;  2EC6 C;  2LMU A;  1QIV A;  1GJY A;  4L9M A;  4NDC A;  1X02 A;  3SIB A;  1CDP A;  2CCM A;  3PFV A;  1PAL A;  1SL7 A;  4ORC B;  4R1E A;  1WLZ A;  3FWB A;  1CFP A;  5HYD A;  1DJY A;  1S5G Y;  1DTL A;  3K21 A;  5I2Q A;  1B1G A;  1QLS A;  1JUO A;  3ZWH A;  1UP5 A;  4MRX A;  3JVT C;  2LVJ A;  3SIA A;  2KDH A;  1B8L A;  1SR6 C;  2HET A;  1K94 A;  1PSB A;  3GOF A;  3PN7 B;  5ER5 A;  3TUY C;  1K95 A;  2M1K B;  4C0K A;  1AHR A;  2LHI A;  4FTG A;  1N0Y A;  2JUL A;  4DS7 A;  1D1O A;  1PUL A;  3KF9 A;  3SG5 A;  3O4Y A;  4WRI A;  4GUK A;  3EVR A;  4QJ5 B;  2I2R E;  1B47 A;  2LAN A;  2KSP A;  4DUQ A;  2JNX A;  2KHN A;  1RK9 A;  1SL8 A;  2K7O A;  2KAY A;  4ORB B;  4N5X A;  1JF2 A;  1G33 A;  2WC8 A;  2JT0 A;  3DF0 B;  2LAP A;  2KI6 D;  1AP4 A;  1QJT A;  1KK7 Z;  2OS8 B;  3I5I C;  3NXA A;  1MHO A;  2G2B A;  4I5J A;  3DVK A;  4ZCV A;  1DGU A;  1C7W A;  1TN4 A;  1F4Q A;  3EK4 A;  3I5G C;  4HRE E;  2QPT A;  1L7Z A;  4BY5 A;  5I2O A;  2I18 A;  1N65 A;  2R2I A;  1S36 A;  1OZS A;  4I5K A;  2OTG C;  3SG4 A;  2FCE A;  1WLM A;  4OKH A;  1YVL A;  4JQ0 D;  4JWQ A;  4UPG A;  4YRU A;  2ZN8 A;  4IL1 A;  2Y5I A;  4YGB B;  1CFF A;  1MWN A;  2LLU A;  1SCM C;  1TNX A;  1BT6 A;  2JC2 A;  2LCP A;  3FWC A;  1RTP 1;  1H8B A;  3TS5 C;  1J1D A;  4M2O A;  2SAS A;  1FBV A;  4CID A;  3BQ3 A;  1CKK A;  1K9P A;  1KK8 B;  1OSA A;  2MHH A;  4OCI A;  1IGV A;  1MUX A;  1ZOT B;  4NDB A;  2HF5 A;  5HKW A;  2K7D A;  1QX2 A;  5HLV A;  4QJ4 B;  1YUS A;  3DD4 A;  1AJ4 A;  5FYX A;  3MSE B;  3VRR A;  1L2O C;  2F2O A;  1DJI A;  1SNL A;  4TNC A;  2BL0 C;  1S1E A;  3NSI A;  5AAN A;  5CSF A;  2RGI A;  4XJK A;  1NP8 A;  2K8M B;  2KI4 C;  1J7O A;  1F55 A;  1JWD A;  3OHM B;  3WHU B;  1F71 A;  2ZND A;  5HKY A;  4BY4 A;  4GGN A;  2LLT A;  2JU0 A;  1DJZ A;  1HT9 A;  1OQP A;  2LMT A;  4MRY A;  2I94 A;  3FIA A;  5KSZ A;  1CLM A;  1JBA A;  2ISD A;  1XVJ A;  4ZCU A;  1K8U A;  1OMV A;  2HPS A;  2I7A A;  3OP0 A;  5HKZ A;  4CPV A;  5DKQ A;  4PDZ A;  2KBI A;  4MZJ A;  2MLF C;  3OX6 A;  4MZK A;  1F8H A;  3NSK A;  1WDC C;  2H2K A;  3CR5 X;  2JT8 A;  1OZO A;  2WND A;  4ICB A;  1A75 B;  1S6J A;  5CPV A;  2EC6 B;  1UHH A;  3OB1 B;  1DMO A;  1C07 A;  1B9A A;  1MXL C;  2JT3 A;  3GK1 A;  2KYF A;  2Q91 A;  1BOC A;  4N1F A;  1R2U A;  3D0Y B;  2PRU A;  2BCX A;  1QXP A;  4AQJ A;  1JFK A;  1LA0 A;  3CR2 A;  4E68 A;  3EKJ A;  1XFY O;  1J7Q A;  1ALV A;  3O78 A;  1SR6 B;  4XYN A;  4HRH A;  1SL9 A;  1A03 A;  1CTR A;  1KCY A;  1U5I B;  1BR1 B;  1SBJ A;  1A29 A;  1DT7 B;  3VRP A;  4CFQ A;  2CXJ A;  1CLL A;  2WCE A;  4MEW A;  1PK0 D;  3TDZ A;  2GGZ A;  2CNP A;  2PMY A;  4CLN A;  1AK8 A;  5F6T A;  1J55 A;  2L51 A;  3LL8 B;  2M8U A;  3DVJ A;  1PVA A;  4YGE B;  1S3P A; 
#chains in the Genus database with same CATH topology
 2F8P A;  1EL4 A;  1UHI A;  2F2P A;  1OOG A;  3CR4 X;  4I5L B;  1IRJ A;  1YVH A;  4INX A;  1IJ6 A;  5PAL A;  1J7R A;  1DEK A;  5ER4 X;  1IKU A;  5D7F A;  3I5I B;  2LP2 A;  3BOW A;  2AUC A;  2H61 C;  3PLF B;  1JC2 A;  1EH2 A;  1E8A A;  1Y6W A;  1XFV O;  3TDU A;  1AUI B;  1ZUZ A;  3I5G B;  2HQW A;  1KWO C;  1H4B A;  3NHI A;  2K60 A;  3ICB A;  3O6B A;  1NPQ A;  2ZFD A;  5KTY A;  4GNK B;  1WRZ A;  2K0J A;  1NX3 A;  5J3X A;  1PVB A;  1CDM A;  3JTD C;  1KFX S;  1HQV A;  1YX7 A;  4FQO A;  4GPL B;  4JPZ B;  1T14 A;  1CDN A;  1B7T Y;  3EK8 A;  5I8N A;  1QVI Z;  4YI8 A;  1C3Z A;  1RWY A;  1XFU O;  3I5H B;  1TOP A;  2CT9 A;  1U5I A;  2KFF A;  4C0J A;  4D1E A;  3PAT A;  5KU1 A;  1SK6 D;  1DJH A;  2F33 A;  3KHE A;  3SG7 A;  3TS5 B;  3D75 A;  1S26 D;  3VRQ A;  4Q04 A;  1CFC A;  2KQY A;  1XFZ O;  3L4L A;  3SJS A;  1Y1U A;  3A4U B;  2LHL A;  2OPO A;  1RFJ A;  2P70 A;  1LIN A;  1OE9 B;  3B88 A;  3OB2 B;  2LVV A;  1B4C A;  2K2F A;  1CMG A;  1MQ1 A;  3FE6 A;  1L2O B;  2M7L A;  2FOT A;  4GGF A;  5B8I B;  2PAS A;  3Q8I A;  4C0L A;  1FW4 A;  3SS4 A;  3O4X A;  2O60 A;  2QDI A;  2KI4 B;  2K2A A;  2V53 A;  3BFB A;  2BE6 A;  2PQL A;  2M0R A;  2LUC A;  1B8R A;  4YGC B;  1V1G A;  3PN7 C;  1Z4H A;  3IQQ A;  2M9G A;  1NSH A;  2F3Z A;  1IH0 A;  2M7N A;  1S6I A;  3VGO A;  1GQM A;  3BUX B;  3TZ1 A;  1CFD A;  2FJU B;  2MJW B;  1LA3 A;  1GGW A;  1XFX O;  3CAB A;  1QLK A;  3QRX A;  3KPX A;  1Y0V H;  3EKH A;  3VRN A;  3AKB A;  2A4J A;  2KGR A;  1B7T Z;  4YGA A;  1REC A;  4USL A;  1BLQ A;  2E30 A;  3L4A A;  3DF0 A;  3S0B A;  4YGD B;  3WHT B;  2LE9 B;  1RJV A;  1QS7 A;  1C3Y A;  2PSR A;  3SS3 A;  2K61 A;  2KOT A;  5IBW A;  3AAK A;  2OS8 C;  1WDC B;  2WOR A;  2ZNE A;  1TCF A;  1MR8 A;  3HX4 A;  3NSO A;  4AOM A;  3ZNI A;  4ORA B;  2F3Y A;  3CZ0 A;  2KPH A;  1DJX A;  1NYA A;  4PAL A;  3PSR A;  3L47 A;  4OR9 B;  2M29 A;  3WXA A;  1NX2 A;  1XK4 C;  2M49 B;  2JTZ A;  1J7P A;  1TNP A;  2TN4 A;  2ZKM X;  2MLE C;  2O5G A;  2AAO A;  1QTX A;  1SKT A;  2JZI A;  1DJG A;  3LLE A;  1M63 B;  2JRF A;  3RM1 A;  3S0G A;  1V1F A;  2NZ0 A;  4OZD A;  1IQ3 A;  1KQM C;  1XO5 A;  1UHK A;  3CWG A;  3B7A A;  3O2P A;  1CB1 A;  4KYN A;  5BPJ A;  3VRO A;  2L4I A;  2ZRS A;  5AEQ A;  5G08 A;  1AJ5 A;  1YRU B;  1M31 A;  2H8V A;  2LUX A;  3D73 A;  1FPW A;  4N1G A;  1AVS A;  1B8C A;  3A8R A;  4QJ3 B;  1MF8 B;  3N7H A;  4M2Q A;  1SW8 A;  1LVC D;  4WQ2 A;  1YUR A;  3JVT B;  1QV1 A;  1QVI Y;  2M1U A;  2KFH A;  2JQ6 A;  4MLW A;  1M39 A;  2QEH A;  1M46 A;  4AQI A;  2YGU A;  2CTN A;  3TUY B;  2PVB A;  3HCM A;  2L2C A;  3FE9 A;  4IJ7 A;  1CM4 A;  1TUZ A;  1YRT B;  5I2L A;  2L50 A;  1XYD A;  1KWO B;  2L5X B;  4GAO A;  3VB1 A;  2Q4U A;  1BF5 A;  1P28 A;  5JOL A;  2VRG A;  3F45 A;  3I5F C;  5AER A;  1M45 A;  1TIZ A;  5DKR A;  1OMD A;  3EVU A;  4P2Y B;  3JTD B;  1W7I B;  3EK7 A;  2ZN9 A;  2CBL A;  1Z2C B;  5GQQ C;  3CTN A;  5TNC A;  2LNK A;  4PHN A;  3CZ1 A;  1XA5 A;  1EJ3 A;  4HRG A;  3DXL A;  5DIC A;  2KAX A;  1A75 A;  1DVI A;  1A4P A;  2WOS A;  1WRK A;  2KYC A;  3CLN A;  1UHJ A;  4ETO A;  4MN0 A;  2LP3 A;  3H4S E;  2BNX A;  4NQG A;  3D0Y A;  2MBX A;  1K93 D;  1QX7 A;  1PRW A;  1S6C A;  2NXQ A;  1NX0 A;  1TTX A;  3C1V A;  2EHB A;  1OMR A;  2OTG B;  2L5Y A;  3CZT X;  3LK1 A;  3SG6 A;  1XFR A;  1KFU L;  3SG3 A;  2BAP A;  3OX5 A;  1TNQ A;  2BE4 A;  3IQO A;  2WCF A;  2BCB A;  2JPT A;  4DRW A;  1BR4 B;  1DGV A;  2DOQ A;  2WCK A;  2QAC A;  2P6B B;  2QEB A;  2H61 A;  4CFR A;  1NCZ A;  1SCM B;  3LK0 A;  5HL1 A;  2NCP A;  1NCX A;  1QWV A;  1EG3 A;  3D10 A;  2MA2 A;  1WY9 A;  2BBN A;  2KI6 C;  1LXF C;  5DKN A;  1IWQ A;  3BUW B;  1K9K A;  1KSM A;  3BFA A;  4GBA A;  2BKI B;  2K7B A;  1UWO A;  3M0W A;  1BU3 A;  3BXK A;  1SY9 A;  1ZAC A;  1SMG A;  4MZL A;  2KGB C;  2E6W A;  1NCY A;  2BL0 B;  2JPO A;  2KNE A;  2Y4Q A;  2LVI A;  3D77 A;  4MVF A;  5K89 A;  2GGM A;  5FI7 A;  2L2E A;  4GGF C;  4PHJ A;  1OOH A;  1CDL A;  1K9U A;  1KSO A;  3BUM B;  4XJK B;  4F0Z B;  5CSN A;  1CLB A;  1EXR A;  2HQ8 A;  1TRF A;  4I5N B;  1IG5 A;  3GK4 X;  2KAV A;  3NSL A;  4GFT A;  1LKJ A;  1GM0 A;  3BUN B;  1GGZ A;  2MAZ A;  1JF0 A;  1NIW A;  1QV0 A;  2Y1N A;  1F54 A;  1S5G Z;  3RLZ A;  1G4Y R;  2LMV A;  2BKH B;  2IS9 A;  1ZFS A;  3BYA A;  2LV7 A;  2JXL A;  1A2X A;  2MRD A;  3EVV A;  4NDD A;  4YI9 A;  2L4H A;  1YUT A;  3I5H C;  1ZMZ A;  2COL B;  3NHT A;  1CMF A;  2Y1M A;  4A4B A;  1Y1A A;  4JD9 A;  1K2H A;  2WCB A;  1BOD A;  5AXI A;  4YBH B;  3DZT A;  1KQM B;  4PHM A;  2LC5 A;  2LVK A;  1F70 A;  2LLS A;  1DQE A;  1UUS A;  2P71 A;  4PCW A;  3UNW A;  2JNF A;  1YTZ C;  3DVE A;  2PAL A;  1BMO A;  1ALW A;  2M97 A;  2WC5 A;  1SRA A;  3S0E A;  1DJW A;  1ODB A;  1K96 A;  3GK2 A;  3PM8 A;  1DF0 B;  2AMI A;  1KFU S;  1KQV A;  1W9Z A;  1YUU A;  1FI6 A;  1W7J B;  1YR5 A;  1CM1 A;  2KQ6 A;  1Y1X A;  2WCL A;  3IVT A;  3LCP C;  4OV2 A;  4JKT A;  3KEV A;  2K7C A;  1JSA A;  1SCV A;  1NUB A;  4P5O E;  1JFJ A;  2ZRT A;  3WNX B;  3E3R A;  1KK8 C;  2JXC A;  4HSZ A;  1NWD A;  1IJ5 A;  1Q80 A;  4FQT A;  2EGD A;  2WCJ A;  1SPY A;  3KO0 A;  2LM5 A;  1IQ5 A;  2GV5 A;  4PE1 A;  1TNW A;  2KBM A;  1XK4 A;  3I5F B;  3AAJ A;  2KFG A;  2QEO A;  3CYZ A;  5JJG A;  1KFX L;  2BBM A;  3B86 A;  1CNP A;  1WRL A;  2JWW A;  3UO9 A;  3CS1 A;  2D8N A;  5CSJ A;  1OOF A;  1IIO A;  4OVN F;  4WQ3 A;  4PE4 A;  1C7V A;  5D69 A;  1UHN A;  1F4O A;  3TDI A;  1MXE A;  1K90 D;  2JTT A;  2NLN A;  3SG2 A;  1SYM A;  5AFP A;  2M3W A;  2BEC A;  4MSP A;  4U8D A;  3CGA A;  1R6P A;  2L0P A;  1VRK A;  3B6X A;  4PT1 A;  5CSI A;  1G8I A;  3BOW B;  3IF7 A;  2G9B A;  1BJF A;  1DF0 A;  1RRO A;  2NCO A;  1QIW A;  1QAS A;  2SCP A;  5HLO A;  3OBV A;  1NX1 A;  1UUR A;  4A4C A;  1PSR A;  3FS7 A;  3S0A A;  2JOJ A;  3RZS A;  3PAL A;  4PE0 A;  2L98 A;  2BCA A;  2B1U A;  2FCD A;  1XFW O;  4PHK A;  1TCO B;  1YX8 A;  3BUO B;  3DVM A;  4DCK A;  1EG4 A;  1OOJ A;  1QX5 B;  4MBE A;  1J1E A;  4PE7 A;  4M2P A;  1BG1 A;  1KK7 Y;  1N2D A;  1QAT A;  3S0F A;  3AKA A;  1FF1 A;  4DIR A;  2EC6 C;  2LMU A;  1QIV A;  3V2L A;  1GJY A;  5FI2 A;  4L9M A;  3SS5 A;  3FE8 A;  4NDC A;  1X02 A;  1TUJ A;  3DYE A;  3SIB A;  1CDP A;  2CCM A;  3PFV A;  1PAL A;  1SL7 A;  4ORC B;  4R1E A;  1WLZ A;  5FI6 A;  3FWB A;  1CFP A;  5HYD A;  1DJY A;  1DEL A;  1DTL A;  1S5G Y;  3K21 A;  4F7F A;  5I2Q A;  1B1G A;  1QLS A;  1JUO A;  3EG5 B;  1UP5 A;  3ZWH A;  4MRX A;  3JVT C;  2LVJ A;  3SIA A;  2KDH A;  1B8L A;  1SR6 C;  2HET A;  1K94 A;  3D74 A;  1PSB A;  3GOF A;  3PN7 B;  5ER5 A;  3TUY C;  1K95 A;  3D78 A;  2M1K B;  4C0K A;  1AHR A;  1OOI X;  2LHI A;  4FTG A;  1N0Y A;  2JUL A;  4DS7 A;  1D1O A;  1PUL A;  3KF9 A;  3SG5 A;  3O4Y A;  4WRI A;  4GUK A;  3EVR A;  4QJ5 B;  1TWO A;  2I2R E;  1B47 A;  2LAN A;  2KSP A;  4DUQ A;  2JNX A;  2KHN A;  1RK9 A;  1SL8 A;  2K7O A;  2QEV A;  3K1E A;  2KAY A;  4ORB B;  4N5X A;  1OW4 A;  1JF2 A;  1G33 A;  2WC8 A;  2JT0 A;  2GTE A;  3DF0 B;  2LAP A;  3CDN A;  2KI6 D;  1AP4 A;  1QJT A;  2WC6 A;  1KK7 Z;  2OS8 B;  3I5I C;  3NXA A;  1MHO A;  2G2B A;  4I5J A;  3DVK A;  4ZCV A;  1DGU A;  1C7W A;  1TN4 A;  1F4Q A;  3EK4 A;  2KLD A;  3I5G C;  4HRE E;  2QPT A;  1L7Z A;  4BY5 A;  5I2O A;  2I18 A;  1N65 A;  2R2I A;  3QME A;  1S36 A;  1OZS A;  4I5K A;  2OTG C;  3SG4 A;  2FCE A;  1WLM A;  4OKH A;  1YVL A;  4JQ0 D;  4JWQ A;  4UPG A;  4YRU A;  2ZN8 A;  3R72 A;  1SSE B;  4IL1 A;  2Y5I A;  4YGB B;  1CFF A;  1MWN A;  2LLU A;  1SCM C;  1TNX A;  1BT6 A;  2JC2 A;  2LCP A;  3FWC A;  1RTP 1;  1H8B A;  3TS5 C;  1J1D A;  4M2O A;  2SAS A;  1FBV A;  3CZ2 A;  4CID A;  3BQ3 A;  1CKK A;  1K9P A;  1KK8 B;  1OSA A;  2MHH A;  2ERB A;  4OCI A;  1IGV A;  1MUX A;  1ZOT B;  3DY9 A;  4INW A;  4NDB A;  2HF5 A;  5HKW A;  2K7D A;  1QX2 A;  5HLV A;  4QJ4 B;  1YUS A;  2WCM A;  3DD4 A;  1AJ4 A;  3BFH A;  3MSE B;  5FYX A;  3VRR A;  1L2O C;  2F2O A;  1DJI A;  1SNL A;  4TNC A;  2BL0 C;  1S1E A;  3NSI A;  1DC1 A;  5AAN A;  5CSF A;  2RGI A;  4XJK A;  1NP8 A;  2FJY A;  2K8M B;  2KI4 C;  1J7O A;  1F55 A;  1JWD A;  3OHM B;  3WHU B;  1F71 A;  2WCH A;  2ZND A;  5HKY A;  4BY4 A;  4GGN A;  2LLT A;  2JU0 A;  1DJZ A;  1HT9 A;  1LS8 A;  3R1O A;  1OQP A;  2LMT A;  4MRY A;  2I94 A;  3FIA A;  5KSZ A;  3OGN A;  1CLM A;  3D76 A;  1JBA A;  2ISD A;  1XVJ A;  4ZCU A;  1K8U A;  1OMV A;  2HPS A;  2I7A A;  3OP0 A;  5EL2 A;  5HKZ A;  4CPV A;  5DKQ A;  4PDZ A;  2KBI A;  4MZJ A;  2MLF C;  3BJH A;  3OX6 A;  4MZK A;  1F8H A;  3NSK A;  1WDC C;  2H2K A;  3CR5 X;  2JT8 A;  1OZO A;  2WND A;  4ICB A;  1A75 B;  2KLE A;  1S6J A;  5CPV A;  2EC6 B;  1UHH A;  3OB1 B;  1DMO A;  1C07 A;  1B9A A;  1MXL C;  2JT3 A;  3GK1 A;  2KYF A;  2Q91 A;  1BOC A;  4N1F A;  1R2U A;  3PJI A;  3S0D A;  3R1V A;  3D0Y B;  2PRU A;  2BCX A;  1QXP A;  4AQJ A;  1JFK A;  1ORG A;  1LA0 A;  3CR2 A;  3NGV A;  4E68 A;  3EKJ A;  1XFY O;  1J7Q A;  1ALV A;  3O78 A;  1SR6 B;  4XYN A;  4HRH A;  1FI5 A;  1SL9 A;  1A03 A;  1CTR A;  1KCY A;  1U5I B;  1BR1 B;  1SBJ A;  1A29 A;  1DT7 B;  3VRP A;  4CFQ A;  2CXJ A;  5D3O A;  1CLL A;  2WCE A;  4MEW A;  1PK0 D;  3TDZ A;  2GGZ A;  3R1P A;  3B87 A;  2CNP A;  2PMY A;  3PM2 A;  4CLN A;  1AK8 A;  5F6T A;  1J55 A;  2L51 A;  3LL8 B;  5I94 A;  2M8U A;  2PYQ A;  3DVJ A;  1PVA A;  4YGE B;  1S3P A; 
#chains in the Genus database with same CATH homology
 2F8P A;  1EL4 A;  1UHI A;  2F2P A;  3CR4 X;  4I5L B;  1IRJ A;  1YVH A;  1IJ6 A;  5PAL A;  1J7R A;  5ER4 X;  1IKU A;  5D7F A;  3I5I B;  2LP2 A;  3BOW A;  2AUC A;  2H61 C;  3PLF B;  1JC2 A;  1EH2 A;  1E8A A;  1Y6W A;  1XFV O;  3TDU A;  1AUI B;  1ZUZ A;  3I5G B;  2HQW A;  1KWO C;  1H4B A;  3ICB A;  3O6B A;  5KTY A;  1NPQ A;  2ZFD A;  4GNK B;  1WRZ A;  2K0J A;  1NX3 A;  5J3X A;  1PVB A;  1CDM A;  3JTD C;  1KFX S;  1HQV A;  1YX7 A;  4FQO A;  4GPL B;  4JPZ B;  1CDN A;  1FI5 A;  1B7T Y;  3EK8 A;  5I8N A;  1QVI Z;  4YI8 A;  1RWY A;  1XFU O;  3I5H B;  1TOP A;  2CT9 A;  1U5I A;  2KFF A;  4C0J A;  4D1E A;  3PAT A;  5KU1 A;  1SK6 D;  1DJH A;  2F33 A;  3KHE A;  3SG7 A;  3TS5 B;  1S26 D;  3VRQ A;  4Q04 A;  1CFC A;  2KQY A;  1XFZ O;  3SJS A;  1Y1U A;  3A4U B;  2LHL A;  2OPO A;  1RFJ A;  1LIN A;  1OE9 B;  3OB2 B;  2LVV A;  1B4C A;  2K2F A;  1CMG A;  1MQ1 A;  2M7L A;  1L2O B;  5B8I B;  2FOT A;  4GGF A;  2PAS A;  4C0L A;  1FW4 A;  2O60 A;  2KI4 B;  2K2A A;  2V53 A;  2BE6 A;  2M0R A;  2LUC A;  1B8R A;  4YGC B;  1V1G A;  3PN7 C;  1IH0 A;  3IQQ A;  2M9G A;  1NSH A;  2F3Z A;  2M7N A;  1S6I A;  3VGO A;  1GQM A;  3BUX B;  3TZ1 A;  1CFD A;  2FJU B;  2MJW B;  1LA3 A;  1GGW A;  1XFX O;  1QLK A;  3QRX A;  3KPX A;  1Y0V H;  3EKH A;  3VRN A;  3AKB A;  2A4J A;  2KGR A;  1B7T Z;  4YGA A;  1REC A;  4USL A;  1BLQ A;  2E30 A;  3DF0 A;  3WHT B;  4YGD B;  2LE9 B;  1RJV A;  1QS7 A;  2PSR A;  2K61 A;  2KOT A;  5IBW A;  3AAK A;  2OS8 C;  1WDC B;  2WOR A;  2ZNE A;  1TCF A;  1MR8 A;  3HX4 A;  3NSO A;  4AOM A;  3ZNI A;  4ORA B;  2F3Y A;  1DJX A;  1NYA A;  4PAL A;  3PSR A;  4OR9 B;  2M29 A;  3WXA A;  1NX2 A;  1XK4 C;  2M49 B;  2JTZ A;  1J7P A;  1TNP A;  2TN4 A;  2ZKM X;  2MLE C;  2O5G A;  2AAO A;  1QTX A;  1SKT A;  2JZI A;  1DJG A;  3LLE A;  1M63 B;  2JRF A;  3RM1 A;  1V1F A;  2NZ0 A;  1IQ3 A;  1KQM C;  1XO5 A;  1UHK A;  3CWG A;  3O2P A;  1CB1 A;  5BPJ A;  3VRO A;  2L4I A;  2ZRS A;  5AEQ A;  5G08 A;  1AJ5 A;  1YRU B;  1M31 A;  2LUX A;  1FPW A;  4N1G A;  1AVS A;  1B8C A;  3A8R A;  4QJ3 B;  1MF8 B;  4M2Q A;  1SW8 A;  1LVC D;  4WQ2 A;  1YUR A;  3JVT B;  1QV1 A;  1QVI Y;  2M1U A;  2KFH A;  2JQ6 A;  4MLW A;  1M39 A;  1M46 A;  4AQI A;  2CTN A;  3TUY B;  2PVB A;  3HCM A;  1CM4 A;  1YRT B;  5I2L A;  2L50 A;  1XYD A;  1KWO B;  2L5X B;  4GAO A;  2Q4U A;  1BF5 A;  5JOL A;  2VRG A;  3F45 A;  3I5F C;  5AER A;  1M45 A;  1TIZ A;  5DKR A;  1OMD A;  3EVU A;  4P2Y B;  3JTD B;  1W7I B;  3EK7 A;  2ZN9 A;  2CBL A;  5GQQ C;  3CTN A;  5TNC A;  2LNK A;  4PHN A;  1XA5 A;  1EJ3 A;  4HRG A;  2KAX A;  1A75 A;  1DVI A;  1A4P A;  2WOS A;  1WRK A;  2KYC A;  3CLN A;  1UHJ A;  4ETO A;  4MN0 A;  2LP3 A;  3H4S E;  4NQG A;  3D0Y A;  2MBX A;  1K93 D;  1QX7 A;  1PRW A;  1S6C A;  2NXQ A;  1NX0 A;  1TTX A;  3C1V A;  2EHB A;  1OMR A;  2OTG B;  3CZT X;  3LK1 A;  3SG6 A;  1KFU L;  3SG3 A;  3OX5 A;  1TNQ A;  2BE4 A;  3IQO A;  2WCF A;  2BCB A;  2JPT A;  4DRW A;  1BR4 B;  1DGV A;  2DOQ A;  2QAC A;  2P6B B;  2H61 A;  4CFR A;  1NCZ A;  1SCM B;  3LK0 A;  2NCP A;  1NCX A;  1EG3 A;  3D10 A;  2MA2 A;  1WY9 A;  2BBN A;  2KI6 C;  1LXF C;  5DKN A;  1IWQ A;  3BUW B;  1K9K A;  1KSM A;  4GBA A;  2BKI B;  2K7B A;  1UWO A;  3M0W A;  1BU3 A;  3BXK A;  1SY9 A;  1ZAC A;  1SMG A;  4MZL A;  2KGB C;  2E6W A;  1NCY A;  2BL0 B;  2KNE A;  2Y4Q A;  2LVI A;  4MVF A;  5K89 A;  2GGM A;  2L2E A;  4GGF C;  4PHJ A;  1CDL A;  1K9U A;  1KSO A;  3BUM B;  4XJK B;  4F0Z B;  5CSN A;  1CLB A;  1EXR A;  2HQ8 A;  1TRF A;  4I5N B;  1IG5 A;  3GK4 X;  2KAV A;  3NSL A;  4GFT A;  1LKJ A;  3BUN B;  1GGZ A;  2MAZ A;  1JF0 A;  1NIW A;  1QV0 A;  2Y1N A;  1F54 A;  1S5G Z;  3RLZ A;  1G4Y R;  2LMV A;  2BKH B;  2IS9 A;  1ZFS A;  3BYA A;  2LV7 A;  2JXL A;  1A2X A;  2MRD A;  3EVV A;  4NDD A;  4YI9 A;  2L4H A;  1YUT A;  3I5H C;  1ZMZ A;  2COL B;  1CMF A;  2Y1M A;  4A4B A;  1Y1A A;  1K2H A;  2WCB A;  1BOD A;  5AXI A;  4YBH B;  4PHM A;  1KQM B;  2LC5 A;  2LVK A;  1F70 A;  2LLS A;  1UUS A;  4PCW A;  2JNF A;  1YTZ C;  3DVE A;  2PAL A;  1BMO A;  1ALW A;  2M97 A;  1SRA A;  1DJW A;  1ODB A;  1K96 A;  3GK2 A;  3PM8 A;  1DF0 B;  2AMI A;  1KFU S;  1KQV A;  1YUU A;  1FI6 A;  1W7J B;  1YR5 A;  1CM1 A;  2KQ6 A;  1Y1X A;  4OV2 A;  3LCP C;  3KEV A;  2K7C A;  1JSA A;  1SCV A;  1NUB A;  4P5O E;  1JFJ A;  2ZRT A;  3WNX B;  3E3R A;  1KK8 C;  2JXC A;  4HSZ A;  1NWD A;  1IJ5 A;  1Q80 A;  2EGD A;  1SPY A;  3KO0 A;  2LM5 A;  1IQ5 A;  2GV5 A;  4PE1 A;  1TNW A;  2KBM A;  1XK4 A;  3I5F B;  3AAJ A;  2KFG A;  5JJG A;  1CNP A;  1KFX L;  2BBM A;  1WRL A;  2JWW A;  3CS1 A;  2D8N A;  5CSJ A;  4OVN F;  4WQ3 A;  4PE4 A;  1C7V A;  5D69 A;  1UHN A;  1F4O A;  3TDI A;  1MXE A;  1K90 D;  2JTT A;  2NLN A;  3SG2 A;  1SYM A;  5AFP A;  2M3W A;  2BEC A;  4MSP A;  4U8D A;  3CGA A;  1R6P A;  2L0P A;  1VRK A;  5CSI A;  1G8I A;  3BOW B;  3IF7 A;  2G9B A;  1BJF A;  1DF0 A;  1RRO A;  2NCO A;  1QIW A;  1QAS A;  2SCP A;  5HLO A;  1NX1 A;  1UUR A;  4A4C A;  1PSR A;  3FS7 A;  2JOJ A;  3PAL A;  4PE0 A;  2L98 A;  2BCA A;  2B1U A;  2FCD A;  1XFW O;  4PHK A;  1TCO B;  1YX8 A;  3BUO B;  3DVM A;  4DCK A;  1EG4 A;  1OOJ A;  1QX5 B;  4MBE A;  1J1E A;  4PE7 A;  4M2P A;  1BG1 A;  1KK7 Y;  1N2D A;  1QAT A;  3AKA A;  1FF1 A;  4DIR A;  2EC6 C;  2LMU A;  1QIV A;  1GJY A;  4L9M A;  4NDC A;  1X02 A;  3SIB A;  1CDP A;  2CCM A;  3PFV A;  1PAL A;  1SL7 A;  4ORC B;  4R1E A;  1WLZ A;  3FWB A;  1CFP A;  5HYD A;  1DJY A;  1S5G Y;  1DTL A;  3K21 A;  5I2Q A;  1B1G A;  1QLS A;  1JUO A;  3ZWH A;  1UP5 A;  4MRX A;  3JVT C;  2LVJ A;  3SIA A;  2KDH A;  1B8L A;  1SR6 C;  2HET A;  1K94 A;  1PSB A;  3GOF A;  3PN7 B;  5ER5 A;  3TUY C;  1K95 A;  2M1K B;  4C0K A;  1AHR A;  2LHI A;  4FTG A;  1N0Y A;  2JUL A;  4DS7 A;  1D1O A;  1PUL A;  3KF9 A;  3SG5 A;  3O4Y A;  4WRI A;  4GUK A;  3EVR A;  4QJ5 B;  2I2R E;  1B47 A;  2LAN A;  2KSP A;  4DUQ A;  2JNX A;  2KHN A;  1RK9 A;  1SL8 A;  2K7O A;  2KAY A;  4ORB B;  4N5X A;  1JF2 A;  1G33 A;  2WC8 A;  2JT0 A;  3DF0 B;  2LAP A;  2KI6 D;  1AP4 A;  1QJT A;  1KK7 Z;  2OS8 B;  3I5I C;  3NXA A;  1MHO A;  2G2B A;  4I5J A;  3DVK A;  4ZCV A;  1DGU A;  1C7W A;  1TN4 A;  1F4Q A;  3EK4 A;  3I5G C;  4HRE E;  2QPT A;  1L7Z A;  4BY5 A;  5I2O A;  2I18 A;  1N65 A;  2R2I A;  1S36 A;  1OZS A;  4I5K A;  2OTG C;  3SG4 A;  2FCE A;  1WLM A;  4OKH A;  1YVL A;  4JQ0 D;  4JWQ A;  4UPG A;  4YRU A;  2ZN8 A;  4IL1 A;  2Y5I A;  4YGB B;  1CFF A;  1MWN A;  2LLU A;  1SCM C;  1TNX A;  1BT6 A;  2JC2 A;  2LCP A;  3FWC A;  1RTP 1;  1H8B A;  3TS5 C;  1J1D A;  4M2O A;  2SAS A;  1FBV A;  4CID A;  3BQ3 A;  1CKK A;  1K9P A;  1KK8 B;  1OSA A;  2MHH A;  4OCI A;  1IGV A;  1MUX A;  1ZOT B;  4NDB A;  2HF5 A;  5HKW A;  2K7D A;  1QX2 A;  5HLV A;  4QJ4 B;  1YUS A;  3DD4 A;  1AJ4 A;  5FYX A;  3MSE B;  3VRR A;  1L2O C;  2F2O A;  1DJI A;  1SNL A;  4TNC A;  2BL0 C;  1S1E A;  3NSI A;  5AAN A;  5CSF A;  2RGI A;  4XJK A;  1NP8 A;  2K8M B;  2KI4 C;  1J7O A;  1F55 A;  1JWD A;  3OHM B;  3WHU B;  1F71 A;  2ZND A;  5HKY A;  4BY4 A;  4GGN A;  2LLT A;  2JU0 A;  1DJZ A;  1HT9 A;  1OQP A;  2LMT A;  4MRY A;  2I94 A;  3FIA A;  5KSZ A;  1CLM A;  1JBA A;  2ISD A;  1XVJ A;  4ZCU A;  1K8U A;  1OMV A;  2HPS A;  2I7A A;  3OP0 A;  5HKZ A;  4CPV A;  5DKQ A;  4PDZ A;  2KBI A;  4MZJ A;  2MLF C;  3OX6 A;  4MZK A;  1F8H A;  3NSK A;  1WDC C;  2H2K A;  3CR5 X;  2JT8 A;  1OZO A;  2WND A;  4ICB A;  1A75 B;  1S6J A;  5CPV A;  2EC6 B;  1UHH A;  3OB1 B;  1DMO A;  1C07 A;  1B9A A;  1MXL C;  2JT3 A;  3GK1 A;  2KYF A;  2Q91 A;  1BOC A;  4N1F A;  1R2U A;  3D0Y B;  2PRU A;  2BCX A;  1QXP A;  4AQJ A;  1JFK A;  1LA0 A;  3CR2 A;  4E68 A;  3EKJ A;  1XFY O;  1J7Q A;  1ALV A;  3O78 A;  1SR6 B;  4XYN A;  4HRH A;  1SL9 A;  1A03 A;  1CTR A;  1KCY A;  1U5I B;  1BR1 B;  1SBJ A;  1A29 A;  1DT7 B;  3VRP A;  4CFQ A;  2CXJ A;  1CLL A;  2WCE A;  4MEW A;  1PK0 D;  3TDZ A;  2GGZ A;  2CNP A;  2PMY A;  4CLN A;  1AK8 A;  5F6T A;  1J55 A;  2L51 A;  3LL8 B;  2M8U A;  3DVJ A;  1PVA A;  4YGE B;  1S3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...