1LKJA

Nmr structure of apo calmodulin from yeast saccharomyces cerevisiae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
146
structure length
146
Chain Sequence
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title The solution structure of apocalmodulin from Saccharomyces cerevisiae implies a mechanism for its unique Ca2+ binding property.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein
total genus 32
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2002-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1lkjA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1lkjA01
2QPTA 1CDPA 4YGDB 1ZMZA 2LANA 2OS8C 1SK6D 4MN0A 1CM1A 5TNCA 2M49B 1FW4A 2BECA 1JWDA 3JTDC 4U8DA 1G8IA 2NZ0A 1RECA 1KSMA 2MHHA 4M2PA 3PM8A 4PE0A 5HLOA 2LVJA 1G33A 2L98A 2O60A 1NX1A 1MXLC 5D69A 1LINA 4PE1A 4I5JA 1AVSA 3BYAA 1G4YR 1MHOA 2BCXA 1BR4B 1DT7B 5AFPA 1CMFA 1J55A 2WC8A 3EK7A 1B1GA 2MLEC 1TCFA 4CIDA 1F54A 2EC6B 1GQMA 2KOTA 3SG2A 2WCBA 1FI5A 2BCBA 1PULA 4HRGA 1IJ5A 2ISDA 1B8LA 1PSBA 1CKKA 2BBMA 2FCDA 4PHMA 2K7BA 1PVAA 4A4CA 2PSRA 1NIWA 1K95A 3BOWB 4JPZB 3TS5C 1CB1A 1DTLA 2EC6C 3PSRA 1FI6A 2K0JA 5KTYA 1F70A 3DVMA 3DVKA 2G9BA 5HKZA 1TNPA 5JJGA 4CLNA 1OMVA 1YTZC 1B8CA 4PE4A 2KYFA 2LC5A 4E68A 2JNXA 2LLSA 4FQOA 4N5XA 2BBNA 1BMOA 1KQMB 2L2EA 2ZRSA 1FF1A 3O4YA 1F4OA 1N65A 2I94A 3CR4X 3I5HB 3I5FC 1MF8B 1XVJA 1JC2A 1F8HA 1NUBA 1DJWA 4YBHB 1OZSA 3JVTC 4OCIA 4ORBB 1KCYA 2LHLA 1B4CA 3LK0A 3ZWHA 1IH0A 1JUOA 3WXAA 2O5GA 3GK4X 2JT8A 2M8UA 3VRRA 3BUNB 1BR1B 3I5HC 4MRXA 2LHIA 1CDLA 3VROA 1WDCB 2JULA 2H61C 2M3WA 2KBMA 3GK2A 2KGBC 2LV7A 1DGUA 1SRAA 3WNXB 1XK4C 4BY5A 1HT9A 2CBLA 1LXFC 3KF9A 4OVNF 1WRKA 5ER4X 1XFVO 1OMDA 2HQ8A 3SG3A 1F55A 1XFZO 2CCMA 1WDCC 2H2KA 2Y1MA 1Y1AA 2FOTA 2Y5IA 1CDNA 2CXJA 5CSFA 4YRUA 4ZCVA 1CNPA 3CWGA 1XFXO 2K7OA 5CSIA 5HKWA 5AEQA 1UP5A 3I5IB 5J3XA 1K96A 3KO0A 4BY4A 3SG6A 1ALWA 2HPSA 1UUSA 4MLWA 1QLKA 1CLLA 3DF0A 2KI4B 1XA5A 5AANA 2ZRTA 1JSAA 2NCPA 1N2DA 1KWOB 2L51A 4AQJA 1K9PA 1OOJA 4NDCA 1BJFA 1A75A 3F45A 1A03A 3I5IC 4GBAA 2LLUA 1GGWA 2HETA 1YVLA 2OTGC 2RGIA 1DJHA 1WRLA 2L5XB 1CFDA 3LK1A 1S6JA 1MWNA 2LLTA 1J1EA 2E30A 1K8UA 2WCEA 1CDMA 2LCPA 2LVKA 2OS8B 4NQGA 5CSNA 1KWOC 1S6CA 2Y1NA 2WORA 1AUIB 3D0YA 2E6WA 3CZTX 1ZUZA 1V1GA 2KFGA 5HLVA 1PK0D 4R1EA 1EXRA 3WHUB 2K7DA 1XK4A 2FJUB 2JOJA 3VRQA 1Y6WA 1OE9B 1PALA 1SNLA 1NX0A 1OMRA 1JFKA 1UHNA 4WQ2A 4GUKA 2L4IA 5KSZA 2JXLA 4YI8A 3FIAA 1ZACA 1CFPA 2BE6A 4FTGA 1CMGA 1SY9A 5PALA 5B8IB 2JPTA 1SL9A 4HRHA 2JTTA 3LLEA 1NCXA 3MSEB 1DMOA 1B7TZ 2LP3A 3BXKA 2GGMA 3D10A 3M0WA 1J7QA 3GK1A 5D7FA 5FYXA 3SIAA 1J1DA 1NSHA 1V1FA 2LVIA 1EG4A 1S5GZ 1WY9A 1A29A 1BLQA 2KSPA 3EKJA 3FWBA 1XFYO 1AJ5A 2KFHA 1IKUA 3BUWB 1QV1A 1NYAA 2FCEA 3TS5B 2OPOA 2F2PA 1YX7A 4Q04A 2ZN9A 4USLA 4MZJA 2KI6C 2MLFC 1LA3A 3EVRA 5CPVA 4C0LA 1E8AA 2F33A 1GJYA 1YVHA 1BG1A 1YURA 3EVUA 4HSZA 1IJ6A 5BPJA 4PCWA 1UWOA 3PFVA 1UHJA 3IQOA 4N1GA 3TDUA 1HQVA 1B47A 4NDBA 1S36A 1QVIY 2CTNA 2PMYA 2ZNEA 2SCPA 3DF0B 3LCPC 2I7AA 4OKHA 4OV2A 4DIRA 2LAPA 1QLSA 3I5FB 2BKHB 3QRXA 1Y1XA 4YI9A 2KDHA 5DKRA 4D1EA 1PVBA 2WOSA 1Q80A 4YGBB 1VRKA 4GGNA 3NSLA 1LA0A 1A75B 1OZOA 3JVTB 4PHJA 3A4UB 2F8PA 2K7CA 3I5GB 1ZOTB 2ZKMX 1KK7Z 1SR6B 1TNWA 3RM1A 4N1FA 2DOQA 2QACA 4ETOA 3DVEA 1CFCA 3D0YB 1BODA 3SIBA 1B8RA 3BUXB 2K8MB 2EHBA 1WLMA 1CTRA 1TCOB 1U5IA 1M45A 4ICBA 3I5GC 2F3ZA 5ER5A 3WHTB 1SR6C 1QXPA 3O6BA 4OR9B 2M9GA 4AOMA 4CPVA 1AP4A 4GFTA 3SG7A 1SCVA 2JTZA 1C07A 1KQVA 3BUMB 2JWWA 2JXCA 1K93D 3A8RA 2JQ6A 1UHHA 2SASA 3PATA 1AK8A 1NP8A 1M39A 2LM5A 3FWCA 1QX7A 1YRTB 2KYCA 1ODBA 1S6IA 4CFQA 5I8NA 2AMIA 2B1UA 1SMGA 5HYDA 2L50A 2A4JA 1A2XA 3DD4A 2M0RA 1H8BA 2JC2A 1JFJA 3C1VA 2M7NA 3E3RA 3OB1B 2P6BB 2WCFA 3NXAA 1SW8A 1CLBA 1UHIA 2OTGB 2R2IA 1CLMA 2LMVA 2I2RE 2V53A 1TIZA 3HX4A 4YGCB 4GNKB 1K90D 2LNKA 1EJ3A 1AJ4A 4MEWA 4ORAB 4GGFC 2M1UA 2JNFA 4QJ3B 1H4BA 2JU0A 4IL1A 1RFJA 1KK8B 4P5OE 3BUOB 1YRUB 1YUTA 1XFWO 4I5NB 1DJXA 1NX3A 3NSOA 1NWDA 1J7RA 1QATA 3KPXA 3ZNIA 5HKYA 1TNXA 1IG5A 3TUYC 1DJYA 1Y1UA 2LP2A 3VRPA 1ZFSA 1TTXA 1NCYA 3BQ3A 3CLNA 4I5KA 1KK8C 3TDZA 1L2OC 5IBWA 1YUSA 4ORCB 2BKIB 3SJSA 2LMUA 2KGRA 1YUUA 2PALA 2F3YA 3SG5A 4QJ5B 2K61A 3CS1A 1GGZA 1IRJA 2LUXA 1BF5A 4MZKA 2CT9A 1U5IB 2AUCA 1QX2A 2MJWB 1CM4A 1IQ5A 1CFFA 2ZFDA 2PVBA 1IGVA 1KFXS 1MQ1A 1FBVA 3OX6A 1QV0A 2BE4A 2BL0B 2K2FA 2LE9B 2D8NA 5AERA 1MUXA 5DKNA 5F6TA 4NDDA 2KI6D 1YR5A 2JT3A 1QX5B 2K2AA 2KHNA 3AAJA 3EVVA 4GGFA 4L9MA 5I2LA 3IQQA 2M97A 1M46A 1N0YA 2EGDA 3LL8B 1B7TY 5DKQA 2M1KB 4JWQA 2Q91A 3PLFB 2LMTA 1SBJA 4MVFA 2BL0C 1NX2A 1K9KA 4DUQA 1SCMB 1S5GY 3EK8A 1WRZA 5GQQC 1MXEA 1C7VA 3OHMB 4PE7A 5KU1A 2Q4UA 1F4QA 1DVIA 5I2OA 4AQIA 1EL4A 1KSOA 1QTXA 1BT6A 4WQ3A 1K9UA 1BU3A 1YX8A 1SCMC 3NSKA 2KQ6A 1XYDA 3VRNA 4YGEB 4XJKA 2MAZA 4I5LB 1QIWA 1QVIZ 3O2PA 4JQ0D 3KHEA 1RK9A 4TNCA 1UURA 1NCZA 1KFXL 1TNQA 1IQ3A 3CR5X 4P2YB 2JRFA 3CTNA 1F71A 3PN7B 1J7PA 1QJTA 2WNDA 2COLB 2MRDA 2KAYA 1W7IB 2BCAA 3OP0A 1DF0A 1OQPA 3K21A 3TZ1A 1K2HA 2KAVA 4MZLA 1PRWA 4M2QA 1R6PA 5AXIA 4PHKA 1RTP1 2ZN8A 1L7ZA 3VGOA 2G2BA 1KK7Y 1WLZA 2M29A 3PN7C 1M31A 5JOLA 3OB2B 3OX5A 2KNEA 4PHNA 1RROA 1S1EA 1TRFA 1J7OA 4HREE 3SG4A 1MR8A 1Y0VH 3EK4A 1DGVA 1KFUS 2MBXA 2L0PA 3CGAA 3GOFA 4PALA 4QJ4B 1NPQA 5I2QA 1QS7A 2CNPA 1R2UA 3PALA 1JF2A 1W7JB 4A4BA 1KQMC 1SL8A 1EG3A 1RJVA 3O78A 2JZIA 3AAKA 2KFFA 2IS9A 1PSRA 3ICBA 1BOCA 2GGZA 1SL7A 2NXQA 4PDZA 2GV5A 2KQYA 1S26D 1TOPA 2AAOA 2KAXA 3H4SE 3DVJA 2KBIA 5CSJA 1A4PA 4UPGA 1IWQA 4MRYA 3TUYB 2HQWA 2ZNDA 1SPYA 4GAOA 4DRWA 5G08A 2MA2A 4C0KA 3CR2A 1QIVA 1XFUO 1L2OB 1RWYA 2L4HA 1SYMA 4CFRA 3HCMA 4DCKA 4C0JA 2LVVA 1QASA 3FS7A 1JBAA 2PRUA 1B9AA 1DJZA 1C7WA 3TDIA 3AKAA 5K89A 1KFUL 4XJKB 3IF7A 3BOWA 1OSAA 2LUCA 4MSPA 1AHRA 1ALVA 1LVCD 2JT0A 1LKJA 4YGAA 1SKTA 2Y4QA 3KEVA 2VRGA 1S3PA 4DS7A 1DF0B 4F0ZB 1DJGA 1EH2A 1X02A 3AKBA 2NCOA 2F2OA 2KI4C 2I18A 1TN4A 2PASA 1D1OA 4ZCUA 3NSIA 1XO5A 3EKHA 2M7LA 1JF0A 4XYNA 2H61A 1K94A 4M2OA 1UHKA 3RLZA 1M63B 4GPLB 2NLNA 3JTDB 4MBEA 1DJIA 4WRIA 2HF5A 1FPWA 2TN4A
chains in the Genus database with same CATH superfamily
2QPTA 1CDPA 4YGDB 1ZMZA 2LANA 2OS8C 1SK6D 4MN0A 1CM1A 5TNCA 2M49B 1FW4A 2BECA 1JWDA 3JTDC 4U8DA 1G8IA 2NZ0A 1RECA 4FQTA 1KSMA 2MHHA 4M2PA 3PM8A 4PE0A 5HLOA 2LVJA 1G33A 3OGNA 2L98A 2BAPA 1NX1A 1MXLC 2O60A 1LINA 5D69A 3D77A 4I5JA 1AVSA 4PE1A 3BYAA 1G4YR 1MHOA 3R1PA 2BCXA 1BR4B 4PT1A 1DT7B 5AFPA 3B88A 3S0FA 1CMFA 1J55A 2WC8A 3EK7A 1B1GA 2MLEC 1TCFA 4CIDA 1F54A 2EC6B 1GQMA 2KOTA 2KLDA 2PYQA 3D74A 3SG2A 3O4XA 2WCBA 1FI5A 2BCBA 1PULA 4HRGA 1IJ5A 2ISDA 1B8LA 1PSBA 1CKKA 2BBMA 2FCDA 2QEHA 4PHMA 5FI7A 2K7BA 1PVAA 4A4CA 2PSRA 1NIWA 1K95A 3BOWB 3D76A 4JPZB 3TS5C 1CB1A 1DTLA 2EC6C 3PSRA 1FI6A 2K0JA 5KTYA 1F70A 3DVMA 2WCMA 3DVKA 2G9BA 5HKZA 1TNPA 5JJGA 4CLNA 1OMVA 1YTZC 1B8CA 4INXA 4PE4A 2KYFA 2LC5A 4E68A 1DQEA 2JNXA 2LLSA 4FQOA 4N5XA 2BBNA 1BMOA 1KQMB 2L2EA 2ZRSA 5EL2A 1FF1A 3O4YA 1F4OA 1N65A 2I94A 3CR4X 3I5HB 3I5FC 1MF8B 1XVJA 1JC2A 1F8HA 1NUBA 1DJWA 4YBHB 1OZSA 3JVTC 4OCIA 4ORBB 1KCYA 2LHLA 1B4CA 3LK0A 3ZWHA 1IH0A 1JUOA 3WXAA 2O5GA 3GK4X 2JT8A 2M8UA 3VRRA 3BUNB 1BR1B 3I5HC 4MRXA 2LHIA 1CDLA 3VROA 1WDCB 2JPOA 2JULA 2H61C 2M3WA 2KBMA 3GK2A 3BJHA 2KGBC 2LV7A 1DGUA 1SRAA 3WNXB 4OZDA 1XK4C 4BY5A 1HT9A 2CBLA 1LXFC 3KF9A 4OVNF 1WRKA 5DICA 1XFVO 1OMDA 2HQ8A 5ER4X 3SG3A 1F55A 1XFZO 2CCMA 1WDCC 2H2KA 2Y1MA 1Y1AA 2FOTA 2Y5IA 1CDNA 2CXJA 5CSFA 4YRUA 4ZCVA 1CNPA 2ERBA 3CWGA 1XFXO 2K7OA 3NGVA 3CABA 5CSIA 5HKWA 1UP5A 3I5IB 5J3XA 1TUZA 5AEQA 1K96A 2WCLA 3BFAA 3KO0A 1ALWA 3SG6A 4BY4A 2HPSA 1UUSA 4MLWA 1QLKA 1CLLA 3DF0A 3NHIA 2KI4B 3L4AA 1XA5A 5AANA 1Z4HA 2ZRTA 1JSAA 2NCPA 1N2DA 2WC5A 1KWOB 2L51A 4AQJA 1K9PA 1OOJA 1Z2CB 4NDCA 1BJFA 1A75A 3F45A 1A03A 3I5IC 4GBAA 2LLUA 1GGWA 2HETA 1YVLA 2OTGC 2RGIA 1DJHA 1WRLA 2L5XB 1CFDA 3LK1A 1S6JA 1MWNA 2LLTA 1J1EA 2E30A 1K8UA 2WCEA 1CDMA 2LCPA 1T14A 2LVKA 2OS8B 4NQGA 1KWOC 1S6CA 2Y1NA 2WORA 1AUIB 3D0YA 3Q8IA 2E6WA 5CSNA 3CZTX 1ZUZA 1V1GA 2KFGA 5HLVA 1PK0D 4R1EA 1EXRA 3WHUB 2K7DA 1XK4A 2FJUB 2JOJA 3VRQA 1Y6WA 1OE9B 1PALA 1SNLA 1NX0A 1OMRA 1JFKA 1UHNA 4WQ2A 4GUKA 2L4IA 5KSZA 2JXLA 3PJIA 4YI8A 3FIAA 1ZACA 1CFPA 2BE6A 4FTGA 1CMGA 3D75A 1SY9A 5PALA 5B8IB 2JPTA 1SL9A 4HRHA 2JTTA 3LLEA 1NCXA 3MSEB 1DMOA 1B7TZ 2LP3A 3BXKA 2GGMA 3D10A 3M0WA 1J7QA 3GK1A 5D7FA 3FE8A 5FYXA 3SIAA 1J1DA 1NSHA 1V1FA 2LVIA 1EG4A 1S5GZ 1WY9A 1A29A 1BLQA 2KSPA 3EKJA 3FWBA 1XFYO 1AJ5A 2KFHA 2WCJA 1IKUA 3BUWB 1QV1A 1NYAA 1QWVA 1ORGA 2FCEA 3TS5B 2OPOA 3DXLA 2F2PA 1YX7A 4Q04A 2ZN9A 4USLA 4MZJA 2KI6C 1SSEB 1LA3A 2MLFC 3EVRA 5CPVA 4C0LA 1E8AA 2F33A 1IIOA 1GJYA 1YVHA 1BG1A 1YURA 3EVUA 4HSZA 1IJ6A 5BPJA 3D73A 1UWOA 3PFVA 4PCWA 1UHJA 3IQOA 4N1GA 3TDUA 1HQVA 1B47A 4NDBA 1S36A 1QVIY 2CTNA 2PMYA 2ZNEA 2SCPA 3DF0B 3LCPC 2I7AA 2P71A 4OKHA 4DIRA 3RZSA 2LAPA 1QLSA 3I5FB 2BKHB 3QRXA 1Y1XA 4YI9A 2KDHA 5DKRA 2P70A 5I94A 4D1EA 1PVBA 2WOSA 1Q80A 4YGBB 3SS3A 1VRKA 4GGNA 3NSLA 1LA0A 1A75B 1OZOA 3JVTB 4PHJA 3A4UB 2F8PA 2K7CA 3I5GB 1ZOTB 2ZKMX 1KK7Z 1SR6B 3DZTA 1TNWA 3RM1A 4F7FA 4N1FA 2DOQA 2QACA 4ETOA 3DVEA 1CFCA 3D0YB 1BODA 3SIBA 1B8RA 3BUXB 2K8MB 2EHBA 1TUJA 1WLMA 1CTRA 1TCOB 1U5IA 1M45A 2L5YA 3I5GC 2F3ZA 4ICBA 5ER5A 3WHTB 1SR6C 1QXPA 3O6BA 4OR9B 2M9GA 4AOMA 4CPVA 1AP4A 4GFTA 3SG7A 1SCVA 1XFRA 2JTZA 1C07A 3B6XA 1KQVA 3BUMB 2JWWA 1C3YA 2JXCA 1K93D 3A8RA 2JQ6A 1UHHA 2SASA 3PATA 1AK8A 2H8VA 1NP8A 1M39A 3R1VA 2LM5A 3FWCA 1QX7A 1YRTB 2KYCA 1ODBA 1S6IA 4CFQA 1OOFA 5I8NA 3NHTA 2AMIA 2B1UA 1SMGA 1OOHA 3FE6A 5HYDA 2L50A 1LS8A 2A4JA 1A2XA 3DD4A 2M0RA 1H8BA 1DELA 3DY9A 2JC2A 3IVTA 1JFJA 3C1VA 2M7NA 3E3RA 3OB1B 2P6BB 2WCFA 3NXAA 3OBVA 1SW8A 1CLBA 1UHIA 5FI2A 2OTGB 2R2IA 1CLMA 2LMVA 2I2RE 2V53A 2QEVA 3S0BA 1DEKA 1TIZA 3HX4A 4YGCB 4GNKB 1K90D 2LNKA 1EJ3A 1AJ4A 1TWOA 4MEWA 4ORAB 4GGFC 2M1UA 2JNFA 4QJ3B 1H4BA 3V2LA 2JU0A 2QDIA 1RFJA 1KK8B 4IL1A 3BUOB 4P5OE 1YRUB 1YUTA 2BNXA 1XFWO 4I5NB 1DJXA 1NX3A 3NSOA 1NWDA 1J7RA 1QATA 3KPXA 3ZNIA 5HKYA 1TNXA 1IG5A 3TUYC 1DJYA 1Y1UA 2LP2A 3VRPA 1ZFSA 5HL1A 1TTXA 1NCYA 3BQ3A 3CLNA 3UNWA 4I5KA 1KK8C 3TDZA 1L2OC 5IBWA 1YUSA 4ORCB 2BKIB 2WCKA 3SJSA 2LMUA 2KGRA 1YUUA 2PALA 2QEOA 3L4LA 2F3YA 3SG5A 4QJ5B 1GM0A 2K61A 3CS1A 1GGZA 2GTEA 1IRJA 3EG5B 2LUXA 1BF5A 1OOIX 4MZKA 2CT9A 1U5IB 2AUCA 2KLEA 1QX2A 2MJWB 1CM4A 1IQ5A 1CFFA 1OW4A 2ZFDA 2PVBA 1IGVA 1KFXS 1MQ1A 3R1OA 4INWA 1FBVA 3OX6A 1QV0A 2BE4A 2BL0B 2K2FA 2LE9B 2D8NA 2WCHA 1MUXA 5AERA 5DKNA 5F6TA 4NDDA 2KI6D 3PM2A 1YR5A 2JT3A 1QX5B 2K2AA 2KHNA 3AAJA 3EVVA 4GGFA 4L9MA 5I2LA 3IQQA 2M97A 1M46A 1W9ZA 1N0YA 2EGDA 3LL8B 1B7TY 5DKQA 3S0DA 2M1KB 4JWQA 2Q91A 3PLFB 2LMTA 3N7HA 1SBJA 4MVFA 2BL0C 1NX2A 1K9KA 4DUQA 1SCMB 1S5GY 3EK8A 1WRZA 5GQQC 1MXEA 1C7VA 3CYZA 3OHMB 4PE7A 5KU1A 2Q4UA 1F4QA 1DVIA 3CZ0A 5I2OA 1P28A 4AQIA 1EL4A 1KSOA 1QTXA 1BT6A 4WQ3A 1K9UA 1BU3A 1YX8A 1SCMC 3NSKA 2KQ6A 1XYDA 4JKTA 4YGEB 4XJKA 3VRNA 3BFHA 2MAZA 4I5LB 1QIWA 1QVIZ 3BFBA 3O2PA 3B86A 3KHEA 4JQ0D 1RK9A 4TNCA 1UURA 1NCZA 1KFXL 1TNQA 3L47A 3UO9A 1IQ3A 3CR5X 4P2YB 2JRFA 3CTNA 3S0EA 1F71A 3PN7B 3B87A 1J7PA 1QJTA 2WNDA 2COLB 2MRDA 2KAYA 3K1EA 1W7IB 2FJYA 2K60A 2BCAA 2QEBA 3OP0A 1DF0A 3S0GA 1OQPA 3K21A 3TZ1A 1K2HA 2KAVA 4MZLA 1PRWA 4M2QA 1R6PA 5AXIA 3S0AA 4PHKA 1RTP1 2ZN8A 1L7ZA 3VGOA 2G2BA 1KK7Y 1WLZA 2M29A 3PN7C 1M31A 5JOLA 3OB2B 3OX5A 2KNEA 4PHNA 1RROA 1S1EA 1TRFA 1J7OA 4HREE 3SG4A 1OOGA 1MR8A 1Y0VH 3B7AA 3EK4A 2WC6A 1DGVA 1KFUS 2MBXA 2L0PA 3CGAA 3GOFA 4PALA 4QJ4B 1NPQA 5I2QA 1QS7A 2CNPA 1R2UA 3PALA 1JF2A 1W7JB 4A4BA 1KQMC 3VB1A 1SL8A 3CZ1A 1EG3A 1RJVA 2KPHA 3O78A 4OV2A 2JZIA 3R72A 3AAKA 2KFFA 2IS9A 1PSRA 3ICBA 1BOCA 2GGZA 1SL7A 2NXQA 4PDZA 2GV5A 3CDNA 2KQYA 1S26D 1TOPA 4JD9A 2AAOA 2KAXA 3H4SE 3DVJA 2KBIA 5CSJA 1A4PA 4UPGA 1IWQA 4MRYA 3CZ2A 3TUYB 2HQWA 2ZNDA 1SPYA 4GAOA 4DRWA 3DYEA 2MA2A 5FI6A 5G08A 4C0KA 3CR2A 1QIVA 1XFUO 1L2OB 1RWYA 2L4HA 1SYMA 4CFRA 3HCMA 4DCKA 4C0JA 2LVVA 1QASA 3FS7A 1JBAA 2PRUA 1B9AA 1DJZA 1C7WA 3FE9A 3TDIA 3AKAA 5K89A 1KFUL 4XJKB 3IF7A 3BOWA 1OSAA 2LUCA 3QMEA 5D3OA 1C3ZA 4MSPA 1AHRA 1ALVA 1LVCD 3SS4A 2JT0A 1LKJA 4YGAA 1SKTA 2YGUA 2Y4QA 3KEVA 1DC1A 2VRGA 1S3PA 4DS7A 4KYNA 1DF0B 4IJ7A 1DJGA 4F0ZB 1EH2A 1X02A 3AKBA 3D78A 2NCOA 2F2OA 2KI4C 2I18A 1TN4A 2PASA 1D1OA 4ZCUA 3NSIA 1XO5A 3EKHA 2M7LA 1JF0A 4XYNA 2H61A 1K94A 4M2OA 1UHKA 3RLZA 1M63B 4GPLB 2NLNA 3JTDB 4MBEA 1DJIA 4WRIA 2L2CA 2HF5A 3SS5A 2PQLA 1FPWA 2TN4A
chains in the Genus database with same CATH topology
2QPTA 1CDPA 4YGDB 1ZMZA 2LANA 2OS8C 1SK6D 4MN0A 1CM1A 5TNCA 2M49B 1FW4A 2BECA 1JWDA 3JTDC 4U8DA 1G8IA 2NZ0A 1RECA 1KSMA 2MHHA 4M2PA 3PM8A 4PE0A 5HLOA 2LVJA 1G33A 2L98A 2O60A 1NX1A 1MXLC 5D69A 1LINA 4PE1A 4I5JA 1AVSA 3BYAA 1G4YR 1MHOA 2BCXA 1BR4B 1DT7B 5AFPA 1CMFA 1J55A 2WC8A 3EK7A 1B1GA 2MLEC 1TCFA 4CIDA 1F54A 2EC6B 1GQMA 2KOTA 3SG2A 2WCBA 1FI5A 2BCBA 1PULA 4HRGA 1IJ5A 2ISDA 1B8LA 1PSBA 1CKKA 2BBMA 2FCDA 4PHMA 2K7BA 1PVAA 4A4CA 2PSRA 1NIWA 1K95A 3BOWB 4JPZB 3TS5C 1CB1A 1DTLA 2EC6C 3PSRA 1FI6A 2K0JA 5KTYA 1F70A 3DVMA 3DVKA 2G9BA 5HKZA 1TNPA 5JJGA 4CLNA 1OMVA 1YTZC 1B8CA 4PE4A 2KYFA 2LC5A 4E68A 2JNXA 2LLSA 4FQOA 4N5XA 2BBNA 1BMOA 1KQMB 2L2EA 2ZRSA 1FF1A 3O4YA 1F4OA 1N65A 2I94A 3CR4X 3I5HB 3I5FC 1MF8B 1XVJA 1JC2A 1F8HA 1NUBA 1DJWA 4YBHB 1OZSA 3JVTC 4OCIA 4ORBB 1KCYA 2LHLA 1B4CA 3LK0A 3ZWHA 1IH0A 1JUOA 3WXAA 2O5GA 3GK4X 2JT8A 2M8UA 3VRRA 3BUNB 1BR1B 3I5HC 4MRXA 2LHIA 1CDLA 3VROA 1WDCB 2JULA 2H61C 2M3WA 2KBMA 3GK2A 2KGBC 2LV7A 1DGUA 1SRAA 3WNXB 1XK4C 4BY5A 1HT9A 2CBLA 1LXFC 3KF9A 4OVNF 1WRKA 5ER4X 1XFVO 1OMDA 2HQ8A 3SG3A 1F55A 1XFZO 2CCMA 1WDCC 2H2KA 2Y1MA 1Y1AA 2FOTA 2Y5IA 1CDNA 2CXJA 5CSFA 4YRUA 4ZCVA 1CNPA 3CWGA 1XFXO 2K7OA 5CSIA 5HKWA 5AEQA 1UP5A 3I5IB 5J3XA 1K96A 3KO0A 4BY4A 3SG6A 1ALWA 2HPSA 1UUSA 4MLWA 1QLKA 1CLLA 3DF0A 2KI4B 1XA5A 5AANA 2ZRTA 1JSAA 2NCPA 1N2DA 1KWOB 2L51A 4AQJA 1K9PA 1OOJA 4NDCA 1BJFA 1A75A 3F45A 1A03A 3I5IC 4GBAA 2LLUA 1GGWA 2HETA 1YVLA 2OTGC 2RGIA 1DJHA 1WRLA 2L5XB 1CFDA 3LK1A 1S6JA 1MWNA 2LLTA 1J1EA 2E30A 1K8UA 2WCEA 1CDMA 2LCPA 2LVKA 2OS8B 4NQGA 5CSNA 1KWOC 1S6CA 2Y1NA 2WORA 1AUIB 3D0YA 2E6WA 3CZTX 1ZUZA 1V1GA 2KFGA 5HLVA 1PK0D 4R1EA 1EXRA 3WHUB 2K7DA 1XK4A 2FJUB 2JOJA 3VRQA 1Y6WA 1OE9B 1PALA 1SNLA 1NX0A 1OMRA 1JFKA 1UHNA 4WQ2A 4GUKA 2L4IA 5KSZA 2JXLA 4YI8A 3FIAA 1ZACA 1CFPA 2BE6A 4FTGA 1CMGA 1SY9A 5PALA 5B8IB 2JPTA 1SL9A 4HRHA 2JTTA 3LLEA 1NCXA 3MSEB 1DMOA 1B7TZ 2LP3A 3BXKA 2GGMA 3D10A 3M0WA 1J7QA 3GK1A 5D7FA 5FYXA 3SIAA 1J1DA 1NSHA 1V1FA 2LVIA 1EG4A 1S5GZ 1WY9A 1A29A 1BLQA 2KSPA 3EKJA 3FWBA 1XFYO 1AJ5A 2KFHA 1IKUA 3BUWB 1QV1A 1NYAA 2FCEA 3TS5B 2OPOA 2F2PA 1YX7A 4Q04A 2ZN9A 4USLA 4MZJA 2KI6C 2MLFC 1LA3A 3EVRA 5CPVA 4C0LA 1E8AA 2F33A 1GJYA 1YVHA 1BG1A 1YURA 3EVUA 4HSZA 1IJ6A 5BPJA 4PCWA 1UWOA 3PFVA 1UHJA 3IQOA 4N1GA 3TDUA 1HQVA 1B47A 4NDBA 1S36A 1QVIY 2CTNA 2PMYA 2ZNEA 2SCPA 3DF0B 3LCPC 2I7AA 4OKHA 4OV2A 4DIRA 2LAPA 1QLSA 3I5FB 2BKHB 3QRXA 1Y1XA 4YI9A 2KDHA 5DKRA 4D1EA 1PVBA 2WOSA 1Q80A 4YGBB 1VRKA 4GGNA 3NSLA 1LA0A 1A75B 1OZOA 3JVTB 4PHJA 3A4UB 2F8PA 2K7CA 3I5GB 1ZOTB 2ZKMX 1KK7Z 1SR6B 1TNWA 3RM1A 4N1FA 2DOQA 2QACA 4ETOA 3DVEA 1CFCA 3D0YB 1BODA 3SIBA 1B8RA 3BUXB 2K8MB 2EHBA 1WLMA 1CTRA 1TCOB 1U5IA 1M45A 4ICBA 3I5GC 2F3ZA 5ER5A 3WHTB 1SR6C 1QXPA 3O6BA 4OR9B 2M9GA 4AOMA 4CPVA 1AP4A 4GFTA 3SG7A 1SCVA 2JTZA 1C07A 1KQVA 3BUMB 2JWWA 2JXCA 1K93D 3A8RA 2JQ6A 1UHHA 2SASA 3PATA 1AK8A 1NP8A 1M39A 2LM5A 3FWCA 1QX7A 1YRTB 2KYCA 1ODBA 1S6IA 4CFQA 5I8NA 2AMIA 2B1UA 1SMGA 5HYDA 2L50A 2A4JA 1A2XA 3DD4A 2M0RA 1H8BA 2JC2A 1JFJA 3C1VA 2M7NA 3E3RA 3OB1B 2P6BB 2WCFA 3NXAA 1SW8A 1CLBA 1UHIA 2OTGB 2R2IA 1CLMA 2LMVA 2I2RE 2V53A 1TIZA 3HX4A 4YGCB 4GNKB 1K90D 2LNKA 1EJ3A 1AJ4A 4MEWA 4ORAB 4GGFC 2M1UA 2JNFA 4QJ3B 1H4BA 2JU0A 4IL1A 1RFJA 1KK8B 4P5OE 3BUOB 1YRUB 1YUTA 1XFWO 4I5NB 1DJXA 1NX3A 3NSOA 1NWDA 1J7RA 1QATA 3KPXA 3ZNIA 5HKYA 1TNXA 1IG5A 3TUYC 1DJYA 1Y1UA 2LP2A 3VRPA 1ZFSA 1TTXA 1NCYA 3BQ3A 3CLNA 4I5KA 1KK8C 3TDZA 1L2OC 5IBWA 1YUSA 4ORCB 2BKIB 3SJSA 2LMUA 2KGRA 1YUUA 2PALA 2F3YA 3SG5A 4QJ5B 2K61A 3CS1A 1GGZA 1IRJA 2LUXA 1BF5A 4MZKA 2CT9A 1U5IB 2AUCA 1QX2A 2MJWB 1CM4A 1IQ5A 1CFFA 2ZFDA 2PVBA 1IGVA 1KFXS 1MQ1A 1FBVA 3OX6A 1QV0A 2BE4A 2BL0B 2K2FA 2LE9B 2D8NA 5AERA 1MUXA 5DKNA 5F6TA 4NDDA 2KI6D 1YR5A 2JT3A 1QX5B 2K2AA 2KHNA 3AAJA 3EVVA 4GGFA 4L9MA 5I2LA 3IQQA 2M97A 1M46A 1N0YA 2EGDA 3LL8B 1B7TY 5DKQA 2M1KB 4JWQA 2Q91A 3PLFB 2LMTA 1SBJA 4MVFA 2BL0C 1NX2A 1K9KA 4DUQA 1SCMB 1S5GY 3EK8A 1WRZA 5GQQC 1MXEA 1C7VA 3OHMB 4PE7A 5KU1A 2Q4UA 1F4QA 1DVIA 5I2OA 4AQIA 1EL4A 1KSOA 1QTXA 1BT6A 4WQ3A 1K9UA 1BU3A 1YX8A 1SCMC 3NSKA 2KQ6A 1XYDA 3VRNA 4YGEB 4XJKA 2MAZA 4I5LB 1QIWA 1QVIZ 3O2PA 4JQ0D 3KHEA 1RK9A 4TNCA 1UURA 1NCZA 1KFXL 1TNQA 1IQ3A 3CR5X 4P2YB 2JRFA 3CTNA 1F71A 3PN7B 1J7PA 1QJTA 2WNDA 2COLB 2MRDA 2KAYA 1W7IB 2BCAA 3OP0A 1DF0A 1OQPA 3K21A 3TZ1A 1K2HA 2KAVA 4MZLA 1PRWA 4M2QA 1R6PA 5AXIA 4PHKA 1RTP1 2ZN8A 1L7ZA 3VGOA 2G2BA 1KK7Y 1WLZA 2M29A 3PN7C 1M31A 5JOLA 3OB2B 3OX5A 2KNEA 4PHNA 1RROA 1S1EA 1TRFA 1J7OA 4HREE 3SG4A 1MR8A 1Y0VH 3EK4A 1DGVA 1KFUS 2MBXA 2L0PA 3CGAA 3GOFA 4PALA 4QJ4B 1NPQA 5I2QA 1QS7A 2CNPA 1R2UA 3PALA 1JF2A 1W7JB 4A4BA 1KQMC 1SL8A 1EG3A 1RJVA 3O78A 2JZIA 3AAKA 2KFFA 2IS9A 1PSRA 3ICBA 1BOCA 2GGZA 1SL7A 2NXQA 4PDZA 2GV5A 2KQYA 1S26D 1TOPA 2AAOA 2KAXA 3H4SE 3DVJA 2KBIA 5CSJA 1A4PA 4UPGA 1IWQA 4MRYA 3TUYB 2HQWA 2ZNDA 1SPYA 4GAOA 4DRWA 5G08A 2MA2A 4C0KA 3CR2A 1QIVA 1XFUO 1L2OB 1RWYA 2L4HA 1SYMA 4CFRA 3HCMA 4DCKA 4C0JA 2LVVA 1QASA 3FS7A 1JBAA 2PRUA 1B9AA 1DJZA 1C7WA 3TDIA 3AKAA 5K89A 1KFUL 4XJKB 3IF7A 3BOWA 1OSAA 2LUCA 4MSPA 1AHRA 1ALVA 1LVCD 2JT0A 1LKJA 4YGAA 1SKTA 2Y4QA 3KEVA 2VRGA 1S3PA 4DS7A 1DF0B 4F0ZB 1DJGA 1EH2A 1X02A 3AKBA 2NCOA 2F2OA 2KI4C 2I18A 1TN4A 2PASA 1D1OA 4ZCUA 3NSIA 1XO5A 3EKHA 2M7LA 1JF0A 4XYNA 2H61A 1K94A 4M2OA 1UHKA 3RLZA 1M63B 4GPLB 2NLNA 3JTDB 4MBEA 1DJIA 4WRIA 2HF5A 1FPWA 2TN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPT A;  1CDP A;  4YGD B;  1ZMZ A;  2LAN A;  2OS8 C;  1SK6 D;  4MN0 A;  1CM1 A;  5TNC A;  2M49 B;  1FW4 A;  2BEC A;  1JWD A;  3JTD C;  4U8D A;  1G8I A;  2NZ0 A;  1REC A;  1KSM A;  2MHH A;  4M2P A;  3PM8 A;  4PE0 A;  5HLO A;  2LVJ A;  1G33 A;  2L98 A;  2O60 A;  1NX1 A;  1MXL C;  5D69 A;  1LIN A;  4PE1 A;  4I5J A;  1AVS A;  3BYA A;  1G4Y R;  1MHO A;  2BCX A;  1BR4 B;  1DT7 B;  5AFP A;  1CMF A;  1J55 A;  2WC8 A;  3EK7 A;  1B1G A;  2MLE C;  1TCF A;  4CID A;  1F54 A;  2EC6 B;  1GQM A;  2KOT A;  3SG2 A;  2WCB A;  1FI5 A;  2BCB A;  1PUL A;  4HRG A;  1IJ5 A;  2ISD A;  1B8L A;  1PSB A;  1CKK A;  2BBM A;  2FCD A;  4PHM A;  2K7B A;  1PVA A;  4A4C A;  2PSR A;  1NIW A;  1K95 A;  3BOW B;  4JPZ B;  3TS5 C;  1CB1 A;  1DTL A;  2EC6 C;  3PSR A;  1FI6 A;  2K0J A;  5KTY A;  1F70 A;  3DVM A;  3DVK A;  2G9B A;  5HKZ A;  1TNP A;  5JJG A;  4CLN A;  1OMV A;  1YTZ C;  1B8C A;  4PE4 A;  2KYF A;  2LC5 A;  4E68 A;  2JNX A;  2LLS A;  4FQO A;  4N5X A;  2BBN A;  1BMO A;  1KQM B;  2L2E A;  2ZRS A;  1FF1 A;  3O4Y A;  1F4O A;  1N65 A;  2I94 A;  3CR4 X;  3I5H B;  3I5F C;  1MF8 B;  1XVJ A;  1JC2 A;  1F8H A;  1NUB A;  1DJW A;  4YBH B;  1OZS A;  3JVT C;  4OCI A;  4ORB B;  1KCY A;  2LHL A;  1B4C A;  3LK0 A;  3ZWH A;  1IH0 A;  1JUO A;  3WXA A;  2O5G A;  3GK4 X;  2JT8 A;  2M8U A;  3VRR A;  3BUN B;  1BR1 B;  3I5H C;  4MRX A;  2LHI A;  1CDL A;  3VRO A;  1WDC B;  2JUL A;  2H61 C;  2M3W A;  2KBM A;  3GK2 A;  2KGB C;  2LV7 A;  1DGU A;  1SRA A;  3WNX B;  1XK4 C;  4BY5 A;  1HT9 A;  2CBL A;  1LXF C;  3KF9 A;  4OVN F;  1WRK A;  5ER4 X;  1XFV O;  1OMD A;  2HQ8 A;  3SG3 A;  1F55 A;  1XFZ O;  2CCM A;  1WDC C;  2H2K A;  2Y1M A;  1Y1A A;  2FOT A;  2Y5I A;  1CDN A;  2CXJ A;  5CSF A;  4YRU A;  4ZCV A;  1CNP A;  3CWG A;  1XFX O;  2K7O A;  5CSI A;  5HKW A;  5AEQ A;  1UP5 A;  3I5I B;  5J3X A;  1K96 A;  3KO0 A;  4BY4 A;  3SG6 A;  1ALW A;  2HPS A;  1UUS A;  4MLW A;  1QLK A;  1CLL A;  3DF0 A;  2KI4 B;  1XA5 A;  5AAN A;  2ZRT A;  1JSA A;  2NCP A;  1N2D A;  1KWO B;  2L51 A;  4AQJ A;  1K9P A;  1OOJ A;  4NDC A;  1BJF A;  1A75 A;  3F45 A;  1A03 A;  3I5I C;  4GBA A;  2LLU A;  1GGW A;  2HET A;  1YVL A;  2OTG C;  2RGI A;  1DJH A;  1WRL A;  2L5X B;  1CFD A;  3LK1 A;  1S6J A;  1MWN A;  2LLT A;  1J1E A;  2E30 A;  1K8U A;  2WCE A;  1CDM A;  2LCP A;  2LVK A;  2OS8 B;  4NQG A;  5CSN A;  1KWO C;  1S6C A;  2Y1N A;  2WOR A;  1AUI B;  3D0Y A;  2E6W A;  3CZT X;  1ZUZ A;  1V1G A;  2KFG A;  5HLV A;  1PK0 D;  4R1E A;  1EXR A;  3WHU B;  2K7D A;  1XK4 A;  2FJU B;  2JOJ A;  3VRQ A;  1Y6W A;  1OE9 B;  1PAL A;  1SNL A;  1NX0 A;  1OMR A;  1JFK A;  1UHN A;  4WQ2 A;  4GUK A;  2L4I A;  5KSZ A;  2JXL A;  4YI8 A;  3FIA A;  1ZAC A;  1CFP A;  2BE6 A;  4FTG A;  1CMG A;  1SY9 A;  5PAL A;  5B8I B;  2JPT A;  1SL9 A;  4HRH A;  2JTT A;  3LLE A;  1NCX A;  3MSE B;  1DMO A;  1B7T Z;  2LP3 A;  3BXK A;  2GGM A;  3D10 A;  3M0W A;  1J7Q A;  3GK1 A;  5D7F A;  5FYX A;  3SIA A;  1J1D A;  1NSH A;  1V1F A;  2LVI A;  1EG4 A;  1S5G Z;  1WY9 A;  1A29 A;  1BLQ A;  2KSP A;  3EKJ A;  3FWB A;  1XFY O;  1AJ5 A;  2KFH A;  1IKU A;  3BUW B;  1QV1 A;  1NYA A;  2FCE A;  3TS5 B;  2OPO A;  2F2P A;  1YX7 A;  4Q04 A;  2ZN9 A;  4USL A;  4MZJ A;  2KI6 C;  2MLF C;  1LA3 A;  3EVR A;  5CPV A;  4C0L A;  1E8A A;  2F33 A;  1GJY A;  1YVH A;  1BG1 A;  1YUR A;  3EVU A;  4HSZ A;  1IJ6 A;  5BPJ A;  4PCW A;  1UWO A;  3PFV A;  1UHJ A;  3IQO A;  4N1G A;  3TDU A;  1HQV A;  1B47 A;  4NDB A;  1S36 A;  1QVI Y;  2CTN A;  2PMY A;  2ZNE A;  2SCP A;  3DF0 B;  3LCP C;  2I7A A;  4OKH A;  4OV2 A;  4DIR A;  2LAP A;  1QLS A;  3I5F B;  2BKH B;  3QRX A;  1Y1X A;  4YI9 A;  2KDH A;  5DKR A;  4D1E A;  1PVB A;  2WOS A;  1Q80 A;  4YGB B;  1VRK A;  4GGN A;  3NSL A;  1LA0 A;  1A75 B;  1OZO A;  3JVT B;  4PHJ A;  3A4U B;  2F8P A;  2K7C A;  3I5G B;  1ZOT B;  2ZKM X;  1KK7 Z;  1SR6 B;  1TNW A;  3RM1 A;  4N1F A;  2DOQ A;  2QAC A;  4ETO A;  3DVE A;  1CFC A;  3D0Y B;  1BOD A;  3SIB A;  1B8R A;  3BUX B;  2K8M B;  2EHB A;  1WLM A;  1CTR A;  1TCO B;  1U5I A;  1M45 A;  4ICB A;  3I5G C;  2F3Z A;  5ER5 A;  3WHT B;  1SR6 C;  1QXP A;  3O6B A;  4OR9 B;  2M9G A;  4AOM A;  4CPV A;  1AP4 A;  4GFT A;  3SG7 A;  1SCV A;  2JTZ A;  1C07 A;  1KQV A;  3BUM B;  2JWW A;  2JXC A;  1K93 D;  3A8R A;  2JQ6 A;  1UHH A;  2SAS A;  3PAT A;  1AK8 A;  1NP8 A;  1M39 A;  2LM5 A;  3FWC A;  1QX7 A;  1YRT B;  2KYC A;  1ODB A;  1S6I A;  4CFQ A;  5I8N A;  2AMI A;  2B1U A;  1SMG A;  5HYD A;  2L50 A;  2A4J A;  1A2X A;  3DD4 A;  2M0R A;  1H8B A;  2JC2 A;  1JFJ A;  3C1V A;  2M7N A;  3E3R A;  3OB1 B;  2P6B B;  2WCF A;  3NXA A;  1SW8 A;  1CLB A;  1UHI A;  2OTG B;  2R2I A;  1CLM A;  2LMV A;  2I2R E;  2V53 A;  1TIZ A;  3HX4 A;  4YGC B;  4GNK B;  1K90 D;  2LNK A;  1EJ3 A;  1AJ4 A;  4MEW A;  4ORA B;  4GGF C;  2M1U A;  2JNF A;  4QJ3 B;  1H4B A;  2JU0 A;  4IL1 A;  1RFJ A;  1KK8 B;  4P5O E;  3BUO B;  1YRU B;  1YUT A;  1XFW O;  4I5N B;  1DJX A;  1NX3 A;  3NSO A;  1NWD A;  1J7R A;  1QAT A;  3KPX A;  3ZNI A;  5HKY A;  1TNX A;  1IG5 A;  3TUY C;  1DJY A;  1Y1U A;  2LP2 A;  3VRP A;  1ZFS A;  1TTX A;  1NCY A;  3BQ3 A;  3CLN A;  4I5K A;  1KK8 C;  3TDZ A;  1L2O C;  5IBW A;  1YUS A;  4ORC B;  2BKI B;  3SJS A;  2LMU A;  2KGR A;  1YUU A;  2PAL A;  2F3Y A;  3SG5 A;  4QJ5 B;  2K61 A;  3CS1 A;  1GGZ A;  1IRJ A;  2LUX A;  1BF5 A;  4MZK A;  2CT9 A;  1U5I B;  2AUC A;  1QX2 A;  2MJW B;  1CM4 A;  1IQ5 A;  1CFF A;  2ZFD A;  2PVB A;  1IGV A;  1KFX S;  1MQ1 A;  1FBV A;  3OX6 A;  1QV0 A;  2BE4 A;  2BL0 B;  2K2F A;  2LE9 B;  2D8N A;  5AER A;  1MUX A;  5DKN A;  5F6T A;  4NDD A;  2KI6 D;  1YR5 A;  2JT3 A;  1QX5 B;  2K2A A;  2KHN A;  3AAJ A;  3EVV A;  4GGF A;  4L9M A;  5I2L A;  3IQQ A;  2M97 A;  1M46 A;  1N0Y A;  2EGD A;  3LL8 B;  1B7T Y;  5DKQ A;  2M1K B;  4JWQ A;  2Q91 A;  3PLF B;  2LMT A;  1SBJ A;  4MVF A;  2BL0 C;  1NX2 A;  1K9K A;  4DUQ A;  1SCM B;  1S5G Y;  3EK8 A;  1WRZ A;  5GQQ C;  1MXE A;  1C7V A;  3OHM B;  4PE7 A;  5KU1 A;  2Q4U A;  1F4Q A;  1DVI A;  5I2O A;  4AQI A;  1EL4 A;  1KSO A;  1QTX A;  1BT6 A;  4WQ3 A;  1K9U A;  1BU3 A;  1YX8 A;  1SCM C;  3NSK A;  2KQ6 A;  1XYD A;  3VRN A;  4YGE B;  4XJK A;  2MAZ A;  4I5L B;  1QIW A;  1QVI Z;  3O2P A;  4JQ0 D;  3KHE A;  1RK9 A;  4TNC A;  1UUR A;  1NCZ A;  1KFX L;  1TNQ A;  1IQ3 A;  3CR5 X;  4P2Y B;  2JRF A;  3CTN A;  1F71 A;  3PN7 B;  1J7P A;  1QJT A;  2WND A;  2COL B;  2MRD A;  2KAY A;  1W7I B;  2BCA A;  3OP0 A;  1DF0 A;  1OQP A;  3K21 A;  3TZ1 A;  1K2H A;  2KAV A;  4MZL A;  1PRW A;  4M2Q A;  1R6P A;  5AXI A;  4PHK A;  1RTP 1;  2ZN8 A;  1L7Z A;  3VGO A;  2G2B A;  1KK7 Y;  1WLZ A;  2M29 A;  3PN7 C;  1M31 A;  5JOL A;  3OB2 B;  3OX5 A;  2KNE A;  4PHN A;  1RRO A;  1S1E A;  1TRF A;  1J7O A;  4HRE E;  3SG4 A;  1MR8 A;  1Y0V H;  3EK4 A;  1DGV A;  1KFU S;  2MBX A;  2L0P A;  3CGA A;  3GOF A;  4PAL A;  4QJ4 B;  1NPQ A;  5I2Q A;  1QS7 A;  2CNP A;  1R2U A;  3PAL A;  1JF2 A;  1W7J B;  4A4B A;  1KQM C;  1SL8 A;  1EG3 A;  1RJV A;  3O78 A;  2JZI A;  3AAK A;  2KFF A;  2IS9 A;  1PSR A;  3ICB A;  1BOC A;  2GGZ A;  1SL7 A;  2NXQ A;  4PDZ A;  2GV5 A;  2KQY A;  1S26 D;  1TOP A;  2AAO A;  2KAX A;  3H4S E;  3DVJ A;  2KBI A;  5CSJ A;  1A4P A;  4UPG A;  1IWQ A;  4MRY A;  3TUY B;  2HQW A;  2ZND A;  1SPY A;  4GAO A;  4DRW A;  5G08 A;  2MA2 A;  4C0K A;  3CR2 A;  1QIV A;  1XFU O;  1L2O B;  1RWY A;  2L4H A;  1SYM A;  4CFR A;  3HCM A;  4DCK A;  4C0J A;  2LVV A;  1QAS A;  3FS7 A;  1JBA A;  2PRU A;  1B9A A;  1DJZ A;  1C7W A;  3TDI A;  3AKA A;  5K89 A;  1KFU L;  4XJK B;  3IF7 A;  3BOW A;  1OSA A;  2LUC A;  4MSP A;  1AHR A;  1ALV A;  1LVC D;  2JT0 A;  1LKJ A;  4YGA A;  1SKT A;  2Y4Q A;  3KEV A;  2VRG A;  1S3P A;  4DS7 A;  1DF0 B;  4F0Z B;  1DJG A;  1EH2 A;  1X02 A;  3AKB A;  2NCO A;  2F2O A;  2KI4 C;  2I18 A;  1TN4 A;  2PAS A;  1D1O A;  4ZCU A;  3NSI A;  1XO5 A;  3EKH A;  2M7L A;  1JF0 A;  4XYN A;  2H61 A;  1K94 A;  4M2O A;  1UHK A;  3RLZ A;  1M63 B;  4GPL B;  2NLN A;  3JTD B;  4MBE A;  1DJI A;  4WRI A;  2HF5 A;  1FPW A;  2TN4 A; 
#chains in the Genus database with same CATH topology
 2QPT A;  1CDP A;  4YGD B;  1ZMZ A;  2LAN A;  2OS8 C;  1SK6 D;  4MN0 A;  1CM1 A;  5TNC A;  2M49 B;  1FW4 A;  2BEC A;  1JWD A;  3JTD C;  4U8D A;  1G8I A;  2NZ0 A;  1REC A;  4FQT A;  1KSM A;  2MHH A;  4M2P A;  3PM8 A;  4PE0 A;  5HLO A;  2LVJ A;  1G33 A;  3OGN A;  2L98 A;  2BAP A;  1NX1 A;  1MXL C;  2O60 A;  1LIN A;  5D69 A;  3D77 A;  4I5J A;  1AVS A;  4PE1 A;  3BYA A;  1G4Y R;  1MHO A;  3R1P A;  2BCX A;  1BR4 B;  4PT1 A;  1DT7 B;  5AFP A;  3B88 A;  3S0F A;  1CMF A;  1J55 A;  2WC8 A;  3EK7 A;  1B1G A;  2MLE C;  1TCF A;  4CID A;  1F54 A;  2EC6 B;  1GQM A;  2KOT A;  2KLD A;  2PYQ A;  3D74 A;  3SG2 A;  3O4X A;  2WCB A;  1FI5 A;  2BCB A;  1PUL A;  4HRG A;  1IJ5 A;  2ISD A;  1B8L A;  1PSB A;  1CKK A;  2BBM A;  2FCD A;  2QEH A;  4PHM A;  5FI7 A;  2K7B A;  1PVA A;  4A4C A;  2PSR A;  1NIW A;  1K95 A;  3BOW B;  3D76 A;  4JPZ B;  3TS5 C;  1CB1 A;  1DTL A;  2EC6 C;  3PSR A;  1FI6 A;  2K0J A;  5KTY A;  1F70 A;  3DVM A;  2WCM A;  3DVK A;  2G9B A;  5HKZ A;  1TNP A;  5JJG A;  4CLN A;  1OMV A;  1YTZ C;  1B8C A;  4INX A;  4PE4 A;  2KYF A;  2LC5 A;  4E68 A;  1DQE A;  2JNX A;  2LLS A;  4FQO A;  4N5X A;  2BBN A;  1BMO A;  1KQM B;  2L2E A;  2ZRS A;  5EL2 A;  1FF1 A;  3O4Y A;  1F4O A;  1N65 A;  2I94 A;  3CR4 X;  3I5H B;  3I5F C;  1MF8 B;  1XVJ A;  1JC2 A;  1F8H A;  1NUB A;  1DJW A;  4YBH B;  1OZS A;  3JVT C;  4OCI A;  4ORB B;  1KCY A;  2LHL A;  1B4C A;  3LK0 A;  3ZWH A;  1IH0 A;  1JUO A;  3WXA A;  2O5G A;  3GK4 X;  2JT8 A;  2M8U A;  3VRR A;  3BUN B;  1BR1 B;  3I5H C;  4MRX A;  2LHI A;  1CDL A;  3VRO A;  1WDC B;  2JPO A;  2JUL A;  2H61 C;  2M3W A;  2KBM A;  3GK2 A;  3BJH A;  2KGB C;  2LV7 A;  1DGU A;  1SRA A;  3WNX B;  4OZD A;  1XK4 C;  4BY5 A;  1HT9 A;  2CBL A;  1LXF C;  3KF9 A;  4OVN F;  1WRK A;  5DIC A;  1XFV O;  1OMD A;  2HQ8 A;  5ER4 X;  3SG3 A;  1F55 A;  1XFZ O;  2CCM A;  1WDC C;  2H2K A;  2Y1M A;  1Y1A A;  2FOT A;  2Y5I A;  1CDN A;  2CXJ A;  5CSF A;  4YRU A;  4ZCV A;  1CNP A;  2ERB A;  3CWG A;  1XFX O;  2K7O A;  3NGV A;  3CAB A;  5CSI A;  5HKW A;  1UP5 A;  3I5I B;  5J3X A;  1TUZ A;  5AEQ A;  1K96 A;  2WCL A;  3BFA A;  3KO0 A;  1ALW A;  3SG6 A;  4BY4 A;  2HPS A;  1UUS A;  4MLW A;  1QLK A;  1CLL A;  3DF0 A;  3NHI A;  2KI4 B;  3L4A A;  1XA5 A;  5AAN A;  1Z4H A;  2ZRT A;  1JSA A;  2NCP A;  1N2D A;  2WC5 A;  1KWO B;  2L51 A;  4AQJ A;  1K9P A;  1OOJ A;  1Z2C B;  4NDC A;  1BJF A;  1A75 A;  3F45 A;  1A03 A;  3I5I C;  4GBA A;  2LLU A;  1GGW A;  2HET A;  1YVL A;  2OTG C;  2RGI A;  1DJH A;  1WRL A;  2L5X B;  1CFD A;  3LK1 A;  1S6J A;  1MWN A;  2LLT A;  1J1E A;  2E30 A;  1K8U A;  2WCE A;  1CDM A;  2LCP A;  1T14 A;  2LVK A;  2OS8 B;  4NQG A;  1KWO C;  1S6C A;  2Y1N A;  2WOR A;  1AUI B;  3D0Y A;  3Q8I A;  2E6W A;  5CSN A;  3CZT X;  1ZUZ A;  1V1G A;  2KFG A;  5HLV A;  1PK0 D;  4R1E A;  1EXR A;  3WHU B;  2K7D A;  1XK4 A;  2FJU B;  2JOJ A;  3VRQ A;  1Y6W A;  1OE9 B;  1PAL A;  1SNL A;  1NX0 A;  1OMR A;  1JFK A;  1UHN A;  4WQ2 A;  4GUK A;  2L4I A;  5KSZ A;  2JXL A;  3PJI A;  4YI8 A;  3FIA A;  1ZAC A;  1CFP A;  2BE6 A;  4FTG A;  1CMG A;  3D75 A;  1SY9 A;  5PAL A;  5B8I B;  2JPT A;  1SL9 A;  4HRH A;  2JTT A;  3LLE A;  1NCX A;  3MSE B;  1DMO A;  1B7T Z;  2LP3 A;  3BXK A;  2GGM A;  3D10 A;  3M0W A;  1J7Q A;  3GK1 A;  5D7F A;  3FE8 A;  5FYX A;  3SIA A;  1J1D A;  1NSH A;  1V1F A;  2LVI A;  1EG4 A;  1S5G Z;  1WY9 A;  1A29 A;  1BLQ A;  2KSP A;  3EKJ A;  3FWB A;  1XFY O;  1AJ5 A;  2KFH A;  2WCJ A;  1IKU A;  3BUW B;  1QV1 A;  1NYA A;  1QWV A;  1ORG A;  2FCE A;  3TS5 B;  2OPO A;  3DXL A;  2F2P A;  1YX7 A;  4Q04 A;  2ZN9 A;  4USL A;  4MZJ A;  2KI6 C;  1SSE B;  1LA3 A;  2MLF C;  3EVR A;  5CPV A;  4C0L A;  1E8A A;  2F33 A;  1IIO A;  1GJY A;  1YVH A;  1BG1 A;  1YUR A;  3EVU A;  4HSZ A;  1IJ6 A;  5BPJ A;  3D73 A;  1UWO A;  3PFV A;  4PCW A;  1UHJ A;  3IQO A;  4N1G A;  3TDU A;  1HQV A;  1B47 A;  4NDB A;  1S36 A;  1QVI Y;  2CTN A;  2PMY A;  2ZNE A;  2SCP A;  3DF0 B;  3LCP C;  2I7A A;  2P71 A;  4OKH A;  4DIR A;  3RZS A;  2LAP A;  1QLS A;  3I5F B;  2BKH B;  3QRX A;  1Y1X A;  4YI9 A;  2KDH A;  5DKR A;  2P70 A;  5I94 A;  4D1E A;  1PVB A;  2WOS A;  1Q80 A;  4YGB B;  3SS3 A;  1VRK A;  4GGN A;  3NSL A;  1LA0 A;  1A75 B;  1OZO A;  3JVT B;  4PHJ A;  3A4U B;  2F8P A;  2K7C A;  3I5G B;  1ZOT B;  2ZKM X;  1KK7 Z;  1SR6 B;  3DZT A;  1TNW A;  3RM1 A;  4F7F A;  4N1F A;  2DOQ A;  2QAC A;  4ETO A;  3DVE A;  1CFC A;  3D0Y B;  1BOD A;  3SIB A;  1B8R A;  3BUX B;  2K8M B;  2EHB A;  1TUJ A;  1WLM A;  1CTR A;  1TCO B;  1U5I A;  1M45 A;  2L5Y A;  3I5G C;  2F3Z A;  4ICB A;  5ER5 A;  3WHT B;  1SR6 C;  1QXP A;  3O6B A;  4OR9 B;  2M9G A;  4AOM A;  4CPV A;  1AP4 A;  4GFT A;  3SG7 A;  1SCV A;  1XFR A;  2JTZ A;  1C07 A;  3B6X A;  1KQV A;  3BUM B;  2JWW A;  1C3Y A;  2JXC A;  1K93 D;  3A8R A;  2JQ6 A;  1UHH A;  2SAS A;  3PAT A;  1AK8 A;  2H8V A;  1NP8 A;  1M39 A;  3R1V A;  2LM5 A;  3FWC A;  1QX7 A;  1YRT B;  2KYC A;  1ODB A;  1S6I A;  4CFQ A;  1OOF A;  5I8N A;  3NHT A;  2AMI A;  2B1U A;  1SMG A;  1OOH A;  3FE6 A;  5HYD A;  2L50 A;  1LS8 A;  2A4J A;  1A2X A;  3DD4 A;  2M0R A;  1H8B A;  1DEL A;  3DY9 A;  2JC2 A;  3IVT A;  1JFJ A;  3C1V A;  2M7N A;  3E3R A;  3OB1 B;  2P6B B;  2WCF A;  3NXA A;  3OBV A;  1SW8 A;  1CLB A;  1UHI A;  5FI2 A;  2OTG B;  2R2I A;  1CLM A;  2LMV A;  2I2R E;  2V53 A;  2QEV A;  3S0B A;  1DEK A;  1TIZ A;  3HX4 A;  4YGC B;  4GNK B;  1K90 D;  2LNK A;  1EJ3 A;  1AJ4 A;  1TWO A;  4MEW A;  4ORA B;  4GGF C;  2M1U A;  2JNF A;  4QJ3 B;  1H4B A;  3V2L A;  2JU0 A;  2QDI A;  1RFJ A;  1KK8 B;  4IL1 A;  3BUO B;  4P5O E;  1YRU B;  1YUT A;  2BNX A;  1XFW O;  4I5N B;  1DJX A;  1NX3 A;  3NSO A;  1NWD A;  1J7R A;  1QAT A;  3KPX A;  3ZNI A;  5HKY A;  1TNX A;  1IG5 A;  3TUY C;  1DJY A;  1Y1U A;  2LP2 A;  3VRP A;  1ZFS A;  5HL1 A;  1TTX A;  1NCY A;  3BQ3 A;  3CLN A;  3UNW A;  4I5K A;  1KK8 C;  3TDZ A;  1L2O C;  5IBW A;  1YUS A;  4ORC B;  2BKI B;  2WCK A;  3SJS A;  2LMU A;  2KGR A;  1YUU A;  2PAL A;  2QEO A;  3L4L A;  2F3Y A;  3SG5 A;  4QJ5 B;  1GM0 A;  2K61 A;  3CS1 A;  1GGZ A;  2GTE A;  1IRJ A;  3EG5 B;  2LUX A;  1BF5 A;  1OOI X;  4MZK A;  2CT9 A;  1U5I B;  2AUC A;  2KLE A;  1QX2 A;  2MJW B;  1CM4 A;  1IQ5 A;  1CFF A;  1OW4 A;  2ZFD A;  2PVB A;  1IGV A;  1KFX S;  1MQ1 A;  3R1O A;  4INW A;  1FBV A;  3OX6 A;  1QV0 A;  2BE4 A;  2BL0 B;  2K2F A;  2LE9 B;  2D8N A;  2WCH A;  1MUX A;  5AER A;  5DKN A;  5F6T A;  4NDD A;  2KI6 D;  3PM2 A;  1YR5 A;  2JT3 A;  1QX5 B;  2K2A A;  2KHN A;  3AAJ A;  3EVV A;  4GGF A;  4L9M A;  5I2L A;  3IQQ A;  2M97 A;  1M46 A;  1W9Z A;  1N0Y A;  2EGD A;  3LL8 B;  1B7T Y;  5DKQ A;  3S0D A;  2M1K B;  4JWQ A;  2Q91 A;  3PLF B;  2LMT A;  3N7H A;  1SBJ A;  4MVF A;  2BL0 C;  1NX2 A;  1K9K A;  4DUQ A;  1SCM B;  1S5G Y;  3EK8 A;  1WRZ A;  5GQQ C;  1MXE A;  1C7V A;  3CYZ A;  3OHM B;  4PE7 A;  5KU1 A;  2Q4U A;  1F4Q A;  1DVI A;  3CZ0 A;  5I2O A;  1P28 A;  4AQI A;  1EL4 A;  1KSO A;  1QTX A;  1BT6 A;  4WQ3 A;  1K9U A;  1BU3 A;  1YX8 A;  1SCM C;  3NSK A;  2KQ6 A;  1XYD A;  4JKT A;  4YGE B;  4XJK A;  3VRN A;  3BFH A;  2MAZ A;  4I5L B;  1QIW A;  1QVI Z;  3BFB A;  3O2P A;  3B86 A;  3KHE A;  4JQ0 D;  1RK9 A;  4TNC A;  1UUR A;  1NCZ A;  1KFX L;  1TNQ A;  3L47 A;  3UO9 A;  1IQ3 A;  3CR5 X;  4P2Y B;  2JRF A;  3CTN A;  3S0E A;  1F71 A;  3PN7 B;  3B87 A;  1J7P A;  1QJT A;  2WND A;  2COL B;  2MRD A;  2KAY A;  3K1E A;  1W7I B;  2FJY A;  2K60 A;  2BCA A;  2QEB A;  3OP0 A;  1DF0 A;  3S0G A;  1OQP A;  3K21 A;  3TZ1 A;  1K2H A;  2KAV A;  4MZL A;  1PRW A;  4M2Q A;  1R6P A;  5AXI A;  3S0A A;  4PHK A;  1RTP 1;  2ZN8 A;  1L7Z A;  3VGO A;  2G2B A;  1KK7 Y;  1WLZ A;  2M29 A;  3PN7 C;  1M31 A;  5JOL A;  3OB2 B;  3OX5 A;  2KNE A;  4PHN A;  1RRO A;  1S1E A;  1TRF A;  1J7O A;  4HRE E;  3SG4 A;  1OOG A;  1MR8 A;  1Y0V H;  3B7A A;  3EK4 A;  2WC6 A;  1DGV A;  1KFU S;  2MBX A;  2L0P A;  3CGA A;  3GOF A;  4PAL A;  4QJ4 B;  1NPQ A;  5I2Q A;  1QS7 A;  2CNP A;  1R2U A;  3PAL A;  1JF2 A;  1W7J B;  4A4B A;  1KQM C;  3VB1 A;  1SL8 A;  3CZ1 A;  1EG3 A;  1RJV A;  2KPH A;  3O78 A;  4OV2 A;  2JZI A;  3R72 A;  3AAK A;  2KFF A;  2IS9 A;  1PSR A;  3ICB A;  1BOC A;  2GGZ A;  1SL7 A;  2NXQ A;  4PDZ A;  2GV5 A;  3CDN A;  2KQY A;  1S26 D;  1TOP A;  4JD9 A;  2AAO A;  2KAX A;  3H4S E;  3DVJ A;  2KBI A;  5CSJ A;  1A4P A;  4UPG A;  1IWQ A;  4MRY A;  3CZ2 A;  3TUY B;  2HQW A;  2ZND A;  1SPY A;  4GAO A;  4DRW A;  3DYE A;  2MA2 A;  5FI6 A;  5G08 A;  4C0K A;  3CR2 A;  1QIV A;  1XFU O;  1L2O B;  1RWY A;  2L4H A;  1SYM A;  4CFR A;  3HCM A;  4DCK A;  4C0J A;  2LVV A;  1QAS A;  3FS7 A;  1JBA A;  2PRU A;  1B9A A;  1DJZ A;  1C7W A;  3FE9 A;  3TDI A;  3AKA A;  5K89 A;  1KFU L;  4XJK B;  3IF7 A;  3BOW A;  1OSA A;  2LUC A;  3QME A;  5D3O A;  1C3Z A;  4MSP A;  1AHR A;  1ALV A;  1LVC D;  3SS4 A;  2JT0 A;  1LKJ A;  4YGA A;  1SKT A;  2YGU A;  2Y4Q A;  3KEV A;  1DC1 A;  2VRG A;  1S3P A;  4DS7 A;  4KYN A;  1DF0 B;  4IJ7 A;  1DJG A;  4F0Z B;  1EH2 A;  1X02 A;  3AKB A;  3D78 A;  2NCO A;  2F2O A;  2KI4 C;  2I18 A;  1TN4 A;  2PAS A;  1D1O A;  4ZCU A;  3NSI A;  1XO5 A;  3EKH A;  2M7L A;  1JF0 A;  4XYN A;  2H61 A;  1K94 A;  4M2O A;  1UHK A;  3RLZ A;  1M63 B;  4GPL B;  2NLN A;  3JTD B;  4MBE A;  1DJI A;  4WRI A;  2L2C A;  2HF5 A;  3SS5 A;  2PQL A;  1FPW A;  2TN4 A; 
#chains in the Genus database with same CATH homology
 2QPT A;  1CDP A;  4YGD B;  1ZMZ A;  2LAN A;  2OS8 C;  1SK6 D;  4MN0 A;  1CM1 A;  5TNC A;  2M49 B;  1FW4 A;  2BEC A;  1JWD A;  3JTD C;  4U8D A;  1G8I A;  2NZ0 A;  1REC A;  1KSM A;  2MHH A;  4M2P A;  3PM8 A;  4PE0 A;  5HLO A;  2LVJ A;  1G33 A;  2L98 A;  2O60 A;  1NX1 A;  1MXL C;  5D69 A;  1LIN A;  4PE1 A;  4I5J A;  1AVS A;  3BYA A;  1G4Y R;  1MHO A;  2BCX A;  1BR4 B;  1DT7 B;  5AFP A;  1CMF A;  1J55 A;  2WC8 A;  3EK7 A;  1B1G A;  2MLE C;  1TCF A;  4CID A;  1F54 A;  2EC6 B;  1GQM A;  2KOT A;  3SG2 A;  2WCB A;  1FI5 A;  2BCB A;  1PUL A;  4HRG A;  1IJ5 A;  2ISD A;  1B8L A;  1PSB A;  1CKK A;  2BBM A;  2FCD A;  4PHM A;  2K7B A;  1PVA A;  4A4C A;  2PSR A;  1NIW A;  1K95 A;  3BOW B;  4JPZ B;  3TS5 C;  1CB1 A;  1DTL A;  2EC6 C;  3PSR A;  1FI6 A;  2K0J A;  5KTY A;  1F70 A;  3DVM A;  3DVK A;  2G9B A;  5HKZ A;  1TNP A;  5JJG A;  4CLN A;  1OMV A;  1YTZ C;  1B8C A;  4PE4 A;  2KYF A;  2LC5 A;  4E68 A;  2JNX A;  2LLS A;  4FQO A;  4N5X A;  2BBN A;  1BMO A;  1KQM B;  2L2E A;  2ZRS A;  1FF1 A;  3O4Y A;  1F4O A;  1N65 A;  2I94 A;  3CR4 X;  3I5H B;  3I5F C;  1MF8 B;  1XVJ A;  1JC2 A;  1F8H A;  1NUB A;  1DJW A;  4YBH B;  1OZS A;  3JVT C;  4OCI A;  4ORB B;  1KCY A;  2LHL A;  1B4C A;  3LK0 A;  3ZWH A;  1IH0 A;  1JUO A;  3WXA A;  2O5G A;  3GK4 X;  2JT8 A;  2M8U A;  3VRR A;  3BUN B;  1BR1 B;  3I5H C;  4MRX A;  2LHI A;  1CDL A;  3VRO A;  1WDC B;  2JUL A;  2H61 C;  2M3W A;  2KBM A;  3GK2 A;  2KGB C;  2LV7 A;  1DGU A;  1SRA A;  3WNX B;  1XK4 C;  4BY5 A;  1HT9 A;  2CBL A;  1LXF C;  3KF9 A;  4OVN F;  1WRK A;  5ER4 X;  1XFV O;  1OMD A;  2HQ8 A;  3SG3 A;  1F55 A;  1XFZ O;  2CCM A;  1WDC C;  2H2K A;  2Y1M A;  1Y1A A;  2FOT A;  2Y5I A;  1CDN A;  2CXJ A;  5CSF A;  4YRU A;  4ZCV A;  1CNP A;  3CWG A;  1XFX O;  2K7O A;  5CSI A;  5HKW A;  5AEQ A;  1UP5 A;  3I5I B;  5J3X A;  1K96 A;  3KO0 A;  4BY4 A;  3SG6 A;  1ALW A;  2HPS A;  1UUS A;  4MLW A;  1QLK A;  1CLL A;  3DF0 A;  2KI4 B;  1XA5 A;  5AAN A;  2ZRT A;  1JSA A;  2NCP A;  1N2D A;  1KWO B;  2L51 A;  4AQJ A;  1K9P A;  1OOJ A;  4NDC A;  1BJF A;  1A75 A;  3F45 A;  1A03 A;  3I5I C;  4GBA A;  2LLU A;  1GGW A;  2HET A;  1YVL A;  2OTG C;  2RGI A;  1DJH A;  1WRL A;  2L5X B;  1CFD A;  3LK1 A;  1S6J A;  1MWN A;  2LLT A;  1J1E A;  2E30 A;  1K8U A;  2WCE A;  1CDM A;  2LCP A;  2LVK A;  2OS8 B;  4NQG A;  5CSN A;  1KWO C;  1S6C A;  2Y1N A;  2WOR A;  1AUI B;  3D0Y A;  2E6W A;  3CZT X;  1ZUZ A;  1V1G A;  2KFG A;  5HLV A;  1PK0 D;  4R1E A;  1EXR A;  3WHU B;  2K7D A;  1XK4 A;  2FJU B;  2JOJ A;  3VRQ A;  1Y6W A;  1OE9 B;  1PAL A;  1SNL A;  1NX0 A;  1OMR A;  1JFK A;  1UHN A;  4WQ2 A;  4GUK A;  2L4I A;  5KSZ A;  2JXL A;  4YI8 A;  3FIA A;  1ZAC A;  1CFP A;  2BE6 A;  4FTG A;  1CMG A;  1SY9 A;  5PAL A;  5B8I B;  2JPT A;  1SL9 A;  4HRH A;  2JTT A;  3LLE A;  1NCX A;  3MSE B;  1DMO A;  1B7T Z;  2LP3 A;  3BXK A;  2GGM A;  3D10 A;  3M0W A;  1J7Q A;  3GK1 A;  5D7F A;  5FYX A;  3SIA A;  1J1D A;  1NSH A;  1V1F A;  2LVI A;  1EG4 A;  1S5G Z;  1WY9 A;  1A29 A;  1BLQ A;  2KSP A;  3EKJ A;  3FWB A;  1XFY O;  1AJ5 A;  2KFH A;  1IKU A;  3BUW B;  1QV1 A;  1NYA A;  2FCE A;  3TS5 B;  2OPO A;  2F2P A;  1YX7 A;  4Q04 A;  2ZN9 A;  4USL A;  4MZJ A;  2KI6 C;  2MLF C;  1LA3 A;  3EVR A;  5CPV A;  4C0L A;  1E8A A;  2F33 A;  1GJY A;  1YVH A;  1BG1 A;  1YUR A;  3EVU A;  4HSZ A;  1IJ6 A;  5BPJ A;  4PCW A;  1UWO A;  3PFV A;  1UHJ A;  3IQO A;  4N1G A;  3TDU A;  1HQV A;  1B47 A;  4NDB A;  1S36 A;  1QVI Y;  2CTN A;  2PMY A;  2ZNE A;  2SCP A;  3DF0 B;  3LCP C;  2I7A A;  4OKH A;  4OV2 A;  4DIR A;  2LAP A;  1QLS A;  3I5F B;  2BKH B;  3QRX A;  1Y1X A;  4YI9 A;  2KDH A;  5DKR A;  4D1E A;  1PVB A;  2WOS A;  1Q80 A;  4YGB B;  1VRK A;  4GGN A;  3NSL A;  1LA0 A;  1A75 B;  1OZO A;  3JVT B;  4PHJ A;  3A4U B;  2F8P A;  2K7C A;  3I5G B;  1ZOT B;  2ZKM X;  1KK7 Z;  1SR6 B;  1TNW A;  3RM1 A;  4N1F A;  2DOQ A;  2QAC A;  4ETO A;  3DVE A;  1CFC A;  3D0Y B;  1BOD A;  3SIB A;  1B8R A;  3BUX B;  2K8M B;  2EHB A;  1WLM A;  1CTR A;  1TCO B;  1U5I A;  1M45 A;  4ICB A;  3I5G C;  2F3Z A;  5ER5 A;  3WHT B;  1SR6 C;  1QXP A;  3O6B A;  4OR9 B;  2M9G A;  4AOM A;  4CPV A;  1AP4 A;  4GFT A;  3SG7 A;  1SCV A;  2JTZ A;  1C07 A;  1KQV A;  3BUM B;  2JWW A;  2JXC A;  1K93 D;  3A8R A;  2JQ6 A;  1UHH A;  2SAS A;  3PAT A;  1AK8 A;  1NP8 A;  1M39 A;  2LM5 A;  3FWC A;  1QX7 A;  1YRT B;  2KYC A;  1ODB A;  1S6I A;  4CFQ A;  5I8N A;  2AMI A;  2B1U A;  1SMG A;  5HYD A;  2L50 A;  2A4J A;  1A2X A;  3DD4 A;  2M0R A;  1H8B A;  2JC2 A;  1JFJ A;  3C1V A;  2M7N A;  3E3R A;  3OB1 B;  2P6B B;  2WCF A;  3NXA A;  1SW8 A;  1CLB A;  1UHI A;  2OTG B;  2R2I A;  1CLM A;  2LMV A;  2I2R E;  2V53 A;  1TIZ A;  3HX4 A;  4YGC B;  4GNK B;  1K90 D;  2LNK A;  1EJ3 A;  1AJ4 A;  4MEW A;  4ORA B;  4GGF C;  2M1U A;  2JNF A;  4QJ3 B;  1H4B A;  2JU0 A;  4IL1 A;  1RFJ A;  1KK8 B;  4P5O E;  3BUO B;  1YRU B;  1YUT A;  1XFW O;  4I5N B;  1DJX A;  1NX3 A;  3NSO A;  1NWD A;  1J7R A;  1QAT A;  3KPX A;  3ZNI A;  5HKY A;  1TNX A;  1IG5 A;  3TUY C;  1DJY A;  1Y1U A;  2LP2 A;  3VRP A;  1ZFS A;  1TTX A;  1NCY A;  3BQ3 A;  3CLN A;  4I5K A;  1KK8 C;  3TDZ A;  1L2O C;  5IBW A;  1YUS A;  4ORC B;  2BKI B;  3SJS A;  2LMU A;  2KGR A;  1YUU A;  2PAL A;  2F3Y A;  3SG5 A;  4QJ5 B;  2K61 A;  3CS1 A;  1GGZ A;  1IRJ A;  2LUX A;  1BF5 A;  4MZK A;  2CT9 A;  1U5I B;  2AUC A;  1QX2 A;  2MJW B;  1CM4 A;  1IQ5 A;  1CFF A;  2ZFD A;  2PVB A;  1IGV A;  1KFX S;  1MQ1 A;  1FBV A;  3OX6 A;  1QV0 A;  2BE4 A;  2BL0 B;  2K2F A;  2LE9 B;  2D8N A;  5AER A;  1MUX A;  5DKN A;  5F6T A;  4NDD A;  2KI6 D;  1YR5 A;  2JT3 A;  1QX5 B;  2K2A A;  2KHN A;  3AAJ A;  3EVV A;  4GGF A;  4L9M A;  5I2L A;  3IQQ A;  2M97 A;  1M46 A;  1N0Y A;  2EGD A;  3LL8 B;  1B7T Y;  5DKQ A;  2M1K B;  4JWQ A;  2Q91 A;  3PLF B;  2LMT A;  1SBJ A;  4MVF A;  2BL0 C;  1NX2 A;  1K9K A;  4DUQ A;  1SCM B;  1S5G Y;  3EK8 A;  1WRZ A;  5GQQ C;  1MXE A;  1C7V A;  3OHM B;  4PE7 A;  5KU1 A;  2Q4U A;  1F4Q A;  1DVI A;  5I2O A;  4AQI A;  1EL4 A;  1KSO A;  1QTX A;  1BT6 A;  4WQ3 A;  1K9U A;  1BU3 A;  1YX8 A;  1SCM C;  3NSK A;  2KQ6 A;  1XYD A;  3VRN A;  4YGE B;  4XJK A;  2MAZ A;  4I5L B;  1QIW A;  1QVI Z;  3O2P A;  4JQ0 D;  3KHE A;  1RK9 A;  4TNC A;  1UUR A;  1NCZ A;  1KFX L;  1TNQ A;  1IQ3 A;  3CR5 X;  4P2Y B;  2JRF A;  3CTN A;  1F71 A;  3PN7 B;  1J7P A;  1QJT A;  2WND A;  2COL B;  2MRD A;  2KAY A;  1W7I B;  2BCA A;  3OP0 A;  1DF0 A;  1OQP A;  3K21 A;  3TZ1 A;  1K2H A;  2KAV A;  4MZL A;  1PRW A;  4M2Q A;  1R6P A;  5AXI A;  4PHK A;  1RTP 1;  2ZN8 A;  1L7Z A;  3VGO A;  2G2B A;  1KK7 Y;  1WLZ A;  2M29 A;  3PN7 C;  1M31 A;  5JOL A;  3OB2 B;  3OX5 A;  2KNE A;  4PHN A;  1RRO A;  1S1E A;  1TRF A;  1J7O A;  4HRE E;  3SG4 A;  1MR8 A;  1Y0V H;  3EK4 A;  1DGV A;  1KFU S;  2MBX A;  2L0P A;  3CGA A;  3GOF A;  4PAL A;  4QJ4 B;  1NPQ A;  5I2Q A;  1QS7 A;  2CNP A;  1R2U A;  3PAL A;  1JF2 A;  1W7J B;  4A4B A;  1KQM C;  1SL8 A;  1EG3 A;  1RJV A;  3O78 A;  2JZI A;  3AAK A;  2KFF A;  2IS9 A;  1PSR A;  3ICB A;  1BOC A;  2GGZ A;  1SL7 A;  2NXQ A;  4PDZ A;  2GV5 A;  2KQY A;  1S26 D;  1TOP A;  2AAO A;  2KAX A;  3H4S E;  3DVJ A;  2KBI A;  5CSJ A;  1A4P A;  4UPG A;  1IWQ A;  4MRY A;  3TUY B;  2HQW A;  2ZND A;  1SPY A;  4GAO A;  4DRW A;  5G08 A;  2MA2 A;  4C0K A;  3CR2 A;  1QIV A;  1XFU O;  1L2O B;  1RWY A;  2L4H A;  1SYM A;  4CFR A;  3HCM A;  4DCK A;  4C0J A;  2LVV A;  1QAS A;  3FS7 A;  1JBA A;  2PRU A;  1B9A A;  1DJZ A;  1C7W A;  3TDI A;  3AKA A;  5K89 A;  1KFU L;  4XJK B;  3IF7 A;  3BOW A;  1OSA A;  2LUC A;  4MSP A;  1AHR A;  1ALV A;  1LVC D;  2JT0 A;  1LKJ A;  4YGA A;  1SKT A;  2Y4Q A;  3KEV A;  2VRG A;  1S3P A;  4DS7 A;  1DF0 B;  4F0Z B;  1DJG A;  1EH2 A;  1X02 A;  3AKB A;  2NCO A;  2F2O A;  2KI4 C;  2I18 A;  1TN4 A;  2PAS A;  1D1O A;  4ZCU A;  3NSI A;  1XO5 A;  3EKH A;  2M7L A;  1JF0 A;  4XYN A;  2H61 A;  1K94 A;  4M2O A;  1UHK A;  3RLZ A;  1M63 B;  4GPL B;  2NLN A;  3JTD B;  4MBE A;  1DJI A;  4WRI A;  2HF5 A;  1FPW A;  2TN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...