3BQ3A

Crystal structure of s. cerevisiae dcn1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
258
structure length
250
Chain Sequence
SPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGVAHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, ligase
molecule keywords Defective in cullin neddylation protein 1
publication title Dcn1 Functions as a Scaffold-Type E3 Ligase for Cullin Neddylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 80
structure length 250
sequence length 258
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3bq3A00
1IG5A 3ZWHA 5JOLA 1SCMB 1RWYA 2LANA 1YRTB 3I5IB 1TTXA 2KGRA 1A29A 2LMUA 1CFCA 3CLNA 4PHJA 2JT8A 3CR5X 3VGOA 2ZNEA 1Q80A 1SKTA 3TUYC 2FCDA 4WQ2A 2CXJA 2BL0B 1IWQA 1TNXA 3K21A 1NIWA 2GGMA 5AXIA 4NQGA 1BF5A 1AJ4A 4U8DA 1UP5A 1B8LA 1DJZA 4ORAB 1OMDA 2PALA 2KAYA 3OX6A 1NCXA 1C7VA 1MR8A 2M97A 2PSRA 2E30A 4DS7A 1A75B 1V1FA 1XVJA 2DOQA 1BMOA 2TN4A 2ZRSA 1BOCA 1QTXA 1SBJA 2M8UA 3IF7A 2KDHA 1L2OC 1CTRA 1KFXL 1C7WA 2PVBA 2I94A 2LC5A 2LAPA 4GGFC 5HLVA 2JQ6A 2JNFA 3CZTX 3CR2A 1JWDA 1TRFA 1YUTA 1SCMC 3H4SE 1B9AA 3I5IC 1SL9A 1EG3A 2LE9B 3JVTC 2Y4QA 3EVVA 1F4OA 1OOJA 2I7AA 3PFVA 1AK8A 2CT9A 1SCVA 3NSIA 1KFXS 2KAVA 4MZKA 4ETOA 1F4QA 1CFFA 1IH0A 3SG6A 2AAOA 1S5GY 2RGIA 2JWWA 5HKZA 4C0LA 1AUIB 4I5JA 1M46A 3GOFA 2JNXA 1J7QA 1G33A 1ODBA 3FWBA 1PALA 3IQQA 3OHMB 1B47A 2KNEA 5CPVA 3GK2A 2ZFDA 1RROA 1W7IB 3CWGA 1CDLA 4GAOA 1CDPA 4XJKB 4OR9B 4OKHA 2JZIA 2M1UA 1NUBA 1YUUA 4FQOA 3WNXB 3CTNA 3BUOB 2ZN9A 2EGDA 1M63B 2BCBA 1F54A 2F2OA 2JRFA 3OP0A 4DIRA 4MZLA 1K93D 1NX2A 3RLZA 1J1EA 2JXCA 4IL1A 5D7FA 1NCZA 2OS8C 4PHMA 4YGBB 4MBEA 4GGFA 2M9GA 4ORCB 1SL8A 3CR4X 1UUSA 5KTYA 4AQIA 1JFJA 3JTDB 1IJ5A 5KU1A 5FYXA 1FBVA 1UHHA 3I5GC 5CSFA 2M29A 2KI6C 1CM1A 1CMFA 1AVSA 5GQQC 2FJUB 4DUQA 2WNDA 2F2PA 4MLWA 4PE1A 2GGZA 1PULA 1DVIA 1MQ1A 3BXKA 2KQ6A 2JULA 3OX5A 4I5NB 2JTZA 1XK4A 2MRDA 2O5GA 3EK7A 1KCYA 1WDCC 2WCEA 1DJIA 3DD4A 5PALA 4ZCVA 3M0WA 1NX3A 1K95A 4GNKB 4F0ZB 1A2XA 1ZFSA 2PMYA 3HX4A 1H4BA 4PDZA 1MWNA 2KBIA 4C0JA 2JPTA 2M0RA 1NWDA 3O2PA 3DVKA 3KF9A 3BOWB 3SG2A 3IQOA 1CNPA 1ZUZA 1S6JA 3BUXB 1SPYA 3JTDC 4NDDA 3SG4A 1BR4B 4YGDB 3AAKA 2OPOA 1QX2A 1CDMA 1UWOA 2L50A 4HSZA 4BY4A 1QIVA 2D8NA 2BE4A 5AANA 2L0PA 2CBLA 2JOJA 1FPWA 1TNQA 4AQJA 2HQ8A 1YVLA 2FOTA 2SASA 4XJKA 2COLB 1G8IA 4GFTA 1XA5A 2LLTA 1IGVA 5DKNA 1F71A 1DF0B 1NX0A 4C0KA 1ALVA 2KOTA 4CIDA 3SIAA 3VRQA 4D1EA 1MHOA 4CPVA 3EVRA 2M3WA 4L9MA 1KSOA 1UHJA 4PE4A 4USLA 3ZNIA 1WY9A 1S3PA 2BECA 3SG7A 1BR1B 1KQVA 1TIZA 3DVMA 1B7TZ 2LCPA 1IQ5A 1QVIY 2G9BA 4HRHA 2L51A 1QLKA 4YRUA 2NLNA 1F70A 3PLFB 3GK4X 1J1DA 1PRWA 1LXFC 4GGNA 1LVCD 3D0YB 3FWCA 4GUKA 1BODA 1GQMA 2NCOA 3NSKA 4I5LB 1J55A 2PRUA 2LUXA 1S1EA 3SG3A 2KAXA 1XYDA 5KSZA 3BUWB 1B1GA 2BL0C 5ER5A 1XFZO 3D10A 1K2HA 1M39A 1CFDA 4YBHB 1BLQA 3PALA 2LMTA 2L4IA 3I5FB 3MSEB 3HCMA 1J7PA 3AKAA 1OZSA 3A8RA 1AHRA 3O4YA 2BKIB 1MUXA 5G08A 3AKBA 2M7NA 1DJWA 1JF0A 1XFUO 2IS9A 1HQVA 1X02A 2MJWB 1DGUA 3A4UB 2MBXA 2Y5IA 1OE9B 4GBAA 1PVAA 3BQ3A 3BOWA 1CFPA 1DJYA 4ICBA 1QX5B 2KQYA 1OMRA 1DJXA 2F3YA 3DF0A 1K9PA 1Y1UA 1M31A 4I5KA 2I18A 1PK0D 3DVEA 4MEWA 3SJSA 3VROA 5DKQA 1VRKA 4M2QA 3KO0A 4CLNA 4NDBA 1OSAA 2QPTA 2LV7A 1JF2A 3C1VA 4Q04A 3SIBA 2OTGB 2GV5A 1RECA 3CGAA 1DTLA 2JT3A 2JTTA 2I2RE 3TZ1A 1QS7A 5K89A 3KHEA 1JFKA 1FF1A 3I5FC 2JU0A 2L5XB 1CKKA 2K7BA 5AFPA 1R6PA 2QACA 2F33A 2HQWA 1Y0VH 2Q4UA 1K96A 5F6TA 1ZOTB 1RJVA 3FIAA 1QXPA 1TNWA 2PASA 2KFGA 1K9UA 1YX7A 2WOSA 1L7ZA 1K94A 3EKJA 2LMVA 1OQPA 1IJ6A 1J7OA 5CSJA 1WRKA 1Y1XA 3BYAA 1MF8B 1QATA 2KYCA 5IBWA 1U5IB 1A75A 1LINA 2LHLA 3WHUB 2ZRTA 5HKWA 5J3XA 2A4JA 1SRAA 2WC8A 1NSHA 1WRZA 2OTGC 3CS1A 3F45A 4R1EA 1FI5A 2LVKA 1QJTA 1SR6B 1XO5A 4XYNA 3D0YA 1N0YA 3I5HB 2K7CA 1EG4A 1SK6D 1TNPA 1KK7Z 2MLEC 5HYDA 4NDCA 2Y1NA 4OVNF 1NX1A 2L2EA 3E3RA 1QLSA 3NXAA 3LK1A 3LCPC 2LP2A 2MHHA 2KI4B 1HT9A 2NXQA 3LLEA 2LLUA 5AEQA 4YI8A 1KWOB 4YI9A 2CCMA 4P2YB 3SG5A 4DRWA 4QJ5B 2Q91A 3TUYB 4BY5A 2SCPA 5I2QA 4M2OA 1ALWA 1D1OA 1EL4A 3LK0A 4PHNA 2K61A 2K7OA 1UHKA 3ICBA 1LA0A 1YX8A 2LM5A 3LL8B 1K90D 1K8UA 2MAZA 1S6CA 2ZKMX 2BKHB 1DMOA 1CDNA 1SR6C 1MXEA 1NYAA 1BG1A 1CLBA 2ZN8A 1TCFA 2CTNA 3OB2B 3I5HC 4PE7A 5HLOA 1PVBA 1XFYO 3BUMB 1JSAA 1QV0A 1QV1A 1L2OB 1KFUL 4JWQA 2B1UA 1SMGA 4A4BA 2L98A 1K9KA 4QJ3B 1GJYA 1ZMZA 4OV2A 4TNCA 1E8AA 1RFJA 2K8MB 4QJ4B 4MN0A 1SL7A 2KI4C 4YGEB 2H61C 5TNCA 3JVTB 1EJ3A 1KWOC 1EXRA 1YVHA 1B8RA 3TDZA 1KFUS 1PSRA 1OMVA 4WRIA 4PALA 1QVIZ 4WQ3A 1S6IA 2KYFA 2M49B 3GK1A 2KFFA 1XFVO 2EC6B 3AAJA 1LA3A 3PM8A 4JPZB 4MRXA 1KK8B 1M45A 1JBAA 2KFHA 1IQ3A 3TS5B 1FI6A 1YTZC 4HREE 4AOMA 4CFRA 4YGCB 1TN4A 1B7TY 5AERA 1CM4A 2V53A 4PCWA 1S26D 1KSMA 3EVUA 1SW8A 1ZACA 2BCXA 2ISDA 2BE6A 1DJGA 1RTP1 4FTGA 1Y1AA 1U5IA 1S5GZ 4CFQA 1AP4A 3OB1B 4A4CA 1YURA 2HETA 1A03A 1A4PA 1B8CA 5CSNA 4ORBB 5I2OA 1DT7B 1AJ5A 1V1GA 1IRJA 2AUCA 2EHBA 1WLZA 1YRUB 3TDIA 3VRNA 4M2PA 1YUSA 1SNLA 3EK4A 1YR5A 4N1FA 2CNPA 4N1GA 4UPGA 1UHIA 3EKHA 2LUCA 4N5XA 2OS8B 1KQMB 1SY9A 4MVFA 2EC6C 1BJFA 1DJHA 3VRRA 1W7JB 1KK8C 2HF5A 1C07A 3TS5C 5CSIA 4YGAA 4E68A 1XK4C 1MXLC 3PSRA 2H61A 2LVJA 3WHTB 2E6WA 3O78A 5ER4X 2ZNDA 1SYMA 2NZ0A 3I5GB 2WCFA 2BBNA 4ZCUA 2LVIA 2WCBA 3TDUA 2K7DA 2M7LA 1B4CA 1DF0A 1N2DA 1UHNA 5JJGA 2HPSA 1WDCB 1TOPA 1F8HA 1BU3A 1WRLA 2LHIA 1BT6A 5DKRA 2Y1MA 1LKJA 2O60A 3PN7B 4PHKA 2LLSA 1OZOA 2JT0A 3VRPA 3EK8A 1KQMC 2G2BA 2M1KB 1F55A 1R2UA 1CLLA 1S36A 2NCPA 3PATA 3NSOA 4JQ0D 2FCEA 2LP3A 5B8IB 2P6BB 2L4HA 4OCIA 1FW4A 1UURA 5I8NA 1H8BA 2KHNA 2MA2A 4DCKA 2AMIA 5BPJA 1G4YR 4GPLB 4MZJA 1QX7A 3WXAA 5I2LA 5D69A 1QIWA 2JC2A 4P5OE 1TCOB 1GGWA 2K2AA 3RM1A 1JUOA 2LNKA 1J7RA 2KBMA 4HRGA 3DVJA 3BUNB 3PN7C 2LVVA 1IKUA 2H2KA 3NSLA 5HKYA 1JC2A 2KI6D 1GGZA 4PE0A 2F8PA 2JXLA 1KK7Y 2K0JA 1CMGA 1PSBA 3KEVA 1QASA 1XFWO 1NCYA 1CLMA 2WORA 1DGVA 2KGBC 3O6BA 1WLMA 2K2FA 3KPXA 3DF0B 1CB1A 4MSPA 1NP8A 1RK9A 2MLFC 1EH2A 1Y6WA 3FS7A 2BBMA 1NPQA 2R2IA 2KSPA 1XFXO 1N65A 4MRYA 2VRGA 2F3ZA 2BCAA 3QRXA
chains in the Genus database with same CATH superfamily
1IG5A 3ZWHA 2P70A 5JOLA 1SCMB 1RWYA 2LANA 1YRTB 2PQLA 3I5IB 1TTXA 2KGRA 1A29A 2LMUA 1CFCA 3CLNA 4PHJA 2JT8A 3CR5X 3VGOA 2ZNEA 4KYNA 1Q80A 1SKTA 3TUYC 5FI6A 2FCDA 4WQ2A 2CXJA 3V2LA 3N7HA 2BL0B 1IWQA 1TNXA 3K21A 1NIWA 2GGMA 3S0EA 5AXIA 3B88A 4NQGA 1BF5A 1AJ4A 4U8DA 1UP5A 1B8LA 1DJZA 4ORAB 1OMDA 2PALA 2KAYA 3OX6A 1NCXA 3OGNA 2PYQA 1C7VA 1MR8A 2M97A 3UO9A 2PSRA 2E30A 4DS7A 1A75B 1V1FA 1XVJA 2DOQA 1BMOA 2TN4A 2ZRSA 3RZSA 1BOCA 1QTXA 1SBJA 2M8UA 3IF7A 2KDHA 1L2OC 1CTRA 1KFXL 1C7WA 2PVBA 2WCJA 2I94A 2LC5A 2LAPA 4GGFC 5HLVA 2JQ6A 2JNFA 3CZTX 3CR2A 1JWDA 1TRFA 1YUTA 1SCMC 2H8VA 2QDIA 1B9AA 3H4SE 3I5IC 1SL9A 1EG3A 2LE9B 3JVTC 2Y4QA 1QWVA 1F4OA 1OOJA 2I7AA 3EVVA 3PFVA 1AK8A 2CT9A 1C3YA 1SCVA 3NSIA 1KFXS 2KAVA 4MZKA 4ETOA 1F4QA 3FE8A 1CFFA 3SG6A 2AAOA 1IH0A 1S5GY 2RGIA 2JWWA 5HKZA 4C0LA 1AUIB 3D76A 4I5JA 3SS5A 1M46A 3GOFA 2JNXA 1J7QA 1G33A 1ODBA 3FWBA 1PALA 3IQQA 3OHMB 1B47A 2KNEA 5CPVA 3GK2A 2ZFDA 1RROA 1W7IB 2WC6A 3CWGA 3D73A 1CDLA 4GAOA 1CDPA 1OOHA 4XJKB 3S0DA 1GM0A 4OR9B 4OKHA 2JZIA 2M1UA 1NUBA 1YUUA 4FQOA 3WNXB 2GTEA 3CTNA 3BUOB 2QEVA 2ZN9A 2EGDA 1M63B 2BCBA 1F54A 2F2OA 2JRFA 3OP0A 4DIRA 3CZ1A 4MZLA 1K93D 1NX2A 3RLZA 1J1EA 2JXCA 4IL1A 5D7FA 1NCZA 2OS8C 4PHMA 4YGBB 4MBEA 4GGFA 2M9GA 4ORCB 3D75A 1SL8A 3CR4X 3CZ0A 1UUSA 5KTYA 4AQIA 1JFJA 3JTDB 1IJ5A 5KU1A 3BFHA 5FYXA 1FBVA 5FI2A 1UHHA 3I5GC 5CSFA 2M29A 2KI6C 1CM1A 1CMFA 1AVSA 5GQQC 3SS4A 2FJUB 4DUQA 2WNDA 2F2PA 4MLWA 4PE1A 2GGZA 1PULA 1DVIA 1MQ1A 3BXKA 2KQ6A 2JULA 3OX5A 4I5NB 2JTZA 1XK4A 2MRDA 2O5GA 3EK7A 1KCYA 1WDCC 2WCEA 1DJIA 3DD4A 5PALA 4ZCVA 3M0WA 1NX3A 1K95A 4GNKB 4F0ZB 1A2XA 1ZFSA 2PMYA 3HX4A 1H4BA 4PDZA 1MWNA 2KBIA 3BFAA 4C0JA 2JPTA 2M0RA 1NWDA 3O2PA 3DVKA 2QEBA 3KF9A 3BOWB 3SG2A 3IQOA 1CNPA 1ZUZA 1S6JA 3BUXB 1SPYA 3JTDC 4NDDA 3SG4A 1BR4B 4YGDB 3AAKA 2OPOA 1QX2A 1CDMA 1UWOA 2L50A 4HSZA 4BY4A 2FJYA 1QIVA 2D8NA 2BE4A 4JD9A 2L0PA 5AANA 2CBLA 2JOJA 4OZDA 1JBAA 2WCMA 1FPWA 1TNQA 4AQJA 2HQ8A 1YVLA 2FOTA 2SASA 4XJKA 2COLB 1G8IA 1OOFA 4GFTA 1XA5A 2LLTA 1IGVA 5DKNA 1F71A 1DF0B 1NX0A 4C0KA 1ALVA 3OBVA 2KOTA 1T14A 2L2CA 4CIDA 3SIAA 3B7AA 3VRQA 1MHOA 4D1EA 4CPVA 3EVRA 2M3WA 4L9MA 1KSOA 1UHJA 4PE4A 4USLA 3ZNIA 1WY9A 1S3PA 2BECA 3SG7A 1BR1B 1KQVA 1TIZA 2WC5A 3DVMA 3NHTA 1B7TZ 2LCPA 1IQ5A 1QVIY 2G9BA 4HRHA 2L51A 1DELA 1QLKA 4YRUA 2NLNA 1F70A 3PLFB 3GK4X 1J1DA 1PRWA 1LXFC 4GGNA 3VB1A 1LVCD 3D0YB 3B86A 3FWCA 4GUKA 1BODA 5I94A 1GQMA 2NCOA 3NSKA 4I5LB 1J55A 2PRUA 2LUXA 1S1EA 3SG3A 2KAXA 1XYDA 2KPHA 5KSZA 3BUWB 1B1GA 3S0AA 2BL0C 5ER5A 1XFZO 3D10A 1K2HA 1M39A 1CFDA 4YBHB 1BLQA 3PALA 2LMTA 2L4IA 3I5FB 3MSEB 3HCMA 3CABA 1J7PA 3AKAA 1OZSA 3A8RA 1AHRA 3O4YA 2BKIB 1MUXA 3NGVA 5G08A 3AKBA 2M7NA 1DJWA 1JF0A 1XFUO 2IS9A 1HQVA 1X02A 2MJWB 1DGUA 2K60A 3A4UB 2Y5IA 1OE9B 2MBXA 4GBAA 1PVAA 3BQ3A 3BOWA 1CFPA 1DJYA 3K1EA 4ICBA 1QX5B 2KQYA 1OMRA 1DJXA 2F3YA 3DF0A 1K9PA 2P71A 1Y1UA 1M31A 4I5KA 2I18A 1PK0D 3DVEA 3DXLA 4MEWA 3SJSA 3VROA 5DKQA 1VRKA 4M2QA 3KO0A 4CLNA 4NDBA 1OSAA 3B87A 2QPTA 2LV7A 1JF2A 3C1VA 4Q04A 3SIBA 2OTGB 2GV5A 1RECA 3CGAA 1DTLA 2JT3A 2JTTA 2I2RE 3TZ1A 1QS7A 5K89A 3KHEA 1JFKA 1FF1A 3I5FC 2JU0A 2L5XB 1CKKA 2K7BA 5AFPA 1R6PA 2QACA 2F33A 2HQWA 1DC1A 1Y0VH 2Q4UA 1K96A 5F6TA 2BNXA 1ZOTB 1RJVA 3FIAA 1QXPA 1TNWA 1TUZA 2PASA 2KFGA 1K9UA 1YX7A 2WOSA 1L7ZA 2YGUA 1K94A 3EKJA 3PM2A 2LMVA 1OQPA 1IJ6A 1C3ZA 1J7OA 5CSJA 1WRKA 1Y1XA 3BYAA 1MF8B 1QATA 2KYCA 5IBWA 2ERBA 1U5IB 1A75A 1LINA 2LHLA 3WHUB 3L47A 2ZRTA 5HKWA 5J3XA 2A4JA 1SRAA 2WC8A 1NSHA 1WRZA 2OTGC 3CS1A 3F45A 4R1EA 1FI5A 2LVKA 1QJTA 3BJHA 1SR6B 1XO5A 5FI7A 1IIOA 4XYNA 3D0YA 1N0YA 3I5HB 2K7CA 1EG4A 1SK6D 1TNPA 1KK7Z 2MLEC 5HYDA 4NDCA 2Y1NA 4OVNF 1NX1A 2L2EA 3E3RA 1QLSA 3NXAA 3LK1A 3L4LA 3LCPC 2LP2A 2MHHA 2KI4B 1HT9A 2NXQA 1OOIX 2LLUA 1Z4HA 3LLEA 4YI8A 5AEQA 1KWOB 4YI9A 2CCMA 3Q8IA 2QEOA 4P2YB 1P28A 3SG5A 2Q91A 3TUYB 4BY5A 4DRWA 2SCPA 5I2QA 4M2OA 1ALWA 1D1OA 1EL4A 3LK0A 4PHNA 2K61A 2K7OA 2BAPA 1OW4A 1UHKA 3ICBA 1LA0A 1YX8A 2LM5A 3LL8B 1K90D 1K8UA 1TWOA 2MAZA 1S6CA 2ZKMX 2BKHB 1DMOA 1CDNA 1SR6C 1MXEA 1DQEA 1NYAA 1BG1A 1CLBA 2ZN8A 1TCFA 2CTNA 3OB2B 3I5HC 4PE7A 4F7FA 5HLOA 1PVBA 1XFYO 3BUMB 3NHIA 1JSAA 1ORGA 1QV0A 1QV1A 1L2OB 4INXA 1KFUL 4JWQA 2B1UA 1SMGA 4A4BA 2L98A 4FQTA 1K9KA 4QJ3B 1GJYA 4IJ7A 1ZMZA 4OV2A 4TNCA 1E8AA 1RFJA 2K8MB 4QJ4B 4MN0A 3S0BA 1SL7A 2KI4C 4YGEB 2H61C 5TNCA 3JVTB 2WCKA 1EJ3A 1KWOC 1EXRA 1YVHA 1B8RA 3TDZA 1KFUS 1OOGA 1OMVA 1PSRA 4WRIA 4PALA 1QVIZ 4WQ3A 1S6IA 2KYFA 2M49B 3GK1A 2KFFA 1XFVO 3IVTA 2EC6B 2KLDA 3AAJA 1LA3A 3PM8A 4JPZB 4MRXA 1KK8B 1M45A 1DEKA 2KFHA 3B6XA 3QMEA 3TS5B 1YTZC 4HREE 4AOMA 4CFRA 1IQ3A 4YGCB 1FI6A 1TN4A 1B7TY 5AERA 1CM4A 2V53A 4PCWA 3DZTA 1LS8A 2KLEA 1S26D 1KSMA 3EVUA 3R1PA 1SW8A 1ZACA 2BCXA 4INWA 3FE9A 2BE6A 2ISDA 3SS3A 1DJGA 1RTP1 4FTGA 1Y1AA 1U5IA 1S5GZ 4CFQA 1AP4A 3OB1B 4A4CA 1YURA 2HETA 1A03A 1A4PA 1B8CA 5CSNA 2QEHA 4ORBB 5I2OA 1AJ5A 1DT7B 1V1GA 1IRJA 3EG5B 2AUCA 2EHBA 1WLZA 1YRUB 3TDIA 3VRNA 4M2PA 1YUSA 1SNLA 3EK4A 1YR5A 4N1FA 2CNPA 4N1GA 4UPGA 1UHIA 3EKHA 2LUCA 4N5XA 2OS8B 1KQMB 1SY9A 4MVFA 2EC6C 1BJFA 1DJHA 3VRRA 1W7JB 1KK8C 2HF5A 1C07A 3TS5C 5CSIA 4YGAA 4E68A 1XK4C 1MXLC 3PSRA 2H61A 2LVJA 3WHTB 3R72A 3D77A 2E6WA 3O78A 5ER4X 2ZNDA 1SYMA 2NZ0A 3I5GB 2WCFA 2BBNA 4ZCUA 2LVIA 2WCBA 3TDUA 1XFRA 2K7DA 2M7LA 2WCHA 1B4CA 1DF0A 2JPOA 3BFBA 1N2DA 2WCLA 1TUJA 1UHNA 5JJGA 2HPSA 3CDNA 5D3OA 1WDCB 1TOPA 3PJIA 1F8HA 1BU3A 1WRLA 2LHIA 1BT6A 5DKRA 2Y1MA 1LKJA 2O60A 3PN7B 3CZ2A 3DYEA 4PHKA 2LLSA 5HL1A 1OZOA 2JT0A 3VRPA 3EK8A 1KQMC 2G2BA 2M1KB 1F55A 1R2UA 1CLLA 1S36A 2NCPA 3PATA 3NSOA 4JQ0D 2FCEA 2LP3A 5B8IB 2P6BB 2L4HA 4OCIA 1FW4A 1Z2CB 3D74A 1UURA 5I8NA 1H8BA 2KHNA 2MA2A 3S0FA 4DCKA 2AMIA 5BPJA 1G4YR 4GPLB 4MZJA 1QX7A 3WXAA 5I2LA 3S0GA 1SSEB 5D69A 1QIWA 2JC2A 4P5OE 1TCOB 3L4AA 3CYZA 1GGWA 2K2AA 3RM1A 1JUOA 2LNKA 3DY9A 1J7RA 2KBMA 4HRGA 3DVJA 3BUNB 3PN7C 2LVVA 1IKUA 2H2KA 3NSLA 3D78A 5HKYA 3R1OA 4PT1A 3FE6A 3O4XA 1JC2A 2KI6D 1GGZA 4PE0A 2F8PA 2JXLA 1KK7Y 2K0JA 1CMGA 1PSBA 3KEVA 1QASA 1XFWO 1NCYA 1CLMA 2WORA 1DGVA 2KGBC 3O6BA 1WLMA 4QJ5B 2K2FA 4JKTA 3KPXA 3DF0B 3UNWA 1CB1A 4MSPA 1NP8A 1RK9A 2MLFC 3R1VA 1Y6WA 1EH2A 1W9ZA 3FS7A 5EL2A 2BBMA 1NPQA 2R2IA 2L5YA 2KSPA 1XFXO 1N65A 4MRYA 2VRGA 5DICA 2F3ZA 2BCAA 3QRXA
chains in the Genus database with same CATH topology
1IG5A 3ZWHA 5JOLA 1SCMB 1RWYA 2LANA 1YRTB 3I5IB 1TTXA 2KGRA 1A29A 2LMUA 1CFCA 3CLNA 4PHJA 2JT8A 3CR5X 3VGOA 2ZNEA 1Q80A 1SKTA 3TUYC 2FCDA 4WQ2A 2CXJA 2BL0B 1IWQA 1TNXA 3K21A 1NIWA 2GGMA 5AXIA 4NQGA 1BF5A 1AJ4A 4U8DA 1UP5A 1B8LA 1DJZA 4ORAB 1OMDA 2PALA 2KAYA 3OX6A 1NCXA 1C7VA 1MR8A 2M97A 2PSRA 2E30A 4DS7A 1A75B 1V1FA 1XVJA 2DOQA 1BMOA 2TN4A 2ZRSA 1BOCA 1QTXA 1SBJA 2M8UA 3IF7A 2KDHA 1L2OC 1CTRA 1KFXL 1C7WA 2PVBA 2I94A 2LC5A 2LAPA 4GGFC 5HLVA 2JQ6A 2JNFA 3CZTX 3CR2A 1JWDA 1TRFA 1YUTA 1SCMC 3H4SE 1B9AA 3I5IC 1SL9A 1EG3A 2LE9B 3JVTC 2Y4QA 3EVVA 1F4OA 1OOJA 2I7AA 3PFVA 1AK8A 2CT9A 1SCVA 3NSIA 1KFXS 2KAVA 4MZKA 4ETOA 1F4QA 1CFFA 1IH0A 3SG6A 2AAOA 1S5GY 2RGIA 2JWWA 5HKZA 4C0LA 1AUIB 4I5JA 1M46A 3GOFA 2JNXA 1J7QA 1G33A 1ODBA 3FWBA 1PALA 3IQQA 3OHMB 1B47A 2KNEA 5CPVA 3GK2A 2ZFDA 1RROA 1W7IB 3CWGA 1CDLA 4GAOA 1CDPA 4XJKB 4OR9B 4OKHA 2JZIA 2M1UA 1NUBA 1YUUA 4FQOA 3WNXB 3CTNA 3BUOB 2ZN9A 2EGDA 1M63B 2BCBA 1F54A 2F2OA 2JRFA 3OP0A 4DIRA 4MZLA 1K93D 1NX2A 3RLZA 1J1EA 2JXCA 4IL1A 5D7FA 1NCZA 2OS8C 4PHMA 4YGBB 4MBEA 4GGFA 2M9GA 4ORCB 1SL8A 3CR4X 1UUSA 5KTYA 4AQIA 1JFJA 3JTDB 1IJ5A 5KU1A 5FYXA 1FBVA 1UHHA 3I5GC 5CSFA 2M29A 2KI6C 1CM1A 1CMFA 1AVSA 5GQQC 2FJUB 4DUQA 2WNDA 2F2PA 4MLWA 4PE1A 2GGZA 1PULA 1DVIA 1MQ1A 3BXKA 2KQ6A 2JULA 3OX5A 4I5NB 2JTZA 1XK4A 2MRDA 2O5GA 3EK7A 1KCYA 1WDCC 2WCEA 1DJIA 3DD4A 5PALA 4ZCVA 3M0WA 1NX3A 1K95A 4GNKB 4F0ZB 1A2XA 1ZFSA 2PMYA 3HX4A 1H4BA 4PDZA 1MWNA 2KBIA 4C0JA 2JPTA 2M0RA 1NWDA 3O2PA 3DVKA 3KF9A 3BOWB 3SG2A 3IQOA 1CNPA 1ZUZA 1S6JA 3BUXB 1SPYA 3JTDC 4NDDA 3SG4A 1BR4B 4YGDB 3AAKA 2OPOA 1QX2A 1CDMA 1UWOA 2L50A 4HSZA 4BY4A 1QIVA 2D8NA 2BE4A 5AANA 2L0PA 2CBLA 2JOJA 1FPWA 1TNQA 4AQJA 2HQ8A 1YVLA 2FOTA 2SASA 4XJKA 2COLB 1G8IA 4GFTA 1XA5A 2LLTA 1IGVA 5DKNA 1F71A 1DF0B 1NX0A 4C0KA 1ALVA 2KOTA 4CIDA 3SIAA 3VRQA 4D1EA 1MHOA 4CPVA 3EVRA 2M3WA 4L9MA 1KSOA 1UHJA 4PE4A 4USLA 3ZNIA 1WY9A 1S3PA 2BECA 3SG7A 1BR1B 1KQVA 1TIZA 3DVMA 1B7TZ 2LCPA 1IQ5A 1QVIY 2G9BA 4HRHA 2L51A 1QLKA 4YRUA 2NLNA 1F70A 3PLFB 3GK4X 1J1DA 1PRWA 1LXFC 4GGNA 1LVCD 3D0YB 3FWCA 4GUKA 1BODA 1GQMA 2NCOA 3NSKA 4I5LB 1J55A 2PRUA 2LUXA 1S1EA 3SG3A 2KAXA 1XYDA 5KSZA 3BUWB 1B1GA 2BL0C 5ER5A 1XFZO 3D10A 1K2HA 1M39A 1CFDA 4YBHB 1BLQA 3PALA 2LMTA 2L4IA 3I5FB 3MSEB 3HCMA 1J7PA 3AKAA 1OZSA 3A8RA 1AHRA 3O4YA 2BKIB 1MUXA 5G08A 3AKBA 2M7NA 1DJWA 1JF0A 1XFUO 2IS9A 1HQVA 1X02A 2MJWB 1DGUA 3A4UB 2MBXA 2Y5IA 1OE9B 4GBAA 1PVAA 3BQ3A 3BOWA 1CFPA 1DJYA 4ICBA 1QX5B 2KQYA 1OMRA 1DJXA 2F3YA 3DF0A 1K9PA 1Y1UA 1M31A 4I5KA 2I18A 1PK0D 3DVEA 4MEWA 3SJSA 3VROA 5DKQA 1VRKA 4M2QA 3KO0A 4CLNA 4NDBA 1OSAA 2QPTA 2LV7A 1JF2A 3C1VA 4Q04A 3SIBA 2OTGB 2GV5A 1RECA 3CGAA 1DTLA 2JT3A 2JTTA 2I2RE 3TZ1A 1QS7A 5K89A 3KHEA 1JFKA 1FF1A 3I5FC 2JU0A 2L5XB 1CKKA 2K7BA 5AFPA 1R6PA 2QACA 2F33A 2HQWA 1Y0VH 2Q4UA 1K96A 5F6TA 1ZOTB 1RJVA 3FIAA 1QXPA 1TNWA 2PASA 2KFGA 1K9UA 1YX7A 2WOSA 1L7ZA 1K94A 3EKJA 2LMVA 1OQPA 1IJ6A 1J7OA 5CSJA 1WRKA 1Y1XA 3BYAA 1MF8B 1QATA 2KYCA 5IBWA 1U5IB 1A75A 1LINA 2LHLA 3WHUB 2ZRTA 5HKWA 5J3XA 2A4JA 1SRAA 2WC8A 1NSHA 1WRZA 2OTGC 3CS1A 3F45A 4R1EA 1FI5A 2LVKA 1QJTA 1SR6B 1XO5A 4XYNA 3D0YA 1N0YA 3I5HB 2K7CA 1EG4A 1SK6D 1TNPA 1KK7Z 2MLEC 5HYDA 4NDCA 2Y1NA 4OVNF 1NX1A 2L2EA 3E3RA 1QLSA 3NXAA 3LK1A 3LCPC 2LP2A 2MHHA 2KI4B 1HT9A 2NXQA 3LLEA 2LLUA 5AEQA 4YI8A 1KWOB 4YI9A 2CCMA 4P2YB 3SG5A 4DRWA 4QJ5B 2Q91A 3TUYB 4BY5A 2SCPA 5I2QA 4M2OA 1ALWA 1D1OA 1EL4A 3LK0A 4PHNA 2K61A 2K7OA 1UHKA 3ICBA 1LA0A 1YX8A 2LM5A 3LL8B 1K90D 1K8UA 2MAZA 1S6CA 2ZKMX 2BKHB 1DMOA 1CDNA 1SR6C 1MXEA 1NYAA 1BG1A 1CLBA 2ZN8A 1TCFA 2CTNA 3OB2B 3I5HC 4PE7A 5HLOA 1PVBA 1XFYO 3BUMB 1JSAA 1QV0A 1QV1A 1L2OB 1KFUL 4JWQA 2B1UA 1SMGA 4A4BA 2L98A 1K9KA 4QJ3B 1GJYA 1ZMZA 4OV2A 4TNCA 1E8AA 1RFJA 2K8MB 4QJ4B 4MN0A 1SL7A 2KI4C 4YGEB 2H61C 5TNCA 3JVTB 1EJ3A 1KWOC 1EXRA 1YVHA 1B8RA 3TDZA 1KFUS 1PSRA 1OMVA 4WRIA 4PALA 1QVIZ 4WQ3A 1S6IA 2KYFA 2M49B 3GK1A 2KFFA 1XFVO 2EC6B 3AAJA 1LA3A 3PM8A 4JPZB 4MRXA 1KK8B 1M45A 1JBAA 2KFHA 1IQ3A 3TS5B 1FI6A 1YTZC 4HREE 4AOMA 4CFRA 4YGCB 1TN4A 1B7TY 5AERA 1CM4A 2V53A 4PCWA 1S26D 1KSMA 3EVUA 1SW8A 1ZACA 2BCXA 2ISDA 2BE6A 1DJGA 1RTP1 4FTGA 1Y1AA 1U5IA 1S5GZ 4CFQA 1AP4A 3OB1B 4A4CA 1YURA 2HETA 1A03A 1A4PA 1B8CA 5CSNA 4ORBB 5I2OA 1DT7B 1AJ5A 1V1GA 1IRJA 2AUCA 2EHBA 1WLZA 1YRUB 3TDIA 3VRNA 4M2PA 1YUSA 1SNLA 3EK4A 1YR5A 4N1FA 2CNPA 4N1GA 4UPGA 1UHIA 3EKHA 2LUCA 4N5XA 2OS8B 1KQMB 1SY9A 4MVFA 2EC6C 1BJFA 1DJHA 3VRRA 1W7JB 1KK8C 2HF5A 1C07A 3TS5C 5CSIA 4YGAA 4E68A 1XK4C 1MXLC 3PSRA 2H61A 2LVJA 3WHTB 2E6WA 3O78A 5ER4X 2ZNDA 1SYMA 2NZ0A 3I5GB 2WCFA 2BBNA 4ZCUA 2LVIA 2WCBA 3TDUA 2K7DA 2M7LA 1B4CA 1DF0A 1N2DA 1UHNA 5JJGA 2HPSA 1WDCB 1TOPA 1F8HA 1BU3A 1WRLA 2LHIA 1BT6A 5DKRA 2Y1MA 1LKJA 2O60A 3PN7B 4PHKA 2LLSA 1OZOA 2JT0A 3VRPA 3EK8A 1KQMC 2G2BA 2M1KB 1F55A 1R2UA 1CLLA 1S36A 2NCPA 3PATA 3NSOA 4JQ0D 2FCEA 2LP3A 5B8IB 2P6BB 2L4HA 4OCIA 1FW4A 1UURA 5I8NA 1H8BA 2KHNA 2MA2A 4DCKA 2AMIA 5BPJA 1G4YR 4GPLB 4MZJA 1QX7A 3WXAA 5I2LA 5D69A 1QIWA 2JC2A 4P5OE 1TCOB 1GGWA 2K2AA 3RM1A 1JUOA 2LNKA 1J7RA 2KBMA 4HRGA 3DVJA 3BUNB 3PN7C 2LVVA 1IKUA 2H2KA 3NSLA 5HKYA 1JC2A 2KI6D 1GGZA 4PE0A 2F8PA 2JXLA 1KK7Y 2K0JA 1CMGA 1PSBA 3KEVA 1QASA 1XFWO 1NCYA 1CLMA 2WORA 1DGVA 2KGBC 3O6BA 1WLMA 2K2FA 3KPXA 3DF0B 1CB1A 4MSPA 1NP8A 1RK9A 2MLFC 1EH2A 1Y6WA 3FS7A 2BBMA 1NPQA 2R2IA 2KSPA 1XFXO 1N65A 4MRYA 2VRGA 2F3ZA 2BCAA 3QRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IG5 A;  3ZWH A;  5JOL A;  1SCM B;  1RWY A;  2LAN A;  1YRT B;  3I5I B;  1TTX A;  2KGR A;  1A29 A;  2LMU A;  1CFC A;  3CLN A;  4PHJ A;  2JT8 A;  3CR5 X;  3VGO A;  2ZNE A;  1Q80 A;  1SKT A;  3TUY C;  2FCD A;  4WQ2 A;  2CXJ A;  2BL0 B;  1IWQ A;  1TNX A;  3K21 A;  1NIW A;  2GGM A;  5AXI A;  4NQG A;  1BF5 A;  1AJ4 A;  4U8D A;  1UP5 A;  1B8L A;  1DJZ A;  4ORA B;  1OMD A;  2PAL A;  2KAY A;  3OX6 A;  1NCX A;  1C7V A;  1MR8 A;  2M97 A;  2PSR A;  2E30 A;  4DS7 A;  1A75 B;  1V1F A;  1XVJ A;  2DOQ A;  1BMO A;  2TN4 A;  2ZRS A;  1BOC A;  1QTX A;  1SBJ A;  2M8U A;  3IF7 A;  2KDH A;  1L2O C;  1CTR A;  1KFX L;  1C7W A;  2PVB A;  2I94 A;  2LC5 A;  2LAP A;  4GGF C;  5HLV A;  2JQ6 A;  2JNF A;  3CZT X;  3CR2 A;  1JWD A;  1TRF A;  1YUT A;  1SCM C;  3H4S E;  1B9A A;  3I5I C;  1SL9 A;  1EG3 A;  2LE9 B;  3JVT C;  2Y4Q A;  3EVV A;  1F4O A;  1OOJ A;  2I7A A;  3PFV A;  1AK8 A;  2CT9 A;  1SCV A;  3NSI A;  1KFX S;  2KAV A;  4MZK A;  4ETO A;  1F4Q A;  1CFF A;  1IH0 A;  3SG6 A;  2AAO A;  1S5G Y;  2RGI A;  2JWW A;  5HKZ A;  4C0L A;  1AUI B;  4I5J A;  1M46 A;  3GOF A;  2JNX A;  1J7Q A;  1G33 A;  1ODB A;  3FWB A;  1PAL A;  3IQQ A;  3OHM B;  1B47 A;  2KNE A;  5CPV A;  3GK2 A;  2ZFD A;  1RRO A;  1W7I B;  3CWG A;  1CDL A;  4GAO A;  1CDP A;  4XJK B;  4OR9 B;  4OKH A;  2JZI A;  2M1U A;  1NUB A;  1YUU A;  4FQO A;  3WNX B;  3CTN A;  3BUO B;  2ZN9 A;  2EGD A;  1M63 B;  2BCB A;  1F54 A;  2F2O A;  2JRF A;  3OP0 A;  4DIR A;  4MZL A;  1K93 D;  1NX2 A;  3RLZ A;  1J1E A;  2JXC A;  4IL1 A;  5D7F A;  1NCZ A;  2OS8 C;  4PHM A;  4YGB B;  4MBE A;  4GGF A;  2M9G A;  4ORC B;  1SL8 A;  3CR4 X;  1UUS A;  5KTY A;  4AQI A;  1JFJ A;  3JTD B;  1IJ5 A;  5KU1 A;  5FYX A;  1FBV A;  1UHH A;  3I5G C;  5CSF A;  2M29 A;  2KI6 C;  1CM1 A;  1CMF A;  1AVS A;  5GQQ C;  2FJU B;  4DUQ A;  2WND A;  2F2P A;  4MLW A;  4PE1 A;  2GGZ A;  1PUL A;  1DVI A;  1MQ1 A;  3BXK A;  2KQ6 A;  2JUL A;  3OX5 A;  4I5N B;  2JTZ A;  1XK4 A;  2MRD A;  2O5G A;  3EK7 A;  1KCY A;  1WDC C;  2WCE A;  1DJI A;  3DD4 A;  5PAL A;  4ZCV A;  3M0W A;  1NX3 A;  1K95 A;  4GNK B;  4F0Z B;  1A2X A;  1ZFS A;  2PMY A;  3HX4 A;  1H4B A;  4PDZ A;  1MWN A;  2KBI A;  4C0J A;  2JPT A;  2M0R A;  1NWD A;  3O2P A;  3DVK A;  3KF9 A;  3BOW B;  3SG2 A;  3IQO A;  1CNP A;  1ZUZ A;  1S6J A;  3BUX B;  1SPY A;  3JTD C;  4NDD A;  3SG4 A;  1BR4 B;  4YGD B;  3AAK A;  2OPO A;  1QX2 A;  1CDM A;  1UWO A;  2L50 A;  4HSZ A;  4BY4 A;  1QIV A;  2D8N A;  2BE4 A;  5AAN A;  2L0P A;  2CBL A;  2JOJ A;  1FPW A;  1TNQ A;  4AQJ A;  2HQ8 A;  1YVL A;  2FOT A;  2SAS A;  4XJK A;  2COL B;  1G8I A;  4GFT A;  1XA5 A;  2LLT A;  1IGV A;  5DKN A;  1F71 A;  1DF0 B;  1NX0 A;  4C0K A;  1ALV A;  2KOT A;  4CID A;  3SIA A;  3VRQ A;  4D1E A;  1MHO A;  4CPV A;  3EVR A;  2M3W A;  4L9M A;  1KSO A;  1UHJ A;  4PE4 A;  4USL A;  3ZNI A;  1WY9 A;  1S3P A;  2BEC A;  3SG7 A;  1BR1 B;  1KQV A;  1TIZ A;  3DVM A;  1B7T Z;  2LCP A;  1IQ5 A;  1QVI Y;  2G9B A;  4HRH A;  2L51 A;  1QLK A;  4YRU A;  2NLN A;  1F70 A;  3PLF B;  3GK4 X;  1J1D A;  1PRW A;  1LXF C;  4GGN A;  1LVC D;  3D0Y B;  3FWC A;  4GUK A;  1BOD A;  1GQM A;  2NCO A;  3NSK A;  4I5L B;  1J55 A;  2PRU A;  2LUX A;  1S1E A;  3SG3 A;  2KAX A;  1XYD A;  5KSZ A;  3BUW B;  1B1G A;  2BL0 C;  5ER5 A;  1XFZ O;  3D10 A;  1K2H A;  1M39 A;  1CFD A;  4YBH B;  1BLQ A;  3PAL A;  2LMT A;  2L4I A;  3I5F B;  3MSE B;  3HCM A;  1J7P A;  3AKA A;  1OZS A;  3A8R A;  1AHR A;  3O4Y A;  2BKI B;  1MUX A;  5G08 A;  3AKB A;  2M7N A;  1DJW A;  1JF0 A;  1XFU O;  2IS9 A;  1HQV A;  1X02 A;  2MJW B;  1DGU A;  3A4U B;  2MBX A;  2Y5I A;  1OE9 B;  4GBA A;  1PVA A;  3BQ3 A;  3BOW A;  1CFP A;  1DJY A;  4ICB A;  1QX5 B;  2KQY A;  1OMR A;  1DJX A;  2F3Y A;  3DF0 A;  1K9P A;  1Y1U A;  1M31 A;  4I5K A;  2I18 A;  1PK0 D;  3DVE A;  4MEW A;  3SJS A;  3VRO A;  5DKQ A;  1VRK A;  4M2Q A;  3KO0 A;  4CLN A;  4NDB A;  1OSA A;  2QPT A;  2LV7 A;  1JF2 A;  3C1V A;  4Q04 A;  3SIB A;  2OTG B;  2GV5 A;  1REC A;  3CGA A;  1DTL A;  2JT3 A;  2JTT A;  2I2R E;  3TZ1 A;  1QS7 A;  5K89 A;  3KHE A;  1JFK A;  1FF1 A;  3I5F C;  2JU0 A;  2L5X B;  1CKK A;  2K7B A;  5AFP A;  1R6P A;  2QAC A;  2F33 A;  2HQW A;  1Y0V H;  2Q4U A;  1K96 A;  5F6T A;  1ZOT B;  1RJV A;  3FIA A;  1QXP A;  1TNW A;  2PAS A;  2KFG A;  1K9U A;  1YX7 A;  2WOS A;  1L7Z A;  1K94 A;  3EKJ A;  2LMV A;  1OQP A;  1IJ6 A;  1J7O A;  5CSJ A;  1WRK A;  1Y1X A;  3BYA A;  1MF8 B;  1QAT A;  2KYC A;  5IBW A;  1U5I B;  1A75 A;  1LIN A;  2LHL A;  3WHU B;  2ZRT A;  5HKW A;  5J3X A;  2A4J A;  1SRA A;  2WC8 A;  1NSH A;  1WRZ A;  2OTG C;  3CS1 A;  3F45 A;  4R1E A;  1FI5 A;  2LVK A;  1QJT A;  1SR6 B;  1XO5 A;  4XYN A;  3D0Y A;  1N0Y A;  3I5H B;  2K7C A;  1EG4 A;  1SK6 D;  1TNP A;  1KK7 Z;  2MLE C;  5HYD A;  4NDC A;  2Y1N A;  4OVN F;  1NX1 A;  2L2E A;  3E3R A;  1QLS A;  3NXA A;  3LK1 A;  3LCP C;  2LP2 A;  2MHH A;  2KI4 B;  1HT9 A;  2NXQ A;  3LLE A;  2LLU A;  5AEQ A;  4YI8 A;  1KWO B;  4YI9 A;  2CCM A;  4P2Y B;  3SG5 A;  4DRW A;  4QJ5 B;  2Q91 A;  3TUY B;  4BY5 A;  2SCP A;  5I2Q A;  4M2O A;  1ALW A;  1D1O A;  1EL4 A;  3LK0 A;  4PHN A;  2K61 A;  2K7O A;  1UHK A;  3ICB A;  1LA0 A;  1YX8 A;  2LM5 A;  3LL8 B;  1K90 D;  1K8U A;  2MAZ A;  1S6C A;  2ZKM X;  2BKH B;  1DMO A;  1CDN A;  1SR6 C;  1MXE A;  1NYA A;  1BG1 A;  1CLB A;  2ZN8 A;  1TCF A;  2CTN A;  3OB2 B;  3I5H C;  4PE7 A;  5HLO A;  1PVB A;  1XFY O;  3BUM B;  1JSA A;  1QV0 A;  1QV1 A;  1L2O B;  1KFU L;  4JWQ A;  2B1U A;  1SMG A;  4A4B A;  2L98 A;  1K9K A;  4QJ3 B;  1GJY A;  1ZMZ A;  4OV2 A;  4TNC A;  1E8A A;  1RFJ A;  2K8M B;  4QJ4 B;  4MN0 A;  1SL7 A;  2KI4 C;  4YGE B;  2H61 C;  5TNC A;  3JVT B;  1EJ3 A;  1KWO C;  1EXR A;  1YVH A;  1B8R A;  3TDZ A;  1KFU S;  1PSR A;  1OMV A;  4WRI A;  4PAL A;  1QVI Z;  4WQ3 A;  1S6I A;  2KYF A;  2M49 B;  3GK1 A;  2KFF A;  1XFV O;  2EC6 B;  3AAJ A;  1LA3 A;  3PM8 A;  4JPZ B;  4MRX A;  1KK8 B;  1M45 A;  1JBA A;  2KFH A;  1IQ3 A;  3TS5 B;  1FI6 A;  1YTZ C;  4HRE E;  4AOM A;  4CFR A;  4YGC B;  1TN4 A;  1B7T Y;  5AER A;  1CM4 A;  2V53 A;  4PCW A;  1S26 D;  1KSM A;  3EVU A;  1SW8 A;  1ZAC A;  2BCX A;  2ISD A;  2BE6 A;  1DJG A;  1RTP 1;  4FTG A;  1Y1A A;  1U5I A;  1S5G Z;  4CFQ A;  1AP4 A;  3OB1 B;  4A4C A;  1YUR A;  2HET A;  1A03 A;  1A4P A;  1B8C A;  5CSN A;  4ORB B;  5I2O A;  1DT7 B;  1AJ5 A;  1V1G A;  1IRJ A;  2AUC A;  2EHB A;  1WLZ A;  1YRU B;  3TDI A;  3VRN A;  4M2P A;  1YUS A;  1SNL A;  3EK4 A;  1YR5 A;  4N1F A;  2CNP A;  4N1G A;  4UPG A;  1UHI A;  3EKH A;  2LUC A;  4N5X A;  2OS8 B;  1KQM B;  1SY9 A;  4MVF A;  2EC6 C;  1BJF A;  1DJH A;  3VRR A;  1W7J B;  1KK8 C;  2HF5 A;  1C07 A;  3TS5 C;  5CSI A;  4YGA A;  4E68 A;  1XK4 C;  1MXL C;  3PSR A;  2H61 A;  2LVJ A;  3WHT B;  2E6W A;  3O78 A;  5ER4 X;  2ZND A;  1SYM A;  2NZ0 A;  3I5G B;  2WCF A;  2BBN A;  4ZCU A;  2LVI A;  2WCB A;  3TDU A;  2K7D A;  2M7L A;  1B4C A;  1DF0 A;  1N2D A;  1UHN A;  5JJG A;  2HPS A;  1WDC B;  1TOP A;  1F8H A;  1BU3 A;  1WRL A;  2LHI A;  1BT6 A;  5DKR A;  2Y1M A;  1LKJ A;  2O60 A;  3PN7 B;  4PHK A;  2LLS A;  1OZO A;  2JT0 A;  3VRP A;  3EK8 A;  1KQM C;  2G2B A;  2M1K B;  1F55 A;  1R2U A;  1CLL A;  1S36 A;  2NCP A;  3PAT A;  3NSO A;  4JQ0 D;  2FCE A;  2LP3 A;  5B8I B;  2P6B B;  2L4H A;  4OCI A;  1FW4 A;  1UUR A;  5I8N A;  1H8B A;  2KHN A;  2MA2 A;  4DCK A;  2AMI A;  5BPJ A;  1G4Y R;  4GPL B;  4MZJ A;  1QX7 A;  3WXA A;  5I2L A;  5D69 A;  1QIW A;  2JC2 A;  4P5O E;  1TCO B;  1GGW A;  2K2A A;  3RM1 A;  1JUO A;  2LNK A;  1J7R A;  2KBM A;  4HRG A;  3DVJ A;  3BUN B;  3PN7 C;  2LVV A;  1IKU A;  2H2K A;  3NSL A;  5HKY A;  1JC2 A;  2KI6 D;  1GGZ A;  4PE0 A;  2F8P A;  2JXL A;  1KK7 Y;  2K0J A;  1CMG A;  1PSB A;  3KEV A;  1QAS A;  1XFW O;  1NCY A;  1CLM A;  2WOR A;  1DGV A;  2KGB C;  3O6B A;  1WLM A;  2K2F A;  3KPX A;  3DF0 B;  1CB1 A;  4MSP A;  1NP8 A;  1RK9 A;  2MLF C;  1EH2 A;  1Y6W A;  3FS7 A;  2BBM A;  1NPQ A;  2R2I A;  2KSP A;  1XFX O;  1N65 A;  4MRY A;  2VRG A;  2F3Z A;  2BCA A;  3QRX A; 
#chains in the Genus database with same CATH topology
 1IG5 A;  3ZWH A;  2P70 A;  5JOL A;  1SCM B;  1RWY A;  2LAN A;  1YRT B;  2PQL A;  3I5I B;  1TTX A;  2KGR A;  1A29 A;  2LMU A;  1CFC A;  3CLN A;  4PHJ A;  2JT8 A;  3CR5 X;  3VGO A;  2ZNE A;  4KYN A;  1Q80 A;  1SKT A;  3TUY C;  5FI6 A;  2FCD A;  4WQ2 A;  2CXJ A;  3V2L A;  3N7H A;  2BL0 B;  1IWQ A;  1TNX A;  3K21 A;  1NIW A;  2GGM A;  3S0E A;  5AXI A;  3B88 A;  4NQG A;  1BF5 A;  1AJ4 A;  4U8D A;  1UP5 A;  1B8L A;  1DJZ A;  4ORA B;  1OMD A;  2PAL A;  2KAY A;  3OX6 A;  1NCX A;  3OGN A;  2PYQ A;  1C7V A;  1MR8 A;  2M97 A;  3UO9 A;  2PSR A;  2E30 A;  4DS7 A;  1A75 B;  1V1F A;  1XVJ A;  2DOQ A;  1BMO A;  2TN4 A;  2ZRS A;  3RZS A;  1BOC A;  1QTX A;  1SBJ A;  2M8U A;  3IF7 A;  2KDH A;  1L2O C;  1CTR A;  1KFX L;  1C7W A;  2PVB A;  2WCJ A;  2I94 A;  2LC5 A;  2LAP A;  4GGF C;  5HLV A;  2JQ6 A;  2JNF A;  3CZT X;  3CR2 A;  1JWD A;  1TRF A;  1YUT A;  1SCM C;  2H8V A;  2QDI A;  1B9A A;  3H4S E;  3I5I C;  1SL9 A;  1EG3 A;  2LE9 B;  3JVT C;  2Y4Q A;  1QWV A;  1F4O A;  1OOJ A;  2I7A A;  3EVV A;  3PFV A;  1AK8 A;  2CT9 A;  1C3Y A;  1SCV A;  3NSI A;  1KFX S;  2KAV A;  4MZK A;  4ETO A;  1F4Q A;  3FE8 A;  1CFF A;  3SG6 A;  2AAO A;  1IH0 A;  1S5G Y;  2RGI A;  2JWW A;  5HKZ A;  4C0L A;  1AUI B;  3D76 A;  4I5J A;  3SS5 A;  1M46 A;  3GOF A;  2JNX A;  1J7Q A;  1G33 A;  1ODB A;  3FWB A;  1PAL A;  3IQQ A;  3OHM B;  1B47 A;  2KNE A;  5CPV A;  3GK2 A;  2ZFD A;  1RRO A;  1W7I B;  2WC6 A;  3CWG A;  3D73 A;  1CDL A;  4GAO A;  1CDP A;  1OOH A;  4XJK B;  3S0D A;  1GM0 A;  4OR9 B;  4OKH A;  2JZI A;  2M1U A;  1NUB A;  1YUU A;  4FQO A;  3WNX B;  2GTE A;  3CTN A;  3BUO B;  2QEV A;  2ZN9 A;  2EGD A;  1M63 B;  2BCB A;  1F54 A;  2F2O A;  2JRF A;  3OP0 A;  4DIR A;  3CZ1 A;  4MZL A;  1K93 D;  1NX2 A;  3RLZ A;  1J1E A;  2JXC A;  4IL1 A;  5D7F A;  1NCZ A;  2OS8 C;  4PHM A;  4YGB B;  4MBE A;  4GGF A;  2M9G A;  4ORC B;  3D75 A;  1SL8 A;  3CR4 X;  3CZ0 A;  1UUS A;  5KTY A;  4AQI A;  1JFJ A;  3JTD B;  1IJ5 A;  5KU1 A;  3BFH A;  5FYX A;  1FBV A;  5FI2 A;  1UHH A;  3I5G C;  5CSF A;  2M29 A;  2KI6 C;  1CM1 A;  1CMF A;  1AVS A;  5GQQ C;  3SS4 A;  2FJU B;  4DUQ A;  2WND A;  2F2P A;  4MLW A;  4PE1 A;  2GGZ A;  1PUL A;  1DVI A;  1MQ1 A;  3BXK A;  2KQ6 A;  2JUL A;  3OX5 A;  4I5N B;  2JTZ A;  1XK4 A;  2MRD A;  2O5G A;  3EK7 A;  1KCY A;  1WDC C;  2WCE A;  1DJI A;  3DD4 A;  5PAL A;  4ZCV A;  3M0W A;  1NX3 A;  1K95 A;  4GNK B;  4F0Z B;  1A2X A;  1ZFS A;  2PMY A;  3HX4 A;  1H4B A;  4PDZ A;  1MWN A;  2KBI A;  3BFA A;  4C0J A;  2JPT A;  2M0R A;  1NWD A;  3O2P A;  3DVK A;  2QEB A;  3KF9 A;  3BOW B;  3SG2 A;  3IQO A;  1CNP A;  1ZUZ A;  1S6J A;  3BUX B;  1SPY A;  3JTD C;  4NDD A;  3SG4 A;  1BR4 B;  4YGD B;  3AAK A;  2OPO A;  1QX2 A;  1CDM A;  1UWO A;  2L50 A;  4HSZ A;  4BY4 A;  2FJY A;  1QIV A;  2D8N A;  2BE4 A;  4JD9 A;  2L0P A;  5AAN A;  2CBL A;  2JOJ A;  4OZD A;  1JBA A;  2WCM A;  1FPW A;  1TNQ A;  4AQJ A;  2HQ8 A;  1YVL A;  2FOT A;  2SAS A;  4XJK A;  2COL B;  1G8I A;  1OOF A;  4GFT A;  1XA5 A;  2LLT A;  1IGV A;  5DKN A;  1F71 A;  1DF0 B;  1NX0 A;  4C0K A;  1ALV A;  3OBV A;  2KOT A;  1T14 A;  2L2C A;  4CID A;  3SIA A;  3B7A A;  3VRQ A;  1MHO A;  4D1E A;  4CPV A;  3EVR A;  2M3W A;  4L9M A;  1KSO A;  1UHJ A;  4PE4 A;  4USL A;  3ZNI A;  1WY9 A;  1S3P A;  2BEC A;  3SG7 A;  1BR1 B;  1KQV A;  1TIZ A;  2WC5 A;  3DVM A;  3NHT A;  1B7T Z;  2LCP A;  1IQ5 A;  1QVI Y;  2G9B A;  4HRH A;  2L51 A;  1DEL A;  1QLK A;  4YRU A;  2NLN A;  1F70 A;  3PLF B;  3GK4 X;  1J1D A;  1PRW A;  1LXF C;  4GGN A;  3VB1 A;  1LVC D;  3D0Y B;  3B86 A;  3FWC A;  4GUK A;  1BOD A;  5I94 A;  1GQM A;  2NCO A;  3NSK A;  4I5L B;  1J55 A;  2PRU A;  2LUX A;  1S1E A;  3SG3 A;  2KAX A;  1XYD A;  2KPH A;  5KSZ A;  3BUW B;  1B1G A;  3S0A A;  2BL0 C;  5ER5 A;  1XFZ O;  3D10 A;  1K2H A;  1M39 A;  1CFD A;  4YBH B;  1BLQ A;  3PAL A;  2LMT A;  2L4I A;  3I5F B;  3MSE B;  3HCM A;  3CAB A;  1J7P A;  3AKA A;  1OZS A;  3A8R A;  1AHR A;  3O4Y A;  2BKI B;  1MUX A;  3NGV A;  5G08 A;  3AKB A;  2M7N A;  1DJW A;  1JF0 A;  1XFU O;  2IS9 A;  1HQV A;  1X02 A;  2MJW B;  1DGU A;  2K60 A;  3A4U B;  2Y5I A;  1OE9 B;  2MBX A;  4GBA A;  1PVA A;  3BQ3 A;  3BOW A;  1CFP A;  1DJY A;  3K1E A;  4ICB A;  1QX5 B;  2KQY A;  1OMR A;  1DJX A;  2F3Y A;  3DF0 A;  1K9P A;  2P71 A;  1Y1U A;  1M31 A;  4I5K A;  2I18 A;  1PK0 D;  3DVE A;  3DXL A;  4MEW A;  3SJS A;  3VRO A;  5DKQ A;  1VRK A;  4M2Q A;  3KO0 A;  4CLN A;  4NDB A;  1OSA A;  3B87 A;  2QPT A;  2LV7 A;  1JF2 A;  3C1V A;  4Q04 A;  3SIB A;  2OTG B;  2GV5 A;  1REC A;  3CGA A;  1DTL A;  2JT3 A;  2JTT A;  2I2R E;  3TZ1 A;  1QS7 A;  5K89 A;  3KHE A;  1JFK A;  1FF1 A;  3I5F C;  2JU0 A;  2L5X B;  1CKK A;  2K7B A;  5AFP A;  1R6P A;  2QAC A;  2F33 A;  2HQW A;  1DC1 A;  1Y0V H;  2Q4U A;  1K96 A;  5F6T A;  2BNX A;  1ZOT B;  1RJV A;  3FIA A;  1QXP A;  1TNW A;  1TUZ A;  2PAS A;  2KFG A;  1K9U A;  1YX7 A;  2WOS A;  1L7Z A;  2YGU A;  1K94 A;  3EKJ A;  3PM2 A;  2LMV A;  1OQP A;  1IJ6 A;  1C3Z A;  1J7O A;  5CSJ A;  1WRK A;  1Y1X A;  3BYA A;  1MF8 B;  1QAT A;  2KYC A;  5IBW A;  2ERB A;  1U5I B;  1A75 A;  1LIN A;  2LHL A;  3WHU B;  3L47 A;  2ZRT A;  5HKW A;  5J3X A;  2A4J A;  1SRA A;  2WC8 A;  1NSH A;  1WRZ A;  2OTG C;  3CS1 A;  3F45 A;  4R1E A;  1FI5 A;  2LVK A;  1QJT A;  3BJH A;  1SR6 B;  1XO5 A;  5FI7 A;  1IIO A;  4XYN A;  3D0Y A;  1N0Y A;  3I5H B;  2K7C A;  1EG4 A;  1SK6 D;  1TNP A;  1KK7 Z;  2MLE C;  5HYD A;  4NDC A;  2Y1N A;  4OVN F;  1NX1 A;  2L2E A;  3E3R A;  1QLS A;  3NXA A;  3LK1 A;  3L4L A;  3LCP C;  2LP2 A;  2MHH A;  2KI4 B;  1HT9 A;  2NXQ A;  1OOI X;  2LLU A;  1Z4H A;  3LLE A;  4YI8 A;  5AEQ A;  1KWO B;  4YI9 A;  2CCM A;  3Q8I A;  2QEO A;  4P2Y B;  1P28 A;  3SG5 A;  2Q91 A;  3TUY B;  4BY5 A;  4DRW A;  2SCP A;  5I2Q A;  4M2O A;  1ALW A;  1D1O A;  1EL4 A;  3LK0 A;  4PHN A;  2K61 A;  2K7O A;  2BAP A;  1OW4 A;  1UHK A;  3ICB A;  1LA0 A;  1YX8 A;  2LM5 A;  3LL8 B;  1K90 D;  1K8U A;  1TWO A;  2MAZ A;  1S6C A;  2ZKM X;  2BKH B;  1DMO A;  1CDN A;  1SR6 C;  1MXE A;  1DQE A;  1NYA A;  1BG1 A;  1CLB A;  2ZN8 A;  1TCF A;  2CTN A;  3OB2 B;  3I5H C;  4PE7 A;  4F7F A;  5HLO A;  1PVB A;  1XFY O;  3BUM B;  3NHI A;  1JSA A;  1ORG A;  1QV0 A;  1QV1 A;  1L2O B;  4INX A;  1KFU L;  4JWQ A;  2B1U A;  1SMG A;  4A4B A;  2L98 A;  4FQT A;  1K9K A;  4QJ3 B;  1GJY A;  4IJ7 A;  1ZMZ A;  4OV2 A;  4TNC A;  1E8A A;  1RFJ A;  2K8M B;  4QJ4 B;  4MN0 A;  3S0B A;  1SL7 A;  2KI4 C;  4YGE B;  2H61 C;  5TNC A;  3JVT B;  2WCK A;  1EJ3 A;  1KWO C;  1EXR A;  1YVH A;  1B8R A;  3TDZ A;  1KFU S;  1OOG A;  1OMV A;  1PSR A;  4WRI A;  4PAL A;  1QVI Z;  4WQ3 A;  1S6I A;  2KYF A;  2M49 B;  3GK1 A;  2KFF A;  1XFV O;  3IVT A;  2EC6 B;  2KLD A;  3AAJ A;  1LA3 A;  3PM8 A;  4JPZ B;  4MRX A;  1KK8 B;  1M45 A;  1DEK A;  2KFH A;  3B6X A;  3QME A;  3TS5 B;  1YTZ C;  4HRE E;  4AOM A;  4CFR A;  1IQ3 A;  4YGC B;  1FI6 A;  1TN4 A;  1B7T Y;  5AER A;  1CM4 A;  2V53 A;  4PCW A;  3DZT A;  1LS8 A;  2KLE A;  1S26 D;  1KSM A;  3EVU A;  3R1P A;  1SW8 A;  1ZAC A;  2BCX A;  4INW A;  3FE9 A;  2BE6 A;  2ISD A;  3SS3 A;  1DJG A;  1RTP 1;  4FTG A;  1Y1A A;  1U5I A;  1S5G Z;  4CFQ A;  1AP4 A;  3OB1 B;  4A4C A;  1YUR A;  2HET A;  1A03 A;  1A4P A;  1B8C A;  5CSN A;  2QEH A;  4ORB B;  5I2O A;  1AJ5 A;  1DT7 B;  1V1G A;  1IRJ A;  3EG5 B;  2AUC A;  2EHB A;  1WLZ A;  1YRU B;  3TDI A;  3VRN A;  4M2P A;  1YUS A;  1SNL A;  3EK4 A;  1YR5 A;  4N1F A;  2CNP A;  4N1G A;  4UPG A;  1UHI A;  3EKH A;  2LUC A;  4N5X A;  2OS8 B;  1KQM B;  1SY9 A;  4MVF A;  2EC6 C;  1BJF A;  1DJH A;  3VRR A;  1W7J B;  1KK8 C;  2HF5 A;  1C07 A;  3TS5 C;  5CSI A;  4YGA A;  4E68 A;  1XK4 C;  1MXL C;  3PSR A;  2H61 A;  2LVJ A;  3WHT B;  3R72 A;  3D77 A;  2E6W A;  3O78 A;  5ER4 X;  2ZND A;  1SYM A;  2NZ0 A;  3I5G B;  2WCF A;  2BBN A;  4ZCU A;  2LVI A;  2WCB A;  3TDU A;  1XFR A;  2K7D A;  2M7L A;  2WCH A;  1B4C A;  1DF0 A;  2JPO A;  3BFB A;  1N2D A;  2WCL A;  1TUJ A;  1UHN A;  5JJG A;  2HPS A;  3CDN A;  5D3O A;  1WDC B;  1TOP A;  3PJI A;  1F8H A;  1BU3 A;  1WRL A;  2LHI A;  1BT6 A;  5DKR A;  2Y1M A;  1LKJ A;  2O60 A;  3PN7 B;  3CZ2 A;  3DYE A;  4PHK A;  2LLS A;  5HL1 A;  1OZO A;  2JT0 A;  3VRP A;  3EK8 A;  1KQM C;  2G2B A;  2M1K B;  1F55 A;  1R2U A;  1CLL A;  1S36 A;  2NCP A;  3PAT A;  3NSO A;  4JQ0 D;  2FCE A;  2LP3 A;  5B8I B;  2P6B B;  2L4H A;  4OCI A;  1FW4 A;  1Z2C B;  3D74 A;  1UUR A;  5I8N A;  1H8B A;  2KHN A;  2MA2 A;  3S0F A;  4DCK A;  2AMI A;  5BPJ A;  1G4Y R;  4GPL B;  4MZJ A;  1QX7 A;  3WXA A;  5I2L A;  3S0G A;  1SSE B;  5D69 A;  1QIW A;  2JC2 A;  4P5O E;  1TCO B;  3L4A A;  3CYZ A;  1GGW A;  2K2A A;  3RM1 A;  1JUO A;  2LNK A;  3DY9 A;  1J7R A;  2KBM A;  4HRG A;  3DVJ A;  3BUN B;  3PN7 C;  2LVV A;  1IKU A;  2H2K A;  3NSL A;  3D78 A;  5HKY A;  3R1O A;  4PT1 A;  3FE6 A;  3O4X A;  1JC2 A;  2KI6 D;  1GGZ A;  4PE0 A;  2F8P A;  2JXL A;  1KK7 Y;  2K0J A;  1CMG A;  1PSB A;  3KEV A;  1QAS A;  1XFW O;  1NCY A;  1CLM A;  2WOR A;  1DGV A;  2KGB C;  3O6B A;  1WLM A;  4QJ5 B;  2K2F A;  4JKT A;  3KPX A;  3DF0 B;  3UNW A;  1CB1 A;  4MSP A;  1NP8 A;  1RK9 A;  2MLF C;  3R1V A;  1Y6W A;  1EH2 A;  1W9Z A;  3FS7 A;  5EL2 A;  2BBM A;  1NPQ A;  2R2I A;  2L5Y A;  2KSP A;  1XFX O;  1N65 A;  4MRY A;  2VRG A;  5DIC A;  2F3Z A;  2BCA A;  3QRX A; 
#chains in the Genus database with same CATH homology
 1IG5 A;  3ZWH A;  5JOL A;  1SCM B;  1RWY A;  2LAN A;  1YRT B;  3I5I B;  1TTX A;  2KGR A;  1A29 A;  2LMU A;  1CFC A;  3CLN A;  4PHJ A;  2JT8 A;  3CR5 X;  3VGO A;  2ZNE A;  1Q80 A;  1SKT A;  3TUY C;  2FCD A;  4WQ2 A;  2CXJ A;  2BL0 B;  1IWQ A;  1TNX A;  3K21 A;  1NIW A;  2GGM A;  5AXI A;  4NQG A;  1BF5 A;  1AJ4 A;  4U8D A;  1UP5 A;  1B8L A;  1DJZ A;  4ORA B;  1OMD A;  2PAL A;  2KAY A;  3OX6 A;  1NCX A;  1C7V A;  1MR8 A;  2M97 A;  2PSR A;  2E30 A;  4DS7 A;  1A75 B;  1V1F A;  1XVJ A;  2DOQ A;  1BMO A;  2TN4 A;  2ZRS A;  1BOC A;  1QTX A;  1SBJ A;  2M8U A;  3IF7 A;  2KDH A;  1L2O C;  1CTR A;  1KFX L;  1C7W A;  2PVB A;  2I94 A;  2LC5 A;  2LAP A;  4GGF C;  5HLV A;  2JQ6 A;  2JNF A;  3CZT X;  3CR2 A;  1JWD A;  1TRF A;  1YUT A;  1SCM C;  3H4S E;  1B9A A;  3I5I C;  1SL9 A;  1EG3 A;  2LE9 B;  3JVT C;  2Y4Q A;  3EVV A;  1F4O A;  1OOJ A;  2I7A A;  3PFV A;  1AK8 A;  2CT9 A;  1SCV A;  3NSI A;  1KFX S;  2KAV A;  4MZK A;  4ETO A;  1F4Q A;  1CFF A;  1IH0 A;  3SG6 A;  2AAO A;  1S5G Y;  2RGI A;  2JWW A;  5HKZ A;  4C0L A;  1AUI B;  4I5J A;  1M46 A;  3GOF A;  2JNX A;  1J7Q A;  1G33 A;  1ODB A;  3FWB A;  1PAL A;  3IQQ A;  3OHM B;  1B47 A;  2KNE A;  5CPV A;  3GK2 A;  2ZFD A;  1RRO A;  1W7I B;  3CWG A;  1CDL A;  4GAO A;  1CDP A;  4XJK B;  4OR9 B;  4OKH A;  2JZI A;  2M1U A;  1NUB A;  1YUU A;  4FQO A;  3WNX B;  3CTN A;  3BUO B;  2ZN9 A;  2EGD A;  1M63 B;  2BCB A;  1F54 A;  2F2O A;  2JRF A;  3OP0 A;  4DIR A;  4MZL A;  1K93 D;  1NX2 A;  3RLZ A;  1J1E A;  2JXC A;  4IL1 A;  5D7F A;  1NCZ A;  2OS8 C;  4PHM A;  4YGB B;  4MBE A;  4GGF A;  2M9G A;  4ORC B;  1SL8 A;  3CR4 X;  1UUS A;  5KTY A;  4AQI A;  1JFJ A;  3JTD B;  1IJ5 A;  5KU1 A;  5FYX A;  1FBV A;  1UHH A;  3I5G C;  5CSF A;  2M29 A;  2KI6 C;  1CM1 A;  1CMF A;  1AVS A;  5GQQ C;  2FJU B;  4DUQ A;  2WND A;  2F2P A;  4MLW A;  4PE1 A;  2GGZ A;  1PUL A;  1DVI A;  1MQ1 A;  3BXK A;  2KQ6 A;  2JUL A;  3OX5 A;  4I5N B;  2JTZ A;  1XK4 A;  2MRD A;  2O5G A;  3EK7 A;  1KCY A;  1WDC C;  2WCE A;  1DJI A;  3DD4 A;  5PAL A;  4ZCV A;  3M0W A;  1NX3 A;  1K95 A;  4GNK B;  4F0Z B;  1A2X A;  1ZFS A;  2PMY A;  3HX4 A;  1H4B A;  4PDZ A;  1MWN A;  2KBI A;  4C0J A;  2JPT A;  2M0R A;  1NWD A;  3O2P A;  3DVK A;  3KF9 A;  3BOW B;  3SG2 A;  3IQO A;  1CNP A;  1ZUZ A;  1S6J A;  3BUX B;  1SPY A;  3JTD C;  4NDD A;  3SG4 A;  1BR4 B;  4YGD B;  3AAK A;  2OPO A;  1QX2 A;  1CDM A;  1UWO A;  2L50 A;  4HSZ A;  4BY4 A;  1QIV A;  2D8N A;  2BE4 A;  5AAN A;  2L0P A;  2CBL A;  2JOJ A;  1FPW A;  1TNQ A;  4AQJ A;  2HQ8 A;  1YVL A;  2FOT A;  2SAS A;  4XJK A;  2COL B;  1G8I A;  4GFT A;  1XA5 A;  2LLT A;  1IGV A;  5DKN A;  1F71 A;  1DF0 B;  1NX0 A;  4C0K A;  1ALV A;  2KOT A;  4CID A;  3SIA A;  3VRQ A;  4D1E A;  1MHO A;  4CPV A;  3EVR A;  2M3W A;  4L9M A;  1KSO A;  1UHJ A;  4PE4 A;  4USL A;  3ZNI A;  1WY9 A;  1S3P A;  2BEC A;  3SG7 A;  1BR1 B;  1KQV A;  1TIZ A;  3DVM A;  1B7T Z;  2LCP A;  1IQ5 A;  1QVI Y;  2G9B A;  4HRH A;  2L51 A;  1QLK A;  4YRU A;  2NLN A;  1F70 A;  3PLF B;  3GK4 X;  1J1D A;  1PRW A;  1LXF C;  4GGN A;  1LVC D;  3D0Y B;  3FWC A;  4GUK A;  1BOD A;  1GQM A;  2NCO A;  3NSK A;  4I5L B;  1J55 A;  2PRU A;  2LUX A;  1S1E A;  3SG3 A;  2KAX A;  1XYD A;  5KSZ A;  3BUW B;  1B1G A;  2BL0 C;  5ER5 A;  1XFZ O;  3D10 A;  1K2H A;  1M39 A;  1CFD A;  4YBH B;  1BLQ A;  3PAL A;  2LMT A;  2L4I A;  3I5F B;  3MSE B;  3HCM A;  1J7P A;  3AKA A;  1OZS A;  3A8R A;  1AHR A;  3O4Y A;  2BKI B;  1MUX A;  5G08 A;  3AKB A;  2M7N A;  1DJW A;  1JF0 A;  1XFU O;  2IS9 A;  1HQV A;  1X02 A;  2MJW B;  1DGU A;  3A4U B;  2MBX A;  2Y5I A;  1OE9 B;  4GBA A;  1PVA A;  3BQ3 A;  3BOW A;  1CFP A;  1DJY A;  4ICB A;  1QX5 B;  2KQY A;  1OMR A;  1DJX A;  2F3Y A;  3DF0 A;  1K9P A;  1Y1U A;  1M31 A;  4I5K A;  2I18 A;  1PK0 D;  3DVE A;  4MEW A;  3SJS A;  3VRO A;  5DKQ A;  1VRK A;  4M2Q A;  3KO0 A;  4CLN A;  4NDB A;  1OSA A;  2QPT A;  2LV7 A;  1JF2 A;  3C1V A;  4Q04 A;  3SIB A;  2OTG B;  2GV5 A;  1REC A;  3CGA A;  1DTL A;  2JT3 A;  2JTT A;  2I2R E;  3TZ1 A;  1QS7 A;  5K89 A;  3KHE A;  1JFK A;  1FF1 A;  3I5F C;  2JU0 A;  2L5X B;  1CKK A;  2K7B A;  5AFP A;  1R6P A;  2QAC A;  2F33 A;  2HQW A;  1Y0V H;  2Q4U A;  1K96 A;  5F6T A;  1ZOT B;  1RJV A;  3FIA A;  1QXP A;  1TNW A;  2PAS A;  2KFG A;  1K9U A;  1YX7 A;  2WOS A;  1L7Z A;  1K94 A;  3EKJ A;  2LMV A;  1OQP A;  1IJ6 A;  1J7O A;  5CSJ A;  1WRK A;  1Y1X A;  3BYA A;  1MF8 B;  1QAT A;  2KYC A;  5IBW A;  1U5I B;  1A75 A;  1LIN A;  2LHL A;  3WHU B;  2ZRT A;  5HKW A;  5J3X A;  2A4J A;  1SRA A;  2WC8 A;  1NSH A;  1WRZ A;  2OTG C;  3CS1 A;  3F45 A;  4R1E A;  1FI5 A;  2LVK A;  1QJT A;  1SR6 B;  1XO5 A;  4XYN A;  3D0Y A;  1N0Y A;  3I5H B;  2K7C A;  1EG4 A;  1SK6 D;  1TNP A;  1KK7 Z;  2MLE C;  5HYD A;  4NDC A;  2Y1N A;  4OVN F;  1NX1 A;  2L2E A;  3E3R A;  1QLS A;  3NXA A;  3LK1 A;  3LCP C;  2LP2 A;  2MHH A;  2KI4 B;  1HT9 A;  2NXQ A;  3LLE A;  2LLU A;  5AEQ A;  4YI8 A;  1KWO B;  4YI9 A;  2CCM A;  4P2Y B;  3SG5 A;  4DRW A;  4QJ5 B;  2Q91 A;  3TUY B;  4BY5 A;  2SCP A;  5I2Q A;  4M2O A;  1ALW A;  1D1O A;  1EL4 A;  3LK0 A;  4PHN A;  2K61 A;  2K7O A;  1UHK A;  3ICB A;  1LA0 A;  1YX8 A;  2LM5 A;  3LL8 B;  1K90 D;  1K8U A;  2MAZ A;  1S6C A;  2ZKM X;  2BKH B;  1DMO A;  1CDN A;  1SR6 C;  1MXE A;  1NYA A;  1BG1 A;  1CLB A;  2ZN8 A;  1TCF A;  2CTN A;  3OB2 B;  3I5H C;  4PE7 A;  5HLO A;  1PVB A;  1XFY O;  3BUM B;  1JSA A;  1QV0 A;  1QV1 A;  1L2O B;  1KFU L;  4JWQ A;  2B1U A;  1SMG A;  4A4B A;  2L98 A;  1K9K A;  4QJ3 B;  1GJY A;  1ZMZ A;  4OV2 A;  4TNC A;  1E8A A;  1RFJ A;  2K8M B;  4QJ4 B;  4MN0 A;  1SL7 A;  2KI4 C;  4YGE B;  2H61 C;  5TNC A;  3JVT B;  1EJ3 A;  1KWO C;  1EXR A;  1YVH A;  1B8R A;  3TDZ A;  1KFU S;  1PSR A;  1OMV A;  4WRI A;  4PAL A;  1QVI Z;  4WQ3 A;  1S6I A;  2KYF A;  2M49 B;  3GK1 A;  2KFF A;  1XFV O;  2EC6 B;  3AAJ A;  1LA3 A;  3PM8 A;  4JPZ B;  4MRX A;  1KK8 B;  1M45 A;  1JBA A;  2KFH A;  1IQ3 A;  3TS5 B;  1FI6 A;  1YTZ C;  4HRE E;  4AOM A;  4CFR A;  4YGC B;  1TN4 A;  1B7T Y;  5AER A;  1CM4 A;  2V53 A;  4PCW A;  1S26 D;  1KSM A;  3EVU A;  1SW8 A;  1ZAC A;  2BCX A;  2ISD A;  2BE6 A;  1DJG A;  1RTP 1;  4FTG A;  1Y1A A;  1U5I A;  1S5G Z;  4CFQ A;  1AP4 A;  3OB1 B;  4A4C A;  1YUR A;  2HET A;  1A03 A;  1A4P A;  1B8C A;  5CSN A;  4ORB B;  5I2O A;  1DT7 B;  1AJ5 A;  1V1G A;  1IRJ A;  2AUC A;  2EHB A;  1WLZ A;  1YRU B;  3TDI A;  3VRN A;  4M2P A;  1YUS A;  1SNL A;  3EK4 A;  1YR5 A;  4N1F A;  2CNP A;  4N1G A;  4UPG A;  1UHI A;  3EKH A;  2LUC A;  4N5X A;  2OS8 B;  1KQM B;  1SY9 A;  4MVF A;  2EC6 C;  1BJF A;  1DJH A;  3VRR A;  1W7J B;  1KK8 C;  2HF5 A;  1C07 A;  3TS5 C;  5CSI A;  4YGA A;  4E68 A;  1XK4 C;  1MXL C;  3PSR A;  2H61 A;  2LVJ A;  3WHT B;  2E6W A;  3O78 A;  5ER4 X;  2ZND A;  1SYM A;  2NZ0 A;  3I5G B;  2WCF A;  2BBN A;  4ZCU A;  2LVI A;  2WCB A;  3TDU A;  2K7D A;  2M7L A;  1B4C A;  1DF0 A;  1N2D A;  1UHN A;  5JJG A;  2HPS A;  1WDC B;  1TOP A;  1F8H A;  1BU3 A;  1WRL A;  2LHI A;  1BT6 A;  5DKR A;  2Y1M A;  1LKJ A;  2O60 A;  3PN7 B;  4PHK A;  2LLS A;  1OZO A;  2JT0 A;  3VRP A;  3EK8 A;  1KQM C;  2G2B A;  2M1K B;  1F55 A;  1R2U A;  1CLL A;  1S36 A;  2NCP A;  3PAT A;  3NSO A;  4JQ0 D;  2FCE A;  2LP3 A;  5B8I B;  2P6B B;  2L4H A;  4OCI A;  1FW4 A;  1UUR A;  5I8N A;  1H8B A;  2KHN A;  2MA2 A;  4DCK A;  2AMI A;  5BPJ A;  1G4Y R;  4GPL B;  4MZJ A;  1QX7 A;  3WXA A;  5I2L A;  5D69 A;  1QIW A;  2JC2 A;  4P5O E;  1TCO B;  1GGW A;  2K2A A;  3RM1 A;  1JUO A;  2LNK A;  1J7R A;  2KBM A;  4HRG A;  3DVJ A;  3BUN B;  3PN7 C;  2LVV A;  1IKU A;  2H2K A;  3NSL A;  5HKY A;  1JC2 A;  2KI6 D;  1GGZ A;  4PE0 A;  2F8P A;  2JXL A;  1KK7 Y;  2K0J A;  1CMG A;  1PSB A;  3KEV A;  1QAS A;  1XFW O;  1NCY A;  1CLM A;  2WOR A;  1DGV A;  2KGB C;  3O6B A;  1WLM A;  2K2F A;  3KPX A;  3DF0 B;  1CB1 A;  4MSP A;  1NP8 A;  1RK9 A;  2MLF C;  1EH2 A;  1Y6W A;  3FS7 A;  2BBM A;  1NPQ A;  2R2I A;  2KSP A;  1XFX O;  1N65 A;  4MRY A;  2VRG A;  2F3Z A;  2BCA A;  3QRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...