3BQ3A

Crystal structure of s. cerevisiae dcn1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
258
structure length
250
Chain Sequence
SPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGVAHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dcn1 Functions as a Scaffold-Type E3 Ligase for Cullin Neddylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle, ligase
molecule keywords Defective in cullin neddylation protein 1
total genus 80
structure length 250
sequence length 258
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3bq3A00
5DKNA 5HYDA 2K0JA 1CFCA 1L2OC 1UHHA 2PRUA 1IQ5A 1BJFA 4YGBB 1QLKA 1SCMC 4N5XA 4M2PA 2GGZA 1M45A 2JULA 1QLSA 1SW8A 4U8DA 1AP4A 1YX8A 2NCOA 1IG5A 1DJGA 1PK0D 4JWQA 2JT8A 3KPXA 1RROA 5AANA 1S36A 4R1EA 2CXJA 4GGFC 1M39A 3EKHA 5K89A 1DJZA 1YURA 1CKKA 4FQOA 1C7VA 1K90D 3NXAA 3KHEA 5D69A 3SG6A 1NX3A 3DF0B 2BCAA 1SL9A 5D7FA 2LE9B 4USLA 4CIDA 3GK1A 3O4YA 2LCPA 1OSAA 2QPTA 2JTZA 1IKUA 2L5XB 1XFZO 3RLZA 1TNPA 2Q91A 2ISDA 2LP3A 1MWNA 4PHMA 1YUTA 3NSLA 1S6IA 3QRXA 1ZMZA 1LA3A 2HQ8A 2JNFA 1DJWA 3TZ1A 2PSRA 2K2FA 4HRGA 1JFJA 2GV5A 4I5KA 1IQ3A 1YVHA 1ALVA 1DVIA 3FS7A 4MRYA 2OPOA 1IJ6A 5ER4X 1RTP1 5IBWA 2KFHA 3SJSA 3BQ3A 2CCMA 1UWOA 2LVVA 1J7RA 4QJ5B 4I5JA 5ER5A 2KAXA 4DIRA 3BUXB 1LXFC 2WC8A 3VRPA 4CPVA 4C0JA 3DVKA 1SCMB 1D1OA 1QJTA 1CDLA 2D8NA 2Y1NA 2PVBA 4PHKA 5AERA 1K94A 1CTRA 1L2OB 1QX2A 2ZN8A 3DVJA 3FWBA 3M0WA 1ODBA 2AAOA 1CB1A 1Y0VH 1QVIZ 2MJWB 2M1UA 4N1GA 1MXEA 1XFUO 3SIAA 2O60A 1GQMA 2CTNA 1AHRA 1QATA 5CPVA 3NSIA 2L98A 4DUQA 5JOLA 1MUXA 3CR5X 1J7QA 3D0YA 1TN4A 1B8RA 3K21A 1L7ZA 2KQ6A 5I2LA 2JT3A 4JPZB 4CFQA 3KO0A 2I7AA 3OB1B 1OE9B 1V1GA 3FWCA 2WORA 4MZLA 5CSIA 1NWDA 4OCIA 1K2HA 1SR6C 3OP0A 1SYMA 2A4JA 3I5FB 4GGNA 2EHBA 1UURA 2KI6D 4MSPA 2O5GA 2K7OA 3D10A 3O78A 2BL0C 4HREE 1CNPA 1B7TZ 1KFXL 1J7OA 1BF5A 1WDCC 2M97A 1TNWA 2KFGA 4QJ3B 5F6TA 2KGRA 1OOJA 1IJ5A 2F3YA 4PHNA 1KK8C 5G08A 2LVJA 2ZN9A 3JVTB 1F4QA 4DCKA 3OHMB 2LUCA 4IL1A 2V53A 1F55A 1LVCD 2KAYA 1R6PA 2BKIB 1SMGA 1JC2A 1CM4A 1KFUL 4MZJA 1KSOA 2HETA 1UHIA 1N65A 1UHNA 2LMUA 2KOTA 5KSZA 2K61A 3JTDB 3HX4A 3PN7C 2LANA 1BODA 1B47A 1W7JB 1M46A 3O2PA 1GGZA 1LA0A 2ZFDA 3CZTX 5I2OA 3BXKA 1TRFA 4DRWA 4MEWA 3A4UB 4GPLB 4P2YB 2WNDA 2M0RA 5HKYA 2LMTA 4XJKB 1Q80A 3AKBA 2BBNA 2OS8C 2Q4UA 4CLNA 1CLLA 1RK9A 4YGAA 1WRKA 3BOWB 3CR4X 1XFXO 1QASA 1E8AA 3SIBA 1CFDA 3TUYB 1NCXA 2MBXA 2EGDA 1LKJA 1NX2A 5KU1A 4ZCUA 3TDUA 1S5GY 4NQGA 1DGUA 2NXQA 1BOCA 1JFKA 3I5GB 4BY5A 1FW4A 4QJ4B 1X02A 2GGMA 4E68A 2Y1MA 2K7CA 1NX1A 1KSMA 3PSRA 2BE6A 1B4CA 1K9KA 3AAJA 1QX7A 5AXIA 2LAPA 1A2XA 1BR1B 1DJYA 1V1FA 1QIWA 4OKHA 3PM8A 4YGDB 3SG4A 5JJGA 3A8RA 2LHIA 1ZUZA 1IGVA 1N0YA 3VRNA 2HQWA 2H61A 1FBVA 4I5NB 2OTGC 2I18A 4Q04A 1CLBA 4ORBB 3I5IB 1W7IB 2LP2A 1C07A 1RWYA 4PDZA 3WHTB 4YI9A 3SG7A 1DGVA 4AOMA 3O6BA 2ZKMX 2JNXA 2KYFA 4MZKA 2PASA 2NZ0A 1G8IA 1OMVA 4XJKA 1KK7Y 2NLNA 1G4YR 1TCOB 2E6WA 2BCBA 1MF8B 1KK7Z 2ZRTA 3KEVA 1LINA 1MHOA 2MA2A 1EH2A 1PALA 4GNKB 3WXAA 2K7DA 1DMOA 4A4CA 2KSPA 1XFYO 2LLUA 1FI6A 1IH0A 5HKZA 3ICBA 2WCBA 3SG3A 4HRHA 3DVMA 1OZOA 2FCEA 3TS5C 3GK2A 2MRDA 1B7TY 3F45A 5I2QA 1U5IA 2FOTA 1UHKA 1KQMC 1MQ1A 1BU3A 4UPGA 1YRTB 4PE7A 2SASA 2F8PA 1NPQA 4GGFA 1XO5A 1ZACA 1TNXA 1WLMA 1XK4C 1S6JA 1SPYA 1CLMA 2EC6C 2LLTA 2JC2A 2G2BA 3BUMB 4ORAB 2KI4C 1OMDA 4PCWA 4NDBA 1R2UA 2F33A 4YGCB 2L50A 2H2KA 2R2IA 3LLEA 3OX6A 4MLWA 1SL8A 1XVJA 2KHNA 1S3PA 3OX5A 1J1EA 1VRKA 1NYAA 1QIVA 4D1EA 4JQ0D 3EVVA 2BCXA 1SNLA 1B8LA 1AK8A 2KFFA 3GOFA 3D0YB 3VRQA 3I5HB 2WOSA 1K95A 1OMRA 3VRRA 2L0PA 3IF7A 1KFXS 1K9UA 2LUXA 4WQ2A 1DT7B 3LK0A 1KWOB 1EG3A 3RM1A 1JUOA 2LMVA 1B1GA 1S5GZ 1KWOC 4WQ3A 3NSKA 3LK1A 1H8BA 1GJYA 1CFFA 4YGEB 3I5HC 1DTLA 2JWWA 3E3RA 2WCFA 1NCYA 1U5IB 3PATA 1PRWA 1N2DA 1Y1UA 4HSZA 4A4BA 2L4IA 2JTTA 2E30A 5HKWA 1HT9A 4M2QA 2LLSA 1BMOA 4CFRA 3SG5A 4YRUA 2MLFC 3KF9A 2K2AA 1WLZA 1JWDA 1DF0B 2BBMA 5CSFA 2JOJA 1RECA 1IRJA 1SY9A 2KGBC 3CGAA 2KI4B 3CTNA 1CDMA 1MR8A 1JBAA 2RGIA 2EC6B 1AJ5A 1J1DA 1CDNA 4DS7A 1UP5A 1KCYA 4BY4A 1IWQA 1C7WA 1Y1AA 2COLB 4OV2A 1F54A 1BT6A 1QXPA 1BR4B 3BUNB 3H4SE 4AQIA 1CDPA 1CMFA 5J3XA 1KQMB 5B8IB 1KFUS 1SCVA 1SK6D 2CT9A 2JU0A 1Y1XA 1NCZA 1YR5A 2WCEA 3HCMA 1AJ4A 1NP8A 1TNQA 1B9AA 2BKHB 4GAOA 3BUWB 1WRZA 4YI8A 3TS5B 3CWGA 2PMYA 4ZCVA 1XA5A 2BE4A 1S1EA 3EVUA 2KAVA 3BOWA 3MSEB 1YRUB 4AQJA 5AFPA 1Y6WA 2HF5A 5AEQA 3AKAA 1G33A 1QVIY 2K8MB 5HLOA 1QS7A 4FTGA 2M8UA 3EVRA 5TNCA 1CM1A 3LCPC 1F70A 2M1KB 2KI6C 1GGWA 1K9PA 1PSRA 2MHHA 1K96A 2KQYA 4WRIA 1YTZC 4L9MA 1UUSA 1KQVA 3I5IC 2KBMA 3C1VA 3EK4A 2OTGB 4ICBA 1FPWA 1DF0A 1QX5B 2JPTA 1DJXA 1EL4A 2AUCA 3PFVA 3ZWHA 1BLQA 1XFVO 1SKTA 1WY9A 1A4PA 2F2PA 1PULA 4TNCA 2L2EA 3SG2A 1A29A 1CMGA 1XFWO 1QTXA 2LHLA 3PALA 3BUOB 1K93D 1XK4A 1FI5A 1SRAA 1TTXA 1M63B 1PVAA 3GK4X 2M3WA 3WHUB 1UHJA 2QACA 1TCFA 4GBAA 2JRFA 2F2OA 2FJUB 5HLVA 1A75A 1M31A 4PE4A 1OZSA 3I5GC 2JQ6A 2CBLA 4NDCA 2M7NA 3TDIA 2I2RE 1AVSA 2AMIA 2SCPA 3EKJA 3OB2B 4PHJA 1QV1A 1QV0A 2JXLA 2P6BB 5FYXA 2DOQA 1YX7A 2LVKA 3CS1A 4N1FA 4MVFA 2Y4QA 1S26D 4C0LA 3TUYC 5DKRA 1RJVA 3BYAA 1F71A 2BECA 2OS8B 2MAZA 1TOPA 3IQOA 5KTYA 3VGOA 1AUIB 3EK8A 1NSHA 4PE0A 3PLFB 4C0KA 2HPSA 1OQPA 1H4BA 1NIWA 5CSJA 2FCDA 5PALA 3DD4A 2LV7A 2B1UA 2KDHA 1ZFSA 5I8NA 1YUUA 1HQVA 1DJHA 3DVEA 2LM5A 2I94A 1NX0A 3PN7B 2IS9A 4PALA 2KBIA 3JTDC 3CLNA 2H61C 1F4OA 2JT0A 1ALWA 1J55A 1JF2A 1SBJA 1RFJA 4YBHB 2MLEC 3LL8B 1NUBA 2VRGA 5DKQA 2L51A 2JZIA 1MXLC 1SL7A 2G9BA 3EK7A 2LC5A 2KNEA 4P5OE 4MRXA 2M9GA 1A03A 3FIAA 3JVTC 3WNXB 1J7PA 1KK8B 2JXCA 3CR2A 5CSNA 1PSBA 2KYCA 1XYDA 4OVNF 1S6CA 4F0ZB 1EG4A 1B8CA 3AAKA 4OR9B 1WDCB 2M49B 2TN4A 1A75B 3DF0A 3VROA 4NDDA 2BL0B 4ETOA 1JSAA 3NSOA 2Y5IA 2NCPA 3ZNIA 4I5LB 1YVLA 1ZOTB 3I5FC 2L4HA 4ORCB 1SR6B 5BPJA 1CFPA 1FF1A 1TIZA 2ZRSA 1WRLA 1YUSA 2ZNDA 4XYNA 2ZNEA 5GQQC 2LVIA 1DJIA 4MN0A 1BG1A 1EJ3A 2LNKA 2CNPA 4M2OA 4GUKA 1JF0A 4MBEA 2K7BA 2M29A 4PE1A 2M7LA 2F3ZA 2PALA 1K8UA 4GFTA 1EXRA 3TDZA 3IQQA 1PVBA 1F8HA
chains in the Genus database with same CATH superfamily
5DKNA 5HYDA 2K0JA 1CFCA 1L2OC 1UHHA 2PRUA 1IQ5A 1BJFA 4PT1A 4YGBB 1QLKA 2WC5A 1SCMC 4N5XA 4M2PA 2GGZA 1M45A 2JULA 1QLSA 1SW8A 4U8DA 1AP4A 1YX8A 2NCOA 1IG5A 1DJGA 1PK0D 4JWQA 2JT8A 3KPXA 1RROA 5AANA 1S36A 4R1EA 2CXJA 4GGFC 1M39A 3D77A 3EKHA 5K89A 1DJZA 1YURA 2H8VA 1CKKA 4FQOA 1C7VA 1K90D 2KLDA 3KHEA 3NXAA 5D69A 3SG6A 2P71A 1NX3A 3DF0B 2BCAA 1SL9A 2QEBA 5D7FA 5DKQA 2LE9B 4USLA 4PHJA 4CIDA 3GK1A 3O4YA 2LCPA 1OSAA 2QPTA 2JTZA 1IKUA 2L5XB 1XFZO 3RLZA 1TNPA 2Q91A 3K1EA 2ISDA 2LP3A 1MWNA 1DQEA 4PHMA 1YUTA 3NSLA 3SS5A 1S6IA 3QRXA 1ZMZA 1LA3A 2HQ8A 2JNFA 1DJWA 3TZ1A 2PSRA 2K2FA 4HRGA 3IVTA 1JFJA 2GV5A 4I5KA 1IQ3A 1YVHA 1TWOA 1ALVA 1DVIA 3FS7A 4MRYA 1DELA 2OPOA 1IJ6A 5ER4X 1RTP1 5IBWA 2KFHA 3SJSA 3BQ3A 2CCMA 1UWOA 2LVVA 1J7RA 4QJ5B 4I5JA 3FE8A 2KAXA 5ER5A 5EL2A 5FI6A 4DIRA 3BUXB 1LXFC 2WC8A 3D74A 3VRPA 4CPVA 4C0JA 3DVKA 1SCMB 1D1OA 1QJTA 1CDLA 2D8NA 2Y1NA 2PVBA 4PHKA 5AERA 1K94A 3D78A 2WCLA 1CTRA 1L2OB 1QX2A 2ZN8A 3DVJA 3FWBA 3M0WA 1ODBA 2AAOA 1CB1A 1Y0VH 1QVIZ 2MJWB 2M1UA 4N1GA 3S0DA 1MXEA 1XFUO 2KPHA 2O60A 3CZ2A 3SIAA 1GQMA 2CTNA 1AHRA 5D3OA 1QATA 5CPVA 3NSIA 2L98A 4DUQA 5JOLA 1MUXA 3CR5X 1J7QA 3D0YA 1TN4A 2WCHA 1B8RA 3K21A 1L7ZA 2KQ6A 5I2LA 2JT3A 4JPZB 4CFQA 3KO0A 2I7AA 3OB1B 1OE9B 1V1GA 3FWCA 2WORA 4MZLA 5CSIA 1NWDA 4OCIA 1K2HA 1SR6C 3OP0A 1SYMA 2A4JA 3I5FB 4GGNA 2EHBA 2FJYA 1UURA 2KI6D 4MSPA 2O5GA 2K7OA 3D10A 3O78A 2BL0C 4HREE 1CNPA 1B7TZ 1KFXL 1J7OA 1BF5A 1WDCC 2M97A 1TNWA 3R1PA 4F7FA 2KFGA 4QJ3B 5F6TA 2KGRA 1OOJA 3DY9A 1IJ5A 2F3YA 4PHNA 1KK8C 5G08A 2LVJA 1DEKA 2ZN9A 1F4QA 3DXLA 3JVTB 4DCKA 3OHMB 2LUCA 4IL1A 2V53A 1F55A 1LVCD 2KAYA 1R6PA 2BKIB 1SMGA 1JC2A 2QEOA 1CM4A 1KFUL 4MZJA 1KSOA 2HETA 1UHIA 1N65A 1UHNA 2LMUA 2KOTA 5KSZA 2K61A 3JTDB 3HX4A 3PN7C 2LANA 1BODA 1B47A 1W7JB 1M46A 3O2PA 3N7HA 1GGZA 1LA0A 2ZFDA 3CZTX 5I2OA 5I94A 3BXKA 1TRFA 4DRWA 4MEWA 3A4UB 4GPLB 3NHTA 5HL1A 4P2YB 3DYEA 2WNDA 2WCJA 2M0RA 5HKYA 2LMTA 4XJKB 1Q80A 3AKBA 2BBNA 2OS8C 2Q4UA 4CLNA 1CLLA 1RK9A 4YGAA 1WRKA 3BOWB 3CR4X 1XFXO 1QASA 1E8AA 3BFHA 1CFDA 3SIBA 1NCXA 2MBXA 3TUYB 2EGDA 1LKJA 1NX2A 2PQLA 5KU1A 4ZCUA 3TDUA 1S5GY 4NQGA 1DGUA 2NXQA 3VB1A 3R1VA 1BOCA 3SS3A 1JFKA 3I5GB 4BY5A 1FW4A 4QJ4B 1X02A 2GGMA 5FI2A 4E68A 2Y1MA 2K7CA 1NX1A 3SS4A 1KSMA 3PSRA 2BE6A 1B4CA 1K9KA 3AAJA 3RZSA 1QX7A 5AXIA 2LAPA 1A2XA 3D75A 1BR1B 1DJYA 1V1FA 1QIWA 4OKHA 3PM8A 4YGDB 3SG4A 3CZ1A 5JJGA 3A8RA 2LHIA 1ZUZA 1IGVA 1N0YA 3B6XA 3VRNA 2HQWA 2H61A 1FBVA 4I5NB 2OTGC 2I18A 4Q04A 1CLBA 4ORBB 3I5IB 1W7IB 2LP2A 1C07A 1RWYA 3Q8IA 4PDZA 3WHTB 4YI9A 3SG7A 1DGVA 4AOMA 3O6BA 2ZKMX 4OZDA 2JNXA 2KYFA 4MZKA 2PASA 2NZ0A 1G8IA 4KYNA 1OMVA 4XJKA 1KK7Y 3R1OA 2NLNA 3B87A 1G4YR 1TCOB 2E6WA 2BCBA 1MF8B 1KK7Z 2ZRTA 3KEVA 1LINA 1MHOA 2MA2A 1EH2A 1PALA 4GNKB 3WXAA 2K7DA 2WCKA 1DMOA 4A4CA 1OOIX 1SSEB 2KSPA 3R72A 1XFYO 2LLUA 1FI6A 1IH0A 3PM2A 5HKZA 3ICBA 2WCBA 3SG3A 4HRHA 3DVMA 1OZOA 2FCEA 3TS5C 3GK2A 2MRDA 1B7TY 2QEHA 3F45A 4YI8A 5I2QA 1U5IA 2FOTA 3UNWA 2K60A 1UHKA 1KQMC 1MQ1A 1BU3A 4UPGA 1YRTB 4PE7A 2SASA 4JKTA 2F8PA 1NPQA 4GGFA 3DZTA 3S0EA 1XO5A 1ZACA 1TNXA 1WLMA 1XK4C 2YGUA 3NHIA 1S6JA 1SPYA 1CLMA 2EC6C 2LLTA 2JC2A 2G2BA 3BUMB 4ORAB 2KI4C 1OMDA 4PCWA 4NDBA 2PYQA 1R2UA 2F33A 4YGCB 2L50A 2H2KA 2R2IA 3LLEA 3D73A 3OX6A 1OOFA 4MLWA 3S0FA 1SL8A 1XVJA 1C3YA 2KHNA 1S3PA 3OX5A 1J1EA 1VRKA 1NYAA 1QIVA 4D1EA 4JQ0D 3EVVA 3O4XA 2BCXA 1SNLA 3L4LA 1B8LA 1AK8A 2KFFA 3OGNA 1TUJA 3GOFA 3D0YB 3VRQA 3I5HB 2QEVA 3CDNA 2WOSA 1K95A 3NGVA 1OMRA 1W9ZA 2L0PA 3VRRA 3IF7A 1KFXS 1K9UA 2LUXA 4WQ2A 1DT7B 3LK0A 1KWOB 1EG3A 3RM1A 1JUOA 1GM0A 1T14A 2ERBA 2LMVA 1B1GA 1DC1A 1S5GZ 1KWOC 4WQ3A 3NSKA 3LK1A 2L2CA 3UO9A 1H8BA 1GJYA 1CFFA 4YGEB 2BNXA 3I5HC 3S0AA 1DTLA 3S0BA 2JWWA 3E3RA 2WCFA 1NCYA 1U5IB 3PATA 1PRWA 1N2DA 1Y1UA 4HSZA 4A4BA 2L4IA 2JTTA 2E30A 5HKWA 1HT9A 4M2QA 2LLSA 1BMOA 4CFRA 3SG5A 4YRUA 2MLFC 3KF9A 2K2AA 1WLZA 3CYZA 3EG5B 1JWDA 1DF0B 2BBMA 5CSFA 2JOJA 1RECA 1IRJA 1SY9A 2KGBC 3PJIA 3CGAA 2KI4B 3CTNA 1CDMA 1C3ZA 1MR8A 1JBAA 2RGIA 2EC6B 1AJ5A 1J1DA 3BJHA 1CDNA 4DS7A 1UP5A 1KCYA 4BY4A 1IWQA 1C7WA 1Y1AA 2COLB 4OV2A 1F54A 1BT6A 1QXPA 1BR4B 3BUNB 3H4SE 4AQIA 1CDPA 1CMFA 1QWVA 5J3XA 1KQMB 5B8IB 1KFUS 1SCVA 1SK6D 2CT9A 2JU0A 2BAPA 2WCMA 1Y1XA 1NCZA 1YR5A 2WCEA 3HCMA 4IJ7A 1AJ4A 1NP8A 1TNQA 1B9AA 2BKHB 3BFBA 3BUWB 1WRZA 3CABA 4GAOA 3CWGA 3TS5B 2PMYA 4ZCVA 1XA5A 2BE4A 1S1EA 3EVUA 2KAVA 3BOWA 3MSEB 3B88A 1YRUB 4AQJA 5AFPA 1Y6WA 2HF5A 1LS8A 5AEQA 3AKAA 1G33A 1QVIY 2K8MB 5HLOA 3BFAA 1QS7A 4FTGA 2M8UA 3EVRA 5TNCA 1CM1A 3LCPC 2GTEA 1F70A 2M1KB 2KI6C 1GGWA 1K9PA 1PSRA 2MHHA 3CZ0A 1K96A 2KQYA 4WRIA 1YTZC 4L9MA 1UUSA 1KQVA 3OBVA 3I5IC 2KBMA 3C1VA 3EK4A 2OTGB 4ICBA 4JD9A 1FPWA 1DF0A 1OOHA 1QX5B 2JPTA 1DJXA 1EL4A 2AUCA 3PFVA 3ZWHA 1BLQA 1XFVO 1SKTA 1WY9A 1A4PA 2F2PA 1PULA 4TNCA 2L2EA 3SG2A 1A29A 5DICA 1CMGA 1IIOA 1XFWO 1QTXA 2LHLA 3PALA 3BUOB 1Z4HA 1K93D 1XK4A 1FI5A 1ORGA 3V2LA 1SRAA 1TTXA 1M63B 1PVAA 3GK4X 2M3WA 3WHUB 1UHJA 2QACA 1TCFA 3D76A 4GBAA 2JRFA 1P28A 2F2OA 2FJUB 5HLVA 1A75A 1M31A 4PE4A 1OZSA 3I5GC 2JQ6A 4FQTA 2CBLA 4NDCA 2JPOA 2M7NA 2P70A 3TDIA 2I2RE 1AVSA 2AMIA 2SCPA 3EKJA 3OB2B 2QDIA 1QV1A 1QV0A 2JXLA 2P6BB 5FYXA 2DOQA 1YX7A 2LVKA 3CS1A 4N1FA 4MVFA 2Y4QA 1S26D 4C0LA 3TUYC 5DKRA 1RJVA 3BYAA 1F71A 2BECA 2OS8B 2MAZA 1TOPA 3IQOA 5KTYA 1XFRA 3VGOA 1AUIB 3EK8A 1NSHA 4PE0A 3PLFB 4C0KA 2HPSA 1OQPA 1H4BA 3QMEA 1NIWA 3B7AA 2FCDA 5CSJA 5PALA 3DD4A 2LV7A 2B1UA 2KDHA 1ZFSA 5I8NA 1YUUA 1HQVA 3B86A 1DJHA 3DVEA 2LM5A 2I94A 1NX0A 3PN7B 2IS9A 4PALA 2KBIA 3JTDC 3CLNA 1F4OA 2H61C 2JT0A 1ALWA 1J55A 1JF2A 1SBJA 1RFJA 4YBHB 2MLEC 3LL8B 1NUBA 2VRGA 4INWA 2L51A 2JZIA 1MXLC 1SL7A 2G9BA 3EK7A 2WC6A 2LC5A 2KNEA 4P5OE 4MRXA 5FI7A 2M9GA 1TUZA 3FIAA 1A03A 3S0GA 3JVTC 3FE9A 3WNXB 1J7PA 1KK8B 2JXCA 3CR2A 5CSNA 1PSBA 1OOGA 2KYCA 1XYDA 3L4AA 4OVNF 1S6CA 4F0ZB 1EG4A 1B8CA 3AAKA 4OR9B 1WDCB 2M49B 2TN4A 1A75B 3DF0A 3VROA 4NDDA 2BL0B 4ETOA 1JSAA 3NSOA 2Y5IA 2L5YA 1Z2CB 2NCPA 3ZNIA 4I5LB 1YVLA 1ZOTB 3I5FC 2L4HA 4ORCB 1SR6B 5BPJA 1CFPA 4INXA 1FF1A 1TIZA 2ZRSA 1WRLA 1YUSA 2ZNDA 4XYNA 2ZNEA 2KLEA 2LVIA 5GQQC 1DJIA 4MN0A 3FE6A 1BG1A 1EJ3A 2LNKA 2CNPA 4M2OA 4GUKA 1JF0A 4MBEA 2K7BA 2M29A 4PE1A 2M7LA 2F3ZA 2PALA 3L47A 1K8UA 1OW4A 4GFTA 1EXRA 3TDZA 3IQQA 1PVBA 1F8HA
chains in the Genus database with same CATH topology
5DKNA 5HYDA 2K0JA 1CFCA 1L2OC 1UHHA 2PRUA 1IQ5A 1BJFA 4YGBB 1QLKA 1SCMC 4N5XA 4M2PA 2GGZA 1M45A 2JULA 1QLSA 1SW8A 4U8DA 1AP4A 1YX8A 2NCOA 1IG5A 1DJGA 1PK0D 4JWQA 2JT8A 3KPXA 1RROA 5AANA 1S36A 4R1EA 2CXJA 4GGFC 1M39A 3EKHA 5K89A 1DJZA 1YURA 1CKKA 4FQOA 1C7VA 1K90D 3NXAA 3KHEA 5D69A 3SG6A 1NX3A 3DF0B 2BCAA 1SL9A 5D7FA 2LE9B 4USLA 4CIDA 3GK1A 3O4YA 2LCPA 1OSAA 2QPTA 2JTZA 1IKUA 2L5XB 1XFZO 3RLZA 1TNPA 2Q91A 2ISDA 2LP3A 1MWNA 4PHMA 1YUTA 3NSLA 1S6IA 3QRXA 1ZMZA 1LA3A 2HQ8A 2JNFA 1DJWA 3TZ1A 2PSRA 2K2FA 4HRGA 1JFJA 2GV5A 4I5KA 1IQ3A 1YVHA 1ALVA 1DVIA 3FS7A 4MRYA 2OPOA 1IJ6A 5ER4X 1RTP1 5IBWA 2KFHA 3SJSA 3BQ3A 2CCMA 1UWOA 2LVVA 1J7RA 4QJ5B 4I5JA 5ER5A 2KAXA 4DIRA 3BUXB 1LXFC 2WC8A 3VRPA 4CPVA 4C0JA 3DVKA 1SCMB 1D1OA 1QJTA 1CDLA 2D8NA 2Y1NA 2PVBA 4PHKA 5AERA 1K94A 1CTRA 1L2OB 1QX2A 2ZN8A 3DVJA 3FWBA 3M0WA 1ODBA 2AAOA 1CB1A 1Y0VH 1QVIZ 2MJWB 2M1UA 4N1GA 1MXEA 1XFUO 3SIAA 2O60A 1GQMA 2CTNA 1AHRA 1QATA 5CPVA 3NSIA 2L98A 4DUQA 5JOLA 1MUXA 3CR5X 1J7QA 3D0YA 1TN4A 1B8RA 3K21A 1L7ZA 2KQ6A 5I2LA 2JT3A 4JPZB 4CFQA 3KO0A 2I7AA 3OB1B 1OE9B 1V1GA 3FWCA 2WORA 4MZLA 5CSIA 1NWDA 4OCIA 1K2HA 1SR6C 3OP0A 1SYMA 2A4JA 3I5FB 4GGNA 2EHBA 1UURA 2KI6D 4MSPA 2O5GA 2K7OA 3D10A 3O78A 2BL0C 4HREE 1CNPA 1B7TZ 1KFXL 1J7OA 1BF5A 1WDCC 2M97A 1TNWA 2KFGA 4QJ3B 5F6TA 2KGRA 1OOJA 1IJ5A 2F3YA 4PHNA 1KK8C 5G08A 2LVJA 2ZN9A 3JVTB 1F4QA 4DCKA 3OHMB 2LUCA 4IL1A 2V53A 1F55A 1LVCD 2KAYA 1R6PA 2BKIB 1SMGA 1JC2A 1CM4A 1KFUL 4MZJA 1KSOA 2HETA 1UHIA 1N65A 1UHNA 2LMUA 2KOTA 5KSZA 2K61A 3JTDB 3HX4A 3PN7C 2LANA 1BODA 1B47A 1W7JB 1M46A 3O2PA 1GGZA 1LA0A 2ZFDA 3CZTX 5I2OA 3BXKA 1TRFA 4DRWA 4MEWA 3A4UB 4GPLB 4P2YB 2WNDA 2M0RA 5HKYA 2LMTA 4XJKB 1Q80A 3AKBA 2BBNA 2OS8C 2Q4UA 4CLNA 1CLLA 1RK9A 4YGAA 1WRKA 3BOWB 3CR4X 1XFXO 1QASA 1E8AA 3SIBA 1CFDA 3TUYB 1NCXA 2MBXA 2EGDA 1LKJA 1NX2A 5KU1A 4ZCUA 3TDUA 1S5GY 4NQGA 1DGUA 2NXQA 1BOCA 1JFKA 3I5GB 4BY5A 1FW4A 4QJ4B 1X02A 2GGMA 4E68A 2Y1MA 2K7CA 1NX1A 1KSMA 3PSRA 2BE6A 1B4CA 1K9KA 3AAJA 1QX7A 5AXIA 2LAPA 1A2XA 1BR1B 1DJYA 1V1FA 1QIWA 4OKHA 3PM8A 4YGDB 3SG4A 5JJGA 3A8RA 2LHIA 1ZUZA 1IGVA 1N0YA 3VRNA 2HQWA 2H61A 1FBVA 4I5NB 2OTGC 2I18A 4Q04A 1CLBA 4ORBB 3I5IB 1W7IB 2LP2A 1C07A 1RWYA 4PDZA 3WHTB 4YI9A 3SG7A 1DGVA 4AOMA 3O6BA 2ZKMX 2JNXA 2KYFA 4MZKA 2PASA 2NZ0A 1G8IA 1OMVA 4XJKA 1KK7Y 2NLNA 1G4YR 1TCOB 2E6WA 2BCBA 1MF8B 1KK7Z 2ZRTA 3KEVA 1LINA 1MHOA 2MA2A 1EH2A 1PALA 4GNKB 3WXAA 2K7DA 1DMOA 4A4CA 2KSPA 1XFYO 2LLUA 1FI6A 1IH0A 5HKZA 3ICBA 2WCBA 3SG3A 4HRHA 3DVMA 1OZOA 2FCEA 3TS5C 3GK2A 2MRDA 1B7TY 3F45A 5I2QA 1U5IA 2FOTA 1UHKA 1KQMC 1MQ1A 1BU3A 4UPGA 1YRTB 4PE7A 2SASA 2F8PA 1NPQA 4GGFA 1XO5A 1ZACA 1TNXA 1WLMA 1XK4C 1S6JA 1SPYA 1CLMA 2EC6C 2LLTA 2JC2A 2G2BA 3BUMB 4ORAB 2KI4C 1OMDA 4PCWA 4NDBA 1R2UA 2F33A 4YGCB 2L50A 2H2KA 2R2IA 3LLEA 3OX6A 4MLWA 1SL8A 1XVJA 2KHNA 1S3PA 3OX5A 1J1EA 1VRKA 1NYAA 1QIVA 4D1EA 4JQ0D 3EVVA 2BCXA 1SNLA 1B8LA 1AK8A 2KFFA 3GOFA 3D0YB 3VRQA 3I5HB 2WOSA 1K95A 1OMRA 3VRRA 2L0PA 3IF7A 1KFXS 1K9UA 2LUXA 4WQ2A 1DT7B 3LK0A 1KWOB 1EG3A 3RM1A 1JUOA 2LMVA 1B1GA 1S5GZ 1KWOC 4WQ3A 3NSKA 3LK1A 1H8BA 1GJYA 1CFFA 4YGEB 3I5HC 1DTLA 2JWWA 3E3RA 2WCFA 1NCYA 1U5IB 3PATA 1PRWA 1N2DA 1Y1UA 4HSZA 4A4BA 2L4IA 2JTTA 2E30A 5HKWA 1HT9A 4M2QA 2LLSA 1BMOA 4CFRA 3SG5A 4YRUA 2MLFC 3KF9A 2K2AA 1WLZA 1JWDA 1DF0B 2BBMA 5CSFA 2JOJA 1RECA 1IRJA 1SY9A 2KGBC 3CGAA 2KI4B 3CTNA 1CDMA 1MR8A 1JBAA 2RGIA 2EC6B 1AJ5A 1J1DA 1CDNA 4DS7A 1UP5A 1KCYA 4BY4A 1IWQA 1C7WA 1Y1AA 2COLB 4OV2A 1F54A 1BT6A 1QXPA 1BR4B 3BUNB 3H4SE 4AQIA 1CDPA 1CMFA 5J3XA 1KQMB 5B8IB 1KFUS 1SCVA 1SK6D 2CT9A 2JU0A 1Y1XA 1NCZA 1YR5A 2WCEA 3HCMA 1AJ4A 1NP8A 1TNQA 1B9AA 2BKHB 4GAOA 3BUWB 1WRZA 4YI8A 3TS5B 3CWGA 2PMYA 4ZCVA 1XA5A 2BE4A 1S1EA 3EVUA 2KAVA 3BOWA 3MSEB 1YRUB 4AQJA 5AFPA 1Y6WA 2HF5A 5AEQA 3AKAA 1G33A 1QVIY 2K8MB 5HLOA 1QS7A 4FTGA 2M8UA 3EVRA 5TNCA 1CM1A 3LCPC 1F70A 2M1KB 2KI6C 1GGWA 1K9PA 1PSRA 2MHHA 1K96A 2KQYA 4WRIA 1YTZC 4L9MA 1UUSA 1KQVA 3I5IC 2KBMA 3C1VA 3EK4A 2OTGB 4ICBA 1FPWA 1DF0A 1QX5B 2JPTA 1DJXA 1EL4A 2AUCA 3PFVA 3ZWHA 1BLQA 1XFVO 1SKTA 1WY9A 1A4PA 2F2PA 1PULA 4TNCA 2L2EA 3SG2A 1A29A 1CMGA 1XFWO 1QTXA 2LHLA 3PALA 3BUOB 1K93D 1XK4A 1FI5A 1SRAA 1TTXA 1M63B 1PVAA 3GK4X 2M3WA 3WHUB 1UHJA 2QACA 1TCFA 4GBAA 2JRFA 2F2OA 2FJUB 5HLVA 1A75A 1M31A 4PE4A 1OZSA 3I5GC 2JQ6A 2CBLA 4NDCA 2M7NA 3TDIA 2I2RE 1AVSA 2AMIA 2SCPA 3EKJA 3OB2B 4PHJA 1QV1A 1QV0A 2JXLA 2P6BB 5FYXA 2DOQA 1YX7A 2LVKA 3CS1A 4N1FA 4MVFA 2Y4QA 1S26D 4C0LA 3TUYC 5DKRA 1RJVA 3BYAA 1F71A 2BECA 2OS8B 2MAZA 1TOPA 3IQOA 5KTYA 3VGOA 1AUIB 3EK8A 1NSHA 4PE0A 3PLFB 4C0KA 2HPSA 1OQPA 1H4BA 1NIWA 5CSJA 2FCDA 5PALA 3DD4A 2LV7A 2B1UA 2KDHA 1ZFSA 5I8NA 1YUUA 1HQVA 1DJHA 3DVEA 2LM5A 2I94A 1NX0A 3PN7B 2IS9A 4PALA 2KBIA 3JTDC 3CLNA 2H61C 1F4OA 2JT0A 1ALWA 1J55A 1JF2A 1SBJA 1RFJA 4YBHB 2MLEC 3LL8B 1NUBA 2VRGA 5DKQA 2L51A 2JZIA 1MXLC 1SL7A 2G9BA 3EK7A 2LC5A 2KNEA 4P5OE 4MRXA 2M9GA 1A03A 3FIAA 3JVTC 3WNXB 1J7PA 1KK8B 2JXCA 3CR2A 5CSNA 1PSBA 2KYCA 1XYDA 4OVNF 1S6CA 4F0ZB 1EG4A 1B8CA 3AAKA 4OR9B 1WDCB 2M49B 2TN4A 1A75B 3DF0A 3VROA 4NDDA 2BL0B 4ETOA 1JSAA 3NSOA 2Y5IA 2NCPA 3ZNIA 4I5LB 1YVLA 1ZOTB 3I5FC 2L4HA 4ORCB 1SR6B 5BPJA 1CFPA 1FF1A 1TIZA 2ZRSA 1WRLA 1YUSA 2ZNDA 4XYNA 2ZNEA 5GQQC 2LVIA 1DJIA 4MN0A 1BG1A 1EJ3A 2LNKA 2CNPA 4M2OA 4GUKA 1JF0A 4MBEA 2K7BA 2M29A 4PE1A 2M7LA 2F3ZA 2PALA 1K8UA 4GFTA 1EXRA 3TDZA 3IQQA 1PVBA 1F8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKN A;  5HYD A;  2K0J A;  1CFC A;  1L2O C;  1UHH A;  2PRU A;  1IQ5 A;  1BJF A;  4YGB B;  1QLK A;  1SCM C;  4N5X A;  4M2P A;  2GGZ A;  1M45 A;  2JUL A;  1QLS A;  1SW8 A;  4U8D A;  1AP4 A;  1YX8 A;  2NCO A;  1IG5 A;  1DJG A;  1PK0 D;  4JWQ A;  2JT8 A;  3KPX A;  1RRO A;  5AAN A;  1S36 A;  4R1E A;  2CXJ A;  4GGF C;  1M39 A;  3EKH A;  5K89 A;  1DJZ A;  1YUR A;  1CKK A;  4FQO A;  1C7V A;  1K90 D;  3NXA A;  3KHE A;  5D69 A;  3SG6 A;  1NX3 A;  3DF0 B;  2BCA A;  1SL9 A;  5D7F A;  2LE9 B;  4USL A;  4CID A;  3GK1 A;  3O4Y A;  2LCP A;  1OSA A;  2QPT A;  2JTZ A;  1IKU A;  2L5X B;  1XFZ O;  3RLZ A;  1TNP A;  2Q91 A;  2ISD A;  2LP3 A;  1MWN A;  4PHM A;  1YUT A;  3NSL A;  1S6I A;  3QRX A;  1ZMZ A;  1LA3 A;  2HQ8 A;  2JNF A;  1DJW A;  3TZ1 A;  2PSR A;  2K2F A;  4HRG A;  1JFJ A;  2GV5 A;  4I5K A;  1IQ3 A;  1YVH A;  1ALV A;  1DVI A;  3FS7 A;  4MRY A;  2OPO A;  1IJ6 A;  5ER4 X;  1RTP 1;  5IBW A;  2KFH A;  3SJS A;  3BQ3 A;  2CCM A;  1UWO A;  2LVV A;  1J7R A;  4QJ5 B;  4I5J A;  5ER5 A;  2KAX A;  4DIR A;  3BUX B;  1LXF C;  2WC8 A;  3VRP A;  4CPV A;  4C0J A;  3DVK A;  1SCM B;  1D1O A;  1QJT A;  1CDL A;  2D8N A;  2Y1N A;  2PVB A;  4PHK A;  5AER A;  1K94 A;  1CTR A;  1L2O B;  1QX2 A;  2ZN8 A;  3DVJ A;  3FWB A;  3M0W A;  1ODB A;  2AAO A;  1CB1 A;  1Y0V H;  1QVI Z;  2MJW B;  2M1U A;  4N1G A;  1MXE A;  1XFU O;  3SIA A;  2O60 A;  1GQM A;  2CTN A;  1AHR A;  1QAT A;  5CPV A;  3NSI A;  2L98 A;  4DUQ A;  5JOL A;  1MUX A;  3CR5 X;  1J7Q A;  3D0Y A;  1TN4 A;  1B8R A;  3K21 A;  1L7Z A;  2KQ6 A;  5I2L A;  2JT3 A;  4JPZ B;  4CFQ A;  3KO0 A;  2I7A A;  3OB1 B;  1OE9 B;  1V1G A;  3FWC A;  2WOR A;  4MZL A;  5CSI A;  1NWD A;  4OCI A;  1K2H A;  1SR6 C;  3OP0 A;  1SYM A;  2A4J A;  3I5F B;  4GGN A;  2EHB A;  1UUR A;  2KI6 D;  4MSP A;  2O5G A;  2K7O A;  3D10 A;  3O78 A;  2BL0 C;  4HRE E;  1CNP A;  1B7T Z;  1KFX L;  1J7O A;  1BF5 A;  1WDC C;  2M97 A;  1TNW A;  2KFG A;  4QJ3 B;  5F6T A;  2KGR A;  1OOJ A;  1IJ5 A;  2F3Y A;  4PHN A;  1KK8 C;  5G08 A;  2LVJ A;  2ZN9 A;  3JVT B;  1F4Q A;  4DCK A;  3OHM B;  2LUC A;  4IL1 A;  2V53 A;  1F55 A;  1LVC D;  2KAY A;  1R6P A;  2BKI B;  1SMG A;  1JC2 A;  1CM4 A;  1KFU L;  4MZJ A;  1KSO A;  2HET A;  1UHI A;  1N65 A;  1UHN A;  2LMU A;  2KOT A;  5KSZ A;  2K61 A;  3JTD B;  3HX4 A;  3PN7 C;  2LAN A;  1BOD A;  1B47 A;  1W7J B;  1M46 A;  3O2P A;  1GGZ A;  1LA0 A;  2ZFD A;  3CZT X;  5I2O A;  3BXK A;  1TRF A;  4DRW A;  4MEW A;  3A4U B;  4GPL B;  4P2Y B;  2WND A;  2M0R A;  5HKY A;  2LMT A;  4XJK B;  1Q80 A;  3AKB A;  2BBN A;  2OS8 C;  2Q4U A;  4CLN A;  1CLL A;  1RK9 A;  4YGA A;  1WRK A;  3BOW B;  3CR4 X;  1XFX O;  1QAS A;  1E8A A;  3SIB A;  1CFD A;  3TUY B;  1NCX A;  2MBX A;  2EGD A;  1LKJ A;  1NX2 A;  5KU1 A;  4ZCU A;  3TDU A;  1S5G Y;  4NQG A;  1DGU A;  2NXQ A;  1BOC A;  1JFK A;  3I5G B;  4BY5 A;  1FW4 A;  4QJ4 B;  1X02 A;  2GGM A;  4E68 A;  2Y1M A;  2K7C A;  1NX1 A;  1KSM A;  3PSR A;  2BE6 A;  1B4C A;  1K9K A;  3AAJ A;  1QX7 A;  5AXI A;  2LAP A;  1A2X A;  1BR1 B;  1DJY A;  1V1F A;  1QIW A;  4OKH A;  3PM8 A;  4YGD B;  3SG4 A;  5JJG A;  3A8R A;  2LHI A;  1ZUZ A;  1IGV A;  1N0Y A;  3VRN A;  2HQW A;  2H61 A;  1FBV A;  4I5N B;  2OTG C;  2I18 A;  4Q04 A;  1CLB A;  4ORB B;  3I5I B;  1W7I B;  2LP2 A;  1C07 A;  1RWY A;  4PDZ A;  3WHT B;  4YI9 A;  3SG7 A;  1DGV A;  4AOM A;  3O6B A;  2ZKM X;  2JNX A;  2KYF A;  4MZK A;  2PAS A;  2NZ0 A;  1G8I A;  1OMV A;  4XJK A;  1KK7 Y;  2NLN A;  1G4Y R;  1TCO B;  2E6W A;  2BCB A;  1MF8 B;  1KK7 Z;  2ZRT A;  3KEV A;  1LIN A;  1MHO A;  2MA2 A;  1EH2 A;  1PAL A;  4GNK B;  3WXA A;  2K7D A;  1DMO A;  4A4C A;  2KSP A;  1XFY O;  2LLU A;  1FI6 A;  1IH0 A;  5HKZ A;  3ICB A;  2WCB A;  3SG3 A;  4HRH A;  3DVM A;  1OZO A;  2FCE A;  3TS5 C;  3GK2 A;  2MRD A;  1B7T Y;  3F45 A;  5I2Q A;  1U5I A;  2FOT A;  1UHK A;  1KQM C;  1MQ1 A;  1BU3 A;  4UPG A;  1YRT B;  4PE7 A;  2SAS A;  2F8P A;  1NPQ A;  4GGF A;  1XO5 A;  1ZAC A;  1TNX A;  1WLM A;  1XK4 C;  1S6J A;  1SPY A;  1CLM A;  2EC6 C;  2LLT A;  2JC2 A;  2G2B A;  3BUM B;  4ORA B;  2KI4 C;  1OMD A;  4PCW A;  4NDB A;  1R2U A;  2F33 A;  4YGC B;  2L50 A;  2H2K A;  2R2I A;  3LLE A;  3OX6 A;  4MLW A;  1SL8 A;  1XVJ A;  2KHN A;  1S3P A;  3OX5 A;  1J1E A;  1VRK A;  1NYA A;  1QIV A;  4D1E A;  4JQ0 D;  3EVV A;  2BCX A;  1SNL A;  1B8L A;  1AK8 A;  2KFF A;  3GOF A;  3D0Y B;  3VRQ A;  3I5H B;  2WOS A;  1K95 A;  1OMR A;  3VRR A;  2L0P A;  3IF7 A;  1KFX S;  1K9U A;  2LUX A;  4WQ2 A;  1DT7 B;  3LK0 A;  1KWO B;  1EG3 A;  3RM1 A;  1JUO A;  2LMV A;  1B1G A;  1S5G Z;  1KWO C;  4WQ3 A;  3NSK A;  3LK1 A;  1H8B A;  1GJY A;  1CFF A;  4YGE B;  3I5H C;  1DTL A;  2JWW A;  3E3R A;  2WCF A;  1NCY A;  1U5I B;  3PAT A;  1PRW A;  1N2D A;  1Y1U A;  4HSZ A;  4A4B A;  2L4I A;  2JTT A;  2E30 A;  5HKW A;  1HT9 A;  4M2Q A;  2LLS A;  1BMO A;  4CFR A;  3SG5 A;  4YRU A;  2MLF C;  3KF9 A;  2K2A A;  1WLZ A;  1JWD A;  1DF0 B;  2BBM A;  5CSF A;  2JOJ A;  1REC A;  1IRJ A;  1SY9 A;  2KGB C;  3CGA A;  2KI4 B;  3CTN A;  1CDM A;  1MR8 A;  1JBA A;  2RGI A;  2EC6 B;  1AJ5 A;  1J1D A;  1CDN A;  4DS7 A;  1UP5 A;  1KCY A;  4BY4 A;  1IWQ A;  1C7W A;  1Y1A A;  2COL B;  4OV2 A;  1F54 A;  1BT6 A;  1QXP A;  1BR4 B;  3BUN B;  3H4S E;  4AQI A;  1CDP A;  1CMF A;  5J3X A;  1KQM B;  5B8I B;  1KFU S;  1SCV A;  1SK6 D;  2CT9 A;  2JU0 A;  1Y1X A;  1NCZ A;  1YR5 A;  2WCE A;  3HCM A;  1AJ4 A;  1NP8 A;  1TNQ A;  1B9A A;  2BKH B;  4GAO A;  3BUW B;  1WRZ A;  4YI8 A;  3TS5 B;  3CWG A;  2PMY A;  4ZCV A;  1XA5 A;  2BE4 A;  1S1E A;  3EVU A;  2KAV A;  3BOW A;  3MSE B;  1YRU B;  4AQJ A;  5AFP A;  1Y6W A;  2HF5 A;  5AEQ A;  3AKA A;  1G33 A;  1QVI Y;  2K8M B;  5HLO A;  1QS7 A;  4FTG A;  2M8U A;  3EVR A;  5TNC A;  1CM1 A;  3LCP C;  1F70 A;  2M1K B;  2KI6 C;  1GGW A;  1K9P A;  1PSR A;  2MHH A;  1K96 A;  2KQY A;  4WRI A;  1YTZ C;  4L9M A;  1UUS A;  1KQV A;  3I5I C;  2KBM A;  3C1V A;  3EK4 A;  2OTG B;  4ICB A;  1FPW A;  1DF0 A;  1QX5 B;  2JPT A;  1DJX A;  1EL4 A;  2AUC A;  3PFV A;  3ZWH A;  1BLQ A;  1XFV O;  1SKT A;  1WY9 A;  1A4P A;  2F2P A;  1PUL A;  4TNC A;  2L2E A;  3SG2 A;  1A29 A;  1CMG A;  1XFW O;  1QTX A;  2LHL A;  3PAL A;  3BUO B;  1K93 D;  1XK4 A;  1FI5 A;  1SRA A;  1TTX A;  1M63 B;  1PVA A;  3GK4 X;  2M3W A;  3WHU B;  1UHJ A;  2QAC A;  1TCF A;  4GBA A;  2JRF A;  2F2O A;  2FJU B;  5HLV A;  1A75 A;  1M31 A;  4PE4 A;  1OZS A;  3I5G C;  2JQ6 A;  2CBL A;  4NDC A;  2M7N A;  3TDI A;  2I2R E;  1AVS A;  2AMI A;  2SCP A;  3EKJ A;  3OB2 B;  4PHJ A;  1QV1 A;  1QV0 A;  2JXL A;  2P6B B;  5FYX A;  2DOQ A;  1YX7 A;  2LVK A;  3CS1 A;  4N1F A;  4MVF A;  2Y4Q A;  1S26 D;  4C0L A;  3TUY C;  5DKR A;  1RJV A;  3BYA A;  1F71 A;  2BEC A;  2OS8 B;  2MAZ A;  1TOP A;  3IQO A;  5KTY A;  3VGO A;  1AUI B;  3EK8 A;  1NSH A;  4PE0 A;  3PLF B;  4C0K A;  2HPS A;  1OQP A;  1H4B A;  1NIW A;  5CSJ A;  2FCD A;  5PAL A;  3DD4 A;  2LV7 A;  2B1U A;  2KDH A;  1ZFS A;  5I8N A;  1YUU A;  1HQV A;  1DJH A;  3DVE A;  2LM5 A;  2I94 A;  1NX0 A;  3PN7 B;  2IS9 A;  4PAL A;  2KBI A;  3JTD C;  3CLN A;  2H61 C;  1F4O A;  2JT0 A;  1ALW A;  1J55 A;  1JF2 A;  1SBJ A;  1RFJ A;  4YBH B;  2MLE C;  3LL8 B;  1NUB A;  2VRG A;  5DKQ A;  2L51 A;  2JZI A;  1MXL C;  1SL7 A;  2G9B A;  3EK7 A;  2LC5 A;  2KNE A;  4P5O E;  4MRX A;  2M9G A;  1A03 A;  3FIA A;  3JVT C;  3WNX B;  1J7P A;  1KK8 B;  2JXC A;  3CR2 A;  5CSN A;  1PSB A;  2KYC A;  1XYD A;  4OVN F;  1S6C A;  4F0Z B;  1EG4 A;  1B8C A;  3AAK A;  4OR9 B;  1WDC B;  2M49 B;  2TN4 A;  1A75 B;  3DF0 A;  3VRO A;  4NDD A;  2BL0 B;  4ETO A;  1JSA A;  3NSO A;  2Y5I A;  2NCP A;  3ZNI A;  4I5L B;  1YVL A;  1ZOT B;  3I5F C;  2L4H A;  4ORC B;  1SR6 B;  5BPJ A;  1CFP A;  1FF1 A;  1TIZ A;  2ZRS A;  1WRL A;  1YUS A;  2ZND A;  4XYN A;  2ZNE A;  5GQQ C;  2LVI A;  1DJI A;  4MN0 A;  1BG1 A;  1EJ3 A;  2LNK A;  2CNP A;  4M2O A;  4GUK A;  1JF0 A;  4MBE A;  2K7B A;  2M29 A;  4PE1 A;  2M7L A;  2F3Z A;  2PAL A;  1K8U A;  4GFT A;  1EXR A;  3TDZ A;  3IQQ A;  1PVB A;  1F8H A; 
#chains in the Genus database with same CATH topology
 5DKN A;  5HYD A;  2K0J A;  1CFC A;  1L2O C;  1UHH A;  2PRU A;  1IQ5 A;  1BJF A;  4PT1 A;  4YGB B;  1QLK A;  2WC5 A;  1SCM C;  4N5X A;  4M2P A;  2GGZ A;  1M45 A;  2JUL A;  1QLS A;  1SW8 A;  4U8D A;  1AP4 A;  1YX8 A;  2NCO A;  1IG5 A;  1DJG A;  1PK0 D;  4JWQ A;  2JT8 A;  3KPX A;  1RRO A;  5AAN A;  1S36 A;  4R1E A;  2CXJ A;  4GGF C;  1M39 A;  3D77 A;  3EKH A;  5K89 A;  1DJZ A;  1YUR A;  2H8V A;  1CKK A;  4FQO A;  1C7V A;  1K90 D;  2KLD A;  3KHE A;  3NXA A;  5D69 A;  3SG6 A;  2P71 A;  1NX3 A;  3DF0 B;  2BCA A;  1SL9 A;  2QEB A;  5D7F A;  5DKQ A;  2LE9 B;  4USL A;  4PHJ A;  4CID A;  3GK1 A;  3O4Y A;  2LCP A;  1OSA A;  2QPT A;  2JTZ A;  1IKU A;  2L5X B;  1XFZ O;  3RLZ A;  1TNP A;  2Q91 A;  3K1E A;  2ISD A;  2LP3 A;  1MWN A;  1DQE A;  4PHM A;  1YUT A;  3NSL A;  3SS5 A;  1S6I A;  3QRX A;  1ZMZ A;  1LA3 A;  2HQ8 A;  2JNF A;  1DJW A;  3TZ1 A;  2PSR A;  2K2F A;  4HRG A;  3IVT A;  1JFJ A;  2GV5 A;  4I5K A;  1IQ3 A;  1YVH A;  1TWO A;  1ALV A;  1DVI A;  3FS7 A;  4MRY A;  1DEL A;  2OPO A;  1IJ6 A;  5ER4 X;  1RTP 1;  5IBW A;  2KFH A;  3SJS A;  3BQ3 A;  2CCM A;  1UWO A;  2LVV A;  1J7R A;  4QJ5 B;  4I5J A;  3FE8 A;  2KAX A;  5ER5 A;  5EL2 A;  5FI6 A;  4DIR A;  3BUX B;  1LXF C;  2WC8 A;  3D74 A;  3VRP A;  4CPV A;  4C0J A;  3DVK A;  1SCM B;  1D1O A;  1QJT A;  1CDL A;  2D8N A;  2Y1N A;  2PVB A;  4PHK A;  5AER A;  1K94 A;  3D78 A;  2WCL A;  1CTR A;  1L2O B;  1QX2 A;  2ZN8 A;  3DVJ A;  3FWB A;  3M0W A;  1ODB A;  2AAO A;  1CB1 A;  1Y0V H;  1QVI Z;  2MJW B;  2M1U A;  4N1G A;  3S0D A;  1MXE A;  1XFU O;  2KPH A;  2O60 A;  3CZ2 A;  3SIA A;  1GQM A;  2CTN A;  1AHR A;  5D3O A;  1QAT A;  5CPV A;  3NSI A;  2L98 A;  4DUQ A;  5JOL A;  1MUX A;  3CR5 X;  1J7Q A;  3D0Y A;  1TN4 A;  2WCH A;  1B8R A;  3K21 A;  1L7Z A;  2KQ6 A;  5I2L A;  2JT3 A;  4JPZ B;  4CFQ A;  3KO0 A;  2I7A A;  3OB1 B;  1OE9 B;  1V1G A;  3FWC A;  2WOR A;  4MZL A;  5CSI A;  1NWD A;  4OCI A;  1K2H A;  1SR6 C;  3OP0 A;  1SYM A;  2A4J A;  3I5F B;  4GGN A;  2EHB A;  2FJY A;  1UUR A;  2KI6 D;  4MSP A;  2O5G A;  2K7O A;  3D10 A;  3O78 A;  2BL0 C;  4HRE E;  1CNP A;  1B7T Z;  1KFX L;  1J7O A;  1BF5 A;  1WDC C;  2M97 A;  1TNW A;  3R1P A;  4F7F A;  2KFG A;  4QJ3 B;  5F6T A;  2KGR A;  1OOJ A;  3DY9 A;  1IJ5 A;  2F3Y A;  4PHN A;  1KK8 C;  5G08 A;  2LVJ A;  1DEK A;  2ZN9 A;  1F4Q A;  3DXL A;  3JVT B;  4DCK A;  3OHM B;  2LUC A;  4IL1 A;  2V53 A;  1F55 A;  1LVC D;  2KAY A;  1R6P A;  2BKI B;  1SMG A;  1JC2 A;  2QEO A;  1CM4 A;  1KFU L;  4MZJ A;  1KSO A;  2HET A;  1UHI A;  1N65 A;  1UHN A;  2LMU A;  2KOT A;  5KSZ A;  2K61 A;  3JTD B;  3HX4 A;  3PN7 C;  2LAN A;  1BOD A;  1B47 A;  1W7J B;  1M46 A;  3O2P A;  3N7H A;  1GGZ A;  1LA0 A;  2ZFD A;  3CZT X;  5I2O A;  5I94 A;  3BXK A;  1TRF A;  4DRW A;  4MEW A;  3A4U B;  4GPL B;  3NHT A;  5HL1 A;  4P2Y B;  3DYE A;  2WND A;  2WCJ A;  2M0R A;  5HKY A;  2LMT A;  4XJK B;  1Q80 A;  3AKB A;  2BBN A;  2OS8 C;  2Q4U A;  4CLN A;  1CLL A;  1RK9 A;  4YGA A;  1WRK A;  3BOW B;  3CR4 X;  1XFX O;  1QAS A;  1E8A A;  3BFH A;  1CFD A;  3SIB A;  1NCX A;  2MBX A;  3TUY B;  2EGD A;  1LKJ A;  1NX2 A;  2PQL A;  5KU1 A;  4ZCU A;  3TDU A;  1S5G Y;  4NQG A;  1DGU A;  2NXQ A;  3VB1 A;  3R1V A;  1BOC A;  3SS3 A;  1JFK A;  3I5G B;  4BY5 A;  1FW4 A;  4QJ4 B;  1X02 A;  2GGM A;  5FI2 A;  4E68 A;  2Y1M A;  2K7C A;  1NX1 A;  3SS4 A;  1KSM A;  3PSR A;  2BE6 A;  1B4C A;  1K9K A;  3AAJ A;  3RZS A;  1QX7 A;  5AXI A;  2LAP A;  1A2X A;  3D75 A;  1BR1 B;  1DJY A;  1V1F A;  1QIW A;  4OKH A;  3PM8 A;  4YGD B;  3SG4 A;  3CZ1 A;  5JJG A;  3A8R A;  2LHI A;  1ZUZ A;  1IGV A;  1N0Y A;  3B6X A;  3VRN A;  2HQW A;  2H61 A;  1FBV A;  4I5N B;  2OTG C;  2I18 A;  4Q04 A;  1CLB A;  4ORB B;  3I5I B;  1W7I B;  2LP2 A;  1C07 A;  1RWY A;  3Q8I A;  4PDZ A;  3WHT B;  4YI9 A;  3SG7 A;  1DGV A;  4AOM A;  3O6B A;  2ZKM X;  4OZD A;  2JNX A;  2KYF A;  4MZK A;  2PAS A;  2NZ0 A;  1G8I A;  4KYN A;  1OMV A;  4XJK A;  1KK7 Y;  3R1O A;  2NLN A;  3B87 A;  1G4Y R;  1TCO B;  2E6W A;  2BCB A;  1MF8 B;  1KK7 Z;  2ZRT A;  3KEV A;  1LIN A;  1MHO A;  2MA2 A;  1EH2 A;  1PAL A;  4GNK B;  3WXA A;  2K7D A;  2WCK A;  1DMO A;  4A4C A;  1OOI X;  1SSE B;  2KSP A;  3R72 A;  1XFY O;  2LLU A;  1FI6 A;  1IH0 A;  3PM2 A;  5HKZ A;  3ICB A;  2WCB A;  3SG3 A;  4HRH A;  3DVM A;  1OZO A;  2FCE A;  3TS5 C;  3GK2 A;  2MRD A;  1B7T Y;  2QEH A;  3F45 A;  4YI8 A;  5I2Q A;  1U5I A;  2FOT A;  3UNW A;  2K60 A;  1UHK A;  1KQM C;  1MQ1 A;  1BU3 A;  4UPG A;  1YRT B;  4PE7 A;  2SAS A;  4JKT A;  2F8P A;  1NPQ A;  4GGF A;  3DZT A;  3S0E A;  1XO5 A;  1ZAC A;  1TNX A;  1WLM A;  1XK4 C;  2YGU A;  3NHI A;  1S6J A;  1SPY A;  1CLM A;  2EC6 C;  2LLT A;  2JC2 A;  2G2B A;  3BUM B;  4ORA B;  2KI4 C;  1OMD A;  4PCW A;  4NDB A;  2PYQ A;  1R2U A;  2F33 A;  4YGC B;  2L50 A;  2H2K A;  2R2I A;  3LLE A;  3D73 A;  3OX6 A;  1OOF A;  4MLW A;  3S0F A;  1SL8 A;  1XVJ A;  1C3Y A;  2KHN A;  1S3P A;  3OX5 A;  1J1E A;  1VRK A;  1NYA A;  1QIV A;  4D1E A;  4JQ0 D;  3EVV A;  3O4X A;  2BCX A;  1SNL A;  3L4L A;  1B8L A;  1AK8 A;  2KFF A;  3OGN A;  1TUJ A;  3GOF A;  3D0Y B;  3VRQ A;  3I5H B;  2QEV A;  3CDN A;  2WOS A;  1K95 A;  3NGV A;  1OMR A;  1W9Z A;  2L0P A;  3VRR A;  3IF7 A;  1KFX S;  1K9U A;  2LUX A;  4WQ2 A;  1DT7 B;  3LK0 A;  1KWO B;  1EG3 A;  3RM1 A;  1JUO A;  1GM0 A;  1T14 A;  2ERB A;  2LMV A;  1B1G A;  1DC1 A;  1S5G Z;  1KWO C;  4WQ3 A;  3NSK A;  3LK1 A;  2L2C A;  3UO9 A;  1H8B A;  1GJY A;  1CFF A;  4YGE B;  2BNX A;  3I5H C;  3S0A A;  1DTL A;  3S0B A;  2JWW A;  3E3R A;  2WCF A;  1NCY A;  1U5I B;  3PAT A;  1PRW A;  1N2D A;  1Y1U A;  4HSZ A;  4A4B A;  2L4I A;  2JTT A;  2E30 A;  5HKW A;  1HT9 A;  4M2Q A;  2LLS A;  1BMO A;  4CFR A;  3SG5 A;  4YRU A;  2MLF C;  3KF9 A;  2K2A A;  1WLZ A;  3CYZ A;  3EG5 B;  1JWD A;  1DF0 B;  2BBM A;  5CSF A;  2JOJ A;  1REC A;  1IRJ A;  1SY9 A;  2KGB C;  3PJI A;  3CGA A;  2KI4 B;  3CTN A;  1CDM A;  1C3Z A;  1MR8 A;  1JBA A;  2RGI A;  2EC6 B;  1AJ5 A;  1J1D A;  3BJH A;  1CDN A;  4DS7 A;  1UP5 A;  1KCY A;  4BY4 A;  1IWQ A;  1C7W A;  1Y1A A;  2COL B;  4OV2 A;  1F54 A;  1BT6 A;  1QXP A;  1BR4 B;  3BUN B;  3H4S E;  4AQI A;  1CDP A;  1CMF A;  1QWV A;  5J3X A;  1KQM B;  5B8I B;  1KFU S;  1SCV A;  1SK6 D;  2CT9 A;  2JU0 A;  2BAP A;  2WCM A;  1Y1X A;  1NCZ A;  1YR5 A;  2WCE A;  3HCM A;  4IJ7 A;  1AJ4 A;  1NP8 A;  1TNQ A;  1B9A A;  2BKH B;  3BFB A;  3BUW B;  1WRZ A;  3CAB A;  4GAO A;  3CWG A;  3TS5 B;  2PMY A;  4ZCV A;  1XA5 A;  2BE4 A;  1S1E A;  3EVU A;  2KAV A;  3BOW A;  3MSE B;  3B88 A;  1YRU B;  4AQJ A;  5AFP A;  1Y6W A;  2HF5 A;  1LS8 A;  5AEQ A;  3AKA A;  1G33 A;  1QVI Y;  2K8M B;  5HLO A;  3BFA A;  1QS7 A;  4FTG A;  2M8U A;  3EVR A;  5TNC A;  1CM1 A;  3LCP C;  2GTE A;  1F70 A;  2M1K B;  2KI6 C;  1GGW A;  1K9P A;  1PSR A;  2MHH A;  3CZ0 A;  1K96 A;  2KQY A;  4WRI A;  1YTZ C;  4L9M A;  1UUS A;  1KQV A;  3OBV A;  3I5I C;  2KBM A;  3C1V A;  3EK4 A;  2OTG B;  4ICB A;  4JD9 A;  1FPW A;  1DF0 A;  1OOH A;  1QX5 B;  2JPT A;  1DJX A;  1EL4 A;  2AUC A;  3PFV A;  3ZWH A;  1BLQ A;  1XFV O;  1SKT A;  1WY9 A;  1A4P A;  2F2P A;  1PUL A;  4TNC A;  2L2E A;  3SG2 A;  1A29 A;  5DIC A;  1CMG A;  1IIO A;  1XFW O;  1QTX A;  2LHL A;  3PAL A;  3BUO B;  1Z4H A;  1K93 D;  1XK4 A;  1FI5 A;  1ORG A;  3V2L A;  1SRA A;  1TTX A;  1M63 B;  1PVA A;  3GK4 X;  2M3W A;  3WHU B;  1UHJ A;  2QAC A;  1TCF A;  3D76 A;  4GBA A;  2JRF A;  1P28 A;  2F2O A;  2FJU B;  5HLV A;  1A75 A;  1M31 A;  4PE4 A;  1OZS A;  3I5G C;  2JQ6 A;  4FQT A;  2CBL A;  4NDC A;  2JPO A;  2M7N A;  2P70 A;  3TDI A;  2I2R E;  1AVS A;  2AMI A;  2SCP A;  3EKJ A;  3OB2 B;  2QDI A;  1QV1 A;  1QV0 A;  2JXL A;  2P6B B;  5FYX A;  2DOQ A;  1YX7 A;  2LVK A;  3CS1 A;  4N1F A;  4MVF A;  2Y4Q A;  1S26 D;  4C0L A;  3TUY C;  5DKR A;  1RJV A;  3BYA A;  1F71 A;  2BEC A;  2OS8 B;  2MAZ A;  1TOP A;  3IQO A;  5KTY A;  1XFR A;  3VGO A;  1AUI B;  3EK8 A;  1NSH A;  4PE0 A;  3PLF B;  4C0K A;  2HPS A;  1OQP A;  1H4B A;  3QME A;  1NIW A;  3B7A A;  2FCD A;  5CSJ A;  5PAL A;  3DD4 A;  2LV7 A;  2B1U A;  2KDH A;  1ZFS A;  5I8N A;  1YUU A;  1HQV A;  3B86 A;  1DJH A;  3DVE A;  2LM5 A;  2I94 A;  1NX0 A;  3PN7 B;  2IS9 A;  4PAL A;  2KBI A;  3JTD C;  3CLN A;  1F4O A;  2H61 C;  2JT0 A;  1ALW A;  1J55 A;  1JF2 A;  1SBJ A;  1RFJ A;  4YBH B;  2MLE C;  3LL8 B;  1NUB A;  2VRG A;  4INW A;  2L51 A;  2JZI A;  1MXL C;  1SL7 A;  2G9B A;  3EK7 A;  2WC6 A;  2LC5 A;  2KNE A;  4P5O E;  4MRX A;  5FI7 A;  2M9G A;  1TUZ A;  3FIA A;  1A03 A;  3S0G A;  3JVT C;  3FE9 A;  3WNX B;  1J7P A;  1KK8 B;  2JXC A;  3CR2 A;  5CSN A;  1PSB A;  1OOG A;  2KYC A;  1XYD A;  3L4A A;  4OVN F;  1S6C A;  4F0Z B;  1EG4 A;  1B8C A;  3AAK A;  4OR9 B;  1WDC B;  2M49 B;  2TN4 A;  1A75 B;  3DF0 A;  3VRO A;  4NDD A;  2BL0 B;  4ETO A;  1JSA A;  3NSO A;  2Y5I A;  2L5Y A;  1Z2C B;  2NCP A;  3ZNI A;  4I5L B;  1YVL A;  1ZOT B;  3I5F C;  2L4H A;  4ORC B;  1SR6 B;  5BPJ A;  1CFP A;  4INX A;  1FF1 A;  1TIZ A;  2ZRS A;  1WRL A;  1YUS A;  2ZND A;  4XYN A;  2ZNE A;  2KLE A;  2LVI A;  5GQQ C;  1DJI A;  4MN0 A;  3FE6 A;  1BG1 A;  1EJ3 A;  2LNK A;  2CNP A;  4M2O A;  4GUK A;  1JF0 A;  4MBE A;  2K7B A;  2M29 A;  4PE1 A;  2M7L A;  2F3Z A;  2PAL A;  3L47 A;  1K8U A;  1OW4 A;  4GFT A;  1EXR A;  3TDZ A;  3IQQ A;  1PVB A;  1F8H A; 
#chains in the Genus database with same CATH homology
 5DKN A;  5HYD A;  2K0J A;  1CFC A;  1L2O C;  1UHH A;  2PRU A;  1IQ5 A;  1BJF A;  4YGB B;  1QLK A;  1SCM C;  4N5X A;  4M2P A;  2GGZ A;  1M45 A;  2JUL A;  1QLS A;  1SW8 A;  4U8D A;  1AP4 A;  1YX8 A;  2NCO A;  1IG5 A;  1DJG A;  1PK0 D;  4JWQ A;  2JT8 A;  3KPX A;  1RRO A;  5AAN A;  1S36 A;  4R1E A;  2CXJ A;  4GGF C;  1M39 A;  3EKH A;  5K89 A;  1DJZ A;  1YUR A;  1CKK A;  4FQO A;  1C7V A;  1K90 D;  3NXA A;  3KHE A;  5D69 A;  3SG6 A;  1NX3 A;  3DF0 B;  2BCA A;  1SL9 A;  5D7F A;  2LE9 B;  4USL A;  4CID A;  3GK1 A;  3O4Y A;  2LCP A;  1OSA A;  2QPT A;  2JTZ A;  1IKU A;  2L5X B;  1XFZ O;  3RLZ A;  1TNP A;  2Q91 A;  2ISD A;  2LP3 A;  1MWN A;  4PHM A;  1YUT A;  3NSL A;  1S6I A;  3QRX A;  1ZMZ A;  1LA3 A;  2HQ8 A;  2JNF A;  1DJW A;  3TZ1 A;  2PSR A;  2K2F A;  4HRG A;  1JFJ A;  2GV5 A;  4I5K A;  1IQ3 A;  1YVH A;  1ALV A;  1DVI A;  3FS7 A;  4MRY A;  2OPO A;  1IJ6 A;  5ER4 X;  1RTP 1;  5IBW A;  2KFH A;  3SJS A;  3BQ3 A;  2CCM A;  1UWO A;  2LVV A;  1J7R A;  4QJ5 B;  4I5J A;  5ER5 A;  2KAX A;  4DIR A;  3BUX B;  1LXF C;  2WC8 A;  3VRP A;  4CPV A;  4C0J A;  3DVK A;  1SCM B;  1D1O A;  1QJT A;  1CDL A;  2D8N A;  2Y1N A;  2PVB A;  4PHK A;  5AER A;  1K94 A;  1CTR A;  1L2O B;  1QX2 A;  2ZN8 A;  3DVJ A;  3FWB A;  3M0W A;  1ODB A;  2AAO A;  1CB1 A;  1Y0V H;  1QVI Z;  2MJW B;  2M1U A;  4N1G A;  1MXE A;  1XFU O;  3SIA A;  2O60 A;  1GQM A;  2CTN A;  1AHR A;  1QAT A;  5CPV A;  3NSI A;  2L98 A;  4DUQ A;  5JOL A;  1MUX A;  3CR5 X;  1J7Q A;  3D0Y A;  1TN4 A;  1B8R A;  3K21 A;  1L7Z A;  2KQ6 A;  5I2L A;  2JT3 A;  4JPZ B;  4CFQ A;  3KO0 A;  2I7A A;  3OB1 B;  1OE9 B;  1V1G A;  3FWC A;  2WOR A;  4MZL A;  5CSI A;  1NWD A;  4OCI A;  1K2H A;  1SR6 C;  3OP0 A;  1SYM A;  2A4J A;  3I5F B;  4GGN A;  2EHB A;  1UUR A;  2KI6 D;  4MSP A;  2O5G A;  2K7O A;  3D10 A;  3O78 A;  2BL0 C;  4HRE E;  1CNP A;  1B7T Z;  1KFX L;  1J7O A;  1BF5 A;  1WDC C;  2M97 A;  1TNW A;  2KFG A;  4QJ3 B;  5F6T A;  2KGR A;  1OOJ A;  1IJ5 A;  2F3Y A;  4PHN A;  1KK8 C;  5G08 A;  2LVJ A;  2ZN9 A;  3JVT B;  1F4Q A;  4DCK A;  3OHM B;  2LUC A;  4IL1 A;  2V53 A;  1F55 A;  1LVC D;  2KAY A;  1R6P A;  2BKI B;  1SMG A;  1JC2 A;  1CM4 A;  1KFU L;  4MZJ A;  1KSO A;  2HET A;  1UHI A;  1N65 A;  1UHN A;  2LMU A;  2KOT A;  5KSZ A;  2K61 A;  3JTD B;  3HX4 A;  3PN7 C;  2LAN A;  1BOD A;  1B47 A;  1W7J B;  1M46 A;  3O2P A;  1GGZ A;  1LA0 A;  2ZFD A;  3CZT X;  5I2O A;  3BXK A;  1TRF A;  4DRW A;  4MEW A;  3A4U B;  4GPL B;  4P2Y B;  2WND A;  2M0R A;  5HKY A;  2LMT A;  4XJK B;  1Q80 A;  3AKB A;  2BBN A;  2OS8 C;  2Q4U A;  4CLN A;  1CLL A;  1RK9 A;  4YGA A;  1WRK A;  3BOW B;  3CR4 X;  1XFX O;  1QAS A;  1E8A A;  3SIB A;  1CFD A;  3TUY B;  1NCX A;  2MBX A;  2EGD A;  1LKJ A;  1NX2 A;  5KU1 A;  4ZCU A;  3TDU A;  1S5G Y;  4NQG A;  1DGU A;  2NXQ A;  1BOC A;  1JFK A;  3I5G B;  4BY5 A;  1FW4 A;  4QJ4 B;  1X02 A;  2GGM A;  4E68 A;  2Y1M A;  2K7C A;  1NX1 A;  1KSM A;  3PSR A;  2BE6 A;  1B4C A;  1K9K A;  3AAJ A;  1QX7 A;  5AXI A;  2LAP A;  1A2X A;  1BR1 B;  1DJY A;  1V1F A;  1QIW A;  4OKH A;  3PM8 A;  4YGD B;  3SG4 A;  5JJG A;  3A8R A;  2LHI A;  1ZUZ A;  1IGV A;  1N0Y A;  3VRN A;  2HQW A;  2H61 A;  1FBV A;  4I5N B;  2OTG C;  2I18 A;  4Q04 A;  1CLB A;  4ORB B;  3I5I B;  1W7I B;  2LP2 A;  1C07 A;  1RWY A;  4PDZ A;  3WHT B;  4YI9 A;  3SG7 A;  1DGV A;  4AOM A;  3O6B A;  2ZKM X;  2JNX A;  2KYF A;  4MZK A;  2PAS A;  2NZ0 A;  1G8I A;  1OMV A;  4XJK A;  1KK7 Y;  2NLN A;  1G4Y R;  1TCO B;  2E6W A;  2BCB A;  1MF8 B;  1KK7 Z;  2ZRT A;  3KEV A;  1LIN A;  1MHO A;  2MA2 A;  1EH2 A;  1PAL A;  4GNK B;  3WXA A;  2K7D A;  1DMO A;  4A4C A;  2KSP A;  1XFY O;  2LLU A;  1FI6 A;  1IH0 A;  5HKZ A;  3ICB A;  2WCB A;  3SG3 A;  4HRH A;  3DVM A;  1OZO A;  2FCE A;  3TS5 C;  3GK2 A;  2MRD A;  1B7T Y;  3F45 A;  5I2Q A;  1U5I A;  2FOT A;  1UHK A;  1KQM C;  1MQ1 A;  1BU3 A;  4UPG A;  1YRT B;  4PE7 A;  2SAS A;  2F8P A;  1NPQ A;  4GGF A;  1XO5 A;  1ZAC A;  1TNX A;  1WLM A;  1XK4 C;  1S6J A;  1SPY A;  1CLM A;  2EC6 C;  2LLT A;  2JC2 A;  2G2B A;  3BUM B;  4ORA B;  2KI4 C;  1OMD A;  4PCW A;  4NDB A;  1R2U A;  2F33 A;  4YGC B;  2L50 A;  2H2K A;  2R2I A;  3LLE A;  3OX6 A;  4MLW A;  1SL8 A;  1XVJ A;  2KHN A;  1S3P A;  3OX5 A;  1J1E A;  1VRK A;  1NYA A;  1QIV A;  4D1E A;  4JQ0 D;  3EVV A;  2BCX A;  1SNL A;  1B8L A;  1AK8 A;  2KFF A;  3GOF A;  3D0Y B;  3VRQ A;  3I5H B;  2WOS A;  1K95 A;  1OMR A;  3VRR A;  2L0P A;  3IF7 A;  1KFX S;  1K9U A;  2LUX A;  4WQ2 A;  1DT7 B;  3LK0 A;  1KWO B;  1EG3 A;  3RM1 A;  1JUO A;  2LMV A;  1B1G A;  1S5G Z;  1KWO C;  4WQ3 A;  3NSK A;  3LK1 A;  1H8B A;  1GJY A;  1CFF A;  4YGE B;  3I5H C;  1DTL A;  2JWW A;  3E3R A;  2WCF A;  1NCY A;  1U5I B;  3PAT A;  1PRW A;  1N2D A;  1Y1U A;  4HSZ A;  4A4B A;  2L4I A;  2JTT A;  2E30 A;  5HKW A;  1HT9 A;  4M2Q A;  2LLS A;  1BMO A;  4CFR A;  3SG5 A;  4YRU A;  2MLF C;  3KF9 A;  2K2A A;  1WLZ A;  1JWD A;  1DF0 B;  2BBM A;  5CSF A;  2JOJ A;  1REC A;  1IRJ A;  1SY9 A;  2KGB C;  3CGA A;  2KI4 B;  3CTN A;  1CDM A;  1MR8 A;  1JBA A;  2RGI A;  2EC6 B;  1AJ5 A;  1J1D A;  1CDN A;  4DS7 A;  1UP5 A;  1KCY A;  4BY4 A;  1IWQ A;  1C7W A;  1Y1A A;  2COL B;  4OV2 A;  1F54 A;  1BT6 A;  1QXP A;  1BR4 B;  3BUN B;  3H4S E;  4AQI A;  1CDP A;  1CMF A;  5J3X A;  1KQM B;  5B8I B;  1KFU S;  1SCV A;  1SK6 D;  2CT9 A;  2JU0 A;  1Y1X A;  1NCZ A;  1YR5 A;  2WCE A;  3HCM A;  1AJ4 A;  1NP8 A;  1TNQ A;  1B9A A;  2BKH B;  4GAO A;  3BUW B;  1WRZ A;  4YI8 A;  3TS5 B;  3CWG A;  2PMY A;  4ZCV A;  1XA5 A;  2BE4 A;  1S1E A;  3EVU A;  2KAV A;  3BOW A;  3MSE B;  1YRU B;  4AQJ A;  5AFP A;  1Y6W A;  2HF5 A;  5AEQ A;  3AKA A;  1G33 A;  1QVI Y;  2K8M B;  5HLO A;  1QS7 A;  4FTG A;  2M8U A;  3EVR A;  5TNC A;  1CM1 A;  3LCP C;  1F70 A;  2M1K B;  2KI6 C;  1GGW A;  1K9P A;  1PSR A;  2MHH A;  1K96 A;  2KQY A;  4WRI A;  1YTZ C;  4L9M A;  1UUS A;  1KQV A;  3I5I C;  2KBM A;  3C1V A;  3EK4 A;  2OTG B;  4ICB A;  1FPW A;  1DF0 A;  1QX5 B;  2JPT A;  1DJX A;  1EL4 A;  2AUC A;  3PFV A;  3ZWH A;  1BLQ A;  1XFV O;  1SKT A;  1WY9 A;  1A4P A;  2F2P A;  1PUL A;  4TNC A;  2L2E A;  3SG2 A;  1A29 A;  1CMG A;  1XFW O;  1QTX A;  2LHL A;  3PAL A;  3BUO B;  1K93 D;  1XK4 A;  1FI5 A;  1SRA A;  1TTX A;  1M63 B;  1PVA A;  3GK4 X;  2M3W A;  3WHU B;  1UHJ A;  2QAC A;  1TCF A;  4GBA A;  2JRF A;  2F2O A;  2FJU B;  5HLV A;  1A75 A;  1M31 A;  4PE4 A;  1OZS A;  3I5G C;  2JQ6 A;  2CBL A;  4NDC A;  2M7N A;  3TDI A;  2I2R E;  1AVS A;  2AMI A;  2SCP A;  3EKJ A;  3OB2 B;  4PHJ A;  1QV1 A;  1QV0 A;  2JXL A;  2P6B B;  5FYX A;  2DOQ A;  1YX7 A;  2LVK A;  3CS1 A;  4N1F A;  4MVF A;  2Y4Q A;  1S26 D;  4C0L A;  3TUY C;  5DKR A;  1RJV A;  3BYA A;  1F71 A;  2BEC A;  2OS8 B;  2MAZ A;  1TOP A;  3IQO A;  5KTY A;  3VGO A;  1AUI B;  3EK8 A;  1NSH A;  4PE0 A;  3PLF B;  4C0K A;  2HPS A;  1OQP A;  1H4B A;  1NIW A;  5CSJ A;  2FCD A;  5PAL A;  3DD4 A;  2LV7 A;  2B1U A;  2KDH A;  1ZFS A;  5I8N A;  1YUU A;  1HQV A;  1DJH A;  3DVE A;  2LM5 A;  2I94 A;  1NX0 A;  3PN7 B;  2IS9 A;  4PAL A;  2KBI A;  3JTD C;  3CLN A;  2H61 C;  1F4O A;  2JT0 A;  1ALW A;  1J55 A;  1JF2 A;  1SBJ A;  1RFJ A;  4YBH B;  2MLE C;  3LL8 B;  1NUB A;  2VRG A;  5DKQ A;  2L51 A;  2JZI A;  1MXL C;  1SL7 A;  2G9B A;  3EK7 A;  2LC5 A;  2KNE A;  4P5O E;  4MRX A;  2M9G A;  1A03 A;  3FIA A;  3JVT C;  3WNX B;  1J7P A;  1KK8 B;  2JXC A;  3CR2 A;  5CSN A;  1PSB A;  2KYC A;  1XYD A;  4OVN F;  1S6C A;  4F0Z B;  1EG4 A;  1B8C A;  3AAK A;  4OR9 B;  1WDC B;  2M49 B;  2TN4 A;  1A75 B;  3DF0 A;  3VRO A;  4NDD A;  2BL0 B;  4ETO A;  1JSA A;  3NSO A;  2Y5I A;  2NCP A;  3ZNI A;  4I5L B;  1YVL A;  1ZOT B;  3I5F C;  2L4H A;  4ORC B;  1SR6 B;  5BPJ A;  1CFP A;  1FF1 A;  1TIZ A;  2ZRS A;  1WRL A;  1YUS A;  2ZND A;  4XYN A;  2ZNE A;  5GQQ C;  2LVI A;  1DJI A;  4MN0 A;  1BG1 A;  1EJ3 A;  2LNK A;  2CNP A;  4M2O A;  4GUK A;  1JF0 A;  4MBE A;  2K7B A;  2M29 A;  4PE1 A;  2M7L A;  2F3Z A;  2PAL A;  1K8U A;  4GFT A;  1EXR A;  3TDZ A;  3IQQ A;  1PVB A;  1F8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...