3K1EA

Crystal structure of odorant binding protein 1 (aaegobp1) from aedes aegypti
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
VTPRRDAEYPPPEFLEAMKPLREICIKKTGVTEEAIIEFSDGKVHEDENLKCYMNCLFHEAKVVDDTGHVHLEKLHDALPDSMHDIALHMGKRCLYPEGENLCEKAFWLHKCWKESDPKHYFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein
publication title Structure of an odorant-binding protein from the mosquito Aedes aegypti suggests a binding pocket covered by a pH-sensitive "Lid".
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Odorant binding protein
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3k1eA01
2WCHA 1TWOA 3CZ0A 4INWA 3R1OA 2WCLA 2H8VA 3D77A 4JD9A 2P71A 2QEHA 3BFBA 3BFHA 3CDNA 3B87A 2QEBA 2QEOA 2ERBA 1OW4A 3S0BA 2FJYA 4INXA 3NHIA 2KPHA 3DXLA 3S0GA 3N7HA 1OOHA 3B88A 2WCKA 1T14A 2PQLA 3DZTA 3FE8A 1OOFA 3S0AA 2GTEA 3B6XA 3NGVA 4OZDA 3NHTA 3FE9A 4F7FA 3S0DA 1C3ZA 1LS8A 1OOGA 2QDIA 2WCJA 3BFAA 5DICA 1XFRA 1OOIX 2WC5A 3OGNA 1TUJA 3BJHA 3DY9A 2P70A 3QMEA 3R72A 3R1PA 3PJIA 3D74A 3L4AA 2JPOA 3S0EA 3RZSA 1DQEA 3R1VA 3CYZA 1ORGA 1P28A 3D73A 3CZ1A 3CABA 3DYEA 1C3YA 3FE6A 3D76A 3L4LA 2WCMA 3K1EA 3Q8IA 3D78A 3V2LA 3L47A 5EL2A 3D75A 3S0FA 4FQTA 3B7AA 1QWVA 2L2CA 3VB1A 1GM0A 2QEVA 3B86A 4PT1A 2WC6A 3CZ2A
chains in the Genus database with same CATH superfamily
2WORA 3CR4X 1U5IB 2F8PA 2WCHA 3CZTX 1TWOA 3DD4A 4ICBA 2O60A 4OKHA 2ZFDA 3TS5B 2CXJA 4HRHA 2H2KA 1SW8A 3OX6A 1A75B 2Y5IA 5IBWA 3CS1A 2LP2A 2LMTA 4JD9A 1J7PA 2A4JA 2L51A 3BFHA 1Z4HA 1IGVA 2BE6A 2WNDA 3B87A 1UP5A 1LA0A 3I5FC 1K8UA 2B1UA 1E8AA 1S6JA 3FS7A 1CMGA 3VRQA 5TNCA 1H8BA 3BOWA 3IQOA 2LCPA 1QS7A 2KQYA 4XJKB 1NX3A 2PASA 1TCFA 3NSLA 3KEVA 1BR1B 3UO9A 2Q91A 1EH2A 2KFHA 1RK9A 1U5IA 1UWOA 2LVKA 3EVUA 1OOHA 1LVCD 1B4CA 1HT9A 1A75A 2KI4B 3DVJA 4HSZA 2BL0B 1A03A 3DZTA 2KNEA 4C0JA 1OMVA 3PN7B 3I5HB 3ZWHA 1RWYA 5HLVA 4AOMA 1B1GA 2KAYA 2M97A 3OB1B 1PULA 1PSBA 2F3ZA 4P2YB 3VRPA 1SY9A 3HX4A 5I8NA 1S1EA 1CKKA 2GTEA 1NUBA 2CTNA 1PVAA 1UHHA 4PALA 3BYAA 4M2QA 5AERA 4OR9B 2NCOA 3FE9A 2LHIA 2I2RE 3PFVA 4XJKA 1Y1UA 5KSZA 2PMYA 4L9MA 1L2OB 1NX2A 1CM1A 1LS8A 1OOGA 2VRGA 3BFAA 1KFXS 2LC5A 2ZN9A 2H61A 2LUXA 3BUXB 3GK4X 1KK7Z 2CBLA 1KK8B 2CNPA 3O78A 5I2LA 1F54A 2PALA 2WC5A 2GV5A 1CDNA 1DJHA 3BUOB 1S6CA 1DMOA 2SCPA 3LL8B 4DCKA 1TUJA 3FWCA 1JSAA 4N1GA 3DY9A 1EG3A 2BE4A 1J7RA 4P5OE 3O2PA 1A4PA 1JF0A 3JTDB 5HKWA 3R1PA 1TNQA 3PJIA 1IG5A 1SL9A 2LAPA 1SCVA 2JXCA 1XA5A 1YVHA 2OPOA 3L4AA 3R1VA 1N0YA 1DT7B 1CMFA 1JFKA 1IRJA 4NDBA 1J1DA 2JULA 2KAVA 2TN4A 1SK6D 4U8DA 4XYNA 4BY5A 3CWGA 3AAKA 2JRFA 2JPTA 1K90D 1KSOA 1OSAA 2MAZA 1LKJA 4JPZB 2BCBA 3SG5A 1XO5A 5I2QA 1TNXA 5HKYA 1C7WA 2WCMA 3AKBA 1LA3A 2ZNEA 3LK1A 2OS8C 2L2EA 3FIAA 3CLNA 1SL8A 1S3PA 1RJVA 2KBMA 4PCWA 1L2OC 1OZSA 3D10A 3SG2A 3VRNA 1X02A 2JNFA 1CTRA 2KYFA 5EL2A 4ETOA 1BLQA 1XK4A 1KFUS 1YUSA 3M0WA 1OMDA 1AP4A 1YRUB 2L2CA 4C0KA 2K60A 4MZLA 5JOLA 3TUYC 1J1EA 3UNWA 2KSPA 2ZNDA 1KQVA 2KLDA 1IQ5A 1ALWA 1NCZA 4WQ2A 2F2OA 3NSIA 4MRYA 2BCAA 1SCMB 1UHNA 5KTYA 2WOSA 1WY9A 3A8RA 1DTLA 1QIVA 5AANA 2M29A 1SKTA 1B9AA 1B8CA 3PM2A 4MVFA 1YVLA 3F45A 4ORCB 2P71A 1NX1A 5AEQA 1KFXL 1XFZO 2GGZA 3WNXB 3QRXA 3EVRA 1M45A 1L7ZA 4MN0A 4TNCA 1QTXA 1YUTA 1GQMA 1CFPA 1GJYA 1BJFA 2ERBA 2L50A 2JXLA 1AVSA 2CT9A 2KDHA 2Y4QA 3I5IC 2E6WA 1CLLA 2NXQA 2FJYA 3VRRA 2EHBA 4INXA 3CR2A 1SL7A 1XFVO 2KHNA 1RECA 2BNXA 4MZKA 1IJ6A 1FI5A 3TDIA 5FYXA 2M1KB 3ICBA 1J7OA 1NCYA 3B88A 1QXPA 2WCKA 5CSNA 1XFXO 4A4CA 3OX5A 3PALA 5BPJA 1TUZA 4F0ZB 2JOJA 1ODBA 3PLFB 2RGIA 2NLNA 1JC2A 1K96A 2MA2A 1AUIB 1M46A 4I5JA 2ISDA 3SG6A 1CFCA 2BKIB 1OOFA 4GUKA 4DUQA 1YR5A 1CNPA 3E3RA 1M31A 4PHJA 1S26D 4QJ4B 1NYAA 3D0YB 3NGVA 4OZDA 4MEWA 2K7BA 2KGBC 3AKAA 3KF9A 5AXIA 1TNWA 2PVBA 2LVJA 2AAOA 1B7TY 2BKHB 1FBVA 2JTTA 4FQOA 2QACA 1R6PA 2LP3A 5CPVA 3EK4A 5DICA 2HQWA 1Y6WA 5AFPA 1F71A 1BR4B 1OE9B 2ZKMX 1W7IB 1QVIY 2LM5A 2QPTA 5B8IB 1XYDA 4DRWA 1YX7A 4GAOA 3SG3A 1QATA 1TNPA 4GBAA 1MR8A 1ZOTB 3TS5C 3NSKA 2NCPA 1V1GA 4NDCA 5D69A 3TDUA 1CLMA 2JPOA 2L98A 1DQEA 3SIBA 1N65A 2JQ6A 2ZN8A 5ER5A 3D0YA 3SS3A 3RM1A 1KCYA 4N5XA 4ORBB 1ORGA 1M63B 1P28A 1S5GZ 1EXRA 3D73A 2KFFA 1JUOA 4Q04A 2LLTA 1NPQA 4GGNA 2ZRSA 2JT3A 2LLSA 3EKHA 1SYMA 1BODA 3D76A 4USLA 3EK8A 3LCPC 1JWDA 4E68A 3O4XA 4M2PA 4CLNA 2BAPA 2JC2A 1QX2A 1LXFC 3D78A 4CFRA 3CR5X 4CIDA 3BUWB 1CDLA 2H61C 3D75A 2K7CA 2KGRA 4FQTA 1J7QA 1MWNA 1QWVA 2JZIA 2MJWB 2KI4C 4YGDB 2BL0C 2K7DA 1KWOB 1GM0A 1NP8A 1SR6B 1ALVA 3PN7C 3I5HC 1PRWA 1J55A 4R1EA 4IJ7A 2CCMA 5HYDA 4YRUA 1YTZC 1FI6A 1ZUZA 4CPVA 1G4YR 2HPSA 2Q4UA 5D7FA 2K2FA 1PK0D 4INWA 4NQGA 1QLSA 1YUUA 2E30A 2WCLA 3I5GB 2H8VA 5DKQA 1B7TZ 1B8LA 2AMIA 3D77A 5CSIA 1DJYA 1G33A 2M7LA 2I94A 2AUCA 2MHHA 2PYQA 1FW4A 1WLMA 1RTP1 2PRUA 2QEHA 3IF7A 1LINA 3CDNA 3SS5A 3NXAA 1Q80A 4YGAA 2IS9A 1QVIZ 4UPGA 1MHOA 2QEBA 1KK8C 1DEKA 1H4BA 2KQ6A 2K7OA 2QEOA 3LLEA 1OW4A 2JNXA 4PE7A 1K94A 4KYNA 3S0BA 1V1FA 1RFJA 1A2XA 1W7JB 1XK4C 1DGVA 2K8MB 1KSMA 2MLFC 3JTDC 3NHIA 4GGFA 1NX0A 1DVIA 1RROA 3DXLA 4HRGA 3S0GA 3N7HA 3EG5B 1HQVA 1KWOC 1SR6C 3ZNIA 3BUNB 2EC6B 2Y1NA 1DF0B 1KQMB 1T14A 1BF5A 2BECA 2LMVA 4MBEA 5DKNA 2BCXA 2V53A 3IQQA 3VGOA 2LVIA 1A29A 3O4YA 2KLEA 1IH0A 2FJUB 1DELA 3I5GC 4ZCVA 1Y0VH 1OOJA 1BMOA 2KBIA 3S0AA 1S5GY 1YRTB 1DJZA 5FI2A 5PALA 3BXKA 2M1UA 3HCMA 1XFUO 2KI6D 1CDPA 2JWWA 1IIOA 3S0DA 2M49B 4M2OA 5CSJA 1QJTA 3WHTB 5FI7A 1QV0A 1CB1A 1MUXA 2FOTA 2SASA 1XFRA 1FF1A 4N1FA 1YURA 2D8NA 1NSHA 1DF0A 1NIWA 2F33A 3EKJA 4MSPA 4MRXA 1XVJA 1SCMC 2DOQA 4PHNA 2M8UA 3AAJA 2WCBA 1UHKA 1C07A 3S0EA 2WCFA 1WDCB 1N2DA 4PE1A 1PSRA 3CYZA 2COLB 2LV7A 5D3OA 1XFYO 1CDMA 1S36A 3WXAA 1DGUA 2WC8A 1EJ3A 2K61A 1PALA 4PE4A 1TOPA 1KFUL 2JT8A 3CABA 3KO0A 3DYEA 1SNLA 2WCEA 3GK1A 1M39A 3FE6A 1IJ5A 4C0LA 1NWDA 2JU0A 2EGDA 1K9UA 1D1OA 2FCEA 1VRKA 3K1EA 2BBNA 2LUCA 3C1VA 3OBVA 4A4BA 4PDZA 1R2UA 4ZCUA 1AJ4A 1MXEA 1OZOA 1Y1XA 3JVTB 2ZRTA 2L0PA 3DVEA 2LHLA 2MRDA 5I2OA 2F2PA 3S0FA 4JWQA 2MBXA 3TZ1A 1WRLA 5G08A 2FCDA 3OP0A 1ZACA 1CFFA 2HETA 3PM8A 3B86A 1QX7A 3OB2B 2WC6A 1ZMZA 3CZ2A 3A4UB 3OHMB 1XFWO 1WDCC 1EG4A 3BUMB 1OQPA 3CZ0A 4GFTA 2JTZA 1QX5B 4WQ3A 3SJSA 4DIRA 5K89A 1BU3A 1FPWA 3GOFA 2JT0A 2LE9B 3R1OA 2L5XB 2LANA 5J3XA 1TTXA 1AHRA 1DC1A 4BY4A 2O5GA 5GQQC 1UURA 3LK0A 1DJWA 4QJ3B 2HQ8A 1TIZA 1BOCA 3BFBA 1GGWA 3WHUB 4YGCB 3EVVA 1QLKA 1K93D 2G9BA 2L4HA 2M0RA 2KOTA 3DVKA 1JFJA 4JQ0D 2LLUA 1WRKA 4PHKA 2M7NA 3SS4A 3JVTC 3SIAA 3DF0B 4I5NB 5ER4X 2HF5A 1W9ZA 2OS8B 1G8IA 4D1EA 2OTGB 1SRAA 2KPHA 3K21A 1Y1AA 4YGEB 3TDZA 1QV1A 4HREE 5DKRA 3GK2A 1QASA 4GNKB 1K9KA 2PQLA 3TUYB 3FE8A 1TRFA 4NDDA 2BBMA 2G2BA 5FI6A 4OVNF 4YI9A 5JJGA 3CTNA 1SBJA 3VROA 3B6XA 4YBHB 1K9PA 3BQ3A 2LMUA 5CSFA 4OV2A 2KFGA 3NHTA 1BT6A 2L4IA 3DVMA 4F7FA 2I7AA 1GGZA 3EK7A 5HL1A 1DJXA 2M3WA 3DF0A 1F70A 4YGBB 4I5LB 4FTGA 1QIWA 4PE0A 2L5YA 1C3ZA 1AJ5A 1UHJA 2QDIA 2LNKA 2R2IA 2WCJA 3H4SE 4OCIA 1AK8A 1UHIA 4PHMA 4I5KA 1NCXA 1OOIX 4WRIA 2MLEC 3OGNA 4GGFC 2OTGC 1IWQA 2NZ0A 3I5IB 4ORAB 1JBAA 2PSRA 2Y1MA 5F6TA 4QJ5B 3BJHA 1F4QA 3MSEB 3SG4A 1B8RA 3FWBA 5KU1A 1F55A 2P70A 1MXLC 3KPXA 3QMEA 3R72A 2K0JA 3D74A 2GGMA 3RZSA 1DJIA 2P6BB 1SMGA 1CLBA 3IVTA 1ZFSA 2LVVA 1YX8A 1SPYA 2KI6C 1IQ3A 2M9GA 4MZJA 4JKTA 3CZ1A 4YI8A 3PATA 1JF2A 3PSRA 4AQIA 1C3YA 2KAXA 3CGAA 1K2HA 1MQ1A 3L4LA 5HKZA 1IKUA 1F4OA 4DS7A 3O6BA 3Q8IA 3KHEA 4AQJA 1EL4A 3I5FB 1CFDA 1TCOB 1UUSA 3SG7A 1S6IA 4GPLB 1SSEB 3V2LA 4CFQA 3L47A 2K2AA 1DJGA 2I18A 1PVBA 1C7VA 5I94A 1B47A 1K95A 3B7AA 3RLZA 2EC6C 1MF8B 2F3YA 5HLOA 1KQMC 1Z2CB 1CM4A 3VB1A 3BOWB 1WLZA 1WRZA 2QEVA 1F8HA 4PT1A 4MLWA 1BG1A 4IL1A 2KYCA 1KK7Y 2YGUA 1TN4A 1OMRA 3NSOA
chains in the Genus database with same CATH topology
2WCHA 1TWOA 3CZ0A 4INWA 3R1OA 2WCLA 2H8VA 3D77A 4JD9A 2P71A 2QEHA 3BFBA 3BFHA 3CDNA 3B87A 2QEBA 2QEOA 2ERBA 1OW4A 3S0BA 2FJYA 4INXA 3NHIA 2KPHA 3DXLA 3S0GA 3N7HA 1OOHA 3B88A 2WCKA 1T14A 2PQLA 3DZTA 3FE8A 1OOFA 3S0AA 2GTEA 3B6XA 3NGVA 4OZDA 3NHTA 3FE9A 4F7FA 3S0DA 1C3ZA 1LS8A 1OOGA 2QDIA 2WCJA 3BFAA 5DICA 1XFRA 1OOIX 2WC5A 3OGNA 1TUJA 3BJHA 3DY9A 2P70A 3QMEA 3R72A 3R1PA 3PJIA 3D74A 3L4AA 2JPOA 3S0EA 3RZSA 1DQEA 3R1VA 3CYZA 1ORGA 1P28A 3D73A 3CZ1A 3CABA 3DYEA 1C3YA 3FE6A 3D76A 3L4LA 2WCMA 3K1EA 3Q8IA 3D78A 3V2LA 3L47A 5EL2A 3D75A 3S0FA 4FQTA 3B7AA 1QWVA 2L2CA 3VB1A 1GM0A 2QEVA 3B86A 4PT1A 2WC6A 3CZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCH A;  1TWO A;  3CZ0 A;  4INW A;  3R1O A;  2WCL A;  2H8V A;  3D77 A;  4JD9 A;  2P71 A;  2QEH A;  3BFB A;  3BFH A;  3CDN A;  3B87 A;  2QEB A;  2QEO A;  2ERB A;  1OW4 A;  3S0B A;  2FJY A;  4INX A;  3NHI A;  2KPH A;  3DXL A;  3S0G A;  3N7H A;  1OOH A;  3B88 A;  2WCK A;  1T14 A;  2PQL A;  3DZT A;  3FE8 A;  1OOF A;  3S0A A;  2GTE A;  3B6X A;  3NGV A;  4OZD A;  3NHT A;  3FE9 A;  4F7F A;  3S0D A;  1C3Z A;  1LS8 A;  1OOG A;  2QDI A;  2WCJ A;  3BFA A;  5DIC A;  1XFR A;  1OOI X;  2WC5 A;  3OGN A;  1TUJ A;  3BJH A;  3DY9 A;  2P70 A;  3QME A;  3R72 A;  3R1P A;  3PJI A;  3D74 A;  3L4A A;  2JPO A;  3S0E A;  3RZS A;  1DQE A;  3R1V A;  3CYZ A;  1ORG A;  1P28 A;  3D73 A;  3CZ1 A;  3CAB A;  3DYE A;  1C3Y A;  3FE6 A;  3D76 A;  3L4L A;  2WCM A;  3K1E A;  3Q8I A;  3D78 A;  3V2L A;  3L47 A;  5EL2 A;  3D75 A;  3S0F A;  4FQT A;  3B7A A;  1QWV A;  2L2C A;  3VB1 A;  1GM0 A;  2QEV A;  3B86 A;  4PT1 A;  2WC6 A;  3CZ2 A; 
#chains in the Genus database with same CATH topology
 2WOR A;  3CR4 X;  1U5I B;  2F8P A;  2WCH A;  3CZT X;  1TWO A;  3DD4 A;  4ICB A;  2O60 A;  4OKH A;  2ZFD A;  3TS5 B;  2CXJ A;  4HRH A;  2H2K A;  1SW8 A;  3OX6 A;  1A75 B;  2Y5I A;  5IBW A;  3CS1 A;  2LP2 A;  2LMT A;  4JD9 A;  1J7P A;  2A4J A;  2L51 A;  3BFH A;  1Z4H A;  1IGV A;  2BE6 A;  2WND A;  3B87 A;  1UP5 A;  1LA0 A;  3I5F C;  1K8U A;  2B1U A;  1E8A A;  1S6J A;  3FS7 A;  1CMG A;  3VRQ A;  5TNC A;  1H8B A;  3BOW A;  3IQO A;  2LCP A;  1QS7 A;  2KQY A;  4XJK B;  1NX3 A;  2PAS A;  1TCF A;  3NSL A;  3KEV A;  1BR1 B;  3UO9 A;  2Q91 A;  1EH2 A;  2KFH A;  1RK9 A;  1U5I A;  1UWO A;  2LVK A;  3EVU A;  1OOH A;  1LVC D;  1B4C A;  1HT9 A;  1A75 A;  2KI4 B;  3DVJ A;  4HSZ A;  2BL0 B;  1A03 A;  3DZT A;  2KNE A;  4C0J A;  1OMV A;  3PN7 B;  3I5H B;  3ZWH A;  1RWY A;  5HLV A;  4AOM A;  1B1G A;  2KAY A;  2M97 A;  3OB1 B;  1PUL A;  1PSB A;  2F3Z A;  4P2Y B;  3VRP A;  1SY9 A;  3HX4 A;  5I8N A;  1S1E A;  1CKK A;  2GTE A;  1NUB A;  2CTN A;  1PVA A;  1UHH A;  4PAL A;  3BYA A;  4M2Q A;  5AER A;  4OR9 B;  2NCO A;  3FE9 A;  2LHI A;  2I2R E;  3PFV A;  4XJK A;  1Y1U A;  5KSZ A;  2PMY A;  4L9M A;  1L2O B;  1NX2 A;  1CM1 A;  1LS8 A;  1OOG A;  2VRG A;  3BFA A;  1KFX S;  2LC5 A;  2ZN9 A;  2H61 A;  2LUX A;  3BUX B;  3GK4 X;  1KK7 Z;  2CBL A;  1KK8 B;  2CNP A;  3O78 A;  5I2L A;  1F54 A;  2PAL A;  2WC5 A;  2GV5 A;  1CDN A;  1DJH A;  3BUO B;  1S6C A;  1DMO A;  2SCP A;  3LL8 B;  4DCK A;  1TUJ A;  3FWC A;  1JSA A;  4N1G A;  3DY9 A;  1EG3 A;  2BE4 A;  1J7R A;  4P5O E;  3O2P A;  1A4P A;  1JF0 A;  3JTD B;  5HKW A;  3R1P A;  1TNQ A;  3PJI A;  1IG5 A;  1SL9 A;  2LAP A;  1SCV A;  2JXC A;  1XA5 A;  1YVH A;  2OPO A;  3L4A A;  3R1V A;  1N0Y A;  1DT7 B;  1CMF A;  1JFK A;  1IRJ A;  4NDB A;  1J1D A;  2JUL A;  2KAV A;  2TN4 A;  1SK6 D;  4U8D A;  4XYN A;  4BY5 A;  3CWG A;  3AAK A;  2JRF A;  2JPT A;  1K90 D;  1KSO A;  1OSA A;  2MAZ A;  1LKJ A;  4JPZ B;  2BCB A;  3SG5 A;  1XO5 A;  5I2Q A;  1TNX A;  5HKY A;  1C7W A;  2WCM A;  3AKB A;  1LA3 A;  2ZNE A;  3LK1 A;  2OS8 C;  2L2E A;  3FIA A;  3CLN A;  1SL8 A;  1S3P A;  1RJV A;  2KBM A;  4PCW A;  1L2O C;  1OZS A;  3D10 A;  3SG2 A;  3VRN A;  1X02 A;  2JNF A;  1CTR A;  2KYF A;  5EL2 A;  4ETO A;  1BLQ A;  1XK4 A;  1KFU S;  1YUS A;  3M0W A;  1OMD A;  1AP4 A;  1YRU B;  2L2C A;  4C0K A;  2K60 A;  4MZL A;  5JOL A;  3TUY C;  1J1E A;  3UNW A;  2KSP A;  2ZND A;  1KQV A;  2KLD A;  1IQ5 A;  1ALW A;  1NCZ A;  4WQ2 A;  2F2O A;  3NSI A;  4MRY A;  2BCA A;  1SCM B;  1UHN A;  5KTY A;  2WOS A;  1WY9 A;  3A8R A;  1DTL A;  1QIV A;  5AAN A;  2M29 A;  1SKT A;  1B9A A;  1B8C A;  3PM2 A;  4MVF A;  1YVL A;  3F45 A;  4ORC B;  2P71 A;  1NX1 A;  5AEQ A;  1KFX L;  1XFZ O;  2GGZ A;  3WNX B;  3QRX A;  3EVR A;  1M45 A;  1L7Z A;  4MN0 A;  4TNC A;  1QTX A;  1YUT A;  1GQM A;  1CFP A;  1GJY A;  1BJF A;  2ERB A;  2L50 A;  2JXL A;  1AVS A;  2CT9 A;  2KDH A;  2Y4Q A;  3I5I C;  2E6W A;  1CLL A;  2NXQ A;  2FJY A;  3VRR A;  2EHB A;  4INX A;  3CR2 A;  1SL7 A;  1XFV O;  2KHN A;  1REC A;  2BNX A;  4MZK A;  1IJ6 A;  1FI5 A;  3TDI A;  5FYX A;  2M1K B;  3ICB A;  1J7O A;  1NCY A;  3B88 A;  1QXP A;  2WCK A;  5CSN A;  1XFX O;  4A4C A;  3OX5 A;  3PAL A;  5BPJ A;  1TUZ A;  4F0Z B;  2JOJ A;  1ODB A;  3PLF B;  2RGI A;  2NLN A;  1JC2 A;  1K96 A;  2MA2 A;  1AUI B;  1M46 A;  4I5J A;  2ISD A;  3SG6 A;  1CFC A;  2BKI B;  1OOF A;  4GUK A;  4DUQ A;  1YR5 A;  1CNP A;  3E3R A;  1M31 A;  4PHJ A;  1S26 D;  4QJ4 B;  1NYA A;  3D0Y B;  3NGV A;  4OZD A;  4MEW A;  2K7B A;  2KGB C;  3AKA A;  3KF9 A;  5AXI A;  1TNW A;  2PVB A;  2LVJ A;  2AAO A;  1B7T Y;  2BKH B;  1FBV A;  2JTT A;  4FQO A;  2QAC A;  1R6P A;  2LP3 A;  5CPV A;  3EK4 A;  5DIC A;  2HQW A;  1Y6W A;  5AFP A;  1F71 A;  1BR4 B;  1OE9 B;  2ZKM X;  1W7I B;  1QVI Y;  2LM5 A;  2QPT A;  5B8I B;  1XYD A;  4DRW A;  1YX7 A;  4GAO A;  3SG3 A;  1QAT A;  1TNP A;  4GBA A;  1MR8 A;  1ZOT B;  3TS5 C;  3NSK A;  2NCP A;  1V1G A;  4NDC A;  5D69 A;  3TDU A;  1CLM A;  2JPO A;  2L98 A;  1DQE A;  3SIB A;  1N65 A;  2JQ6 A;  2ZN8 A;  5ER5 A;  3D0Y A;  3SS3 A;  3RM1 A;  1KCY A;  4N5X A;  4ORB B;  1ORG A;  1M63 B;  1P28 A;  1S5G Z;  1EXR A;  3D73 A;  2KFF A;  1JUO A;  4Q04 A;  2LLT A;  1NPQ A;  4GGN A;  2ZRS A;  2JT3 A;  2LLS A;  3EKH A;  1SYM A;  1BOD A;  3D76 A;  4USL A;  3EK8 A;  3LCP C;  1JWD A;  4E68 A;  3O4X A;  4M2P A;  4CLN A;  2BAP A;  2JC2 A;  1QX2 A;  1LXF C;  3D78 A;  4CFR A;  3CR5 X;  4CID A;  3BUW B;  1CDL A;  2H61 C;  3D75 A;  2K7C A;  2KGR A;  4FQT A;  1J7Q A;  1MWN A;  1QWV A;  2JZI A;  2MJW B;  2KI4 C;  4YGD B;  2BL0 C;  2K7D A;  1KWO B;  1GM0 A;  1NP8 A;  1SR6 B;  1ALV A;  3PN7 C;  3I5H C;  1PRW A;  1J55 A;  4R1E A;  4IJ7 A;  2CCM A;  5HYD A;  4YRU A;  1YTZ C;  1FI6 A;  1ZUZ A;  4CPV A;  1G4Y R;  2HPS A;  2Q4U A;  5D7F A;  2K2F A;  1PK0 D;  4INW A;  4NQG A;  1QLS A;  1YUU A;  2E30 A;  2WCL A;  3I5G B;  2H8V A;  5DKQ A;  1B7T Z;  1B8L A;  2AMI A;  3D77 A;  5CSI A;  1DJY A;  1G33 A;  2M7L A;  2I94 A;  2AUC A;  2MHH A;  2PYQ A;  1FW4 A;  1WLM A;  1RTP 1;  2PRU A;  2QEH A;  3IF7 A;  1LIN A;  3CDN A;  3SS5 A;  3NXA A;  1Q80 A;  4YGA A;  2IS9 A;  1QVI Z;  4UPG A;  1MHO A;  2QEB A;  1KK8 C;  1DEK A;  1H4B A;  2KQ6 A;  2K7O A;  2QEO A;  3LLE A;  1OW4 A;  2JNX A;  4PE7 A;  1K94 A;  4KYN A;  3S0B A;  1V1F A;  1RFJ A;  1A2X A;  1W7J B;  1XK4 C;  1DGV A;  2K8M B;  1KSM A;  2MLF C;  3JTD C;  3NHI A;  4GGF A;  1NX0 A;  1DVI A;  1RRO A;  3DXL A;  4HRG A;  3S0G A;  3N7H A;  3EG5 B;  1HQV A;  1KWO C;  1SR6 C;  3ZNI A;  3BUN B;  2EC6 B;  2Y1N A;  1DF0 B;  1KQM B;  1T14 A;  1BF5 A;  2BEC A;  2LMV A;  4MBE A;  5DKN A;  2BCX A;  2V53 A;  3IQQ A;  3VGO A;  2LVI A;  1A29 A;  3O4Y A;  2KLE A;  1IH0 A;  2FJU B;  1DEL A;  3I5G C;  4ZCV A;  1Y0V H;  1OOJ A;  1BMO A;  2KBI A;  3S0A A;  1S5G Y;  1YRT B;  1DJZ A;  5FI2 A;  5PAL A;  3BXK A;  2M1U A;  3HCM A;  1XFU O;  2KI6 D;  1CDP A;  2JWW A;  1IIO A;  3S0D A;  2M49 B;  4M2O A;  5CSJ A;  1QJT A;  3WHT B;  5FI7 A;  1QV0 A;  1CB1 A;  1MUX A;  2FOT A;  2SAS A;  1XFR A;  1FF1 A;  4N1F A;  1YUR A;  2D8N A;  1NSH A;  1DF0 A;  1NIW A;  2F33 A;  3EKJ A;  4MSP A;  4MRX A;  1XVJ A;  1SCM C;  2DOQ A;  4PHN A;  2M8U A;  3AAJ A;  2WCB A;  1UHK A;  1C07 A;  3S0E A;  2WCF A;  1WDC B;  1N2D A;  4PE1 A;  1PSR A;  3CYZ A;  2COL B;  2LV7 A;  5D3O A;  1XFY O;  1CDM A;  1S36 A;  3WXA A;  1DGU A;  2WC8 A;  1EJ3 A;  2K61 A;  1PAL A;  4PE4 A;  1TOP A;  1KFU L;  2JT8 A;  3CAB A;  3KO0 A;  3DYE A;  1SNL A;  2WCE A;  3GK1 A;  1M39 A;  3FE6 A;  1IJ5 A;  4C0L A;  1NWD A;  2JU0 A;  2EGD A;  1K9U A;  1D1O A;  2FCE A;  1VRK A;  3K1E A;  2BBN A;  2LUC A;  3C1V A;  3OBV A;  4A4B A;  4PDZ A;  1R2U A;  4ZCU A;  1AJ4 A;  1MXE A;  1OZO A;  1Y1X A;  3JVT B;  2ZRT A;  2L0P A;  3DVE A;  2LHL A;  2MRD A;  5I2O A;  2F2P A;  3S0F A;  4JWQ A;  2MBX A;  3TZ1 A;  1WRL A;  5G08 A;  2FCD A;  3OP0 A;  1ZAC A;  1CFF A;  2HET A;  3PM8 A;  3B86 A;  1QX7 A;  3OB2 B;  2WC6 A;  1ZMZ A;  3CZ2 A;  3A4U B;  3OHM B;  1XFW O;  1WDC C;  1EG4 A;  3BUM B;  1OQP A;  3CZ0 A;  4GFT A;  2JTZ A;  1QX5 B;  4WQ3 A;  3SJS A;  4DIR A;  5K89 A;  1BU3 A;  1FPW A;  3GOF A;  2JT0 A;  2LE9 B;  3R1O A;  2L5X B;  2LAN A;  5J3X A;  1TTX A;  1AHR A;  1DC1 A;  4BY4 A;  2O5G A;  5GQQ C;  1UUR A;  3LK0 A;  1DJW A;  4QJ3 B;  2HQ8 A;  1TIZ A;  1BOC A;  3BFB A;  1GGW A;  3WHU B;  4YGC B;  3EVV A;  1QLK A;  1K93 D;  2G9B A;  2L4H A;  2M0R A;  2KOT A;  3DVK A;  1JFJ A;  4JQ0 D;  2LLU A;  1WRK A;  4PHK A;  2M7N A;  3SS4 A;  3JVT C;  3SIA A;  3DF0 B;  4I5N B;  5ER4 X;  2HF5 A;  1W9Z A;  2OS8 B;  1G8I A;  4D1E A;  2OTG B;  1SRA A;  2KPH A;  3K21 A;  1Y1A A;  4YGE B;  3TDZ A;  1QV1 A;  4HRE E;  5DKR A;  3GK2 A;  1QAS A;  4GNK B;  1K9K A;  2PQL A;  3TUY B;  3FE8 A;  1TRF A;  4NDD A;  2BBM A;  2G2B A;  5FI6 A;  4OVN F;  4YI9 A;  5JJG A;  3CTN A;  1SBJ A;  3VRO A;  3B6X A;  4YBH B;  1K9P A;  3BQ3 A;  2LMU A;  5CSF A;  4OV2 A;  2KFG A;  3NHT A;  1BT6 A;  2L4I A;  3DVM A;  4F7F A;  2I7A A;  1GGZ A;  3EK7 A;  5HL1 A;  1DJX A;  2M3W A;  3DF0 A;  1F70 A;  4YGB B;  4I5L B;  4FTG A;  1QIW A;  4PE0 A;  2L5Y A;  1C3Z A;  1AJ5 A;  1UHJ A;  2QDI A;  2LNK A;  2R2I A;  2WCJ A;  3H4S E;  4OCI A;  1AK8 A;  1UHI A;  4PHM A;  4I5K A;  1NCX A;  1OOI X;  4WRI A;  2MLE C;  3OGN A;  4GGF C;  2OTG C;  1IWQ A;  2NZ0 A;  3I5I B;  4ORA B;  1JBA A;  2PSR A;  2Y1M A;  5F6T A;  4QJ5 B;  3BJH A;  1F4Q A;  3MSE B;  3SG4 A;  1B8R A;  3FWB A;  5KU1 A;  1F55 A;  2P70 A;  1MXL C;  3KPX A;  3QME A;  3R72 A;  2K0J A;  3D74 A;  2GGM A;  3RZS A;  1DJI A;  2P6B B;  1SMG A;  1CLB A;  3IVT A;  1ZFS A;  2LVV A;  1YX8 A;  1SPY A;  2KI6 C;  1IQ3 A;  2M9G A;  4MZJ A;  4JKT A;  3CZ1 A;  4YI8 A;  3PAT A;  1JF2 A;  3PSR A;  4AQI A;  1C3Y A;  2KAX A;  3CGA A;  1K2H A;  1MQ1 A;  3L4L A;  5HKZ A;  1IKU A;  1F4O A;  4DS7 A;  3O6B A;  3Q8I A;  3KHE A;  4AQJ A;  1EL4 A;  3I5F B;  1CFD A;  1TCO B;  1UUS A;  3SG7 A;  1S6I A;  4GPL B;  1SSE B;  3V2L A;  4CFQ A;  3L47 A;  2K2A A;  1DJG A;  2I18 A;  1PVB A;  1C7V A;  5I94 A;  1B47 A;  1K95 A;  3B7A A;  3RLZ A;  2EC6 C;  1MF8 B;  2F3Y A;  5HLO A;  1KQM C;  1Z2C B;  1CM4 A;  3VB1 A;  3BOW B;  1WLZ A;  1WRZ A;  2QEV A;  1F8H A;  4PT1 A;  4MLW A;  1BG1 A;  4IL1 A;  2KYC A;  1KK7 Y;  2YGU A;  1TN4 A;  1OMR A;  3NSO A; 
#chains in the Genus database with same CATH homology
 2WCH A;  1TWO A;  3CZ0 A;  4INW A;  3R1O A;  2WCL A;  2H8V A;  3D77 A;  4JD9 A;  2P71 A;  2QEH A;  3BFB A;  3BFH A;  3CDN A;  3B87 A;  2QEB A;  2QEO A;  2ERB A;  1OW4 A;  3S0B A;  2FJY A;  4INX A;  3NHI A;  2KPH A;  3DXL A;  3S0G A;  3N7H A;  1OOH A;  3B88 A;  2WCK A;  1T14 A;  2PQL A;  3DZT A;  3FE8 A;  1OOF A;  3S0A A;  2GTE A;  3B6X A;  3NGV A;  4OZD A;  3NHT A;  3FE9 A;  4F7F A;  3S0D A;  1C3Z A;  1LS8 A;  1OOG A;  2QDI A;  2WCJ A;  3BFA A;  5DIC A;  1XFR A;  1OOI X;  2WC5 A;  3OGN A;  1TUJ A;  3BJH A;  3DY9 A;  2P70 A;  3QME A;  3R72 A;  3R1P A;  3PJI A;  3D74 A;  3L4A A;  2JPO A;  3S0E A;  3RZS A;  1DQE A;  3R1V A;  3CYZ A;  1ORG A;  1P28 A;  3D73 A;  3CZ1 A;  3CAB A;  3DYE A;  1C3Y A;  3FE6 A;  3D76 A;  3L4L A;  2WCM A;  3K1E A;  3Q8I A;  3D78 A;  3V2L A;  3L47 A;  5EL2 A;  3D75 A;  3S0F A;  4FQT A;  3B7A A;  1QWV A;  2L2C A;  3VB1 A;  1GM0 A;  2QEV A;  3B86 A;  4PT1 A;  2WC6 A;  3CZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...