1LKJA

Nmr structure of apo calmodulin from yeast saccharomyces cerevisiae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
146
structure length
146
Chain Sequence
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin
publication title The solution structure of apocalmodulin from Saccharomyces cerevisiae implies a mechanism for its unique Ca2+ binding property.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 32
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2002-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1lkjA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1lkjA01
4XJKB 3I5IC 4WQ2A 1F55A 3DVJA 2AUCA 4N1FA 4MZJA 1NCZA 1MUXA 3LLEA 2ZRTA 4YGBB 4GFTA 1KSMA 3WXAA 1S6IA 2KI4B 4PHKA 1BT6A 1Y0VH 2H61A 2K2AA 3TS5B 2LP2A 1CLBA 1CLMA 1TNQA 4NDDA 4YI8A 4L9MA 4ZCVA 1SPYA 2JC2A 2COLB 1YTZC 2ZN9A 3OB1B 1WLZA 3SIBA 4MRXA 1DT7B 3CS1A 3GK1A 5HLOA 1K8UA 2F2OA 1TNPA 1KQMB 1YURA 2KFGA 2OTGC 3HX4A 2M7LA 4QJ5B 2L51A 1CKKA 4C0JA 1B47A 2H61C 4PDZA 3WHTB 1WRKA 1JC2A 5AFPA 1KWOB 5D69A 4MBEA 1M63B 2PVBA 1JBAA 1DF0A 4MRYA 3PN7B 5HKWA 4BY4A 2CT9A 1DTLA 3TUYC 4NDCA 3VGOA 3ZNIA 3AKBA 2LMUA 5AANA 1F70A 1SR6C 1IG5A 1OQPA 2EHBA 1J7RA 1K93D 2LLTA 4MZKA 2I7AA 5JJGA 1R2UA 1S36A 2FOTA 1BG1A 1LA0A 2KFFA 3CTNA 3IQQA 2JRFA 1UHKA 3D0YB 3KHEA 3O4YA 3TDIA 1C7VA 2D8NA 2M49B 3NSLA 2K7DA 4YGEB 1CDNA 1SCMC 1KCYA 3ICBA 3SG2A 2HQWA 2JT3A 1N65A 3HCMA 4AOMA 3VRRA 1S1EA 3SJSA 1SL8A 1QJTA 1TCOB 2BL0C 1LINA 5IBWA 2BCXA 1KFUL 2F2PA 1QVIZ 3TS5C 1ALWA 2MHHA 2KSPA 1QV1A 3CR4X 3KEVA 2FJUB 1AJ5A 4CFRA 1IQ3A 1SL7A 4MZLA 2KAXA 2LHLA 1Y1UA 1UWOA 5FYXA 3TZ1A 3LL8B 3KF9A 2OS8C 3I5IB 3OP0A 1XFVO 1NX0A 1JFKA 2EC6C 1H8BA 3GK4X 1XVJA 1HT9A 1QIVA 1V1FA 3FWBA 2BECA 1C07A 5PALA 5KSZA 2JTTA 2V53A 1BLQA 2ZRSA 2L2EA 5DKRA 4NQGA 1RJVA 2Y5IA 2G2BA 1IRJA 2JWWA 1DJGA 1YVHA 4BY5A 1NPQA 3BOWA 2KGRA 3I5FC 4Q04A 1S5GY 1CLLA 4GGNA 5KTYA 2K2FA 1UHHA 2OTGB 3NSOA 3SG4A 1PVAA 3EVUA 1SW8A 1YUTA 1DVIA 1FW4A 1KK7Z 1TTXA 3SG3A 3VRNA 3VRQA 1UUSA 1A29A 4M2PA 3LCPC 2O5GA 1S26D 1WDCC 1CDMA 1SNLA 2LAPA 2PALA 1ZMZA 4YI9A 5GQQC 5HLVA 1W7IB 1RK9A 4ETOA 1FI5A 2NZ0A 3EK4A 2LE9B 2WC8A 1G33A 3BUWB 1OE9B 3TUYB 4CPVA 1K9PA 2LVKA 1XFZO 1SR6B 4CLNA 4OV2A 1NP8A 3WHUB 4HSZA 2JT0A 2M7NA 1MF8B 2ISDA 2KAVA 2M9GA 2KI6D 1AJ4A 4NDBA 1M46A 4WQ3A 1SRAA 1YUSA 1KK8C 1IJ5A 4PE1A 1SCMB 1DJWA 2ZNDA 4USLA 1PVBA 2BBMA 4YGAA 3AKAA 1BODA 1OMRA 4JPZB 2L0PA 2BL0B 1MXEA 1CDPA 2WCEA 2QPTA 1NCYA 1GQMA 1RROA 2LANA 1TIZA 5D7FA 1K9UA 2K8MB 1VRKA 2ZKMX 2OS8B 1BOCA 5BPJA 1B8CA 1KFXS 3CWGA 2NCPA 1WRZA 2L4IA 3PATA 5AERA 2EC6B 1CFFA 4QJ3B 1B4CA 2NCOA 1YRUB 2WCBA 4JWQA 4HRGA 1CFCA 3FIAA 3OX5A 1H4BA 1Q80A 4E68A 1BF5A 1WLMA 1N2DA 1TN4A 2NXQA 1FF1A 1FI6A 1SBJA 1TNWA 1J1DA 2DOQA 1K96A 2F3YA 1U5IB 2BE4A 1AP4A 1CMFA 1NYAA 1SYMA 1QTXA 5DKNA 4OR9B 1TOPA 3I5FB 3DVMA 1XA5A 3O6BA 2LC5A 1GGWA 1UURA 3EVVA 3A8RA 1J7OA 4OKHA 1J1EA 3IF7A 2MA2A 3BUMB 4MN0A 4MVFA 2QACA 2Y1MA 3RM1A 4AQJA 3GOFA 4CIDA 1WDCB 4I5KA 2CTNA 1DGVA 2L50A 4R1EA 3FWCA 2KQYA 3EKHA 4U8DA 1XO5A 3BOWB 2RGIA 2PMYA 1LVCD 4MLWA 2KYCA 2JZIA 1A4PA 3I5HC 3AAJA 1AUIB 1IWQA 3OX6A 3MSEB 4MSPA 1DJYA 1GGZA 4A4BA 2B1UA 4WRIA 4ZCUA 4GUKA 1SK6D 2E6WA 1PALA 1DJHA 2I94A 4DS7A 1M39A 3KPXA 1U5IA 3RLZA 1KK8B 2KGBC 1QXPA 2LUXA 2HPSA 1QVIY 1MR8A 2KI6C 1DJXA 2Y4QA 3QRXA 3O2PA 5J3XA 3SIAA 3E3RA 5JOLA 4YGDB 1F4QA 1BR1B 1CFDA 4UPGA 2MLFC 1MQ1A 2SCPA 3BYAA 3BUNB 2LVIA 4PE7A 1NIWA 5TNCA 5I2LA 3JTDC 2ZNEA 4IL1A 1QATA 1QV0A 1XK4A 1ZOTB 2WNDA 3LK1A 3SG6A 2L5XB 2JQ6A 3DF0A 2AMIA 1RFJA 3A4UB 1Y1AA 1CM1A 2SASA 4DIRA 3PM8A 2JXLA 1OZOA 1B7TY 2KAYA 4I5LB 1YUUA 4GGFC 5HKYA 2CNPA 1UHNA 2KHNA 1S6CA 3GK2A 2MBXA 2M1KB 1KFXL 3K21A 4QJ4B 1NX1A 1PSRA 1XK4C 2K61A 1S5GZ 1NX2A 2OPOA 5AEQA 1NWDA 2GGZA 1PRWA 1SMGA 1X02A 1EG3A 3NSIA 1K9KA 3PLFB 2JPTA 5HKZA 1J7PA 2JNFA 1XYDA 3PALA 1CM4A 3PSRA 2VRGA 4FTGA 1ALVA 2E30A 1K90D 4ORBB 1QASA 2LP3A 2M8UA 1SKTA 5HYDA 2LM5A 1G8IA 4PE4A 1QLKA 4DCKA 1K94A 5CSJA 2LVVA 4PHMA 2CBLA 3M0WA 2LUCA 1SY9A 3DD4A 2KQ6A 2WOSA 1WY9A 1B1GA 2L98A 1IQ5A 3I5HB 1E8AA 1MHOA 4PALA 2K7BA 1GJYA 1XFXO 1KSOA 2G9BA 2LCPA 1F4OA 2LMTA 1SL9A 5ER4X 2KNEA 2HQ8A 1SCVA 1Y1XA 4C0KA 4ORAB 1A75A 2GGMA 5I2QA 1J55A 2BE6A 1QIWA 3LK0A 4YBHB 2KYFA 1UHJA 4GNKB 1OSAA 1YRTB 1BJFA 2GV5A 1JF2A 1UHIA 2F33A 2M97A 2PRUA 5F6TA 1ZUZA 3I5GC 4P2YB 2FCEA 2A4JA 2MLEC 2BBNA 3CGAA 3TDUA 2O60A 1CTRA 3SG5A 4MEWA 5I8NA 1V1GA 2IS9A 1DGUA 1M45A 2LHIA 2P6BB 2JXCA 3ZWHA 1YVLA 3JTDB 2LMVA 1J7QA 1FBVA 2M29A 1MXLC 1WRLA 2KOTA 2NLNA 1IH0A 2HF5A 1RTP1 4A4CA 1PULA 2BKHB 2CCMA 3IQOA 2LLUA 1KQVA 1PK0D 1QX2A 3FS7A 5KU1A 3PFVA 1QLSA 3BUXB 2M1UA 1K95A 2JULA 4PCWA 1CB1A 3EVRA 1L2OC 1OMDA 2K7CA 1TRFA 1NSHA 1B8RA 4AQIA 1IJ6A 3AAKA 3DF0B 2F3ZA 1OZSA 3JVTC 3OB2B 4XJKA 1RECA 2MJWB 2WORA 4PHNA 3WNXB 1AHRA 3F45A 4JQ0D 1EG4A 2L4HA 1YX8A 4D1EA 1R6PA 1TNXA 1BU3A 4XYNA 2LLSA 2KFHA 1YX7A 1XFYO 1ZACA 2I2RE 1JUOA 1S3PA 1YR5A 3DVKA 2KBMA 3NSKA 5CSNA 3BUOB 1HQVA 2TN4A 1LA3A 2KBIA 5G08A 4M2OA 1M31A 2HETA 5ER5A 2ZFDA 1A03A 1Y6WA 2I18A 3EKJA 4N1GA 1OMVA 2EGDA 3PN7C 2BCAA 2H2KA 1EH2A 1OOJA 2JTZA 2MAZA 2PASA 4GGFA 3H4SE 2PSRA 3D10A 4F0ZB 2M0RA 2JOJA 3BQ3A 5CPVA 1DJIA 1NUBA 4M2QA 4HREE 2KI4C 4HRHA 1B8LA 4ICBA 3O78A 3BXKA 1EL4A 1K2HA 1L7ZA 1XFWO 3OHMB 1D1OA 1AVSA 1CMGA 1JSAA 4P5OE 1IGVA 5K89A 2Y1NA 3I5GB 1JF0A 2AAOA 4I5JA 2F8PA 2ZN8A 1KQMC 2LV7A 1QX5B 1A2XA 1NX3A 2MRDA 5CSFA 3CLNA 1JWDA 4GBAA 1XFUO 3NXAA 2M3WA 1EJ3A 4GPLB 3TDZA 2WCFA 1MWNA 1CFPA 1A75B 1UP5A 1KWOC 1N0YA 1C7WA 3D0YA 3SG7A 5CSIA 4DRWA 1RWYA 1KK7Y 2Q91A 1DJZA 1B7TZ 1LKJA 2BCBA 4DUQA 1NCXA 1CNPA 1W7JB 4OCIA 1F54A 3EK7A 3C1VA 5I2OA 4I5NB 3VRPA 1FPWA 5AXIA 1ODBA 3CR2A 1CDLA 1G4YR 1DMOA 1TCFA 1L2OB 3CZTX 1BMOA 4ORCB 4OVNF 1QX7A 2KDHA 2JNXA 1JFJA 5B8IB 5DKQA 2JU0A 2CXJA 1ZFSA 3JVTB 1KFUS 2JT8A 3VROA 2Q4UA 4FQOA 3EK8A 2FCDA 3CR5X 2K7OA 4GAOA 1EXRA 1BR4B 4PE0A 4YGCB 2R2IA 4N5XA 4C0LA 1F8HA 2BKIB 1LXFC 2LVJA 1PSBA 2LNKA 3DVEA 3KO0A 1B9AA 4YRUA 4CFQA 1S6JA 1IKUA 1QS7A 1F71A 2K0JA 4PHJA 4TNCA 1AK8A 1DF0B
chains in the Genus database with same CATH superfamily
4XJKB 3I5IC 4WQ2A 1F55A 3DVJA 2AUCA 4N1FA 4MZJA 1NCZA 1MUXA 3B88A 2ZRTA 3LLEA 4YGBB 4GFTA 1KSMA 3L47A 3WXAA 1S6IA 2KI4B 4PHKA 3D76A 1BT6A 1Y0VH 2H61A 2K2AA 3TS5B 2LP2A 2WCJA 1CLBA 1CLMA 1TNQA 4NDDA 4F7FA 4YI8A 4L9MA 2P71A 3V2LA 4ZCVA 1SPYA 2JC2A 2COLB 1YTZC 2ZN9A 3OB1B 1WLZA 3SIBA 4MRXA 1DT7B 3CS1A 3GK1A 5HLOA 3B6XA 1K8UA 2F2OA 1TNPA 1KQMB 1YURA 2KFGA 2OTGC 3HX4A 3OGNA 2M7LA 4QJ5B 2L51A 5HLVA 1CKKA 3O4XA 4C0JA 1B47A 2H61C 4PDZA 3WHTB 1WRKA 3OBVA 1JC2A 5AFPA 1KWOB 5D69A 4PT1A 4MBEA 1M63B 2PVBA 1JBAA 1DF0A 3NGVA 1Z4HA 3PN7B 4MRYA 3FE6A 5HKWA 4BY4A 4KYNA 2CT9A 1DTLA 3TUYC 4NDCA 3VGOA 3ZNIA 3AKBA 2LMUA 5AANA 1F70A 1SR6C 1IG5A 1OQPA 2EHBA 1DEKA 1J7RA 1K93D 2LLTA 4MZKA 2I7AA 5JJGA 1R2UA 1S36A 2FOTA 1BG1A 1LA0A 2KFFA 3CTNA 3IQQA 2JRFA 1OOFA 1UHKA 3D0YB 3KHEA 3O4YA 3TDIA 1C7VA 2D8NA 2M49B 3NSLA 3B87A 2K7DA 4YGEB 1CDNA 1SCMC 1KCYA 3ICBA 3SG2A 2HQWA 2JT3A 1N65A 3HCMA 4AOMA 3VRRA 1S1EA 3SJSA 1SL8A 1QJTA 1TCOB 1LINA 2BL0C 5IBWA 2BCXA 1KFUL 2F2PA 1QVIZ 3TS5C 1ALWA 1IIOA 1DQEA 2MHHA 2KSPA 1QV1A 3CR4X 3KEVA 2FJUB 1AJ5A 4CFRA 1IQ3A 1SL7A 4MZLA 2KAXA 2LHLA 1Y1UA 1UWOA 3DZTA 5FYXA 3TZ1A 3LL8B 3KF9A 2OS8C 3I5IB 3OP0A 1XFVO 1NX0A 1JFKA 2EC6C 3FE8A 1H8BA 3GK4X 1XVJA 1HT9A 1QIVA 1V1FA 3FWBA 2BECA 1C07A 3L4AA 5PALA 5KSZA 2JTTA 2V53A 5D3OA 1BLQA 2ZRSA 2L2EA 5DKRA 4NQGA 2K60A 1RJVA 2Y5IA 2G2BA 1IRJA 2JWWA 1DJGA 1YVHA 5FI7A 4BY5A 1NPQA 3BOWA 2KGRA 3I5FC 4Q04A 1S5GY 1CLLA 4GGNA 5KTYA 2K2FA 1UHHA 2OTGB 3NSOA 3SG4A 1PVAA 3EVUA 1SW8A 1YUTA 1DVIA 1FW4A 1KK7Z 1TTXA 3SG3A 3VRNA 3VRQA 1UUSA 1A29A 4M2PA 3SS3A 3LCPC 2O5GA 1S26D 1WDCC 1CDMA 1SNLA 1OW4A 2LAPA 1ZMZA 2PALA 4YI9A 5GQQC 1W7IB 1RK9A 4ETOA 1FI5A 1OOGA 2NZ0A 3EK4A 2LE9B 2WC8A 1G33A 3BUWB 1OE9B 3TUYB 3CDNA 4CPVA 1K9PA 2LVKA 1XFZO 3BFBA 1SR6B 4CLNA 4OV2A 1NP8A 3D74A 2QDIA 3WHUB 4HSZA 2JT0A 2M7NA 1MF8B 2ISDA 2KAVA 2M9GA 3BJHA 2KI6D 3B7AA 1AJ4A 3D77A 4NDBA 1M46A 4WQ3A 1SRAA 1YUSA 1KK8C 1IJ5A 2WCLA 4PE1A 1SCMB 1DJWA 2ZNDA 4USLA 1PVBA 2BBMA 4YGAA 3AKAA 1BODA 1OMRA 2WCHA 2L0PA 2BL0B 4JPZB 1DC1A 1MXEA 1CDPA 2WCEA 2QPTA 1TWOA 1NCYA 1GQMA 3B86A 1DELA 1RROA 2LANA 1TIZA 5D7FA 1K9UA 2BNXA 4OZDA 2K8MB 1VRKA 1TUZA 2ZKMX 2OS8B 1BOCA 5BPJA 1B8CA 1KFXS 2WC6A 2NCPA 1WRZA 2L4IA 2PQLA 3CWGA 3VB1A 1TUJA 2QEBA 3PATA 5AERA 2EC6B 1CFFA 1SSEB 4QJ3B 1B4CA 2NCOA 1YRUB 2WCBA 4JWQA 4HRGA 1CFCA 3FIAA 3OX5A 1H4BA 1Q80A 2WCMA 4E68A 1BF5A 2JPOA 1WLMA 1N2DA 1TN4A 2BAPA 2NXQA 1FF1A 1FI6A 1SBJA 1TNWA 1J1DA 2DOQA 1K96A 2F3YA 1U5IB 2BE4A 1AP4A 1CMFA 1NYAA 4JKTA 1SYMA 1QTXA 3DYEA 5DKNA 4OR9B 1TOPA 2KPHA 3I5FB 3L4LA 3CABA 3DVMA 1XA5A 3EG5B 3O6BA 2LC5A 1GGWA 1UURA 2WC5A 3EVVA 3A8RA 1J7OA 4OKHA 5FI6A 1J1EA 3IF7A 2MA2A 3BUMB 4MN0A 4MVFA 2QACA 1Z2CB 2Y1MA 3RM1A 4AQJA 1T14A 3GOFA 4CIDA 1WDCB 4I5KA 2CTNA 1DGVA 2L50A 4R1EA 3FWCA 2KQYA 3EKHA 4U8DA 1XO5A 3BOWB 2RGIA 2PMYA 1LVCD 4MLWA 2KYCA 3S0DA 2JZIA 1A4PA 3DY9A 3I5HC 3AAJA 1AUIB 1IWQA 3OX6A 3MSEB 4MSPA 1DJYA 1GGZA 4A4BA 2B1UA 4WRIA 4ZCUA 4GUKA 1SK6D 2E6WA 3CZ0A 1PALA 1DJHA 2I94A 4DS7A 1M39A 3KPXA 1QWVA 1U5IA 3RLZA 1KK8B 2KGBC 3UO9A 2WCKA 1QXPA 2LUXA 2HPSA 1QVIY 1MR8A 2GTEA 1DJXA 2KI6C 2Y4QA 3N7HA 3QRXA 3S0BA 3O2PA 5J3XA 3SIAA 3E3RA 5JOLA 4YGDB 1F4QA 1BR1B 1CFDA 4UPGA 2MLFC 1MQ1A 3R1VA 2SCPA 3BYAA 3BUNB 2LVIA 3FE9A 4PE7A 1NIWA 5TNCA 5I2LA 3JTDC 2ZNEA 4IL1A 1QATA 1QV0A 1XK4A 3SS5A 1ZOTB 2WNDA 3LK1A 3SG6A 2L5XB 2JQ6A 3DF0A 2AMIA 1RFJA 3A4UB 3D78A 1Y1AA 3R1PA 1CM1A 2KLDA 2SASA 4DIRA 3PM8A 2H8VA 2JXLA 1OZOA 1B7TY 2KAYA 4I5LB 1YUUA 4GGFC 5HKYA 2CNPA 1UHNA 2KHNA 1S6CA 4IJ7A 3GK2A 2MBXA 2M1KB 1KFXL 3K21A 4QJ4B 2YGUA 1NX1A 1PSRA 1OOIX 1XK4C 2K61A 1S5GZ 1NX2A 2OPOA 5AEQA 1NWDA 2GGZA 1PRWA 1SMGA 1X02A 1EG3A 3NSIA 1K9KA 3PLFB 1P28A 2JPTA 5HKZA 3S0EA 1J7PA 2JNFA 1XYDA 3PALA 1CM4A 3PSRA 2ERBA 2VRGA 4FTGA 1ALVA 2E30A 1K90D 4ORBB 1QASA 2FJYA 2LP3A 2M8UA 1SKTA 5HYDA 2LM5A 1G8IA 4PE4A 1QLKA 4DCKA 1K94A 5CSJA 2LVVA 4PHMA 2CBLA 3M0WA 2LUCA 1SY9A 3DD4A 1C3YA 2KQ6A 2WOSA 1WY9A 1ORGA 3NHTA 2L98A 4INWA 3QMEA 1B1GA 1IQ5A 3I5HB 1E8AA 1MHOA 4PALA 2K7BA 1GJYA 1LS8A 1XFXO 1KSOA 2G9BA 2LCPA 1F4OA 2LMTA 1SL9A 5ER4X 2KNEA 2HQ8A 1SCVA 1Y1XA 4C0KA 4ORAB 1A75A 2GGMA 5I2QA 1J55A 2BE6A 1QIWA 3LK0A 4YBHB 2KYFA 1UHJA 4GNKB 1OSAA 1YRTB 1BJFA 2GV5A 1JF2A 1UHIA 1XFRA 2F33A 2M97A 2PRUA 5F6TA 1ZUZA 3I5GC 3K1EA 4P2YB 2FCEA 2A4JA 2MLEC 2BBNA 3CGAA 3TDUA 2O60A 1CTRA 3SG5A 4MEWA 5I8NA 1V1GA 2IS9A 1DGUA 1M45A 2LHIA 2P6BB 5I94A 3D75A 2JXCA 3ZWHA 1YVLA 3JTDB 2KLEA 2LMVA 1J7QA 1FBVA 2M29A 1MXLC 1WRLA 2KOTA 2NLNA 1IH0A 2HF5A 3S0FA 1RTP1 4A4CA 1PULA 2BKHB 2CCMA 3IQOA 2LLUA 3D73A 1C3ZA 1KQVA 1PK0D 1QX2A 3FS7A 5KU1A 3PFVA 1QLSA 3BUXB 2M1UA 1K95A 2JULA 4PCWA 1CB1A 3S0GA 3EVRA 1L2OC 1OMDA 2K7CA 1TRFA 5DICA 3PM2A 1NSHA 1W9ZA 1B8RA 4AQIA 1IJ6A 3AAKA 3DF0B 2F3ZA 1OZSA 3JVTC 3OB2B 5HL1A 4XJKA 1RECA 3R72A 2MJWB 2WORA 4PHNA 3WNXB 1AHRA 3F45A 4JQ0D 1EG4A 2L4HA 1YX8A 4D1EA 1R6PA 1TNXA 1BU3A 4XYNA 2LLSA 2KFHA 1YX7A 1XFYO 1ZACA 2I2RE 1JUOA 1S3PA 1YR5A 3DVKA 2KBMA 3NSKA 5CSNA 3BUOB 1HQVA 2TN4A 1OOHA 3BFHA 1LA3A 2KBIA 2L5YA 5G08A 4M2OA 1M31A 2HETA 5ER5A 2ZFDA 1A03A 1Y6WA 2I18A 3EKJA 4N1GA 1OMVA 2EGDA 3PN7C 2BCAA 2H2KA 1EH2A 1OOJA 2JTZA 2MAZA 2PASA 3Q8IA 4GGFA 3H4SE 2PSRA 3D10A 4F0ZB 3PJIA 2M0RA 2JOJA 3BQ3A 5CPVA 1DJIA 1NUBA 4M2QA 4HREE 2KI4C 4HRHA 1B8LA 4ICBA 3O78A 3BXKA 1EL4A 1K2HA 1L7ZA 5FI2A 1XFWO 3OHMB 5EL2A 1D1OA 1AVSA 1CMGA 1JSAA 2QEVA 4P5OE 3CYZA 1IGVA 5K89A 2Y1NA 3I5GB 1JF0A 2AAOA 4I5JA 2F8PA 2ZN8A 1KQMC 2LV7A 1QX5B 1A2XA 1NX3A 2MRDA 5CSFA 3CLNA 1JWDA 4GBAA 1XFUO 3NXAA 2M3WA 1EJ3A 4GPLB 3TDZA 3RZSA 2WCFA 1MWNA 1CFPA 1A75B 1UP5A 1KWOC 1N0YA 1C7WA 3D0YA 3SG7A 5CSIA 2L2CA 4DRWA 1RWYA 1KK7Y 2Q91A 1DJZA 1B7TZ 1LKJA 2BCBA 4DUQA 1NCXA 1CNPA 1W7JB 4FQTA 4OCIA 3EK7A 1F54A 3C1VA 5I2OA 2QEHA 4I5NB 3VRPA 3BFAA 1FPWA 5AXIA 1ODBA 3CR2A 3SS4A 1CDLA 1G4YR 1DMOA 1TCFA 1L2OB 3DXLA 3CZTX 3NHIA 1BMOA 1GM0A 4ORCB 4OVNF 1QX7A 3CZ1A 3UNWA 2KDHA 2JNXA 1JFJA 5B8IB 5DKQA 2JU0A 2CXJA 1ZFSA 2PYQA 3JVTB 1KFUS 2JT8A 3VROA 2Q4UA 4FQOA 3EK8A 3R1OA 2FCDA 2P70A 2QEOA 3CR5X 4INXA 2K7OA 4GAOA 1EXRA 1BR4B 4PE0A 4YGCB 2R2IA 4N5XA 4C0LA 1F8HA 2BKIB 1LXFC 2LVJA 1PSBA 2LNKA 3DVEA 3IVTA 3KO0A 1B9AA 4JD9A 4YRUA 3S0AA 4CFQA 1S6JA 3CZ2A 1IKUA 1QS7A 1F71A 2K0JA 4PHJA 4TNCA 1AK8A 1DF0B
chains in the Genus database with same CATH topology
4XJKB 3I5IC 4WQ2A 1F55A 3DVJA 2AUCA 4N1FA 4MZJA 1NCZA 1MUXA 3LLEA 2ZRTA 4YGBB 4GFTA 1KSMA 3WXAA 1S6IA 2KI4B 4PHKA 1BT6A 1Y0VH 2H61A 2K2AA 3TS5B 2LP2A 1CLBA 1CLMA 1TNQA 4NDDA 4YI8A 4L9MA 4ZCVA 1SPYA 2JC2A 2COLB 1YTZC 2ZN9A 3OB1B 1WLZA 3SIBA 4MRXA 1DT7B 3CS1A 3GK1A 5HLOA 1K8UA 2F2OA 1TNPA 1KQMB 1YURA 2KFGA 2OTGC 3HX4A 2M7LA 4QJ5B 2L51A 1CKKA 4C0JA 1B47A 2H61C 4PDZA 3WHTB 1WRKA 1JC2A 5AFPA 1KWOB 5D69A 4MBEA 1M63B 2PVBA 1JBAA 1DF0A 4MRYA 3PN7B 5HKWA 4BY4A 2CT9A 1DTLA 3TUYC 4NDCA 3VGOA 3ZNIA 3AKBA 2LMUA 5AANA 1F70A 1SR6C 1IG5A 1OQPA 2EHBA 1J7RA 1K93D 2LLTA 4MZKA 2I7AA 5JJGA 1R2UA 1S36A 2FOTA 1BG1A 1LA0A 2KFFA 3CTNA 3IQQA 2JRFA 1UHKA 3D0YB 3KHEA 3O4YA 3TDIA 1C7VA 2D8NA 2M49B 3NSLA 2K7DA 4YGEB 1CDNA 1SCMC 1KCYA 3ICBA 3SG2A 2HQWA 2JT3A 1N65A 3HCMA 4AOMA 3VRRA 1S1EA 3SJSA 1SL8A 1QJTA 1TCOB 2BL0C 1LINA 5IBWA 2BCXA 1KFUL 2F2PA 1QVIZ 3TS5C 1ALWA 2MHHA 2KSPA 1QV1A 3CR4X 3KEVA 2FJUB 1AJ5A 4CFRA 1IQ3A 1SL7A 4MZLA 2KAXA 2LHLA 1Y1UA 1UWOA 5FYXA 3TZ1A 3LL8B 3KF9A 2OS8C 3I5IB 3OP0A 1XFVO 1NX0A 1JFKA 2EC6C 1H8BA 3GK4X 1XVJA 1HT9A 1QIVA 1V1FA 3FWBA 2BECA 1C07A 5PALA 5KSZA 2JTTA 2V53A 1BLQA 2ZRSA 2L2EA 5DKRA 4NQGA 1RJVA 2Y5IA 2G2BA 1IRJA 2JWWA 1DJGA 1YVHA 4BY5A 1NPQA 3BOWA 2KGRA 3I5FC 4Q04A 1S5GY 1CLLA 4GGNA 5KTYA 2K2FA 1UHHA 2OTGB 3NSOA 3SG4A 1PVAA 3EVUA 1SW8A 1YUTA 1DVIA 1FW4A 1KK7Z 1TTXA 3SG3A 3VRNA 3VRQA 1UUSA 1A29A 4M2PA 3LCPC 2O5GA 1S26D 1WDCC 1CDMA 1SNLA 2LAPA 2PALA 1ZMZA 4YI9A 5GQQC 5HLVA 1W7IB 1RK9A 4ETOA 1FI5A 2NZ0A 3EK4A 2LE9B 2WC8A 1G33A 3BUWB 1OE9B 3TUYB 4CPVA 1K9PA 2LVKA 1XFZO 1SR6B 4CLNA 4OV2A 1NP8A 3WHUB 4HSZA 2JT0A 2M7NA 1MF8B 2ISDA 2KAVA 2M9GA 2KI6D 1AJ4A 4NDBA 1M46A 4WQ3A 1SRAA 1YUSA 1KK8C 1IJ5A 4PE1A 1SCMB 1DJWA 2ZNDA 4USLA 1PVBA 2BBMA 4YGAA 3AKAA 1BODA 1OMRA 4JPZB 2L0PA 2BL0B 1MXEA 1CDPA 2WCEA 2QPTA 1NCYA 1GQMA 1RROA 2LANA 1TIZA 5D7FA 1K9UA 2K8MB 1VRKA 2ZKMX 2OS8B 1BOCA 5BPJA 1B8CA 1KFXS 3CWGA 2NCPA 1WRZA 2L4IA 3PATA 5AERA 2EC6B 1CFFA 4QJ3B 1B4CA 2NCOA 1YRUB 2WCBA 4JWQA 4HRGA 1CFCA 3FIAA 3OX5A 1H4BA 1Q80A 4E68A 1BF5A 1WLMA 1N2DA 1TN4A 2NXQA 1FF1A 1FI6A 1SBJA 1TNWA 1J1DA 2DOQA 1K96A 2F3YA 1U5IB 2BE4A 1AP4A 1CMFA 1NYAA 1SYMA 1QTXA 5DKNA 4OR9B 1TOPA 3I5FB 3DVMA 1XA5A 3O6BA 2LC5A 1GGWA 1UURA 3EVVA 3A8RA 1J7OA 4OKHA 1J1EA 3IF7A 2MA2A 3BUMB 4MN0A 4MVFA 2QACA 2Y1MA 3RM1A 4AQJA 3GOFA 4CIDA 1WDCB 4I5KA 2CTNA 1DGVA 2L50A 4R1EA 3FWCA 2KQYA 3EKHA 4U8DA 1XO5A 3BOWB 2RGIA 2PMYA 1LVCD 4MLWA 2KYCA 2JZIA 1A4PA 3I5HC 3AAJA 1AUIB 1IWQA 3OX6A 3MSEB 4MSPA 1DJYA 1GGZA 4A4BA 2B1UA 4WRIA 4ZCUA 4GUKA 1SK6D 2E6WA 1PALA 1DJHA 2I94A 4DS7A 1M39A 3KPXA 1U5IA 3RLZA 1KK8B 2KGBC 1QXPA 2LUXA 2HPSA 1QVIY 1MR8A 2KI6C 1DJXA 2Y4QA 3QRXA 3O2PA 5J3XA 3SIAA 3E3RA 5JOLA 4YGDB 1F4QA 1BR1B 1CFDA 4UPGA 2MLFC 1MQ1A 2SCPA 3BYAA 3BUNB 2LVIA 4PE7A 1NIWA 5TNCA 5I2LA 3JTDC 2ZNEA 4IL1A 1QATA 1QV0A 1XK4A 1ZOTB 2WNDA 3LK1A 3SG6A 2L5XB 2JQ6A 3DF0A 2AMIA 1RFJA 3A4UB 1Y1AA 1CM1A 2SASA 4DIRA 3PM8A 2JXLA 1OZOA 1B7TY 2KAYA 4I5LB 1YUUA 4GGFC 5HKYA 2CNPA 1UHNA 2KHNA 1S6CA 3GK2A 2MBXA 2M1KB 1KFXL 3K21A 4QJ4B 1NX1A 1PSRA 1XK4C 2K61A 1S5GZ 1NX2A 2OPOA 5AEQA 1NWDA 2GGZA 1PRWA 1SMGA 1X02A 1EG3A 3NSIA 1K9KA 3PLFB 2JPTA 5HKZA 1J7PA 2JNFA 1XYDA 3PALA 1CM4A 3PSRA 2VRGA 4FTGA 1ALVA 2E30A 1K90D 4ORBB 1QASA 2LP3A 2M8UA 1SKTA 5HYDA 2LM5A 1G8IA 4PE4A 1QLKA 4DCKA 1K94A 5CSJA 2LVVA 4PHMA 2CBLA 3M0WA 2LUCA 1SY9A 3DD4A 2KQ6A 2WOSA 1WY9A 1B1GA 2L98A 1IQ5A 3I5HB 1E8AA 1MHOA 4PALA 2K7BA 1GJYA 1XFXO 1KSOA 2G9BA 2LCPA 1F4OA 2LMTA 1SL9A 5ER4X 2KNEA 2HQ8A 1SCVA 1Y1XA 4C0KA 4ORAB 1A75A 2GGMA 5I2QA 1J55A 2BE6A 1QIWA 3LK0A 4YBHB 2KYFA 1UHJA 4GNKB 1OSAA 1YRTB 1BJFA 2GV5A 1JF2A 1UHIA 2F33A 2M97A 2PRUA 5F6TA 1ZUZA 3I5GC 4P2YB 2FCEA 2A4JA 2MLEC 2BBNA 3CGAA 3TDUA 2O60A 1CTRA 3SG5A 4MEWA 5I8NA 1V1GA 2IS9A 1DGUA 1M45A 2LHIA 2P6BB 2JXCA 3ZWHA 1YVLA 3JTDB 2LMVA 1J7QA 1FBVA 2M29A 1MXLC 1WRLA 2KOTA 2NLNA 1IH0A 2HF5A 1RTP1 4A4CA 1PULA 2BKHB 2CCMA 3IQOA 2LLUA 1KQVA 1PK0D 1QX2A 3FS7A 5KU1A 3PFVA 1QLSA 3BUXB 2M1UA 1K95A 2JULA 4PCWA 1CB1A 3EVRA 1L2OC 1OMDA 2K7CA 1TRFA 1NSHA 1B8RA 4AQIA 1IJ6A 3AAKA 3DF0B 2F3ZA 1OZSA 3JVTC 3OB2B 4XJKA 1RECA 2MJWB 2WORA 4PHNA 3WNXB 1AHRA 3F45A 4JQ0D 1EG4A 2L4HA 1YX8A 4D1EA 1R6PA 1TNXA 1BU3A 4XYNA 2LLSA 2KFHA 1YX7A 1XFYO 1ZACA 2I2RE 1JUOA 1S3PA 1YR5A 3DVKA 2KBMA 3NSKA 5CSNA 3BUOB 1HQVA 2TN4A 1LA3A 2KBIA 5G08A 4M2OA 1M31A 2HETA 5ER5A 2ZFDA 1A03A 1Y6WA 2I18A 3EKJA 4N1GA 1OMVA 2EGDA 3PN7C 2BCAA 2H2KA 1EH2A 1OOJA 2JTZA 2MAZA 2PASA 4GGFA 3H4SE 2PSRA 3D10A 4F0ZB 2M0RA 2JOJA 3BQ3A 5CPVA 1DJIA 1NUBA 4M2QA 4HREE 2KI4C 4HRHA 1B8LA 4ICBA 3O78A 3BXKA 1EL4A 1K2HA 1L7ZA 1XFWO 3OHMB 1D1OA 1AVSA 1CMGA 1JSAA 4P5OE 1IGVA 5K89A 2Y1NA 3I5GB 1JF0A 2AAOA 4I5JA 2F8PA 2ZN8A 1KQMC 2LV7A 1QX5B 1A2XA 1NX3A 2MRDA 5CSFA 3CLNA 1JWDA 4GBAA 1XFUO 3NXAA 2M3WA 1EJ3A 4GPLB 3TDZA 2WCFA 1MWNA 1CFPA 1A75B 1UP5A 1KWOC 1N0YA 1C7WA 3D0YA 3SG7A 5CSIA 4DRWA 1RWYA 1KK7Y 2Q91A 1DJZA 1B7TZ 1LKJA 2BCBA 4DUQA 1NCXA 1CNPA 1W7JB 4OCIA 1F54A 3EK7A 3C1VA 5I2OA 4I5NB 3VRPA 1FPWA 5AXIA 1ODBA 3CR2A 1CDLA 1G4YR 1DMOA 1TCFA 1L2OB 3CZTX 1BMOA 4ORCB 4OVNF 1QX7A 2KDHA 2JNXA 1JFJA 5B8IB 5DKQA 2JU0A 2CXJA 1ZFSA 3JVTB 1KFUS 2JT8A 3VROA 2Q4UA 4FQOA 3EK8A 2FCDA 3CR5X 2K7OA 4GAOA 1EXRA 1BR4B 4PE0A 4YGCB 2R2IA 4N5XA 4C0LA 1F8HA 2BKIB 1LXFC 2LVJA 1PSBA 2LNKA 3DVEA 3KO0A 1B9AA 4YRUA 4CFQA 1S6JA 1IKUA 1QS7A 1F71A 2K0JA 4PHJA 4TNCA 1AK8A 1DF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJK B;  3I5I C;  4WQ2 A;  1F55 A;  3DVJ A;  2AUC A;  4N1F A;  4MZJ A;  1NCZ A;  1MUX A;  3LLE A;  2ZRT A;  4YGB B;  4GFT A;  1KSM A;  3WXA A;  1S6I A;  2KI4 B;  4PHK A;  1BT6 A;  1Y0V H;  2H61 A;  2K2A A;  3TS5 B;  2LP2 A;  1CLB A;  1CLM A;  1TNQ A;  4NDD A;  4YI8 A;  4L9M A;  4ZCV A;  1SPY A;  2JC2 A;  2COL B;  1YTZ C;  2ZN9 A;  3OB1 B;  1WLZ A;  3SIB A;  4MRX A;  1DT7 B;  3CS1 A;  3GK1 A;  5HLO A;  1K8U A;  2F2O A;  1TNP A;  1KQM B;  1YUR A;  2KFG A;  2OTG C;  3HX4 A;  2M7L A;  4QJ5 B;  2L51 A;  1CKK A;  4C0J A;  1B47 A;  2H61 C;  4PDZ A;  3WHT B;  1WRK A;  1JC2 A;  5AFP A;  1KWO B;  5D69 A;  4MBE A;  1M63 B;  2PVB A;  1JBA A;  1DF0 A;  4MRY A;  3PN7 B;  5HKW A;  4BY4 A;  2CT9 A;  1DTL A;  3TUY C;  4NDC A;  3VGO A;  3ZNI A;  3AKB A;  2LMU A;  5AAN A;  1F70 A;  1SR6 C;  1IG5 A;  1OQP A;  2EHB A;  1J7R A;  1K93 D;  2LLT A;  4MZK A;  2I7A A;  5JJG A;  1R2U A;  1S36 A;  2FOT A;  1BG1 A;  1LA0 A;  2KFF A;  3CTN A;  3IQQ A;  2JRF A;  1UHK A;  3D0Y B;  3KHE A;  3O4Y A;  3TDI A;  1C7V A;  2D8N A;  2M49 B;  3NSL A;  2K7D A;  4YGE B;  1CDN A;  1SCM C;  1KCY A;  3ICB A;  3SG2 A;  2HQW A;  2JT3 A;  1N65 A;  3HCM A;  4AOM A;  3VRR A;  1S1E A;  3SJS A;  1SL8 A;  1QJT A;  1TCO B;  2BL0 C;  1LIN A;  5IBW A;  2BCX A;  1KFU L;  2F2P A;  1QVI Z;  3TS5 C;  1ALW A;  2MHH A;  2KSP A;  1QV1 A;  3CR4 X;  3KEV A;  2FJU B;  1AJ5 A;  4CFR A;  1IQ3 A;  1SL7 A;  4MZL A;  2KAX A;  2LHL A;  1Y1U A;  1UWO A;  5FYX A;  3TZ1 A;  3LL8 B;  3KF9 A;  2OS8 C;  3I5I B;  3OP0 A;  1XFV O;  1NX0 A;  1JFK A;  2EC6 C;  1H8B A;  3GK4 X;  1XVJ A;  1HT9 A;  1QIV A;  1V1F A;  3FWB A;  2BEC A;  1C07 A;  5PAL A;  5KSZ A;  2JTT A;  2V53 A;  1BLQ A;  2ZRS A;  2L2E A;  5DKR A;  4NQG A;  1RJV A;  2Y5I A;  2G2B A;  1IRJ A;  2JWW A;  1DJG A;  1YVH A;  4BY5 A;  1NPQ A;  3BOW A;  2KGR A;  3I5F C;  4Q04 A;  1S5G Y;  1CLL A;  4GGN A;  5KTY A;  2K2F A;  1UHH A;  2OTG B;  3NSO A;  3SG4 A;  1PVA A;  3EVU A;  1SW8 A;  1YUT A;  1DVI A;  1FW4 A;  1KK7 Z;  1TTX A;  3SG3 A;  3VRN A;  3VRQ A;  1UUS A;  1A29 A;  4M2P A;  3LCP C;  2O5G A;  1S26 D;  1WDC C;  1CDM A;  1SNL A;  2LAP A;  2PAL A;  1ZMZ A;  4YI9 A;  5GQQ C;  5HLV A;  1W7I B;  1RK9 A;  4ETO A;  1FI5 A;  2NZ0 A;  3EK4 A;  2LE9 B;  2WC8 A;  1G33 A;  3BUW B;  1OE9 B;  3TUY B;  4CPV A;  1K9P A;  2LVK A;  1XFZ O;  1SR6 B;  4CLN A;  4OV2 A;  1NP8 A;  3WHU B;  4HSZ A;  2JT0 A;  2M7N A;  1MF8 B;  2ISD A;  2KAV A;  2M9G A;  2KI6 D;  1AJ4 A;  4NDB A;  1M46 A;  4WQ3 A;  1SRA A;  1YUS A;  1KK8 C;  1IJ5 A;  4PE1 A;  1SCM B;  1DJW A;  2ZND A;  4USL A;  1PVB A;  2BBM A;  4YGA A;  3AKA A;  1BOD A;  1OMR A;  4JPZ B;  2L0P A;  2BL0 B;  1MXE A;  1CDP A;  2WCE A;  2QPT A;  1NCY A;  1GQM A;  1RRO A;  2LAN A;  1TIZ A;  5D7F A;  1K9U A;  2K8M B;  1VRK A;  2ZKM X;  2OS8 B;  1BOC A;  5BPJ A;  1B8C A;  1KFX S;  3CWG A;  2NCP A;  1WRZ A;  2L4I A;  3PAT A;  5AER A;  2EC6 B;  1CFF A;  4QJ3 B;  1B4C A;  2NCO A;  1YRU B;  2WCB A;  4JWQ A;  4HRG A;  1CFC A;  3FIA A;  3OX5 A;  1H4B A;  1Q80 A;  4E68 A;  1BF5 A;  1WLM A;  1N2D A;  1TN4 A;  2NXQ A;  1FF1 A;  1FI6 A;  1SBJ A;  1TNW A;  1J1D A;  2DOQ A;  1K96 A;  2F3Y A;  1U5I B;  2BE4 A;  1AP4 A;  1CMF A;  1NYA A;  1SYM A;  1QTX A;  5DKN A;  4OR9 B;  1TOP A;  3I5F B;  3DVM A;  1XA5 A;  3O6B A;  2LC5 A;  1GGW A;  1UUR A;  3EVV A;  3A8R A;  1J7O A;  4OKH A;  1J1E A;  3IF7 A;  2MA2 A;  3BUM B;  4MN0 A;  4MVF A;  2QAC A;  2Y1M A;  3RM1 A;  4AQJ A;  3GOF A;  4CID A;  1WDC B;  4I5K A;  2CTN A;  1DGV A;  2L50 A;  4R1E A;  3FWC A;  2KQY A;  3EKH A;  4U8D A;  1XO5 A;  3BOW B;  2RGI A;  2PMY A;  1LVC D;  4MLW A;  2KYC A;  2JZI A;  1A4P A;  3I5H C;  3AAJ A;  1AUI B;  1IWQ A;  3OX6 A;  3MSE B;  4MSP A;  1DJY A;  1GGZ A;  4A4B A;  2B1U A;  4WRI A;  4ZCU A;  4GUK A;  1SK6 D;  2E6W A;  1PAL A;  1DJH A;  2I94 A;  4DS7 A;  1M39 A;  3KPX A;  1U5I A;  3RLZ A;  1KK8 B;  2KGB C;  1QXP A;  2LUX A;  2HPS A;  1QVI Y;  1MR8 A;  2KI6 C;  1DJX A;  2Y4Q A;  3QRX A;  3O2P A;  5J3X A;  3SIA A;  3E3R A;  5JOL A;  4YGD B;  1F4Q A;  1BR1 B;  1CFD A;  4UPG A;  2MLF C;  1MQ1 A;  2SCP A;  3BYA A;  3BUN B;  2LVI A;  4PE7 A;  1NIW A;  5TNC A;  5I2L A;  3JTD C;  2ZNE A;  4IL1 A;  1QAT A;  1QV0 A;  1XK4 A;  1ZOT B;  2WND A;  3LK1 A;  3SG6 A;  2L5X B;  2JQ6 A;  3DF0 A;  2AMI A;  1RFJ A;  3A4U B;  1Y1A A;  1CM1 A;  2SAS A;  4DIR A;  3PM8 A;  2JXL A;  1OZO A;  1B7T Y;  2KAY A;  4I5L B;  1YUU A;  4GGF C;  5HKY A;  2CNP A;  1UHN A;  2KHN A;  1S6C A;  3GK2 A;  2MBX A;  2M1K B;  1KFX L;  3K21 A;  4QJ4 B;  1NX1 A;  1PSR A;  1XK4 C;  2K61 A;  1S5G Z;  1NX2 A;  2OPO A;  5AEQ A;  1NWD A;  2GGZ A;  1PRW A;  1SMG A;  1X02 A;  1EG3 A;  3NSI A;  1K9K A;  3PLF B;  2JPT A;  5HKZ A;  1J7P A;  2JNF A;  1XYD A;  3PAL A;  1CM4 A;  3PSR A;  2VRG A;  4FTG A;  1ALV A;  2E30 A;  1K90 D;  4ORB B;  1QAS A;  2LP3 A;  2M8U A;  1SKT A;  5HYD A;  2LM5 A;  1G8I A;  4PE4 A;  1QLK A;  4DCK A;  1K94 A;  5CSJ A;  2LVV A;  4PHM A;  2CBL A;  3M0W A;  2LUC A;  1SY9 A;  3DD4 A;  2KQ6 A;  2WOS A;  1WY9 A;  1B1G A;  2L98 A;  1IQ5 A;  3I5H B;  1E8A A;  1MHO A;  4PAL A;  2K7B A;  1GJY A;  1XFX O;  1KSO A;  2G9B A;  2LCP A;  1F4O A;  2LMT A;  1SL9 A;  5ER4 X;  2KNE A;  2HQ8 A;  1SCV A;  1Y1X A;  4C0K A;  4ORA B;  1A75 A;  2GGM A;  5I2Q A;  1J55 A;  2BE6 A;  1QIW A;  3LK0 A;  4YBH B;  2KYF A;  1UHJ A;  4GNK B;  1OSA A;  1YRT B;  1BJF A;  2GV5 A;  1JF2 A;  1UHI A;  2F33 A;  2M97 A;  2PRU A;  5F6T A;  1ZUZ A;  3I5G C;  4P2Y B;  2FCE A;  2A4J A;  2MLE C;  2BBN A;  3CGA A;  3TDU A;  2O60 A;  1CTR A;  3SG5 A;  4MEW A;  5I8N A;  1V1G A;  2IS9 A;  1DGU A;  1M45 A;  2LHI A;  2P6B B;  2JXC A;  3ZWH A;  1YVL A;  3JTD B;  2LMV A;  1J7Q A;  1FBV A;  2M29 A;  1MXL C;  1WRL A;  2KOT A;  2NLN A;  1IH0 A;  2HF5 A;  1RTP 1;  4A4C A;  1PUL A;  2BKH B;  2CCM A;  3IQO A;  2LLU A;  1KQV A;  1PK0 D;  1QX2 A;  3FS7 A;  5KU1 A;  3PFV A;  1QLS A;  3BUX B;  2M1U A;  1K95 A;  2JUL A;  4PCW A;  1CB1 A;  3EVR A;  1L2O C;  1OMD A;  2K7C A;  1TRF A;  1NSH A;  1B8R A;  4AQI A;  1IJ6 A;  3AAK A;  3DF0 B;  2F3Z A;  1OZS A;  3JVT C;  3OB2 B;  4XJK A;  1REC A;  2MJW B;  2WOR A;  4PHN A;  3WNX B;  1AHR A;  3F45 A;  4JQ0 D;  1EG4 A;  2L4H A;  1YX8 A;  4D1E A;  1R6P A;  1TNX A;  1BU3 A;  4XYN A;  2LLS A;  2KFH A;  1YX7 A;  1XFY O;  1ZAC A;  2I2R E;  1JUO A;  1S3P A;  1YR5 A;  3DVK A;  2KBM A;  3NSK A;  5CSN A;  3BUO B;  1HQV A;  2TN4 A;  1LA3 A;  2KBI A;  5G08 A;  4M2O A;  1M31 A;  2HET A;  5ER5 A;  2ZFD A;  1A03 A;  1Y6W A;  2I18 A;  3EKJ A;  4N1G A;  1OMV A;  2EGD A;  3PN7 C;  2BCA A;  2H2K A;  1EH2 A;  1OOJ A;  2JTZ A;  2MAZ A;  2PAS A;  4GGF A;  3H4S E;  2PSR A;  3D10 A;  4F0Z B;  2M0R A;  2JOJ A;  3BQ3 A;  5CPV A;  1DJI A;  1NUB A;  4M2Q A;  4HRE E;  2KI4 C;  4HRH A;  1B8L A;  4ICB A;  3O78 A;  3BXK A;  1EL4 A;  1K2H A;  1L7Z A;  1XFW O;  3OHM B;  1D1O A;  1AVS A;  1CMG A;  1JSA A;  4P5O E;  1IGV A;  5K89 A;  2Y1N A;  3I5G B;  1JF0 A;  2AAO A;  4I5J A;  2F8P A;  2ZN8 A;  1KQM C;  2LV7 A;  1QX5 B;  1A2X A;  1NX3 A;  2MRD A;  5CSF A;  3CLN A;  1JWD A;  4GBA A;  1XFU O;  3NXA A;  2M3W A;  1EJ3 A;  4GPL B;  3TDZ A;  2WCF A;  1MWN A;  1CFP A;  1A75 B;  1UP5 A;  1KWO C;  1N0Y A;  1C7W A;  3D0Y A;  3SG7 A;  5CSI A;  4DRW A;  1RWY A;  1KK7 Y;  2Q91 A;  1DJZ A;  1B7T Z;  1LKJ A;  2BCB A;  4DUQ A;  1NCX A;  1CNP A;  1W7J B;  4OCI A;  1F54 A;  3EK7 A;  3C1V A;  5I2O A;  4I5N B;  3VRP A;  1FPW A;  5AXI A;  1ODB A;  3CR2 A;  1CDL A;  1G4Y R;  1DMO A;  1TCF A;  1L2O B;  3CZT X;  1BMO A;  4ORC B;  4OVN F;  1QX7 A;  2KDH A;  2JNX A;  1JFJ A;  5B8I B;  5DKQ A;  2JU0 A;  2CXJ A;  1ZFS A;  3JVT B;  1KFU S;  2JT8 A;  3VRO A;  2Q4U A;  4FQO A;  3EK8 A;  2FCD A;  3CR5 X;  2K7O A;  4GAO A;  1EXR A;  1BR4 B;  4PE0 A;  4YGC B;  2R2I A;  4N5X A;  4C0L A;  1F8H A;  2BKI B;  1LXF C;  2LVJ A;  1PSB A;  2LNK A;  3DVE A;  3KO0 A;  1B9A A;  4YRU A;  4CFQ A;  1S6J A;  1IKU A;  1QS7 A;  1F71 A;  2K0J A;  4PHJ A;  4TNC A;  1AK8 A;  1DF0 B; 
#chains in the Genus database with same CATH topology
 4XJK B;  3I5I C;  4WQ2 A;  1F55 A;  3DVJ A;  2AUC A;  4N1F A;  4MZJ A;  1NCZ A;  1MUX A;  3B88 A;  2ZRT A;  3LLE A;  4YGB B;  4GFT A;  1KSM A;  3L47 A;  3WXA A;  1S6I A;  2KI4 B;  4PHK A;  3D76 A;  1BT6 A;  1Y0V H;  2H61 A;  2K2A A;  3TS5 B;  2LP2 A;  2WCJ A;  1CLB A;  1CLM A;  1TNQ A;  4NDD A;  4F7F A;  4YI8 A;  4L9M A;  2P71 A;  3V2L A;  4ZCV A;  1SPY A;  2JC2 A;  2COL B;  1YTZ C;  2ZN9 A;  3OB1 B;  1WLZ A;  3SIB A;  4MRX A;  1DT7 B;  3CS1 A;  3GK1 A;  5HLO A;  3B6X A;  1K8U A;  2F2O A;  1TNP A;  1KQM B;  1YUR A;  2KFG A;  2OTG C;  3HX4 A;  3OGN A;  2M7L A;  4QJ5 B;  2L51 A;  5HLV A;  1CKK A;  3O4X A;  4C0J A;  1B47 A;  2H61 C;  4PDZ A;  3WHT B;  1WRK A;  3OBV A;  1JC2 A;  5AFP A;  1KWO B;  5D69 A;  4PT1 A;  4MBE A;  1M63 B;  2PVB A;  1JBA A;  1DF0 A;  3NGV A;  1Z4H A;  3PN7 B;  4MRY A;  3FE6 A;  5HKW A;  4BY4 A;  4KYN A;  2CT9 A;  1DTL A;  3TUY C;  4NDC A;  3VGO A;  3ZNI A;  3AKB A;  2LMU A;  5AAN A;  1F70 A;  1SR6 C;  1IG5 A;  1OQP A;  2EHB A;  1DEK A;  1J7R A;  1K93 D;  2LLT A;  4MZK A;  2I7A A;  5JJG A;  1R2U A;  1S36 A;  2FOT A;  1BG1 A;  1LA0 A;  2KFF A;  3CTN A;  3IQQ A;  2JRF A;  1OOF A;  1UHK A;  3D0Y B;  3KHE A;  3O4Y A;  3TDI A;  1C7V A;  2D8N A;  2M49 B;  3NSL A;  3B87 A;  2K7D A;  4YGE B;  1CDN A;  1SCM C;  1KCY A;  3ICB A;  3SG2 A;  2HQW A;  2JT3 A;  1N65 A;  3HCM A;  4AOM A;  3VRR A;  1S1E A;  3SJS A;  1SL8 A;  1QJT A;  1TCO B;  1LIN A;  2BL0 C;  5IBW A;  2BCX A;  1KFU L;  2F2P A;  1QVI Z;  3TS5 C;  1ALW A;  1IIO A;  1DQE A;  2MHH A;  2KSP A;  1QV1 A;  3CR4 X;  3KEV A;  2FJU B;  1AJ5 A;  4CFR A;  1IQ3 A;  1SL7 A;  4MZL A;  2KAX A;  2LHL A;  1Y1U A;  1UWO A;  3DZT A;  5FYX A;  3TZ1 A;  3LL8 B;  3KF9 A;  2OS8 C;  3I5I B;  3OP0 A;  1XFV O;  1NX0 A;  1JFK A;  2EC6 C;  3FE8 A;  1H8B A;  3GK4 X;  1XVJ A;  1HT9 A;  1QIV A;  1V1F A;  3FWB A;  2BEC A;  1C07 A;  3L4A A;  5PAL A;  5KSZ A;  2JTT A;  2V53 A;  5D3O A;  1BLQ A;  2ZRS A;  2L2E A;  5DKR A;  4NQG A;  2K60 A;  1RJV A;  2Y5I A;  2G2B A;  1IRJ A;  2JWW A;  1DJG A;  1YVH A;  5FI7 A;  4BY5 A;  1NPQ A;  3BOW A;  2KGR A;  3I5F C;  4Q04 A;  1S5G Y;  1CLL A;  4GGN A;  5KTY A;  2K2F A;  1UHH A;  2OTG B;  3NSO A;  3SG4 A;  1PVA A;  3EVU A;  1SW8 A;  1YUT A;  1DVI A;  1FW4 A;  1KK7 Z;  1TTX A;  3SG3 A;  3VRN A;  3VRQ A;  1UUS A;  1A29 A;  4M2P A;  3SS3 A;  3LCP C;  2O5G A;  1S26 D;  1WDC C;  1CDM A;  1SNL A;  1OW4 A;  2LAP A;  1ZMZ A;  2PAL A;  4YI9 A;  5GQQ C;  1W7I B;  1RK9 A;  4ETO A;  1FI5 A;  1OOG A;  2NZ0 A;  3EK4 A;  2LE9 B;  2WC8 A;  1G33 A;  3BUW B;  1OE9 B;  3TUY B;  3CDN A;  4CPV A;  1K9P A;  2LVK A;  1XFZ O;  3BFB A;  1SR6 B;  4CLN A;  4OV2 A;  1NP8 A;  3D74 A;  2QDI A;  3WHU B;  4HSZ A;  2JT0 A;  2M7N A;  1MF8 B;  2ISD A;  2KAV A;  2M9G A;  3BJH A;  2KI6 D;  3B7A A;  1AJ4 A;  3D77 A;  4NDB A;  1M46 A;  4WQ3 A;  1SRA A;  1YUS A;  1KK8 C;  1IJ5 A;  2WCL A;  4PE1 A;  1SCM B;  1DJW A;  2ZND A;  4USL A;  1PVB A;  2BBM A;  4YGA A;  3AKA A;  1BOD A;  1OMR A;  2WCH A;  2L0P A;  2BL0 B;  4JPZ B;  1DC1 A;  1MXE A;  1CDP A;  2WCE A;  2QPT A;  1TWO A;  1NCY A;  1GQM A;  3B86 A;  1DEL A;  1RRO A;  2LAN A;  1TIZ A;  5D7F A;  1K9U A;  2BNX A;  4OZD A;  2K8M B;  1VRK A;  1TUZ A;  2ZKM X;  2OS8 B;  1BOC A;  5BPJ A;  1B8C A;  1KFX S;  2WC6 A;  2NCP A;  1WRZ A;  2L4I A;  2PQL A;  3CWG A;  3VB1 A;  1TUJ A;  2QEB A;  3PAT A;  5AER A;  2EC6 B;  1CFF A;  1SSE B;  4QJ3 B;  1B4C A;  2NCO A;  1YRU B;  2WCB A;  4JWQ A;  4HRG A;  1CFC A;  3FIA A;  3OX5 A;  1H4B A;  1Q80 A;  2WCM A;  4E68 A;  1BF5 A;  2JPO A;  1WLM A;  1N2D A;  1TN4 A;  2BAP A;  2NXQ A;  1FF1 A;  1FI6 A;  1SBJ A;  1TNW A;  1J1D A;  2DOQ A;  1K96 A;  2F3Y A;  1U5I B;  2BE4 A;  1AP4 A;  1CMF A;  1NYA A;  4JKT A;  1SYM A;  1QTX A;  3DYE A;  5DKN A;  4OR9 B;  1TOP A;  2KPH A;  3I5F B;  3L4L A;  3CAB A;  3DVM A;  1XA5 A;  3EG5 B;  3O6B A;  2LC5 A;  1GGW A;  1UUR A;  2WC5 A;  3EVV A;  3A8R A;  1J7O A;  4OKH A;  5FI6 A;  1J1E A;  3IF7 A;  2MA2 A;  3BUM B;  4MN0 A;  4MVF A;  2QAC A;  1Z2C B;  2Y1M A;  3RM1 A;  4AQJ A;  1T14 A;  3GOF A;  4CID A;  1WDC B;  4I5K A;  2CTN A;  1DGV A;  2L50 A;  4R1E A;  3FWC A;  2KQY A;  3EKH A;  4U8D A;  1XO5 A;  3BOW B;  2RGI A;  2PMY A;  1LVC D;  4MLW A;  2KYC A;  3S0D A;  2JZI A;  1A4P A;  3DY9 A;  3I5H C;  3AAJ A;  1AUI B;  1IWQ A;  3OX6 A;  3MSE B;  4MSP A;  1DJY A;  1GGZ A;  4A4B A;  2B1U A;  4WRI A;  4ZCU A;  4GUK A;  1SK6 D;  2E6W A;  3CZ0 A;  1PAL A;  1DJH A;  2I94 A;  4DS7 A;  1M39 A;  3KPX A;  1QWV A;  1U5I A;  3RLZ A;  1KK8 B;  2KGB C;  3UO9 A;  2WCK A;  1QXP A;  2LUX A;  2HPS A;  1QVI Y;  1MR8 A;  2GTE A;  1DJX A;  2KI6 C;  2Y4Q A;  3N7H A;  3QRX A;  3S0B A;  3O2P A;  5J3X A;  3SIA A;  3E3R A;  5JOL A;  4YGD B;  1F4Q A;  1BR1 B;  1CFD A;  4UPG A;  2MLF C;  1MQ1 A;  3R1V A;  2SCP A;  3BYA A;  3BUN B;  2LVI A;  3FE9 A;  4PE7 A;  1NIW A;  5TNC A;  5I2L A;  3JTD C;  2ZNE A;  4IL1 A;  1QAT A;  1QV0 A;  1XK4 A;  3SS5 A;  1ZOT B;  2WND A;  3LK1 A;  3SG6 A;  2L5X B;  2JQ6 A;  3DF0 A;  2AMI A;  1RFJ A;  3A4U B;  3D78 A;  1Y1A A;  3R1P A;  1CM1 A;  2KLD A;  2SAS A;  4DIR A;  3PM8 A;  2H8V A;  2JXL A;  1OZO A;  1B7T Y;  2KAY A;  4I5L B;  1YUU A;  4GGF C;  5HKY A;  2CNP A;  1UHN A;  2KHN A;  1S6C A;  4IJ7 A;  3GK2 A;  2MBX A;  2M1K B;  1KFX L;  3K21 A;  4QJ4 B;  2YGU A;  1NX1 A;  1PSR A;  1OOI X;  1XK4 C;  2K61 A;  1S5G Z;  1NX2 A;  2OPO A;  5AEQ A;  1NWD A;  2GGZ A;  1PRW A;  1SMG A;  1X02 A;  1EG3 A;  3NSI A;  1K9K A;  3PLF B;  1P28 A;  2JPT A;  5HKZ A;  3S0E A;  1J7P A;  2JNF A;  1XYD A;  3PAL A;  1CM4 A;  3PSR A;  2ERB A;  2VRG A;  4FTG A;  1ALV A;  2E30 A;  1K90 D;  4ORB B;  1QAS A;  2FJY A;  2LP3 A;  2M8U A;  1SKT A;  5HYD A;  2LM5 A;  1G8I A;  4PE4 A;  1QLK A;  4DCK A;  1K94 A;  5CSJ A;  2LVV A;  4PHM A;  2CBL A;  3M0W A;  2LUC A;  1SY9 A;  3DD4 A;  1C3Y A;  2KQ6 A;  2WOS A;  1WY9 A;  1ORG A;  3NHT A;  2L98 A;  4INW A;  3QME A;  1B1G A;  1IQ5 A;  3I5H B;  1E8A A;  1MHO A;  4PAL A;  2K7B A;  1GJY A;  1LS8 A;  1XFX O;  1KSO A;  2G9B A;  2LCP A;  1F4O A;  2LMT A;  1SL9 A;  5ER4 X;  2KNE A;  2HQ8 A;  1SCV A;  1Y1X A;  4C0K A;  4ORA B;  1A75 A;  2GGM A;  5I2Q A;  1J55 A;  2BE6 A;  1QIW A;  3LK0 A;  4YBH B;  2KYF A;  1UHJ A;  4GNK B;  1OSA A;  1YRT B;  1BJF A;  2GV5 A;  1JF2 A;  1UHI A;  1XFR A;  2F33 A;  2M97 A;  2PRU A;  5F6T A;  1ZUZ A;  3I5G C;  3K1E A;  4P2Y B;  2FCE A;  2A4J A;  2MLE C;  2BBN A;  3CGA A;  3TDU A;  2O60 A;  1CTR A;  3SG5 A;  4MEW A;  5I8N A;  1V1G A;  2IS9 A;  1DGU A;  1M45 A;  2LHI A;  2P6B B;  5I94 A;  3D75 A;  2JXC A;  3ZWH A;  1YVL A;  3JTD B;  2KLE A;  2LMV A;  1J7Q A;  1FBV A;  2M29 A;  1MXL C;  1WRL A;  2KOT A;  2NLN A;  1IH0 A;  2HF5 A;  3S0F A;  1RTP 1;  4A4C A;  1PUL A;  2BKH B;  2CCM A;  3IQO A;  2LLU A;  3D73 A;  1C3Z A;  1KQV A;  1PK0 D;  1QX2 A;  3FS7 A;  5KU1 A;  3PFV A;  1QLS A;  3BUX B;  2M1U A;  1K95 A;  2JUL A;  4PCW A;  1CB1 A;  3S0G A;  3EVR A;  1L2O C;  1OMD A;  2K7C A;  1TRF A;  5DIC A;  3PM2 A;  1NSH A;  1W9Z A;  1B8R A;  4AQI A;  1IJ6 A;  3AAK A;  3DF0 B;  2F3Z A;  1OZS A;  3JVT C;  3OB2 B;  5HL1 A;  4XJK A;  1REC A;  3R72 A;  2MJW B;  2WOR A;  4PHN A;  3WNX B;  1AHR A;  3F45 A;  4JQ0 D;  1EG4 A;  2L4H A;  1YX8 A;  4D1E A;  1R6P A;  1TNX A;  1BU3 A;  4XYN A;  2LLS A;  2KFH A;  1YX7 A;  1XFY O;  1ZAC A;  2I2R E;  1JUO A;  1S3P A;  1YR5 A;  3DVK A;  2KBM A;  3NSK A;  5CSN A;  3BUO B;  1HQV A;  2TN4 A;  1OOH A;  3BFH A;  1LA3 A;  2KBI A;  2L5Y A;  5G08 A;  4M2O A;  1M31 A;  2HET A;  5ER5 A;  2ZFD A;  1A03 A;  1Y6W A;  2I18 A;  3EKJ A;  4N1G A;  1OMV A;  2EGD A;  3PN7 C;  2BCA A;  2H2K A;  1EH2 A;  1OOJ A;  2JTZ A;  2MAZ A;  2PAS A;  3Q8I A;  4GGF A;  3H4S E;  2PSR A;  3D10 A;  4F0Z B;  3PJI A;  2M0R A;  2JOJ A;  3BQ3 A;  5CPV A;  1DJI A;  1NUB A;  4M2Q A;  4HRE E;  2KI4 C;  4HRH A;  1B8L A;  4ICB A;  3O78 A;  3BXK A;  1EL4 A;  1K2H A;  1L7Z A;  5FI2 A;  1XFW O;  3OHM B;  5EL2 A;  1D1O A;  1AVS A;  1CMG A;  1JSA A;  2QEV A;  4P5O E;  3CYZ A;  1IGV A;  5K89 A;  2Y1N A;  3I5G B;  1JF0 A;  2AAO A;  4I5J A;  2F8P A;  2ZN8 A;  1KQM C;  2LV7 A;  1QX5 B;  1A2X A;  1NX3 A;  2MRD A;  5CSF A;  3CLN A;  1JWD A;  4GBA A;  1XFU O;  3NXA A;  2M3W A;  1EJ3 A;  4GPL B;  3TDZ A;  3RZS A;  2WCF A;  1MWN A;  1CFP A;  1A75 B;  1UP5 A;  1KWO C;  1N0Y A;  1C7W A;  3D0Y A;  3SG7 A;  5CSI A;  2L2C A;  4DRW A;  1RWY A;  1KK7 Y;  2Q91 A;  1DJZ A;  1B7T Z;  1LKJ A;  2BCB A;  4DUQ A;  1NCX A;  1CNP A;  1W7J B;  4FQT A;  4OCI A;  3EK7 A;  1F54 A;  3C1V A;  5I2O A;  2QEH A;  4I5N B;  3VRP A;  3BFA A;  1FPW A;  5AXI A;  1ODB A;  3CR2 A;  3SS4 A;  1CDL A;  1G4Y R;  1DMO A;  1TCF A;  1L2O B;  3DXL A;  3CZT X;  3NHI A;  1BMO A;  1GM0 A;  4ORC B;  4OVN F;  1QX7 A;  3CZ1 A;  3UNW A;  2KDH A;  2JNX A;  1JFJ A;  5B8I B;  5DKQ A;  2JU0 A;  2CXJ A;  1ZFS A;  2PYQ A;  3JVT B;  1KFU S;  2JT8 A;  3VRO A;  2Q4U A;  4FQO A;  3EK8 A;  3R1O A;  2FCD A;  2P70 A;  2QEO A;  3CR5 X;  4INX A;  2K7O A;  4GAO A;  1EXR A;  1BR4 B;  4PE0 A;  4YGC B;  2R2I A;  4N5X A;  4C0L A;  1F8H A;  2BKI B;  1LXF C;  2LVJ A;  1PSB A;  2LNK A;  3DVE A;  3IVT A;  3KO0 A;  1B9A A;  4JD9 A;  4YRU A;  3S0A A;  4CFQ A;  1S6J A;  3CZ2 A;  1IKU A;  1QS7 A;  1F71 A;  2K0J A;  4PHJ A;  4TNC A;  1AK8 A;  1DF0 B; 
#chains in the Genus database with same CATH homology
 4XJK B;  3I5I C;  4WQ2 A;  1F55 A;  3DVJ A;  2AUC A;  4N1F A;  4MZJ A;  1NCZ A;  1MUX A;  3LLE A;  2ZRT A;  4YGB B;  4GFT A;  1KSM A;  3WXA A;  1S6I A;  2KI4 B;  4PHK A;  1BT6 A;  1Y0V H;  2H61 A;  2K2A A;  3TS5 B;  2LP2 A;  1CLB A;  1CLM A;  1TNQ A;  4NDD A;  4YI8 A;  4L9M A;  4ZCV A;  1SPY A;  2JC2 A;  2COL B;  1YTZ C;  2ZN9 A;  3OB1 B;  1WLZ A;  3SIB A;  4MRX A;  1DT7 B;  3CS1 A;  3GK1 A;  5HLO A;  1K8U A;  2F2O A;  1TNP A;  1KQM B;  1YUR A;  2KFG A;  2OTG C;  3HX4 A;  2M7L A;  4QJ5 B;  2L51 A;  1CKK A;  4C0J A;  1B47 A;  2H61 C;  4PDZ A;  3WHT B;  1WRK A;  1JC2 A;  5AFP A;  1KWO B;  5D69 A;  4MBE A;  1M63 B;  2PVB A;  1JBA A;  1DF0 A;  4MRY A;  3PN7 B;  5HKW A;  4BY4 A;  2CT9 A;  1DTL A;  3TUY C;  4NDC A;  3VGO A;  3ZNI A;  3AKB A;  2LMU A;  5AAN A;  1F70 A;  1SR6 C;  1IG5 A;  1OQP A;  2EHB A;  1J7R A;  1K93 D;  2LLT A;  4MZK A;  2I7A A;  5JJG A;  1R2U A;  1S36 A;  2FOT A;  1BG1 A;  1LA0 A;  2KFF A;  3CTN A;  3IQQ A;  2JRF A;  1UHK A;  3D0Y B;  3KHE A;  3O4Y A;  3TDI A;  1C7V A;  2D8N A;  2M49 B;  3NSL A;  2K7D A;  4YGE B;  1CDN A;  1SCM C;  1KCY A;  3ICB A;  3SG2 A;  2HQW A;  2JT3 A;  1N65 A;  3HCM A;  4AOM A;  3VRR A;  1S1E A;  3SJS A;  1SL8 A;  1QJT A;  1TCO B;  2BL0 C;  1LIN A;  5IBW A;  2BCX A;  1KFU L;  2F2P A;  1QVI Z;  3TS5 C;  1ALW A;  2MHH A;  2KSP A;  1QV1 A;  3CR4 X;  3KEV A;  2FJU B;  1AJ5 A;  4CFR A;  1IQ3 A;  1SL7 A;  4MZL A;  2KAX A;  2LHL A;  1Y1U A;  1UWO A;  5FYX A;  3TZ1 A;  3LL8 B;  3KF9 A;  2OS8 C;  3I5I B;  3OP0 A;  1XFV O;  1NX0 A;  1JFK A;  2EC6 C;  1H8B A;  3GK4 X;  1XVJ A;  1HT9 A;  1QIV A;  1V1F A;  3FWB A;  2BEC A;  1C07 A;  5PAL A;  5KSZ A;  2JTT A;  2V53 A;  1BLQ A;  2ZRS A;  2L2E A;  5DKR A;  4NQG A;  1RJV A;  2Y5I A;  2G2B A;  1IRJ A;  2JWW A;  1DJG A;  1YVH A;  4BY5 A;  1NPQ A;  3BOW A;  2KGR A;  3I5F C;  4Q04 A;  1S5G Y;  1CLL A;  4GGN A;  5KTY A;  2K2F A;  1UHH A;  2OTG B;  3NSO A;  3SG4 A;  1PVA A;  3EVU A;  1SW8 A;  1YUT A;  1DVI A;  1FW4 A;  1KK7 Z;  1TTX A;  3SG3 A;  3VRN A;  3VRQ A;  1UUS A;  1A29 A;  4M2P A;  3LCP C;  2O5G A;  1S26 D;  1WDC C;  1CDM A;  1SNL A;  2LAP A;  2PAL A;  1ZMZ A;  4YI9 A;  5GQQ C;  5HLV A;  1W7I B;  1RK9 A;  4ETO A;  1FI5 A;  2NZ0 A;  3EK4 A;  2LE9 B;  2WC8 A;  1G33 A;  3BUW B;  1OE9 B;  3TUY B;  4CPV A;  1K9P A;  2LVK A;  1XFZ O;  1SR6 B;  4CLN A;  4OV2 A;  1NP8 A;  3WHU B;  4HSZ A;  2JT0 A;  2M7N A;  1MF8 B;  2ISD A;  2KAV A;  2M9G A;  2KI6 D;  1AJ4 A;  4NDB A;  1M46 A;  4WQ3 A;  1SRA A;  1YUS A;  1KK8 C;  1IJ5 A;  4PE1 A;  1SCM B;  1DJW A;  2ZND A;  4USL A;  1PVB A;  2BBM A;  4YGA A;  3AKA A;  1BOD A;  1OMR A;  4JPZ B;  2L0P A;  2BL0 B;  1MXE A;  1CDP A;  2WCE A;  2QPT A;  1NCY A;  1GQM A;  1RRO A;  2LAN A;  1TIZ A;  5D7F A;  1K9U A;  2K8M B;  1VRK A;  2ZKM X;  2OS8 B;  1BOC A;  5BPJ A;  1B8C A;  1KFX S;  3CWG A;  2NCP A;  1WRZ A;  2L4I A;  3PAT A;  5AER A;  2EC6 B;  1CFF A;  4QJ3 B;  1B4C A;  2NCO A;  1YRU B;  2WCB A;  4JWQ A;  4HRG A;  1CFC A;  3FIA A;  3OX5 A;  1H4B A;  1Q80 A;  4E68 A;  1BF5 A;  1WLM A;  1N2D A;  1TN4 A;  2NXQ A;  1FF1 A;  1FI6 A;  1SBJ A;  1TNW A;  1J1D A;  2DOQ A;  1K96 A;  2F3Y A;  1U5I B;  2BE4 A;  1AP4 A;  1CMF A;  1NYA A;  1SYM A;  1QTX A;  5DKN A;  4OR9 B;  1TOP A;  3I5F B;  3DVM A;  1XA5 A;  3O6B A;  2LC5 A;  1GGW A;  1UUR A;  3EVV A;  3A8R A;  1J7O A;  4OKH A;  1J1E A;  3IF7 A;  2MA2 A;  3BUM B;  4MN0 A;  4MVF A;  2QAC A;  2Y1M A;  3RM1 A;  4AQJ A;  3GOF A;  4CID A;  1WDC B;  4I5K A;  2CTN A;  1DGV A;  2L50 A;  4R1E A;  3FWC A;  2KQY A;  3EKH A;  4U8D A;  1XO5 A;  3BOW B;  2RGI A;  2PMY A;  1LVC D;  4MLW A;  2KYC A;  2JZI A;  1A4P A;  3I5H C;  3AAJ A;  1AUI B;  1IWQ A;  3OX6 A;  3MSE B;  4MSP A;  1DJY A;  1GGZ A;  4A4B A;  2B1U A;  4WRI A;  4ZCU A;  4GUK A;  1SK6 D;  2E6W A;  1PAL A;  1DJH A;  2I94 A;  4DS7 A;  1M39 A;  3KPX A;  1U5I A;  3RLZ A;  1KK8 B;  2KGB C;  1QXP A;  2LUX A;  2HPS A;  1QVI Y;  1MR8 A;  2KI6 C;  1DJX A;  2Y4Q A;  3QRX A;  3O2P A;  5J3X A;  3SIA A;  3E3R A;  5JOL A;  4YGD B;  1F4Q A;  1BR1 B;  1CFD A;  4UPG A;  2MLF C;  1MQ1 A;  2SCP A;  3BYA A;  3BUN B;  2LVI A;  4PE7 A;  1NIW A;  5TNC A;  5I2L A;  3JTD C;  2ZNE A;  4IL1 A;  1QAT A;  1QV0 A;  1XK4 A;  1ZOT B;  2WND A;  3LK1 A;  3SG6 A;  2L5X B;  2JQ6 A;  3DF0 A;  2AMI A;  1RFJ A;  3A4U B;  1Y1A A;  1CM1 A;  2SAS A;  4DIR A;  3PM8 A;  2JXL A;  1OZO A;  1B7T Y;  2KAY A;  4I5L B;  1YUU A;  4GGF C;  5HKY A;  2CNP A;  1UHN A;  2KHN A;  1S6C A;  3GK2 A;  2MBX A;  2M1K B;  1KFX L;  3K21 A;  4QJ4 B;  1NX1 A;  1PSR A;  1XK4 C;  2K61 A;  1S5G Z;  1NX2 A;  2OPO A;  5AEQ A;  1NWD A;  2GGZ A;  1PRW A;  1SMG A;  1X02 A;  1EG3 A;  3NSI A;  1K9K A;  3PLF B;  2JPT A;  5HKZ A;  1J7P A;  2JNF A;  1XYD A;  3PAL A;  1CM4 A;  3PSR A;  2VRG A;  4FTG A;  1ALV A;  2E30 A;  1K90 D;  4ORB B;  1QAS A;  2LP3 A;  2M8U A;  1SKT A;  5HYD A;  2LM5 A;  1G8I A;  4PE4 A;  1QLK A;  4DCK A;  1K94 A;  5CSJ A;  2LVV A;  4PHM A;  2CBL A;  3M0W A;  2LUC A;  1SY9 A;  3DD4 A;  2KQ6 A;  2WOS A;  1WY9 A;  1B1G A;  2L98 A;  1IQ5 A;  3I5H B;  1E8A A;  1MHO A;  4PAL A;  2K7B A;  1GJY A;  1XFX O;  1KSO A;  2G9B A;  2LCP A;  1F4O A;  2LMT A;  1SL9 A;  5ER4 X;  2KNE A;  2HQ8 A;  1SCV A;  1Y1X A;  4C0K A;  4ORA B;  1A75 A;  2GGM A;  5I2Q A;  1J55 A;  2BE6 A;  1QIW A;  3LK0 A;  4YBH B;  2KYF A;  1UHJ A;  4GNK B;  1OSA A;  1YRT B;  1BJF A;  2GV5 A;  1JF2 A;  1UHI A;  2F33 A;  2M97 A;  2PRU A;  5F6T A;  1ZUZ A;  3I5G C;  4P2Y B;  2FCE A;  2A4J A;  2MLE C;  2BBN A;  3CGA A;  3TDU A;  2O60 A;  1CTR A;  3SG5 A;  4MEW A;  5I8N A;  1V1G A;  2IS9 A;  1DGU A;  1M45 A;  2LHI A;  2P6B B;  2JXC A;  3ZWH A;  1YVL A;  3JTD B;  2LMV A;  1J7Q A;  1FBV A;  2M29 A;  1MXL C;  1WRL A;  2KOT A;  2NLN A;  1IH0 A;  2HF5 A;  1RTP 1;  4A4C A;  1PUL A;  2BKH B;  2CCM A;  3IQO A;  2LLU A;  1KQV A;  1PK0 D;  1QX2 A;  3FS7 A;  5KU1 A;  3PFV A;  1QLS A;  3BUX B;  2M1U A;  1K95 A;  2JUL A;  4PCW A;  1CB1 A;  3EVR A;  1L2O C;  1OMD A;  2K7C A;  1TRF A;  1NSH A;  1B8R A;  4AQI A;  1IJ6 A;  3AAK A;  3DF0 B;  2F3Z A;  1OZS A;  3JVT C;  3OB2 B;  4XJK A;  1REC A;  2MJW B;  2WOR A;  4PHN A;  3WNX B;  1AHR A;  3F45 A;  4JQ0 D;  1EG4 A;  2L4H A;  1YX8 A;  4D1E A;  1R6P A;  1TNX A;  1BU3 A;  4XYN A;  2LLS A;  2KFH A;  1YX7 A;  1XFY O;  1ZAC A;  2I2R E;  1JUO A;  1S3P A;  1YR5 A;  3DVK A;  2KBM A;  3NSK A;  5CSN A;  3BUO B;  1HQV A;  2TN4 A;  1LA3 A;  2KBI A;  5G08 A;  4M2O A;  1M31 A;  2HET A;  5ER5 A;  2ZFD A;  1A03 A;  1Y6W A;  2I18 A;  3EKJ A;  4N1G A;  1OMV A;  2EGD A;  3PN7 C;  2BCA A;  2H2K A;  1EH2 A;  1OOJ A;  2JTZ A;  2MAZ A;  2PAS A;  4GGF A;  3H4S E;  2PSR A;  3D10 A;  4F0Z B;  2M0R A;  2JOJ A;  3BQ3 A;  5CPV A;  1DJI A;  1NUB A;  4M2Q A;  4HRE E;  2KI4 C;  4HRH A;  1B8L A;  4ICB A;  3O78 A;  3BXK A;  1EL4 A;  1K2H A;  1L7Z A;  1XFW O;  3OHM B;  1D1O A;  1AVS A;  1CMG A;  1JSA A;  4P5O E;  1IGV A;  5K89 A;  2Y1N A;  3I5G B;  1JF0 A;  2AAO A;  4I5J A;  2F8P A;  2ZN8 A;  1KQM C;  2LV7 A;  1QX5 B;  1A2X A;  1NX3 A;  2MRD A;  5CSF A;  3CLN A;  1JWD A;  4GBA A;  1XFU O;  3NXA A;  2M3W A;  1EJ3 A;  4GPL B;  3TDZ A;  2WCF A;  1MWN A;  1CFP A;  1A75 B;  1UP5 A;  1KWO C;  1N0Y A;  1C7W A;  3D0Y A;  3SG7 A;  5CSI A;  4DRW A;  1RWY A;  1KK7 Y;  2Q91 A;  1DJZ A;  1B7T Z;  1LKJ A;  2BCB A;  4DUQ A;  1NCX A;  1CNP A;  1W7J B;  4OCI A;  1F54 A;  3EK7 A;  3C1V A;  5I2O A;  4I5N B;  3VRP A;  1FPW A;  5AXI A;  1ODB A;  3CR2 A;  1CDL A;  1G4Y R;  1DMO A;  1TCF A;  1L2O B;  3CZT X;  1BMO A;  4ORC B;  4OVN F;  1QX7 A;  2KDH A;  2JNX A;  1JFJ A;  5B8I B;  5DKQ A;  2JU0 A;  2CXJ A;  1ZFS A;  3JVT B;  1KFU S;  2JT8 A;  3VRO A;  2Q4U A;  4FQO A;  3EK8 A;  2FCD A;  3CR5 X;  2K7O A;  4GAO A;  1EXR A;  1BR4 B;  4PE0 A;  4YGC B;  2R2I A;  4N5X A;  4C0L A;  1F8H A;  2BKI B;  1LXF C;  2LVJ A;  1PSB A;  2LNK A;  3DVE A;  3KO0 A;  1B9A A;  4YRU A;  4CFQ A;  1S6J A;  1IKU A;  1QS7 A;  1F71 A;  2K0J A;  4PHJ A;  4TNC A;  1AK8 A;  1DF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...