2WC6A

Structure of bmori gobp2 (general odorant binding protein 2) with bombykol and water to arg 110
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wc6A00
2PQLA 3DZTA 3CABA 2WCKA 3D73A 2ERBA 1P28A 3PJIA 1DQEA 1C3ZA 4JD9A 4INXA 3DXLA 1TWOA 3CYZA 3L47A 3V2LA 3FE6A 3B87A 3S0BA 3NGVA 3N7HA 2KPHA 3D77A 3NHTA 1T14A 3FE8A 3VB1A 1OOGA 3D74A 4INWA 3DYEA 1LS8A 3B88A 2P71A 3S0DA 3S0AA 2WCMA 2L2CA 3DY9A 1GM0A 4PT1A 3R1OA 3B7AA 3D78A 3CDNA 1ORGA 3BFHA 3D76A 2QEVA 3R1VA 4FQTA 2WCHA 3L4AA 1TUJA 2H8VA 3Q8IA 2P70A 1C3YA 2WC6A 3R72A 3S0EA 3R1PA 3B86A 1OOHA 2QEBA 3CZ0A 1OOFA 3FE9A 2WC5A 3BFBA 1OOIX 2GTEA 3BFAA 2WCJA 4OZDA 3OGNA 3L4LA 4F7FA 2FJYA 3S0GA 3K1EA 3CZ2A 3QMEA 2JPOA 2QDIA 2WCLA 3S0FA 5DICA 3CZ1A 3BJHA 1XFRA 1OW4A 2QEHA 3B6XA 3D75A 1QWVA 5EL2A 3RZSA 3NHIA 2QEOA
chains in the Genus database with same CATH superfamily
4XYNA 4YBHB 1MXEA 3PN7C 3TDIA 1B4CA 4DCKA 1EJ3A 3KO0A 1KQMB 4NQGA 3O6BA 1S5GY 1JF2A 2JT0A 3VGOA 3D0YB 1K96A 4PE0A 1WRZA 2I2RE 1BODA 1C3ZA 1RECA 1QV0A 1NSHA 2LUXA 4JWQA 1SCMC 3M0WA 3VRRA 1IJ5A 2JTTA 2LLTA 1V1FA 4MBEA 1TIZA 2QPTA 2WCEA 1M39A 1FF1A 2KAXA 1TNQA 1K93D 3EVUA 2KSPA 2KBIA 3NHTA 4PHNA 1QX2A 1F55A 1IH0A 4INWA 5HLVA 2WCBA 3DYEA 1ZMZA 4MZLA 2K7DA 1F70A 5HLOA 2BKIB 2KNEA 3BXKA 2BE4A 1QS7A 3S0DA 1ZACA 5BPJA 1CDPA 3S0AA 3NSKA 1DEKA 5DKNA 2MRDA 3RLZA 5CSIA 1B9AA 1XFYO 2L5XB 1LVCD 1B8LA 2LMUA 1NIWA 4MZKA 3SG2A 4MEWA 4JPZB 4U8DA 3B7AA 4I5NB 1EXRA 1XFVO 4WQ3A 1BT6A 3AAJA 4MRYA 1QASA 1JF0A 2MLEC 3CLNA 1KQVA 1K9UA 4OKHA 1H4BA 1IRJA 1JBAA 1J1EA 1TUJA 3L4AA 2JNFA 1PRWA 1L2OC 2H8VA 3TS5B 1HQVA 2K7BA 2LVKA 2PVBA 3Q8IA 5AFPA 1NX0A 2OTGB 3JVTB 1CFFA 1L7ZA 4GFTA 1OSAA 1W7JB 4KYNA 2LANA 3MSEB 1DJZA 2MHHA 5AANA 4YGBB 3S0EA 1SW8A 3EG5B 4OV2A 2O5GA 2H2KA 4L9MA 1A75B 3OX5A 4HRGA 3A4UB 3DVKA 3TUYB 3CZ0A 2K61A 2PASA 3EVVA 5CSFA 1CLBA 3AKAA 3FIAA 1IKUA 1SL8A 1Y1AA 2HF5A 3DVEA 1QXPA 1OOIX 2IS9A 1A75A 1EG4A 2F3YA 3KF9A 1A2XA 2KQ6A 3NSIA 2JXLA 4XJKB 1TNXA 1QLSA 2LVJA 3BUMB 1AJ5A 1LKJA 3O4YA 1CNPA 4BY4A 1B7TY 1MWNA 3DF0A 1DJWA 1MR8A 3C1VA 4XJKA 1AUIB 3BOWB 2LLUA 2LE9B 3CZ1A 1NP8A 3BJHA 1XFRA 5I2LA 1JC2A 1MQ1A 3B6XA 1XFUO 1SR6B 3D75A 1DMOA 5EL2A 2LUCA 5CSNA 2JC2A 1IQ3A 1WDCC 1GQMA 1MXLC 2EC6C 3BOWA 3CR5X 4QJ5B 1CFDA 4DS7A 5B8IB 2FCDA 1LA0A 2BBMA 1DELA 1WRKA 1NWDA 3CR4X 3EKJA 3N7HA 2PMYA 1S5GZ 4C0JA 4CFQA 1KQMC 2PQLA 1F8HA 1PULA 1UURA 1QIWA 1S3PA 1U5IB 1WY9A 1IWQA 4USLA 1DGVA 1AK8A 4FTGA 1NX1A 3D73A 4GGNA 1ZFSA 4R1EA 3SIBA 2RGIA 1J7OA 3CR2A 2Q91A 1DQEA 1IGVA 2KGBC 1F4QA 1U5IA 1RJVA 2LC5A 3TDZA 2KHNA 1OZOA 5HKYA 1NX2A 1C07A 1TWOA 3SG7A 1BOCA 4N1GA 3L47A 1KWOB 4ZCVA 5KSZA 1A29A 1YVHA 1AP4A 2FCEA 3LL8B 3BUXB 1K8UA 2TN4A 3NGVA 1XFWO 2JQ6A 4M2PA 1WLZA 3CZTX 3FE8A 5PALA 2WCFA 4WRIA 1K9PA 2A4JA 4I5KA 3VB1A 1RFJA 2Q4UA 3SJSA 2JT8A 3D74A 1YURA 1NUBA 2AUCA 2M29A 4AOMA 1QX7A 4CPVA 5IBWA 1GGWA 1IQ5A 2L51A 1QIVA 3ICBA 1B8RA 5JJGA 1IJ6A 1JFKA 2LMVA 2LNKA 5AEQA 1S6IA 3DY9A 2BL0B 1CKKA 1GM0A 1FW4A 2JOJA 4GBAA 5F6TA 1CDMA 4F0ZB 2LHIA 2B1UA 4MN0A 1YUUA 3EKHA 2MA2A 4MRXA 1QATA 1F54A 2KYFA 1TCOB 2FJUB 1KK7Z 1OMRA 2QEVA 4FQOA 2KAYA 1AJ4A 4YI9A 3TS5C 3PSRA 3VRNA 3JVTC 4IJ7A 5DKRA 4JKTA 5KTYA 2YGUA 1NPQA 1Z2CB 2P70A 3D10A 4YGDB 1J7QA 4QJ3B 2K60A 1R6PA 2JTZA 4YGAA 2M7NA 4HSZA 2F3ZA 2K2FA 4M2QA 3I5FB 3VRPA 1X02A 2MJWB 1N65A 3JTDB 1NCYA 3R1PA 3NSLA 1NCXA 1DF0B 2LP2A 2Y5IA 2L2EA 3B86A 5D69A 3WNXB 4JQ0D 2GV5A 2MBXA 2VRGA 1BG1A 1IG5A 1K94A 1LXFC 1YUSA 3IQOA 5D7FA 1TN4A 1XK4A 2F2PA 2G2BA 1RTP1 2SASA 2PSRA 2KAVA 5K89A 2L98A 1B47A 1G4YR 1DF0A 3AKBA 1CM1A 2WOSA 1ALWA 2KOTA 1B8CA 2I18A 3BYAA 2AAOA 1G33A 1KSMA 1Q80A 2WCJA 2K7CA 4WQ2A 1AVSA 3LK0A 2M7LA 1C7VA 4MVFA 1S26D 1KK7Y 1XFZO 3PALA 2V53A 4N1FA 1R2UA 1B7TZ 3EVRA 5ER5A 3A8RA 3OGNA 3L4LA 1CFCA 2KFHA 1TRFA 2FJYA 2JWWA 1CMFA 1GGZA 1SNLA 4YRUA 2QDIA 1UHHA 2WCLA 1DVIA 2G9BA 1CTRA 1BF5A 1SCMB 1SR6C 1N0YA 3TDUA 4C0KA 2QEHA 1EG3A 3CS1A 3HCMA 1A03A 1H8BA 1XO5A 1QJTA 2BECA 2JXCA 5AERA 4NDDA 1FPWA 3NSOA 2CXJA 1YVLA 1CDNA 3PFVA 3SG6A 2GTEA 1UHJA 4MZJA 2KBMA 2L50A 5HYDA 1UWOA 2CBLA 2OPOA 3DF0B 5FI7A 1FI5A 1B1GA 3RM1A 5HKZA 2BCAA 3DVJA 2LV7A 2KI4B 2L5YA 1TNPA 2KYCA 3DZTA 1YTZC 2BCXA 1P28A 2LCPA 3SIAA 2ZNDA 1CB1A 4YI8A 3KHEA 2M1KB 4JD9A 1PK0D 3E3RA 4QJ4B 3PLFB 3DXLA 2PYQA 3CYZA 2CNPA 1NCZA 2SCPA 2HQWA 4Q04A 2NXQA 3V2LA 2FOTA 1TTXA 4OVNF 1J7PA 3FE6A 4YGEB 1K95A 3DVMA 2M49B 3SG4A 2Y1NA 3SG3A 3HX4A 1KK8C 2KPHA 4ICBA 1T14A 1GJYA 5I2QA 3CGAA 1OOGA 4D1EA 5FYXA 1L2OB 2M8UA 2ZN8A 1D1OA 4OCIA 3WXAA 1S6CA 1SPYA 2COLB 2F2OA 3WHTB 2BL0C 1SRAA 2WCMA 2WORA 1AHRA 5TNCA 3GK1A 3I5GB 4AQIA 2F8PA 2M9GA 4ORAB 4DRWA 3R1OA 1SL7A 4ORCB 3I5IB 1KFUS 1CMGA 2H61A 1S36A 4DIRA 5HKWA 2ISDA 3CDNA 1QV1A 2L4IA 3OP0A 1TCFA 1NYAA 3EK7A 4HRHA 4PE7A 1ORGA 3I5HB 3BFHA 3OB2B 2KQYA 3EK4A 1KCYA 1OQPA 1SSEB 4PE4A 2ZKMX 3SG5A 2EGDA 3KPXA 2KGRA 3ZNIA 1OZSA 3OHMB 1SY9A 1C3YA 2NCPA 2JZIA 3LLEA 1RK9A 1QVIZ 2LHLA 4ORBB 1S1EA 5J3XA 3F45A 1XK4C 3JTDC 4E68A 2M1UA 3SS3A 3R72A 2DOQA 2LMTA 4C0LA 5D3OA 4OR9B 2WNDA 4GGFA 1S6JA 1OMVA 3IQQA 2WC8A 2KDHA 1OOHA 5DKQA 1KSOA 4PCWA 1RWYA 1YUTA 2QEBA 3IVTA 2OS8B 1Y1UA 3GK2A 4PDZA 2GGZA 3BFBA 1OE9B 1KFXL 1YR5A 2K2AA 2ZNEA 3IF7A 3UO9A 2GGMA 2M0RA 1QTXA 2HPSA 2OTGC 2I94A 2KFFA 4PALA 1MUXA 4OZDA 2CCMA 1DC1A 1HT9A 1PSRA 2HQ8A 1TUZA 1XA5A 4F7FA 5JOLA 1YRTB 3K1EA 3SS4A 3CZ2A 3QMEA 2JPOA 2KI6D 1PSBA 1UHKA 1BU3A 3O2PA 1EL4A 4DUQA 1DT7B 4PHMA 1VRKA 1W7IB 1XVJA 1PVBA 1WLMA 3D0YA 3BUNB 1JFJA 1QVIY 1UHNA 1V1GA 1J55A 3DD4A 4TNCA 5DICA 1ALVA 1E8AA 2LP3A 1OW4A 2I7AA 3TUYC 4YGCB 3QRXA 1QWVA 1C7WA 1KFXS 3RZSA 5AXIA 1ODBA 4UPGA 2KI6C 2LM5A 4P5OE 1DJYA 1XFXO 3NHIA 1IIOA 1SYMA 1QX5B 1Y1XA 4NDCA 3PATA 3O78A 3O4XA 2KI4C 1BMOA 1DTLA 1F4OA 2MLFC 3PN7B 4MSPA 2M97A 2NCOA 2NZ0A 2BAPA 4MLWA 3CABA 1W9ZA 2WCKA 2ZRSA 2ERBA 2LVVA 1J1DA 3PJIA 1FI6A 2BNXA 1G8IA 3OX6A 4INXA 5G08A 2E6WA 3CWGA 3H4SE 2LAPA 1TOPA 2HETA 3GOFA 1DGUA 2K8MB 3B87A 3S0BA 1CLMA 3D77A 4A4CA 1JSAA 2K0JA 1JWDA 1NX3A 1Z4HA 2KLDA 1EH2A 1UUSA 1YX7A 1LS8A 2LVIA 3B88A 3S0FA 1M63B 1UP5A 2P71A 2H61C 3VROA 3LK1A 3I5GC 2EHBA 2L2CA 2ZRTA 4ETOA 5I2OA 3AAKA 1CLLA 1SMGA 2JNXA 2PRUA 2JPTA 4PT1A 4CLNA 4A4BA 2Y1MA 3I5IC 3PM2A 5FI6A 1YRUB 1YX8A 1FBVA 1KWOC 2L0PA 3D78A 1DJXA 1DJIA 4N5XA 3I5HC 4BY5A 3FWBA 1SK6D 2L4HA 3D76A 3LCPC 1KFUL 3NXAA 3R1VA 4FQTA 2WCHA 1BR1B 2R2IA 3FWCA 1WRLA 4CIDA 1SKTA 1N2DA 3PM8A 1MF8B 4GGFC 4I5LB 2KLEA 3ZWHA 1SCVA 2JULA 4P2YB 2P6BB 2KFGA 3UNWA 2WC6A 3BQ3A 2K7OA 1OOJA 5ER4X 2MAZA 1ZOTB 2JT3A 3K21A 3OBVA 1Y6WA 4GUKA 4PE1A 1A4PA 2BE6A 1RROA 4PHKA 4HREE 3BUWB 1F71A 1XYDA 2OS8C 2AMIA 2BKHB 2E30A 4IL1A 1UHIA 1OOFA 3FE9A 3WHUB 1CDLA 2CT9A 1JUOA 2WC5A 5HL1A 3BFAA 3CTNA 2BBNA 3OB1B 2LLSA 5CSJA 2NLNA 5I8NA 1DJHA 2M3WA 4I5JA 4AQJA 2JU0A 4GPLB 2Y4QA 2D8NA 4M2OA 1MHOA 1OMDA 1Y0VH 4PHJA 3S0GA 5CPVA 1SBJA 3I5FC 1PVAA 1ZUZA 5I94A 1K2HA 5GQQC 1LINA 1CFPA 5KU1A 3VRQA 1QLKA 2ZN9A 4GNKB 3EK8A 1M45A 1J7RA 1LA3A 1PALA 3KEVA 1M31A 2QACA 1K90D 2F33A 1M46A 1SL9A 2CTNA 5FI2A 1CM4A 3FS7A 3SS5A 4GAOA 4CFRA 1BLQA 2BCBA 2JRFA 1TNWA 1BJFA 1DJGA 2PALA 1K9KA 3BUOB 1KK8B 1BR4B 1WDCB 2EC6B 3GK4X 2QEOA 2ZFDA 4ZCUA 2O60A 4NDBA 3TZ1A
chains in the Genus database with same CATH topology
2PQLA 3DZTA 3CABA 2WCKA 3D73A 2ERBA 1P28A 3PJIA 1DQEA 1C3ZA 4JD9A 4INXA 3DXLA 1TWOA 3CYZA 3L47A 3V2LA 3FE6A 3B87A 3S0BA 3NGVA 3N7HA 2KPHA 3D77A 3NHTA 1T14A 3FE8A 3VB1A 1OOGA 3D74A 4INWA 3DYEA 1LS8A 3B88A 2P71A 3S0DA 3S0AA 2WCMA 2L2CA 3DY9A 1GM0A 4PT1A 3R1OA 3B7AA 3D78A 3CDNA 1ORGA 3BFHA 3D76A 2QEVA 3R1VA 4FQTA 2WCHA 3L4AA 1TUJA 2H8VA 3Q8IA 2P70A 1C3YA 2WC6A 3R72A 3S0EA 3R1PA 3B86A 1OOHA 2QEBA 3CZ0A 1OOFA 3FE9A 2WC5A 3BFBA 1OOIX 2GTEA 3BFAA 2WCJA 4OZDA 3OGNA 3L4LA 4F7FA 2FJYA 3S0GA 3K1EA 3CZ2A 3QMEA 2JPOA 2QDIA 2WCLA 3S0FA 5DICA 3CZ1A 3BJHA 1XFRA 1OW4A 2QEHA 3B6XA 3D75A 1QWVA 5EL2A 3RZSA 3NHIA 2QEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQL A;  3DZT A;  3CAB A;  2WCK A;  3D73 A;  2ERB A;  1P28 A;  3PJI A;  1DQE A;  1C3Z A;  4JD9 A;  4INX A;  3DXL A;  1TWO A;  3CYZ A;  3L47 A;  3V2L A;  3FE6 A;  3B87 A;  3S0B A;  3NGV A;  3N7H A;  2KPH A;  3D77 A;  3NHT A;  1T14 A;  3FE8 A;  3VB1 A;  1OOG A;  3D74 A;  4INW A;  3DYE A;  1LS8 A;  3B88 A;  2P71 A;  3S0D A;  3S0A A;  2WCM A;  2L2C A;  3DY9 A;  1GM0 A;  4PT1 A;  3R1O A;  3B7A A;  3D78 A;  3CDN A;  1ORG A;  3BFH A;  3D76 A;  2QEV A;  3R1V A;  4FQT A;  2WCH A;  3L4A A;  1TUJ A;  2H8V A;  3Q8I A;  2P70 A;  1C3Y A;  2WC6 A;  3R72 A;  3S0E A;  3R1P A;  3B86 A;  1OOH A;  2QEB A;  3CZ0 A;  1OOF A;  3FE9 A;  2WC5 A;  3BFB A;  1OOI X;  2GTE A;  3BFA A;  2WCJ A;  4OZD A;  3OGN A;  3L4L A;  4F7F A;  2FJY A;  3S0G A;  3K1E A;  3CZ2 A;  3QME A;  2JPO A;  2QDI A;  2WCL A;  3S0F A;  5DIC A;  3CZ1 A;  3BJH A;  1XFR A;  1OW4 A;  2QEH A;  3B6X A;  3D75 A;  1QWV A;  5EL2 A;  3RZS A;  3NHI A;  2QEO A; 
#chains in the Genus database with same CATH topology
 4XYN A;  4YBH B;  1MXE A;  3PN7 C;  3TDI A;  1B4C A;  4DCK A;  1EJ3 A;  3KO0 A;  1KQM B;  4NQG A;  3O6B A;  1S5G Y;  1JF2 A;  2JT0 A;  3VGO A;  3D0Y B;  1K96 A;  4PE0 A;  1WRZ A;  2I2R E;  1BOD A;  1C3Z A;  1REC A;  1QV0 A;  1NSH A;  2LUX A;  4JWQ A;  1SCM C;  3M0W A;  3VRR A;  1IJ5 A;  2JTT A;  2LLT A;  1V1F A;  4MBE A;  1TIZ A;  2QPT A;  2WCE A;  1M39 A;  1FF1 A;  2KAX A;  1TNQ A;  1K93 D;  3EVU A;  2KSP A;  2KBI A;  3NHT A;  4PHN A;  1QX2 A;  1F55 A;  1IH0 A;  4INW A;  5HLV A;  2WCB A;  3DYE A;  1ZMZ A;  4MZL A;  2K7D A;  1F70 A;  5HLO A;  2BKI B;  2KNE A;  3BXK A;  2BE4 A;  1QS7 A;  3S0D A;  1ZAC A;  5BPJ A;  1CDP A;  3S0A A;  3NSK A;  1DEK A;  5DKN A;  2MRD A;  3RLZ A;  5CSI A;  1B9A A;  1XFY O;  2L5X B;  1LVC D;  1B8L A;  2LMU A;  1NIW A;  4MZK A;  3SG2 A;  4MEW A;  4JPZ B;  4U8D A;  3B7A A;  4I5N B;  1EXR A;  1XFV O;  4WQ3 A;  1BT6 A;  3AAJ A;  4MRY A;  1QAS A;  1JF0 A;  2MLE C;  3CLN A;  1KQV A;  1K9U A;  4OKH A;  1H4B A;  1IRJ A;  1JBA A;  1J1E A;  1TUJ A;  3L4A A;  2JNF A;  1PRW A;  1L2O C;  2H8V A;  3TS5 B;  1HQV A;  2K7B A;  2LVK A;  2PVB A;  3Q8I A;  5AFP A;  1NX0 A;  2OTG B;  3JVT B;  1CFF A;  1L7Z A;  4GFT A;  1OSA A;  1W7J B;  4KYN A;  2LAN A;  3MSE B;  1DJZ A;  2MHH A;  5AAN A;  4YGB B;  3S0E A;  1SW8 A;  3EG5 B;  4OV2 A;  2O5G A;  2H2K A;  4L9M A;  1A75 B;  3OX5 A;  4HRG A;  3A4U B;  3DVK A;  3TUY B;  3CZ0 A;  2K61 A;  2PAS A;  3EVV A;  5CSF A;  1CLB A;  3AKA A;  3FIA A;  1IKU A;  1SL8 A;  1Y1A A;  2HF5 A;  3DVE A;  1QXP A;  1OOI X;  2IS9 A;  1A75 A;  1EG4 A;  2F3Y A;  3KF9 A;  1A2X A;  2KQ6 A;  3NSI A;  2JXL A;  4XJK B;  1TNX A;  1QLS A;  2LVJ A;  3BUM B;  1AJ5 A;  1LKJ A;  3O4Y A;  1CNP A;  4BY4 A;  1B7T Y;  1MWN A;  3DF0 A;  1DJW A;  1MR8 A;  3C1V A;  4XJK A;  1AUI B;  3BOW B;  2LLU A;  2LE9 B;  3CZ1 A;  1NP8 A;  3BJH A;  1XFR A;  5I2L A;  1JC2 A;  1MQ1 A;  3B6X A;  1XFU O;  1SR6 B;  3D75 A;  1DMO A;  5EL2 A;  2LUC A;  5CSN A;  2JC2 A;  1IQ3 A;  1WDC C;  1GQM A;  1MXL C;  2EC6 C;  3BOW A;  3CR5 X;  4QJ5 B;  1CFD A;  4DS7 A;  5B8I B;  2FCD A;  1LA0 A;  2BBM A;  1DEL A;  1WRK A;  1NWD A;  3CR4 X;  3EKJ A;  3N7H A;  2PMY A;  1S5G Z;  4C0J A;  4CFQ A;  1KQM C;  2PQL A;  1F8H A;  1PUL A;  1UUR A;  1QIW A;  1S3P A;  1U5I B;  1WY9 A;  1IWQ A;  4USL A;  1DGV A;  1AK8 A;  4FTG A;  1NX1 A;  3D73 A;  4GGN A;  1ZFS A;  4R1E A;  3SIB A;  2RGI A;  1J7O A;  3CR2 A;  2Q91 A;  1DQE A;  1IGV A;  2KGB C;  1F4Q A;  1U5I A;  1RJV A;  2LC5 A;  3TDZ A;  2KHN A;  1OZO A;  5HKY A;  1NX2 A;  1C07 A;  1TWO A;  3SG7 A;  1BOC A;  4N1G A;  3L47 A;  1KWO B;  4ZCV A;  5KSZ A;  1A29 A;  1YVH A;  1AP4 A;  2FCE A;  3LL8 B;  3BUX B;  1K8U A;  2TN4 A;  3NGV A;  1XFW O;  2JQ6 A;  4M2P A;  1WLZ A;  3CZT X;  3FE8 A;  5PAL A;  2WCF A;  4WRI A;  1K9P A;  2A4J A;  4I5K A;  3VB1 A;  1RFJ A;  2Q4U A;  3SJS A;  2JT8 A;  3D74 A;  1YUR A;  1NUB A;  2AUC A;  2M29 A;  4AOM A;  1QX7 A;  4CPV A;  5IBW A;  1GGW A;  1IQ5 A;  2L51 A;  1QIV A;  3ICB A;  1B8R A;  5JJG A;  1IJ6 A;  1JFK A;  2LMV A;  2LNK A;  5AEQ A;  1S6I A;  3DY9 A;  2BL0 B;  1CKK A;  1GM0 A;  1FW4 A;  2JOJ A;  4GBA A;  5F6T A;  1CDM A;  4F0Z B;  2LHI A;  2B1U A;  4MN0 A;  1YUU A;  3EKH A;  2MA2 A;  4MRX A;  1QAT A;  1F54 A;  2KYF A;  1TCO B;  2FJU B;  1KK7 Z;  1OMR A;  2QEV A;  4FQO A;  2KAY A;  1AJ4 A;  4YI9 A;  3TS5 C;  3PSR A;  3VRN A;  3JVT C;  4IJ7 A;  5DKR A;  4JKT A;  5KTY A;  2YGU A;  1NPQ A;  1Z2C B;  2P70 A;  3D10 A;  4YGD B;  1J7Q A;  4QJ3 B;  2K60 A;  1R6P A;  2JTZ A;  4YGA A;  2M7N A;  4HSZ A;  2F3Z A;  2K2F A;  4M2Q A;  3I5F B;  3VRP A;  1X02 A;  2MJW B;  1N65 A;  3JTD B;  1NCY A;  3R1P A;  3NSL A;  1NCX A;  1DF0 B;  2LP2 A;  2Y5I A;  2L2E A;  3B86 A;  5D69 A;  3WNX B;  4JQ0 D;  2GV5 A;  2MBX A;  2VRG A;  1BG1 A;  1IG5 A;  1K94 A;  1LXF C;  1YUS A;  3IQO A;  5D7F A;  1TN4 A;  1XK4 A;  2F2P A;  2G2B A;  1RTP 1;  2SAS A;  2PSR A;  2KAV A;  5K89 A;  2L98 A;  1B47 A;  1G4Y R;  1DF0 A;  3AKB A;  1CM1 A;  2WOS A;  1ALW A;  2KOT A;  1B8C A;  2I18 A;  3BYA A;  2AAO A;  1G33 A;  1KSM A;  1Q80 A;  2WCJ A;  2K7C A;  4WQ2 A;  1AVS A;  3LK0 A;  2M7L A;  1C7V A;  4MVF A;  1S26 D;  1KK7 Y;  1XFZ O;  3PAL A;  2V53 A;  4N1F A;  1R2U A;  1B7T Z;  3EVR A;  5ER5 A;  3A8R A;  3OGN A;  3L4L A;  1CFC A;  2KFH A;  1TRF A;  2FJY A;  2JWW A;  1CMF A;  1GGZ A;  1SNL A;  4YRU A;  2QDI A;  1UHH A;  2WCL A;  1DVI A;  2G9B A;  1CTR A;  1BF5 A;  1SCM B;  1SR6 C;  1N0Y A;  3TDU A;  4C0K A;  2QEH A;  1EG3 A;  3CS1 A;  3HCM A;  1A03 A;  1H8B A;  1XO5 A;  1QJT A;  2BEC A;  2JXC A;  5AER A;  4NDD A;  1FPW A;  3NSO A;  2CXJ A;  1YVL A;  1CDN A;  3PFV A;  3SG6 A;  2GTE A;  1UHJ A;  4MZJ A;  2KBM A;  2L50 A;  5HYD A;  1UWO A;  2CBL A;  2OPO A;  3DF0 B;  5FI7 A;  1FI5 A;  1B1G A;  3RM1 A;  5HKZ A;  2BCA A;  3DVJ A;  2LV7 A;  2KI4 B;  2L5Y A;  1TNP A;  2KYC A;  3DZT A;  1YTZ C;  2BCX A;  1P28 A;  2LCP A;  3SIA A;  2ZND A;  1CB1 A;  4YI8 A;  3KHE A;  2M1K B;  4JD9 A;  1PK0 D;  3E3R A;  4QJ4 B;  3PLF B;  3DXL A;  2PYQ A;  3CYZ A;  2CNP A;  1NCZ A;  2SCP A;  2HQW A;  4Q04 A;  2NXQ A;  3V2L A;  2FOT A;  1TTX A;  4OVN F;  1J7P A;  3FE6 A;  4YGE B;  1K95 A;  3DVM A;  2M49 B;  3SG4 A;  2Y1N A;  3SG3 A;  3HX4 A;  1KK8 C;  2KPH A;  4ICB A;  1T14 A;  1GJY A;  5I2Q A;  3CGA A;  1OOG A;  4D1E A;  5FYX A;  1L2O B;  2M8U A;  2ZN8 A;  1D1O A;  4OCI A;  3WXA A;  1S6C A;  1SPY A;  2COL B;  2F2O A;  3WHT B;  2BL0 C;  1SRA A;  2WCM A;  2WOR A;  1AHR A;  5TNC A;  3GK1 A;  3I5G B;  4AQI A;  2F8P A;  2M9G A;  4ORA B;  4DRW A;  3R1O A;  1SL7 A;  4ORC B;  3I5I B;  1KFU S;  1CMG A;  2H61 A;  1S36 A;  4DIR A;  5HKW A;  2ISD A;  3CDN A;  1QV1 A;  2L4I A;  3OP0 A;  1TCF A;  1NYA A;  3EK7 A;  4HRH A;  4PE7 A;  1ORG A;  3I5H B;  3BFH A;  3OB2 B;  2KQY A;  3EK4 A;  1KCY A;  1OQP A;  1SSE B;  4PE4 A;  2ZKM X;  3SG5 A;  2EGD A;  3KPX A;  2KGR A;  3ZNI A;  1OZS A;  3OHM B;  1SY9 A;  1C3Y A;  2NCP A;  2JZI A;  3LLE A;  1RK9 A;  1QVI Z;  2LHL A;  4ORB B;  1S1E A;  5J3X A;  3F45 A;  1XK4 C;  3JTD C;  4E68 A;  2M1U A;  3SS3 A;  3R72 A;  2DOQ A;  2LMT A;  4C0L A;  5D3O A;  4OR9 B;  2WND A;  4GGF A;  1S6J A;  1OMV A;  3IQQ A;  2WC8 A;  2KDH A;  1OOH A;  5DKQ A;  1KSO A;  4PCW A;  1RWY A;  1YUT A;  2QEB A;  3IVT A;  2OS8 B;  1Y1U A;  3GK2 A;  4PDZ A;  2GGZ A;  3BFB A;  1OE9 B;  1KFX L;  1YR5 A;  2K2A A;  2ZNE A;  3IF7 A;  3UO9 A;  2GGM A;  2M0R A;  1QTX A;  2HPS A;  2OTG C;  2I94 A;  2KFF A;  4PAL A;  1MUX A;  4OZD A;  2CCM A;  1DC1 A;  1HT9 A;  1PSR A;  2HQ8 A;  1TUZ A;  1XA5 A;  4F7F A;  5JOL A;  1YRT B;  3K1E A;  3SS4 A;  3CZ2 A;  3QME A;  2JPO A;  2KI6 D;  1PSB A;  1UHK A;  1BU3 A;  3O2P A;  1EL4 A;  4DUQ A;  1DT7 B;  4PHM A;  1VRK A;  1W7I B;  1XVJ A;  1PVB A;  1WLM A;  3D0Y A;  3BUN B;  1JFJ A;  1QVI Y;  1UHN A;  1V1G A;  1J55 A;  3DD4 A;  4TNC A;  5DIC A;  1ALV A;  1E8A A;  2LP3 A;  1OW4 A;  2I7A A;  3TUY C;  4YGC B;  3QRX A;  1QWV A;  1C7W A;  1KFX S;  3RZS A;  5AXI A;  1ODB A;  4UPG A;  2KI6 C;  2LM5 A;  4P5O E;  1DJY A;  1XFX O;  3NHI A;  1IIO A;  1SYM A;  1QX5 B;  1Y1X A;  4NDC A;  3PAT A;  3O78 A;  3O4X A;  2KI4 C;  1BMO A;  1DTL A;  1F4O A;  2MLF C;  3PN7 B;  4MSP A;  2M97 A;  2NCO A;  2NZ0 A;  2BAP A;  4MLW A;  3CAB A;  1W9Z A;  2WCK A;  2ZRS A;  2ERB A;  2LVV A;  1J1D A;  3PJI A;  1FI6 A;  2BNX A;  1G8I A;  3OX6 A;  4INX A;  5G08 A;  2E6W A;  3CWG A;  3H4S E;  2LAP A;  1TOP A;  2HET A;  3GOF A;  1DGU A;  2K8M B;  3B87 A;  3S0B A;  1CLM A;  3D77 A;  4A4C A;  1JSA A;  2K0J A;  1JWD A;  1NX3 A;  1Z4H A;  2KLD A;  1EH2 A;  1UUS A;  1YX7 A;  1LS8 A;  2LVI A;  3B88 A;  3S0F A;  1M63 B;  1UP5 A;  2P71 A;  2H61 C;  3VRO A;  3LK1 A;  3I5G C;  2EHB A;  2L2C A;  2ZRT A;  4ETO A;  5I2O A;  3AAK A;  1CLL A;  1SMG A;  2JNX A;  2PRU A;  2JPT A;  4PT1 A;  4CLN A;  4A4B A;  2Y1M A;  3I5I C;  3PM2 A;  5FI6 A;  1YRU B;  1YX8 A;  1FBV A;  1KWO C;  2L0P A;  3D78 A;  1DJX A;  1DJI A;  4N5X A;  3I5H C;  4BY5 A;  3FWB A;  1SK6 D;  2L4H A;  3D76 A;  3LCP C;  1KFU L;  3NXA A;  3R1V A;  4FQT A;  2WCH A;  1BR1 B;  2R2I A;  3FWC A;  1WRL A;  4CID A;  1SKT A;  1N2D A;  3PM8 A;  1MF8 B;  4GGF C;  4I5L B;  2KLE A;  3ZWH A;  1SCV A;  2JUL A;  4P2Y B;  2P6B B;  2KFG A;  3UNW A;  2WC6 A;  3BQ3 A;  2K7O A;  1OOJ A;  5ER4 X;  2MAZ A;  1ZOT B;  2JT3 A;  3K21 A;  3OBV A;  1Y6W A;  4GUK A;  4PE1 A;  1A4P A;  2BE6 A;  1RRO A;  4PHK A;  4HRE E;  3BUW B;  1F71 A;  1XYD A;  2OS8 C;  2AMI A;  2BKH B;  2E30 A;  4IL1 A;  1UHI A;  1OOF A;  3FE9 A;  3WHU B;  1CDL A;  2CT9 A;  1JUO A;  2WC5 A;  5HL1 A;  3BFA A;  3CTN A;  2BBN A;  3OB1 B;  2LLS A;  5CSJ A;  2NLN A;  5I8N A;  1DJH A;  2M3W A;  4I5J A;  4AQJ A;  2JU0 A;  4GPL B;  2Y4Q A;  2D8N A;  4M2O A;  1MHO A;  1OMD A;  1Y0V H;  4PHJ A;  3S0G A;  5CPV A;  1SBJ A;  3I5F C;  1PVA A;  1ZUZ A;  5I94 A;  1K2H A;  5GQQ C;  1LIN A;  1CFP A;  5KU1 A;  3VRQ A;  1QLK A;  2ZN9 A;  4GNK B;  3EK8 A;  1M45 A;  1J7R A;  1LA3 A;  1PAL A;  3KEV A;  1M31 A;  2QAC A;  1K90 D;  2F33 A;  1M46 A;  1SL9 A;  2CTN A;  5FI2 A;  1CM4 A;  3FS7 A;  3SS5 A;  4GAO A;  4CFR A;  1BLQ A;  2BCB A;  2JRF A;  1TNW A;  1BJF A;  1DJG A;  2PAL A;  1K9K A;  3BUO B;  1KK8 B;  1BR4 B;  1WDC B;  2EC6 B;  3GK4 X;  2QEO A;  2ZFD A;  4ZCU A;  2O60 A;  4NDB A;  3TZ1 A; 
#chains in the Genus database with same CATH homology
 2PQL A;  3DZT A;  3CAB A;  2WCK A;  3D73 A;  2ERB A;  1P28 A;  3PJI A;  1DQE A;  1C3Z A;  4JD9 A;  4INX A;  3DXL A;  1TWO A;  3CYZ A;  3L47 A;  3V2L A;  3FE6 A;  3B87 A;  3S0B A;  3NGV A;  3N7H A;  2KPH A;  3D77 A;  3NHT A;  1T14 A;  3FE8 A;  3VB1 A;  1OOG A;  3D74 A;  4INW A;  3DYE A;  1LS8 A;  3B88 A;  2P71 A;  3S0D A;  3S0A A;  2WCM A;  2L2C A;  3DY9 A;  1GM0 A;  4PT1 A;  3R1O A;  3B7A A;  3D78 A;  3CDN A;  1ORG A;  3BFH A;  3D76 A;  2QEV A;  3R1V A;  4FQT A;  2WCH A;  3L4A A;  1TUJ A;  2H8V A;  3Q8I A;  2P70 A;  1C3Y A;  2WC6 A;  3R72 A;  3S0E A;  3R1P A;  3B86 A;  1OOH A;  2QEB A;  3CZ0 A;  1OOF A;  3FE9 A;  2WC5 A;  3BFB A;  1OOI X;  2GTE A;  3BFA A;  2WCJ A;  4OZD A;  3OGN A;  3L4L A;  4F7F A;  2FJY A;  3S0G A;  3K1E A;  3CZ2 A;  3QME A;  2JPO A;  2QDI A;  2WCL A;  3S0F A;  5DIC A;  3CZ1 A;  3BJH A;  1XFR A;  1OW4 A;  2QEH A;  3B6X A;  3D75 A;  1QWV A;  5EL2 A;  3RZS A;  3NHI A;  2QEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...