5JJGA

Structure of magnesium-loaded alg-2
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
168
structure length
168
Chain Sequence
DQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pcalcium-binding protein ALG-2, rogrammed cell death protein
publication title EF5 Is the High-Affinity Mg(2+) Site in ALG-2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 63
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2016-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5jjgA00
2EC6B 1PVBA 2PASA 2F3ZA 1NCXA 1IQ5A 5TNCA 1B7TZ 1WLZA 2LVIA 1MF8B 2WCBA 1F70A 2LAPA 3KO0A 3IF7A 1XFZO 2WC8A 1DJXA 2BL0B 3CS1A 3PN7B 4PHNA 3RM1A 1CMGA 2D8NA 2TN4A 2F33A 1KQMC 3I5IC 3DVKA 2JTTA 2CXJA 5HLOA 1Y1AA 2L0PA 3EVUA 1GQMA 4CFRA 1UHKA 1WRZA 1KFXS 2KAYA 3PALA 2K7OA 1FF1A 5CPVA 1BT6A 1NP8A 2NCPA 3JTDB 2WNDA 3OX5A 5CSFA 4GGNA 1XO5A 1S6JA 2V53A 2L98A 1A29A 1DF0A 3VRQA 2LLSA 1DJYA 1UWOA 1YUSA 3OP0A 1KQVA 2F3YA 2M29A 1L7ZA 4WRIA 2LVKA 1OOJA 1TOPA 3CZTX 1NX2A 2KYFA 4DRWA 2SASA 4OKHA 1LA0A 1B1GA 1NCYA 1S36A 2K7CA 3D10A 2F2OA 3SG4A 1OMRA 3PFVA 2ISDA 4GGFA 1CFPA 2JXLA 1N65A 2M1KB 1DMOA 4MRXA 5IBWA 4UPGA 2BCXA 1N2DA 1SKTA 2CT9A 5HKZA 1DF0B 1UHIA 2P6BB 4ORBB 2L5XB 2OPOA 2WCFA 3I5FB 3ICBA 1J7PA 4MBEA 1EXRA 2FOTA 3NXAA 1CFCA 2KI4C 2LP2A 2COLB 5I2OA 3DD4A 1QX5B 1RTP1 4HRGA 5JJGA 1GGZA 3AAKA 1ZFSA 1JC2A 1OZOA 1QTXA 1ZACA 2AMIA 3VRNA 4PHJA 1PK0D 1YUUA 3SG2A 4MN0A 1IRJA 1SCMB 1OMVA 2LLTA 1A75A 2JRFA 1QASA 1TRFA 2PSRA 4WQ3A 1A03A 4AOMA 2PMYA 2BCAA 1M39A 1SCVA 1UHHA 4HREE 1XFUO 2HETA 1K93D 1H4BA 4BY4A 4C0JA 3EKHA 1QS7A 1JFJA 2KDHA 5PALA 2KGBC 1JUOA 2NZ0A 2FCEA 1SR6C 1RK9A 1AJ4A 2H2KA 2LLUA 3TS5B 3SJSA 2LVVA 2JPTA 1EG3A 1W7IB 2OTGC 3I5HC 2KAXA 4M2QA 2M7LA 1ZUZA 3EVRA 3E3RA 2BBMA 1QLSA 2EGDA 1BG1A 4BY5A 1PULA 4XJKA 3AAJA 1OSAA 3HX4A 3BOWA 2ZFDA 2QACA 1RECA 1QV1A 1V1FA 2MAZA 3OHMB 1K95A 2Y1MA 1KK8C 3CR2A 4DUQA 1DT7B 1OQPA 3KEVA 4I5NB 3I5GC 5CSJA 1WLMA 2PRUA 3O78A 2CTNA 1J1DA 1SL9A 3FWCA 1CDNA 4GUKA 1G8IA 1YRUB 1KSMA 3CR4X 4PHKA 1D1OA 1FI6A 2AAOA 1TNQA 3MSEB 1NWDA 4XJKB 4A4BA 3O2PA 4P5OE 2ZN9A 1C7WA 2JC2A 2LE9B 2ZRSA 1GGWA 2HQWA 2KQ6A 1XFYO 3I5IB 3IQQA 2WOSA 2M97A 2E6WA 3TDIA 1CB1A 1PSBA 4CLNA 1MXEA 3TUYB 4GBAA 1BR1B 4U8DA 2LANA 1MQ1A 1UHJA 5BPJA 2ZRTA 2LUXA 2Q91A 2MLEC 3OB2B 3WXAA 1QXPA 3EK8A 3SIAA 3TDZA 5HKYA 1BJFA 1OZSA 2KI6C 4DIRA 1J55A 1S5GZ 2KQYA 3LK0A 4GPLB 2BCBA 3LLEA 4AQJA 1FBVA 1G33A 1Y0VH 4PE7A 5DKNA 1KWOC 3NSOA 5HLVA 1CLBA 4M2PA 1G4YR 1R6PA 4MZJA 3BXKA 4JPZB 2MBXA 2LHLA 3LCPC 2K7BA 1SL7A 1BR4B 2KYCA 2I18A 3BUXB 2K7DA 1EG4A 5ER4X 1YURA 3HCMA 1CTRA 3SG7A 2Y4QA 5I2LA 1IH0A 1V1GA 1F54A 3LL8B 1PVAA 1B7TY 3M0WA 1BU3A 1WDCB 1BF5A 1JSAA 1IQ3A 1RFJA 1QVIZ 1BLQA 4AQIA 1J7OA 2NXQA 3TDUA 2L4HA 4GNKB 2EC6C 5J3XA 2K2FA 2JNFA 2M0RA 2ZNEA 3EK7A 4P2YB 1JF0A 5CSNA 1EL4A 4IL1A 2Y5IA 2M8UA 5JOLA 1TTXA 4YI8A 2KGRA 2BL0C 1ZMZA 1WY9A 3BUWB 3BYAA 2IS9A 3PN7C 4PCWA 5D7FA 1Y1UA 1KK7Z 1W7JB 2GV5A 1NUBA 4R1EA 4YRUA 4FQOA 1XK4A 2KHNA 2FCDA 4DCKA 2K61A 4I5LB 4OVNF 3BQ3A 2R2IA 1DJZA 2KI6D 3CLNA 4FTGA 5FYXA 2G9BA 2JNXA 1BOCA 1B8RA 1UHNA 2F8PA 1QVIY 1YX8A 2PVBA 1S6IA 2GGMA 2JZIA 1CDPA 3WHTB 3ZNIA 3SG6A 1TN4A 3I5HB 3SG3A 1AUIB 1CDMA 1SMGA 2K8MB 1MWNA 2O60A 3VGOA 1RROA 1QJTA 2B1UA 5B8IB 2JT3A 4QJ4B 2BBNA 2L51A 2BECA 2KOTA 1SW8A 1U5IA 2K2AA 1EH2A 1KK8B 4I5JA 3KPXA 5DKRA 3D0YA 5AFPA 2M1UA 1SK6D 2JULA 3A8RA 3EK4A 1B8LA 1KFUL 2MJWB 2CNPA 4N5XA 1A75B 4PHMA 3CR5X 1VRKA 2K0JA 1L2OC 1KFUS 1RWYA 4M2OA 1NYAA 2JWWA 1M45A 1FPWA 2L50A 2KBMA 2OS8C 3CTNA 4QJ5B 4OR9B 1XFXO 1WRKA 3WNXB 3PATA 1U5IB 2L4IA 3D0YB 2GGZA 1B9AA 4GGFC 5I2QA 4YGCB 1NPQA 1XFWO 3BUNB 4C0KA 2M7NA 1YVLA 1HT9A 1YR5A 3OB1B 3NSKA 4ETOA 2M9GA 4NDCA 3FWBA 2O5GA 2BKIB 3BOWB 3CGAA 1KQMB 1JBAA 2F2PA 2H61C 2JXCA 2LM5A 3PLFB 5ER5A 1F71A 1IJ5A 1TCFA 3PSRA 1F8HA 1KWOB 1NCZA 2AUCA 5DKQA 1YVHA 1AVSA 2LHIA 1N0YA 1A2XA 1IJ6A 2Y1NA 4GAOA 1PALA 1RJVA 1UUSA 2DOQA 1LKJA 1Q80A 1K2HA 1K9PA 2G2BA 2Q4UA 1CMFA 1CLLA 5HKWA 1OMDA 2NCOA 5D69A 4ORCB 1JFKA 1K90D 2SCPA 4MVFA 1OE9B 1CFDA 3GK4X 1AJ5A 1DJWA 3JVTC 1NIWA 1F55A 5GQQC 2I7AA 1C7VA 3OX6A 4DS7A 1K94A 1IWQA 1SL8A 1F4OA 1DJHA 1YRTB 2BKHB 1CFFA 1GJYA 1QX7A 4ICBA 3VRPA 1UURA 3IQOA 5I8NA 1B4CA 5G08A 1CDLA 1TNXA 4YGDB 4JWQA 2FJUB 3EKJA 3KHEA 1ODBA 2RGIA 1KCYA 2KFHA 1NX3A 1S1EA 2L2EA 4YI9A 1YTZC 2A4JA 4N1FA 3VROA 3RLZA 1XA5A 2LVJA 1DTLA 3KF9A 1QIWA 3CWGA 3QRXA 1KFXL 3TUYC 1K9UA 2LMVA 4CFQA 2KI4B 1JF2A 1SYMA 1KSOA 1J1EA 1IG5A 4NDBA 1S5GY 1MUXA 1CLMA 2ZNDA 1CM4A 1F4QA 4CPVA 4HRHA 1ZOTB 1S6CA 2KFFA 3DVMA 1YUTA 4NDDA 2KAVA 3A4UB 1IGVA 3F45A 3AKAA 5KU1A 4ORAB 1SRAA 4YGBB 1FI5A 2MLFC 1LXFC 3C1VA 1YX7A 1UP5A 4JQ0D 2BE4A 2HQ8A 2JTZA 2JQ6A 1JWDA 2CBLA 2MRDA 3ZWHA 2HF5A 4A4CA 1NX0A 1QATA 4PDZA 1TIZA 2WORA 5F6TA 3JTDC 1EJ3A 1IKUA 1TCOB 1SR6B 1J7RA 1QV0A 1R2UA 4GFTA 4OV2A 1SY9A 2JT0A 1QX2A 2OTGB 3PM8A 1LINA 1WDCC 1L2OB 2WCEA 2JU0A 3FS7A 4YGAA 4MRYA 3GK2A 1NSHA 3K21A 4USLA 1LVCD 2E30A 4XYNA 5HYDA 1XYDA 2KFGA 4HSZA 1AK8A 2JT8A 2OS8B 3DVEA 1MHOA 1MXLC 2HPSA 1AP4A 1KK7Y 5AANA 2LV7A 2VRGA 2H61A 3NSLA 1C07A 1PRWA 2KSPA 1S26D 3I5GB 3NSIA 1DVIA 4CIDA 1K9KA 2ZN8A 1B47A 1CNPA 2I94A 5KSZA 1PSRA 2LMUA 4QJ3B 2LUCA 1DGVA 2QPTA 4TNCA 1LA3A 4OCIA 4MLWA 2I2RE 1BMOA 1AHRA 3O4YA 3I5FC 2LC5A 4YBHB 2LCPA 1X02A 2JOJA 3FIAA 1SPYA 1MR8A 1XFVO 1S3PA 1SBJA 1Y1XA 3GOFA 4D1EA 1B8CA 5AXIA 2ZKMX 1QIVA 3VRRA 1CM1A 4Q04A 2LNKA 2CCMA 1Y6WA 1DJGA 1M31A 2MA2A 3WHUB 4I5KA 1SCMC 4E68A 3EVVA 1ALVA 1J7QA 4F0ZB 1BODA 4ZCVA 1XK4C 4L9MA 4PALA 1FW4A 3SIBA 2LMTA 1M46A 1QLKA 4WQ2A 2EHBA 1CKKA 1A4PA 1TNPA 2KNEA 2PALA 4YGEB 4ZCUA 1TNWA 4NQGA 4MEWA 1ALWA 2LP3A 3JVTB 3SG5A 3DF0A 3BUOB 4MZKA 4MSPA 3H4SE 4PE4A 4PE0A 2MHHA 3TS5C 1M63B 2KBIA 1WRLA 5KTYA 2NLNA 2M3WA 1HQVA 3BUMB 4PE1A 4C0LA 1K96A 1DJIA 3AKBA 1H8BA 1SNLA 5K89A 1NX1A 2M49B 3DVJA 4N1GA 1E8AA 1XVJA 5CSIA 4MZLA 5AEQA 5AERA 3LK1A 3DF0B 1DGUA 3TZ1A 3GK1A 3O6BA 1K8UA 2BE6A
chains in the Genus database with same CATH superfamily
2EC6B 1PVBA 2PASA 3UO9A 2F3ZA 5FI7A 1OOHA 1NCXA 1IQ5A 5TNCA 1B7TZ 1WLZA 2GTEA 2QEHA 2LVIA 1MF8B 2WCBA 3D74A 1F70A 2LAPA 3KO0A 1C3ZA 3IF7A 1XFZO 1Z2CB 2WC8A 1DJXA 2WC5A 2BL0B 3CS1A 3PN7B 4PHNA 3RM1A 1CMGA 2D8NA 2TN4A 2F33A 1KQMC 3EG5B 3I5IC 3DVKA 5I94A 2WCLA 2JTTA 2CXJA 5HLOA 1Y1AA 2L0PA 3EVUA 1GQMA 4CFRA 1UHKA 1WRZA 1KFXS 2KAYA 3PALA 2K7OA 1FF1A 5CPVA 1BT6A 1NP8A 2NCPA 2WCKA 2WNDA 3JTDB 3OX5A 5CSFA 4GGNA 2PQLA 1XO5A 1S6JA 2V53A 2L98A 1A29A 1DF0A 3K1EA 3VRQA 1C3YA 2LLSA 1DJYA 1UWOA 1YUSA 3OP0A 1KQVA 1TUJA 2F3YA 2M29A 3RZSA 1L7ZA 4WRIA 2LVKA 1OOJA 1TOPA 3CZTX 1CFCA 1NX2A 3B86A 2KYFA 4DRWA 2SASA 4OKHA 1LA0A 1B1GA 1NCYA 1S36A 2K7CA 3D10A 2F2OA 3SG4A 3R72A 3CZ2A 1OMRA 3DY9A 3PFVA 3VB1A 2ISDA 4GGFA 1CFPA 2JXLA 1N65A 2M1KB 3L47A 1DMOA 4MRXA 5IBWA 3O4XA 4UPGA 2BCXA 3R1PA 1N2DA 1SKTA 2CT9A 5HKZA 1DF0B 1UHIA 2P6BB 4ORBB 2L5XB 2OPOA 2WCFA 3I5FB 3ICBA 1J7PA 4MBEA 1EXRA 2FOTA 3NXAA 5FI6A 2KI4C 2LP2A 2COLB 2WCMA 5I2OA 3DD4A 1QX5B 1RTP1 4HRGA 5JJGA 1GGZA 3AAKA 1ZFSA 1JC2A 1OZOA 1QTXA 1ZACA 2AMIA 1DQEA 2ERBA 3NHIA 3VRNA 4PHJA 1PK0D 1YUUA 1T14A 4MN0A 1IRJA 1SCMB 1OMVA 2LLTA 3PM2A 1A75A 2JRFA 3S0EA 1QASA 1TRFA 2PSRA 4WQ3A 1A03A 4AOMA 2PMYA 1M39A 1SCVA 1UHHA 2BCAA 3CZ0A 4HREE 1XFUO 3IVTA 2HETA 2BNXA 1K93D 1H4BA 3SS3A 4BY4A 4C0JA 3EKHA 1QS7A 1JFJA 2KDHA 5PALA 2KGBC 1JUOA 2NZ0A 2FCEA 2QEVA 1SR6C 1RK9A 1AJ4A 2H2KA 2LLUA 3TS5B 3SJSA 2QDIA 2LVVA 2JPTA 1EG3A 1QWVA 1W7IB 2OTGC 2KAXA 3I5HC 4M2QA 2M7LA 1ZUZA 1DELA 3EVRA 3E3RA 2WCJA 2BBMA 1QLSA 2EGDA 1BG1A 4BY5A 1PULA 4XJKA 3AAJA 1OSAA 3HX4A 3BOWA 2ZFDA 2QACA 3NGVA 1RECA 1QV1A 1V1FA 2MAZA 3OHMB 1K95A 2Y1MA 1KK8C 3CR2A 4DUQA 1DT7B 1OQPA 3KEVA 4I5NB 3I5GC 5CSJA 1WLMA 2L5YA 3OBVA 2PRUA 3O78A 2CTNA 1J1DA 1SL9A 3FWCA 3S0AA 1CDNA 4GUKA 1G8IA 1YRUB 1KSMA 3CR4X 4PHKA 1D1OA 1FI6A 4KYNA 2AAOA 1TNQA 3MSEB 1NWDA 4XJKB 4A4BA 3O2PA 4P5OE 2ZN9A 1C7WA 2JC2A 5DICA 2LE9B 2ZRSA 1GGWA 2HQWA 1OOFA 1XFYO 2KQ6A 3I5IB 2WOSA 2M97A 2E6WA 3IQQA 3TDIA 1PSBA 1CB1A 4CLNA 1MXEA 3TUYB 4GBAA 1BR1B 4U8DA 3UNWA 2LANA 1MQ1A 1UHJA 5BPJA 2ZRTA 2LUXA 2Q91A 1ORGA 2MLEC 3OB2B 3SS5A 3WXAA 2WCHA 1QXPA 3EK8A 3SIAA 2QEOA 3TDZA 5HKYA 1BJFA 1OZSA 2KI6C 4DIRA 1J55A 1S5GZ 4INXA 2KQYA 3LK0A 4GPLB 3OGNA 2BCBA 3B7AA 3LLEA 3B88A 3L4LA 4AQJA 1G33A 1FBVA 1Y0VH 3R1VA 4PE7A 5DKNA 1KWOC 3NSOA 5HLVA 1CLBA 4M2PA 1G4YR 1R6PA 4MZJA 3BXKA 4JPZB 2MBXA 2LHLA 2JPOA 3LCPC 2K7BA 1SL7A 1BR4B 2KYCA 2I18A 2KLDA 3BUXB 2K7DA 1EG4A 5ER4X 1YURA 3HCMA 1CTRA 3SG7A 2Y4QA 5I2LA 1IH0A 1V1GA 1F54A 3LL8B 1PVAA 1B7TY 3D77A 3M0WA 4PT1A 1BU3A 1WDCB 3QMEA 1BF5A 1JSAA 1IQ3A 1RFJA 1QVIZ 1BLQA 4AQIA 1J7OA 2NXQA 3TDUA 2L4HA 4GNKB 2EC6C 5J3XA 2K2FA 2JNFA 2M0RA 2ZNEA 3EK7A 4IJ7A 4P2YB 1JF0A 5CSNA 1EL4A 4IL1A 3SG2A 2Y5IA 2M8UA 5JOLA 1TTXA 1DEKA 4YI8A 2KGRA 2BL0C 1ZMZA 1WY9A 3BUWB 3BYAA 2IS9A 3PN7C 3DYEA 1TUZA 4PCWA 5D7FA 1Y1UA 1KK7Z 2BAPA 1W7JB 2GV5A 1NUBA 4R1EA 4YRUA 4FQOA 1XK4A 2KHNA 1DC1A 2FCDA 4DCKA 3S0FA 2K61A 4I5LB 4OVNF 3BQ3A 2R2IA 1DJZA 3D75A 2KI6D 3BFHA 3CLNA 4FTGA 5FYXA 1P28A 3FE6A 2G9BA 1SSEB 2JNXA 5HL1A 5EL2A 1BOCA 1B8RA 1UHNA 2F8PA 1QVIY 1YX8A 2PVBA 1S6IA 2GGMA 2JZIA 1CDPA 3WHTB 3ZNIA 3SG6A 1TN4A 3I5HB 3SG3A 1AUIB 1CDMA 1SMGA 2K8MB 1MWNA 2O60A 3VGOA 1RROA 1QJTA 2B1UA 5B8IB 2JT3A 4QJ4B 2BBNA 2L51A 2BECA 2KOTA 1SW8A 1U5IA 2K2AA 1EH2A 1KK8B 4I5JA 3KPXA 5DKRA 3D0YA 3SS4A 4JKTA 2M1UA 1SK6D 3DXLA 5D3OA 5AFPA 1Z4HA 2JULA 3A8RA 3DZTA 1B8LA 3EK4A 1KFUL 2MJWB 2CNPA 4N5XA 1A75B 4PHMA 3CR5X 1VRKA 3N7HA 2K0JA 1L2OC 1KFUS 1RWYA 4M2OA 1NYAA 2JWWA 1M45A 1FPWA 2QEBA 2L50A 2KBMA 2OS8C 3CTNA 4QJ5B 4OR9B 1XFXO 1WRKA 3WNXB 3S0DA 3PATA 1U5IB 3S0GA 2L4IA 3D0YB 2GGZA 1B9AA 3CYZA 4GGFC 2WC6A 5I2QA 4JD9A 1OOIX 4YGCB 1NPQA 1OW4A 1XFRA 1XFWO 3BUNB 4C0KA 2M7NA 1YVLA 1HT9A 3B87A 3BJHA 1YR5A 2K60A 3OB1B 3NSKA 3PJIA 4ETOA 2M9GA 4NDCA 3FWBA 2O5GA 2BKIB 3BOWB 3CGAA 1KQMB 1TWOA 1JBAA 2F2PA 2FJYA 2H61C 2JXCA 2LM5A 3PLFB 5ER5A 1F71A 1IJ5A 1TCFA 3PSRA 1F8HA 1KWOB 1NCZA 5FI2A 2AUCA 5DKQA 1YVHA 1AVSA 2LHIA 1N0YA 1A2XA 1IJ6A 2Y1NA 4GAOA 1PALA 1RJVA 1UUSA 2DOQA 1LKJA 1Q80A 1K2HA 1K9PA 2G2BA 2Q4UA 1CMFA 1CLLA 3CABA 1OMDA 2NCOA 5D69A 5HKWA 2P71A 4ORCB 1JFKA 1K90D 2SCPA 4MVFA 1OE9B 1CFDA 3GK4X 1AJ5A 1DJWA 3JVTC 1NIWA 1F55A 5GQQC 2I7AA 1C7VA 3OX6A 4DS7A 1K94A 1IWQA 1SL8A 3B6XA 1F4OA 1DJHA 1YRTB 2BKHB 1CFFA 1GJYA 1QX7A 4ICBA 3VRPA 1UURA 3IQOA 5I8NA 1B4CA 5G08A 1CDLA 1TNXA 3BFBA 4YGDB 4JWQA 2FJUB 2PYQA 3EKJA 3KHEA 1ODBA 2RGIA 1KCYA 2KFHA 1NX3A 1S1EA 2L2EA 4YI9A 1YTZC 2A4JA 2YGUA 4N1FA 3RLZA 3VROA 1XA5A 2LVJA 1DTLA 3KF9A 1QIWA 3CWGA 3QRXA 1KFXL 3TUYC 1K9UA 2LMVA 4CFQA 2KI4B 1JF2A 3D78A 1SYMA 3CZ1A 1KSOA 1J1EA 1IG5A 2KLEA 3R1OA 4NDBA 1S5GY 1MUXA 1CLMA 2ZNDA 1CM4A 1F4QA 3CDNA 4CPVA 4HRHA 1ZOTB 1S6CA 2KFFA 3DVMA 1YUTA 4NDDA 3FE8A 2KAVA 3A4UB 1IGVA 2H8VA 3F45A 3AKAA 5KU1A 4ORAB 3BFAA 3FE9A 1GM0A 1SRAA 4YGBB 1FI5A 2MLFC 1LXFC 3C1VA 1YX7A 1UP5A 4JQ0D 2BE4A 2HQ8A 2JTZA 2JQ6A 2L2CA 1JWDA 2CBLA 2MRDA 3ZWHA 2HF5A 4A4CA 1NX0A 1QATA 4PDZA 3L4AA 1TIZA 2WORA 5F6TA 3JTDC 1EJ3A 1IKUA 1TCOB 1SR6B 1J7RA 1QV0A 1R2UA 4GFTA 4OV2A 1SY9A 2JT0A 1QX2A 2OTGB 3PM8A 1LINA 1WDCC 1L2OB 2WCEA 2JU0A 2KPHA 3FS7A 4MRYA 4YGAA 3GK2A 1NSHA 3K21A 4USLA 1LVCD 2E30A 4XYNA 5HYDA 1XYDA 2KFGA 4HSZA 1AK8A 2JT8A 2OS8B 3DVEA 1MHOA 1MXLC 2HPSA 1AP4A 1KK7Y 5AANA 2LV7A 2VRGA 2H61A 3NSLA 1C07A 1PRWA 2KSPA 1S26D 3I5GB 3NSIA 1DVIA 4CIDA 1K9KA 1OOGA 1B47A 2ZN8A 2I94A 5KSZA 1PSRA 2LMUA 1CNPA 4QJ3B 2LUCA 1DGVA 2QPTA 4TNCA 1LA3A 4OCIA 4MLWA 2I2RE 1BMOA 1AHRA 3O4YA 3I5FC 3D73A 2LC5A 3D76A 4YBHB 2LCPA 1X02A 2JOJA 3S0BA 3FIAA 1SPYA 1MR8A 1XFVO 1S3PA 1SBJA 1Y1XA 3GOFA 4D1EA 1B8CA 5AXIA 2ZKMX 1QIVA 3VRRA 1CM1A 4Q04A 2LNKA 3Q8IA 2CCMA 1Y6WA 1DJGA 1M31A 2MA2A 1W9ZA 3WHUB 4I5KA 1SCMC 4E68A 3EVVA 1ALVA 4INWA 1J7QA 2P70A 4F0ZB 1BODA 4ZCVA 1XK4C 4L9MA 4PALA 1FW4A 3SIBA 2LMTA 1M46A 1QLKA 4WQ2A 2EHBA 1CKKA 1A4PA 1TNPA 2KNEA 2PALA 3V2LA 4YGEB 4ZCUA 1TNWA 4NQGA 4MEWA 1ALWA 2LP3A 3JVTB 3SG5A 3DF0A 3BUOB 4MZKA 4MSPA 3H4SE 4PE4A 4PE0A 2MHHA 3TS5C 1M63B 3NHTA 2KBIA 1WRLA 5KTYA 2NLNA 2M3WA 1HQVA 3BUMB 4PE1A 4F7FA 4FQTA 4C0LA 1K96A 1DJIA 3AKBA 1H8BA 1SNLA 5K89A 1LS8A 1NX1A 2M49B 3DVJA 4OZDA 4N1GA 1E8AA 1XVJA 5CSIA 4MZLA 5AEQA 5AERA 3LK1A 3DF0B 1DGUA 3TZ1A 3GK1A 3O6BA 1K8UA 2BE6A 1IIOA
chains in the Genus database with same CATH topology
2EC6B 1PVBA 2PASA 2F3ZA 1NCXA 1IQ5A 5TNCA 1B7TZ 1WLZA 2LVIA 1MF8B 2WCBA 1F70A 2LAPA 3KO0A 3IF7A 1XFZO 2WC8A 1DJXA 2BL0B 3CS1A 3PN7B 4PHNA 3RM1A 1CMGA 2D8NA 2TN4A 2F33A 1KQMC 3I5IC 3DVKA 2JTTA 2CXJA 5HLOA 1Y1AA 2L0PA 3EVUA 1GQMA 4CFRA 1UHKA 1WRZA 1KFXS 2KAYA 3PALA 2K7OA 1FF1A 5CPVA 1BT6A 1NP8A 2NCPA 3JTDB 2WNDA 3OX5A 5CSFA 4GGNA 1XO5A 1S6JA 2V53A 2L98A 1A29A 1DF0A 3VRQA 2LLSA 1DJYA 1UWOA 1YUSA 3OP0A 1KQVA 2F3YA 2M29A 1L7ZA 4WRIA 2LVKA 1OOJA 1TOPA 3CZTX 1NX2A 2KYFA 4DRWA 2SASA 4OKHA 1LA0A 1B1GA 1NCYA 1S36A 2K7CA 3D10A 2F2OA 3SG4A 1OMRA 3PFVA 2ISDA 4GGFA 1CFPA 2JXLA 1N65A 2M1KB 1DMOA 4MRXA 5IBWA 4UPGA 2BCXA 1N2DA 1SKTA 2CT9A 5HKZA 1DF0B 1UHIA 2P6BB 4ORBB 2L5XB 2OPOA 2WCFA 3I5FB 3ICBA 1J7PA 4MBEA 1EXRA 2FOTA 3NXAA 1CFCA 2KI4C 2LP2A 2COLB 5I2OA 3DD4A 1QX5B 1RTP1 4HRGA 5JJGA 1GGZA 3AAKA 1ZFSA 1JC2A 1OZOA 1QTXA 1ZACA 2AMIA 3VRNA 4PHJA 1PK0D 1YUUA 3SG2A 4MN0A 1IRJA 1SCMB 1OMVA 2LLTA 1A75A 2JRFA 1QASA 1TRFA 2PSRA 4WQ3A 1A03A 4AOMA 2PMYA 2BCAA 1M39A 1SCVA 1UHHA 4HREE 1XFUO 2HETA 1K93D 1H4BA 4BY4A 4C0JA 3EKHA 1QS7A 1JFJA 2KDHA 5PALA 2KGBC 1JUOA 2NZ0A 2FCEA 1SR6C 1RK9A 1AJ4A 2H2KA 2LLUA 3TS5B 3SJSA 2LVVA 2JPTA 1EG3A 1W7IB 2OTGC 3I5HC 2KAXA 4M2QA 2M7LA 1ZUZA 3EVRA 3E3RA 2BBMA 1QLSA 2EGDA 1BG1A 4BY5A 1PULA 4XJKA 3AAJA 1OSAA 3HX4A 3BOWA 2ZFDA 2QACA 1RECA 1QV1A 1V1FA 2MAZA 3OHMB 1K95A 2Y1MA 1KK8C 3CR2A 4DUQA 1DT7B 1OQPA 3KEVA 4I5NB 3I5GC 5CSJA 1WLMA 2PRUA 3O78A 2CTNA 1J1DA 1SL9A 3FWCA 1CDNA 4GUKA 1G8IA 1YRUB 1KSMA 3CR4X 4PHKA 1D1OA 1FI6A 2AAOA 1TNQA 3MSEB 1NWDA 4XJKB 4A4BA 3O2PA 4P5OE 2ZN9A 1C7WA 2JC2A 2LE9B 2ZRSA 1GGWA 2HQWA 2KQ6A 1XFYO 3I5IB 3IQQA 2WOSA 2M97A 2E6WA 3TDIA 1CB1A 1PSBA 4CLNA 1MXEA 3TUYB 4GBAA 1BR1B 4U8DA 2LANA 1MQ1A 1UHJA 5BPJA 2ZRTA 2LUXA 2Q91A 2MLEC 3OB2B 3WXAA 1QXPA 3EK8A 3SIAA 3TDZA 5HKYA 1BJFA 1OZSA 2KI6C 4DIRA 1J55A 1S5GZ 2KQYA 3LK0A 4GPLB 2BCBA 3LLEA 4AQJA 1FBVA 1G33A 1Y0VH 4PE7A 5DKNA 1KWOC 3NSOA 5HLVA 1CLBA 4M2PA 1G4YR 1R6PA 4MZJA 3BXKA 4JPZB 2MBXA 2LHLA 3LCPC 2K7BA 1SL7A 1BR4B 2KYCA 2I18A 3BUXB 2K7DA 1EG4A 5ER4X 1YURA 3HCMA 1CTRA 3SG7A 2Y4QA 5I2LA 1IH0A 1V1GA 1F54A 3LL8B 1PVAA 1B7TY 3M0WA 1BU3A 1WDCB 1BF5A 1JSAA 1IQ3A 1RFJA 1QVIZ 1BLQA 4AQIA 1J7OA 2NXQA 3TDUA 2L4HA 4GNKB 2EC6C 5J3XA 2K2FA 2JNFA 2M0RA 2ZNEA 3EK7A 4P2YB 1JF0A 5CSNA 1EL4A 4IL1A 2Y5IA 2M8UA 5JOLA 1TTXA 4YI8A 2KGRA 2BL0C 1ZMZA 1WY9A 3BUWB 3BYAA 2IS9A 3PN7C 4PCWA 5D7FA 1Y1UA 1KK7Z 1W7JB 2GV5A 1NUBA 4R1EA 4YRUA 4FQOA 1XK4A 2KHNA 2FCDA 4DCKA 2K61A 4I5LB 4OVNF 3BQ3A 2R2IA 1DJZA 2KI6D 3CLNA 4FTGA 5FYXA 2G9BA 2JNXA 1BOCA 1B8RA 1UHNA 2F8PA 1QVIY 1YX8A 2PVBA 1S6IA 2GGMA 2JZIA 1CDPA 3WHTB 3ZNIA 3SG6A 1TN4A 3I5HB 3SG3A 1AUIB 1CDMA 1SMGA 2K8MB 1MWNA 2O60A 3VGOA 1RROA 1QJTA 2B1UA 5B8IB 2JT3A 4QJ4B 2BBNA 2L51A 2BECA 2KOTA 1SW8A 1U5IA 2K2AA 1EH2A 1KK8B 4I5JA 3KPXA 5DKRA 3D0YA 5AFPA 2M1UA 1SK6D 2JULA 3A8RA 3EK4A 1B8LA 1KFUL 2MJWB 2CNPA 4N5XA 1A75B 4PHMA 3CR5X 1VRKA 2K0JA 1L2OC 1KFUS 1RWYA 4M2OA 1NYAA 2JWWA 1M45A 1FPWA 2L50A 2KBMA 2OS8C 3CTNA 4QJ5B 4OR9B 1XFXO 1WRKA 3WNXB 3PATA 1U5IB 2L4IA 3D0YB 2GGZA 1B9AA 4GGFC 5I2QA 4YGCB 1NPQA 1XFWO 3BUNB 4C0KA 2M7NA 1YVLA 1HT9A 1YR5A 3OB1B 3NSKA 4ETOA 2M9GA 4NDCA 3FWBA 2O5GA 2BKIB 3BOWB 3CGAA 1KQMB 1JBAA 2F2PA 2H61C 2JXCA 2LM5A 3PLFB 5ER5A 1F71A 1IJ5A 1TCFA 3PSRA 1F8HA 1KWOB 1NCZA 2AUCA 5DKQA 1YVHA 1AVSA 2LHIA 1N0YA 1A2XA 1IJ6A 2Y1NA 4GAOA 1PALA 1RJVA 1UUSA 2DOQA 1LKJA 1Q80A 1K2HA 1K9PA 2G2BA 2Q4UA 1CMFA 1CLLA 5HKWA 1OMDA 2NCOA 5D69A 4ORCB 1JFKA 1K90D 2SCPA 4MVFA 1OE9B 1CFDA 3GK4X 1AJ5A 1DJWA 3JVTC 1NIWA 1F55A 5GQQC 2I7AA 1C7VA 3OX6A 4DS7A 1K94A 1IWQA 1SL8A 1F4OA 1DJHA 1YRTB 2BKHB 1CFFA 1GJYA 1QX7A 4ICBA 3VRPA 1UURA 3IQOA 5I8NA 1B4CA 5G08A 1CDLA 1TNXA 4YGDB 4JWQA 2FJUB 3EKJA 3KHEA 1ODBA 2RGIA 1KCYA 2KFHA 1NX3A 1S1EA 2L2EA 4YI9A 1YTZC 2A4JA 4N1FA 3VROA 3RLZA 1XA5A 2LVJA 1DTLA 3KF9A 1QIWA 3CWGA 3QRXA 1KFXL 3TUYC 1K9UA 2LMVA 4CFQA 2KI4B 1JF2A 1SYMA 1KSOA 1J1EA 1IG5A 4NDBA 1S5GY 1MUXA 1CLMA 2ZNDA 1CM4A 1F4QA 4CPVA 4HRHA 1ZOTB 1S6CA 2KFFA 3DVMA 1YUTA 4NDDA 2KAVA 3A4UB 1IGVA 3F45A 3AKAA 5KU1A 4ORAB 1SRAA 4YGBB 1FI5A 2MLFC 1LXFC 3C1VA 1YX7A 1UP5A 4JQ0D 2BE4A 2HQ8A 2JTZA 2JQ6A 1JWDA 2CBLA 2MRDA 3ZWHA 2HF5A 4A4CA 1NX0A 1QATA 4PDZA 1TIZA 2WORA 5F6TA 3JTDC 1EJ3A 1IKUA 1TCOB 1SR6B 1J7RA 1QV0A 1R2UA 4GFTA 4OV2A 1SY9A 2JT0A 1QX2A 2OTGB 3PM8A 1LINA 1WDCC 1L2OB 2WCEA 2JU0A 3FS7A 4YGAA 4MRYA 3GK2A 1NSHA 3K21A 4USLA 1LVCD 2E30A 4XYNA 5HYDA 1XYDA 2KFGA 4HSZA 1AK8A 2JT8A 2OS8B 3DVEA 1MHOA 1MXLC 2HPSA 1AP4A 1KK7Y 5AANA 2LV7A 2VRGA 2H61A 3NSLA 1C07A 1PRWA 2KSPA 1S26D 3I5GB 3NSIA 1DVIA 4CIDA 1K9KA 2ZN8A 1B47A 1CNPA 2I94A 5KSZA 1PSRA 2LMUA 4QJ3B 2LUCA 1DGVA 2QPTA 4TNCA 1LA3A 4OCIA 4MLWA 2I2RE 1BMOA 1AHRA 3O4YA 3I5FC 2LC5A 4YBHB 2LCPA 1X02A 2JOJA 3FIAA 1SPYA 1MR8A 1XFVO 1S3PA 1SBJA 1Y1XA 3GOFA 4D1EA 1B8CA 5AXIA 2ZKMX 1QIVA 3VRRA 1CM1A 4Q04A 2LNKA 2CCMA 1Y6WA 1DJGA 1M31A 2MA2A 3WHUB 4I5KA 1SCMC 4E68A 3EVVA 1ALVA 1J7QA 4F0ZB 1BODA 4ZCVA 1XK4C 4L9MA 4PALA 1FW4A 3SIBA 2LMTA 1M46A 1QLKA 4WQ2A 2EHBA 1CKKA 1A4PA 1TNPA 2KNEA 2PALA 4YGEB 4ZCUA 1TNWA 4NQGA 4MEWA 1ALWA 2LP3A 3JVTB 3SG5A 3DF0A 3BUOB 4MZKA 4MSPA 3H4SE 4PE4A 4PE0A 2MHHA 3TS5C 1M63B 2KBIA 1WRLA 5KTYA 2NLNA 2M3WA 1HQVA 3BUMB 4PE1A 4C0LA 1K96A 1DJIA 3AKBA 1H8BA 1SNLA 5K89A 1NX1A 2M49B 3DVJA 4N1GA 1E8AA 1XVJA 5CSIA 4MZLA 5AEQA 5AERA 3LK1A 3DF0B 1DGUA 3TZ1A 3GK1A 3O6BA 1K8UA 2BE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC6 B;  1PVB A;  2PAS A;  2F3Z A;  1NCX A;  1IQ5 A;  5TNC A;  1B7T Z;  1WLZ A;  2LVI A;  1MF8 B;  2WCB A;  1F70 A;  2LAP A;  3KO0 A;  3IF7 A;  1XFZ O;  2WC8 A;  1DJX A;  2BL0 B;  3CS1 A;  3PN7 B;  4PHN A;  3RM1 A;  1CMG A;  2D8N A;  2TN4 A;  2F33 A;  1KQM C;  3I5I C;  3DVK A;  2JTT A;  2CXJ A;  5HLO A;  1Y1A A;  2L0P A;  3EVU A;  1GQM A;  4CFR A;  1UHK A;  1WRZ A;  1KFX S;  2KAY A;  3PAL A;  2K7O A;  1FF1 A;  5CPV A;  1BT6 A;  1NP8 A;  2NCP A;  3JTD B;  2WND A;  3OX5 A;  5CSF A;  4GGN A;  1XO5 A;  1S6J A;  2V53 A;  2L98 A;  1A29 A;  1DF0 A;  3VRQ A;  2LLS A;  1DJY A;  1UWO A;  1YUS A;  3OP0 A;  1KQV A;  2F3Y A;  2M29 A;  1L7Z A;  4WRI A;  2LVK A;  1OOJ A;  1TOP A;  3CZT X;  1NX2 A;  2KYF A;  4DRW A;  2SAS A;  4OKH A;  1LA0 A;  1B1G A;  1NCY A;  1S36 A;  2K7C A;  3D10 A;  2F2O A;  3SG4 A;  1OMR A;  3PFV A;  2ISD A;  4GGF A;  1CFP A;  2JXL A;  1N65 A;  2M1K B;  1DMO A;  4MRX A;  5IBW A;  4UPG A;  2BCX A;  1N2D A;  1SKT A;  2CT9 A;  5HKZ A;  1DF0 B;  1UHI A;  2P6B B;  4ORB B;  2L5X B;  2OPO A;  2WCF A;  3I5F B;  3ICB A;  1J7P A;  4MBE A;  1EXR A;  2FOT A;  3NXA A;  1CFC A;  2KI4 C;  2LP2 A;  2COL B;  5I2O A;  3DD4 A;  1QX5 B;  1RTP 1;  4HRG A;  5JJG A;  1GGZ A;  3AAK A;  1ZFS A;  1JC2 A;  1OZO A;  1QTX A;  1ZAC A;  2AMI A;  3VRN A;  4PHJ A;  1PK0 D;  1YUU A;  3SG2 A;  4MN0 A;  1IRJ A;  1SCM B;  1OMV A;  2LLT A;  1A75 A;  2JRF A;  1QAS A;  1TRF A;  2PSR A;  4WQ3 A;  1A03 A;  4AOM A;  2PMY A;  2BCA A;  1M39 A;  1SCV A;  1UHH A;  4HRE E;  1XFU O;  2HET A;  1K93 D;  1H4B A;  4BY4 A;  4C0J A;  3EKH A;  1QS7 A;  1JFJ A;  2KDH A;  5PAL A;  2KGB C;  1JUO A;  2NZ0 A;  2FCE A;  1SR6 C;  1RK9 A;  1AJ4 A;  2H2K A;  2LLU A;  3TS5 B;  3SJS A;  2LVV A;  2JPT A;  1EG3 A;  1W7I B;  2OTG C;  3I5H C;  2KAX A;  4M2Q A;  2M7L A;  1ZUZ A;  3EVR A;  3E3R A;  2BBM A;  1QLS A;  2EGD A;  1BG1 A;  4BY5 A;  1PUL A;  4XJK A;  3AAJ A;  1OSA A;  3HX4 A;  3BOW A;  2ZFD A;  2QAC A;  1REC A;  1QV1 A;  1V1F A;  2MAZ A;  3OHM B;  1K95 A;  2Y1M A;  1KK8 C;  3CR2 A;  4DUQ A;  1DT7 B;  1OQP A;  3KEV A;  4I5N B;  3I5G C;  5CSJ A;  1WLM A;  2PRU A;  3O78 A;  2CTN A;  1J1D A;  1SL9 A;  3FWC A;  1CDN A;  4GUK A;  1G8I A;  1YRU B;  1KSM A;  3CR4 X;  4PHK A;  1D1O A;  1FI6 A;  2AAO A;  1TNQ A;  3MSE B;  1NWD A;  4XJK B;  4A4B A;  3O2P A;  4P5O E;  2ZN9 A;  1C7W A;  2JC2 A;  2LE9 B;  2ZRS A;  1GGW A;  2HQW A;  2KQ6 A;  1XFY O;  3I5I B;  3IQQ A;  2WOS A;  2M97 A;  2E6W A;  3TDI A;  1CB1 A;  1PSB A;  4CLN A;  1MXE A;  3TUY B;  4GBA A;  1BR1 B;  4U8D A;  2LAN A;  1MQ1 A;  1UHJ A;  5BPJ A;  2ZRT A;  2LUX A;  2Q91 A;  2MLE C;  3OB2 B;  3WXA A;  1QXP A;  3EK8 A;  3SIA A;  3TDZ A;  5HKY A;  1BJF A;  1OZS A;  2KI6 C;  4DIR A;  1J55 A;  1S5G Z;  2KQY A;  3LK0 A;  4GPL B;  2BCB A;  3LLE A;  4AQJ A;  1FBV A;  1G33 A;  1Y0V H;  4PE7 A;  5DKN A;  1KWO C;  3NSO A;  5HLV A;  1CLB A;  4M2P A;  1G4Y R;  1R6P A;  4MZJ A;  3BXK A;  4JPZ B;  2MBX A;  2LHL A;  3LCP C;  2K7B A;  1SL7 A;  1BR4 B;  2KYC A;  2I18 A;  3BUX B;  2K7D A;  1EG4 A;  5ER4 X;  1YUR A;  3HCM A;  1CTR A;  3SG7 A;  2Y4Q A;  5I2L A;  1IH0 A;  1V1G A;  1F54 A;  3LL8 B;  1PVA A;  1B7T Y;  3M0W A;  1BU3 A;  1WDC B;  1BF5 A;  1JSA A;  1IQ3 A;  1RFJ A;  1QVI Z;  1BLQ A;  4AQI A;  1J7O A;  2NXQ A;  3TDU A;  2L4H A;  4GNK B;  2EC6 C;  5J3X A;  2K2F A;  2JNF A;  2M0R A;  2ZNE A;  3EK7 A;  4P2Y B;  1JF0 A;  5CSN A;  1EL4 A;  4IL1 A;  2Y5I A;  2M8U A;  5JOL A;  1TTX A;  4YI8 A;  2KGR A;  2BL0 C;  1ZMZ A;  1WY9 A;  3BUW B;  3BYA A;  2IS9 A;  3PN7 C;  4PCW A;  5D7F A;  1Y1U A;  1KK7 Z;  1W7J B;  2GV5 A;  1NUB A;  4R1E A;  4YRU A;  4FQO A;  1XK4 A;  2KHN A;  2FCD A;  4DCK A;  2K61 A;  4I5L B;  4OVN F;  3BQ3 A;  2R2I A;  1DJZ A;  2KI6 D;  3CLN A;  4FTG A;  5FYX A;  2G9B A;  2JNX A;  1BOC A;  1B8R A;  1UHN A;  2F8P A;  1QVI Y;  1YX8 A;  2PVB A;  1S6I A;  2GGM A;  2JZI A;  1CDP A;  3WHT B;  3ZNI A;  3SG6 A;  1TN4 A;  3I5H B;  3SG3 A;  1AUI B;  1CDM A;  1SMG A;  2K8M B;  1MWN A;  2O60 A;  3VGO A;  1RRO A;  1QJT A;  2B1U A;  5B8I B;  2JT3 A;  4QJ4 B;  2BBN A;  2L51 A;  2BEC A;  2KOT A;  1SW8 A;  1U5I A;  2K2A A;  1EH2 A;  1KK8 B;  4I5J A;  3KPX A;  5DKR A;  3D0Y A;  5AFP A;  2M1U A;  1SK6 D;  2JUL A;  3A8R A;  3EK4 A;  1B8L A;  1KFU L;  2MJW B;  2CNP A;  4N5X A;  1A75 B;  4PHM A;  3CR5 X;  1VRK A;  2K0J A;  1L2O C;  1KFU S;  1RWY A;  4M2O A;  1NYA A;  2JWW A;  1M45 A;  1FPW A;  2L50 A;  2KBM A;  2OS8 C;  3CTN A;  4QJ5 B;  4OR9 B;  1XFX O;  1WRK A;  3WNX B;  3PAT A;  1U5I B;  2L4I A;  3D0Y B;  2GGZ A;  1B9A A;  4GGF C;  5I2Q A;  4YGC B;  1NPQ A;  1XFW O;  3BUN B;  4C0K A;  2M7N A;  1YVL A;  1HT9 A;  1YR5 A;  3OB1 B;  3NSK A;  4ETO A;  2M9G A;  4NDC A;  3FWB A;  2O5G A;  2BKI B;  3BOW B;  3CGA A;  1KQM B;  1JBA A;  2F2P A;  2H61 C;  2JXC A;  2LM5 A;  3PLF B;  5ER5 A;  1F71 A;  1IJ5 A;  1TCF A;  3PSR A;  1F8H A;  1KWO B;  1NCZ A;  2AUC A;  5DKQ A;  1YVH A;  1AVS A;  2LHI A;  1N0Y A;  1A2X A;  1IJ6 A;  2Y1N A;  4GAO A;  1PAL A;  1RJV A;  1UUS A;  2DOQ A;  1LKJ A;  1Q80 A;  1K2H A;  1K9P A;  2G2B A;  2Q4U A;  1CMF A;  1CLL A;  5HKW A;  1OMD A;  2NCO A;  5D69 A;  4ORC B;  1JFK A;  1K90 D;  2SCP A;  4MVF A;  1OE9 B;  1CFD A;  3GK4 X;  1AJ5 A;  1DJW A;  3JVT C;  1NIW A;  1F55 A;  5GQQ C;  2I7A A;  1C7V A;  3OX6 A;  4DS7 A;  1K94 A;  1IWQ A;  1SL8 A;  1F4O A;  1DJH A;  1YRT B;  2BKH B;  1CFF A;  1GJY A;  1QX7 A;  4ICB A;  3VRP A;  1UUR A;  3IQO A;  5I8N A;  1B4C A;  5G08 A;  1CDL A;  1TNX A;  4YGD B;  4JWQ A;  2FJU B;  3EKJ A;  3KHE A;  1ODB A;  2RGI A;  1KCY A;  2KFH A;  1NX3 A;  1S1E A;  2L2E A;  4YI9 A;  1YTZ C;  2A4J A;  4N1F A;  3VRO A;  3RLZ A;  1XA5 A;  2LVJ A;  1DTL A;  3KF9 A;  1QIW A;  3CWG A;  3QRX A;  1KFX L;  3TUY C;  1K9U A;  2LMV A;  4CFQ A;  2KI4 B;  1JF2 A;  1SYM A;  1KSO A;  1J1E A;  1IG5 A;  4NDB A;  1S5G Y;  1MUX A;  1CLM A;  2ZND A;  1CM4 A;  1F4Q A;  4CPV A;  4HRH A;  1ZOT B;  1S6C A;  2KFF A;  3DVM A;  1YUT A;  4NDD A;  2KAV A;  3A4U B;  1IGV A;  3F45 A;  3AKA A;  5KU1 A;  4ORA B;  1SRA A;  4YGB B;  1FI5 A;  2MLF C;  1LXF C;  3C1V A;  1YX7 A;  1UP5 A;  4JQ0 D;  2BE4 A;  2HQ8 A;  2JTZ A;  2JQ6 A;  1JWD A;  2CBL A;  2MRD A;  3ZWH A;  2HF5 A;  4A4C A;  1NX0 A;  1QAT A;  4PDZ A;  1TIZ A;  2WOR A;  5F6T A;  3JTD C;  1EJ3 A;  1IKU A;  1TCO B;  1SR6 B;  1J7R A;  1QV0 A;  1R2U A;  4GFT A;  4OV2 A;  1SY9 A;  2JT0 A;  1QX2 A;  2OTG B;  3PM8 A;  1LIN A;  1WDC C;  1L2O B;  2WCE A;  2JU0 A;  3FS7 A;  4YGA A;  4MRY A;  3GK2 A;  1NSH A;  3K21 A;  4USL A;  1LVC D;  2E30 A;  4XYN A;  5HYD A;  1XYD A;  2KFG A;  4HSZ A;  1AK8 A;  2JT8 A;  2OS8 B;  3DVE A;  1MHO A;  1MXL C;  2HPS A;  1AP4 A;  1KK7 Y;  5AAN A;  2LV7 A;  2VRG A;  2H61 A;  3NSL A;  1C07 A;  1PRW A;  2KSP A;  1S26 D;  3I5G B;  3NSI A;  1DVI A;  4CID A;  1K9K A;  2ZN8 A;  1B47 A;  1CNP A;  2I94 A;  5KSZ A;  1PSR A;  2LMU A;  4QJ3 B;  2LUC A;  1DGV A;  2QPT A;  4TNC A;  1LA3 A;  4OCI A;  4MLW A;  2I2R E;  1BMO A;  1AHR A;  3O4Y A;  3I5F C;  2LC5 A;  4YBH B;  2LCP A;  1X02 A;  2JOJ A;  3FIA A;  1SPY A;  1MR8 A;  1XFV O;  1S3P A;  1SBJ A;  1Y1X A;  3GOF A;  4D1E A;  1B8C A;  5AXI A;  2ZKM X;  1QIV A;  3VRR A;  1CM1 A;  4Q04 A;  2LNK A;  2CCM A;  1Y6W A;  1DJG A;  1M31 A;  2MA2 A;  3WHU B;  4I5K A;  1SCM C;  4E68 A;  3EVV A;  1ALV A;  1J7Q A;  4F0Z B;  1BOD A;  4ZCV A;  1XK4 C;  4L9M A;  4PAL A;  1FW4 A;  3SIB A;  2LMT A;  1M46 A;  1QLK A;  4WQ2 A;  2EHB A;  1CKK A;  1A4P A;  1TNP A;  2KNE A;  2PAL A;  4YGE B;  4ZCU A;  1TNW A;  4NQG A;  4MEW A;  1ALW A;  2LP3 A;  3JVT B;  3SG5 A;  3DF0 A;  3BUO B;  4MZK A;  4MSP A;  3H4S E;  4PE4 A;  4PE0 A;  2MHH A;  3TS5 C;  1M63 B;  2KBI A;  1WRL A;  5KTY A;  2NLN A;  2M3W A;  1HQV A;  3BUM B;  4PE1 A;  4C0L A;  1K96 A;  1DJI A;  3AKB A;  1H8B A;  1SNL A;  5K89 A;  1NX1 A;  2M49 B;  3DVJ A;  4N1G A;  1E8A A;  1XVJ A;  5CSI A;  4MZL A;  5AEQ A;  5AER A;  3LK1 A;  3DF0 B;  1DGU A;  3TZ1 A;  3GK1 A;  3O6B A;  1K8U A;  2BE6 A; 
#chains in the Genus database with same CATH topology
 2EC6 B;  1PVB A;  2PAS A;  3UO9 A;  2F3Z A;  5FI7 A;  1OOH A;  1NCX A;  1IQ5 A;  5TNC A;  1B7T Z;  1WLZ A;  2GTE A;  2QEH A;  2LVI A;  1MF8 B;  2WCB A;  3D74 A;  1F70 A;  2LAP A;  3KO0 A;  1C3Z A;  3IF7 A;  1XFZ O;  1Z2C B;  2WC8 A;  1DJX A;  2WC5 A;  2BL0 B;  3CS1 A;  3PN7 B;  4PHN A;  3RM1 A;  1CMG A;  2D8N A;  2TN4 A;  2F33 A;  1KQM C;  3EG5 B;  3I5I C;  3DVK A;  5I94 A;  2WCL A;  2JTT A;  2CXJ A;  5HLO A;  1Y1A A;  2L0P A;  3EVU A;  1GQM A;  4CFR A;  1UHK A;  1WRZ A;  1KFX S;  2KAY A;  3PAL A;  2K7O A;  1FF1 A;  5CPV A;  1BT6 A;  1NP8 A;  2NCP A;  2WCK A;  2WND A;  3JTD B;  3OX5 A;  5CSF A;  4GGN A;  2PQL A;  1XO5 A;  1S6J A;  2V53 A;  2L98 A;  1A29 A;  1DF0 A;  3K1E A;  3VRQ A;  1C3Y A;  2LLS A;  1DJY A;  1UWO A;  1YUS A;  3OP0 A;  1KQV A;  1TUJ A;  2F3Y A;  2M29 A;  3RZS A;  1L7Z A;  4WRI A;  2LVK A;  1OOJ A;  1TOP A;  3CZT X;  1CFC A;  1NX2 A;  3B86 A;  2KYF A;  4DRW A;  2SAS A;  4OKH A;  1LA0 A;  1B1G A;  1NCY A;  1S36 A;  2K7C A;  3D10 A;  2F2O A;  3SG4 A;  3R72 A;  3CZ2 A;  1OMR A;  3DY9 A;  3PFV A;  3VB1 A;  2ISD A;  4GGF A;  1CFP A;  2JXL A;  1N65 A;  2M1K B;  3L47 A;  1DMO A;  4MRX A;  5IBW A;  3O4X A;  4UPG A;  2BCX A;  3R1P A;  1N2D A;  1SKT A;  2CT9 A;  5HKZ A;  1DF0 B;  1UHI A;  2P6B B;  4ORB B;  2L5X B;  2OPO A;  2WCF A;  3I5F B;  3ICB A;  1J7P A;  4MBE A;  1EXR A;  2FOT A;  3NXA A;  5FI6 A;  2KI4 C;  2LP2 A;  2COL B;  2WCM A;  5I2O A;  3DD4 A;  1QX5 B;  1RTP 1;  4HRG A;  5JJG A;  1GGZ A;  3AAK A;  1ZFS A;  1JC2 A;  1OZO A;  1QTX A;  1ZAC A;  2AMI A;  1DQE A;  2ERB A;  3NHI A;  3VRN A;  4PHJ A;  1PK0 D;  1YUU A;  1T14 A;  4MN0 A;  1IRJ A;  1SCM B;  1OMV A;  2LLT A;  3PM2 A;  1A75 A;  2JRF A;  3S0E A;  1QAS A;  1TRF A;  2PSR A;  4WQ3 A;  1A03 A;  4AOM A;  2PMY A;  1M39 A;  1SCV A;  1UHH A;  2BCA A;  3CZ0 A;  4HRE E;  1XFU O;  3IVT A;  2HET A;  2BNX A;  1K93 D;  1H4B A;  3SS3 A;  4BY4 A;  4C0J A;  3EKH A;  1QS7 A;  1JFJ A;  2KDH A;  5PAL A;  2KGB C;  1JUO A;  2NZ0 A;  2FCE A;  2QEV A;  1SR6 C;  1RK9 A;  1AJ4 A;  2H2K A;  2LLU A;  3TS5 B;  3SJS A;  2QDI A;  2LVV A;  2JPT A;  1EG3 A;  1QWV A;  1W7I B;  2OTG C;  2KAX A;  3I5H C;  4M2Q A;  2M7L A;  1ZUZ A;  1DEL A;  3EVR A;  3E3R A;  2WCJ A;  2BBM A;  1QLS A;  2EGD A;  1BG1 A;  4BY5 A;  1PUL A;  4XJK A;  3AAJ A;  1OSA A;  3HX4 A;  3BOW A;  2ZFD A;  2QAC A;  3NGV A;  1REC A;  1QV1 A;  1V1F A;  2MAZ A;  3OHM B;  1K95 A;  2Y1M A;  1KK8 C;  3CR2 A;  4DUQ A;  1DT7 B;  1OQP A;  3KEV A;  4I5N B;  3I5G C;  5CSJ A;  1WLM A;  2L5Y A;  3OBV A;  2PRU A;  3O78 A;  2CTN A;  1J1D A;  1SL9 A;  3FWC A;  3S0A A;  1CDN A;  4GUK A;  1G8I A;  1YRU B;  1KSM A;  3CR4 X;  4PHK A;  1D1O A;  1FI6 A;  4KYN A;  2AAO A;  1TNQ A;  3MSE B;  1NWD A;  4XJK B;  4A4B A;  3O2P A;  4P5O E;  2ZN9 A;  1C7W A;  2JC2 A;  5DIC A;  2LE9 B;  2ZRS A;  1GGW A;  2HQW A;  1OOF A;  1XFY O;  2KQ6 A;  3I5I B;  2WOS A;  2M97 A;  2E6W A;  3IQQ A;  3TDI A;  1PSB A;  1CB1 A;  4CLN A;  1MXE A;  3TUY B;  4GBA A;  1BR1 B;  4U8D A;  3UNW A;  2LAN A;  1MQ1 A;  1UHJ A;  5BPJ A;  2ZRT A;  2LUX A;  2Q91 A;  1ORG A;  2MLE C;  3OB2 B;  3SS5 A;  3WXA A;  2WCH A;  1QXP A;  3EK8 A;  3SIA A;  2QEO A;  3TDZ A;  5HKY A;  1BJF A;  1OZS A;  2KI6 C;  4DIR A;  1J55 A;  1S5G Z;  4INX A;  2KQY A;  3LK0 A;  4GPL B;  3OGN A;  2BCB A;  3B7A A;  3LLE A;  3B88 A;  3L4L A;  4AQJ A;  1G33 A;  1FBV A;  1Y0V H;  3R1V A;  4PE7 A;  5DKN A;  1KWO C;  3NSO A;  5HLV A;  1CLB A;  4M2P A;  1G4Y R;  1R6P A;  4MZJ A;  3BXK A;  4JPZ B;  2MBX A;  2LHL A;  2JPO A;  3LCP C;  2K7B A;  1SL7 A;  1BR4 B;  2KYC A;  2I18 A;  2KLD A;  3BUX B;  2K7D A;  1EG4 A;  5ER4 X;  1YUR A;  3HCM A;  1CTR A;  3SG7 A;  2Y4Q A;  5I2L A;  1IH0 A;  1V1G A;  1F54 A;  3LL8 B;  1PVA A;  1B7T Y;  3D77 A;  3M0W A;  4PT1 A;  1BU3 A;  1WDC B;  3QME A;  1BF5 A;  1JSA A;  1IQ3 A;  1RFJ A;  1QVI Z;  1BLQ A;  4AQI A;  1J7O A;  2NXQ A;  3TDU A;  2L4H A;  4GNK B;  2EC6 C;  5J3X A;  2K2F A;  2JNF A;  2M0R A;  2ZNE A;  3EK7 A;  4IJ7 A;  4P2Y B;  1JF0 A;  5CSN A;  1EL4 A;  4IL1 A;  3SG2 A;  2Y5I A;  2M8U A;  5JOL A;  1TTX A;  1DEK A;  4YI8 A;  2KGR A;  2BL0 C;  1ZMZ A;  1WY9 A;  3BUW B;  3BYA A;  2IS9 A;  3PN7 C;  3DYE A;  1TUZ A;  4PCW A;  5D7F A;  1Y1U A;  1KK7 Z;  2BAP A;  1W7J B;  2GV5 A;  1NUB A;  4R1E A;  4YRU A;  4FQO A;  1XK4 A;  2KHN A;  1DC1 A;  2FCD A;  4DCK A;  3S0F A;  2K61 A;  4I5L B;  4OVN F;  3BQ3 A;  2R2I A;  1DJZ A;  3D75 A;  2KI6 D;  3BFH A;  3CLN A;  4FTG A;  5FYX A;  1P28 A;  3FE6 A;  2G9B A;  1SSE B;  2JNX A;  5HL1 A;  5EL2 A;  1BOC A;  1B8R A;  1UHN A;  2F8P A;  1QVI Y;  1YX8 A;  2PVB A;  1S6I A;  2GGM A;  2JZI A;  1CDP A;  3WHT B;  3ZNI A;  3SG6 A;  1TN4 A;  3I5H B;  3SG3 A;  1AUI B;  1CDM A;  1SMG A;  2K8M B;  1MWN A;  2O60 A;  3VGO A;  1RRO A;  1QJT A;  2B1U A;  5B8I B;  2JT3 A;  4QJ4 B;  2BBN A;  2L51 A;  2BEC A;  2KOT A;  1SW8 A;  1U5I A;  2K2A A;  1EH2 A;  1KK8 B;  4I5J A;  3KPX A;  5DKR A;  3D0Y A;  3SS4 A;  4JKT A;  2M1U A;  1SK6 D;  3DXL A;  5D3O A;  5AFP A;  1Z4H A;  2JUL A;  3A8R A;  3DZT A;  1B8L A;  3EK4 A;  1KFU L;  2MJW B;  2CNP A;  4N5X A;  1A75 B;  4PHM A;  3CR5 X;  1VRK A;  3N7H A;  2K0J A;  1L2O C;  1KFU S;  1RWY A;  4M2O A;  1NYA A;  2JWW A;  1M45 A;  1FPW A;  2QEB A;  2L50 A;  2KBM A;  2OS8 C;  3CTN A;  4QJ5 B;  4OR9 B;  1XFX O;  1WRK A;  3WNX B;  3S0D A;  3PAT A;  1U5I B;  3S0G A;  2L4I A;  3D0Y B;  2GGZ A;  1B9A A;  3CYZ A;  4GGF C;  2WC6 A;  5I2Q A;  4JD9 A;  1OOI X;  4YGC B;  1NPQ A;  1OW4 A;  1XFR A;  1XFW O;  3BUN B;  4C0K A;  2M7N A;  1YVL A;  1HT9 A;  3B87 A;  3BJH A;  1YR5 A;  2K60 A;  3OB1 B;  3NSK A;  3PJI A;  4ETO A;  2M9G A;  4NDC A;  3FWB A;  2O5G A;  2BKI B;  3BOW B;  3CGA A;  1KQM B;  1TWO A;  1JBA A;  2F2P A;  2FJY A;  2H61 C;  2JXC A;  2LM5 A;  3PLF B;  5ER5 A;  1F71 A;  1IJ5 A;  1TCF A;  3PSR A;  1F8H A;  1KWO B;  1NCZ A;  5FI2 A;  2AUC A;  5DKQ A;  1YVH A;  1AVS A;  2LHI A;  1N0Y A;  1A2X A;  1IJ6 A;  2Y1N A;  4GAO A;  1PAL A;  1RJV A;  1UUS A;  2DOQ A;  1LKJ A;  1Q80 A;  1K2H A;  1K9P A;  2G2B A;  2Q4U A;  1CMF A;  1CLL A;  3CAB A;  1OMD A;  2NCO A;  5D69 A;  5HKW A;  2P71 A;  4ORC B;  1JFK A;  1K90 D;  2SCP A;  4MVF A;  1OE9 B;  1CFD A;  3GK4 X;  1AJ5 A;  1DJW A;  3JVT C;  1NIW A;  1F55 A;  5GQQ C;  2I7A A;  1C7V A;  3OX6 A;  4DS7 A;  1K94 A;  1IWQ A;  1SL8 A;  3B6X A;  1F4O A;  1DJH A;  1YRT B;  2BKH B;  1CFF A;  1GJY A;  1QX7 A;  4ICB A;  3VRP A;  1UUR A;  3IQO A;  5I8N A;  1B4C A;  5G08 A;  1CDL A;  1TNX A;  3BFB A;  4YGD B;  4JWQ A;  2FJU B;  2PYQ A;  3EKJ A;  3KHE A;  1ODB A;  2RGI A;  1KCY A;  2KFH A;  1NX3 A;  1S1E A;  2L2E A;  4YI9 A;  1YTZ C;  2A4J A;  2YGU A;  4N1F A;  3RLZ A;  3VRO A;  1XA5 A;  2LVJ A;  1DTL A;  3KF9 A;  1QIW A;  3CWG A;  3QRX A;  1KFX L;  3TUY C;  1K9U A;  2LMV A;  4CFQ A;  2KI4 B;  1JF2 A;  3D78 A;  1SYM A;  3CZ1 A;  1KSO A;  1J1E A;  1IG5 A;  2KLE A;  3R1O A;  4NDB A;  1S5G Y;  1MUX A;  1CLM A;  2ZND A;  1CM4 A;  1F4Q A;  3CDN A;  4CPV A;  4HRH A;  1ZOT B;  1S6C A;  2KFF A;  3DVM A;  1YUT A;  4NDD A;  3FE8 A;  2KAV A;  3A4U B;  1IGV A;  2H8V A;  3F45 A;  3AKA A;  5KU1 A;  4ORA B;  3BFA A;  3FE9 A;  1GM0 A;  1SRA A;  4YGB B;  1FI5 A;  2MLF C;  1LXF C;  3C1V A;  1YX7 A;  1UP5 A;  4JQ0 D;  2BE4 A;  2HQ8 A;  2JTZ A;  2JQ6 A;  2L2C A;  1JWD A;  2CBL A;  2MRD A;  3ZWH A;  2HF5 A;  4A4C A;  1NX0 A;  1QAT A;  4PDZ A;  3L4A A;  1TIZ A;  2WOR A;  5F6T A;  3JTD C;  1EJ3 A;  1IKU A;  1TCO B;  1SR6 B;  1J7R A;  1QV0 A;  1R2U A;  4GFT A;  4OV2 A;  1SY9 A;  2JT0 A;  1QX2 A;  2OTG B;  3PM8 A;  1LIN A;  1WDC C;  1L2O B;  2WCE A;  2JU0 A;  2KPH A;  3FS7 A;  4MRY A;  4YGA A;  3GK2 A;  1NSH A;  3K21 A;  4USL A;  1LVC D;  2E30 A;  4XYN A;  5HYD A;  1XYD A;  2KFG A;  4HSZ A;  1AK8 A;  2JT8 A;  2OS8 B;  3DVE A;  1MHO A;  1MXL C;  2HPS A;  1AP4 A;  1KK7 Y;  5AAN A;  2LV7 A;  2VRG A;  2H61 A;  3NSL A;  1C07 A;  1PRW A;  2KSP A;  1S26 D;  3I5G B;  3NSI A;  1DVI A;  4CID A;  1K9K A;  1OOG A;  1B47 A;  2ZN8 A;  2I94 A;  5KSZ A;  1PSR A;  2LMU A;  1CNP A;  4QJ3 B;  2LUC A;  1DGV A;  2QPT A;  4TNC A;  1LA3 A;  4OCI A;  4MLW A;  2I2R E;  1BMO A;  1AHR A;  3O4Y A;  3I5F C;  3D73 A;  2LC5 A;  3D76 A;  4YBH B;  2LCP A;  1X02 A;  2JOJ A;  3S0B A;  3FIA A;  1SPY A;  1MR8 A;  1XFV O;  1S3P A;  1SBJ A;  1Y1X A;  3GOF A;  4D1E A;  1B8C A;  5AXI A;  2ZKM X;  1QIV A;  3VRR A;  1CM1 A;  4Q04 A;  2LNK A;  3Q8I A;  2CCM A;  1Y6W A;  1DJG A;  1M31 A;  2MA2 A;  1W9Z A;  3WHU B;  4I5K A;  1SCM C;  4E68 A;  3EVV A;  1ALV A;  4INW A;  1J7Q A;  2P70 A;  4F0Z B;  1BOD A;  4ZCV A;  1XK4 C;  4L9M A;  4PAL A;  1FW4 A;  3SIB A;  2LMT A;  1M46 A;  1QLK A;  4WQ2 A;  2EHB A;  1CKK A;  1A4P A;  1TNP A;  2KNE A;  2PAL A;  3V2L A;  4YGE B;  4ZCU A;  1TNW A;  4NQG A;  4MEW A;  1ALW A;  2LP3 A;  3JVT B;  3SG5 A;  3DF0 A;  3BUO B;  4MZK A;  4MSP A;  3H4S E;  4PE4 A;  4PE0 A;  2MHH A;  3TS5 C;  1M63 B;  3NHT A;  2KBI A;  1WRL A;  5KTY A;  2NLN A;  2M3W A;  1HQV A;  3BUM B;  4PE1 A;  4F7F A;  4FQT A;  4C0L A;  1K96 A;  1DJI A;  3AKB A;  1H8B A;  1SNL A;  5K89 A;  1LS8 A;  1NX1 A;  2M49 B;  3DVJ A;  4OZD A;  4N1G A;  1E8A A;  1XVJ A;  5CSI A;  4MZL A;  5AEQ A;  5AER A;  3LK1 A;  3DF0 B;  1DGU A;  3TZ1 A;  3GK1 A;  3O6B A;  1K8U A;  2BE6 A;  1IIO A; 
#chains in the Genus database with same CATH homology
 2EC6 B;  1PVB A;  2PAS A;  2F3Z A;  1NCX A;  1IQ5 A;  5TNC A;  1B7T Z;  1WLZ A;  2LVI A;  1MF8 B;  2WCB A;  1F70 A;  2LAP A;  3KO0 A;  3IF7 A;  1XFZ O;  2WC8 A;  1DJX A;  2BL0 B;  3CS1 A;  3PN7 B;  4PHN A;  3RM1 A;  1CMG A;  2D8N A;  2TN4 A;  2F33 A;  1KQM C;  3I5I C;  3DVK A;  2JTT A;  2CXJ A;  5HLO A;  1Y1A A;  2L0P A;  3EVU A;  1GQM A;  4CFR A;  1UHK A;  1WRZ A;  1KFX S;  2KAY A;  3PAL A;  2K7O A;  1FF1 A;  5CPV A;  1BT6 A;  1NP8 A;  2NCP A;  3JTD B;  2WND A;  3OX5 A;  5CSF A;  4GGN A;  1XO5 A;  1S6J A;  2V53 A;  2L98 A;  1A29 A;  1DF0 A;  3VRQ A;  2LLS A;  1DJY A;  1UWO A;  1YUS A;  3OP0 A;  1KQV A;  2F3Y A;  2M29 A;  1L7Z A;  4WRI A;  2LVK A;  1OOJ A;  1TOP A;  3CZT X;  1NX2 A;  2KYF A;  4DRW A;  2SAS A;  4OKH A;  1LA0 A;  1B1G A;  1NCY A;  1S36 A;  2K7C A;  3D10 A;  2F2O A;  3SG4 A;  1OMR A;  3PFV A;  2ISD A;  4GGF A;  1CFP A;  2JXL A;  1N65 A;  2M1K B;  1DMO A;  4MRX A;  5IBW A;  4UPG A;  2BCX A;  1N2D A;  1SKT A;  2CT9 A;  5HKZ A;  1DF0 B;  1UHI A;  2P6B B;  4ORB B;  2L5X B;  2OPO A;  2WCF A;  3I5F B;  3ICB A;  1J7P A;  4MBE A;  1EXR A;  2FOT A;  3NXA A;  1CFC A;  2KI4 C;  2LP2 A;  2COL B;  5I2O A;  3DD4 A;  1QX5 B;  1RTP 1;  4HRG A;  5JJG A;  1GGZ A;  3AAK A;  1ZFS A;  1JC2 A;  1OZO A;  1QTX A;  1ZAC A;  2AMI A;  3VRN A;  4PHJ A;  1PK0 D;  1YUU A;  3SG2 A;  4MN0 A;  1IRJ A;  1SCM B;  1OMV A;  2LLT A;  1A75 A;  2JRF A;  1QAS A;  1TRF A;  2PSR A;  4WQ3 A;  1A03 A;  4AOM A;  2PMY A;  2BCA A;  1M39 A;  1SCV A;  1UHH A;  4HRE E;  1XFU O;  2HET A;  1K93 D;  1H4B A;  4BY4 A;  4C0J A;  3EKH A;  1QS7 A;  1JFJ A;  2KDH A;  5PAL A;  2KGB C;  1JUO A;  2NZ0 A;  2FCE A;  1SR6 C;  1RK9 A;  1AJ4 A;  2H2K A;  2LLU A;  3TS5 B;  3SJS A;  2LVV A;  2JPT A;  1EG3 A;  1W7I B;  2OTG C;  3I5H C;  2KAX A;  4M2Q A;  2M7L A;  1ZUZ A;  3EVR A;  3E3R A;  2BBM A;  1QLS A;  2EGD A;  1BG1 A;  4BY5 A;  1PUL A;  4XJK A;  3AAJ A;  1OSA A;  3HX4 A;  3BOW A;  2ZFD A;  2QAC A;  1REC A;  1QV1 A;  1V1F A;  2MAZ A;  3OHM B;  1K95 A;  2Y1M A;  1KK8 C;  3CR2 A;  4DUQ A;  1DT7 B;  1OQP A;  3KEV A;  4I5N B;  3I5G C;  5CSJ A;  1WLM A;  2PRU A;  3O78 A;  2CTN A;  1J1D A;  1SL9 A;  3FWC A;  1CDN A;  4GUK A;  1G8I A;  1YRU B;  1KSM A;  3CR4 X;  4PHK A;  1D1O A;  1FI6 A;  2AAO A;  1TNQ A;  3MSE B;  1NWD A;  4XJK B;  4A4B A;  3O2P A;  4P5O E;  2ZN9 A;  1C7W A;  2JC2 A;  2LE9 B;  2ZRS A;  1GGW A;  2HQW A;  2KQ6 A;  1XFY O;  3I5I B;  3IQQ A;  2WOS A;  2M97 A;  2E6W A;  3TDI A;  1CB1 A;  1PSB A;  4CLN A;  1MXE A;  3TUY B;  4GBA A;  1BR1 B;  4U8D A;  2LAN A;  1MQ1 A;  1UHJ A;  5BPJ A;  2ZRT A;  2LUX A;  2Q91 A;  2MLE C;  3OB2 B;  3WXA A;  1QXP A;  3EK8 A;  3SIA A;  3TDZ A;  5HKY A;  1BJF A;  1OZS A;  2KI6 C;  4DIR A;  1J55 A;  1S5G Z;  2KQY A;  3LK0 A;  4GPL B;  2BCB A;  3LLE A;  4AQJ A;  1FBV A;  1G33 A;  1Y0V H;  4PE7 A;  5DKN A;  1KWO C;  3NSO A;  5HLV A;  1CLB A;  4M2P A;  1G4Y R;  1R6P A;  4MZJ A;  3BXK A;  4JPZ B;  2MBX A;  2LHL A;  3LCP C;  2K7B A;  1SL7 A;  1BR4 B;  2KYC A;  2I18 A;  3BUX B;  2K7D A;  1EG4 A;  5ER4 X;  1YUR A;  3HCM A;  1CTR A;  3SG7 A;  2Y4Q A;  5I2L A;  1IH0 A;  1V1G A;  1F54 A;  3LL8 B;  1PVA A;  1B7T Y;  3M0W A;  1BU3 A;  1WDC B;  1BF5 A;  1JSA A;  1IQ3 A;  1RFJ A;  1QVI Z;  1BLQ A;  4AQI A;  1J7O A;  2NXQ A;  3TDU A;  2L4H A;  4GNK B;  2EC6 C;  5J3X A;  2K2F A;  2JNF A;  2M0R A;  2ZNE A;  3EK7 A;  4P2Y B;  1JF0 A;  5CSN A;  1EL4 A;  4IL1 A;  2Y5I A;  2M8U A;  5JOL A;  1TTX A;  4YI8 A;  2KGR A;  2BL0 C;  1ZMZ A;  1WY9 A;  3BUW B;  3BYA A;  2IS9 A;  3PN7 C;  4PCW A;  5D7F A;  1Y1U A;  1KK7 Z;  1W7J B;  2GV5 A;  1NUB A;  4R1E A;  4YRU A;  4FQO A;  1XK4 A;  2KHN A;  2FCD A;  4DCK A;  2K61 A;  4I5L B;  4OVN F;  3BQ3 A;  2R2I A;  1DJZ A;  2KI6 D;  3CLN A;  4FTG A;  5FYX A;  2G9B A;  2JNX A;  1BOC A;  1B8R A;  1UHN A;  2F8P A;  1QVI Y;  1YX8 A;  2PVB A;  1S6I A;  2GGM A;  2JZI A;  1CDP A;  3WHT B;  3ZNI A;  3SG6 A;  1TN4 A;  3I5H B;  3SG3 A;  1AUI B;  1CDM A;  1SMG A;  2K8M B;  1MWN A;  2O60 A;  3VGO A;  1RRO A;  1QJT A;  2B1U A;  5B8I B;  2JT3 A;  4QJ4 B;  2BBN A;  2L51 A;  2BEC A;  2KOT A;  1SW8 A;  1U5I A;  2K2A A;  1EH2 A;  1KK8 B;  4I5J A;  3KPX A;  5DKR A;  3D0Y A;  5AFP A;  2M1U A;  1SK6 D;  2JUL A;  3A8R A;  3EK4 A;  1B8L A;  1KFU L;  2MJW B;  2CNP A;  4N5X A;  1A75 B;  4PHM A;  3CR5 X;  1VRK A;  2K0J A;  1L2O C;  1KFU S;  1RWY A;  4M2O A;  1NYA A;  2JWW A;  1M45 A;  1FPW A;  2L50 A;  2KBM A;  2OS8 C;  3CTN A;  4QJ5 B;  4OR9 B;  1XFX O;  1WRK A;  3WNX B;  3PAT A;  1U5I B;  2L4I A;  3D0Y B;  2GGZ A;  1B9A A;  4GGF C;  5I2Q A;  4YGC B;  1NPQ A;  1XFW O;  3BUN B;  4C0K A;  2M7N A;  1YVL A;  1HT9 A;  1YR5 A;  3OB1 B;  3NSK A;  4ETO A;  2M9G A;  4NDC A;  3FWB A;  2O5G A;  2BKI B;  3BOW B;  3CGA A;  1KQM B;  1JBA A;  2F2P A;  2H61 C;  2JXC A;  2LM5 A;  3PLF B;  5ER5 A;  1F71 A;  1IJ5 A;  1TCF A;  3PSR A;  1F8H A;  1KWO B;  1NCZ A;  2AUC A;  5DKQ A;  1YVH A;  1AVS A;  2LHI A;  1N0Y A;  1A2X A;  1IJ6 A;  2Y1N A;  4GAO A;  1PAL A;  1RJV A;  1UUS A;  2DOQ A;  1LKJ A;  1Q80 A;  1K2H A;  1K9P A;  2G2B A;  2Q4U A;  1CMF A;  1CLL A;  5HKW A;  1OMD A;  2NCO A;  5D69 A;  4ORC B;  1JFK A;  1K90 D;  2SCP A;  4MVF A;  1OE9 B;  1CFD A;  3GK4 X;  1AJ5 A;  1DJW A;  3JVT C;  1NIW A;  1F55 A;  5GQQ C;  2I7A A;  1C7V A;  3OX6 A;  4DS7 A;  1K94 A;  1IWQ A;  1SL8 A;  1F4O A;  1DJH A;  1YRT B;  2BKH B;  1CFF A;  1GJY A;  1QX7 A;  4ICB A;  3VRP A;  1UUR A;  3IQO A;  5I8N A;  1B4C A;  5G08 A;  1CDL A;  1TNX A;  4YGD B;  4JWQ A;  2FJU B;  3EKJ A;  3KHE A;  1ODB A;  2RGI A;  1KCY A;  2KFH A;  1NX3 A;  1S1E A;  2L2E A;  4YI9 A;  1YTZ C;  2A4J A;  4N1F A;  3VRO A;  3RLZ A;  1XA5 A;  2LVJ A;  1DTL A;  3KF9 A;  1QIW A;  3CWG A;  3QRX A;  1KFX L;  3TUY C;  1K9U A;  2LMV A;  4CFQ A;  2KI4 B;  1JF2 A;  1SYM A;  1KSO A;  1J1E A;  1IG5 A;  4NDB A;  1S5G Y;  1MUX A;  1CLM A;  2ZND A;  1CM4 A;  1F4Q A;  4CPV A;  4HRH A;  1ZOT B;  1S6C A;  2KFF A;  3DVM A;  1YUT A;  4NDD A;  2KAV A;  3A4U B;  1IGV A;  3F45 A;  3AKA A;  5KU1 A;  4ORA B;  1SRA A;  4YGB B;  1FI5 A;  2MLF C;  1LXF C;  3C1V A;  1YX7 A;  1UP5 A;  4JQ0 D;  2BE4 A;  2HQ8 A;  2JTZ A;  2JQ6 A;  1JWD A;  2CBL A;  2MRD A;  3ZWH A;  2HF5 A;  4A4C A;  1NX0 A;  1QAT A;  4PDZ A;  1TIZ A;  2WOR A;  5F6T A;  3JTD C;  1EJ3 A;  1IKU A;  1TCO B;  1SR6 B;  1J7R A;  1QV0 A;  1R2U A;  4GFT A;  4OV2 A;  1SY9 A;  2JT0 A;  1QX2 A;  2OTG B;  3PM8 A;  1LIN A;  1WDC C;  1L2O B;  2WCE A;  2JU0 A;  3FS7 A;  4YGA A;  4MRY A;  3GK2 A;  1NSH A;  3K21 A;  4USL A;  1LVC D;  2E30 A;  4XYN A;  5HYD A;  1XYD A;  2KFG A;  4HSZ A;  1AK8 A;  2JT8 A;  2OS8 B;  3DVE A;  1MHO A;  1MXL C;  2HPS A;  1AP4 A;  1KK7 Y;  5AAN A;  2LV7 A;  2VRG A;  2H61 A;  3NSL A;  1C07 A;  1PRW A;  2KSP A;  1S26 D;  3I5G B;  3NSI A;  1DVI A;  4CID A;  1K9K A;  2ZN8 A;  1B47 A;  1CNP A;  2I94 A;  5KSZ A;  1PSR A;  2LMU A;  4QJ3 B;  2LUC A;  1DGV A;  2QPT A;  4TNC A;  1LA3 A;  4OCI A;  4MLW A;  2I2R E;  1BMO A;  1AHR A;  3O4Y A;  3I5F C;  2LC5 A;  4YBH B;  2LCP A;  1X02 A;  2JOJ A;  3FIA A;  1SPY A;  1MR8 A;  1XFV O;  1S3P A;  1SBJ A;  1Y1X A;  3GOF A;  4D1E A;  1B8C A;  5AXI A;  2ZKM X;  1QIV A;  3VRR A;  1CM1 A;  4Q04 A;  2LNK A;  2CCM A;  1Y6W A;  1DJG A;  1M31 A;  2MA2 A;  3WHU B;  4I5K A;  1SCM C;  4E68 A;  3EVV A;  1ALV A;  1J7Q A;  4F0Z B;  1BOD A;  4ZCV A;  1XK4 C;  4L9M A;  4PAL A;  1FW4 A;  3SIB A;  2LMT A;  1M46 A;  1QLK A;  4WQ2 A;  2EHB A;  1CKK A;  1A4P A;  1TNP A;  2KNE A;  2PAL A;  4YGE B;  4ZCU A;  1TNW A;  4NQG A;  4MEW A;  1ALW A;  2LP3 A;  3JVT B;  3SG5 A;  3DF0 A;  3BUO B;  4MZK A;  4MSP A;  3H4S E;  4PE4 A;  4PE0 A;  2MHH A;  3TS5 C;  1M63 B;  2KBI A;  1WRL A;  5KTY A;  2NLN A;  2M3W A;  1HQV A;  3BUM B;  4PE1 A;  4C0L A;  1K96 A;  1DJI A;  3AKB A;  1H8B A;  1SNL A;  5K89 A;  1NX1 A;  2M49 B;  3DVJ A;  4N1G A;  1E8A A;  1XVJ A;  5CSI A;  4MZL A;  5AEQ A;  5AER A;  3LK1 A;  3DF0 B;  1DGU A;  3TZ1 A;  3GK1 A;  3O6B A;  1K8U A;  2BE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...