5JJGA

Structure of magnesium-loaded alg-2
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
168
structure length
168
Chain Sequence
DQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Pcalcium-binding protein ALG-2, rogrammed cell death protein
publication title EF5 Is the High-Affinity Mg(2+) Site in ALG-2.
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2016-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5jjgA00
4ORBB 1YUUA 5HKWA 3DVMA 1DF0B 1B4CA 1QATA 1ZUZA 3OP0A 2GGZA 5JOLA 2FCDA 1SKTA 1WRZA 2JU0A 2KFHA 2AMIA 1TNXA 4GPLB 2E6WA 2JRFA 2ZRSA 1UHKA 1GQMA 1QTXA 4JWQA 3NSIA 2PSRA 4L9MA 2AAOA 3SG2A 1CMFA 3SG5A 1L2OC 4CFRA 2BBMA 2LHIA 1YR5A 1BOCA 2K61A 4MVFA 2B1UA 2BCXA 3I5GC 1CLBA 3TS5C 3TUYC 3VRQA 4YBHB 1ZACA 2HPSA 1IWQA 2HETA 1FI5A 3TDIA 2Y1NA 1J7RA 3SG4A 2PVBA 5HKZA 5I2LA 3JTDC 4BY4A 3JVTC 4YGCB 3DVJA 1CM4A 2LVVA 4MZLA 2K7CA 1R6PA 1OSAA 1RTP1 5HLVA 1KQVA 3WNXB 4M2QA 3KEVA 1BF5A 2ZKMX 5TNCA 1IG5A 1SK6D 1X02A 4MLWA 3WHUB 3OHMB 1KQMC 2CTNA 2KNEA 3VRNA 1AUIB 1VRKA 3RLZA 1RWYA 2M49B 1BG1A 1WLMA 2OTGB 2KI4C 3I5IC 1K96A 4JQ0D 1BJFA 1M45A 1TNPA 2EC6C 2BCBA 1AP4A 3KPXA 2MBXA 3OX5A 4PE7A 3VROA 3KO0A 2L2EA 5KSZA 2OS8C 2ZN9A 4ORAB 4XJKA 1SL8A 1UHNA 1YVHA 2ZRTA 4UPGA 3BQ3A 4MZKA 4ZCVA 1N0YA 3GK2A 4C0LA 1SBJA 1PALA 3DVEA 4WQ3A 4YGBB 2LNKA 1QIWA 1DGVA 1TOPA 2MHHA 3LCPC 5BPJA 5HYDA 1XK4C 2BE4A 1V1FA 1YX7A 2MAZA 2KBIA 1K8UA 2KAYA 1W7IB 1A4PA 1SNLA 1CFPA 2WCEA 1QVIY 2BBNA 1QV1A 3I5FB 2BECA 2KDHA 2JOJA 1DJXA 2COLB 2PALA 2Q4UA 1DJYA 1BT6A 2F3YA 2JT0A 3D10A 2ISDA 4ETOA 2KFGA 3HX4A 3GK4X 1WY9A 4FQOA 4TNCA 2NZ0A 2G9BA 1Q80A 1ALWA 2KYFA 2BKIB 2D8NA 5I2QA 2F33A 3OX6A 3BXKA 5KU1A 5G08A 1KSMA 1PRWA 1PSBA 1SR6C 3PATA 3CLNA 1BLQA 2KSPA 4HRHA 2LP3A 5DKQA 1SW8A 2NLNA 2LAPA 1B8RA 2PASA 1SY9A 1ZFSA 2FJUB 3EVRA 3DF0B 1QX7A 2MA2A 1SL7A 2HQWA 1LVCD 1SRAA 2K0JA 3PFVA 2O60A 1BR1B 1AVSA 1E8AA 2BL0C 2LVJA 4OV2A 4PHKA 4YGDB 2FCEA 1KK7Z 2LANA 2M7LA 1IJ6A 1XFXO 1YRUB 1S6IA 1W7JB 2E30A 2Q91A 2SASA 1LKJA 1NIWA 3SIBA 3GK1A 3NSOA 1DJZA 3DVKA 1JF2A 1ODBA 3K21A 2LLUA 1QLKA 2LC5A 3PN7B 4GFTA 1UHHA 2WNDA 4U8DA 2MJWB 1OMVA 1WRKA 4QJ4B 4HRGA 1DGUA 2QPTA 1KCYA 1BR4B 2JT8A 1K95A 1M63B 1KK8B 5CSJA 1YRTB 5AERA 3KHEA 5GQQC 1FW4A 1SMGA 3GOFA 1YVLA 3AKAA 4BY5A 1CM1A 3SJSA 2KAXA 1K90D 1MHOA 1LINA 3A4UB 3IQOA 1M39A 4PE1A 5ER5A 1OMRA 3LLEA 2PRUA 4GGFA 5CPVA 1DMOA 1F70A 2RGIA 4PE0A 1AK8A 1MR8A 4C0KA 3O78A 1WLZA 2ZNDA 1YUSA 3LL8B 4M2OA 3AAJA 1JWDA 2JXLA 3AKBA 1WDCC 4MZJA 4M2PA 3EKHA 4OCIA 3D0YB 3IQQA 3BYAA 4NQGA 3VRRA 1HT9A 1KSOA 2LVIA 2KGBC 1CFCA 4DIRA 1TIZA 1DVIA 2M0RA 4P2YB 4WRIA 3BOWB 1JFKA 2M3WA 1K93D 1CDLA 1UHIA 2JTTA 2AUCA 4GUKA 2JQ6A 1CKKA 3O4YA 2ZFDA 1J1EA 1XO5A 1CLMA 2F2OA 3I5HB 1BODA 2LMVA 2OPOA 1GJYA 2L4HA 4DS7A 3TDZA 1N65A 1FBVA 2CXJA 1EXRA 2KFFA 3CR5X 2P6BB 4I5KA 5IBWA 1RFJA 1AJ5A 1KWOB 1SL9A 2SCPA 2VRGA 1MXLC 1XFYO 3BUMB 3QRXA 1NX3A 1XFUO 3ZNIA 4N1FA 1J55A 2M1KB 1S1EA 2EGDA 4HREE 4PHMA 3OB2B 1CNPA 2LHLA 3E3RA 1DJIA 2GGMA 3AAKA 3NSLA 1JFJA 1GGWA 4OVNF 1N2DA 2NCPA 1SCMC 1NCYA 1B7TY 1S26D 1TRFA 3PLFB 2K8MB 4R1EA 4DUQA 1NPQA 1U5IB 1KFUS 1XFZO 2K7DA 4A4BA 1K9UA 4I5JA 1NYAA 4PDZA 1TCOB 1A75B 2WORA 1QS7A 2FOTA 2K7BA 4E68A 2M8UA 3VGOA 2QACA 1PVBA 5F6TA 3SIAA 1LA3A 1Y0VH 2JULA 1CFDA 2KYCA 4DRWA 2L50A 2KI6D 1F4QA 1GGZA 4YGAA 1KFXS 1UUSA 3I5GB 3DF0A 3TS5B 3TUYB 2F3ZA 2CNPA 3BUXB 4ZCUA 4ICBA 3ZWHA 4NDBA 1MQ1A 1DJHA 5JJGA 4MBEA 3RM1A 1DT7B 3CZTX 2L4IA 3EKJA 1Y1AA 2H61A 2LUXA 3JVTB 4Q04A 2F8PA 3EK7A 1EL4A 2ZN8A 5CSNA 2M9GA 4GGNA 4NDDA 1M31A 2BCAA 2G2BA 5CSIA 1CDNA 1CMGA 1JSAA 1ZOTB 1F55A 4I5LB 5FYXA 2F2PA 1J7OA 1K2HA 2GV5A 1BU3A 1KQMB 5B8IB 4GGFC 1AJ4A 1S5GY 1MXEA 4HSZA 3TZ1A 2L5XB 2LMTA 1FI6A 5PALA 1FF1A 4CFQA 2KI4B 3I5IB 4YRUA 1TNQA 1XA5A 2EC6B 4WQ2A 1QXPA 1JC2A 2OTGC 1S36A 1K9PA 4FTGA 1PVAA 2IS9A 2OS8B 1OQPA 1LXFC 3EVVA 4I5NB 1OZOA 5K89A 1NWDA 2KAVA 2K2FA 4MN0A 1L7ZA 2A4JA 3FWCA 2JNFA 1RK9A 2EHBA 1EG3A 2I94A 1TNWA 1WRLA 1YUTA 1CDPA 2JC2A 3SG3A 4F0ZB 1RJVA 1YURA 3ICBA 4PALA 4QJ5B 3NXAA 5J3XA 1QIVA 4AOMA 3BUNB 1QJTA 1S3PA 1QVIZ 1TN4A 3O6BA 3VRPA 5I2OA 1Y1UA 1IGVA 2CCMA 3D0YA 1RECA 2LCPA 4NDCA 1OOJA 3C1VA 1B8CA 1NSHA 3I5FC 3BOWA 4N1GA 2K7OA 2JNXA 5D69A 2NCOA 1QX2A 3CR4X 2WCBA 2WOSA 1R2UA 1JUOA 2I2RE 1JBAA 1XYDA 1RROA 4AQIA 2Y1MA 3M0WA 1SPYA 2L98A 1B47A 4MSPA 5AFPA 3LK0A 1EJ3A 1SR6B 2TN4A 4PHJA 4IL1A 1MUXA 1MF8B 1NCXA 1QX5B 1YTZC 4GBAA 1B1GA 4YGEB 1G33A 3EVUA 1IJ5A 1K9KA 1H4BA 3BUWB 1D1OA 3KF9A 1OE9B 2LM5A 1NX0A 1B9AA 1ZMZA 2BL0B 1XVJA 2LMUA 3FWBA 3HCMA 2JXCA 1S5GZ 4OKHA 1EG4A 3CR2A 4A4CA 1CTRA 2H2KA 1NP8A 2JT3A 1F71A 4CIDA 1MWNA 1QASA 1U5IA 2R2IA 3CS1A 1KK7Y 3CGAA 3DD4A 2H61C 4USLA 1CDMA 2BKHB 1A75A 2JWWA 5CSFA 2M29A 1DJWA 1Y1XA 1CLLA 2LV7A 1PK0D 1AHRA 1G4YR 4QJ3B 1QLSA 1UP5A 3LK1A 1A29A 2V53A 3TDUA 1H8BA 1NUBA 1S6CA 1PSRA 1IQ3A 1IH0A 3A8RA 3PN7C 1KFUL 2K2AA 3F45A 2LE9B 5DKRA 2LLTA 1B8LA 4D1EA 4OR9B 2M1UA 1TCFA 1C07A 2NXQA 2L0PA 2Y4QA 3NSKA 1Y6WA 4CPVA 1HQVA 1FPWA 2PMYA 2WCFA 2WC8A 4YI9A 4XYNA 1L2OB 3EK8A 3BUOB 2KQYA 1ALVA 2M97A 3FS7A 1KK8C 3O2PA 1XFWO 2M7NA 2KHNA 1KFXL 1F54A 1OZSA 2DOQA 4XJKB 2L51A 2MRDA 5I8NA 1C7VA 3EK4A 1CFFA 1J1DA 2I7AA 5AXIA 4PCWA 1SYMA 1EH2A 2LVKA 4N5XA 1CB1A 3JTDB 5AEQA 1NCZA 2HQ8A 2LUCA 5D7FA 1J7QA 1YX8A 4C0JA 1S6JA 3H4SE 2CT9A 2KI6C 2CBLA 4PE4A 4AQJA 1WDCB 2MLEC 1UURA 5HKYA 1PULA 5HLOA 4MRYA 2KQ6A 5AANA 1OMDA 3IF7A 1IRJA 2I18A 4MRXA 1F8HA 1V1GA 2MLFC 3CWGA 4P5OE 2ZNEA 3CTNA 1M46A 3MSEB 4MEWA 1G8IA 3FIAA 1DJGA 1F4OA 4DCKA 1NX2A 2KBMA 4YI8A 3PSRA 1UHJA 3PALA 4GNKB 1XFVO 2BE6A 2O5GA 2JPTA 2LLSA 1NX1A 4ORCB 1C7WA 1A2XA 1QV0A 5KTYA 1JF0A 2KGRA 2KOTA 3I5HC 1XK4A 3WXAA 1IKUA 1A03A 4PHNA 5ER4X 4GAOA 3SG6A 1K94A 1IQ5A 3OB1B 1KWOC 1DF0A 2Y5IA 1J7PA 1SCVA 2LP2A 1TTXA 3SG7A 4CLNA 1DTLA 3PM8A 5DKNA 1LA0A 2JTZA 1UWOA 2JZIA 2HF5A 1BMOA 1B7TZ 1SCMB 4JPZB 3WHTB
chains in the Genus database with same CATH superfamily
3B88A 4ORBB 1YUUA 5HKWA 3DVMA 1DF0B 1B4CA 1QATA 1ZUZA 2QEHA 3OP0A 2GGZA 5JOLA 2FCDA 3NHTA 1SKTA 1WRZA 2JU0A 2KFHA 2AMIA 1TNXA 4GPLB 1TUJA 2E6WA 2JRFA 2ZRSA 1UHKA 1GQMA 1QTXA 4JWQA 3NSIA 2PSRA 4L9MA 2AAOA 3SG2A 1CMFA 3SG5A 1L2OC 4CFRA 2BBMA 3NGVA 3FE9A 2LHIA 1YR5A 3V2LA 1BOCA 2K61A 4MVFA 2B1UA 3N7HA 2BCXA 3I5GC 1CLBA 3TS5C 3TUYC 4IJ7A 3VRQA 4YBHB 1ZACA 2HPSA 3PJIA 1IWQA 2HETA 1FI5A 3TDIA 2Y1NA 1J7RA 3SG4A 2GTEA 2PVBA 3BFHA 1OOHA 5HKZA 5I2LA 3JTDC 4BY4A 2QEOA 3R1VA 3JVTC 4YGCB 1DEKA 3DVJA 1CM4A 2LVVA 4MZLA 2K7CA 1R6PA 1OSAA 1RTP1 5HLVA 3B7AA 1KQVA 3WNXB 4M2QA 3KEVA 1BF5A 2ZKMX 5TNCA 1IG5A 1SK6D 1X02A 4MLWA 3WHUB 2WC5A 1C3YA 3OHMB 1KQMC 2CTNA 2KNEA 3VRNA 3FE6A 1AUIB 1VRKA 3RLZA 1RWYA 2M49B 1BG1A 1WLMA 2OTGB 2KI4C 3I5IC 1K96A 4JQ0D 5I94A 1BJFA 1M45A 1TNPA 2EC6C 2BCBA 1AP4A 3KPXA 2MBXA 3L4LA 3OX5A 4PE7A 3VROA 3KO0A 1C3ZA 2L2EA 5KSZA 2OS8C 2ZN9A 4ORAB 4XJKA 1SL8A 1UHNA 1YVHA 2ZRTA 4UPGA 3BQ3A 4MZKA 4ZCVA 1N0YA 1W9ZA 4OZDA 3GK2A 2L2CA 4C0LA 1SBJA 1PALA 3DVEA 4WQ3A 4YGBB 2LNKA 1QIWA 1DGVA 1OOIX 1TOPA 2MHHA 3LCPC 5BPJA 5HYDA 3D73A 1XK4C 2BE4A 1V1FA 1YX7A 2MAZA 2KBIA 1K8UA 2KAYA 1OW4A 1W7IB 1A4PA 3B86A 1SNLA 3D74A 1CFPA 2WCEA 1QVIY 2BBNA 1QV1A 3I5FB 2BECA 2KDHA 2JOJA 1DJXA 2COLB 2PALA 4KYNA 2Q4UA 1DJYA 1BT6A 2F3YA 2JT0A 3D10A 2ISDA 5DICA 4ETOA 2KFGA 4JKTA 3HX4A 3GK4X 1WY9A 4FQOA 4TNCA 2NZ0A 2G9BA 1Q80A 1ALWA 2KYFA 2BKIB 2D8NA 2WCHA 5I2QA 2F33A 2L5YA 3OX6A 3BXKA 5KU1A 5G08A 1KSMA 1PRWA 1PSBA 1SR6C 3PATA 3CLNA 3DY9A 1BLQA 2KSPA 4HRHA 2LP3A 5DKQA 1SW8A 2NLNA 2LAPA 1B8RA 2PASA 1SY9A 1ZFSA 2FJUB 3EVRA 3DF0B 1QX7A 3NHIA 2MA2A 3Q8IA 1SL7A 2HQWA 1LVCD 1SRAA 2K0JA 3PFVA 2O60A 1BR1B 1AVSA 1E8AA 2BL0C 2LVJA 4OV2A 4PHKA 3OGNA 2FCEA 4YGDB 3RZSA 1KK7Z 2LANA 2M7LA 1IJ6A 1XFXO 1YRUB 1S6IA 1W7JB 2E30A 2Q91A 2SASA 1LKJA 2WCJA 1NIWA 3SIBA 3GK1A 3NSOA 1DJZA 3DVKA 3CZ2A 1JF2A 1ODBA 3K21A 2LLUA 1QLKA 2LC5A 1GM0A 3PN7B 4GFTA 1T14A 1UHHA 5HL1A 2WNDA 4U8DA 2MJWB 1OMVA 1WRKA 4QJ4B 4HRGA 1DGUA 1DC1A 2QPTA 2QEVA 1KCYA 1BR4B 2JT8A 1K95A 3DZTA 1M63B 1KK8B 5CSJA 1YRTB 5AERA 3KHEA 5GQQC 1FW4A 1SMGA 3GOFA 2FJYA 3BFAA 1YVLA 3AKAA 4BY5A 3S0EA 1CM1A 3SJSA 2KAXA 1K90D 1MHOA 2YGUA 1LINA 3A4UB 3DXLA 3IQOA 5FI7A 1IIOA 1M39A 4PE1A 5ER5A 1OMRA 3LLEA 2PRUA 4GGFA 2WCLA 5CPVA 1DMOA 1F70A 2RGIA 3L4AA 4PE0A 1MR8A 4C0KA 1AK8A 3O78A 3CDNA 1WLZA 2ZNDA 1YUSA 3LL8B 4M2OA 3AAJA 1JWDA 2JXLA 3AKBA 1WDCC 4MZJA 4M2PA 3EKHA 4OCIA 3D0YB 3IQQA 3BYAA 4NQGA 3VRRA 1HT9A 1KSOA 2LVIA 2KGBC 1CFCA 4DIRA 1TIZA 1DVIA 2M0RA 4P2YB 4WRIA 3BOWB 1JFKA 2M3WA 1K93D 1CDLA 1UHIA 2JTTA 2AUCA 4GUKA 2JQ6A 1CKKA 3O4YA 2ZFDA 1J1EA 1XO5A 1CLMA 3D77A 2F2OA 3I5HB 1BODA 2LMVA 2OPOA 1GJYA 2L4HA 4DS7A 3TDZA 1TUZA 1N65A 1FBVA 2CXJA 3L47A 1EXRA 2KFFA 3CR5X 2P6BB 4I5KA 5IBWA 1RFJA 1AJ5A 1KWOB 1SL9A 2SCPA 2VRGA 1MXLC 1XFYO 3BUMB 3QRXA 1NX3A 1XFUO 3ZNIA 4N1FA 1J55A 2M1KB 1S1EA 2EGDA 4HREE 4PHMA 3OB2B 1CNPA 2LHLA 3E3RA 1DJIA 1ORGA 2GGMA 3AAKA 3NSLA 1JFJA 1GGWA 4OVNF 1N2DA 2ERBA 1SCMC 1NCYA 2NCPA 1B7TY 1S26D 1TRFA 3PLFB 3BJHA 2K8MB 4R1EA 4DUQA 1NPQA 1U5IB 1KFUS 1XFZO 2BNXA 2K7DA 1K9UA 4I5JA 1NYAA 4A4BA 4PDZA 3BFBA 1TCOB 3SS3A 1A75B 2WORA 3SS4A 1QS7A 2FOTA 2K7BA 2WCMA 4E68A 2M8UA 3VGOA 1Z2CB 2QACA 1PVBA 5F6TA 3SIAA 1LA3A 1SSEB 1Y0VH 1CFDA 2JULA 2KYCA 3R1PA 2L50A 4DRWA 2KI6D 1F4QA 1GGZA 4YGAA 1KFXS 1UUSA 3B6XA 3DF0A 3I5GB 3TS5B 3TUYB 2F3ZA 2CNPA 3BUXB 4ZCUA 4ICBA 3ZWHA 4NDBA 1MQ1A 2P70A 1DJHA 5JJGA 4MBEA 3RM1A 1DT7B 3CZTX 2L4IA 3EKJA 1Y1AA 1OOGA 2H61A 2LUXA 3JVTB 1LS8A 2F8PA 4Q04A 3EK7A 1EL4A 3D75A 2ZN8A 5CSNA 2M9GA 4INWA 2JPOA 3EG5B 4GGNA 4NDDA 1M31A 2BCAA 2G2BA 5CSIA 1CDNA 3UNWA 1CMGA 1ZOTB 1JSAA 1F55A 4I5LB 5FYXA 2F2PA 1J7OA 2P71A 1K2HA 2GV5A 1BU3A 1KQMB 5B8IB 4GGFC 1AJ4A 1S5GY 1MXEA 4HSZA 3TZ1A 2L5XB 2LMTA 1FI6A 5PALA 1FF1A 4CFQA 2KI4B 3I5IB 4YRUA 1TNQA 1XA5A 3S0DA 2EC6B 4WQ2A 1QXPA 1JC2A 2OTGC 1S36A 4FQTA 1K9PA 4FTGA 1PVAA 2IS9A 2OS8B 1OQPA 1LXFC 3EVVA 4I5NB 1OZOA 5K89A 1NWDA 3CZ1A 2KAVA 2K2FA 2PQLA 4MN0A 1L7ZA 2A4JA 3FWCA 2JNFA 1RK9A 2EHBA 1EG3A 2I94A 1TNWA 1WRLA 1YUTA 1CDPA 2JC2A 3SG3A 4F0ZB 1RJVA 1YURA 3ICBA 4PALA 4QJ5B 4F7FA 3NXAA 5J3XA 1QIVA 4AOMA 3BUNB 3VB1A 1QJTA 1S3PA 1QVIZ 1TN4A 3O6BA 3VRPA 5I2OA 1Y1UA 1IGVA 2CCMA 3D0YA 3UO9A 1RECA 2LCPA 4NDCA 1OOJA 3R1OA 3C1VA 1B8CA 3S0BA 1NSHA 3I5FC 3BOWA 4N1GA 2K7OA 2JNXA 5D69A 2NCOA 1QX2A 3CR4X 2WCBA 2WOSA 1R2UA 1JUOA 2I2RE 1JBAA 1XYDA 1RROA 2KLDA 4AQIA 2Y1MA 3M0WA 1SPYA 2L98A 3O4XA 1B47A 4MSPA 5AFPA 2PYQA 3LK0A 1EJ3A 1SR6B 2TN4A 4PHJA 4IL1A 1MUXA 1MF8B 1NCXA 1QX5B 1YTZC 3K1EA 4GBAA 1B1GA 4YGEB 1G33A 3EVUA 1IJ5A 1K9KA 1H4BA 3BUWB 1D1OA 3KF9A 1OE9B 3S0GA 2LM5A 1NX0A 4PT1A 1B9AA 1ZMZA 2BL0B 3FE8A 1XVJA 2LMUA 3FWBA 3HCMA 2JXCA 1S5GZ 4OKHA 1EG4A 3CR2A 5FI6A 1CTRA 4A4CA 2H2KA 5FI2A 1NP8A 2JT3A 1F71A 4CIDA 1MWNA 1QASA 1U5IA 2R2IA 3CS1A 1KK7Y 3CGAA 3DD4A 2H61C 4JD9A 4USLA 1CDMA 2BKHB 1A75A 2JWWA 5CSFA 2M29A 1DJWA 1Y1XA 1CLLA 2LV7A 1PK0D 1AHRA 1G4YR 4QJ3B 1XFRA 1QLSA 1UP5A 3LK1A 1A29A 2V53A 3TDUA 1H8BA 1NUBA 1S6CA 1PSRA 1IQ3A 1IH0A 3A8RA 3PN7C 3IVTA 1KFUL 2K2AA 3F45A 2LE9B 5DKRA 2LLTA 1B8LA 4D1EA 4OR9B 2M1UA 1TCFA 1C07A 2NXQA 2L0PA 2Y4QA 3NSKA 1Y6WA 4CPVA 1HQVA 1FPWA 2PMYA 2WC6A 2WCFA 2WC8A 4YI9A 2H8VA 4XYNA 2KLEA 2BAPA 1L2OB 3CABA 1TWOA 3BUOB 3EK8A 2KQYA 1ALVA 2M97A 3CZ0A 1KK8C 3FS7A 3O2PA 1XFWO 2M7NA 2KHNA 1KFXL 3QMEA 1F54A 1OZSA 2DOQA 4XJKB 2L51A 2MRDA 5I8NA 1C7VA 3EK4A 1CFFA 1J1DA 2I7AA 2QEBA 5AXIA 5EL2A 4PCWA 1SYMA 1EH2A 2LVKA 4N5XA 1CB1A 3JTDB 5AEQA 3R72A 3SS5A 1NCZA 2HQ8A 2LUCA 5D7FA 1J7QA 1YX8A 4C0JA 1S6JA 3H4SE 2CT9A 2KI6C 2CBLA 4PE4A 4AQJA 1WDCB 2MLEC 1UURA 5HKYA 1PULA 5HLOA 4MRYA 2KPHA 2KQ6A 5AANA 1OMDA 3IF7A 1IRJA 1P28A 2I18A 4MRXA 1F8HA 1V1GA 2MLFC 3CWGA 4P5OE 2ZNEA 3CTNA 1M46A 3MSEB 2QDIA 4MEWA 1G8IA 1OOFA 3FIAA 1DJGA 1F4OA 4DCKA 1NX2A 2KBMA 4YI8A 3D76A 1UHJA 1Z4HA 3PALA 3PSRA 4GNKB 1XFVO 2BE6A 1DELA 2K60A 2JPTA 2O5GA 4INXA 3S0AA 2LLSA 1NX1A 4ORCB 1C7WA 3D78A 5D3OA 1A2XA 1QV0A 5KTYA 1JF0A 2KGRA 2KOTA 3I5HC 1XK4A 3WXAA 1IKUA 1A03A 4PHNA 5ER4X 3PM2A 4GAOA 3SG6A 1K94A 1QWVA 1IQ5A 3OB1B 1KWOC 3DYEA 1DF0A 2Y5IA 1J7PA 1SCVA 2LP2A 1TTXA 3SG7A 4CLNA 1DTLA 3PM8A 5DKNA 1LA0A 2JTZA 1DQEA 3CYZA 3S0FA 1UWOA 2JZIA 2HF5A 2WCKA 3B87A 1BMOA 1B7TZ 1SCMB 4JPZB 3OBVA 3WHTB
chains in the Genus database with same CATH topology
4ORBB 1YUUA 5HKWA 3DVMA 1DF0B 1B4CA 1QATA 1ZUZA 3OP0A 2GGZA 5JOLA 2FCDA 1SKTA 1WRZA 2JU0A 2KFHA 2AMIA 1TNXA 4GPLB 2E6WA 2JRFA 2ZRSA 1UHKA 1GQMA 1QTXA 4JWQA 3NSIA 2PSRA 4L9MA 2AAOA 3SG2A 1CMFA 3SG5A 1L2OC 4CFRA 2BBMA 2LHIA 1YR5A 1BOCA 2K61A 4MVFA 2B1UA 2BCXA 3I5GC 1CLBA 3TS5C 3TUYC 3VRQA 4YBHB 1ZACA 2HPSA 1IWQA 2HETA 1FI5A 3TDIA 2Y1NA 1J7RA 3SG4A 2PVBA 5HKZA 5I2LA 3JTDC 4BY4A 3JVTC 4YGCB 3DVJA 1CM4A 2LVVA 4MZLA 2K7CA 1R6PA 1OSAA 1RTP1 5HLVA 1KQVA 3WNXB 4M2QA 3KEVA 1BF5A 2ZKMX 5TNCA 1IG5A 1SK6D 1X02A 4MLWA 3WHUB 3OHMB 1KQMC 2CTNA 2KNEA 3VRNA 1AUIB 1VRKA 3RLZA 1RWYA 2M49B 1BG1A 1WLMA 2OTGB 2KI4C 3I5IC 1K96A 4JQ0D 1BJFA 1M45A 1TNPA 2EC6C 2BCBA 1AP4A 3KPXA 2MBXA 3OX5A 4PE7A 3VROA 3KO0A 2L2EA 5KSZA 2OS8C 2ZN9A 4ORAB 4XJKA 1SL8A 1UHNA 1YVHA 2ZRTA 4UPGA 3BQ3A 4MZKA 4ZCVA 1N0YA 3GK2A 4C0LA 1SBJA 1PALA 3DVEA 4WQ3A 4YGBB 2LNKA 1QIWA 1DGVA 1TOPA 2MHHA 3LCPC 5BPJA 5HYDA 1XK4C 2BE4A 1V1FA 1YX7A 2MAZA 2KBIA 1K8UA 2KAYA 1W7IB 1A4PA 1SNLA 1CFPA 2WCEA 1QVIY 2BBNA 1QV1A 3I5FB 2BECA 2KDHA 2JOJA 1DJXA 2COLB 2PALA 2Q4UA 1DJYA 1BT6A 2F3YA 2JT0A 3D10A 2ISDA 4ETOA 2KFGA 3HX4A 3GK4X 1WY9A 4FQOA 4TNCA 2NZ0A 2G9BA 1Q80A 1ALWA 2KYFA 2BKIB 2D8NA 5I2QA 2F33A 3OX6A 3BXKA 5KU1A 5G08A 1KSMA 1PRWA 1PSBA 1SR6C 3PATA 3CLNA 1BLQA 2KSPA 4HRHA 2LP3A 5DKQA 1SW8A 2NLNA 2LAPA 1B8RA 2PASA 1SY9A 1ZFSA 2FJUB 3EVRA 3DF0B 1QX7A 2MA2A 1SL7A 2HQWA 1LVCD 1SRAA 2K0JA 3PFVA 2O60A 1BR1B 1AVSA 1E8AA 2BL0C 2LVJA 4OV2A 4PHKA 4YGDB 2FCEA 1KK7Z 2LANA 2M7LA 1IJ6A 1XFXO 1YRUB 1S6IA 1W7JB 2E30A 2Q91A 2SASA 1LKJA 1NIWA 3SIBA 3GK1A 3NSOA 1DJZA 3DVKA 1JF2A 1ODBA 3K21A 2LLUA 1QLKA 2LC5A 3PN7B 4GFTA 1UHHA 2WNDA 4U8DA 2MJWB 1OMVA 1WRKA 4QJ4B 4HRGA 1DGUA 2QPTA 1KCYA 1BR4B 2JT8A 1K95A 1M63B 1KK8B 5CSJA 1YRTB 5AERA 3KHEA 5GQQC 1FW4A 1SMGA 3GOFA 1YVLA 3AKAA 4BY5A 1CM1A 3SJSA 2KAXA 1K90D 1MHOA 1LINA 3A4UB 3IQOA 1M39A 4PE1A 5ER5A 1OMRA 3LLEA 2PRUA 4GGFA 5CPVA 1DMOA 1F70A 2RGIA 4PE0A 1AK8A 1MR8A 4C0KA 3O78A 1WLZA 2ZNDA 1YUSA 3LL8B 4M2OA 3AAJA 1JWDA 2JXLA 3AKBA 1WDCC 4MZJA 4M2PA 3EKHA 4OCIA 3D0YB 3IQQA 3BYAA 4NQGA 3VRRA 1HT9A 1KSOA 2LVIA 2KGBC 1CFCA 4DIRA 1TIZA 1DVIA 2M0RA 4P2YB 4WRIA 3BOWB 1JFKA 2M3WA 1K93D 1CDLA 1UHIA 2JTTA 2AUCA 4GUKA 2JQ6A 1CKKA 3O4YA 2ZFDA 1J1EA 1XO5A 1CLMA 2F2OA 3I5HB 1BODA 2LMVA 2OPOA 1GJYA 2L4HA 4DS7A 3TDZA 1N65A 1FBVA 2CXJA 1EXRA 2KFFA 3CR5X 2P6BB 4I5KA 5IBWA 1RFJA 1AJ5A 1KWOB 1SL9A 2SCPA 2VRGA 1MXLC 1XFYO 3BUMB 3QRXA 1NX3A 1XFUO 3ZNIA 4N1FA 1J55A 2M1KB 1S1EA 2EGDA 4HREE 4PHMA 3OB2B 1CNPA 2LHLA 3E3RA 1DJIA 2GGMA 3AAKA 3NSLA 1JFJA 1GGWA 4OVNF 1N2DA 2NCPA 1SCMC 1NCYA 1B7TY 1S26D 1TRFA 3PLFB 2K8MB 4R1EA 4DUQA 1NPQA 1U5IB 1KFUS 1XFZO 2K7DA 4A4BA 1K9UA 4I5JA 1NYAA 4PDZA 1TCOB 1A75B 2WORA 1QS7A 2FOTA 2K7BA 4E68A 2M8UA 3VGOA 2QACA 1PVBA 5F6TA 3SIAA 1LA3A 1Y0VH 2JULA 1CFDA 2KYCA 4DRWA 2L50A 2KI6D 1F4QA 1GGZA 4YGAA 1KFXS 1UUSA 3I5GB 3DF0A 3TS5B 3TUYB 2F3ZA 2CNPA 3BUXB 4ZCUA 4ICBA 3ZWHA 4NDBA 1MQ1A 1DJHA 5JJGA 4MBEA 3RM1A 1DT7B 3CZTX 2L4IA 3EKJA 1Y1AA 2H61A 2LUXA 3JVTB 4Q04A 2F8PA 3EK7A 1EL4A 2ZN8A 5CSNA 2M9GA 4GGNA 4NDDA 1M31A 2BCAA 2G2BA 5CSIA 1CDNA 1CMGA 1JSAA 1ZOTB 1F55A 4I5LB 5FYXA 2F2PA 1J7OA 1K2HA 2GV5A 1BU3A 1KQMB 5B8IB 4GGFC 1AJ4A 1S5GY 1MXEA 4HSZA 3TZ1A 2L5XB 2LMTA 1FI6A 5PALA 1FF1A 4CFQA 2KI4B 3I5IB 4YRUA 1TNQA 1XA5A 2EC6B 4WQ2A 1QXPA 1JC2A 2OTGC 1S36A 1K9PA 4FTGA 1PVAA 2IS9A 2OS8B 1OQPA 1LXFC 3EVVA 4I5NB 1OZOA 5K89A 1NWDA 2KAVA 2K2FA 4MN0A 1L7ZA 2A4JA 3FWCA 2JNFA 1RK9A 2EHBA 1EG3A 2I94A 1TNWA 1WRLA 1YUTA 1CDPA 2JC2A 3SG3A 4F0ZB 1RJVA 1YURA 3ICBA 4PALA 4QJ5B 3NXAA 5J3XA 1QIVA 4AOMA 3BUNB 1QJTA 1S3PA 1QVIZ 1TN4A 3O6BA 3VRPA 5I2OA 1Y1UA 1IGVA 2CCMA 3D0YA 1RECA 2LCPA 4NDCA 1OOJA 3C1VA 1B8CA 1NSHA 3I5FC 3BOWA 4N1GA 2K7OA 2JNXA 5D69A 2NCOA 1QX2A 3CR4X 2WCBA 2WOSA 1R2UA 1JUOA 2I2RE 1JBAA 1XYDA 1RROA 4AQIA 2Y1MA 3M0WA 1SPYA 2L98A 1B47A 4MSPA 5AFPA 3LK0A 1EJ3A 1SR6B 2TN4A 4PHJA 4IL1A 1MUXA 1MF8B 1NCXA 1QX5B 1YTZC 4GBAA 1B1GA 4YGEB 1G33A 3EVUA 1IJ5A 1K9KA 1H4BA 3BUWB 1D1OA 3KF9A 1OE9B 2LM5A 1NX0A 1B9AA 1ZMZA 2BL0B 1XVJA 2LMUA 3FWBA 3HCMA 2JXCA 1S5GZ 4OKHA 1EG4A 3CR2A 4A4CA 1CTRA 2H2KA 1NP8A 2JT3A 1F71A 4CIDA 1MWNA 1QASA 1U5IA 2R2IA 3CS1A 1KK7Y 3CGAA 3DD4A 2H61C 4USLA 1CDMA 2BKHB 1A75A 2JWWA 5CSFA 2M29A 1DJWA 1Y1XA 1CLLA 2LV7A 1PK0D 1AHRA 1G4YR 4QJ3B 1QLSA 1UP5A 3LK1A 1A29A 2V53A 3TDUA 1H8BA 1NUBA 1S6CA 1PSRA 1IQ3A 1IH0A 3A8RA 3PN7C 1KFUL 2K2AA 3F45A 2LE9B 5DKRA 2LLTA 1B8LA 4D1EA 4OR9B 2M1UA 1TCFA 1C07A 2NXQA 2L0PA 2Y4QA 3NSKA 1Y6WA 4CPVA 1HQVA 1FPWA 2PMYA 2WCFA 2WC8A 4YI9A 4XYNA 1L2OB 3EK8A 3BUOB 2KQYA 1ALVA 2M97A 3FS7A 1KK8C 3O2PA 1XFWO 2M7NA 2KHNA 1KFXL 1F54A 1OZSA 2DOQA 4XJKB 2L51A 2MRDA 5I8NA 1C7VA 3EK4A 1CFFA 1J1DA 2I7AA 5AXIA 4PCWA 1SYMA 1EH2A 2LVKA 4N5XA 1CB1A 3JTDB 5AEQA 1NCZA 2HQ8A 2LUCA 5D7FA 1J7QA 1YX8A 4C0JA 1S6JA 3H4SE 2CT9A 2KI6C 2CBLA 4PE4A 4AQJA 1WDCB 2MLEC 1UURA 5HKYA 1PULA 5HLOA 4MRYA 2KQ6A 5AANA 1OMDA 3IF7A 1IRJA 2I18A 4MRXA 1F8HA 1V1GA 2MLFC 3CWGA 4P5OE 2ZNEA 3CTNA 1M46A 3MSEB 4MEWA 1G8IA 3FIAA 1DJGA 1F4OA 4DCKA 1NX2A 2KBMA 4YI8A 3PSRA 1UHJA 3PALA 4GNKB 1XFVO 2BE6A 2O5GA 2JPTA 2LLSA 1NX1A 4ORCB 1C7WA 1A2XA 1QV0A 5KTYA 1JF0A 2KGRA 2KOTA 3I5HC 1XK4A 3WXAA 1IKUA 1A03A 4PHNA 5ER4X 4GAOA 3SG6A 1K94A 1IQ5A 3OB1B 1KWOC 1DF0A 2Y5IA 1J7PA 1SCVA 2LP2A 1TTXA 3SG7A 4CLNA 1DTLA 3PM8A 5DKNA 1LA0A 2JTZA 1UWOA 2JZIA 2HF5A 1BMOA 1B7TZ 1SCMB 4JPZB 3WHTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORB B;  1YUU A;  5HKW A;  3DVM A;  1DF0 B;  1B4C A;  1QAT A;  1ZUZ A;  3OP0 A;  2GGZ A;  5JOL A;  2FCD A;  1SKT A;  1WRZ A;  2JU0 A;  2KFH A;  2AMI A;  1TNX A;  4GPL B;  2E6W A;  2JRF A;  2ZRS A;  1UHK A;  1GQM A;  1QTX A;  4JWQ A;  3NSI A;  2PSR A;  4L9M A;  2AAO A;  3SG2 A;  1CMF A;  3SG5 A;  1L2O C;  4CFR A;  2BBM A;  2LHI A;  1YR5 A;  1BOC A;  2K61 A;  4MVF A;  2B1U A;  2BCX A;  3I5G C;  1CLB A;  3TS5 C;  3TUY C;  3VRQ A;  4YBH B;  1ZAC A;  2HPS A;  1IWQ A;  2HET A;  1FI5 A;  3TDI A;  2Y1N A;  1J7R A;  3SG4 A;  2PVB A;  5HKZ A;  5I2L A;  3JTD C;  4BY4 A;  3JVT C;  4YGC B;  3DVJ A;  1CM4 A;  2LVV A;  4MZL A;  2K7C A;  1R6P A;  1OSA A;  1RTP 1;  5HLV A;  1KQV A;  3WNX B;  4M2Q A;  3KEV A;  1BF5 A;  2ZKM X;  5TNC A;  1IG5 A;  1SK6 D;  1X02 A;  4MLW A;  3WHU B;  3OHM B;  1KQM C;  2CTN A;  2KNE A;  3VRN A;  1AUI B;  1VRK A;  3RLZ A;  1RWY A;  2M49 B;  1BG1 A;  1WLM A;  2OTG B;  2KI4 C;  3I5I C;  1K96 A;  4JQ0 D;  1BJF A;  1M45 A;  1TNP A;  2EC6 C;  2BCB A;  1AP4 A;  3KPX A;  2MBX A;  3OX5 A;  4PE7 A;  3VRO A;  3KO0 A;  2L2E A;  5KSZ A;  2OS8 C;  2ZN9 A;  4ORA B;  4XJK A;  1SL8 A;  1UHN A;  1YVH A;  2ZRT A;  4UPG A;  3BQ3 A;  4MZK A;  4ZCV A;  1N0Y A;  3GK2 A;  4C0L A;  1SBJ A;  1PAL A;  3DVE A;  4WQ3 A;  4YGB B;  2LNK A;  1QIW A;  1DGV A;  1TOP A;  2MHH A;  3LCP C;  5BPJ A;  5HYD A;  1XK4 C;  2BE4 A;  1V1F A;  1YX7 A;  2MAZ A;  2KBI A;  1K8U A;  2KAY A;  1W7I B;  1A4P A;  1SNL A;  1CFP A;  2WCE A;  1QVI Y;  2BBN A;  1QV1 A;  3I5F B;  2BEC A;  2KDH A;  2JOJ A;  1DJX A;  2COL B;  2PAL A;  2Q4U A;  1DJY A;  1BT6 A;  2F3Y A;  2JT0 A;  3D10 A;  2ISD A;  4ETO A;  2KFG A;  3HX4 A;  3GK4 X;  1WY9 A;  4FQO A;  4TNC A;  2NZ0 A;  2G9B A;  1Q80 A;  1ALW A;  2KYF A;  2BKI B;  2D8N A;  5I2Q A;  2F33 A;  3OX6 A;  3BXK A;  5KU1 A;  5G08 A;  1KSM A;  1PRW A;  1PSB A;  1SR6 C;  3PAT A;  3CLN A;  1BLQ A;  2KSP A;  4HRH A;  2LP3 A;  5DKQ A;  1SW8 A;  2NLN A;  2LAP A;  1B8R A;  2PAS A;  1SY9 A;  1ZFS A;  2FJU B;  3EVR A;  3DF0 B;  1QX7 A;  2MA2 A;  1SL7 A;  2HQW A;  1LVC D;  1SRA A;  2K0J A;  3PFV A;  2O60 A;  1BR1 B;  1AVS A;  1E8A A;  2BL0 C;  2LVJ A;  4OV2 A;  4PHK A;  4YGD B;  2FCE A;  1KK7 Z;  2LAN A;  2M7L A;  1IJ6 A;  1XFX O;  1YRU B;  1S6I A;  1W7J B;  2E30 A;  2Q91 A;  2SAS A;  1LKJ A;  1NIW A;  3SIB A;  3GK1 A;  3NSO A;  1DJZ A;  3DVK A;  1JF2 A;  1ODB A;  3K21 A;  2LLU A;  1QLK A;  2LC5 A;  3PN7 B;  4GFT A;  1UHH A;  2WND A;  4U8D A;  2MJW B;  1OMV A;  1WRK A;  4QJ4 B;  4HRG A;  1DGU A;  2QPT A;  1KCY A;  1BR4 B;  2JT8 A;  1K95 A;  1M63 B;  1KK8 B;  5CSJ A;  1YRT B;  5AER A;  3KHE A;  5GQQ C;  1FW4 A;  1SMG A;  3GOF A;  1YVL A;  3AKA A;  4BY5 A;  1CM1 A;  3SJS A;  2KAX A;  1K90 D;  1MHO A;  1LIN A;  3A4U B;  3IQO A;  1M39 A;  4PE1 A;  5ER5 A;  1OMR A;  3LLE A;  2PRU A;  4GGF A;  5CPV A;  1DMO A;  1F70 A;  2RGI A;  4PE0 A;  1AK8 A;  1MR8 A;  4C0K A;  3O78 A;  1WLZ A;  2ZND A;  1YUS A;  3LL8 B;  4M2O A;  3AAJ A;  1JWD A;  2JXL A;  3AKB A;  1WDC C;  4MZJ A;  4M2P A;  3EKH A;  4OCI A;  3D0Y B;  3IQQ A;  3BYA A;  4NQG A;  3VRR A;  1HT9 A;  1KSO A;  2LVI A;  2KGB C;  1CFC A;  4DIR A;  1TIZ A;  1DVI A;  2M0R A;  4P2Y B;  4WRI A;  3BOW B;  1JFK A;  2M3W A;  1K93 D;  1CDL A;  1UHI A;  2JTT A;  2AUC A;  4GUK A;  2JQ6 A;  1CKK A;  3O4Y A;  2ZFD A;  1J1E A;  1XO5 A;  1CLM A;  2F2O A;  3I5H B;  1BOD A;  2LMV A;  2OPO A;  1GJY A;  2L4H A;  4DS7 A;  3TDZ A;  1N65 A;  1FBV A;  2CXJ A;  1EXR A;  2KFF A;  3CR5 X;  2P6B B;  4I5K A;  5IBW A;  1RFJ A;  1AJ5 A;  1KWO B;  1SL9 A;  2SCP A;  2VRG A;  1MXL C;  1XFY O;  3BUM B;  3QRX A;  1NX3 A;  1XFU O;  3ZNI A;  4N1F A;  1J55 A;  2M1K B;  1S1E A;  2EGD A;  4HRE E;  4PHM A;  3OB2 B;  1CNP A;  2LHL A;  3E3R A;  1DJI A;  2GGM A;  3AAK A;  3NSL A;  1JFJ A;  1GGW A;  4OVN F;  1N2D A;  2NCP A;  1SCM C;  1NCY A;  1B7T Y;  1S26 D;  1TRF A;  3PLF B;  2K8M B;  4R1E A;  4DUQ A;  1NPQ A;  1U5I B;  1KFU S;  1XFZ O;  2K7D A;  4A4B A;  1K9U A;  4I5J A;  1NYA A;  4PDZ A;  1TCO B;  1A75 B;  2WOR A;  1QS7 A;  2FOT A;  2K7B A;  4E68 A;  2M8U A;  3VGO A;  2QAC A;  1PVB A;  5F6T A;  3SIA A;  1LA3 A;  1Y0V H;  2JUL A;  1CFD A;  2KYC A;  4DRW A;  2L50 A;  2KI6 D;  1F4Q A;  1GGZ A;  4YGA A;  1KFX S;  1UUS A;  3I5G B;  3DF0 A;  3TS5 B;  3TUY B;  2F3Z A;  2CNP A;  3BUX B;  4ZCU A;  4ICB A;  3ZWH A;  4NDB A;  1MQ1 A;  1DJH A;  5JJG A;  4MBE A;  3RM1 A;  1DT7 B;  3CZT X;  2L4I A;  3EKJ A;  1Y1A A;  2H61 A;  2LUX A;  3JVT B;  4Q04 A;  2F8P A;  3EK7 A;  1EL4 A;  2ZN8 A;  5CSN A;  2M9G A;  4GGN A;  4NDD A;  1M31 A;  2BCA A;  2G2B A;  5CSI A;  1CDN A;  1CMG A;  1JSA A;  1ZOT B;  1F55 A;  4I5L B;  5FYX A;  2F2P A;  1J7O A;  1K2H A;  2GV5 A;  1BU3 A;  1KQM B;  5B8I B;  4GGF C;  1AJ4 A;  1S5G Y;  1MXE A;  4HSZ A;  3TZ1 A;  2L5X B;  2LMT A;  1FI6 A;  5PAL A;  1FF1 A;  4CFQ A;  2KI4 B;  3I5I B;  4YRU A;  1TNQ A;  1XA5 A;  2EC6 B;  4WQ2 A;  1QXP A;  1JC2 A;  2OTG C;  1S36 A;  1K9P A;  4FTG A;  1PVA A;  2IS9 A;  2OS8 B;  1OQP A;  1LXF C;  3EVV A;  4I5N B;  1OZO A;  5K89 A;  1NWD A;  2KAV A;  2K2F A;  4MN0 A;  1L7Z A;  2A4J A;  3FWC A;  2JNF A;  1RK9 A;  2EHB A;  1EG3 A;  2I94 A;  1TNW A;  1WRL A;  1YUT A;  1CDP A;  2JC2 A;  3SG3 A;  4F0Z B;  1RJV A;  1YUR A;  3ICB A;  4PAL A;  4QJ5 B;  3NXA A;  5J3X A;  1QIV A;  4AOM A;  3BUN B;  1QJT A;  1S3P A;  1QVI Z;  1TN4 A;  3O6B A;  3VRP A;  5I2O A;  1Y1U A;  1IGV A;  2CCM A;  3D0Y A;  1REC A;  2LCP A;  4NDC A;  1OOJ A;  3C1V A;  1B8C A;  1NSH A;  3I5F C;  3BOW A;  4N1G A;  2K7O A;  2JNX A;  5D69 A;  2NCO A;  1QX2 A;  3CR4 X;  2WCB A;  2WOS A;  1R2U A;  1JUO A;  2I2R E;  1JBA A;  1XYD A;  1RRO A;  4AQI A;  2Y1M A;  3M0W A;  1SPY A;  2L98 A;  1B47 A;  4MSP A;  5AFP A;  3LK0 A;  1EJ3 A;  1SR6 B;  2TN4 A;  4PHJ A;  4IL1 A;  1MUX A;  1MF8 B;  1NCX A;  1QX5 B;  1YTZ C;  4GBA A;  1B1G A;  4YGE B;  1G33 A;  3EVU A;  1IJ5 A;  1K9K A;  1H4B A;  3BUW B;  1D1O A;  3KF9 A;  1OE9 B;  2LM5 A;  1NX0 A;  1B9A A;  1ZMZ A;  2BL0 B;  1XVJ A;  2LMU A;  3FWB A;  3HCM A;  2JXC A;  1S5G Z;  4OKH A;  1EG4 A;  3CR2 A;  4A4C A;  1CTR A;  2H2K A;  1NP8 A;  2JT3 A;  1F71 A;  4CID A;  1MWN A;  1QAS A;  1U5I A;  2R2I A;  3CS1 A;  1KK7 Y;  3CGA A;  3DD4 A;  2H61 C;  4USL A;  1CDM A;  2BKH B;  1A75 A;  2JWW A;  5CSF A;  2M29 A;  1DJW A;  1Y1X A;  1CLL A;  2LV7 A;  1PK0 D;  1AHR A;  1G4Y R;  4QJ3 B;  1QLS A;  1UP5 A;  3LK1 A;  1A29 A;  2V53 A;  3TDU A;  1H8B A;  1NUB A;  1S6C A;  1PSR A;  1IQ3 A;  1IH0 A;  3A8R A;  3PN7 C;  1KFU L;  2K2A A;  3F45 A;  2LE9 B;  5DKR A;  2LLT A;  1B8L A;  4D1E A;  4OR9 B;  2M1U A;  1TCF A;  1C07 A;  2NXQ A;  2L0P A;  2Y4Q A;  3NSK A;  1Y6W A;  4CPV A;  1HQV A;  1FPW A;  2PMY A;  2WCF A;  2WC8 A;  4YI9 A;  4XYN A;  1L2O B;  3EK8 A;  3BUO B;  2KQY A;  1ALV A;  2M97 A;  3FS7 A;  1KK8 C;  3O2P A;  1XFW O;  2M7N A;  2KHN A;  1KFX L;  1F54 A;  1OZS A;  2DOQ A;  4XJK B;  2L51 A;  2MRD A;  5I8N A;  1C7V A;  3EK4 A;  1CFF A;  1J1D A;  2I7A A;  5AXI A;  4PCW A;  1SYM A;  1EH2 A;  2LVK A;  4N5X A;  1CB1 A;  3JTD B;  5AEQ A;  1NCZ A;  2HQ8 A;  2LUC A;  5D7F A;  1J7Q A;  1YX8 A;  4C0J A;  1S6J A;  3H4S E;  2CT9 A;  2KI6 C;  2CBL A;  4PE4 A;  4AQJ A;  1WDC B;  2MLE C;  1UUR A;  5HKY A;  1PUL A;  5HLO A;  4MRY A;  2KQ6 A;  5AAN A;  1OMD A;  3IF7 A;  1IRJ A;  2I18 A;  4MRX A;  1F8H A;  1V1G A;  2MLF C;  3CWG A;  4P5O E;  2ZNE A;  3CTN A;  1M46 A;  3MSE B;  4MEW A;  1G8I A;  3FIA A;  1DJG A;  1F4O A;  4DCK A;  1NX2 A;  2KBM A;  4YI8 A;  3PSR A;  1UHJ A;  3PAL A;  4GNK B;  1XFV O;  2BE6 A;  2O5G A;  2JPT A;  2LLS A;  1NX1 A;  4ORC B;  1C7W A;  1A2X A;  1QV0 A;  5KTY A;  1JF0 A;  2KGR A;  2KOT A;  3I5H C;  1XK4 A;  3WXA A;  1IKU A;  1A03 A;  4PHN A;  5ER4 X;  4GAO A;  3SG6 A;  1K94 A;  1IQ5 A;  3OB1 B;  1KWO C;  1DF0 A;  2Y5I A;  1J7P A;  1SCV A;  2LP2 A;  1TTX A;  3SG7 A;  4CLN A;  1DTL A;  3PM8 A;  5DKN A;  1LA0 A;  2JTZ A;  1UWO A;  2JZI A;  2HF5 A;  1BMO A;  1B7T Z;  1SCM B;  4JPZ B;  3WHT B; 
#chains in the Genus database with same CATH topology
 3B88 A;  4ORB B;  1YUU A;  5HKW A;  3DVM A;  1DF0 B;  1B4C A;  1QAT A;  1ZUZ A;  2QEH A;  3OP0 A;  2GGZ A;  5JOL A;  2FCD A;  3NHT A;  1SKT A;  1WRZ A;  2JU0 A;  2KFH A;  2AMI A;  1TNX A;  4GPL B;  1TUJ A;  2E6W A;  2JRF A;  2ZRS A;  1UHK A;  1GQM A;  1QTX A;  4JWQ A;  3NSI A;  2PSR A;  4L9M A;  2AAO A;  3SG2 A;  1CMF A;  3SG5 A;  1L2O C;  4CFR A;  2BBM A;  3NGV A;  3FE9 A;  2LHI A;  1YR5 A;  3V2L A;  1BOC A;  2K61 A;  4MVF A;  2B1U A;  3N7H A;  2BCX A;  3I5G C;  1CLB A;  3TS5 C;  3TUY C;  4IJ7 A;  3VRQ A;  4YBH B;  1ZAC A;  2HPS A;  3PJI A;  1IWQ A;  2HET A;  1FI5 A;  3TDI A;  2Y1N A;  1J7R A;  3SG4 A;  2GTE A;  2PVB A;  3BFH A;  1OOH A;  5HKZ A;  5I2L A;  3JTD C;  4BY4 A;  2QEO A;  3R1V A;  3JVT C;  4YGC B;  1DEK A;  3DVJ A;  1CM4 A;  2LVV A;  4MZL A;  2K7C A;  1R6P A;  1OSA A;  1RTP 1;  5HLV A;  3B7A A;  1KQV A;  3WNX B;  4M2Q A;  3KEV A;  1BF5 A;  2ZKM X;  5TNC A;  1IG5 A;  1SK6 D;  1X02 A;  4MLW A;  3WHU B;  2WC5 A;  1C3Y A;  3OHM B;  1KQM C;  2CTN A;  2KNE A;  3VRN A;  3FE6 A;  1AUI B;  1VRK A;  3RLZ A;  1RWY A;  2M49 B;  1BG1 A;  1WLM A;  2OTG B;  2KI4 C;  3I5I C;  1K96 A;  4JQ0 D;  5I94 A;  1BJF A;  1M45 A;  1TNP A;  2EC6 C;  2BCB A;  1AP4 A;  3KPX A;  2MBX A;  3L4L A;  3OX5 A;  4PE7 A;  3VRO A;  3KO0 A;  1C3Z A;  2L2E A;  5KSZ A;  2OS8 C;  2ZN9 A;  4ORA B;  4XJK A;  1SL8 A;  1UHN A;  1YVH A;  2ZRT A;  4UPG A;  3BQ3 A;  4MZK A;  4ZCV A;  1N0Y A;  1W9Z A;  4OZD A;  3GK2 A;  2L2C A;  4C0L A;  1SBJ A;  1PAL A;  3DVE A;  4WQ3 A;  4YGB B;  2LNK A;  1QIW A;  1DGV A;  1OOI X;  1TOP A;  2MHH A;  3LCP C;  5BPJ A;  5HYD A;  3D73 A;  1XK4 C;  2BE4 A;  1V1F A;  1YX7 A;  2MAZ A;  2KBI A;  1K8U A;  2KAY A;  1OW4 A;  1W7I B;  1A4P A;  3B86 A;  1SNL A;  3D74 A;  1CFP A;  2WCE A;  1QVI Y;  2BBN A;  1QV1 A;  3I5F B;  2BEC A;  2KDH A;  2JOJ A;  1DJX A;  2COL B;  2PAL A;  4KYN A;  2Q4U A;  1DJY A;  1BT6 A;  2F3Y A;  2JT0 A;  3D10 A;  2ISD A;  5DIC A;  4ETO A;  2KFG A;  4JKT A;  3HX4 A;  3GK4 X;  1WY9 A;  4FQO A;  4TNC A;  2NZ0 A;  2G9B A;  1Q80 A;  1ALW A;  2KYF A;  2BKI B;  2D8N A;  2WCH A;  5I2Q A;  2F33 A;  2L5Y A;  3OX6 A;  3BXK A;  5KU1 A;  5G08 A;  1KSM A;  1PRW A;  1PSB A;  1SR6 C;  3PAT A;  3CLN A;  3DY9 A;  1BLQ A;  2KSP A;  4HRH A;  2LP3 A;  5DKQ A;  1SW8 A;  2NLN A;  2LAP A;  1B8R A;  2PAS A;  1SY9 A;  1ZFS A;  2FJU B;  3EVR A;  3DF0 B;  1QX7 A;  3NHI A;  2MA2 A;  3Q8I A;  1SL7 A;  2HQW A;  1LVC D;  1SRA A;  2K0J A;  3PFV A;  2O60 A;  1BR1 B;  1AVS A;  1E8A A;  2BL0 C;  2LVJ A;  4OV2 A;  4PHK A;  3OGN A;  2FCE A;  4YGD B;  3RZS A;  1KK7 Z;  2LAN A;  2M7L A;  1IJ6 A;  1XFX O;  1YRU B;  1S6I A;  1W7J B;  2E30 A;  2Q91 A;  2SAS A;  1LKJ A;  2WCJ A;  1NIW A;  3SIB A;  3GK1 A;  3NSO A;  1DJZ A;  3DVK A;  3CZ2 A;  1JF2 A;  1ODB A;  3K21 A;  2LLU A;  1QLK A;  2LC5 A;  1GM0 A;  3PN7 B;  4GFT A;  1T14 A;  1UHH A;  5HL1 A;  2WND A;  4U8D A;  2MJW B;  1OMV A;  1WRK A;  4QJ4 B;  4HRG A;  1DGU A;  1DC1 A;  2QPT A;  2QEV A;  1KCY A;  1BR4 B;  2JT8 A;  1K95 A;  3DZT A;  1M63 B;  1KK8 B;  5CSJ A;  1YRT B;  5AER A;  3KHE A;  5GQQ C;  1FW4 A;  1SMG A;  3GOF A;  2FJY A;  3BFA A;  1YVL A;  3AKA A;  4BY5 A;  3S0E A;  1CM1 A;  3SJS A;  2KAX A;  1K90 D;  1MHO A;  2YGU A;  1LIN A;  3A4U B;  3DXL A;  3IQO A;  5FI7 A;  1IIO A;  1M39 A;  4PE1 A;  5ER5 A;  1OMR A;  3LLE A;  2PRU A;  4GGF A;  2WCL A;  5CPV A;  1DMO A;  1F70 A;  2RGI A;  3L4A A;  4PE0 A;  1MR8 A;  4C0K A;  1AK8 A;  3O78 A;  3CDN A;  1WLZ A;  2ZND A;  1YUS A;  3LL8 B;  4M2O A;  3AAJ A;  1JWD A;  2JXL A;  3AKB A;  1WDC C;  4MZJ A;  4M2P A;  3EKH A;  4OCI A;  3D0Y B;  3IQQ A;  3BYA A;  4NQG A;  3VRR A;  1HT9 A;  1KSO A;  2LVI A;  2KGB C;  1CFC A;  4DIR A;  1TIZ A;  1DVI A;  2M0R A;  4P2Y B;  4WRI A;  3BOW B;  1JFK A;  2M3W A;  1K93 D;  1CDL A;  1UHI A;  2JTT A;  2AUC A;  4GUK A;  2JQ6 A;  1CKK A;  3O4Y A;  2ZFD A;  1J1E A;  1XO5 A;  1CLM A;  3D77 A;  2F2O A;  3I5H B;  1BOD A;  2LMV A;  2OPO A;  1GJY A;  2L4H A;  4DS7 A;  3TDZ A;  1TUZ A;  1N65 A;  1FBV A;  2CXJ A;  3L47 A;  1EXR A;  2KFF A;  3CR5 X;  2P6B B;  4I5K A;  5IBW A;  1RFJ A;  1AJ5 A;  1KWO B;  1SL9 A;  2SCP A;  2VRG A;  1MXL C;  1XFY O;  3BUM B;  3QRX A;  1NX3 A;  1XFU O;  3ZNI A;  4N1F A;  1J55 A;  2M1K B;  1S1E A;  2EGD A;  4HRE E;  4PHM A;  3OB2 B;  1CNP A;  2LHL A;  3E3R A;  1DJI A;  1ORG A;  2GGM A;  3AAK A;  3NSL A;  1JFJ A;  1GGW A;  4OVN F;  1N2D A;  2ERB A;  1SCM C;  1NCY A;  2NCP A;  1B7T Y;  1S26 D;  1TRF A;  3PLF B;  3BJH A;  2K8M B;  4R1E A;  4DUQ A;  1NPQ A;  1U5I B;  1KFU S;  1XFZ O;  2BNX A;  2K7D A;  1K9U A;  4I5J A;  1NYA A;  4A4B A;  4PDZ A;  3BFB A;  1TCO B;  3SS3 A;  1A75 B;  2WOR A;  3SS4 A;  1QS7 A;  2FOT A;  2K7B A;  2WCM A;  4E68 A;  2M8U A;  3VGO A;  1Z2C B;  2QAC A;  1PVB A;  5F6T A;  3SIA A;  1LA3 A;  1SSE B;  1Y0V H;  1CFD A;  2JUL A;  2KYC A;  3R1P A;  2L50 A;  4DRW A;  2KI6 D;  1F4Q A;  1GGZ A;  4YGA A;  1KFX S;  1UUS A;  3B6X A;  3DF0 A;  3I5G B;  3TS5 B;  3TUY B;  2F3Z A;  2CNP A;  3BUX B;  4ZCU A;  4ICB A;  3ZWH A;  4NDB A;  1MQ1 A;  2P70 A;  1DJH A;  5JJG A;  4MBE A;  3RM1 A;  1DT7 B;  3CZT X;  2L4I A;  3EKJ A;  1Y1A A;  1OOG A;  2H61 A;  2LUX A;  3JVT B;  1LS8 A;  2F8P A;  4Q04 A;  3EK7 A;  1EL4 A;  3D75 A;  2ZN8 A;  5CSN A;  2M9G A;  4INW A;  2JPO A;  3EG5 B;  4GGN A;  4NDD A;  1M31 A;  2BCA A;  2G2B A;  5CSI A;  1CDN A;  3UNW A;  1CMG A;  1ZOT B;  1JSA A;  1F55 A;  4I5L B;  5FYX A;  2F2P A;  1J7O A;  2P71 A;  1K2H A;  2GV5 A;  1BU3 A;  1KQM B;  5B8I B;  4GGF C;  1AJ4 A;  1S5G Y;  1MXE A;  4HSZ A;  3TZ1 A;  2L5X B;  2LMT A;  1FI6 A;  5PAL A;  1FF1 A;  4CFQ A;  2KI4 B;  3I5I B;  4YRU A;  1TNQ A;  1XA5 A;  3S0D A;  2EC6 B;  4WQ2 A;  1QXP A;  1JC2 A;  2OTG C;  1S36 A;  4FQT A;  1K9P A;  4FTG A;  1PVA A;  2IS9 A;  2OS8 B;  1OQP A;  1LXF C;  3EVV A;  4I5N B;  1OZO A;  5K89 A;  1NWD A;  3CZ1 A;  2KAV A;  2K2F A;  2PQL A;  4MN0 A;  1L7Z A;  2A4J A;  3FWC A;  2JNF A;  1RK9 A;  2EHB A;  1EG3 A;  2I94 A;  1TNW A;  1WRL A;  1YUT A;  1CDP A;  2JC2 A;  3SG3 A;  4F0Z B;  1RJV A;  1YUR A;  3ICB A;  4PAL A;  4QJ5 B;  4F7F A;  3NXA A;  5J3X A;  1QIV A;  4AOM A;  3BUN B;  3VB1 A;  1QJT A;  1S3P A;  1QVI Z;  1TN4 A;  3O6B A;  3VRP A;  5I2O A;  1Y1U A;  1IGV A;  2CCM A;  3D0Y A;  3UO9 A;  1REC A;  2LCP A;  4NDC A;  1OOJ A;  3R1O A;  3C1V A;  1B8C A;  3S0B A;  1NSH A;  3I5F C;  3BOW A;  4N1G A;  2K7O A;  2JNX A;  5D69 A;  2NCO A;  1QX2 A;  3CR4 X;  2WCB A;  2WOS A;  1R2U A;  1JUO A;  2I2R E;  1JBA A;  1XYD A;  1RRO A;  2KLD A;  4AQI A;  2Y1M A;  3M0W A;  1SPY A;  2L98 A;  3O4X A;  1B47 A;  4MSP A;  5AFP A;  2PYQ A;  3LK0 A;  1EJ3 A;  1SR6 B;  2TN4 A;  4PHJ A;  4IL1 A;  1MUX A;  1MF8 B;  1NCX A;  1QX5 B;  1YTZ C;  3K1E A;  4GBA A;  1B1G A;  4YGE B;  1G33 A;  3EVU A;  1IJ5 A;  1K9K A;  1H4B A;  3BUW B;  1D1O A;  3KF9 A;  1OE9 B;  3S0G A;  2LM5 A;  1NX0 A;  4PT1 A;  1B9A A;  1ZMZ A;  2BL0 B;  3FE8 A;  1XVJ A;  2LMU A;  3FWB A;  3HCM A;  2JXC A;  1S5G Z;  4OKH A;  1EG4 A;  3CR2 A;  5FI6 A;  1CTR A;  4A4C A;  2H2K A;  5FI2 A;  1NP8 A;  2JT3 A;  1F71 A;  4CID A;  1MWN A;  1QAS A;  1U5I A;  2R2I A;  3CS1 A;  1KK7 Y;  3CGA A;  3DD4 A;  2H61 C;  4JD9 A;  4USL A;  1CDM A;  2BKH B;  1A75 A;  2JWW A;  5CSF A;  2M29 A;  1DJW A;  1Y1X A;  1CLL A;  2LV7 A;  1PK0 D;  1AHR A;  1G4Y R;  4QJ3 B;  1XFR A;  1QLS A;  1UP5 A;  3LK1 A;  1A29 A;  2V53 A;  3TDU A;  1H8B A;  1NUB A;  1S6C A;  1PSR A;  1IQ3 A;  1IH0 A;  3A8R A;  3PN7 C;  3IVT A;  1KFU L;  2K2A A;  3F45 A;  2LE9 B;  5DKR A;  2LLT A;  1B8L A;  4D1E A;  4OR9 B;  2M1U A;  1TCF A;  1C07 A;  2NXQ A;  2L0P A;  2Y4Q A;  3NSK A;  1Y6W A;  4CPV A;  1HQV A;  1FPW A;  2PMY A;  2WC6 A;  2WCF A;  2WC8 A;  4YI9 A;  2H8V A;  4XYN A;  2KLE A;  2BAP A;  1L2O B;  3CAB A;  1TWO A;  3BUO B;  3EK8 A;  2KQY A;  1ALV A;  2M97 A;  3CZ0 A;  1KK8 C;  3FS7 A;  3O2P A;  1XFW O;  2M7N A;  2KHN A;  1KFX L;  3QME A;  1F54 A;  1OZS A;  2DOQ A;  4XJK B;  2L51 A;  2MRD A;  5I8N A;  1C7V A;  3EK4 A;  1CFF A;  1J1D A;  2I7A A;  2QEB A;  5AXI A;  5EL2 A;  4PCW A;  1SYM A;  1EH2 A;  2LVK A;  4N5X A;  1CB1 A;  3JTD B;  5AEQ A;  3R72 A;  3SS5 A;  1NCZ A;  2HQ8 A;  2LUC A;  5D7F A;  1J7Q A;  1YX8 A;  4C0J A;  1S6J A;  3H4S E;  2CT9 A;  2KI6 C;  2CBL A;  4PE4 A;  4AQJ A;  1WDC B;  2MLE C;  1UUR A;  5HKY A;  1PUL A;  5HLO A;  4MRY A;  2KPH A;  2KQ6 A;  5AAN A;  1OMD A;  3IF7 A;  1IRJ A;  1P28 A;  2I18 A;  4MRX A;  1F8H A;  1V1G A;  2MLF C;  3CWG A;  4P5O E;  2ZNE A;  3CTN A;  1M46 A;  3MSE B;  2QDI A;  4MEW A;  1G8I A;  1OOF A;  3FIA A;  1DJG A;  1F4O A;  4DCK A;  1NX2 A;  2KBM A;  4YI8 A;  3D76 A;  1UHJ A;  1Z4H A;  3PAL A;  3PSR A;  4GNK B;  1XFV O;  2BE6 A;  1DEL A;  2K60 A;  2JPT A;  2O5G A;  4INX A;  3S0A A;  2LLS A;  1NX1 A;  4ORC B;  1C7W A;  3D78 A;  5D3O A;  1A2X A;  1QV0 A;  5KTY A;  1JF0 A;  2KGR A;  2KOT A;  3I5H C;  1XK4 A;  3WXA A;  1IKU A;  1A03 A;  4PHN A;  5ER4 X;  3PM2 A;  4GAO A;  3SG6 A;  1K94 A;  1QWV A;  1IQ5 A;  3OB1 B;  1KWO C;  3DYE A;  1DF0 A;  2Y5I A;  1J7P A;  1SCV A;  2LP2 A;  1TTX A;  3SG7 A;  4CLN A;  1DTL A;  3PM8 A;  5DKN A;  1LA0 A;  2JTZ A;  1DQE A;  3CYZ A;  3S0F A;  1UWO A;  2JZI A;  2HF5 A;  2WCK A;  3B87 A;  1BMO A;  1B7T Z;  1SCM B;  4JPZ B;  3OBV A;  3WHT B; 
#chains in the Genus database with same CATH homology
 4ORB B;  1YUU A;  5HKW A;  3DVM A;  1DF0 B;  1B4C A;  1QAT A;  1ZUZ A;  3OP0 A;  2GGZ A;  5JOL A;  2FCD A;  1SKT A;  1WRZ A;  2JU0 A;  2KFH A;  2AMI A;  1TNX A;  4GPL B;  2E6W A;  2JRF A;  2ZRS A;  1UHK A;  1GQM A;  1QTX A;  4JWQ A;  3NSI A;  2PSR A;  4L9M A;  2AAO A;  3SG2 A;  1CMF A;  3SG5 A;  1L2O C;  4CFR A;  2BBM A;  2LHI A;  1YR5 A;  1BOC A;  2K61 A;  4MVF A;  2B1U A;  2BCX A;  3I5G C;  1CLB A;  3TS5 C;  3TUY C;  3VRQ A;  4YBH B;  1ZAC A;  2HPS A;  1IWQ A;  2HET A;  1FI5 A;  3TDI A;  2Y1N A;  1J7R A;  3SG4 A;  2PVB A;  5HKZ A;  5I2L A;  3JTD C;  4BY4 A;  3JVT C;  4YGC B;  3DVJ A;  1CM4 A;  2LVV A;  4MZL A;  2K7C A;  1R6P A;  1OSA A;  1RTP 1;  5HLV A;  1KQV A;  3WNX B;  4M2Q A;  3KEV A;  1BF5 A;  2ZKM X;  5TNC A;  1IG5 A;  1SK6 D;  1X02 A;  4MLW A;  3WHU B;  3OHM B;  1KQM C;  2CTN A;  2KNE A;  3VRN A;  1AUI B;  1VRK A;  3RLZ A;  1RWY A;  2M49 B;  1BG1 A;  1WLM A;  2OTG B;  2KI4 C;  3I5I C;  1K96 A;  4JQ0 D;  1BJF A;  1M45 A;  1TNP A;  2EC6 C;  2BCB A;  1AP4 A;  3KPX A;  2MBX A;  3OX5 A;  4PE7 A;  3VRO A;  3KO0 A;  2L2E A;  5KSZ A;  2OS8 C;  2ZN9 A;  4ORA B;  4XJK A;  1SL8 A;  1UHN A;  1YVH A;  2ZRT A;  4UPG A;  3BQ3 A;  4MZK A;  4ZCV A;  1N0Y A;  3GK2 A;  4C0L A;  1SBJ A;  1PAL A;  3DVE A;  4WQ3 A;  4YGB B;  2LNK A;  1QIW A;  1DGV A;  1TOP A;  2MHH A;  3LCP C;  5BPJ A;  5HYD A;  1XK4 C;  2BE4 A;  1V1F A;  1YX7 A;  2MAZ A;  2KBI A;  1K8U A;  2KAY A;  1W7I B;  1A4P A;  1SNL A;  1CFP A;  2WCE A;  1QVI Y;  2BBN A;  1QV1 A;  3I5F B;  2BEC A;  2KDH A;  2JOJ A;  1DJX A;  2COL B;  2PAL A;  2Q4U A;  1DJY A;  1BT6 A;  2F3Y A;  2JT0 A;  3D10 A;  2ISD A;  4ETO A;  2KFG A;  3HX4 A;  3GK4 X;  1WY9 A;  4FQO A;  4TNC A;  2NZ0 A;  2G9B A;  1Q80 A;  1ALW A;  2KYF A;  2BKI B;  2D8N A;  5I2Q A;  2F33 A;  3OX6 A;  3BXK A;  5KU1 A;  5G08 A;  1KSM A;  1PRW A;  1PSB A;  1SR6 C;  3PAT A;  3CLN A;  1BLQ A;  2KSP A;  4HRH A;  2LP3 A;  5DKQ A;  1SW8 A;  2NLN A;  2LAP A;  1B8R A;  2PAS A;  1SY9 A;  1ZFS A;  2FJU B;  3EVR A;  3DF0 B;  1QX7 A;  2MA2 A;  1SL7 A;  2HQW A;  1LVC D;  1SRA A;  2K0J A;  3PFV A;  2O60 A;  1BR1 B;  1AVS A;  1E8A A;  2BL0 C;  2LVJ A;  4OV2 A;  4PHK A;  4YGD B;  2FCE A;  1KK7 Z;  2LAN A;  2M7L A;  1IJ6 A;  1XFX O;  1YRU B;  1S6I A;  1W7J B;  2E30 A;  2Q91 A;  2SAS A;  1LKJ A;  1NIW A;  3SIB A;  3GK1 A;  3NSO A;  1DJZ A;  3DVK A;  1JF2 A;  1ODB A;  3K21 A;  2LLU A;  1QLK A;  2LC5 A;  3PN7 B;  4GFT A;  1UHH A;  2WND A;  4U8D A;  2MJW B;  1OMV A;  1WRK A;  4QJ4 B;  4HRG A;  1DGU A;  2QPT A;  1KCY A;  1BR4 B;  2JT8 A;  1K95 A;  1M63 B;  1KK8 B;  5CSJ A;  1YRT B;  5AER A;  3KHE A;  5GQQ C;  1FW4 A;  1SMG A;  3GOF A;  1YVL A;  3AKA A;  4BY5 A;  1CM1 A;  3SJS A;  2KAX A;  1K90 D;  1MHO A;  1LIN A;  3A4U B;  3IQO A;  1M39 A;  4PE1 A;  5ER5 A;  1OMR A;  3LLE A;  2PRU A;  4GGF A;  5CPV A;  1DMO A;  1F70 A;  2RGI A;  4PE0 A;  1AK8 A;  1MR8 A;  4C0K A;  3O78 A;  1WLZ A;  2ZND A;  1YUS A;  3LL8 B;  4M2O A;  3AAJ A;  1JWD A;  2JXL A;  3AKB A;  1WDC C;  4MZJ A;  4M2P A;  3EKH A;  4OCI A;  3D0Y B;  3IQQ A;  3BYA A;  4NQG A;  3VRR A;  1HT9 A;  1KSO A;  2LVI A;  2KGB C;  1CFC A;  4DIR A;  1TIZ A;  1DVI A;  2M0R A;  4P2Y B;  4WRI A;  3BOW B;  1JFK A;  2M3W A;  1K93 D;  1CDL A;  1UHI A;  2JTT A;  2AUC A;  4GUK A;  2JQ6 A;  1CKK A;  3O4Y A;  2ZFD A;  1J1E A;  1XO5 A;  1CLM A;  2F2O A;  3I5H B;  1BOD A;  2LMV A;  2OPO A;  1GJY A;  2L4H A;  4DS7 A;  3TDZ A;  1N65 A;  1FBV A;  2CXJ A;  1EXR A;  2KFF A;  3CR5 X;  2P6B B;  4I5K A;  5IBW A;  1RFJ A;  1AJ5 A;  1KWO B;  1SL9 A;  2SCP A;  2VRG A;  1MXL C;  1XFY O;  3BUM B;  3QRX A;  1NX3 A;  1XFU O;  3ZNI A;  4N1F A;  1J55 A;  2M1K B;  1S1E A;  2EGD A;  4HRE E;  4PHM A;  3OB2 B;  1CNP A;  2LHL A;  3E3R A;  1DJI A;  2GGM A;  3AAK A;  3NSL A;  1JFJ A;  1GGW A;  4OVN F;  1N2D A;  2NCP A;  1SCM C;  1NCY A;  1B7T Y;  1S26 D;  1TRF A;  3PLF B;  2K8M B;  4R1E A;  4DUQ A;  1NPQ A;  1U5I B;  1KFU S;  1XFZ O;  2K7D A;  4A4B A;  1K9U A;  4I5J A;  1NYA A;  4PDZ A;  1TCO B;  1A75 B;  2WOR A;  1QS7 A;  2FOT A;  2K7B A;  4E68 A;  2M8U A;  3VGO A;  2QAC A;  1PVB A;  5F6T A;  3SIA A;  1LA3 A;  1Y0V H;  2JUL A;  1CFD A;  2KYC A;  4DRW A;  2L50 A;  2KI6 D;  1F4Q A;  1GGZ A;  4YGA A;  1KFX S;  1UUS A;  3I5G B;  3DF0 A;  3TS5 B;  3TUY B;  2F3Z A;  2CNP A;  3BUX B;  4ZCU A;  4ICB A;  3ZWH A;  4NDB A;  1MQ1 A;  1DJH A;  5JJG A;  4MBE A;  3RM1 A;  1DT7 B;  3CZT X;  2L4I A;  3EKJ A;  1Y1A A;  2H61 A;  2LUX A;  3JVT B;  4Q04 A;  2F8P A;  3EK7 A;  1EL4 A;  2ZN8 A;  5CSN A;  2M9G A;  4GGN A;  4NDD A;  1M31 A;  2BCA A;  2G2B A;  5CSI A;  1CDN A;  1CMG A;  1JSA A;  1ZOT B;  1F55 A;  4I5L B;  5FYX A;  2F2P A;  1J7O A;  1K2H A;  2GV5 A;  1BU3 A;  1KQM B;  5B8I B;  4GGF C;  1AJ4 A;  1S5G Y;  1MXE A;  4HSZ A;  3TZ1 A;  2L5X B;  2LMT A;  1FI6 A;  5PAL A;  1FF1 A;  4CFQ A;  2KI4 B;  3I5I B;  4YRU A;  1TNQ A;  1XA5 A;  2EC6 B;  4WQ2 A;  1QXP A;  1JC2 A;  2OTG C;  1S36 A;  1K9P A;  4FTG A;  1PVA A;  2IS9 A;  2OS8 B;  1OQP A;  1LXF C;  3EVV A;  4I5N B;  1OZO A;  5K89 A;  1NWD A;  2KAV A;  2K2F A;  4MN0 A;  1L7Z A;  2A4J A;  3FWC A;  2JNF A;  1RK9 A;  2EHB A;  1EG3 A;  2I94 A;  1TNW A;  1WRL A;  1YUT A;  1CDP A;  2JC2 A;  3SG3 A;  4F0Z B;  1RJV A;  1YUR A;  3ICB A;  4PAL A;  4QJ5 B;  3NXA A;  5J3X A;  1QIV A;  4AOM A;  3BUN B;  1QJT A;  1S3P A;  1QVI Z;  1TN4 A;  3O6B A;  3VRP A;  5I2O A;  1Y1U A;  1IGV A;  2CCM A;  3D0Y A;  1REC A;  2LCP A;  4NDC A;  1OOJ A;  3C1V A;  1B8C A;  1NSH A;  3I5F C;  3BOW A;  4N1G A;  2K7O A;  2JNX A;  5D69 A;  2NCO A;  1QX2 A;  3CR4 X;  2WCB A;  2WOS A;  1R2U A;  1JUO A;  2I2R E;  1JBA A;  1XYD A;  1RRO A;  4AQI A;  2Y1M A;  3M0W A;  1SPY A;  2L98 A;  1B47 A;  4MSP A;  5AFP A;  3LK0 A;  1EJ3 A;  1SR6 B;  2TN4 A;  4PHJ A;  4IL1 A;  1MUX A;  1MF8 B;  1NCX A;  1QX5 B;  1YTZ C;  4GBA A;  1B1G A;  4YGE B;  1G33 A;  3EVU A;  1IJ5 A;  1K9K A;  1H4B A;  3BUW B;  1D1O A;  3KF9 A;  1OE9 B;  2LM5 A;  1NX0 A;  1B9A A;  1ZMZ A;  2BL0 B;  1XVJ A;  2LMU A;  3FWB A;  3HCM A;  2JXC A;  1S5G Z;  4OKH A;  1EG4 A;  3CR2 A;  4A4C A;  1CTR A;  2H2K A;  1NP8 A;  2JT3 A;  1F71 A;  4CID A;  1MWN A;  1QAS A;  1U5I A;  2R2I A;  3CS1 A;  1KK7 Y;  3CGA A;  3DD4 A;  2H61 C;  4USL A;  1CDM A;  2BKH B;  1A75 A;  2JWW A;  5CSF A;  2M29 A;  1DJW A;  1Y1X A;  1CLL A;  2LV7 A;  1PK0 D;  1AHR A;  1G4Y R;  4QJ3 B;  1QLS A;  1UP5 A;  3LK1 A;  1A29 A;  2V53 A;  3TDU A;  1H8B A;  1NUB A;  1S6C A;  1PSR A;  1IQ3 A;  1IH0 A;  3A8R A;  3PN7 C;  1KFU L;  2K2A A;  3F45 A;  2LE9 B;  5DKR A;  2LLT A;  1B8L A;  4D1E A;  4OR9 B;  2M1U A;  1TCF A;  1C07 A;  2NXQ A;  2L0P A;  2Y4Q A;  3NSK A;  1Y6W A;  4CPV A;  1HQV A;  1FPW A;  2PMY A;  2WCF A;  2WC8 A;  4YI9 A;  4XYN A;  1L2O B;  3EK8 A;  3BUO B;  2KQY A;  1ALV A;  2M97 A;  3FS7 A;  1KK8 C;  3O2P A;  1XFW O;  2M7N A;  2KHN A;  1KFX L;  1F54 A;  1OZS A;  2DOQ A;  4XJK B;  2L51 A;  2MRD A;  5I8N A;  1C7V A;  3EK4 A;  1CFF A;  1J1D A;  2I7A A;  5AXI A;  4PCW A;  1SYM A;  1EH2 A;  2LVK A;  4N5X A;  1CB1 A;  3JTD B;  5AEQ A;  1NCZ A;  2HQ8 A;  2LUC A;  5D7F A;  1J7Q A;  1YX8 A;  4C0J A;  1S6J A;  3H4S E;  2CT9 A;  2KI6 C;  2CBL A;  4PE4 A;  4AQJ A;  1WDC B;  2MLE C;  1UUR A;  5HKY A;  1PUL A;  5HLO A;  4MRY A;  2KQ6 A;  5AAN A;  1OMD A;  3IF7 A;  1IRJ A;  2I18 A;  4MRX A;  1F8H A;  1V1G A;  2MLF C;  3CWG A;  4P5O E;  2ZNE A;  3CTN A;  1M46 A;  3MSE B;  4MEW A;  1G8I A;  3FIA A;  1DJG A;  1F4O A;  4DCK A;  1NX2 A;  2KBM A;  4YI8 A;  3PSR A;  1UHJ A;  3PAL A;  4GNK B;  1XFV O;  2BE6 A;  2O5G A;  2JPT A;  2LLS A;  1NX1 A;  4ORC B;  1C7W A;  1A2X A;  1QV0 A;  5KTY A;  1JF0 A;  2KGR A;  2KOT A;  3I5H C;  1XK4 A;  3WXA A;  1IKU A;  1A03 A;  4PHN A;  5ER4 X;  4GAO A;  3SG6 A;  1K94 A;  1IQ5 A;  3OB1 B;  1KWO C;  1DF0 A;  2Y5I A;  1J7P A;  1SCV A;  2LP2 A;  1TTX A;  3SG7 A;  4CLN A;  1DTL A;  3PM8 A;  5DKN A;  1LA0 A;  2JTZ A;  1UWO A;  2JZI A;  2HF5 A;  1BMO A;  1B7T Z;  1SCM B;  4JPZ B;  3WHT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...