2WC6A

Structure of bmori gobp2 (general odorant binding protein 2) with bombykol and water to arg 110
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wc6A00
3B7AA 3QMEA 3OGNA 1TWOA 2PQLA 4PT1A 1T14A 2GTEA 2ERBA 3L47A 3R72A 3L4LA 3NHIA 3CZ1A 3BFBA 2H8VA 3NGVA 4JD9A 3CYZA 5DICA 2QEOA 2L2CA 2WCLA 3FE8A 3V2LA 1OOIX 1DQEA 3B88A 3D74A 3CZ2A 3DZTA 3R1PA 2WC5A 3Q8IA 3DY9A 4INWA 3D73A 3CZ0A 1XFRA 3D77A 3DYEA 3S0GA 1OOHA 2QDIA 2WCHA 2JPOA 3B6XA 3D78A 3BJHA 2WC6A 2FJYA 1P28A 3D76A 3S0FA 3FE9A 3S0DA 3S0BA 2WCMA 3DXLA 5EL2A 3PJIA 3FE6A 4OZDA 1ORGA 3CABA 3S0AA 2P70A 1C3ZA 1LS8A 2QEBA 2WCJA 3B87A 3S0EA 3BFAA 3B86A 3CDNA 3R1OA 1C3YA 1OOFA 3RZSA 3D75A 1OOGA 1GM0A 3N7HA 2P71A 2QEHA 4FQTA 4F7FA 3NHTA 3R1VA 4INXA 3L4AA 1TUJA 3BFHA 2QEVA 1QWVA 3VB1A 1OW4A 3K1EA 2KPHA 2WCKA
chains in the Genus database with same CATH superfamily
2SASA 1DJIA 1FI5A 1CFFA 3FS7A 3FWCA 1K9KA 2BL0B 2AUCA 1HT9A 2MAZA 2K2AA 4CFRA 1TNPA 1YUUA 2ERBA 1B47A 4XJKB 1XFYO 3CS1A 3L47A 4XYNA 3RM1A 2LM5A 3MSEB 2I94A 1K96A 3I5GB 3CZ1A 1S6JA 1WDCC 1YX8A 3O6BA 5G08A 3CYZA 2SCPA 5DICA 4YGCB 3EVUA 3QRXA 1CM4A 3VRNA 2HF5A 2WCLA 1AUIB 1Y1AA 1AJ5A 1C07A 3DD4A 5CSIA 2K7BA 5JJGA 1DMOA 1J55A 5K89A 3BUNB 1WDCB 5HKYA 1H8BA 3DY9A 1R6PA 1G4YR 1FBVA 3K21A 1DJWA 1ZMZA 1UUSA 3D73A 3CZ0A 3DYEA 1SKTA 3FIAA 2LHLA 1BJFA 2QDIA 1UHKA 1F8HA 1UURA 2Q91A 2WCEA 5J3XA 3B6XA 1TCOB 4FQOA 1SL9A 4N5XA 2A4JA 2IS9A 1NIWA 2WCBA 1NCZA 2WC6A 1K95A 2LMTA 3UO9A 1FF1A 1JUOA 1U5IA 1FI6A 5I2QA 1LXFC 4P5OE 3KHEA 2WNDA 2PALA 3AKBA 3OX6A 2H61C 1G33A 1Z4HA 3TDZA 1YURA 1AK8A 3KPXA 3TUYB 2JPTA 1V1GA 1N65A 1KK7Z 2FCDA 3BOWA 3S0BA 1CM1A 2WORA 2JZIA 2HQ8A 1BG1A 2O5GA 3H4SE 1TIZA 1NP8A 1J1EA 3AAJA 3PN7B 1DTLA 2M0RA 1EH2A 4N1FA 2NZ0A 1RECA 3BUWB 1M63B 3FE6A 2AMIA 3SG5A 4NDDA 1B8RA 3C1VA 2PMYA 4BY4A 1K2HA 1F4QA 4OZDA 1XO5A 2LUXA 4WQ3A 4DIRA 1C7WA 1GGZA 1KK7Y 4NQGA 3S0AA 1C3ZA 1LS8A 2QEBA 2K0JA 3AAKA 3DF0B 2JT0A 2KAVA 4GPLB 1QXPA 1YUTA 2KHNA 2K2FA 4WQ2A 1UWOA 3F45A 2KQ6A 1AJ4A 5ER4X 3TS5C 1CNPA 2KYFA 4MRYA 1IRJA 1OMDA 3EKHA 3KO0A 1K90D 2WCFA 1OOFA 3CR2A 1XA5A 4IJ7A 1E8AA 1JF0A 2F3YA 1AHRA 1PVBA 1J1DA 1PULA 1KQVA 3OP0A 3N7HA 2E6WA 2PSRA 3KF9A 1JWDA 2K7OA 2LVIA 3TS5B 4ETOA 2LMVA 2M97A 3CWGA 4OCIA 2LLTA 4M2PA 3ZWHA 3NHTA 1IKUA 1NPQA 2BAPA 2NLNA 1OE9B 4INXA 1WRLA 2KOTA 4PE1A 1NYAA 4ZCVA 3BFHA 4C0LA 4DCKA 4MZKA 2WC8A 1GQMA 5HL1A 4AQJA 4UPGA 2JRFA 2WOSA 4YGBB 1IH0A 2BCXA 3NSIA 5KTYA 2ISDA 1BODA 1AP4A 1IIOA 2DOQA 1Q80A 4MZLA 1DT7B 4CFQA 3IQOA 4DUQA 2M3WA 2Y1MA 1OZOA 2JXCA 3EG5B 2KI4B 4I5NB 2I7AA 1U5IB 3I5FB 3FWBA 2ZNEA 1SCVA 2ZFDA 3TDIA 5I2OA 2JC2A 1S5GZ 1X02A 1RJVA 2K7CA 3L4LA 3NHIA 1OZSA 3EKJA 1F71A 1TNXA 5FI2A 2L98A 3EVRA 1QLKA 4JD9A 3CR4X 3BOWB 3NSLA 1OSAA 3OHMB 3PLFB 5CPVA 2Y5IA 1CLBA 3DVJA 2KAXA 3GK1A 3IVTA 1J7OA 3SG3A 3B88A 4GGNA 2JU0A 2K61A 2PYQA 3GK4X 1PVAA 1FPWA 1WLMA 1QLSA 1A29A 1TRFA 2BKHB 3CLNA 3DF0A 1CFPA 1TNQA 2LE9B 1LVCD 2FCEA 2GGZA 1TUZA 1BLQA 2KDHA 3BUOB 2BCAA 5AEQA 1BOCA 3S0GA 1OOHA 1UHJA 2BE6A 2CCMA 2KI6D 1XFUO 1LA3A 3PALA 2JPOA 2L2EA 3A4UB 4GUKA 2JT3A 2G9BA 2KSPA 2M49B 1YUSA 3BJHA 2M29A 1PALA 4OR9B 4CIDA 1QTXA 3NSOA 4AQIA 1EXRA 3VGOA 3ZNIA 2BCBA 1IGVA 2BKIB 1Y1UA 2K8MB 2WCMA 2CBLA 1SPYA 1SL7A 2Y4QA 5CSJA 2ZN9A 2KYCA 1R2UA 1F70A 1DJHA 1ZOTB 1OOJA 3VRRA 2OTGC 1WRKA 3EK8A 1J7PA 3PJIA 5B8IB 1K94A 2F3ZA 2JT8A 2K60A 2F8PA 1UHHA 4AOMA 4GAOA 4YGAA 1ORGA 2M9GA 3JVTC 3CABA 4MRXA 4ORAB 2VRGA 1QX5B 3RLZA 4CLNA 4P2YB 2P70A 2WCJA 1J7QA 1G8IA 1PSBA 3S0EA 4HREE 1SCMC 2OTGB 1XFZO 5CSNA 3BFAA 1A4PA 5KU1A 1CDMA 2NCOA 2JWWA 2HQWA 1EG3A 1M46A 1YTZC 3CDNA 4DS7A 1XK4C 3R1OA 3JVTB 1C3YA 4QJ3B 1OQPA 2JTTA 2KLEA 2MA2A 2MRDA 2JULA 2EGDA 3I5IC 1GM0A 3IF7A 2H2KA 4YI8A 2L50A 1SCMB 1NCYA 2JQ6A 2ZRTA 3DVKA 4JPZB 4NDCA 1ALWA 2ZKMX 5KSZA 4D1EA 1ALVA 1M45A 1SSEB 1LA0A 3WXAA 1LINA 1MXEA 1S36A 3L4AA 4MEWA 1PRWA 4A4CA 3CR5X 3PFVA 2F33A 1UHIA 5HLVA 1K9UA 2YGUA 3OB1B 2Y1NA 4YBHB 1SW8A 3SG4A 3VB1A 4NDBA 1OW4A 1CLMA 1SY9A 1UHNA 3EK7A 3K1EA 4C0JA 1CDNA 2NXQA 4ORCB 2WCKA 1NSHA 3B7AA 1QIWA 2MLFC 2CTNA 3QMEA 3OGNA 2MLEC 1A75A 1NX2A 2HETA 2QACA 1YX7A 1S6CA 1TWOA 2KI6C 3LK0A 4PHMA 5ER5A 1KFUL 1F55A 4HRHA 2PQLA 4PT1A 2GTEA 2PVBA 3OBVA 1M39A 3HX4A 1N0YA 2MJWB 1IJ6A 1DF0B 2BBMA 2L0PA 1NX0A 2LLUA 2BBNA 2FJUB 1J7RA 3BFBA 4YRUA 1XYDA 1MXLC 1SL8A 5JOLA 2E30A 3NGVA 3O4XA 5D3OA 4A4BA 1BF5A 1JBAA 2TN4A 2L2CA 1DJZA 1DGUA 1QATA 1W7JB 2LP2A 4I5KA 5FI7A 1KQMC 1JSAA 3DVEA 3FE8A 1CTRA 1SYMA 3SJSA 1RFJA 5HKWA 2KQYA 1CMGA 2PRUA 2LV7A 3DZTA 3R1PA 3JTDC 2WC5A 1L7ZA 2COLB 4INWA 1QV0A 4YGEB 1XFRA 3DVMA 1KQMB 2LCPA 4PE4A 1MR8A 1EG4A 2R2IA 3SG2A 1S3PA 2Q4UA 1B8LA 3LCPC 4OVNF 1B7TZ 4TNCA 2LC5A 1TCFA 5AERA 3A8RA 3D78A 3SS3A 2K7DA 2LLSA 4PDZA 2JNFA 2FJYA 2KGRA 1S6IA 1VRKA 3JTDB 3TZ1A 2BNXA 1BMOA 3LK1A 2ZN8A 1P28A 3LLEA 4MN0A 5F6TA 3D76A 4MSPA 4PHNA 3FE9A 3S0DA 1WLZA 1DJXA 1ZFSA 4BY5A 1CDLA 3BUXB 1JF2A 1MWNA 3GK2A 4OKHA 1IQ3A 1XK4A 1B7TY 1B8CA 1RK9A 1A03A 2LMUA 1KSMA 5DKNA 3M0WA 4ICBA 4USLA 1KFXS 4JKTA 1DJGA 4MZJA 1CLLA 4KYNA 1A2XA 1CB1A 2MBXA 4QJ4B 2LHIA 3PM8A 4PHKA 4ZCUA 1DELA 4L9MA 3TDUA 1MUXA 1SK6D 1DVIA 5I94A 2RGIA 2BL0C 1QV1A 1EJ3A 1Y1XA 3B87A 1A75B 1B9AA 5IBWA 1CDPA 5PALA 1IQ5A 2CT9A 3I5HC 1DF0A 1LKJA 3SG6A 1L2OC 3SS5A 3B86A 5FI6A 4YI9A 4PE7A 4JQ0D 2I18A 2V53A 4M2OA 1XFWO 3O2PA 4WRIA 3AKAA 2M8UA 3D75A 2HPSA 1K8UA 1SMGA 2D8NA 1W9ZA 4PE0A 3SS4A 3I5HB 1QS7A 2QEHA 3PATA 4JWQA 5D69A 4I5LB 1C7VA 1L2OB 4FQTA 2L5XB 2KGBC 1XVJA 2KBIA 1CMFA 1KK8C 4GFTA 1Y6WA 3R1VA 3BXKA 1BU3A 1TUJA 5HYDA 1IJ5A 4MBEA 5DKRA 4FTGA 2EC6C 1F54A 2BECA 2L5YA 2CXJA 5D7FA 1BR1B 1F4OA 1WY9A 1YR5A 5I8NA 4YGDB 2AAOA 3OX5A 4DRWA 1KK8B 5CSFA 1NX3A 5HKZA 2JNXA 1BR4B 1DGVA 3TUYC 1T14A 1IWQA 2FOTA 2EC6B 1XFXO 1YRUB 1TTXA 1FW4A 3R72A 4IL1A 4C0KA 4GGFA 1JFJA 1XFVO 1OMVA 3HCMA 1S26D 2H8VA 3VRPA 3PN7C 3PSRA 1YVHA 4MLWA 3VRQA 2QEOA 2G2BA 5AFPA 1UP5A 2OS8C 2LVVA 2P6BB 1PSRA 3V2LA 1OOIX 1DQEA 1EL4A 2L4HA 2LAPA 1RTP1 3I5IB 1GGWA 1NUBA 1MQ1A 3BUMB 1DEKA 3WNXB 4CPVA 3EVVA 3D0YA 2B1UA 2LVKA 4R1EA 3D74A 3CZ2A 4QJ5B 3Q8IA 3NSKA 3BQ3A 5AANA 3WHUB 1IG5A 4MVFA 1ODBA 2KNEA 1Z2CB 2KAYA 3LL8B 1SNLA 2JTZA 3D77A 1YRTB 2JXLA 1NCXA 2OS8B 3EK4A 2WCHA 4U8DA 1KCYA 1S1EA 5GQQC 5HLOA 3OB2B 3CZTX 3BYAA 4M2QA 2KLDA 2M7LA 1KFUS 3E3RA 2M7NA 2O60A 1RROA 3O78A 4XJKA 2M1UA 3S0FA 3IQQA 4Q04A 3ICBA 2I2RE 4E68A 2KFGA 1QASA 2M1KB 4OV2A 1SRAA 1DJYA 2ZNDA 1TOPA 3DXLA 3GOFA 4PHJA 2LVJA 1HQVA 5EL2A 5I2LA 1QJTA 3KEVA 5TNCA 1MHOA 1OMRA 4N1GA 3UNWA 3VROA 4HRGA 3PM2A 4HSZA 1JFKA 1SR6C 1K9PA 2KBMA 2F2PA 2GGMA 4GGFC 3SG7A 2BE4A 1QIVA 1QX2A 1RWYA 2KI4C 5AXIA 1WRZA 2OPOA 1H4BA 1D1OA 1PK0D 1BT6A 3I5FC 1GJYA 4PALA 1N2DA 1QVIZ 3O4YA 1CFDA 1SR6B 2L51A 5DKQA 3SIBA 1CFCA 3RZSA 2LUCA 2QPTA 2PASA 1M31A 1V1FA 3CTNA 2L4IA 1KWOC 1OOGA 4ORBB 1B4CA 1TN4A 2EHBA 1ZUZA 1KSOA 2KFHA 2MHHA 2F2OA 3D10A 2P71A 1Y0VH 1SBJA 5FYXA 1QVIY 2CNPA 4GBAA 1ZACA 4F7FA 4I5JA 1TNWA 1W7IB 3CGAA 4PCWA 3D0YB 2NCPA 3NXAA 2LANA 5BPJA 2ZRSA 4GNKB 1NX1A 3SIAA 1MF8B 1CKKA 2LNKA 2QEVA 2H61A 1K93D 1DC1A 1KWOB 1AVSA 1QWVA 1YVLA 2JOJA 2KFFA 3WHTB 1B1GA 2GV5A 1KFXL 3I5GC 2LP3A 1S5GY 1NWDA 2KPHA 1JC2A 1QX7A 4F0ZB
chains in the Genus database with same CATH topology
3B7AA 3QMEA 3OGNA 1TWOA 2PQLA 4PT1A 1T14A 2GTEA 2ERBA 3L47A 3R72A 3L4LA 3NHIA 3CZ1A 3BFBA 2H8VA 3NGVA 4JD9A 3CYZA 5DICA 2QEOA 2L2CA 2WCLA 3FE8A 3V2LA 1OOIX 1DQEA 3B88A 3D74A 3CZ2A 3DZTA 3R1PA 2WC5A 3Q8IA 3DY9A 4INWA 3D73A 3CZ0A 1XFRA 3D77A 3DYEA 3S0GA 1OOHA 2QDIA 2WCHA 2JPOA 3B6XA 3D78A 3BJHA 2WC6A 2FJYA 1P28A 3D76A 3S0FA 3FE9A 3S0DA 3S0BA 2WCMA 3DXLA 5EL2A 3PJIA 3FE6A 4OZDA 1ORGA 3CABA 3S0AA 2P70A 1C3ZA 1LS8A 2QEBA 2WCJA 3B87A 3S0EA 3BFAA 3B86A 3CDNA 3R1OA 1C3YA 1OOFA 3RZSA 3D75A 1OOGA 1GM0A 3N7HA 2P71A 2QEHA 4FQTA 4F7FA 3NHTA 3R1VA 4INXA 3L4AA 1TUJA 3BFHA 2QEVA 1QWVA 3VB1A 1OW4A 3K1EA 2KPHA 2WCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7A A;  3QME A;  3OGN A;  1TWO A;  2PQL A;  4PT1 A;  1T14 A;  2GTE A;  2ERB A;  3L47 A;  3R72 A;  3L4L A;  3NHI A;  3CZ1 A;  3BFB A;  2H8V A;  3NGV A;  4JD9 A;  3CYZ A;  5DIC A;  2QEO A;  2L2C A;  2WCL A;  3FE8 A;  3V2L A;  1OOI X;  1DQE A;  3B88 A;  3D74 A;  3CZ2 A;  3DZT A;  3R1P A;  2WC5 A;  3Q8I A;  3DY9 A;  4INW A;  3D73 A;  3CZ0 A;  1XFR A;  3D77 A;  3DYE A;  3S0G A;  1OOH A;  2QDI A;  2WCH A;  2JPO A;  3B6X A;  3D78 A;  3BJH A;  2WC6 A;  2FJY A;  1P28 A;  3D76 A;  3S0F A;  3FE9 A;  3S0D A;  3S0B A;  2WCM A;  3DXL A;  5EL2 A;  3PJI A;  3FE6 A;  4OZD A;  1ORG A;  3CAB A;  3S0A A;  2P70 A;  1C3Z A;  1LS8 A;  2QEB A;  2WCJ A;  3B87 A;  3S0E A;  3BFA A;  3B86 A;  3CDN A;  3R1O A;  1C3Y A;  1OOF A;  3RZS A;  3D75 A;  1OOG A;  1GM0 A;  3N7H A;  2P71 A;  2QEH A;  4FQT A;  4F7F A;  3NHT A;  3R1V A;  4INX A;  3L4A A;  1TUJ A;  3BFH A;  2QEV A;  1QWV A;  3VB1 A;  1OW4 A;  3K1E A;  2KPH A;  2WCK A; 
#chains in the Genus database with same CATH topology
 2SAS A;  1DJI A;  1FI5 A;  1CFF A;  3FS7 A;  3FWC A;  1K9K A;  2BL0 B;  2AUC A;  1HT9 A;  2MAZ A;  2K2A A;  4CFR A;  1TNP A;  1YUU A;  2ERB A;  1B47 A;  4XJK B;  1XFY O;  3CS1 A;  3L47 A;  4XYN A;  3RM1 A;  2LM5 A;  3MSE B;  2I94 A;  1K96 A;  3I5G B;  3CZ1 A;  1S6J A;  1WDC C;  1YX8 A;  3O6B A;  5G08 A;  3CYZ A;  2SCP A;  5DIC A;  4YGC B;  3EVU A;  3QRX A;  1CM4 A;  3VRN A;  2HF5 A;  2WCL A;  1AUI B;  1Y1A A;  1AJ5 A;  1C07 A;  3DD4 A;  5CSI A;  2K7B A;  5JJG A;  1DMO A;  1J55 A;  5K89 A;  3BUN B;  1WDC B;  5HKY A;  1H8B A;  3DY9 A;  1R6P A;  1G4Y R;  1FBV A;  3K21 A;  1DJW A;  1ZMZ A;  1UUS A;  3D73 A;  3CZ0 A;  3DYE A;  1SKT A;  3FIA A;  2LHL A;  1BJF A;  2QDI A;  1UHK A;  1F8H A;  1UUR A;  2Q91 A;  2WCE A;  5J3X A;  3B6X A;  1TCO B;  4FQO A;  1SL9 A;  4N5X A;  2A4J A;  2IS9 A;  1NIW A;  2WCB A;  1NCZ A;  2WC6 A;  1K95 A;  2LMT A;  3UO9 A;  1FF1 A;  1JUO A;  1U5I A;  1FI6 A;  5I2Q A;  1LXF C;  4P5O E;  3KHE A;  2WND A;  2PAL A;  3AKB A;  3OX6 A;  2H61 C;  1G33 A;  1Z4H A;  3TDZ A;  1YUR A;  1AK8 A;  3KPX A;  3TUY B;  2JPT A;  1V1G A;  1N65 A;  1KK7 Z;  2FCD A;  3BOW A;  3S0B A;  1CM1 A;  2WOR A;  2JZI A;  2HQ8 A;  1BG1 A;  2O5G A;  3H4S E;  1TIZ A;  1NP8 A;  1J1E A;  3AAJ A;  3PN7 B;  1DTL A;  2M0R A;  1EH2 A;  4N1F A;  2NZ0 A;  1REC A;  3BUW B;  1M63 B;  3FE6 A;  2AMI A;  3SG5 A;  4NDD A;  1B8R A;  3C1V A;  2PMY A;  4BY4 A;  1K2H A;  1F4Q A;  4OZD A;  1XO5 A;  2LUX A;  4WQ3 A;  4DIR A;  1C7W A;  1GGZ A;  1KK7 Y;  4NQG A;  3S0A A;  1C3Z A;  1LS8 A;  2QEB A;  2K0J A;  3AAK A;  3DF0 B;  2JT0 A;  2KAV A;  4GPL B;  1QXP A;  1YUT A;  2KHN A;  2K2F A;  4WQ2 A;  1UWO A;  3F45 A;  2KQ6 A;  1AJ4 A;  5ER4 X;  3TS5 C;  1CNP A;  2KYF A;  4MRY A;  1IRJ A;  1OMD A;  3EKH A;  3KO0 A;  1K90 D;  2WCF A;  1OOF A;  3CR2 A;  1XA5 A;  4IJ7 A;  1E8A A;  1JF0 A;  2F3Y A;  1AHR A;  1PVB A;  1J1D A;  1PUL A;  1KQV A;  3OP0 A;  3N7H A;  2E6W A;  2PSR A;  3KF9 A;  1JWD A;  2K7O A;  2LVI A;  3TS5 B;  4ETO A;  2LMV A;  2M97 A;  3CWG A;  4OCI A;  2LLT A;  4M2P A;  3ZWH A;  3NHT A;  1IKU A;  1NPQ A;  2BAP A;  2NLN A;  1OE9 B;  4INX A;  1WRL A;  2KOT A;  4PE1 A;  1NYA A;  4ZCV A;  3BFH A;  4C0L A;  4DCK A;  4MZK A;  2WC8 A;  1GQM A;  5HL1 A;  4AQJ A;  4UPG A;  2JRF A;  2WOS A;  4YGB B;  1IH0 A;  2BCX A;  3NSI A;  5KTY A;  2ISD A;  1BOD A;  1AP4 A;  1IIO A;  2DOQ A;  1Q80 A;  4MZL A;  1DT7 B;  4CFQ A;  3IQO A;  4DUQ A;  2M3W A;  2Y1M A;  1OZO A;  2JXC A;  3EG5 B;  2KI4 B;  4I5N B;  2I7A A;  1U5I B;  3I5F B;  3FWB A;  2ZNE A;  1SCV A;  2ZFD A;  3TDI A;  5I2O A;  2JC2 A;  1S5G Z;  1X02 A;  1RJV A;  2K7C A;  3L4L A;  3NHI A;  1OZS A;  3EKJ A;  1F71 A;  1TNX A;  5FI2 A;  2L98 A;  3EVR A;  1QLK A;  4JD9 A;  3CR4 X;  3BOW B;  3NSL A;  1OSA A;  3OHM B;  3PLF B;  5CPV A;  2Y5I A;  1CLB A;  3DVJ A;  2KAX A;  3GK1 A;  3IVT A;  1J7O A;  3SG3 A;  3B88 A;  4GGN A;  2JU0 A;  2K61 A;  2PYQ A;  3GK4 X;  1PVA A;  1FPW A;  1WLM A;  1QLS A;  1A29 A;  1TRF A;  2BKH B;  3CLN A;  3DF0 A;  1CFP A;  1TNQ A;  2LE9 B;  1LVC D;  2FCE A;  2GGZ A;  1TUZ A;  1BLQ A;  2KDH A;  3BUO B;  2BCA A;  5AEQ A;  1BOC A;  3S0G A;  1OOH A;  1UHJ A;  2BE6 A;  2CCM A;  2KI6 D;  1XFU O;  1LA3 A;  3PAL A;  2JPO A;  2L2E A;  3A4U B;  4GUK A;  2JT3 A;  2G9B A;  2KSP A;  2M49 B;  1YUS A;  3BJH A;  2M29 A;  1PAL A;  4OR9 B;  4CID A;  1QTX A;  3NSO A;  4AQI A;  1EXR A;  3VGO A;  3ZNI A;  2BCB A;  1IGV A;  2BKI B;  1Y1U A;  2K8M B;  2WCM A;  2CBL A;  1SPY A;  1SL7 A;  2Y4Q A;  5CSJ A;  2ZN9 A;  2KYC A;  1R2U A;  1F70 A;  1DJH A;  1ZOT B;  1OOJ A;  3VRR A;  2OTG C;  1WRK A;  3EK8 A;  1J7P A;  3PJI A;  5B8I B;  1K94 A;  2F3Z A;  2JT8 A;  2K60 A;  2F8P A;  1UHH A;  4AOM A;  4GAO A;  4YGA A;  1ORG A;  2M9G A;  3JVT C;  3CAB A;  4MRX A;  4ORA B;  2VRG A;  1QX5 B;  3RLZ A;  4CLN A;  4P2Y B;  2P70 A;  2WCJ A;  1J7Q A;  1G8I A;  1PSB A;  3S0E A;  4HRE E;  1SCM C;  2OTG B;  1XFZ O;  5CSN A;  3BFA A;  1A4P A;  5KU1 A;  1CDM A;  2NCO A;  2JWW A;  2HQW A;  1EG3 A;  1M46 A;  1YTZ C;  3CDN A;  4DS7 A;  1XK4 C;  3R1O A;  3JVT B;  1C3Y A;  4QJ3 B;  1OQP A;  2JTT A;  2KLE A;  2MA2 A;  2MRD A;  2JUL A;  2EGD A;  3I5I C;  1GM0 A;  3IF7 A;  2H2K A;  4YI8 A;  2L50 A;  1SCM B;  1NCY A;  2JQ6 A;  2ZRT A;  3DVK A;  4JPZ B;  4NDC A;  1ALW A;  2ZKM X;  5KSZ A;  4D1E A;  1ALV A;  1M45 A;  1SSE B;  1LA0 A;  3WXA A;  1LIN A;  1MXE A;  1S36 A;  3L4A A;  4MEW A;  1PRW A;  4A4C A;  3CR5 X;  3PFV A;  2F33 A;  1UHI A;  5HLV A;  1K9U A;  2YGU A;  3OB1 B;  2Y1N A;  4YBH B;  1SW8 A;  3SG4 A;  3VB1 A;  4NDB A;  1OW4 A;  1CLM A;  1SY9 A;  1UHN A;  3EK7 A;  3K1E A;  4C0J A;  1CDN A;  2NXQ A;  4ORC B;  2WCK A;  1NSH A;  3B7A A;  1QIW A;  2MLF C;  2CTN A;  3QME A;  3OGN A;  2MLE C;  1A75 A;  1NX2 A;  2HET A;  2QAC A;  1YX7 A;  1S6C A;  1TWO A;  2KI6 C;  3LK0 A;  4PHM A;  5ER5 A;  1KFU L;  1F55 A;  4HRH A;  2PQL A;  4PT1 A;  2GTE A;  2PVB A;  3OBV A;  1M39 A;  3HX4 A;  1N0Y A;  2MJW B;  1IJ6 A;  1DF0 B;  2BBM A;  2L0P A;  1NX0 A;  2LLU A;  2BBN A;  2FJU B;  1J7R A;  3BFB A;  4YRU A;  1XYD A;  1MXL C;  1SL8 A;  5JOL A;  2E30 A;  3NGV A;  3O4X A;  5D3O A;  4A4B A;  1BF5 A;  1JBA A;  2TN4 A;  2L2C A;  1DJZ A;  1DGU A;  1QAT A;  1W7J B;  2LP2 A;  4I5K A;  5FI7 A;  1KQM C;  1JSA A;  3DVE A;  3FE8 A;  1CTR A;  1SYM A;  3SJS A;  1RFJ A;  5HKW A;  2KQY A;  1CMG A;  2PRU A;  2LV7 A;  3DZT A;  3R1P A;  3JTD C;  2WC5 A;  1L7Z A;  2COL B;  4INW A;  1QV0 A;  4YGE B;  1XFR A;  3DVM A;  1KQM B;  2LCP A;  4PE4 A;  1MR8 A;  1EG4 A;  2R2I A;  3SG2 A;  1S3P A;  2Q4U A;  1B8L A;  3LCP C;  4OVN F;  1B7T Z;  4TNC A;  2LC5 A;  1TCF A;  5AER A;  3A8R A;  3D78 A;  3SS3 A;  2K7D A;  2LLS A;  4PDZ A;  2JNF A;  2FJY A;  2KGR A;  1S6I A;  1VRK A;  3JTD B;  3TZ1 A;  2BNX A;  1BMO A;  3LK1 A;  2ZN8 A;  1P28 A;  3LLE A;  4MN0 A;  5F6T A;  3D76 A;  4MSP A;  4PHN A;  3FE9 A;  3S0D A;  1WLZ A;  1DJX A;  1ZFS A;  4BY5 A;  1CDL A;  3BUX B;  1JF2 A;  1MWN A;  3GK2 A;  4OKH A;  1IQ3 A;  1XK4 A;  1B7T Y;  1B8C A;  1RK9 A;  1A03 A;  2LMU A;  1KSM A;  5DKN A;  3M0W A;  4ICB A;  4USL A;  1KFX S;  4JKT A;  1DJG A;  4MZJ A;  1CLL A;  4KYN A;  1A2X A;  1CB1 A;  2MBX A;  4QJ4 B;  2LHI A;  3PM8 A;  4PHK A;  4ZCU A;  1DEL A;  4L9M A;  3TDU A;  1MUX A;  1SK6 D;  1DVI A;  5I94 A;  2RGI A;  2BL0 C;  1QV1 A;  1EJ3 A;  1Y1X A;  3B87 A;  1A75 B;  1B9A A;  5IBW A;  1CDP A;  5PAL A;  1IQ5 A;  2CT9 A;  3I5H C;  1DF0 A;  1LKJ A;  3SG6 A;  1L2O C;  3SS5 A;  3B86 A;  5FI6 A;  4YI9 A;  4PE7 A;  4JQ0 D;  2I18 A;  2V53 A;  4M2O A;  1XFW O;  3O2P A;  4WRI A;  3AKA A;  2M8U A;  3D75 A;  2HPS A;  1K8U A;  1SMG A;  2D8N A;  1W9Z A;  4PE0 A;  3SS4 A;  3I5H B;  1QS7 A;  2QEH A;  3PAT A;  4JWQ A;  5D69 A;  4I5L B;  1C7V A;  1L2O B;  4FQT A;  2L5X B;  2KGB C;  1XVJ A;  2KBI A;  1CMF A;  1KK8 C;  4GFT A;  1Y6W A;  3R1V A;  3BXK A;  1BU3 A;  1TUJ A;  5HYD A;  1IJ5 A;  4MBE A;  5DKR A;  4FTG A;  2EC6 C;  1F54 A;  2BEC A;  2L5Y A;  2CXJ A;  5D7F A;  1BR1 B;  1F4O A;  1WY9 A;  1YR5 A;  5I8N A;  4YGD B;  2AAO A;  3OX5 A;  4DRW A;  1KK8 B;  5CSF A;  1NX3 A;  5HKZ A;  2JNX A;  1BR4 B;  1DGV A;  3TUY C;  1T14 A;  1IWQ A;  2FOT A;  2EC6 B;  1XFX O;  1YRU B;  1TTX A;  1FW4 A;  3R72 A;  4IL1 A;  4C0K A;  4GGF A;  1JFJ A;  1XFV O;  1OMV A;  3HCM A;  1S26 D;  2H8V A;  3VRP A;  3PN7 C;  3PSR A;  1YVH A;  4MLW A;  3VRQ A;  2QEO A;  2G2B A;  5AFP A;  1UP5 A;  2OS8 C;  2LVV A;  2P6B B;  1PSR A;  3V2L A;  1OOI X;  1DQE A;  1EL4 A;  2L4H A;  2LAP A;  1RTP 1;  3I5I B;  1GGW A;  1NUB A;  1MQ1 A;  3BUM B;  1DEK A;  3WNX B;  4CPV A;  3EVV A;  3D0Y A;  2B1U A;  2LVK A;  4R1E A;  3D74 A;  3CZ2 A;  4QJ5 B;  3Q8I A;  3NSK A;  3BQ3 A;  5AAN A;  3WHU B;  1IG5 A;  4MVF A;  1ODB A;  2KNE A;  1Z2C B;  2KAY A;  3LL8 B;  1SNL A;  2JTZ A;  3D77 A;  1YRT B;  2JXL A;  1NCX A;  2OS8 B;  3EK4 A;  2WCH A;  4U8D A;  1KCY A;  1S1E A;  5GQQ C;  5HLO A;  3OB2 B;  3CZT X;  3BYA A;  4M2Q A;  2KLD A;  2M7L A;  1KFU S;  3E3R A;  2M7N A;  2O60 A;  1RRO A;  3O78 A;  4XJK A;  2M1U A;  3S0F A;  3IQQ A;  4Q04 A;  3ICB A;  2I2R E;  4E68 A;  2KFG A;  1QAS A;  2M1K B;  4OV2 A;  1SRA A;  1DJY A;  2ZND A;  1TOP A;  3DXL A;  3GOF A;  4PHJ A;  2LVJ A;  1HQV A;  5EL2 A;  5I2L A;  1QJT A;  3KEV A;  5TNC A;  1MHO A;  1OMR A;  4N1G A;  3UNW A;  3VRO A;  4HRG A;  3PM2 A;  4HSZ A;  1JFK A;  1SR6 C;  1K9P A;  2KBM A;  2F2P A;  2GGM A;  4GGF C;  3SG7 A;  2BE4 A;  1QIV A;  1QX2 A;  1RWY A;  2KI4 C;  5AXI A;  1WRZ A;  2OPO A;  1H4B A;  1D1O A;  1PK0 D;  1BT6 A;  3I5F C;  1GJY A;  4PAL A;  1N2D A;  1QVI Z;  3O4Y A;  1CFD A;  1SR6 B;  2L51 A;  5DKQ A;  3SIB A;  1CFC A;  3RZS A;  2LUC A;  2QPT A;  2PAS A;  1M31 A;  1V1F A;  3CTN A;  2L4I A;  1KWO C;  1OOG A;  4ORB B;  1B4C A;  1TN4 A;  2EHB A;  1ZUZ A;  1KSO A;  2KFH A;  2MHH A;  2F2O A;  3D10 A;  2P71 A;  1Y0V H;  1SBJ A;  5FYX A;  1QVI Y;  2CNP A;  4GBA A;  1ZAC A;  4F7F A;  4I5J A;  1TNW A;  1W7I B;  3CGA A;  4PCW A;  3D0Y B;  2NCP A;  3NXA A;  2LAN A;  5BPJ A;  2ZRS A;  4GNK B;  1NX1 A;  3SIA A;  1MF8 B;  1CKK A;  2LNK A;  2QEV A;  2H61 A;  1K93 D;  1DC1 A;  1KWO B;  1AVS A;  1QWV A;  1YVL A;  2JOJ A;  2KFF A;  3WHT B;  1B1G A;  2GV5 A;  1KFX L;  3I5G C;  2LP3 A;  1S5G Y;  1NWD A;  2KPH A;  1JC2 A;  1QX7 A;  4F0Z B; 
#chains in the Genus database with same CATH homology
 3B7A A;  3QME A;  3OGN A;  1TWO A;  2PQL A;  4PT1 A;  1T14 A;  2GTE A;  2ERB A;  3L47 A;  3R72 A;  3L4L A;  3NHI A;  3CZ1 A;  3BFB A;  2H8V A;  3NGV A;  4JD9 A;  3CYZ A;  5DIC A;  2QEO A;  2L2C A;  2WCL A;  3FE8 A;  3V2L A;  1OOI X;  1DQE A;  3B88 A;  3D74 A;  3CZ2 A;  3DZT A;  3R1P A;  2WC5 A;  3Q8I A;  3DY9 A;  4INW A;  3D73 A;  3CZ0 A;  1XFR A;  3D77 A;  3DYE A;  3S0G A;  1OOH A;  2QDI A;  2WCH A;  2JPO A;  3B6X A;  3D78 A;  3BJH A;  2WC6 A;  2FJY A;  1P28 A;  3D76 A;  3S0F A;  3FE9 A;  3S0D A;  3S0B A;  2WCM A;  3DXL A;  5EL2 A;  3PJI A;  3FE6 A;  4OZD A;  1ORG A;  3CAB A;  3S0A A;  2P70 A;  1C3Z A;  1LS8 A;  2QEB A;  2WCJ A;  3B87 A;  3S0E A;  3BFA A;  3B86 A;  3CDN A;  3R1O A;  1C3Y A;  1OOF A;  3RZS A;  3D75 A;  1OOG A;  1GM0 A;  3N7H A;  2P71 A;  2QEH A;  4FQT A;  4F7F A;  3NHT A;  3R1V A;  4INX A;  3L4A A;  1TUJ A;  3BFH A;  2QEV A;  1QWV A;  3VB1 A;  1OW4 A;  3K1E A;  2KPH A;  2WCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...