1GGZA

Crystal structure of the calmodulin-like protein (hclp) from human epithelial cells
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
144
structure length
144
Chain Sequence
LTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN-RELATED PROTEIN NB-1
publication title Crystal structure of human calmodulin-like protein: insights into its functional role.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 58
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2000-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ggzA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ggzA02
4I5KA 1KK7Y 1ZACA 2MA2A 2NXQA 3EK4A 1QIWA 2HF5A 1J1DA 1C7WA 1SRAA 4GGNA 3BUMB 2KFGA 1D1OA 2KFFA 3O6BA 1IRJA 3BUWB 3O4YA 2PVBA 1J7QA 1KCYA 3KO0A 3OX6A 1WDCC 3DVEA 4QJ4B 1YX7A 2I2RE 2LAPA 1AVSA 1YR5A 4DS7A 5B8IB 2KI6C 2LANA 3DVJA 5HLVA 3KPXA 4QJ5B 5F6TA 4AOMA 3GK2A 1CFDA 2OS8B 3I5HC 3KF9A 4MVFA 1C7VA 4E68A 4YGCB 1B9AA 1RTP1 4AQIA 5AERA 1BG1A 5HKZA 1NUBA 2SASA 3I5GB 2ZN8A 1UP5A 4F0ZB 1XFUO 1B8RA 1M31A 1BJFA 1KQMB 1PRWA 2GGZA 4GGFA 3I5IC 4ORAB 4CLNA 2JWWA 2LVKA 2BECA 4ZCUA 2IS9A 1CDMA 1PSRA 2JULA 1QX5B 2M7LA 1S5GY 1TTXA 2BCAA 2F2OA 4XYNA 1Y6WA 1DT7B 4M2OA 4PE4A 2LMUA 2OTGB 4M2PA 1QVIZ 1SCMB 1SYMA 1XO5A 1AK8A 1AJ4A 4MEWA 4YBHB 3TDIA 4NQGA 3BYAA 1IKUA 4JWQA 1UUSA 1WRKA 1CMGA 1J1EA 3BXKA 3BOWA 1DF0B 4WQ2A 4DCKA 4OKHA 1PULA 1OE9B 1JBAA 2LE9B 3H4SE 2G2BA 1BT6A 3PN7B 1DJIA 4FTGA 1CMFA 1ZOTB 1YVLA 1AUIB 2G9BA 1X02A 5CSFA 4MZLA 1DJXA 2BCBA 1CNPA 3CR5X 3IF7A 2LMVA 4GAOA 1PALA 4OVNF 4QJ3B 4ZCVA 5BPJA 1S6JA 2OS8C 1RFJA 2Y1NA 3GK4X 1OQPA 2LP3A 3EVUA 1KWOB 2FJUB 1RWYA 1SCVA 2LCPA 3I5GC 1NIWA 1UHIA 2CT9A 2JC2A 5ER4X 3SIAA 3RM1A 1B4CA 2QPTA 1KQMC 4PHKA 1CM4A 4NDDA 1XFXO 2WCEA 1LA0A 3IQOA 3O78A 5I2LA 5DKRA 2AAOA 1QLSA 3LCPC 1Y1XA 3FS7A 1J7PA 1B7TY 2L5XB 1LA3A 2K2AA 1EG4A 1HT9A 2FOTA 5AEQA 1DJGA 2K0JA 2OTGC 1B47A 2I18A 1SCMC 1AHRA 2OPOA 3NSKA 5ER5A 2Y4QA 2ZNDA 1F4OA 2WC8A 2MRDA 1ZFSA 1UHKA 1R2UA 1UHHA 3PSRA 4U8DA 1NYAA 1QXPA 2FCDA 3VRQA 2F3ZA 1ALWA 1SMGA 1SNLA 2MBXA 1EXRA 1S36A 4PHNA 1SK6D 1A03A 1F4QA 3IQQA 2BL0B 5CSJA 1LINA 2KSPA 3SIBA 4MRYA 3WNXB 1CKKA 3CWGA 1NP8A 1K9PA 3SG3A 2ZRTA 4MN0A 4MBEA 1QIVA 2JXLA 1UWOA 3LL8B 4XJKB 1W7IB 2COLB 1MXLC 5I8NA 1SW8A 1RROA 2ZN9A 3BUNB 2ISDA 1B1GA 4PDZA 2A4JA 1CDNA 1OMDA 1NX2A 1A75B 4ETOA 1HQVA 2LUXA 3SG7A 1TNPA 2KYCA 2M9GA 4C0KA 2I94A 1KWOC 4N5XA 1QV1A 2LVIA 4R1EA 4PHJA 1JWDA 4YGEB 1DJWA 2F33A 1FI5A 1F54A 1K96A 2L98A 5CSNA 2LVVA 3WXAA 2BKIB 4YGDB 3EKHA 4N1FA 2HETA 1KFXL 5PALA 2CTNA 3ZNIA 1OSAA 2R2IA 2KAVA 1DGVA 1L7ZA 5JJGA 3RLZA 2P6BB 3BUOB 2CCMA 5I2QA 2M1UA 1MUXA 1XK4C 1S5GZ 2K7DA 2BBNA 3K21A 2WCFA 3O2PA 1S1EA 3DF0B 2LV7A 1WY9A 2LNKA 5FYXA 1DJYA 4YI9A 1V1GA 2JPTA 4Q04A 1QTXA 4JQ0D 3TUYB 2LVJA 1SL8A 3MSEB 2M0RA 3LK1A 1K9UA 2BL0C 2EC6B 1KK8B 1KFUS 3NSOA 2DOQA 4ORBB 1CLLA 1QJTA 1DF0A 3F45A 4I5JA 4AQJA 4PE0A 5CPVA 5AXIA 1DJHA 2K8MB 1N0YA 1NCYA 2BE4A 1DGUA 1V1FA 2M1KB 2BCXA 1K2HA 1J7RA 1F71A 1RECA 1F70A 2SCPA 1QATA 2F2PA 5HLOA 1SL7A 1YRUB 2H61C 1PVBA 1OZOA 5I2OA 1F8HA 1TNXA 4DUQA 1B8LA 5K89A 1J7OA 3JVTB 2KOTA 1IGVA 3CR4X 2WOSA 1A29A 3CTNA 2GV5A 4GFTA 5HKWA 1YX8A 2KFHA 2ZNEA 4UPGA 2JQ6A 5D69A 5HKYA 5IBWA 3FWBA 2MLEC 2LHLA 2H2KA 2L4IA 2ZRSA 3D10A 4OR9B 3OB1B 3WHUB 3D0YA 1CLMA 4YI8A 5TNCA 1MQ1A 2D8NA 1U5IA 1YVHA 2LMTA 1NX1A 4WRIA 4TNCA 3SG2A 3ZWHA 2KYFA 4HRHA 1B7TZ 1DMOA 1N2DA 1M39A 4MLWA 1M63B 2NCPA 3ICBA 1FW4A 1BU3A 1TOPA 4A4BA 1NX3A 2RGIA 1S6IA 3PM8A 3FIAA 1MHOA 2CBLA 1YTZC 1MXEA 2PSRA 3TUYC 4MZJA 4YGAA 4DIRA 3BUXB 1TN4A 2KDHA 2BKHB 1QX2A 3KEVA 2EC6C 3AAKA 1KK8C 3BOWB 3PALA 3SJSA 4CPVA 3AAJA 1ZMZA 2PRUA 5DKQA 2WORA 1TRFA 1SR6B 4MSPA 5AANA 1Y1UA 1SY9A 2NZ0A 1JFKA 1UHJA 4PHMA 1L2OB 3TS5B 1XVJA 2KHNA 1FI6A 1YUUA 2V53A 1IJ6A 3NSIA 2K2FA 2K7BA 2HQ8A 1CDPA 1W7JB 4D1EA 2M49B 2JT3A 1KSOA 4ORCB 5D7FA 1BMOA 2JTZA 3JVTC 3I5HB 3QRXA 2KAXA 1F55A 3PN7C 1BR4B 1DJZA 3SG5A 1QV0A 3PATA 4L9MA 3TDUA 3PLFB 4GGFC 1K9KA 1JC2A 5JOLA 1QS7A 1SKTA 2Q4UA 3FWCA 4GNKB 4PCWA 4PE1A 1JF2A 1M45A 1H8BA 1B8CA 3VRNA 2WCBA 3AKAA 1EL4A 1WLZA 3OHMB 1K90D 3VRPA 2JZIA 1CLBA 1TIZA 1Y1AA 3OP0A 5KSZA 1CB1A 3OB2B 1CFPA 4USLA 1QASA 1TCFA 1G33A 1BF5A 1G8IA 3GOFA 1EH2A 1GGZA 2NLNA 2VRGA 2LLTA 1K93D 1DVIA 1ZUZA 1XA5A 3OX5A 4WQ3A 1OMVA 2JT0A 2L2EA 3HCMA 4OCIA 2FCEA 1Y0VH 3EK7A 1S3PA 1SR6C 2MJWB 1RJVA 1FBVA 1L2OC 3TS5C 4MRXA 4BY4A 2PASA 4I5NB 2L51A 2M3WA 1BR1B 1YURA 4HSZA 5J3XA 1WRZA 3VGOA 1A4PA 1MR8A 1EG3A 3A8RA 4CIDA 1JFJA 2KI4B 3JTDB 4GPLB 3DVMA 4PE7A 1XFWO 1K94A 3NXAA 4DRWA 2K7OA 2JOJA 2M8UA 4JPZB 1AJ5A 1GGWA 1YUTA 4IL1A 3TZ1A 2O5GA 2PMYA 1XFZO 3CS1A 5HYDA 2KQYA 2LLUA 4PALA 2AUCA 1EJ3A 4HRGA 2K7CA 1NCZA 4A4CA 4YRUA 3I5FB 4C0LA 4NDCA 2BBMA 1PK0D 3A4UB 5AFPA 1OZSA 1GQMA 1NSHA 1BLQA 5CSIA 3NSLA 2LLSA 1CDLA 1J55A 4N1GA 1RK9A 1LVCD 2EGDA 1CFFA 5GQQC 1JF0A 1CM1A 1QLKA 2GGMA 2HPSA 2KI6D 2ZFDA 3VROA 1IWQA 1KQVA 2MAZA 4CFQA 1E8AA 1TNQA 4I5LB 2JNFA 2JU0A 2LUCA 1KSMA 1BODA 4HREE 3TDZA 1TNWA 4P5OE 1XYDA 2I7AA 2KBIA 1Q80A 2MLFC 1BOCA 1ALVA 1JUOA 1C07A 1XFYO 1OOJA 1KFUL 2EHBA 4GUKA 4M2QA 2JXCA 1QVIY 3CZTX 2AMIA 1XFVO 1XK4A 4MZKA 3GK1A 1IQ5A 2LP2A 1MF8B 4FQOA 1R6PA 3SG6A 1SL9A 2B1UA 2KI4C 1LKJA 1IH0A 3JTDC 2LC5A 1NWDA 2M97A 4GBAA 1VRKA 3E3RA 1JSAA 3LLEA 4BY5A 1IG5A 3EVRA 1N65A 3KHEA 1WRLA 4YGBB 1FPWA 2CNPA 2F3YA 2KNEA 5KU1A 2K61A 3C1VA 2L0PA 3PFVA 1TCOB 3DVKA 3I5FC 2QACA 1YRTB 1UHNA 2JRFA 1DTLA 3EKJA 2LHIA 2KGRA 2M29A 4XJKA 4P2YB 1FF1A 2Q91A 2TN4A 2PALA 2JTTA 3HX4A 2Y1MA 2LM5A 5G08A 1WDCB 1AP4A 1SBJA 2E6WA 3D0YB 1A75A 2BE6A 2L50A 3LK0A 1U5IB 4ICBA 1CFCA 1K95A 2H61A 2M7NA 5DKNA 2MHHA 3CLNA 4CFRA 1NX0A 3VRRA 1H4BA 4OV2A 2HQWA 1PSBA 2E30A 3CR2A 3WHTB 1G4YR 1IQ3A 1A2XA 1ODBA 2JNXA 1M46A 1KFXS 2ZKMX 3I5IB 3M0WA 1GJYA 1CTRA 1S6CA 2CXJA 2KQ6A 2NCOA 3AKBA 4C0JA 1NPQA 4NDBA 1YUSA 1UURA 2KAYA 2KBMA 1OMRA 2L4HA 1KK7Z 1PVAA 2O60A 2Y5IA 1IJ5A 3DF0A 3BQ3A 3CGAA 1SPYA 3EK8A 3EVVA 2F8PA 3DD4A 2WNDA 1MWNA 1S26D 1WLMA 2KGBC 1NCXA 1LXFC 1QX7A 5KTYA 1K8UA 2JT8A 3SG4A
chains in the Genus database with same CATH superfamily
4I5KA 3S0BA 1KK7Y 1ZACA 2MA2A 2NXQA 3EK4A 1QIWA 2HF5A 3D74A 1J1DA 1C7WA 1OOFA 1SRAA 4GGNA 3BUMB 2KFGA 1D1OA 2KFFA 3O6BA 1IRJA 3BUWB 3O4XA 3O4YA 2PVBA 1J7QA 1KCYA 3KO0A 3OX6A 3L4LA 1WDCC 3DVEA 4QJ4B 1YX7A 2I2RE 2LAPA 1AVSA 1YR5A 2WCLA 4DS7A 5B8IB 2KI6C 2LANA 3DVJA 5HLVA 3KPXA 4QJ5B 5F6TA 5FI6A 4AOMA 3GK2A 1CFDA 2OS8B 3I5HC 3KF9A 4MVFA 3B87A 4E68A 4YGCB 1C7VA 1B9AA 1RTP1 4AQIA 5AERA 2YGUA 1BG1A 5HKZA 1NUBA 2SASA 3I5GB 2ZN8A 1UP5A 3K1EA 4F0ZB 1OW4A 2BNXA 1XFUO 3Q8IA 1B8RA 1M31A 1BJFA 1DQEA 1KQMB 1PRWA 2GGZA 3I5IC 4GGFA 4ORAB 3VB1A 4CLNA 2JWWA 2LVKA 2BECA 4ZCUA 2IS9A 1CDMA 1PSRA 2JULA 1QX5B 2M7LA 1S5GY 1TTXA 3S0AA 2BCAA 3OBVA 2F2OA 2QEVA 1Y6WA 4XYNA 1DT7B 4M2OA 4PE4A 2LMUA 2OTGB 4M2PA 1LS8A 1QVIZ 1SCMB 1SYMA 1XO5A 1AK8A 1AJ4A 4MEWA 1OOGA 4YBHB 3TDIA 4NQGA 3BYAA 1IKUA 4JWQA 1UUSA 1WRKA 1CMGA 2WCHA 1J1EA 3BXKA 3BOWA 1DF0B 4WQ2A 4DCKA 4OKHA 1PULA 2PQLA 1OE9B 1JBAA 2LE9B 1TUZA 3H4SE 2G2BA 1BT6A 2WCMA 3PN7B 1DJIA 4FTGA 1CMFA 1ZOTB 1YVLA 1AUIB 2G9BA 1X02A 5CSFA 4MZLA 1DJXA 2BCBA 1CNPA 3CR5X 3IF7A 3CDNA 2LMVA 4GAOA 1PALA 4OVNF 4QJ3B 5FI2A 4ZCVA 5BPJA 1S6JA 2OS8C 1RFJA 2Y1NA 3GK4X 1OQPA 2LP3A 3EVUA 1KWOB 2FJUB 4IJ7A 1RWYA 1SCVA 2LCPA 3I5GC 1NIWA 1UHIA 2CT9A 2JC2A 5ER4X 3SIAA 3CYZA 3RM1A 1B4CA 2QPTA 1KQMC 4PHKA 1CM4A 2K60A 4NDDA 1XFXO 2WCEA 1LA0A 3IQOA 3FE8A 3O78A 5I2LA 5DKRA 2AAOA 1QLSA 3LCPC 1Y1XA 3FS7A 1J7PA 1B7TY 2L5XB 1LA3A 2K2AA 1EG4A 1HT9A 1Z4HA 2BAPA 2FOTA 5AEQA 1DJGA 2K0JA 2OTGC 1B47A 2I18A 1SCMC 1AHRA 2OPOA 3NSKA 5ER5A 3EG5B 2Y4QA 2ZNDA 2PYQA 1F4OA 2WC8A 1IIOA 2MRDA 1ZFSA 1UHKA 1R2UA 1UHHA 3PSRA 4U8DA 1NYAA 1QXPA 2FCDA 3VRQA 2F3ZA 1ALWA 1SMGA 1SNLA 3R1OA 2MBXA 1EXRA 1S36A 4PHNA 3R1PA 1SK6D 1A03A 1F4QA 1OOIX 3IQQA 2BL0B 5CSJA 1LINA 2KSPA 3SIBA 4MRYA 3WNXB 1CKKA 3CWGA 1NP8A 1K9PA 3SG3A 2ZRTA 4MN0A 4MBEA 1QIVA 2JXLA 1UWOA 3LL8B 4XJKB 1W7IB 2COLB 1MXLC 5I8NA 1SW8A 1RROA 2ZN9A 3BUNB 2ISDA 1B1GA 4PDZA 2A4JA 1CDNA 1OMDA 1NX2A 1A75B 4ETOA 1HQVA 2LUXA 3SG7A 1TNPA 2KYCA 2M9GA 4C0KA 3DYEA 2I94A 1KWOC 3S0GA 4N5XA 1QV1A 2LVIA 4R1EA 4PHJA 3RZSA 1JWDA 4YGEB 5I94A 1DJWA 2F33A 2P71A 3D78A 3FE9A 1K96A 2L98A 5CSNA 2LVVA 3WXAA 1F54A 1FI5A 2BKIB 4YGDB 3EKHA 3D76A 4N1FA 2HETA 1KFXL 5PALA 2CTNA 3ZNIA 1OSAA 2R2IA 2KAVA 1DGVA 1L7ZA 5JJGA 3RLZA 3CABA 2P6BB 3BUOB 2CCMA 3D73A 2M1UA 5I2QA 1MUXA 1XK4C 1S5GZ 2K7DA 2BBNA 3K21A 2WCFA 3O2PA 1S1EA 3DF0B 2LV7A 1WY9A 2LNKA 5FYXA 1DJYA 4YI9A 1V1GA 1OOHA 3S0DA 1T14A 2JPTA 4Q04A 3NHIA 1QTXA 4JQ0D 3B88A 3TUYB 2LVJA 1SL8A 3MSEB 2M0RA 3LK1A 1K9UA 2BL0C 2EC6B 1KK8B 1KFUS 3NSOA 2DOQA 4ORBB 1CLLA 1QJTA 1DF0A 3DXLA 3F45A 3CZ1A 4I5JA 3V2LA 4AQJA 4PE0A 5CPVA 5AXIA 1DJHA 2K8MB 1N0YA 1NCYA 2BE4A 1DGUA 1V1FA 2M1KB 2BCXA 1K2HA 1J7RA 4PT1A 1QWVA 1RECA 3SS4A 1F71A 2SCPA 1QATA 2F2PA 5HLOA 3OGNA 3S0EA 1F70A 1SL7A 1YRUB 1Z2CB 2H61C 1PVBA 1OZOA 5I2OA 1F8HA 1TNXA 4DUQA 1B8LA 5K89A 1J7OA 3JVTB 2KOTA 1IGVA 1TWOA 3N7HA 3CR4X 2WOSA 1A29A 3CTNA 2GV5A 4GFTA 5HKWA 1YX8A 2KPHA 2KFHA 2ZNEA 4UPGA 2JQ6A 5D69A 5HKYA 5IBWA 3FWBA 2MLEC 2LHLA 2H2KA 2L4IA 2ZRSA 3D10A 4OR9B 3OB1B 3WHUB 3D0YA 1CLMA 4YI8A 5TNCA 1MQ1A 2D8NA 1U5IA 1YVHA 2LMTA 1NX1A 4WRIA 4TNCA 3SG2A 3ZWHA 2FJYA 2KYFA 1B7TZ 4HRHA 1DMOA 1N2DA 1M39A 4MLWA 2JPOA 1M63B 2NCPA 3BFHA 1FW4A 1BU3A 3ICBA 1TOPA 4A4BA 1NX3A 3L47A 2QEHA 2RGIA 1S6IA 3PM8A 3FIAA 1MHOA 3B86A 2CBLA 1YTZC 1MXEA 2PSRA 3TUYC 4MZJA 4YGAA 4DIRA 3BUXB 1TN4A 2KDHA 2BKHB 1QX2A 3KEVA 2EC6C 3AAKA 1KK8C 3BOWB 3PALA 3SJSA 4CPVA 3AAJA 1ZMZA 2PRUA 5DKQA 2WORA 1TRFA 1SR6B 4MSPA 3DY9A 1Y1UA 1SY9A 2NZ0A 3BFAA 5AANA 1JFKA 1UHJA 4OZDA 4PHMA 1L2OB 3TS5B 1XVJA 2KHNA 1FI6A 1YUUA 2V53A 1IJ6A 3NSIA 2K2FA 2K7BA 2HQ8A 1CDPA 1W7JB 4D1EA 2M49B 1P28A 2JT3A 1KSOA 4ORCB 5D7FA 1BMOA 2JTZA 2L2CA 5DICA 3JVTC 3BFBA 3I5HB 3QRXA 2KAXA 1F55A 3PN7C 1BR4B 1DJZA 3SG5A 1QV0A 3PATA 4L9MA 3SS3A 3TDUA 2L5YA 3PLFB 2WCJA 4GGFC 1K9KA 1JC2A 5JOLA 1QS7A 1SKTA 2Q4UA 3FWCA 4GNKB 4PCWA 4PE1A 1JF2A 1M45A 1H8BA 1B8CA 3VRNA 2WCBA 3AKAA 1EL4A 1WLZA 3OHMB 1K90D 3VRPA 2JZIA 1CLBA 1TIZA 1Y1AA 3OP0A 5KSZA 1CB1A 2ERBA 1DELA 3OB2B 1CFPA 4USLA 1QASA 1TCFA 1G33A 1BF5A 1G8IA 3GOFA 1EH2A 1GGZA 2NLNA 1W9ZA 1C3YA 2VRGA 2LLTA 1K93D 1DVIA 1ZUZA 1XA5A 3B6XA 3OX5A 3R1VA 4WQ3A 1OMVA 2JT0A 2L2EA 3HCMA 4OCIA 3UO9A 2FCEA 1Y0VH 3EK7A 1S3PA 1SR6C 2GTEA 5HL1A 2MJWB 1RJVA 1FBVA 1L2OC 3TS5C 4MRXA 4BY4A 2PASA 2KLDA 2L51A 2M3WA 1XFRA 4I5NB 1BR1B 1YURA 4HSZA 5J3XA 1WRZA 3VGOA 1A4PA 1MR8A 3NGVA 1EG3A 3A8RA 4CIDA 4JD9A 1JFJA 2KI4B 3JTDB 4GPLB 3DVMA 4PE7A 1XFWO 1K94A 2QEBA 3NXAA 1DC1A 4DRWA 2K7OA 2JOJA 2M8UA 4JPZB 1AJ5A 1GGWA 1YUTA 4IL1A 3TZ1A 1SSEB 2O5GA 2PMYA 1XFZO 3CS1A 5HYDA 2KQYA 2LLUA 3D77A 4PALA 2AUCA 1EJ3A 4HRGA 2K7CA 1NCZA 2KLEA 4A4CA 4YRUA 3I5FB 4C0LA 3NHTA 4NDCA 1C3ZA 2BBMA 1PK0D 3A4UB 5AFPA 1OZSA 1GQMA 1NSHA 1BLQA 3SS5A 5CSIA 2QEOA 3NSLA 2LLSA 5D3OA 3PJIA 1CDLA 1J55A 4N1GA 1RK9A 1LVCD 2WC5A 3CZ0A 2EGDA 1CFFA 5GQQC 1JF0A 1ORGA 1CM1A 1QLKA 1GM0A 2GGMA 2HPSA 2KI6D 2ZFDA 3VROA 1IWQA 1KQVA 2MAZA 4CFQA 1E8AA 1TNQA 4I5LB 2JNFA 2JU0A 2LUCA 1KSMA 1BODA 4HREE 3TDZA 1TNWA 4P5OE 5EL2A 3IVTA 1XYDA 3DZTA 3D75A 2I7AA 2KBIA 1Q80A 2MLFC 1BOCA 1ALVA 1JUOA 1C07A 1XFYO 1OOJA 1KFUL 2EHBA 4GUKA 4INXA 4M2QA 2JXCA 1QVIY 3CZTX 2AMIA 1XFVO 1XK4A 4MZKA 3GK1A 1IQ5A 2LP2A 1MF8B 4FQOA 1R6PA 3SG6A 1SL9A 2B1UA 2KI4C 1LKJA 1IH0A 3JTDC 2LC5A 1NWDA 2M97A 4GBAA 4JKTA 1VRKA 3E3RA 1JSAA 3LLEA 4BY5A 1IG5A 3EVRA 1N65A 3KHEA 1WRLA 4YGBB 1FPWA 2CNPA 2F3YA 2KNEA 3UNWA 5KU1A 2K61A 3C1VA 2L0PA 3L4AA 3PFVA 1TCOB 3DVKA 3I5FC 2QACA 1YRTB 1UHNA 2JRFA 1DTLA 3EKJA 2LHIA 4KYNA 2KGRA 2M29A 4XJKA 4P2YB 1FF1A 2Q91A 2TN4A 2PALA 2JTTA 3HX4A 2Y1MA 2LM5A 5G08A 1WDCB 1AP4A 1SBJA 2E6WA 3D0YB 3BJHA 1A75A 2BE6A 2L50A 3LK0A 1U5IB 3B7AA 4ICBA 1CFCA 1K95A 2H61A 2M7NA 5DKNA 2MHHA 3CLNA 4CFRA 1NX0A 3VRRA 1H4BA 4FQTA 4OV2A 2H8VA 2HQWA 1PSBA 2E30A 3CR2A 3CZ2A 1G4YR 3WHTB 1IQ3A 5FI7A 1A2XA 1ODBA 2JNXA 1M46A 1KFXS 2ZKMX 2WC6A 3I5IB 3M0WA 1GJYA 1CTRA 1S6CA 3R72A 2CXJA 2KQ6A 2NCOA 3AKBA 4C0JA 2P70A 1NPQA 4NDBA 1YUSA 3QMEA 1UURA 2KAYA 2KBMA 3PM2A 1OMRA 2L4HA 1KK7Z 1PVAA 3S0FA 2O60A 2Y5IA 1IJ5A 3DF0A 3BQ3A 4INWA 3CGAA 1SPYA 3EK8A 3EVVA 2F8PA 3DD4A 2QDIA 2WNDA 1MWNA 2WCKA 3FE6A 1S26D 1WLMA 1DEKA 2KGBC 1NCXA 1LXFC 1QX7A 5KTYA 1K8UA 2JT8A 4F7FA 3SG4A 1TUJA
chains in the Genus database with same CATH topology
4I5KA 1KK7Y 1ZACA 2MA2A 2NXQA 3EK4A 1QIWA 2HF5A 1J1DA 1C7WA 1SRAA 4GGNA 3BUMB 2KFGA 1D1OA 2KFFA 3O6BA 1IRJA 3BUWB 3O4YA 2PVBA 1J7QA 1KCYA 3KO0A 3OX6A 1WDCC 3DVEA 4QJ4B 1YX7A 2I2RE 2LAPA 1AVSA 1YR5A 4DS7A 5B8IB 2KI6C 2LANA 3DVJA 5HLVA 3KPXA 4QJ5B 5F6TA 4AOMA 3GK2A 1CFDA 2OS8B 3I5HC 3KF9A 4MVFA 1C7VA 4E68A 4YGCB 1B9AA 1RTP1 4AQIA 5AERA 1BG1A 5HKZA 1NUBA 2SASA 3I5GB 2ZN8A 1UP5A 4F0ZB 1XFUO 1B8RA 1M31A 1BJFA 1KQMB 1PRWA 2GGZA 4GGFA 3I5IC 4ORAB 4CLNA 2JWWA 2LVKA 2BECA 4ZCUA 2IS9A 1CDMA 1PSRA 2JULA 1QX5B 2M7LA 1S5GY 1TTXA 2BCAA 2F2OA 4XYNA 1Y6WA 1DT7B 4M2OA 4PE4A 2LMUA 2OTGB 4M2PA 1QVIZ 1SCMB 1SYMA 1XO5A 1AK8A 1AJ4A 4MEWA 4YBHB 3TDIA 4NQGA 3BYAA 1IKUA 4JWQA 1UUSA 1WRKA 1CMGA 1J1EA 3BXKA 3BOWA 1DF0B 4WQ2A 4DCKA 4OKHA 1PULA 1OE9B 1JBAA 2LE9B 3H4SE 2G2BA 1BT6A 3PN7B 1DJIA 4FTGA 1CMFA 1ZOTB 1YVLA 1AUIB 2G9BA 1X02A 5CSFA 4MZLA 1DJXA 2BCBA 1CNPA 3CR5X 3IF7A 2LMVA 4GAOA 1PALA 4OVNF 4QJ3B 4ZCVA 5BPJA 1S6JA 2OS8C 1RFJA 2Y1NA 3GK4X 1OQPA 2LP3A 3EVUA 1KWOB 2FJUB 1RWYA 1SCVA 2LCPA 3I5GC 1NIWA 1UHIA 2CT9A 2JC2A 5ER4X 3SIAA 3RM1A 1B4CA 2QPTA 1KQMC 4PHKA 1CM4A 4NDDA 1XFXO 2WCEA 1LA0A 3IQOA 3O78A 5I2LA 5DKRA 2AAOA 1QLSA 3LCPC 1Y1XA 3FS7A 1J7PA 1B7TY 2L5XB 1LA3A 2K2AA 1EG4A 1HT9A 2FOTA 5AEQA 1DJGA 2K0JA 2OTGC 1B47A 2I18A 1SCMC 1AHRA 2OPOA 3NSKA 5ER5A 2Y4QA 2ZNDA 1F4OA 2WC8A 2MRDA 1ZFSA 1UHKA 1R2UA 1UHHA 3PSRA 4U8DA 1NYAA 1QXPA 2FCDA 3VRQA 2F3ZA 1ALWA 1SMGA 1SNLA 2MBXA 1EXRA 1S36A 4PHNA 1SK6D 1A03A 1F4QA 3IQQA 2BL0B 5CSJA 1LINA 2KSPA 3SIBA 4MRYA 3WNXB 1CKKA 3CWGA 1NP8A 1K9PA 3SG3A 2ZRTA 4MN0A 4MBEA 1QIVA 2JXLA 1UWOA 3LL8B 4XJKB 1W7IB 2COLB 1MXLC 5I8NA 1SW8A 1RROA 2ZN9A 3BUNB 2ISDA 1B1GA 4PDZA 2A4JA 1CDNA 1OMDA 1NX2A 1A75B 4ETOA 1HQVA 2LUXA 3SG7A 1TNPA 2KYCA 2M9GA 4C0KA 2I94A 1KWOC 4N5XA 1QV1A 2LVIA 4R1EA 4PHJA 1JWDA 4YGEB 1DJWA 2F33A 1FI5A 1F54A 1K96A 2L98A 5CSNA 2LVVA 3WXAA 2BKIB 4YGDB 3EKHA 4N1FA 2HETA 1KFXL 5PALA 2CTNA 3ZNIA 1OSAA 2R2IA 2KAVA 1DGVA 1L7ZA 5JJGA 3RLZA 2P6BB 3BUOB 2CCMA 5I2QA 2M1UA 1MUXA 1XK4C 1S5GZ 2K7DA 2BBNA 3K21A 2WCFA 3O2PA 1S1EA 3DF0B 2LV7A 1WY9A 2LNKA 5FYXA 1DJYA 4YI9A 1V1GA 2JPTA 4Q04A 1QTXA 4JQ0D 3TUYB 2LVJA 1SL8A 3MSEB 2M0RA 3LK1A 1K9UA 2BL0C 2EC6B 1KK8B 1KFUS 3NSOA 2DOQA 4ORBB 1CLLA 1QJTA 1DF0A 3F45A 4I5JA 4AQJA 4PE0A 5CPVA 5AXIA 1DJHA 2K8MB 1N0YA 1NCYA 2BE4A 1DGUA 1V1FA 2M1KB 2BCXA 1K2HA 1J7RA 1F71A 1RECA 1F70A 2SCPA 1QATA 2F2PA 5HLOA 1SL7A 1YRUB 2H61C 1PVBA 1OZOA 5I2OA 1F8HA 1TNXA 4DUQA 1B8LA 5K89A 1J7OA 3JVTB 2KOTA 1IGVA 3CR4X 2WOSA 1A29A 3CTNA 2GV5A 4GFTA 5HKWA 1YX8A 2KFHA 2ZNEA 4UPGA 2JQ6A 5D69A 5HKYA 5IBWA 3FWBA 2MLEC 2LHLA 2H2KA 2L4IA 2ZRSA 3D10A 4OR9B 3OB1B 3WHUB 3D0YA 1CLMA 4YI8A 5TNCA 1MQ1A 2D8NA 1U5IA 1YVHA 2LMTA 1NX1A 4WRIA 4TNCA 3SG2A 3ZWHA 2KYFA 4HRHA 1B7TZ 1DMOA 1N2DA 1M39A 4MLWA 1M63B 2NCPA 3ICBA 1FW4A 1BU3A 1TOPA 4A4BA 1NX3A 2RGIA 1S6IA 3PM8A 3FIAA 1MHOA 2CBLA 1YTZC 1MXEA 2PSRA 3TUYC 4MZJA 4YGAA 4DIRA 3BUXB 1TN4A 2KDHA 2BKHB 1QX2A 3KEVA 2EC6C 3AAKA 1KK8C 3BOWB 3PALA 3SJSA 4CPVA 3AAJA 1ZMZA 2PRUA 5DKQA 2WORA 1TRFA 1SR6B 4MSPA 5AANA 1Y1UA 1SY9A 2NZ0A 1JFKA 1UHJA 4PHMA 1L2OB 3TS5B 1XVJA 2KHNA 1FI6A 1YUUA 2V53A 1IJ6A 3NSIA 2K2FA 2K7BA 2HQ8A 1CDPA 1W7JB 4D1EA 2M49B 2JT3A 1KSOA 4ORCB 5D7FA 1BMOA 2JTZA 3JVTC 3I5HB 3QRXA 2KAXA 1F55A 3PN7C 1BR4B 1DJZA 3SG5A 1QV0A 3PATA 4L9MA 3TDUA 3PLFB 4GGFC 1K9KA 1JC2A 5JOLA 1QS7A 1SKTA 2Q4UA 3FWCA 4GNKB 4PCWA 4PE1A 1JF2A 1M45A 1H8BA 1B8CA 3VRNA 2WCBA 3AKAA 1EL4A 1WLZA 3OHMB 1K90D 3VRPA 2JZIA 1CLBA 1TIZA 1Y1AA 3OP0A 5KSZA 1CB1A 3OB2B 1CFPA 4USLA 1QASA 1TCFA 1G33A 1BF5A 1G8IA 3GOFA 1EH2A 1GGZA 2NLNA 2VRGA 2LLTA 1K93D 1DVIA 1ZUZA 1XA5A 3OX5A 4WQ3A 1OMVA 2JT0A 2L2EA 3HCMA 4OCIA 2FCEA 1Y0VH 3EK7A 1S3PA 1SR6C 2MJWB 1RJVA 1FBVA 1L2OC 3TS5C 4MRXA 4BY4A 2PASA 4I5NB 2L51A 2M3WA 1BR1B 1YURA 4HSZA 5J3XA 1WRZA 3VGOA 1A4PA 1MR8A 1EG3A 3A8RA 4CIDA 1JFJA 2KI4B 3JTDB 4GPLB 3DVMA 4PE7A 1XFWO 1K94A 3NXAA 4DRWA 2K7OA 2JOJA 2M8UA 4JPZB 1AJ5A 1GGWA 1YUTA 4IL1A 3TZ1A 2O5GA 2PMYA 1XFZO 3CS1A 5HYDA 2KQYA 2LLUA 4PALA 2AUCA 1EJ3A 4HRGA 2K7CA 1NCZA 4A4CA 4YRUA 3I5FB 4C0LA 4NDCA 2BBMA 1PK0D 3A4UB 5AFPA 1OZSA 1GQMA 1NSHA 1BLQA 5CSIA 3NSLA 2LLSA 1CDLA 1J55A 4N1GA 1RK9A 1LVCD 2EGDA 1CFFA 5GQQC 1JF0A 1CM1A 1QLKA 2GGMA 2HPSA 2KI6D 2ZFDA 3VROA 1IWQA 1KQVA 2MAZA 4CFQA 1E8AA 1TNQA 4I5LB 2JNFA 2JU0A 2LUCA 1KSMA 1BODA 4HREE 3TDZA 1TNWA 4P5OE 1XYDA 2I7AA 2KBIA 1Q80A 2MLFC 1BOCA 1ALVA 1JUOA 1C07A 1XFYO 1OOJA 1KFUL 2EHBA 4GUKA 4M2QA 2JXCA 1QVIY 3CZTX 2AMIA 1XFVO 1XK4A 4MZKA 3GK1A 1IQ5A 2LP2A 1MF8B 4FQOA 1R6PA 3SG6A 1SL9A 2B1UA 2KI4C 1LKJA 1IH0A 3JTDC 2LC5A 1NWDA 2M97A 4GBAA 1VRKA 3E3RA 1JSAA 3LLEA 4BY5A 1IG5A 3EVRA 1N65A 3KHEA 1WRLA 4YGBB 1FPWA 2CNPA 2F3YA 2KNEA 5KU1A 2K61A 3C1VA 2L0PA 3PFVA 1TCOB 3DVKA 3I5FC 2QACA 1YRTB 1UHNA 2JRFA 1DTLA 3EKJA 2LHIA 2KGRA 2M29A 4XJKA 4P2YB 1FF1A 2Q91A 2TN4A 2PALA 2JTTA 3HX4A 2Y1MA 2LM5A 5G08A 1WDCB 1AP4A 1SBJA 2E6WA 3D0YB 1A75A 2BE6A 2L50A 3LK0A 1U5IB 4ICBA 1CFCA 1K95A 2H61A 2M7NA 5DKNA 2MHHA 3CLNA 4CFRA 1NX0A 3VRRA 1H4BA 4OV2A 2HQWA 1PSBA 2E30A 3CR2A 3WHTB 1G4YR 1IQ3A 1A2XA 1ODBA 2JNXA 1M46A 1KFXS 2ZKMX 3I5IB 3M0WA 1GJYA 1CTRA 1S6CA 2CXJA 2KQ6A 2NCOA 3AKBA 4C0JA 1NPQA 4NDBA 1YUSA 1UURA 2KAYA 2KBMA 1OMRA 2L4HA 1KK7Z 1PVAA 2O60A 2Y5IA 1IJ5A 3DF0A 3BQ3A 3CGAA 1SPYA 3EK8A 3EVVA 2F8PA 3DD4A 2WNDA 1MWNA 1S26D 1WLMA 2KGBC 1NCXA 1LXFC 1QX7A 5KTYA 1K8UA 2JT8A 3SG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5K A;  1KK7 Y;  1ZAC A;  2MA2 A;  2NXQ A;  3EK4 A;  1QIW A;  2HF5 A;  1J1D A;  1C7W A;  1SRA A;  4GGN A;  3BUM B;  2KFG A;  1D1O A;  2KFF A;  3O6B A;  1IRJ A;  3BUW B;  3O4Y A;  2PVB A;  1J7Q A;  1KCY A;  3KO0 A;  3OX6 A;  1WDC C;  3DVE A;  4QJ4 B;  1YX7 A;  2I2R E;  2LAP A;  1AVS A;  1YR5 A;  4DS7 A;  5B8I B;  2KI6 C;  2LAN A;  3DVJ A;  5HLV A;  3KPX A;  4QJ5 B;  5F6T A;  4AOM A;  3GK2 A;  1CFD A;  2OS8 B;  3I5H C;  3KF9 A;  4MVF A;  1C7V A;  4E68 A;  4YGC B;  1B9A A;  1RTP 1;  4AQI A;  5AER A;  1BG1 A;  5HKZ A;  1NUB A;  2SAS A;  3I5G B;  2ZN8 A;  1UP5 A;  4F0Z B;  1XFU O;  1B8R A;  1M31 A;  1BJF A;  1KQM B;  1PRW A;  2GGZ A;  4GGF A;  3I5I C;  4ORA B;  4CLN A;  2JWW A;  2LVK A;  2BEC A;  4ZCU A;  2IS9 A;  1CDM A;  1PSR A;  2JUL A;  1QX5 B;  2M7L A;  1S5G Y;  1TTX A;  2BCA A;  2F2O A;  4XYN A;  1Y6W A;  1DT7 B;  4M2O A;  4PE4 A;  2LMU A;  2OTG B;  4M2P A;  1QVI Z;  1SCM B;  1SYM A;  1XO5 A;  1AK8 A;  1AJ4 A;  4MEW A;  4YBH B;  3TDI A;  4NQG A;  3BYA A;  1IKU A;  4JWQ A;  1UUS A;  1WRK A;  1CMG A;  1J1E A;  3BXK A;  3BOW A;  1DF0 B;  4WQ2 A;  4DCK A;  4OKH A;  1PUL A;  1OE9 B;  1JBA A;  2LE9 B;  3H4S E;  2G2B A;  1BT6 A;  3PN7 B;  1DJI A;  4FTG A;  1CMF A;  1ZOT B;  1YVL A;  1AUI B;  2G9B A;  1X02 A;  5CSF A;  4MZL A;  1DJX A;  2BCB A;  1CNP A;  3CR5 X;  3IF7 A;  2LMV A;  4GAO A;  1PAL A;  4OVN F;  4QJ3 B;  4ZCV A;  5BPJ A;  1S6J A;  2OS8 C;  1RFJ A;  2Y1N A;  3GK4 X;  1OQP A;  2LP3 A;  3EVU A;  1KWO B;  2FJU B;  1RWY A;  1SCV A;  2LCP A;  3I5G C;  1NIW A;  1UHI A;  2CT9 A;  2JC2 A;  5ER4 X;  3SIA A;  3RM1 A;  1B4C A;  2QPT A;  1KQM C;  4PHK A;  1CM4 A;  4NDD A;  1XFX O;  2WCE A;  1LA0 A;  3IQO A;  3O78 A;  5I2L A;  5DKR A;  2AAO A;  1QLS A;  3LCP C;  1Y1X A;  3FS7 A;  1J7P A;  1B7T Y;  2L5X B;  1LA3 A;  2K2A A;  1EG4 A;  1HT9 A;  2FOT A;  5AEQ A;  1DJG A;  2K0J A;  2OTG C;  1B47 A;  2I18 A;  1SCM C;  1AHR A;  2OPO A;  3NSK A;  5ER5 A;  2Y4Q A;  2ZND A;  1F4O A;  2WC8 A;  2MRD A;  1ZFS A;  1UHK A;  1R2U A;  1UHH A;  3PSR A;  4U8D A;  1NYA A;  1QXP A;  2FCD A;  3VRQ A;  2F3Z A;  1ALW A;  1SMG A;  1SNL A;  2MBX A;  1EXR A;  1S36 A;  4PHN A;  1SK6 D;  1A03 A;  1F4Q A;  3IQQ A;  2BL0 B;  5CSJ A;  1LIN A;  2KSP A;  3SIB A;  4MRY A;  3WNX B;  1CKK A;  3CWG A;  1NP8 A;  1K9P A;  3SG3 A;  2ZRT A;  4MN0 A;  4MBE A;  1QIV A;  2JXL A;  1UWO A;  3LL8 B;  4XJK B;  1W7I B;  2COL B;  1MXL C;  5I8N A;  1SW8 A;  1RRO A;  2ZN9 A;  3BUN B;  2ISD A;  1B1G A;  4PDZ A;  2A4J A;  1CDN A;  1OMD A;  1NX2 A;  1A75 B;  4ETO A;  1HQV A;  2LUX A;  3SG7 A;  1TNP A;  2KYC A;  2M9G A;  4C0K A;  2I94 A;  1KWO C;  4N5X A;  1QV1 A;  2LVI A;  4R1E A;  4PHJ A;  1JWD A;  4YGE B;  1DJW A;  2F33 A;  1FI5 A;  1F54 A;  1K96 A;  2L98 A;  5CSN A;  2LVV A;  3WXA A;  2BKI B;  4YGD B;  3EKH A;  4N1F A;  2HET A;  1KFX L;  5PAL A;  2CTN A;  3ZNI A;  1OSA A;  2R2I A;  2KAV A;  1DGV A;  1L7Z A;  5JJG A;  3RLZ A;  2P6B B;  3BUO B;  2CCM A;  5I2Q A;  2M1U A;  1MUX A;  1XK4 C;  1S5G Z;  2K7D A;  2BBN A;  3K21 A;  2WCF A;  3O2P A;  1S1E A;  3DF0 B;  2LV7 A;  1WY9 A;  2LNK A;  5FYX A;  1DJY A;  4YI9 A;  1V1G A;  2JPT A;  4Q04 A;  1QTX A;  4JQ0 D;  3TUY B;  2LVJ A;  1SL8 A;  3MSE B;  2M0R A;  3LK1 A;  1K9U A;  2BL0 C;  2EC6 B;  1KK8 B;  1KFU S;  3NSO A;  2DOQ A;  4ORB B;  1CLL A;  1QJT A;  1DF0 A;  3F45 A;  4I5J A;  4AQJ A;  4PE0 A;  5CPV A;  5AXI A;  1DJH A;  2K8M B;  1N0Y A;  1NCY A;  2BE4 A;  1DGU A;  1V1F A;  2M1K B;  2BCX A;  1K2H A;  1J7R A;  1F71 A;  1REC A;  1F70 A;  2SCP A;  1QAT A;  2F2P A;  5HLO A;  1SL7 A;  1YRU B;  2H61 C;  1PVB A;  1OZO A;  5I2O A;  1F8H A;  1TNX A;  4DUQ A;  1B8L A;  5K89 A;  1J7O A;  3JVT B;  2KOT A;  1IGV A;  3CR4 X;  2WOS A;  1A29 A;  3CTN A;  2GV5 A;  4GFT A;  5HKW A;  1YX8 A;  2KFH A;  2ZNE A;  4UPG A;  2JQ6 A;  5D69 A;  5HKY A;  5IBW A;  3FWB A;  2MLE C;  2LHL A;  2H2K A;  2L4I A;  2ZRS A;  3D10 A;  4OR9 B;  3OB1 B;  3WHU B;  3D0Y A;  1CLM A;  4YI8 A;  5TNC A;  1MQ1 A;  2D8N A;  1U5I A;  1YVH A;  2LMT A;  1NX1 A;  4WRI A;  4TNC A;  3SG2 A;  3ZWH A;  2KYF A;  4HRH A;  1B7T Z;  1DMO A;  1N2D A;  1M39 A;  4MLW A;  1M63 B;  2NCP A;  3ICB A;  1FW4 A;  1BU3 A;  1TOP A;  4A4B A;  1NX3 A;  2RGI A;  1S6I A;  3PM8 A;  3FIA A;  1MHO A;  2CBL A;  1YTZ C;  1MXE A;  2PSR A;  3TUY C;  4MZJ A;  4YGA A;  4DIR A;  3BUX B;  1TN4 A;  2KDH A;  2BKH B;  1QX2 A;  3KEV A;  2EC6 C;  3AAK A;  1KK8 C;  3BOW B;  3PAL A;  3SJS A;  4CPV A;  3AAJ A;  1ZMZ A;  2PRU A;  5DKQ A;  2WOR A;  1TRF A;  1SR6 B;  4MSP A;  5AAN A;  1Y1U A;  1SY9 A;  2NZ0 A;  1JFK A;  1UHJ A;  4PHM A;  1L2O B;  3TS5 B;  1XVJ A;  2KHN A;  1FI6 A;  1YUU A;  2V53 A;  1IJ6 A;  3NSI A;  2K2F A;  2K7B A;  2HQ8 A;  1CDP A;  1W7J B;  4D1E A;  2M49 B;  2JT3 A;  1KSO A;  4ORC B;  5D7F A;  1BMO A;  2JTZ A;  3JVT C;  3I5H B;  3QRX A;  2KAX A;  1F55 A;  3PN7 C;  1BR4 B;  1DJZ A;  3SG5 A;  1QV0 A;  3PAT A;  4L9M A;  3TDU A;  3PLF B;  4GGF C;  1K9K A;  1JC2 A;  5JOL A;  1QS7 A;  1SKT A;  2Q4U A;  3FWC A;  4GNK B;  4PCW A;  4PE1 A;  1JF2 A;  1M45 A;  1H8B A;  1B8C A;  3VRN A;  2WCB A;  3AKA A;  1EL4 A;  1WLZ A;  3OHM B;  1K90 D;  3VRP A;  2JZI A;  1CLB A;  1TIZ A;  1Y1A A;  3OP0 A;  5KSZ A;  1CB1 A;  3OB2 B;  1CFP A;  4USL A;  1QAS A;  1TCF A;  1G33 A;  1BF5 A;  1G8I A;  3GOF A;  1EH2 A;  1GGZ A;  2NLN A;  2VRG A;  2LLT A;  1K93 D;  1DVI A;  1ZUZ A;  1XA5 A;  3OX5 A;  4WQ3 A;  1OMV A;  2JT0 A;  2L2E A;  3HCM A;  4OCI A;  2FCE A;  1Y0V H;  3EK7 A;  1S3P A;  1SR6 C;  2MJW B;  1RJV A;  1FBV A;  1L2O C;  3TS5 C;  4MRX A;  4BY4 A;  2PAS A;  4I5N B;  2L51 A;  2M3W A;  1BR1 B;  1YUR A;  4HSZ A;  5J3X A;  1WRZ A;  3VGO A;  1A4P A;  1MR8 A;  1EG3 A;  3A8R A;  4CID A;  1JFJ A;  2KI4 B;  3JTD B;  4GPL B;  3DVM A;  4PE7 A;  1XFW O;  1K94 A;  3NXA A;  4DRW A;  2K7O A;  2JOJ A;  2M8U A;  4JPZ B;  1AJ5 A;  1GGW A;  1YUT A;  4IL1 A;  3TZ1 A;  2O5G A;  2PMY A;  1XFZ O;  3CS1 A;  5HYD A;  2KQY A;  2LLU A;  4PAL A;  2AUC A;  1EJ3 A;  4HRG A;  2K7C A;  1NCZ A;  4A4C A;  4YRU A;  3I5F B;  4C0L A;  4NDC A;  2BBM A;  1PK0 D;  3A4U B;  5AFP A;  1OZS A;  1GQM A;  1NSH A;  1BLQ A;  5CSI A;  3NSL A;  2LLS A;  1CDL A;  1J55 A;  4N1G A;  1RK9 A;  1LVC D;  2EGD A;  1CFF A;  5GQQ C;  1JF0 A;  1CM1 A;  1QLK A;  2GGM A;  2HPS A;  2KI6 D;  2ZFD A;  3VRO A;  1IWQ A;  1KQV A;  2MAZ A;  4CFQ A;  1E8A A;  1TNQ A;  4I5L B;  2JNF A;  2JU0 A;  2LUC A;  1KSM A;  1BOD A;  4HRE E;  3TDZ A;  1TNW A;  4P5O E;  1XYD A;  2I7A A;  2KBI A;  1Q80 A;  2MLF C;  1BOC A;  1ALV A;  1JUO A;  1C07 A;  1XFY O;  1OOJ A;  1KFU L;  2EHB A;  4GUK A;  4M2Q A;  2JXC A;  1QVI Y;  3CZT X;  2AMI A;  1XFV O;  1XK4 A;  4MZK A;  3GK1 A;  1IQ5 A;  2LP2 A;  1MF8 B;  4FQO A;  1R6P A;  3SG6 A;  1SL9 A;  2B1U A;  2KI4 C;  1LKJ A;  1IH0 A;  3JTD C;  2LC5 A;  1NWD A;  2M97 A;  4GBA A;  1VRK A;  3E3R A;  1JSA A;  3LLE A;  4BY5 A;  1IG5 A;  3EVR A;  1N65 A;  3KHE A;  1WRL A;  4YGB B;  1FPW A;  2CNP A;  2F3Y A;  2KNE A;  5KU1 A;  2K61 A;  3C1V A;  2L0P A;  3PFV A;  1TCO B;  3DVK A;  3I5F C;  2QAC A;  1YRT B;  1UHN A;  2JRF A;  1DTL A;  3EKJ A;  2LHI A;  2KGR A;  2M29 A;  4XJK A;  4P2Y B;  1FF1 A;  2Q91 A;  2TN4 A;  2PAL A;  2JTT A;  3HX4 A;  2Y1M A;  2LM5 A;  5G08 A;  1WDC B;  1AP4 A;  1SBJ A;  2E6W A;  3D0Y B;  1A75 A;  2BE6 A;  2L50 A;  3LK0 A;  1U5I B;  4ICB A;  1CFC A;  1K95 A;  2H61 A;  2M7N A;  5DKN A;  2MHH A;  3CLN A;  4CFR A;  1NX0 A;  3VRR A;  1H4B A;  4OV2 A;  2HQW A;  1PSB A;  2E30 A;  3CR2 A;  3WHT B;  1G4Y R;  1IQ3 A;  1A2X A;  1ODB A;  2JNX A;  1M46 A;  1KFX S;  2ZKM X;  3I5I B;  3M0W A;  1GJY A;  1CTR A;  1S6C A;  2CXJ A;  2KQ6 A;  2NCO A;  3AKB A;  4C0J A;  1NPQ A;  4NDB A;  1YUS A;  1UUR A;  2KAY A;  2KBM A;  1OMR A;  2L4H A;  1KK7 Z;  1PVA A;  2O60 A;  2Y5I A;  1IJ5 A;  3DF0 A;  3BQ3 A;  3CGA A;  1SPY A;  3EK8 A;  3EVV A;  2F8P A;  3DD4 A;  2WND A;  1MWN A;  1S26 D;  1WLM A;  2KGB C;  1NCX A;  1LXF C;  1QX7 A;  5KTY A;  1K8U A;  2JT8 A;  3SG4 A; 
#chains in the Genus database with same CATH topology
 4I5K A;  3S0B A;  1KK7 Y;  1ZAC A;  2MA2 A;  2NXQ A;  3EK4 A;  1QIW A;  2HF5 A;  3D74 A;  1J1D A;  1C7W A;  1OOF A;  1SRA A;  4GGN A;  3BUM B;  2KFG A;  1D1O A;  2KFF A;  3O6B A;  1IRJ A;  3BUW B;  3O4X A;  3O4Y A;  2PVB A;  1J7Q A;  1KCY A;  3KO0 A;  3OX6 A;  3L4L A;  1WDC C;  3DVE A;  4QJ4 B;  1YX7 A;  2I2R E;  2LAP A;  1AVS A;  1YR5 A;  2WCL A;  4DS7 A;  5B8I B;  2KI6 C;  2LAN A;  3DVJ A;  5HLV A;  3KPX A;  4QJ5 B;  5F6T A;  5FI6 A;  4AOM A;  3GK2 A;  1CFD A;  2OS8 B;  3I5H C;  3KF9 A;  4MVF A;  3B87 A;  4E68 A;  4YGC B;  1C7V A;  1B9A A;  1RTP 1;  4AQI A;  5AER A;  2YGU A;  1BG1 A;  5HKZ A;  1NUB A;  2SAS A;  3I5G B;  2ZN8 A;  1UP5 A;  3K1E A;  4F0Z B;  1OW4 A;  2BNX A;  1XFU O;  3Q8I A;  1B8R A;  1M31 A;  1BJF A;  1DQE A;  1KQM B;  1PRW A;  2GGZ A;  3I5I C;  4GGF A;  4ORA B;  3VB1 A;  4CLN A;  2JWW A;  2LVK A;  2BEC A;  4ZCU A;  2IS9 A;  1CDM A;  1PSR A;  2JUL A;  1QX5 B;  2M7L A;  1S5G Y;  1TTX A;  3S0A A;  2BCA A;  3OBV A;  2F2O A;  2QEV A;  1Y6W A;  4XYN A;  1DT7 B;  4M2O A;  4PE4 A;  2LMU A;  2OTG B;  4M2P A;  1LS8 A;  1QVI Z;  1SCM B;  1SYM A;  1XO5 A;  1AK8 A;  1AJ4 A;  4MEW A;  1OOG A;  4YBH B;  3TDI A;  4NQG A;  3BYA A;  1IKU A;  4JWQ A;  1UUS A;  1WRK A;  1CMG A;  2WCH A;  1J1E A;  3BXK A;  3BOW A;  1DF0 B;  4WQ2 A;  4DCK A;  4OKH A;  1PUL A;  2PQL A;  1OE9 B;  1JBA A;  2LE9 B;  1TUZ A;  3H4S E;  2G2B A;  1BT6 A;  2WCM A;  3PN7 B;  1DJI A;  4FTG A;  1CMF A;  1ZOT B;  1YVL A;  1AUI B;  2G9B A;  1X02 A;  5CSF A;  4MZL A;  1DJX A;  2BCB A;  1CNP A;  3CR5 X;  3IF7 A;  3CDN A;  2LMV A;  4GAO A;  1PAL A;  4OVN F;  4QJ3 B;  5FI2 A;  4ZCV A;  5BPJ A;  1S6J A;  2OS8 C;  1RFJ A;  2Y1N A;  3GK4 X;  1OQP A;  2LP3 A;  3EVU A;  1KWO B;  2FJU B;  4IJ7 A;  1RWY A;  1SCV A;  2LCP A;  3I5G C;  1NIW A;  1UHI A;  2CT9 A;  2JC2 A;  5ER4 X;  3SIA A;  3CYZ A;  3RM1 A;  1B4C A;  2QPT A;  1KQM C;  4PHK A;  1CM4 A;  2K60 A;  4NDD A;  1XFX O;  2WCE A;  1LA0 A;  3IQO A;  3FE8 A;  3O78 A;  5I2L A;  5DKR A;  2AAO A;  1QLS A;  3LCP C;  1Y1X A;  3FS7 A;  1J7P A;  1B7T Y;  2L5X B;  1LA3 A;  2K2A A;  1EG4 A;  1HT9 A;  1Z4H A;  2BAP A;  2FOT A;  5AEQ A;  1DJG A;  2K0J A;  2OTG C;  1B47 A;  2I18 A;  1SCM C;  1AHR A;  2OPO A;  3NSK A;  5ER5 A;  3EG5 B;  2Y4Q A;  2ZND A;  2PYQ A;  1F4O A;  2WC8 A;  1IIO A;  2MRD A;  1ZFS A;  1UHK A;  1R2U A;  1UHH A;  3PSR A;  4U8D A;  1NYA A;  1QXP A;  2FCD A;  3VRQ A;  2F3Z A;  1ALW A;  1SMG A;  1SNL A;  3R1O A;  2MBX A;  1EXR A;  1S36 A;  4PHN A;  3R1P A;  1SK6 D;  1A03 A;  1F4Q A;  1OOI X;  3IQQ A;  2BL0 B;  5CSJ A;  1LIN A;  2KSP A;  3SIB A;  4MRY A;  3WNX B;  1CKK A;  3CWG A;  1NP8 A;  1K9P A;  3SG3 A;  2ZRT A;  4MN0 A;  4MBE A;  1QIV A;  2JXL A;  1UWO A;  3LL8 B;  4XJK B;  1W7I B;  2COL B;  1MXL C;  5I8N A;  1SW8 A;  1RRO A;  2ZN9 A;  3BUN B;  2ISD A;  1B1G A;  4PDZ A;  2A4J A;  1CDN A;  1OMD A;  1NX2 A;  1A75 B;  4ETO A;  1HQV A;  2LUX A;  3SG7 A;  1TNP A;  2KYC A;  2M9G A;  4C0K A;  3DYE A;  2I94 A;  1KWO C;  3S0G A;  4N5X A;  1QV1 A;  2LVI A;  4R1E A;  4PHJ A;  3RZS A;  1JWD A;  4YGE B;  5I94 A;  1DJW A;  2F33 A;  2P71 A;  3D78 A;  3FE9 A;  1K96 A;  2L98 A;  5CSN A;  2LVV A;  3WXA A;  1F54 A;  1FI5 A;  2BKI B;  4YGD B;  3EKH A;  3D76 A;  4N1F A;  2HET A;  1KFX L;  5PAL A;  2CTN A;  3ZNI A;  1OSA A;  2R2I A;  2KAV A;  1DGV A;  1L7Z A;  5JJG A;  3RLZ A;  3CAB A;  2P6B B;  3BUO B;  2CCM A;  3D73 A;  2M1U A;  5I2Q A;  1MUX A;  1XK4 C;  1S5G Z;  2K7D A;  2BBN A;  3K21 A;  2WCF A;  3O2P A;  1S1E A;  3DF0 B;  2LV7 A;  1WY9 A;  2LNK A;  5FYX A;  1DJY A;  4YI9 A;  1V1G A;  1OOH A;  3S0D A;  1T14 A;  2JPT A;  4Q04 A;  3NHI A;  1QTX A;  4JQ0 D;  3B88 A;  3TUY B;  2LVJ A;  1SL8 A;  3MSE B;  2M0R A;  3LK1 A;  1K9U A;  2BL0 C;  2EC6 B;  1KK8 B;  1KFU S;  3NSO A;  2DOQ A;  4ORB B;  1CLL A;  1QJT A;  1DF0 A;  3DXL A;  3F45 A;  3CZ1 A;  4I5J A;  3V2L A;  4AQJ A;  4PE0 A;  5CPV A;  5AXI A;  1DJH A;  2K8M B;  1N0Y A;  1NCY A;  2BE4 A;  1DGU A;  1V1F A;  2M1K B;  2BCX A;  1K2H A;  1J7R A;  4PT1 A;  1QWV A;  1REC A;  3SS4 A;  1F71 A;  2SCP A;  1QAT A;  2F2P A;  5HLO A;  3OGN A;  3S0E A;  1F70 A;  1SL7 A;  1YRU B;  1Z2C B;  2H61 C;  1PVB A;  1OZO A;  5I2O A;  1F8H A;  1TNX A;  4DUQ A;  1B8L A;  5K89 A;  1J7O A;  3JVT B;  2KOT A;  1IGV A;  1TWO A;  3N7H A;  3CR4 X;  2WOS A;  1A29 A;  3CTN A;  2GV5 A;  4GFT A;  5HKW A;  1YX8 A;  2KPH A;  2KFH A;  2ZNE A;  4UPG A;  2JQ6 A;  5D69 A;  5HKY A;  5IBW A;  3FWB A;  2MLE C;  2LHL A;  2H2K A;  2L4I A;  2ZRS A;  3D10 A;  4OR9 B;  3OB1 B;  3WHU B;  3D0Y A;  1CLM A;  4YI8 A;  5TNC A;  1MQ1 A;  2D8N A;  1U5I A;  1YVH A;  2LMT A;  1NX1 A;  4WRI A;  4TNC A;  3SG2 A;  3ZWH A;  2FJY A;  2KYF A;  1B7T Z;  4HRH A;  1DMO A;  1N2D A;  1M39 A;  4MLW A;  2JPO A;  1M63 B;  2NCP A;  3BFH A;  1FW4 A;  1BU3 A;  3ICB A;  1TOP A;  4A4B A;  1NX3 A;  3L47 A;  2QEH A;  2RGI A;  1S6I A;  3PM8 A;  3FIA A;  1MHO A;  3B86 A;  2CBL A;  1YTZ C;  1MXE A;  2PSR A;  3TUY C;  4MZJ A;  4YGA A;  4DIR A;  3BUX B;  1TN4 A;  2KDH A;  2BKH B;  1QX2 A;  3KEV A;  2EC6 C;  3AAK A;  1KK8 C;  3BOW B;  3PAL A;  3SJS A;  4CPV A;  3AAJ A;  1ZMZ A;  2PRU A;  5DKQ A;  2WOR A;  1TRF A;  1SR6 B;  4MSP A;  3DY9 A;  1Y1U A;  1SY9 A;  2NZ0 A;  3BFA A;  5AAN A;  1JFK A;  1UHJ A;  4OZD A;  4PHM A;  1L2O B;  3TS5 B;  1XVJ A;  2KHN A;  1FI6 A;  1YUU A;  2V53 A;  1IJ6 A;  3NSI A;  2K2F A;  2K7B A;  2HQ8 A;  1CDP A;  1W7J B;  4D1E A;  2M49 B;  1P28 A;  2JT3 A;  1KSO A;  4ORC B;  5D7F A;  1BMO A;  2JTZ A;  2L2C A;  5DIC A;  3JVT C;  3BFB A;  3I5H B;  3QRX A;  2KAX A;  1F55 A;  3PN7 C;  1BR4 B;  1DJZ A;  3SG5 A;  1QV0 A;  3PAT A;  4L9M A;  3SS3 A;  3TDU A;  2L5Y A;  3PLF B;  2WCJ A;  4GGF C;  1K9K A;  1JC2 A;  5JOL A;  1QS7 A;  1SKT A;  2Q4U A;  3FWC A;  4GNK B;  4PCW A;  4PE1 A;  1JF2 A;  1M45 A;  1H8B A;  1B8C A;  3VRN A;  2WCB A;  3AKA A;  1EL4 A;  1WLZ A;  3OHM B;  1K90 D;  3VRP A;  2JZI A;  1CLB A;  1TIZ A;  1Y1A A;  3OP0 A;  5KSZ A;  1CB1 A;  2ERB A;  1DEL A;  3OB2 B;  1CFP A;  4USL A;  1QAS A;  1TCF A;  1G33 A;  1BF5 A;  1G8I A;  3GOF A;  1EH2 A;  1GGZ A;  2NLN A;  1W9Z A;  1C3Y A;  2VRG A;  2LLT A;  1K93 D;  1DVI A;  1ZUZ A;  1XA5 A;  3B6X A;  3OX5 A;  3R1V A;  4WQ3 A;  1OMV A;  2JT0 A;  2L2E A;  3HCM A;  4OCI A;  3UO9 A;  2FCE A;  1Y0V H;  3EK7 A;  1S3P A;  1SR6 C;  2GTE A;  5HL1 A;  2MJW B;  1RJV A;  1FBV A;  1L2O C;  3TS5 C;  4MRX A;  4BY4 A;  2PAS A;  2KLD A;  2L51 A;  2M3W A;  1XFR A;  4I5N B;  1BR1 B;  1YUR A;  4HSZ A;  5J3X A;  1WRZ A;  3VGO A;  1A4P A;  1MR8 A;  3NGV A;  1EG3 A;  3A8R A;  4CID A;  4JD9 A;  1JFJ A;  2KI4 B;  3JTD B;  4GPL B;  3DVM A;  4PE7 A;  1XFW O;  1K94 A;  2QEB A;  3NXA A;  1DC1 A;  4DRW A;  2K7O A;  2JOJ A;  2M8U A;  4JPZ B;  1AJ5 A;  1GGW A;  1YUT A;  4IL1 A;  3TZ1 A;  1SSE B;  2O5G A;  2PMY A;  1XFZ O;  3CS1 A;  5HYD A;  2KQY A;  2LLU A;  3D77 A;  4PAL A;  2AUC A;  1EJ3 A;  4HRG A;  2K7C A;  1NCZ A;  2KLE A;  4A4C A;  4YRU A;  3I5F B;  4C0L A;  3NHT A;  4NDC A;  1C3Z A;  2BBM A;  1PK0 D;  3A4U B;  5AFP A;  1OZS A;  1GQM A;  1NSH A;  1BLQ A;  3SS5 A;  5CSI A;  2QEO A;  3NSL A;  2LLS A;  5D3O A;  3PJI A;  1CDL A;  1J55 A;  4N1G A;  1RK9 A;  1LVC D;  2WC5 A;  3CZ0 A;  2EGD A;  1CFF A;  5GQQ C;  1JF0 A;  1ORG A;  1CM1 A;  1QLK A;  1GM0 A;  2GGM A;  2HPS A;  2KI6 D;  2ZFD A;  3VRO A;  1IWQ A;  1KQV A;  2MAZ A;  4CFQ A;  1E8A A;  1TNQ A;  4I5L B;  2JNF A;  2JU0 A;  2LUC A;  1KSM A;  1BOD A;  4HRE E;  3TDZ A;  1TNW A;  4P5O E;  5EL2 A;  3IVT A;  1XYD A;  3DZT A;  3D75 A;  2I7A A;  2KBI A;  1Q80 A;  2MLF C;  1BOC A;  1ALV A;  1JUO A;  1C07 A;  1XFY O;  1OOJ A;  1KFU L;  2EHB A;  4GUK A;  4INX A;  4M2Q A;  2JXC A;  1QVI Y;  3CZT X;  2AMI A;  1XFV O;  1XK4 A;  4MZK A;  3GK1 A;  1IQ5 A;  2LP2 A;  1MF8 B;  4FQO A;  1R6P A;  3SG6 A;  1SL9 A;  2B1U A;  2KI4 C;  1LKJ A;  1IH0 A;  3JTD C;  2LC5 A;  1NWD A;  2M97 A;  4GBA A;  4JKT A;  1VRK A;  3E3R A;  1JSA A;  3LLE A;  4BY5 A;  1IG5 A;  3EVR A;  1N65 A;  3KHE A;  1WRL A;  4YGB B;  1FPW A;  2CNP A;  2F3Y A;  2KNE A;  3UNW A;  5KU1 A;  2K61 A;  3C1V A;  2L0P A;  3L4A A;  3PFV A;  1TCO B;  3DVK A;  3I5F C;  2QAC A;  1YRT B;  1UHN A;  2JRF A;  1DTL A;  3EKJ A;  2LHI A;  4KYN A;  2KGR A;  2M29 A;  4XJK A;  4P2Y B;  1FF1 A;  2Q91 A;  2TN4 A;  2PAL A;  2JTT A;  3HX4 A;  2Y1M A;  2LM5 A;  5G08 A;  1WDC B;  1AP4 A;  1SBJ A;  2E6W A;  3D0Y B;  3BJH A;  1A75 A;  2BE6 A;  2L50 A;  3LK0 A;  1U5I B;  3B7A A;  4ICB A;  1CFC A;  1K95 A;  2H61 A;  2M7N A;  5DKN A;  2MHH A;  3CLN A;  4CFR A;  1NX0 A;  3VRR A;  1H4B A;  4FQT A;  4OV2 A;  2H8V A;  2HQW A;  1PSB A;  2E30 A;  3CR2 A;  3CZ2 A;  1G4Y R;  3WHT B;  1IQ3 A;  5FI7 A;  1A2X A;  1ODB A;  2JNX A;  1M46 A;  1KFX S;  2ZKM X;  2WC6 A;  3I5I B;  3M0W A;  1GJY A;  1CTR A;  1S6C A;  3R72 A;  2CXJ A;  2KQ6 A;  2NCO A;  3AKB A;  4C0J A;  2P70 A;  1NPQ A;  4NDB A;  1YUS A;  3QME A;  1UUR A;  2KAY A;  2KBM A;  3PM2 A;  1OMR A;  2L4H A;  1KK7 Z;  1PVA A;  3S0F A;  2O60 A;  2Y5I A;  1IJ5 A;  3DF0 A;  3BQ3 A;  4INW A;  3CGA A;  1SPY A;  3EK8 A;  3EVV A;  2F8P A;  3DD4 A;  2QDI A;  2WND A;  1MWN A;  2WCK A;  3FE6 A;  1S26 D;  1WLM A;  1DEK A;  2KGB C;  1NCX A;  1LXF C;  1QX7 A;  5KTY A;  1K8U A;  2JT8 A;  4F7F A;  3SG4 A;  1TUJ A; 
#chains in the Genus database with same CATH homology
 4I5K A;  1KK7 Y;  1ZAC A;  2MA2 A;  2NXQ A;  3EK4 A;  1QIW A;  2HF5 A;  1J1D A;  1C7W A;  1SRA A;  4GGN A;  3BUM B;  2KFG A;  1D1O A;  2KFF A;  3O6B A;  1IRJ A;  3BUW B;  3O4Y A;  2PVB A;  1J7Q A;  1KCY A;  3KO0 A;  3OX6 A;  1WDC C;  3DVE A;  4QJ4 B;  1YX7 A;  2I2R E;  2LAP A;  1AVS A;  1YR5 A;  4DS7 A;  5B8I B;  2KI6 C;  2LAN A;  3DVJ A;  5HLV A;  3KPX A;  4QJ5 B;  5F6T A;  4AOM A;  3GK2 A;  1CFD A;  2OS8 B;  3I5H C;  3KF9 A;  4MVF A;  1C7V A;  4E68 A;  4YGC B;  1B9A A;  1RTP 1;  4AQI A;  5AER A;  1BG1 A;  5HKZ A;  1NUB A;  2SAS A;  3I5G B;  2ZN8 A;  1UP5 A;  4F0Z B;  1XFU O;  1B8R A;  1M31 A;  1BJF A;  1KQM B;  1PRW A;  2GGZ A;  4GGF A;  3I5I C;  4ORA B;  4CLN A;  2JWW A;  2LVK A;  2BEC A;  4ZCU A;  2IS9 A;  1CDM A;  1PSR A;  2JUL A;  1QX5 B;  2M7L A;  1S5G Y;  1TTX A;  2BCA A;  2F2O A;  4XYN A;  1Y6W A;  1DT7 B;  4M2O A;  4PE4 A;  2LMU A;  2OTG B;  4M2P A;  1QVI Z;  1SCM B;  1SYM A;  1XO5 A;  1AK8 A;  1AJ4 A;  4MEW A;  4YBH B;  3TDI A;  4NQG A;  3BYA A;  1IKU A;  4JWQ A;  1UUS A;  1WRK A;  1CMG A;  1J1E A;  3BXK A;  3BOW A;  1DF0 B;  4WQ2 A;  4DCK A;  4OKH A;  1PUL A;  1OE9 B;  1JBA A;  2LE9 B;  3H4S E;  2G2B A;  1BT6 A;  3PN7 B;  1DJI A;  4FTG A;  1CMF A;  1ZOT B;  1YVL A;  1AUI B;  2G9B A;  1X02 A;  5CSF A;  4MZL A;  1DJX A;  2BCB A;  1CNP A;  3CR5 X;  3IF7 A;  2LMV A;  4GAO A;  1PAL A;  4OVN F;  4QJ3 B;  4ZCV A;  5BPJ A;  1S6J A;  2OS8 C;  1RFJ A;  2Y1N A;  3GK4 X;  1OQP A;  2LP3 A;  3EVU A;  1KWO B;  2FJU B;  1RWY A;  1SCV A;  2LCP A;  3I5G C;  1NIW A;  1UHI A;  2CT9 A;  2JC2 A;  5ER4 X;  3SIA A;  3RM1 A;  1B4C A;  2QPT A;  1KQM C;  4PHK A;  1CM4 A;  4NDD A;  1XFX O;  2WCE A;  1LA0 A;  3IQO A;  3O78 A;  5I2L A;  5DKR A;  2AAO A;  1QLS A;  3LCP C;  1Y1X A;  3FS7 A;  1J7P A;  1B7T Y;  2L5X B;  1LA3 A;  2K2A A;  1EG4 A;  1HT9 A;  2FOT A;  5AEQ A;  1DJG A;  2K0J A;  2OTG C;  1B47 A;  2I18 A;  1SCM C;  1AHR A;  2OPO A;  3NSK A;  5ER5 A;  2Y4Q A;  2ZND A;  1F4O A;  2WC8 A;  2MRD A;  1ZFS A;  1UHK A;  1R2U A;  1UHH A;  3PSR A;  4U8D A;  1NYA A;  1QXP A;  2FCD A;  3VRQ A;  2F3Z A;  1ALW A;  1SMG A;  1SNL A;  2MBX A;  1EXR A;  1S36 A;  4PHN A;  1SK6 D;  1A03 A;  1F4Q A;  3IQQ A;  2BL0 B;  5CSJ A;  1LIN A;  2KSP A;  3SIB A;  4MRY A;  3WNX B;  1CKK A;  3CWG A;  1NP8 A;  1K9P A;  3SG3 A;  2ZRT A;  4MN0 A;  4MBE A;  1QIV A;  2JXL A;  1UWO A;  3LL8 B;  4XJK B;  1W7I B;  2COL B;  1MXL C;  5I8N A;  1SW8 A;  1RRO A;  2ZN9 A;  3BUN B;  2ISD A;  1B1G A;  4PDZ A;  2A4J A;  1CDN A;  1OMD A;  1NX2 A;  1A75 B;  4ETO A;  1HQV A;  2LUX A;  3SG7 A;  1TNP A;  2KYC A;  2M9G A;  4C0K A;  2I94 A;  1KWO C;  4N5X A;  1QV1 A;  2LVI A;  4R1E A;  4PHJ A;  1JWD A;  4YGE B;  1DJW A;  2F33 A;  1FI5 A;  1F54 A;  1K96 A;  2L98 A;  5CSN A;  2LVV A;  3WXA A;  2BKI B;  4YGD B;  3EKH A;  4N1F A;  2HET A;  1KFX L;  5PAL A;  2CTN A;  3ZNI A;  1OSA A;  2R2I A;  2KAV A;  1DGV A;  1L7Z A;  5JJG A;  3RLZ A;  2P6B B;  3BUO B;  2CCM A;  5I2Q A;  2M1U A;  1MUX A;  1XK4 C;  1S5G Z;  2K7D A;  2BBN A;  3K21 A;  2WCF A;  3O2P A;  1S1E A;  3DF0 B;  2LV7 A;  1WY9 A;  2LNK A;  5FYX A;  1DJY A;  4YI9 A;  1V1G A;  2JPT A;  4Q04 A;  1QTX A;  4JQ0 D;  3TUY B;  2LVJ A;  1SL8 A;  3MSE B;  2M0R A;  3LK1 A;  1K9U A;  2BL0 C;  2EC6 B;  1KK8 B;  1KFU S;  3NSO A;  2DOQ A;  4ORB B;  1CLL A;  1QJT A;  1DF0 A;  3F45 A;  4I5J A;  4AQJ A;  4PE0 A;  5CPV A;  5AXI A;  1DJH A;  2K8M B;  1N0Y A;  1NCY A;  2BE4 A;  1DGU A;  1V1F A;  2M1K B;  2BCX A;  1K2H A;  1J7R A;  1F71 A;  1REC A;  1F70 A;  2SCP A;  1QAT A;  2F2P A;  5HLO A;  1SL7 A;  1YRU B;  2H61 C;  1PVB A;  1OZO A;  5I2O A;  1F8H A;  1TNX A;  4DUQ A;  1B8L A;  5K89 A;  1J7O A;  3JVT B;  2KOT A;  1IGV A;  3CR4 X;  2WOS A;  1A29 A;  3CTN A;  2GV5 A;  4GFT A;  5HKW A;  1YX8 A;  2KFH A;  2ZNE A;  4UPG A;  2JQ6 A;  5D69 A;  5HKY A;  5IBW A;  3FWB A;  2MLE C;  2LHL A;  2H2K A;  2L4I A;  2ZRS A;  3D10 A;  4OR9 B;  3OB1 B;  3WHU B;  3D0Y A;  1CLM A;  4YI8 A;  5TNC A;  1MQ1 A;  2D8N A;  1U5I A;  1YVH A;  2LMT A;  1NX1 A;  4WRI A;  4TNC A;  3SG2 A;  3ZWH A;  2KYF A;  4HRH A;  1B7T Z;  1DMO A;  1N2D A;  1M39 A;  4MLW A;  1M63 B;  2NCP A;  3ICB A;  1FW4 A;  1BU3 A;  1TOP A;  4A4B A;  1NX3 A;  2RGI A;  1S6I A;  3PM8 A;  3FIA A;  1MHO A;  2CBL A;  1YTZ C;  1MXE A;  2PSR A;  3TUY C;  4MZJ A;  4YGA A;  4DIR A;  3BUX B;  1TN4 A;  2KDH A;  2BKH B;  1QX2 A;  3KEV A;  2EC6 C;  3AAK A;  1KK8 C;  3BOW B;  3PAL A;  3SJS A;  4CPV A;  3AAJ A;  1ZMZ A;  2PRU A;  5DKQ A;  2WOR A;  1TRF A;  1SR6 B;  4MSP A;  5AAN A;  1Y1U A;  1SY9 A;  2NZ0 A;  1JFK A;  1UHJ A;  4PHM A;  1L2O B;  3TS5 B;  1XVJ A;  2KHN A;  1FI6 A;  1YUU A;  2V53 A;  1IJ6 A;  3NSI A;  2K2F A;  2K7B A;  2HQ8 A;  1CDP A;  1W7J B;  4D1E A;  2M49 B;  2JT3 A;  1KSO A;  4ORC B;  5D7F A;  1BMO A;  2JTZ A;  3JVT C;  3I5H B;  3QRX A;  2KAX A;  1F55 A;  3PN7 C;  1BR4 B;  1DJZ A;  3SG5 A;  1QV0 A;  3PAT A;  4L9M A;  3TDU A;  3PLF B;  4GGF C;  1K9K A;  1JC2 A;  5JOL A;  1QS7 A;  1SKT A;  2Q4U A;  3FWC A;  4GNK B;  4PCW A;  4PE1 A;  1JF2 A;  1M45 A;  1H8B A;  1B8C A;  3VRN A;  2WCB A;  3AKA A;  1EL4 A;  1WLZ A;  3OHM B;  1K90 D;  3VRP A;  2JZI A;  1CLB A;  1TIZ A;  1Y1A A;  3OP0 A;  5KSZ A;  1CB1 A;  3OB2 B;  1CFP A;  4USL A;  1QAS A;  1TCF A;  1G33 A;  1BF5 A;  1G8I A;  3GOF A;  1EH2 A;  1GGZ A;  2NLN A;  2VRG A;  2LLT A;  1K93 D;  1DVI A;  1ZUZ A;  1XA5 A;  3OX5 A;  4WQ3 A;  1OMV A;  2JT0 A;  2L2E A;  3HCM A;  4OCI A;  2FCE A;  1Y0V H;  3EK7 A;  1S3P A;  1SR6 C;  2MJW B;  1RJV A;  1FBV A;  1L2O C;  3TS5 C;  4MRX A;  4BY4 A;  2PAS A;  4I5N B;  2L51 A;  2M3W A;  1BR1 B;  1YUR A;  4HSZ A;  5J3X A;  1WRZ A;  3VGO A;  1A4P A;  1MR8 A;  1EG3 A;  3A8R A;  4CID A;  1JFJ A;  2KI4 B;  3JTD B;  4GPL B;  3DVM A;  4PE7 A;  1XFW O;  1K94 A;  3NXA A;  4DRW A;  2K7O A;  2JOJ A;  2M8U A;  4JPZ B;  1AJ5 A;  1GGW A;  1YUT A;  4IL1 A;  3TZ1 A;  2O5G A;  2PMY A;  1XFZ O;  3CS1 A;  5HYD A;  2KQY A;  2LLU A;  4PAL A;  2AUC A;  1EJ3 A;  4HRG A;  2K7C A;  1NCZ A;  4A4C A;  4YRU A;  3I5F B;  4C0L A;  4NDC A;  2BBM A;  1PK0 D;  3A4U B;  5AFP A;  1OZS A;  1GQM A;  1NSH A;  1BLQ A;  5CSI A;  3NSL A;  2LLS A;  1CDL A;  1J55 A;  4N1G A;  1RK9 A;  1LVC D;  2EGD A;  1CFF A;  5GQQ C;  1JF0 A;  1CM1 A;  1QLK A;  2GGM A;  2HPS A;  2KI6 D;  2ZFD A;  3VRO A;  1IWQ A;  1KQV A;  2MAZ A;  4CFQ A;  1E8A A;  1TNQ A;  4I5L B;  2JNF A;  2JU0 A;  2LUC A;  1KSM A;  1BOD A;  4HRE E;  3TDZ A;  1TNW A;  4P5O E;  1XYD A;  2I7A A;  2KBI A;  1Q80 A;  2MLF C;  1BOC A;  1ALV A;  1JUO A;  1C07 A;  1XFY O;  1OOJ A;  1KFU L;  2EHB A;  4GUK A;  4M2Q A;  2JXC A;  1QVI Y;  3CZT X;  2AMI A;  1XFV O;  1XK4 A;  4MZK A;  3GK1 A;  1IQ5 A;  2LP2 A;  1MF8 B;  4FQO A;  1R6P A;  3SG6 A;  1SL9 A;  2B1U A;  2KI4 C;  1LKJ A;  1IH0 A;  3JTD C;  2LC5 A;  1NWD A;  2M97 A;  4GBA A;  1VRK A;  3E3R A;  1JSA A;  3LLE A;  4BY5 A;  1IG5 A;  3EVR A;  1N65 A;  3KHE A;  1WRL A;  4YGB B;  1FPW A;  2CNP A;  2F3Y A;  2KNE A;  5KU1 A;  2K61 A;  3C1V A;  2L0P A;  3PFV A;  1TCO B;  3DVK A;  3I5F C;  2QAC A;  1YRT B;  1UHN A;  2JRF A;  1DTL A;  3EKJ A;  2LHI A;  2KGR A;  2M29 A;  4XJK A;  4P2Y B;  1FF1 A;  2Q91 A;  2TN4 A;  2PAL A;  2JTT A;  3HX4 A;  2Y1M A;  2LM5 A;  5G08 A;  1WDC B;  1AP4 A;  1SBJ A;  2E6W A;  3D0Y B;  1A75 A;  2BE6 A;  2L50 A;  3LK0 A;  1U5I B;  4ICB A;  1CFC A;  1K95 A;  2H61 A;  2M7N A;  5DKN A;  2MHH A;  3CLN A;  4CFR A;  1NX0 A;  3VRR A;  1H4B A;  4OV2 A;  2HQW A;  1PSB A;  2E30 A;  3CR2 A;  3WHT B;  1G4Y R;  1IQ3 A;  1A2X A;  1ODB A;  2JNX A;  1M46 A;  1KFX S;  2ZKM X;  3I5I B;  3M0W A;  1GJY A;  1CTR A;  1S6C A;  2CXJ A;  2KQ6 A;  2NCO A;  3AKB A;  4C0J A;  1NPQ A;  4NDB A;  1YUS A;  1UUR A;  2KAY A;  2KBM A;  1OMR A;  2L4H A;  1KK7 Z;  1PVA A;  2O60 A;  2Y5I A;  1IJ5 A;  3DF0 A;  3BQ3 A;  3CGA A;  1SPY A;  3EK8 A;  3EVV A;  2F8P A;  3DD4 A;  2WND A;  1MWN A;  1S26 D;  1WLM A;  2KGB C;  1NCX A;  1LXF C;  1QX7 A;  5KTY A;  1K8U A;  2JT8 A;  3SG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...