3BQ3A

Crystal structure of s. cerevisiae dcn1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
258
structure length
250
Chain Sequence
SPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGVAHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title Dcn1 Functions as a Scaffold-Type E3 Ligase for Cullin Neddylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle, ligase
total genus 80
structure length 250
sequence length 258
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3bq3A00
2M1UA 3EVUA 4NQGA 1CB1A 1RTP1 2H2KA 3VRRA 1KQVA 1L2OB 1RWYA 2KDHA 1IQ3A 1YURA 4C0JA 1XFZO 1DF0B 4DS7A 4N1FA 2GGMA 3GK1A 1SCVA 3D0YA 3VROA 2KBIA 3OB1B 1KQMC 2M9GA 3OP0A 3O6BA 4L9MA 2JTTA 3AKBA 4UPGA 1JF0A 2JXCA 4CIDA 4P5OE 2DOQA 2JT8A 1CDLA 5J3XA 1AJ4A 2RGIA 5CSIA 1PRWA 2KAXA 5CPVA 4HSZA 1NWDA 4JQ0D 5AANA 3GK4X 3TUYC 4PCWA 1KWOC 1AJ5A 3FS7A 2BBNA 3ZWHA 3TS5B 1KFXL 1J7QA 3KHEA 3JTDB 1SBJA 2WORA 1XFXO 1B8CA 1DTLA 2PSRA 3OHMB 2ISDA 2LNKA 1K96A 2LE9B 3DF0A 1S6CA 1QX7A 5ER5A 3CTNA 2PRUA 1UHHA 1W7JB 3CZTX 3LK1A 4NDDA 1MXEA 4C0LA 4PHKA 1AUIB 1K8UA 2NZ0A 5AERA 1MHOA 1BR4B 2L2EA 3EK8A 2G2BA 5CSNA 2I7AA 1W7IB 3DVEA 2JRFA 1MQ1A 4PHJA 1CFFA 3ZNIA 3DD4A 2M49B 2LVJA 2WCBA 4OV2A 1RFJA 1DVIA 1QTXA 4DRWA 1SL9A 1LINA 4NDBA 5G08A 3PN7B 1XFUO 1TCOB 3BUNB 3DVMA 1M31A 1SY9A 3AAJA 1CKKA 1LXFC 2KQYA 3HCMA 4OCIA 1SRAA 1KSMA 3K21A 2WOSA 2ZRTA 1S6JA 3MSEB 3SIBA 5PALA 1IWQA 1SR6B 1S26D 5I2LA 1UHJA 4QJ4B 3CR2A 1F8HA 3TDIA 2M1KB 4P2YB 2WCEA 4C0KA 3BOWB 1PULA 2QPTA 1IKUA 2L4HA 2R2IA 2KI4B 1K9PA 2OPOA 2OTGB 2Y4QA 4MZKA 1EG4A 1OMVA 2D8NA 2KYCA 2JNFA 4ORBB 1JWDA 1HT9A 1BLQA 3GOFA 4E68A 1PSBA 1OZOA 1FI5A 2FCDA 1CMFA 4GUKA 1C7VA 1TTXA 2BKIB 4ORCB 2LMUA 2LHLA 4GFTA 4YI9A 2KBMA 2KFGA 1SCMB 4MN0A 4PE1A 4HRHA 3CGAA 3NSKA 1B7TZ 1GQMA 5HLVA 3SG2A 3VRQA 1WLZA 3H4SE 1SL8A 5JOLA 5HKZA 3SIAA 3O2PA 1JUOA 1A29A 1PVBA 1MR8A 1CTRA 2KNEA 1QATA 1QXPA 4OR9B 1MXLC 3EKHA 1AVSA 1DJWA 1BT6A 1OMRA 3A8RA 1IJ5A 2COLB 1G4YR 2F33A 4PE4A 1N65A 2EGDA 1OE9B 4GPLB 2O60A 1OOJA 2FJUB 3WNXB 2TN4A 1QVIY 2Y5IA 2ZRSA 1OSAA 2PVBA 1EH2A 2EC6B 3RLZA 1CFCA 1SW8A 3ICBA 3BUWB 2ZFDA 3KF9A 1QX5B 1M46A 4MLWA 1Y1XA 2KHNA 2M97A 1U5IA 4F0ZB 1F71A 1TNPA 3TS5C 3VRPA 4YRUA 3JTDC 1IGVA 2E30A 1YUTA 3EK4A 1BR1B 1DJHA 1EG3A 1YUSA 2Q4UA 1NP8A 2I18A 3M0WA 1OZSA 1F55A 1S1EA 1FPWA 2L98A 2JT3A 3NSOA 1BF5A 1A2XA 3AAKA 1DJYA 1NYAA 4CLNA 5B8IB 1DJXA 5DKNA 5GQQC 1MWNA 1NIWA 2PMYA 3JVTB 4OKHA 2BL0B 4QJ5B 1KK7Z 1NUBA 1LVCD 1NSHA 2JQ6A 1QS7A 4I5JA 5AEQA 2M29A 4XYNA 1JFJA 4AOMA 2MA2A 1K94A 1BJFA 1FW4A 1XFWO 1B7TY 1NX0A 1YVLA 2K7OA 3GK2A 1V1FA 1FI6A 2NCOA 1XFYO 5HLOA 1BODA 3PN7C 2K7DA 4BY4A 1A75A 1OMDA 1GGWA 3OX5A 4D1EA 2K2AA 4PE0A 4AQIA 1LA3A 1L7ZA 2LVKA 2P6BB 5AXIA 1F4QA 1JSAA 3I5GB 1FF1A 2L5XB 1DF0A 2CCMA 2JULA 2KFFA 2L50A 2MJWB 1B9AA 4MZJA 1TNWA 1SKTA 2B1UA 2F2PA 5JJGA 1NCYA 1MF8B 1E8AA 1GGZA 3EVRA 2MAZA 1TCFA 2KI4C 3SJSA 2OTGC 1QIVA 4DIRA 3I5FB 1N2DA 1YUUA 1TNXA 2LUXA 2V53A 4I5LB 4PHNA 1Q80A 3VGOA 3I5IB 4GGFA 2LLSA 1WY9A 1UHKA 1DT7B 1H8BA 1SYMA 1DGUA 1AK8A 2LM5A 2CT9A 3D10A 1NPQA 4WQ3A 3KPXA 4N1GA 2BE4A 1SK6D 3CLNA 1QVIZ 3BUMB 1XFVO 1PVAA 2HETA 1CFDA 1G8IA 1XK4C 2F8PA 1ODBA 2LVIA 3WHUB 5KTYA 1CM1A 1KK7Y 2CXJA 3DVKA 4U8DA 4CFQA 1QX2A 2SCPA 2OS8B 2BBMA 1QIWA 1PK0D 2K61A 3FWCA 2JXLA 2MBXA 2H61C 2E6WA 1DJIA 2BCAA 2HQWA 4GBAA 1QV1A 3LCPC 1JC2A 1J7OA 2Y1MA 2ZNDA 2LUCA 1JFKA 2I94A 4ZCVA 3I5HB 4HREE 4MEWA 1UUSA 1XYDA 1KCYA 1CDMA 4M2PA 1M39A 1VRKA 5I2QA 1AP4A 5CSJA 1K93D 2ZN8A 2JTZA 2L0PA 2LLTA 1B8RA 1FBVA 4MBEA 1KK8B 5F6TA 2AMIA 2AUCA 4PALA 3FIAA 2Q91A 5HKYA 2KGRA 2LV7A 1WDCB 3OB2B 2KGBC 3QRXA 1LKJA 5D69A 1NCXA 5DKQA 2LLUA 1L2OC 4XJKA 1JF2A 1X02A 1NX3A 1C7WA 1XO5A 2JNXA 3BXKA 1UWOA 2WNDA 1B8LA 3BOWA 2BCBA 1TN4A 2Y1NA 3JVTC 1CLMA 2BL0C 1U5IB 4ICBA 3TZ1A 3NSLA 2FOTA 2M7NA 4HRGA 1B1GA 1EXRA 4YGAA 4DCKA 1QV0A 4PE7A 2HQ8A 2M3WA 4MRYA 1BU3A 4I5NB 5IBWA 4A4CA 1J1EA 1SMGA 4BY5A 2I2RE 1B4CA 4R1EA 2EHBA 2KAVA 3D0YB 3EVVA 1WRZA 3CS1A 3NXAA 1J1DA 2LANA 1S3PA 1UHIA 3FWBA 4ETOA 1DJZA 2MLEC 1F54A 1DMOA 1UHNA 1D1OA 5CSFA 1DJGA 1ZFSA 1TNQA 1Y6WA 1EL4A 3I5GC 5ER4X 2LCPA 3CWGA 2ZN9A 1ALWA 1TIZA 2H61A 3CR4X 1K9KA 1S5GZ 5TNCA 1KSOA 1MUXA 2JU0A 5HKWA 1KFUS 5FYXA 4OVNF 4MRXA 1BOCA 1H4BA 2CTNA 2JPTA 3IF7A 1BMOA 2KI6C 1LA0A 2FCEA 1ALVA 1RK9A 2BKHB 2LP2A 3I5FC 3C1VA 3SG6A 2AAOA 3DF0B 2JZIA 3I5IC 4YBHB 1F70A 1CMGA 1TOPA 1SPYA 2KOTA 3IQQA 4GAOA 1YTZC 1IQ5A 4JWQA 3WHTB 2MLFC 1CDPA 2LP3A 4NDCA 4FTGA 1Y1AA 3NSIA 1RECA 2MHHA 3VRNA 2CNPA 1M63B 1A4PA 4CFRA 1SR6C 1F4OA 2KFHA 1A03A 1WLMA 3LK0A 2HPSA 2JC2A 2HF5A 2OS8C 4M2QA 2LC5A 2M0RA 4GGNA 2PASA 2K0JA 3AKAA 1K90D 1KFUL 4MVFA 1CLBA 3I5HC 1XA5A 2CBLA 1AHRA 1B47A 2NLNA 1YR5A 2ZKMX 1G33A 4MZLA 3BUOB 4A4BA 1R2UA 3IQOA 2NXQA 1V1GA 3CR5X 1NX1A 1KK8C 1KQMB 1XVJA 1S36A 1YX8A 1ZMZA 2NCPA 3LLEA 2F2OA 3KO0A 1ZUZA 2K7CA 1WDCC 1J55A 1SCMC 1S5GY 1SNLA 3BYAA 5KSZA 4ORAB 4AQJA 4WRIA 1IJ6A 2L51A 1IG5A 2BE6A 3TDUA 2F3YA 2KYFA 1UP5A 3TUYB 1CFPA 3PALA 2KQ6A 1KWOB 4I5KA 4JPZB 4M2OA 1PSRA 2G9BA 2QACA 3SG7A 1RJVA 5DKRA 4YGBB 1BG1A 1IRJA 2K2FA 1QASA 3O4YA 5K89A 1IH0A 5AFPA 3BUXB 4USLA 1C07A 3O78A 1CDNA 2L4IA 3RM1A 2PALA 2K7BA 1NCZA 2GGZA 1M45A 1SL7A 4XJKB 1RROA 1TRFA 2EC6C 2LHIA 3E3RA 4YI8A 2GV5A 3PFVA 2LVVA 3SG5A 1S6IA 1QLSA 5KU1A 2A4JA 4Q04A 2LMTA 1R6PA 2LMVA 4FQOA 1NX2A 2JWWA 1GJYA 2VRGA 4DUQA 4YGDB 4QJ3B 2MRDA 4MSPA 3EK7A 2IS9A 2SASA 4YGEB 1J7RA 3DVJA 2M7LA 5HYDA 3KEVA 3PSRA 4N5XA 1PALA 3OX6A 2JT0A 1ZOTB 1YVHA 3EKJA 4CPVA 2WCFA 1QJTA 2M8UA 4IL1A 5D7FA 1J7PA 4YGCB 3WXAA 1CNPA 5I8NA 2LAPA 3SG3A 2KAYA 4TNCA 1DGVA 1CLLA 1Y0VH 1K9UA 1N0YA 5I2OA 3LL8B 3PATA 1YX7A 2KSPA 2BECA 2ZNEA 1EJ3A 1WRKA 1XK4A 4ZCUA 3SG4A 4PHMA 1JBAA 1QLKA 1Y1UA 2WC8A 3F45A 1YRTB 1YRUB 4PDZA 3TDZA 4GNKB 2O5GA 3PLFB 1HQVA 2BCXA 4WQ2A 1OQPA 1UURA 1ZACA 1WRLA 5BPJA 1CM4A 3BQ3A 3A4UB 3PM8A 4GGFC 1KFXS 2K8MB 1K2HA 2F3ZA 2KI6D 1K95A 1A75B 3HX4A 2JOJA
chains in the Genus database with same CATH superfamily
2M1UA 3EVUA 1DEKA 4NQGA 1CB1A 1RTP1 2H2KA 3VRRA 1KQVA 1L2OB 3L47A 1RWYA 2KDHA 1IQ3A 1YURA 3CYZA 1XFZO 4PT1A 2WC6A 4C0JA 1DF0B 4DS7A 4N1FA 2GGMA 3GK1A 1SCVA 3D0YA 3VROA 2KBIA 3OB1B 1KQMC 2M9GA 3OP0A 3O6BA 4L9MA 2WCKA 2JTTA 3AKBA 4UPGA 1JF0A 2JXCA 4CIDA 4P5OE 2DOQA 2JT8A 5FI6A 1CDLA 5J3XA 1AJ4A 2RGIA 5CSIA 1PRWA 2KAXA 5CPVA 4HSZA 1NWDA 4JQ0D 5AANA 3GK4X 3TUYC 4PCWA 1KWOC 1AJ5A 3FS7A 2BBNA 3ZWHA 3TS5B 1KFXL 1J7QA 3KHEA 3JTDB 1SBJA 2WORA 1XFXO 1B8CA 1DTLA 3Q8IA 2KPHA 2PSRA 3OHMB 2ISDA 2LNKA 1K96A 2LE9B 3DF0A 1S6CA 2QDIA 1QX7A 5ER5A 3CTNA 2PRUA 1UHHA 1W7JB 3CZTX 3LK1A 2QEBA 4NDDA 1MXEA 4C0LA 4PHKA 1AUIB 1K8UA 2NZ0A 5AERA 5FI2A 3UO9A 1MHOA 1BR4B 2L2EA 2QEHA 3EK8A 2G2BA 5CSNA 2I7AA 1W7IB 3DVEA 2JRFA 1MQ1A 4PHJA 1CFFA 3ZNIA 3DD4A 2M49B 2LVJA 2WCBA 4OV2A 1RFJA 3QMEA 1DVIA 1QTXA 4DRWA 1SL9A 1LINA 4NDBA 5G08A 3PN7B 1XFUO 1TCOB 3B6XA 3BUNB 3DVMA 1M31A 1SY9A 3NHTA 3AAJA 1CKKA 1LXFC 5HL1A 2KQYA 3HCMA 3R1PA 4JD9A 1SRAA 4OCIA 1KSMA 3K21A 2WOSA 2ZRTA 1S6JA 3MSEB 3SIBA 5PALA 1IWQA 1SR6B 1S26D 5I2LA 1UHJA 2L2CA 2WCLA 4QJ4B 3CR2A 1F8HA 1QWVA 3TDIA 2M1KB 4P2YB 2WCEA 4C0KA 3BOWB 1PULA 2QPTA 1IKUA 2L4HA 2R2IA 2KI4B 1K9PA 2OPOA 2OTGB 2Y4QA 4MZKA 3S0GA 1EG4A 1OMVA 2D8NA 2KYCA 2JNFA 4ORBB 1JWDA 1HT9A 1BLQA 3GOFA 4E68A 1PSBA 1OZOA 1FI5A 2FCDA 1CMFA 4GUKA 3DY9A 1C7VA 1TTXA 2BKIB 4ORCB 2LMUA 3VB1A 2LHLA 4GFTA 4YI9A 2KBMA 2KFGA 1SCMB 2QEVA 4MN0A 4HRHA 3CGAA 3NSKA 4PE1A 1B7TZ 1GQMA 5HLVA 3SG2A 3VRQA 1C3ZA 5I94A 1WLZA 3H4SE 1SL8A 5JOLA 5HKZA 3BFHA 3O2PA 1JUOA 1A29A 3SIAA 1PVBA 1MR8A 2P71A 2WCHA 1CTRA 2KNEA 1QATA 1QXPA 4OR9B 1MXLC 3EKHA 1AVSA 1DJWA 1BT6A 1OMRA 3A8RA 1IJ5A 2COLB 1DC1A 4KYNA 1G4YR 2F33A 4PE4A 1N65A 2EGDA 1OE9B 4GPLB 2O60A 1OOJA 2FJUB 3WNXB 2TN4A 1QVIY 2Y5IA 2ZRSA 3S0EA 1OSAA 2PVBA 1EH2A 2EC6B 3RLZA 1CFCA 1SW8A 3ICBA 3BUWB 2ZFDA 3D73A 1QX5B 3KF9A 1M46A 1OOIX 4MLWA 1Y1XA 2KHNA 2M97A 1U5IA 4F0ZB 1F71A 1TNPA 3TS5C 3VRPA 3DXLA 3JTDC 4YRUA 1IGVA 2E30A 1YUTA 3BJHA 3K1EA 3EK4A 1BR1B 1DJHA 1EG3A 1YUSA 2Q4UA 1NP8A 2I18A 3M0WA 1OZSA 1F55A 1S1EA 1FPWA 2L98A 3CZ2A 3S0DA 2JT3A 3NSOA 1BF5A 1A2XA 3DYEA 3AAKA 4FQTA 1DJYA 1NYAA 4CLNA 5B8IB 1DJXA 5DKNA 5GQQC 1MWNA 1NIWA 2PMYA 3B87A 3JVTB 4OKHA 1TUZA 2BL0B 4QJ5B 1KK7Z 1NUBA 1LVCD 1NSHA 2JQ6A 1QS7A 4I5JA 5AEQA 2M29A 4XYNA 3BFAA 5FI7A 1JFJA 2WC5A 4AOMA 2MA2A 1K94A 1BJFA 1FW4A 1XFWO 1B7TY 1NX0A 1YVLA 2K7OA 2QEOA 3CDNA 1V1FA 3GK2A 3OBVA 1FI6A 2NCOA 1XFYO 5HLOA 1BODA 3PM2A 3PN7C 1OOGA 2K7DA 3CABA 4BY4A 1A75A 1OMDA 1GGWA 3OX5A 4D1EA 2K2AA 4PE0A 4AQIA 1LA3A 4INXA 1L7ZA 2LVKA 2P6BB 5AXIA 1F4QA 3R1OA 1JSAA 3I5GB 1FF1A 2L5XB 1DF0A 2CCMA 2JULA 2KFFA 2L50A 2MJWB 1B9AA 4MZJA 1OOHA 1TNWA 1SKTA 2ERBA 2B1UA 2F2PA 5D3OA 1NCYA 1MF8B 1E8AA 5JJGA 1GGZA 3EVRA 2MAZA 1TCFA 3OGNA 2KI4C 3SJSA 2OTGC 1QIVA 4DIRA 3I5FB 1N2DA 1YUUA 1TNXA 2LUXA 2V53A 4I5LB 4PHNA 1Q80A 3VGOA 3RZSA 3I5IB 3SS4A 4GGFA 2LLSA 1WY9A 1UHKA 1DT7B 1H8BA 1SYMA 1DGUA 1AK8A 3TDZA 4JKTA 2LM5A 2CT9A 3D10A 1NPQA 4WQ3A 3KPXA 4N1GA 2BE4A 3L4LA 1SK6D 3CLNA 1QVIZ 3BUMB 5EL2A 1XFVO 1PVAA 2HETA 1CFDA 1G8IA 3SS5A 1W9ZA 1XK4C 1ODBA 2F8PA 2LVIA 3B86A 3UNWA 3WHUB 5KTYA 1IIOA 1CM1A 1KK7Y 2CXJA 3DVKA 4U8DA 4CFQA 1QX2A 2SCPA 1DQEA 2OS8B 2BBMA 1QIWA 1PK0D 2K61A 3FWCA 2JXLA 2MBXA 2H61C 2E6WA 1DJIA 2BCAA 2HQWA 4GBAA 1QV1A 3LCPC 1JC2A 1J7OA 2Y1MA 2ZNDA 2LUCA 1JFKA 2I94A 4ZCVA 3I5HB 3FE6A 4HREE 3V2LA 4MEWA 1UUSA 1XYDA 1KCYA 1CDMA 4M2PA 1M39A 1VRKA 5I2QA 1AP4A 5CSJA 1K93D 2ZN8A 2JTZA 2WCMA 3CZ1A 2L0PA 2LLTA 1B8RA 1FBVA 4MBEA 1KK8B 5F6TA 2AMIA 2AUCA 4PALA 3FIAA 2H8VA 2Q91A 2KGRA 2LV7A 5HKYA 1WDCB 3SS3A 3OB2B 2KGBC 1LS8A 3QRXA 1LKJA 5D69A 1NCXA 5DKQA 2LLUA 1L2OC 4XJKA 1JF2A 1X02A 1ORGA 1NX3A 3N7HA 1C7WA 1XO5A 2JNXA 3BXKA 1UWOA 2WNDA 1B8LA 3BOWA 2BCBA 1TN4A 2Y1NA 3JVTC 1CLMA 2BL0C 1U5IB 4ICBA 3TZ1A 3NSLA 1SSEB 2FOTA 2M7NA 4HRGA 1B1GA 1EXRA 4YGAA 4DCKA 1QV0A 4PE7A 2HQ8A 2M3WA 4MRYA 1BU3A 4I5NB 5IBWA 4A4CA 1J1EA 1SMGA 3L4AA 2I2RE 4BY5A 1B4CA 4R1EA 2EHBA 2KAVA 3D0YB 3EVVA 1WRZA 3CS1A 3NXAA 1J1DA 2LANA 1S3PA 1UHIA 3FWBA 3IVTA 1DJZA 2MLEC 4ETOA 1F54A 1DMOA 1UHNA 1D1OA 5CSFA 1DJGA 1ZFSA 3BFBA 1TNQA 1Y6WA 1EL4A 3D75A 3I5GC 2LCPA 5ER4X 3CWGA 2ZN9A 1ALWA 1TIZA 1T14A 2H61A 1K9KA 1S5GZ 3CR4X 5TNCA 1KSOA 1MUXA 2JU0A 3R72A 5HKWA 1KFUS 3D77A 5FYXA 4OVNF 4MRXA 1BOCA 1H4BA 2CTNA 2JPTA 3IF7A 1BMOA 3S0AA 2KI6C 1LA0A 2FCEA 1ALVA 1P28A 1RK9A 2BKHB 2LP2A 3I5FC 3C1VA 3SG6A 2AAOA 3DF0B 2JZIA 3I5IC 4YBHB 1F70A 1CMGA 1TOPA 1SPYA 2KOTA 3IQQA 4GAOA 1YTZC 4IJ7A 1IQ5A 4JWQA 3WHTB 2MLFC 1CDPA 2LP3A 4NDCA 4FTGA 1Y1AA 3B7AA 1RECA 3NSIA 2MHHA 3VRNA 2CNPA 1M63B 1A4PA 3S0BA 4CFRA 1SR6C 1F4OA 2KFHA 1A03A 1WLMA 3LK0A 1Z4HA 2HPSA 2JC2A 2HF5A 2OS8C 4M2QA 2LC5A 2M0RA 4GGNA 2PASA 2K0JA 3AKAA 3O4XA 1K90D 1DELA 1KFUL 4MVFA 1CLBA 1JBAA 3I5HC 1XA5A 2CBLA 1AHRA 1B47A 2NLNA 1YR5A 2ZKMX 1G33A 4MZLA 3BUOB 4INWA 4A4BA 1R2UA 3IQOA 2NXQA 1V1GA 3CR5X 1NX1A 1KK8C 1KQMB 1XVJA 1S36A 1YX8A 1ZMZA 2NCPA 3LLEA 2F2OA 3KO0A 1ZUZA 2K60A 2K7CA 2WCJA 1WDCC 1J55A 1SCMC 1S5GY 1SNLA 3BYAA 5KSZA 1Z2CB 4ORAB 4AQJA 4WRIA 1IJ6A 2FJYA 2L51A 1IG5A 2BE6A 3TDUA 2F3YA 2KLDA 1UP5A 2KLEA 2KYFA 1TUJA 3TUYB 3R1VA 3PALA 2KQ6A 1KWOB 4I5KA 1CFPA 4JPZB 1XFRA 4M2OA 1PSRA 2G9BA 2QACA 3SG7A 1RJVA 5DKRA 4YGBB 1BG1A 1IRJA 2K2FA 1QASA 3O4YA 5K89A 1IH0A 5AFPA 3BUXB 4USLA 1C07A 3O78A 1CDNA 2L4IA 3RM1A 2PALA 2K7BA 5DICA 2PYQA 1NCZA 2GGZA 1M45A 1SL7A 4XJKB 1RROA 1TRFA 2EC6C 2LHIA 3E3RA 4YI8A 2GV5A 3PFVA 2LVVA 3SG5A 1S6IA 1QLSA 5KU1A 2A4JA 3S0FA 2YGUA 4Q04A 2LMTA 1R6PA 2LMVA 3D78A 3FE9A 2JPOA 4FQOA 1NX2A 2JWWA 1OOFA 1GJYA 2VRGA 4DUQA 4YGDB 4QJ3B 2MRDA 4MSPA 3EK7A 2IS9A 2SASA 4YGEB 1J7RA 3DVJA 2M7LA 5HYDA 3KEVA 3PJIA 3PSRA 4N5XA 1PALA 3OX6A 2JT0A 1ZOTB 1YVHA 3EKJA 4CPVA 2WCFA 1QJTA 2M8UA 4IL1A 5D7FA 1J7PA 3FE8A 3D74A 4YGCB 3WXAA 1CNPA 1OW4A 5I8NA 4OZDA 2LAPA 3SG3A 2KAYA 3CZ0A 3NGVA 4TNCA 1DGVA 1CLLA 1Y0VH 2BNXA 1K9UA 3D76A 1N0YA 1GM0A 5I2OA 3LL8B 3PATA 4F7FA 1YX7A 2KSPA 3NHIA 2BECA 2ZNEA 3EG5B 1EJ3A 1WRKA 1XK4A 4ZCUA 3SG4A 4PHMA 1C3YA 1QLKA 1Y1UA 2BAPA 2WC8A 1YRTB 1YRUB 2PQLA 3F45A 4PDZA 2P70A 2O5GA 3PLFB 4GNKB 1HQVA 2BCXA 4WQ2A 3B88A 1OQPA 1TWOA 1UURA 1ZACA 1WRLA 5BPJA 1CM4A 2L5YA 3BQ3A 3A4UB 3PM8A 4GGFC 1KFXS 2GTEA 3DZTA 2K8MB 1K2HA 2F3ZA 2KI6D 1K95A 1A75B 3HX4A 2JOJA
chains in the Genus database with same CATH topology
2M1UA 3EVUA 4NQGA 1CB1A 1RTP1 2H2KA 3VRRA 1KQVA 1L2OB 1RWYA 2KDHA 1IQ3A 1YURA 4C0JA 1XFZO 1DF0B 4DS7A 4N1FA 2GGMA 3GK1A 1SCVA 3D0YA 3VROA 2KBIA 3OB1B 1KQMC 2M9GA 3OP0A 3O6BA 4L9MA 2JTTA 3AKBA 4UPGA 1JF0A 2JXCA 4CIDA 4P5OE 2DOQA 2JT8A 1CDLA 5J3XA 1AJ4A 2RGIA 5CSIA 1PRWA 2KAXA 5CPVA 4HSZA 1NWDA 4JQ0D 5AANA 3GK4X 3TUYC 4PCWA 1KWOC 1AJ5A 3FS7A 2BBNA 3ZWHA 3TS5B 1KFXL 1J7QA 3KHEA 3JTDB 1SBJA 2WORA 1XFXO 1B8CA 1DTLA 2PSRA 3OHMB 2ISDA 2LNKA 1K96A 2LE9B 3DF0A 1S6CA 1QX7A 5ER5A 3CTNA 2PRUA 1UHHA 1W7JB 3CZTX 3LK1A 4NDDA 1MXEA 4C0LA 4PHKA 1AUIB 1K8UA 2NZ0A 5AERA 1MHOA 1BR4B 2L2EA 3EK8A 2G2BA 5CSNA 2I7AA 1W7IB 3DVEA 2JRFA 1MQ1A 4PHJA 1CFFA 3ZNIA 3DD4A 2M49B 2LVJA 2WCBA 4OV2A 1RFJA 1DVIA 1QTXA 4DRWA 1SL9A 1LINA 4NDBA 5G08A 3PN7B 1XFUO 1TCOB 3BUNB 3DVMA 1M31A 1SY9A 3AAJA 1CKKA 1LXFC 2KQYA 3HCMA 4OCIA 1SRAA 1KSMA 3K21A 2WOSA 2ZRTA 1S6JA 3MSEB 3SIBA 5PALA 1IWQA 1SR6B 1S26D 5I2LA 1UHJA 4QJ4B 3CR2A 1F8HA 3TDIA 2M1KB 4P2YB 2WCEA 4C0KA 3BOWB 1PULA 2QPTA 1IKUA 2L4HA 2R2IA 2KI4B 1K9PA 2OPOA 2OTGB 2Y4QA 4MZKA 1EG4A 1OMVA 2D8NA 2KYCA 2JNFA 4ORBB 1JWDA 1HT9A 1BLQA 3GOFA 4E68A 1PSBA 1OZOA 1FI5A 2FCDA 1CMFA 4GUKA 1C7VA 1TTXA 2BKIB 4ORCB 2LMUA 2LHLA 4GFTA 4YI9A 2KBMA 2KFGA 1SCMB 4MN0A 4PE1A 4HRHA 3CGAA 3NSKA 1B7TZ 1GQMA 5HLVA 3SG2A 3VRQA 1WLZA 3H4SE 1SL8A 5JOLA 5HKZA 3SIAA 3O2PA 1JUOA 1A29A 1PVBA 1MR8A 1CTRA 2KNEA 1QATA 1QXPA 4OR9B 1MXLC 3EKHA 1AVSA 1DJWA 1BT6A 1OMRA 3A8RA 1IJ5A 2COLB 1G4YR 2F33A 4PE4A 1N65A 2EGDA 1OE9B 4GPLB 2O60A 1OOJA 2FJUB 3WNXB 2TN4A 1QVIY 2Y5IA 2ZRSA 1OSAA 2PVBA 1EH2A 2EC6B 3RLZA 1CFCA 1SW8A 3ICBA 3BUWB 2ZFDA 3KF9A 1QX5B 1M46A 4MLWA 1Y1XA 2KHNA 2M97A 1U5IA 4F0ZB 1F71A 1TNPA 3TS5C 3VRPA 4YRUA 3JTDC 1IGVA 2E30A 1YUTA 3EK4A 1BR1B 1DJHA 1EG3A 1YUSA 2Q4UA 1NP8A 2I18A 3M0WA 1OZSA 1F55A 1S1EA 1FPWA 2L98A 2JT3A 3NSOA 1BF5A 1A2XA 3AAKA 1DJYA 1NYAA 4CLNA 5B8IB 1DJXA 5DKNA 5GQQC 1MWNA 1NIWA 2PMYA 3JVTB 4OKHA 2BL0B 4QJ5B 1KK7Z 1NUBA 1LVCD 1NSHA 2JQ6A 1QS7A 4I5JA 5AEQA 2M29A 4XYNA 1JFJA 4AOMA 2MA2A 1K94A 1BJFA 1FW4A 1XFWO 1B7TY 1NX0A 1YVLA 2K7OA 3GK2A 1V1FA 1FI6A 2NCOA 1XFYO 5HLOA 1BODA 3PN7C 2K7DA 4BY4A 1A75A 1OMDA 1GGWA 3OX5A 4D1EA 2K2AA 4PE0A 4AQIA 1LA3A 1L7ZA 2LVKA 2P6BB 5AXIA 1F4QA 1JSAA 3I5GB 1FF1A 2L5XB 1DF0A 2CCMA 2JULA 2KFFA 2L50A 2MJWB 1B9AA 4MZJA 1TNWA 1SKTA 2B1UA 2F2PA 5JJGA 1NCYA 1MF8B 1E8AA 1GGZA 3EVRA 2MAZA 1TCFA 2KI4C 3SJSA 2OTGC 1QIVA 4DIRA 3I5FB 1N2DA 1YUUA 1TNXA 2LUXA 2V53A 4I5LB 4PHNA 1Q80A 3VGOA 3I5IB 4GGFA 2LLSA 1WY9A 1UHKA 1DT7B 1H8BA 1SYMA 1DGUA 1AK8A 2LM5A 2CT9A 3D10A 1NPQA 4WQ3A 3KPXA 4N1GA 2BE4A 1SK6D 3CLNA 1QVIZ 3BUMB 1XFVO 1PVAA 2HETA 1CFDA 1G8IA 1XK4C 2F8PA 1ODBA 2LVIA 3WHUB 5KTYA 1CM1A 1KK7Y 2CXJA 3DVKA 4U8DA 4CFQA 1QX2A 2SCPA 2OS8B 2BBMA 1QIWA 1PK0D 2K61A 3FWCA 2JXLA 2MBXA 2H61C 2E6WA 1DJIA 2BCAA 2HQWA 4GBAA 1QV1A 3LCPC 1JC2A 1J7OA 2Y1MA 2ZNDA 2LUCA 1JFKA 2I94A 4ZCVA 3I5HB 4HREE 4MEWA 1UUSA 1XYDA 1KCYA 1CDMA 4M2PA 1M39A 1VRKA 5I2QA 1AP4A 5CSJA 1K93D 2ZN8A 2JTZA 2L0PA 2LLTA 1B8RA 1FBVA 4MBEA 1KK8B 5F6TA 2AMIA 2AUCA 4PALA 3FIAA 2Q91A 5HKYA 2KGRA 2LV7A 1WDCB 3OB2B 2KGBC 3QRXA 1LKJA 5D69A 1NCXA 5DKQA 2LLUA 1L2OC 4XJKA 1JF2A 1X02A 1NX3A 1C7WA 1XO5A 2JNXA 3BXKA 1UWOA 2WNDA 1B8LA 3BOWA 2BCBA 1TN4A 2Y1NA 3JVTC 1CLMA 2BL0C 1U5IB 4ICBA 3TZ1A 3NSLA 2FOTA 2M7NA 4HRGA 1B1GA 1EXRA 4YGAA 4DCKA 1QV0A 4PE7A 2HQ8A 2M3WA 4MRYA 1BU3A 4I5NB 5IBWA 4A4CA 1J1EA 1SMGA 4BY5A 2I2RE 1B4CA 4R1EA 2EHBA 2KAVA 3D0YB 3EVVA 1WRZA 3CS1A 3NXAA 1J1DA 2LANA 1S3PA 1UHIA 3FWBA 4ETOA 1DJZA 2MLEC 1F54A 1DMOA 1UHNA 1D1OA 5CSFA 1DJGA 1ZFSA 1TNQA 1Y6WA 1EL4A 3I5GC 5ER4X 2LCPA 3CWGA 2ZN9A 1ALWA 1TIZA 2H61A 3CR4X 1K9KA 1S5GZ 5TNCA 1KSOA 1MUXA 2JU0A 5HKWA 1KFUS 5FYXA 4OVNF 4MRXA 1BOCA 1H4BA 2CTNA 2JPTA 3IF7A 1BMOA 2KI6C 1LA0A 2FCEA 1ALVA 1RK9A 2BKHB 2LP2A 3I5FC 3C1VA 3SG6A 2AAOA 3DF0B 2JZIA 3I5IC 4YBHB 1F70A 1CMGA 1TOPA 1SPYA 2KOTA 3IQQA 4GAOA 1YTZC 1IQ5A 4JWQA 3WHTB 2MLFC 1CDPA 2LP3A 4NDCA 4FTGA 1Y1AA 3NSIA 1RECA 2MHHA 3VRNA 2CNPA 1M63B 1A4PA 4CFRA 1SR6C 1F4OA 2KFHA 1A03A 1WLMA 3LK0A 2HPSA 2JC2A 2HF5A 2OS8C 4M2QA 2LC5A 2M0RA 4GGNA 2PASA 2K0JA 3AKAA 1K90D 1KFUL 4MVFA 1CLBA 3I5HC 1XA5A 2CBLA 1AHRA 1B47A 2NLNA 1YR5A 2ZKMX 1G33A 4MZLA 3BUOB 4A4BA 1R2UA 3IQOA 2NXQA 1V1GA 3CR5X 1NX1A 1KK8C 1KQMB 1XVJA 1S36A 1YX8A 1ZMZA 2NCPA 3LLEA 2F2OA 3KO0A 1ZUZA 2K7CA 1WDCC 1J55A 1SCMC 1S5GY 1SNLA 3BYAA 5KSZA 4ORAB 4AQJA 4WRIA 1IJ6A 2L51A 1IG5A 2BE6A 3TDUA 2F3YA 2KYFA 1UP5A 3TUYB 1CFPA 3PALA 2KQ6A 1KWOB 4I5KA 4JPZB 4M2OA 1PSRA 2G9BA 2QACA 3SG7A 1RJVA 5DKRA 4YGBB 1BG1A 1IRJA 2K2FA 1QASA 3O4YA 5K89A 1IH0A 5AFPA 3BUXB 4USLA 1C07A 3O78A 1CDNA 2L4IA 3RM1A 2PALA 2K7BA 1NCZA 2GGZA 1M45A 1SL7A 4XJKB 1RROA 1TRFA 2EC6C 2LHIA 3E3RA 4YI8A 2GV5A 3PFVA 2LVVA 3SG5A 1S6IA 1QLSA 5KU1A 2A4JA 4Q04A 2LMTA 1R6PA 2LMVA 4FQOA 1NX2A 2JWWA 1GJYA 2VRGA 4DUQA 4YGDB 4QJ3B 2MRDA 4MSPA 3EK7A 2IS9A 2SASA 4YGEB 1J7RA 3DVJA 2M7LA 5HYDA 3KEVA 3PSRA 4N5XA 1PALA 3OX6A 2JT0A 1ZOTB 1YVHA 3EKJA 4CPVA 2WCFA 1QJTA 2M8UA 4IL1A 5D7FA 1J7PA 4YGCB 3WXAA 1CNPA 5I8NA 2LAPA 3SG3A 2KAYA 4TNCA 1DGVA 1CLLA 1Y0VH 1K9UA 1N0YA 5I2OA 3LL8B 3PATA 1YX7A 2KSPA 2BECA 2ZNEA 1EJ3A 1WRKA 1XK4A 4ZCUA 3SG4A 4PHMA 1JBAA 1QLKA 1Y1UA 2WC8A 3F45A 1YRTB 1YRUB 4PDZA 3TDZA 4GNKB 2O5GA 3PLFB 1HQVA 2BCXA 4WQ2A 1OQPA 1UURA 1ZACA 1WRLA 5BPJA 1CM4A 3BQ3A 3A4UB 3PM8A 4GGFC 1KFXS 2K8MB 1K2HA 2F3ZA 2KI6D 1K95A 1A75B 3HX4A 2JOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1U A;  3EVU A;  4NQG A;  1CB1 A;  1RTP 1;  2H2K A;  3VRR A;  1KQV A;  1L2O B;  1RWY A;  2KDH A;  1IQ3 A;  1YUR A;  4C0J A;  1XFZ O;  1DF0 B;  4DS7 A;  4N1F A;  2GGM A;  3GK1 A;  1SCV A;  3D0Y A;  3VRO A;  2KBI A;  3OB1 B;  1KQM C;  2M9G A;  3OP0 A;  3O6B A;  4L9M A;  2JTT A;  3AKB A;  4UPG A;  1JF0 A;  2JXC A;  4CID A;  4P5O E;  2DOQ A;  2JT8 A;  1CDL A;  5J3X A;  1AJ4 A;  2RGI A;  5CSI A;  1PRW A;  2KAX A;  5CPV A;  4HSZ A;  1NWD A;  4JQ0 D;  5AAN A;  3GK4 X;  3TUY C;  4PCW A;  1KWO C;  1AJ5 A;  3FS7 A;  2BBN A;  3ZWH A;  3TS5 B;  1KFX L;  1J7Q A;  3KHE A;  3JTD B;  1SBJ A;  2WOR A;  1XFX O;  1B8C A;  1DTL A;  2PSR A;  3OHM B;  2ISD A;  2LNK A;  1K96 A;  2LE9 B;  3DF0 A;  1S6C A;  1QX7 A;  5ER5 A;  3CTN A;  2PRU A;  1UHH A;  1W7J B;  3CZT X;  3LK1 A;  4NDD A;  1MXE A;  4C0L A;  4PHK A;  1AUI B;  1K8U A;  2NZ0 A;  5AER A;  1MHO A;  1BR4 B;  2L2E A;  3EK8 A;  2G2B A;  5CSN A;  2I7A A;  1W7I B;  3DVE A;  2JRF A;  1MQ1 A;  4PHJ A;  1CFF A;  3ZNI A;  3DD4 A;  2M49 B;  2LVJ A;  2WCB A;  4OV2 A;  1RFJ A;  1DVI A;  1QTX A;  4DRW A;  1SL9 A;  1LIN A;  4NDB A;  5G08 A;  3PN7 B;  1XFU O;  1TCO B;  3BUN B;  3DVM A;  1M31 A;  1SY9 A;  3AAJ A;  1CKK A;  1LXF C;  2KQY A;  3HCM A;  4OCI A;  1SRA A;  1KSM A;  3K21 A;  2WOS A;  2ZRT A;  1S6J A;  3MSE B;  3SIB A;  5PAL A;  1IWQ A;  1SR6 B;  1S26 D;  5I2L A;  1UHJ A;  4QJ4 B;  3CR2 A;  1F8H A;  3TDI A;  2M1K B;  4P2Y B;  2WCE A;  4C0K A;  3BOW B;  1PUL A;  2QPT A;  1IKU A;  2L4H A;  2R2I A;  2KI4 B;  1K9P A;  2OPO A;  2OTG B;  2Y4Q A;  4MZK A;  1EG4 A;  1OMV A;  2D8N A;  2KYC A;  2JNF A;  4ORB B;  1JWD A;  1HT9 A;  1BLQ A;  3GOF A;  4E68 A;  1PSB A;  1OZO A;  1FI5 A;  2FCD A;  1CMF A;  4GUK A;  1C7V A;  1TTX A;  2BKI B;  4ORC B;  2LMU A;  2LHL A;  4GFT A;  4YI9 A;  2KBM A;  2KFG A;  1SCM B;  4MN0 A;  4PE1 A;  4HRH A;  3CGA A;  3NSK A;  1B7T Z;  1GQM A;  5HLV A;  3SG2 A;  3VRQ A;  1WLZ A;  3H4S E;  1SL8 A;  5JOL A;  5HKZ A;  3SIA A;  3O2P A;  1JUO A;  1A29 A;  1PVB A;  1MR8 A;  1CTR A;  2KNE A;  1QAT A;  1QXP A;  4OR9 B;  1MXL C;  3EKH A;  1AVS A;  1DJW A;  1BT6 A;  1OMR A;  3A8R A;  1IJ5 A;  2COL B;  1G4Y R;  2F33 A;  4PE4 A;  1N65 A;  2EGD A;  1OE9 B;  4GPL B;  2O60 A;  1OOJ A;  2FJU B;  3WNX B;  2TN4 A;  1QVI Y;  2Y5I A;  2ZRS A;  1OSA A;  2PVB A;  1EH2 A;  2EC6 B;  3RLZ A;  1CFC A;  1SW8 A;  3ICB A;  3BUW B;  2ZFD A;  3KF9 A;  1QX5 B;  1M46 A;  4MLW A;  1Y1X A;  2KHN A;  2M97 A;  1U5I A;  4F0Z B;  1F71 A;  1TNP A;  3TS5 C;  3VRP A;  4YRU A;  3JTD C;  1IGV A;  2E30 A;  1YUT A;  3EK4 A;  1BR1 B;  1DJH A;  1EG3 A;  1YUS A;  2Q4U A;  1NP8 A;  2I18 A;  3M0W A;  1OZS A;  1F55 A;  1S1E A;  1FPW A;  2L98 A;  2JT3 A;  3NSO A;  1BF5 A;  1A2X A;  3AAK A;  1DJY A;  1NYA A;  4CLN A;  5B8I B;  1DJX A;  5DKN A;  5GQQ C;  1MWN A;  1NIW A;  2PMY A;  3JVT B;  4OKH A;  2BL0 B;  4QJ5 B;  1KK7 Z;  1NUB A;  1LVC D;  1NSH A;  2JQ6 A;  1QS7 A;  4I5J A;  5AEQ A;  2M29 A;  4XYN A;  1JFJ A;  4AOM A;  2MA2 A;  1K94 A;  1BJF A;  1FW4 A;  1XFW O;  1B7T Y;  1NX0 A;  1YVL A;  2K7O A;  3GK2 A;  1V1F A;  1FI6 A;  2NCO A;  1XFY O;  5HLO A;  1BOD A;  3PN7 C;  2K7D A;  4BY4 A;  1A75 A;  1OMD A;  1GGW A;  3OX5 A;  4D1E A;  2K2A A;  4PE0 A;  4AQI A;  1LA3 A;  1L7Z A;  2LVK A;  2P6B B;  5AXI A;  1F4Q A;  1JSA A;  3I5G B;  1FF1 A;  2L5X B;  1DF0 A;  2CCM A;  2JUL A;  2KFF A;  2L50 A;  2MJW B;  1B9A A;  4MZJ A;  1TNW A;  1SKT A;  2B1U A;  2F2P A;  5JJG A;  1NCY A;  1MF8 B;  1E8A A;  1GGZ A;  3EVR A;  2MAZ A;  1TCF A;  2KI4 C;  3SJS A;  2OTG C;  1QIV A;  4DIR A;  3I5F B;  1N2D A;  1YUU A;  1TNX A;  2LUX A;  2V53 A;  4I5L B;  4PHN A;  1Q80 A;  3VGO A;  3I5I B;  4GGF A;  2LLS A;  1WY9 A;  1UHK A;  1DT7 B;  1H8B A;  1SYM A;  1DGU A;  1AK8 A;  2LM5 A;  2CT9 A;  3D10 A;  1NPQ A;  4WQ3 A;  3KPX A;  4N1G A;  2BE4 A;  1SK6 D;  3CLN A;  1QVI Z;  3BUM B;  1XFV O;  1PVA A;  2HET A;  1CFD A;  1G8I A;  1XK4 C;  2F8P A;  1ODB A;  2LVI A;  3WHU B;  5KTY A;  1CM1 A;  1KK7 Y;  2CXJ A;  3DVK A;  4U8D A;  4CFQ A;  1QX2 A;  2SCP A;  2OS8 B;  2BBM A;  1QIW A;  1PK0 D;  2K61 A;  3FWC A;  2JXL A;  2MBX A;  2H61 C;  2E6W A;  1DJI A;  2BCA A;  2HQW A;  4GBA A;  1QV1 A;  3LCP C;  1JC2 A;  1J7O A;  2Y1M A;  2ZND A;  2LUC A;  1JFK A;  2I94 A;  4ZCV A;  3I5H B;  4HRE E;  4MEW A;  1UUS A;  1XYD A;  1KCY A;  1CDM A;  4M2P A;  1M39 A;  1VRK A;  5I2Q A;  1AP4 A;  5CSJ A;  1K93 D;  2ZN8 A;  2JTZ A;  2L0P A;  2LLT A;  1B8R A;  1FBV A;  4MBE A;  1KK8 B;  5F6T A;  2AMI A;  2AUC A;  4PAL A;  3FIA A;  2Q91 A;  5HKY A;  2KGR A;  2LV7 A;  1WDC B;  3OB2 B;  2KGB C;  3QRX A;  1LKJ A;  5D69 A;  1NCX A;  5DKQ A;  2LLU A;  1L2O C;  4XJK A;  1JF2 A;  1X02 A;  1NX3 A;  1C7W A;  1XO5 A;  2JNX A;  3BXK A;  1UWO A;  2WND A;  1B8L A;  3BOW A;  2BCB A;  1TN4 A;  2Y1N A;  3JVT C;  1CLM A;  2BL0 C;  1U5I B;  4ICB A;  3TZ1 A;  3NSL A;  2FOT A;  2M7N A;  4HRG A;  1B1G A;  1EXR A;  4YGA A;  4DCK A;  1QV0 A;  4PE7 A;  2HQ8 A;  2M3W A;  4MRY A;  1BU3 A;  4I5N B;  5IBW A;  4A4C A;  1J1E A;  1SMG A;  4BY5 A;  2I2R E;  1B4C A;  4R1E A;  2EHB A;  2KAV A;  3D0Y B;  3EVV A;  1WRZ A;  3CS1 A;  3NXA A;  1J1D A;  2LAN A;  1S3P A;  1UHI A;  3FWB A;  4ETO A;  1DJZ A;  2MLE C;  1F54 A;  1DMO A;  1UHN A;  1D1O A;  5CSF A;  1DJG A;  1ZFS A;  1TNQ A;  1Y6W A;  1EL4 A;  3I5G C;  5ER4 X;  2LCP A;  3CWG A;  2ZN9 A;  1ALW A;  1TIZ A;  2H61 A;  3CR4 X;  1K9K A;  1S5G Z;  5TNC A;  1KSO A;  1MUX A;  2JU0 A;  5HKW A;  1KFU S;  5FYX A;  4OVN F;  4MRX A;  1BOC A;  1H4B A;  2CTN A;  2JPT A;  3IF7 A;  1BMO A;  2KI6 C;  1LA0 A;  2FCE A;  1ALV A;  1RK9 A;  2BKH B;  2LP2 A;  3I5F C;  3C1V A;  3SG6 A;  2AAO A;  3DF0 B;  2JZI A;  3I5I C;  4YBH B;  1F70 A;  1CMG A;  1TOP A;  1SPY A;  2KOT A;  3IQQ A;  4GAO A;  1YTZ C;  1IQ5 A;  4JWQ A;  3WHT B;  2MLF C;  1CDP A;  2LP3 A;  4NDC A;  4FTG A;  1Y1A A;  3NSI A;  1REC A;  2MHH A;  3VRN A;  2CNP A;  1M63 B;  1A4P A;  4CFR A;  1SR6 C;  1F4O A;  2KFH A;  1A03 A;  1WLM A;  3LK0 A;  2HPS A;  2JC2 A;  2HF5 A;  2OS8 C;  4M2Q A;  2LC5 A;  2M0R A;  4GGN A;  2PAS A;  2K0J A;  3AKA A;  1K90 D;  1KFU L;  4MVF A;  1CLB A;  3I5H C;  1XA5 A;  2CBL A;  1AHR A;  1B47 A;  2NLN A;  1YR5 A;  2ZKM X;  1G33 A;  4MZL A;  3BUO B;  4A4B A;  1R2U A;  3IQO A;  2NXQ A;  1V1G A;  3CR5 X;  1NX1 A;  1KK8 C;  1KQM B;  1XVJ A;  1S36 A;  1YX8 A;  1ZMZ A;  2NCP A;  3LLE A;  2F2O A;  3KO0 A;  1ZUZ A;  2K7C A;  1WDC C;  1J55 A;  1SCM C;  1S5G Y;  1SNL A;  3BYA A;  5KSZ A;  4ORA B;  4AQJ A;  4WRI A;  1IJ6 A;  2L51 A;  1IG5 A;  2BE6 A;  3TDU A;  2F3Y A;  2KYF A;  1UP5 A;  3TUY B;  1CFP A;  3PAL A;  2KQ6 A;  1KWO B;  4I5K A;  4JPZ B;  4M2O A;  1PSR A;  2G9B A;  2QAC A;  3SG7 A;  1RJV A;  5DKR A;  4YGB B;  1BG1 A;  1IRJ A;  2K2F A;  1QAS A;  3O4Y A;  5K89 A;  1IH0 A;  5AFP A;  3BUX B;  4USL A;  1C07 A;  3O78 A;  1CDN A;  2L4I A;  3RM1 A;  2PAL A;  2K7B A;  1NCZ A;  2GGZ A;  1M45 A;  1SL7 A;  4XJK B;  1RRO A;  1TRF A;  2EC6 C;  2LHI A;  3E3R A;  4YI8 A;  2GV5 A;  3PFV A;  2LVV A;  3SG5 A;  1S6I A;  1QLS A;  5KU1 A;  2A4J A;  4Q04 A;  2LMT A;  1R6P A;  2LMV A;  4FQO A;  1NX2 A;  2JWW A;  1GJY A;  2VRG A;  4DUQ A;  4YGD B;  4QJ3 B;  2MRD A;  4MSP A;  3EK7 A;  2IS9 A;  2SAS A;  4YGE B;  1J7R A;  3DVJ A;  2M7L A;  5HYD A;  3KEV A;  3PSR A;  4N5X A;  1PAL A;  3OX6 A;  2JT0 A;  1ZOT B;  1YVH A;  3EKJ A;  4CPV A;  2WCF A;  1QJT A;  2M8U A;  4IL1 A;  5D7F A;  1J7P A;  4YGC B;  3WXA A;  1CNP A;  5I8N A;  2LAP A;  3SG3 A;  2KAY A;  4TNC A;  1DGV A;  1CLL A;  1Y0V H;  1K9U A;  1N0Y A;  5I2O A;  3LL8 B;  3PAT A;  1YX7 A;  2KSP A;  2BEC A;  2ZNE A;  1EJ3 A;  1WRK A;  1XK4 A;  4ZCU A;  3SG4 A;  4PHM A;  1JBA A;  1QLK A;  1Y1U A;  2WC8 A;  3F45 A;  1YRT B;  1YRU B;  4PDZ A;  3TDZ A;  4GNK B;  2O5G A;  3PLF B;  1HQV A;  2BCX A;  4WQ2 A;  1OQP A;  1UUR A;  1ZAC A;  1WRL A;  5BPJ A;  1CM4 A;  3BQ3 A;  3A4U B;  3PM8 A;  4GGF C;  1KFX S;  2K8M B;  1K2H A;  2F3Z A;  2KI6 D;  1K95 A;  1A75 B;  3HX4 A;  2JOJ A; 
#chains in the Genus database with same CATH topology
 2M1U A;  3EVU A;  1DEK A;  4NQG A;  1CB1 A;  1RTP 1;  2H2K A;  3VRR A;  1KQV A;  1L2O B;  3L47 A;  1RWY A;  2KDH A;  1IQ3 A;  1YUR A;  3CYZ A;  1XFZ O;  4PT1 A;  2WC6 A;  4C0J A;  1DF0 B;  4DS7 A;  4N1F A;  2GGM A;  3GK1 A;  1SCV A;  3D0Y A;  3VRO A;  2KBI A;  3OB1 B;  1KQM C;  2M9G A;  3OP0 A;  3O6B A;  4L9M A;  2WCK A;  2JTT A;  3AKB A;  4UPG A;  1JF0 A;  2JXC A;  4CID A;  4P5O E;  2DOQ A;  2JT8 A;  5FI6 A;  1CDL A;  5J3X A;  1AJ4 A;  2RGI A;  5CSI A;  1PRW A;  2KAX A;  5CPV A;  4HSZ A;  1NWD A;  4JQ0 D;  5AAN A;  3GK4 X;  3TUY C;  4PCW A;  1KWO C;  1AJ5 A;  3FS7 A;  2BBN A;  3ZWH A;  3TS5 B;  1KFX L;  1J7Q A;  3KHE A;  3JTD B;  1SBJ A;  2WOR A;  1XFX O;  1B8C A;  1DTL A;  3Q8I A;  2KPH A;  2PSR A;  3OHM B;  2ISD A;  2LNK A;  1K96 A;  2LE9 B;  3DF0 A;  1S6C A;  2QDI A;  1QX7 A;  5ER5 A;  3CTN A;  2PRU A;  1UHH A;  1W7J B;  3CZT X;  3LK1 A;  2QEB A;  4NDD A;  1MXE A;  4C0L A;  4PHK A;  1AUI B;  1K8U A;  2NZ0 A;  5AER A;  5FI2 A;  3UO9 A;  1MHO A;  1BR4 B;  2L2E A;  2QEH A;  3EK8 A;  2G2B A;  5CSN A;  2I7A A;  1W7I B;  3DVE A;  2JRF A;  1MQ1 A;  4PHJ A;  1CFF A;  3ZNI A;  3DD4 A;  2M49 B;  2LVJ A;  2WCB A;  4OV2 A;  1RFJ A;  3QME A;  1DVI A;  1QTX A;  4DRW A;  1SL9 A;  1LIN A;  4NDB A;  5G08 A;  3PN7 B;  1XFU O;  1TCO B;  3B6X A;  3BUN B;  3DVM A;  1M31 A;  1SY9 A;  3NHT A;  3AAJ A;  1CKK A;  1LXF C;  5HL1 A;  2KQY A;  3HCM A;  3R1P A;  4JD9 A;  1SRA A;  4OCI A;  1KSM A;  3K21 A;  2WOS A;  2ZRT A;  1S6J A;  3MSE B;  3SIB A;  5PAL A;  1IWQ A;  1SR6 B;  1S26 D;  5I2L A;  1UHJ A;  2L2C A;  2WCL A;  4QJ4 B;  3CR2 A;  1F8H A;  1QWV A;  3TDI A;  2M1K B;  4P2Y B;  2WCE A;  4C0K A;  3BOW B;  1PUL A;  2QPT A;  1IKU A;  2L4H A;  2R2I A;  2KI4 B;  1K9P A;  2OPO A;  2OTG B;  2Y4Q A;  4MZK A;  3S0G A;  1EG4 A;  1OMV A;  2D8N A;  2KYC A;  2JNF A;  4ORB B;  1JWD A;  1HT9 A;  1BLQ A;  3GOF A;  4E68 A;  1PSB A;  1OZO A;  1FI5 A;  2FCD A;  1CMF A;  4GUK A;  3DY9 A;  1C7V A;  1TTX A;  2BKI B;  4ORC B;  2LMU A;  3VB1 A;  2LHL A;  4GFT A;  4YI9 A;  2KBM A;  2KFG A;  1SCM B;  2QEV A;  4MN0 A;  4HRH A;  3CGA A;  3NSK A;  4PE1 A;  1B7T Z;  1GQM A;  5HLV A;  3SG2 A;  3VRQ A;  1C3Z A;  5I94 A;  1WLZ A;  3H4S E;  1SL8 A;  5JOL A;  5HKZ A;  3BFH A;  3O2P A;  1JUO A;  1A29 A;  3SIA A;  1PVB A;  1MR8 A;  2P71 A;  2WCH A;  1CTR A;  2KNE A;  1QAT A;  1QXP A;  4OR9 B;  1MXL C;  3EKH A;  1AVS A;  1DJW A;  1BT6 A;  1OMR A;  3A8R A;  1IJ5 A;  2COL B;  1DC1 A;  4KYN A;  1G4Y R;  2F33 A;  4PE4 A;  1N65 A;  2EGD A;  1OE9 B;  4GPL B;  2O60 A;  1OOJ A;  2FJU B;  3WNX B;  2TN4 A;  1QVI Y;  2Y5I A;  2ZRS A;  3S0E A;  1OSA A;  2PVB A;  1EH2 A;  2EC6 B;  3RLZ A;  1CFC A;  1SW8 A;  3ICB A;  3BUW B;  2ZFD A;  3D73 A;  1QX5 B;  3KF9 A;  1M46 A;  1OOI X;  4MLW A;  1Y1X A;  2KHN A;  2M97 A;  1U5I A;  4F0Z B;  1F71 A;  1TNP A;  3TS5 C;  3VRP A;  3DXL A;  3JTD C;  4YRU A;  1IGV A;  2E30 A;  1YUT A;  3BJH A;  3K1E A;  3EK4 A;  1BR1 B;  1DJH A;  1EG3 A;  1YUS A;  2Q4U A;  1NP8 A;  2I18 A;  3M0W A;  1OZS A;  1F55 A;  1S1E A;  1FPW A;  2L98 A;  3CZ2 A;  3S0D A;  2JT3 A;  3NSO A;  1BF5 A;  1A2X A;  3DYE A;  3AAK A;  4FQT A;  1DJY A;  1NYA A;  4CLN A;  5B8I B;  1DJX A;  5DKN A;  5GQQ C;  1MWN A;  1NIW A;  2PMY A;  3B87 A;  3JVT B;  4OKH A;  1TUZ A;  2BL0 B;  4QJ5 B;  1KK7 Z;  1NUB A;  1LVC D;  1NSH A;  2JQ6 A;  1QS7 A;  4I5J A;  5AEQ A;  2M29 A;  4XYN A;  3BFA A;  5FI7 A;  1JFJ A;  2WC5 A;  4AOM A;  2MA2 A;  1K94 A;  1BJF A;  1FW4 A;  1XFW O;  1B7T Y;  1NX0 A;  1YVL A;  2K7O A;  2QEO A;  3CDN A;  1V1F A;  3GK2 A;  3OBV A;  1FI6 A;  2NCO A;  1XFY O;  5HLO A;  1BOD A;  3PM2 A;  3PN7 C;  1OOG A;  2K7D A;  3CAB A;  4BY4 A;  1A75 A;  1OMD A;  1GGW A;  3OX5 A;  4D1E A;  2K2A A;  4PE0 A;  4AQI A;  1LA3 A;  4INX A;  1L7Z A;  2LVK A;  2P6B B;  5AXI A;  1F4Q A;  3R1O A;  1JSA A;  3I5G B;  1FF1 A;  2L5X B;  1DF0 A;  2CCM A;  2JUL A;  2KFF A;  2L50 A;  2MJW B;  1B9A A;  4MZJ A;  1OOH A;  1TNW A;  1SKT A;  2ERB A;  2B1U A;  2F2P A;  5D3O A;  1NCY A;  1MF8 B;  1E8A A;  5JJG A;  1GGZ A;  3EVR A;  2MAZ A;  1TCF A;  3OGN A;  2KI4 C;  3SJS A;  2OTG C;  1QIV A;  4DIR A;  3I5F B;  1N2D A;  1YUU A;  1TNX A;  2LUX A;  2V53 A;  4I5L B;  4PHN A;  1Q80 A;  3VGO A;  3RZS A;  3I5I B;  3SS4 A;  4GGF A;  2LLS A;  1WY9 A;  1UHK A;  1DT7 B;  1H8B A;  1SYM A;  1DGU A;  1AK8 A;  3TDZ A;  4JKT A;  2LM5 A;  2CT9 A;  3D10 A;  1NPQ A;  4WQ3 A;  3KPX A;  4N1G A;  2BE4 A;  3L4L A;  1SK6 D;  3CLN A;  1QVI Z;  3BUM B;  5EL2 A;  1XFV O;  1PVA A;  2HET A;  1CFD A;  1G8I A;  3SS5 A;  1W9Z A;  1XK4 C;  1ODB A;  2F8P A;  2LVI A;  3B86 A;  3UNW A;  3WHU B;  5KTY A;  1IIO A;  1CM1 A;  1KK7 Y;  2CXJ A;  3DVK A;  4U8D A;  4CFQ A;  1QX2 A;  2SCP A;  1DQE A;  2OS8 B;  2BBM A;  1QIW A;  1PK0 D;  2K61 A;  3FWC A;  2JXL A;  2MBX A;  2H61 C;  2E6W A;  1DJI A;  2BCA A;  2HQW A;  4GBA A;  1QV1 A;  3LCP C;  1JC2 A;  1J7O A;  2Y1M A;  2ZND A;  2LUC A;  1JFK A;  2I94 A;  4ZCV A;  3I5H B;  3FE6 A;  4HRE E;  3V2L A;  4MEW A;  1UUS A;  1XYD A;  1KCY A;  1CDM A;  4M2P A;  1M39 A;  1VRK A;  5I2Q A;  1AP4 A;  5CSJ A;  1K93 D;  2ZN8 A;  2JTZ A;  2WCM A;  3CZ1 A;  2L0P A;  2LLT A;  1B8R A;  1FBV A;  4MBE A;  1KK8 B;  5F6T A;  2AMI A;  2AUC A;  4PAL A;  3FIA A;  2H8V A;  2Q91 A;  2KGR A;  2LV7 A;  5HKY A;  1WDC B;  3SS3 A;  3OB2 B;  2KGB C;  1LS8 A;  3QRX A;  1LKJ A;  5D69 A;  1NCX A;  5DKQ A;  2LLU A;  1L2O C;  4XJK A;  1JF2 A;  1X02 A;  1ORG A;  1NX3 A;  3N7H A;  1C7W A;  1XO5 A;  2JNX A;  3BXK A;  1UWO A;  2WND A;  1B8L A;  3BOW A;  2BCB A;  1TN4 A;  2Y1N A;  3JVT C;  1CLM A;  2BL0 C;  1U5I B;  4ICB A;  3TZ1 A;  3NSL A;  1SSE B;  2FOT A;  2M7N A;  4HRG A;  1B1G A;  1EXR A;  4YGA A;  4DCK A;  1QV0 A;  4PE7 A;  2HQ8 A;  2M3W A;  4MRY A;  1BU3 A;  4I5N B;  5IBW A;  4A4C A;  1J1E A;  1SMG A;  3L4A A;  2I2R E;  4BY5 A;  1B4C A;  4R1E A;  2EHB A;  2KAV A;  3D0Y B;  3EVV A;  1WRZ A;  3CS1 A;  3NXA A;  1J1D A;  2LAN A;  1S3P A;  1UHI A;  3FWB A;  3IVT A;  1DJZ A;  2MLE C;  4ETO A;  1F54 A;  1DMO A;  1UHN A;  1D1O A;  5CSF A;  1DJG A;  1ZFS A;  3BFB A;  1TNQ A;  1Y6W A;  1EL4 A;  3D75 A;  3I5G C;  2LCP A;  5ER4 X;  3CWG A;  2ZN9 A;  1ALW A;  1TIZ A;  1T14 A;  2H61 A;  1K9K A;  1S5G Z;  3CR4 X;  5TNC A;  1KSO A;  1MUX A;  2JU0 A;  3R72 A;  5HKW A;  1KFU S;  3D77 A;  5FYX A;  4OVN F;  4MRX A;  1BOC A;  1H4B A;  2CTN A;  2JPT A;  3IF7 A;  1BMO A;  3S0A A;  2KI6 C;  1LA0 A;  2FCE A;  1ALV A;  1P28 A;  1RK9 A;  2BKH B;  2LP2 A;  3I5F C;  3C1V A;  3SG6 A;  2AAO A;  3DF0 B;  2JZI A;  3I5I C;  4YBH B;  1F70 A;  1CMG A;  1TOP A;  1SPY A;  2KOT A;  3IQQ A;  4GAO A;  1YTZ C;  4IJ7 A;  1IQ5 A;  4JWQ A;  3WHT B;  2MLF C;  1CDP A;  2LP3 A;  4NDC A;  4FTG A;  1Y1A A;  3B7A A;  1REC A;  3NSI A;  2MHH A;  3VRN A;  2CNP A;  1M63 B;  1A4P A;  3S0B A;  4CFR A;  1SR6 C;  1F4O A;  2KFH A;  1A03 A;  1WLM A;  3LK0 A;  1Z4H A;  2HPS A;  2JC2 A;  2HF5 A;  2OS8 C;  4M2Q A;  2LC5 A;  2M0R A;  4GGN A;  2PAS A;  2K0J A;  3AKA A;  3O4X A;  1K90 D;  1DEL A;  1KFU L;  4MVF A;  1CLB A;  1JBA A;  3I5H C;  1XA5 A;  2CBL A;  1AHR A;  1B47 A;  2NLN A;  1YR5 A;  2ZKM X;  1G33 A;  4MZL A;  3BUO B;  4INW A;  4A4B A;  1R2U A;  3IQO A;  2NXQ A;  1V1G A;  3CR5 X;  1NX1 A;  1KK8 C;  1KQM B;  1XVJ A;  1S36 A;  1YX8 A;  1ZMZ A;  2NCP A;  3LLE A;  2F2O A;  3KO0 A;  1ZUZ A;  2K60 A;  2K7C A;  2WCJ A;  1WDC C;  1J55 A;  1SCM C;  1S5G Y;  1SNL A;  3BYA A;  5KSZ A;  1Z2C B;  4ORA B;  4AQJ A;  4WRI A;  1IJ6 A;  2FJY A;  2L51 A;  1IG5 A;  2BE6 A;  3TDU A;  2F3Y A;  2KLD A;  1UP5 A;  2KLE A;  2KYF A;  1TUJ A;  3TUY B;  3R1V A;  3PAL A;  2KQ6 A;  1KWO B;  4I5K A;  1CFP A;  4JPZ B;  1XFR A;  4M2O A;  1PSR A;  2G9B A;  2QAC A;  3SG7 A;  1RJV A;  5DKR A;  4YGB B;  1BG1 A;  1IRJ A;  2K2F A;  1QAS A;  3O4Y A;  5K89 A;  1IH0 A;  5AFP A;  3BUX B;  4USL A;  1C07 A;  3O78 A;  1CDN A;  2L4I A;  3RM1 A;  2PAL A;  2K7B A;  5DIC A;  2PYQ A;  1NCZ A;  2GGZ A;  1M45 A;  1SL7 A;  4XJK B;  1RRO A;  1TRF A;  2EC6 C;  2LHI A;  3E3R A;  4YI8 A;  2GV5 A;  3PFV A;  2LVV A;  3SG5 A;  1S6I A;  1QLS A;  5KU1 A;  2A4J A;  3S0F A;  2YGU A;  4Q04 A;  2LMT A;  1R6P A;  2LMV A;  3D78 A;  3FE9 A;  2JPO A;  4FQO A;  1NX2 A;  2JWW A;  1OOF A;  1GJY A;  2VRG A;  4DUQ A;  4YGD B;  4QJ3 B;  2MRD A;  4MSP A;  3EK7 A;  2IS9 A;  2SAS A;  4YGE B;  1J7R A;  3DVJ A;  2M7L A;  5HYD A;  3KEV A;  3PJI A;  3PSR A;  4N5X A;  1PAL A;  3OX6 A;  2JT0 A;  1ZOT B;  1YVH A;  3EKJ A;  4CPV A;  2WCF A;  1QJT A;  2M8U A;  4IL1 A;  5D7F A;  1J7P A;  3FE8 A;  3D74 A;  4YGC B;  3WXA A;  1CNP A;  1OW4 A;  5I8N A;  4OZD A;  2LAP A;  3SG3 A;  2KAY A;  3CZ0 A;  3NGV A;  4TNC A;  1DGV A;  1CLL A;  1Y0V H;  2BNX A;  1K9U A;  3D76 A;  1N0Y A;  1GM0 A;  5I2O A;  3LL8 B;  3PAT A;  4F7F A;  1YX7 A;  2KSP A;  3NHI A;  2BEC A;  2ZNE A;  3EG5 B;  1EJ3 A;  1WRK A;  1XK4 A;  4ZCU A;  3SG4 A;  4PHM A;  1C3Y A;  1QLK A;  1Y1U A;  2BAP A;  2WC8 A;  1YRT B;  1YRU B;  2PQL A;  3F45 A;  4PDZ A;  2P70 A;  2O5G A;  3PLF B;  4GNK B;  1HQV A;  2BCX A;  4WQ2 A;  3B88 A;  1OQP A;  1TWO A;  1UUR A;  1ZAC A;  1WRL A;  5BPJ A;  1CM4 A;  2L5Y A;  3BQ3 A;  3A4U B;  3PM8 A;  4GGF C;  1KFX S;  2GTE A;  3DZT A;  2K8M B;  1K2H A;  2F3Z A;  2KI6 D;  1K95 A;  1A75 B;  3HX4 A;  2JOJ A; 
#chains in the Genus database with same CATH homology
 2M1U A;  3EVU A;  4NQG A;  1CB1 A;  1RTP 1;  2H2K A;  3VRR A;  1KQV A;  1L2O B;  1RWY A;  2KDH A;  1IQ3 A;  1YUR A;  4C0J A;  1XFZ O;  1DF0 B;  4DS7 A;  4N1F A;  2GGM A;  3GK1 A;  1SCV A;  3D0Y A;  3VRO A;  2KBI A;  3OB1 B;  1KQM C;  2M9G A;  3OP0 A;  3O6B A;  4L9M A;  2JTT A;  3AKB A;  4UPG A;  1JF0 A;  2JXC A;  4CID A;  4P5O E;  2DOQ A;  2JT8 A;  1CDL A;  5J3X A;  1AJ4 A;  2RGI A;  5CSI A;  1PRW A;  2KAX A;  5CPV A;  4HSZ A;  1NWD A;  4JQ0 D;  5AAN A;  3GK4 X;  3TUY C;  4PCW A;  1KWO C;  1AJ5 A;  3FS7 A;  2BBN A;  3ZWH A;  3TS5 B;  1KFX L;  1J7Q A;  3KHE A;  3JTD B;  1SBJ A;  2WOR A;  1XFX O;  1B8C A;  1DTL A;  2PSR A;  3OHM B;  2ISD A;  2LNK A;  1K96 A;  2LE9 B;  3DF0 A;  1S6C A;  1QX7 A;  5ER5 A;  3CTN A;  2PRU A;  1UHH A;  1W7J B;  3CZT X;  3LK1 A;  4NDD A;  1MXE A;  4C0L A;  4PHK A;  1AUI B;  1K8U A;  2NZ0 A;  5AER A;  1MHO A;  1BR4 B;  2L2E A;  3EK8 A;  2G2B A;  5CSN A;  2I7A A;  1W7I B;  3DVE A;  2JRF A;  1MQ1 A;  4PHJ A;  1CFF A;  3ZNI A;  3DD4 A;  2M49 B;  2LVJ A;  2WCB A;  4OV2 A;  1RFJ A;  1DVI A;  1QTX A;  4DRW A;  1SL9 A;  1LIN A;  4NDB A;  5G08 A;  3PN7 B;  1XFU O;  1TCO B;  3BUN B;  3DVM A;  1M31 A;  1SY9 A;  3AAJ A;  1CKK A;  1LXF C;  2KQY A;  3HCM A;  4OCI A;  1SRA A;  1KSM A;  3K21 A;  2WOS A;  2ZRT A;  1S6J A;  3MSE B;  3SIB A;  5PAL A;  1IWQ A;  1SR6 B;  1S26 D;  5I2L A;  1UHJ A;  4QJ4 B;  3CR2 A;  1F8H A;  3TDI A;  2M1K B;  4P2Y B;  2WCE A;  4C0K A;  3BOW B;  1PUL A;  2QPT A;  1IKU A;  2L4H A;  2R2I A;  2KI4 B;  1K9P A;  2OPO A;  2OTG B;  2Y4Q A;  4MZK A;  1EG4 A;  1OMV A;  2D8N A;  2KYC A;  2JNF A;  4ORB B;  1JWD A;  1HT9 A;  1BLQ A;  3GOF A;  4E68 A;  1PSB A;  1OZO A;  1FI5 A;  2FCD A;  1CMF A;  4GUK A;  1C7V A;  1TTX A;  2BKI B;  4ORC B;  2LMU A;  2LHL A;  4GFT A;  4YI9 A;  2KBM A;  2KFG A;  1SCM B;  4MN0 A;  4PE1 A;  4HRH A;  3CGA A;  3NSK A;  1B7T Z;  1GQM A;  5HLV A;  3SG2 A;  3VRQ A;  1WLZ A;  3H4S E;  1SL8 A;  5JOL A;  5HKZ A;  3SIA A;  3O2P A;  1JUO A;  1A29 A;  1PVB A;  1MR8 A;  1CTR A;  2KNE A;  1QAT A;  1QXP A;  4OR9 B;  1MXL C;  3EKH A;  1AVS A;  1DJW A;  1BT6 A;  1OMR A;  3A8R A;  1IJ5 A;  2COL B;  1G4Y R;  2F33 A;  4PE4 A;  1N65 A;  2EGD A;  1OE9 B;  4GPL B;  2O60 A;  1OOJ A;  2FJU B;  3WNX B;  2TN4 A;  1QVI Y;  2Y5I A;  2ZRS A;  1OSA A;  2PVB A;  1EH2 A;  2EC6 B;  3RLZ A;  1CFC A;  1SW8 A;  3ICB A;  3BUW B;  2ZFD A;  3KF9 A;  1QX5 B;  1M46 A;  4MLW A;  1Y1X A;  2KHN A;  2M97 A;  1U5I A;  4F0Z B;  1F71 A;  1TNP A;  3TS5 C;  3VRP A;  4YRU A;  3JTD C;  1IGV A;  2E30 A;  1YUT A;  3EK4 A;  1BR1 B;  1DJH A;  1EG3 A;  1YUS A;  2Q4U A;  1NP8 A;  2I18 A;  3M0W A;  1OZS A;  1F55 A;  1S1E A;  1FPW A;  2L98 A;  2JT3 A;  3NSO A;  1BF5 A;  1A2X A;  3AAK A;  1DJY A;  1NYA A;  4CLN A;  5B8I B;  1DJX A;  5DKN A;  5GQQ C;  1MWN A;  1NIW A;  2PMY A;  3JVT B;  4OKH A;  2BL0 B;  4QJ5 B;  1KK7 Z;  1NUB A;  1LVC D;  1NSH A;  2JQ6 A;  1QS7 A;  4I5J A;  5AEQ A;  2M29 A;  4XYN A;  1JFJ A;  4AOM A;  2MA2 A;  1K94 A;  1BJF A;  1FW4 A;  1XFW O;  1B7T Y;  1NX0 A;  1YVL A;  2K7O A;  3GK2 A;  1V1F A;  1FI6 A;  2NCO A;  1XFY O;  5HLO A;  1BOD A;  3PN7 C;  2K7D A;  4BY4 A;  1A75 A;  1OMD A;  1GGW A;  3OX5 A;  4D1E A;  2K2A A;  4PE0 A;  4AQI A;  1LA3 A;  1L7Z A;  2LVK A;  2P6B B;  5AXI A;  1F4Q A;  1JSA A;  3I5G B;  1FF1 A;  2L5X B;  1DF0 A;  2CCM A;  2JUL A;  2KFF A;  2L50 A;  2MJW B;  1B9A A;  4MZJ A;  1TNW A;  1SKT A;  2B1U A;  2F2P A;  5JJG A;  1NCY A;  1MF8 B;  1E8A A;  1GGZ A;  3EVR A;  2MAZ A;  1TCF A;  2KI4 C;  3SJS A;  2OTG C;  1QIV A;  4DIR A;  3I5F B;  1N2D A;  1YUU A;  1TNX A;  2LUX A;  2V53 A;  4I5L B;  4PHN A;  1Q80 A;  3VGO A;  3I5I B;  4GGF A;  2LLS A;  1WY9 A;  1UHK A;  1DT7 B;  1H8B A;  1SYM A;  1DGU A;  1AK8 A;  2LM5 A;  2CT9 A;  3D10 A;  1NPQ A;  4WQ3 A;  3KPX A;  4N1G A;  2BE4 A;  1SK6 D;  3CLN A;  1QVI Z;  3BUM B;  1XFV O;  1PVA A;  2HET A;  1CFD A;  1G8I A;  1XK4 C;  2F8P A;  1ODB A;  2LVI A;  3WHU B;  5KTY A;  1CM1 A;  1KK7 Y;  2CXJ A;  3DVK A;  4U8D A;  4CFQ A;  1QX2 A;  2SCP A;  2OS8 B;  2BBM A;  1QIW A;  1PK0 D;  2K61 A;  3FWC A;  2JXL A;  2MBX A;  2H61 C;  2E6W A;  1DJI A;  2BCA A;  2HQW A;  4GBA A;  1QV1 A;  3LCP C;  1JC2 A;  1J7O A;  2Y1M A;  2ZND A;  2LUC A;  1JFK A;  2I94 A;  4ZCV A;  3I5H B;  4HRE E;  4MEW A;  1UUS A;  1XYD A;  1KCY A;  1CDM A;  4M2P A;  1M39 A;  1VRK A;  5I2Q A;  1AP4 A;  5CSJ A;  1K93 D;  2ZN8 A;  2JTZ A;  2L0P A;  2LLT A;  1B8R A;  1FBV A;  4MBE A;  1KK8 B;  5F6T A;  2AMI A;  2AUC A;  4PAL A;  3FIA A;  2Q91 A;  5HKY A;  2KGR A;  2LV7 A;  1WDC B;  3OB2 B;  2KGB C;  3QRX A;  1LKJ A;  5D69 A;  1NCX A;  5DKQ A;  2LLU A;  1L2O C;  4XJK A;  1JF2 A;  1X02 A;  1NX3 A;  1C7W A;  1XO5 A;  2JNX A;  3BXK A;  1UWO A;  2WND A;  1B8L A;  3BOW A;  2BCB A;  1TN4 A;  2Y1N A;  3JVT C;  1CLM A;  2BL0 C;  1U5I B;  4ICB A;  3TZ1 A;  3NSL A;  2FOT A;  2M7N A;  4HRG A;  1B1G A;  1EXR A;  4YGA A;  4DCK A;  1QV0 A;  4PE7 A;  2HQ8 A;  2M3W A;  4MRY A;  1BU3 A;  4I5N B;  5IBW A;  4A4C A;  1J1E A;  1SMG A;  4BY5 A;  2I2R E;  1B4C A;  4R1E A;  2EHB A;  2KAV A;  3D0Y B;  3EVV A;  1WRZ A;  3CS1 A;  3NXA A;  1J1D A;  2LAN A;  1S3P A;  1UHI A;  3FWB A;  4ETO A;  1DJZ A;  2MLE C;  1F54 A;  1DMO A;  1UHN A;  1D1O A;  5CSF A;  1DJG A;  1ZFS A;  1TNQ A;  1Y6W A;  1EL4 A;  3I5G C;  5ER4 X;  2LCP A;  3CWG A;  2ZN9 A;  1ALW A;  1TIZ A;  2H61 A;  3CR4 X;  1K9K A;  1S5G Z;  5TNC A;  1KSO A;  1MUX A;  2JU0 A;  5HKW A;  1KFU S;  5FYX A;  4OVN F;  4MRX A;  1BOC A;  1H4B A;  2CTN A;  2JPT A;  3IF7 A;  1BMO A;  2KI6 C;  1LA0 A;  2FCE A;  1ALV A;  1RK9 A;  2BKH B;  2LP2 A;  3I5F C;  3C1V A;  3SG6 A;  2AAO A;  3DF0 B;  2JZI A;  3I5I C;  4YBH B;  1F70 A;  1CMG A;  1TOP A;  1SPY A;  2KOT A;  3IQQ A;  4GAO A;  1YTZ C;  1IQ5 A;  4JWQ A;  3WHT B;  2MLF C;  1CDP A;  2LP3 A;  4NDC A;  4FTG A;  1Y1A A;  3NSI A;  1REC A;  2MHH A;  3VRN A;  2CNP A;  1M63 B;  1A4P A;  4CFR A;  1SR6 C;  1F4O A;  2KFH A;  1A03 A;  1WLM A;  3LK0 A;  2HPS A;  2JC2 A;  2HF5 A;  2OS8 C;  4M2Q A;  2LC5 A;  2M0R A;  4GGN A;  2PAS A;  2K0J A;  3AKA A;  1K90 D;  1KFU L;  4MVF A;  1CLB A;  3I5H C;  1XA5 A;  2CBL A;  1AHR A;  1B47 A;  2NLN A;  1YR5 A;  2ZKM X;  1G33 A;  4MZL A;  3BUO B;  4A4B A;  1R2U A;  3IQO A;  2NXQ A;  1V1G A;  3CR5 X;  1NX1 A;  1KK8 C;  1KQM B;  1XVJ A;  1S36 A;  1YX8 A;  1ZMZ A;  2NCP A;  3LLE A;  2F2O A;  3KO0 A;  1ZUZ A;  2K7C A;  1WDC C;  1J55 A;  1SCM C;  1S5G Y;  1SNL A;  3BYA A;  5KSZ A;  4ORA B;  4AQJ A;  4WRI A;  1IJ6 A;  2L51 A;  1IG5 A;  2BE6 A;  3TDU A;  2F3Y A;  2KYF A;  1UP5 A;  3TUY B;  1CFP A;  3PAL A;  2KQ6 A;  1KWO B;  4I5K A;  4JPZ B;  4M2O A;  1PSR A;  2G9B A;  2QAC A;  3SG7 A;  1RJV A;  5DKR A;  4YGB B;  1BG1 A;  1IRJ A;  2K2F A;  1QAS A;  3O4Y A;  5K89 A;  1IH0 A;  5AFP A;  3BUX B;  4USL A;  1C07 A;  3O78 A;  1CDN A;  2L4I A;  3RM1 A;  2PAL A;  2K7B A;  1NCZ A;  2GGZ A;  1M45 A;  1SL7 A;  4XJK B;  1RRO A;  1TRF A;  2EC6 C;  2LHI A;  3E3R A;  4YI8 A;  2GV5 A;  3PFV A;  2LVV A;  3SG5 A;  1S6I A;  1QLS A;  5KU1 A;  2A4J A;  4Q04 A;  2LMT A;  1R6P A;  2LMV A;  4FQO A;  1NX2 A;  2JWW A;  1GJY A;  2VRG A;  4DUQ A;  4YGD B;  4QJ3 B;  2MRD A;  4MSP A;  3EK7 A;  2IS9 A;  2SAS A;  4YGE B;  1J7R A;  3DVJ A;  2M7L A;  5HYD A;  3KEV A;  3PSR A;  4N5X A;  1PAL A;  3OX6 A;  2JT0 A;  1ZOT B;  1YVH A;  3EKJ A;  4CPV A;  2WCF A;  1QJT A;  2M8U A;  4IL1 A;  5D7F A;  1J7P A;  4YGC B;  3WXA A;  1CNP A;  5I8N A;  2LAP A;  3SG3 A;  2KAY A;  4TNC A;  1DGV A;  1CLL A;  1Y0V H;  1K9U A;  1N0Y A;  5I2O A;  3LL8 B;  3PAT A;  1YX7 A;  2KSP A;  2BEC A;  2ZNE A;  1EJ3 A;  1WRK A;  1XK4 A;  4ZCU A;  3SG4 A;  4PHM A;  1JBA A;  1QLK A;  1Y1U A;  2WC8 A;  3F45 A;  1YRT B;  1YRU B;  4PDZ A;  3TDZ A;  4GNK B;  2O5G A;  3PLF B;  1HQV A;  2BCX A;  4WQ2 A;  1OQP A;  1UUR A;  1ZAC A;  1WRL A;  5BPJ A;  1CM4 A;  3BQ3 A;  3A4U B;  3PM8 A;  4GGF C;  1KFX S;  2K8M B;  1K2H A;  2F3Z A;  2KI6 D;  1K95 A;  1A75 B;  3HX4 A;  2JOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...