2WC6A

Structure of bmori gobp2 (general odorant binding protein 2) with bombykol and water to arg 110
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wc6A00
3DXLA 1QWVA 3CABA 1C3YA 3OGNA 4INXA 2H8VA 3N7HA 4FQTA 2JPOA 4PT1A 1OOHA 1T14A 3L4AA 3R72A 3DZTA 1OOIX 3B86A 3NHTA 3B7AA 1ORGA 3B6XA 2KPHA 3NGVA 3S0EA 2WCHA 2QEBA 3D75A 3NHIA 2FJYA 2WCJA 3L4LA 3S0BA 3B88A 3CZ0A 3B87A 5EL2A 3VB1A 3QMEA 2P70A 1GM0A 4INWA 1C3ZA 2ERBA 1TWOA 4JD9A 3S0DA 3DY9A 3DYEA 3FE8A 3CYZA 1OOGA 3BFAA 3CDNA 1LS8A 1DQEA 2WCLA 2WCKA 1OOFA 3R1OA 3K1EA 3BJHA 3D77A 2P71A 2WCMA 3PJIA 2QEOA 3R1VA 3L47A 3R1PA 2QDIA 3S0AA 1OW4A 1TUJA 5DICA 3S0FA 3V2LA 3RZSA 1XFRA 1P28A 3D76A 3D78A 2WC6A 3D73A 3CZ1A 2PQLA 3CZ2A 2QEVA 2L2CA 2GTEA 3D74A 3BFBA 3BFHA 3Q8IA 3FE9A 3FE6A 4F7FA 2WC5A 4OZDA 3S0GA 2QEHA
chains in the Genus database with same CATH superfamily
3BOWB 5KSZA 1KFUL 1C7VA 1K95A 1LVCD 1NCZA 3D0YB 3UO9A 1BLQA 1SL8A 4CFQA 2LP2A 4WRIA 2NCPA 2O5GA 2E6WA 4INXA 1NP8A 2G2BA 1BT6A 1JF0A 1QASA 1OE9B 2LLTA 1F70A 4FQTA 1YUUA 1DJHA 1SW8A 2L5XB 2PMYA 1XFVO 1DEKA 1KQVA 1SSEB 1YRUB 1CNPA 1M39A 4CFRA 2RGIA 1OOHA 1K90D 1WDCC 3L4AA 4MRYA 4JQ0D 2LM5A 1XVJA 2OPOA 2LHIA 2K7DA 2KAVA 4DS7A 4DCKA 4USLA 3B7AA 2M1UA 3AAKA 2KPHA 5HLOA 2KQ6A 3NGVA 4CIDA 4GGNA 4YI8A 2FOTA 1JBAA 2WORA 2LCPA 2I2RE 3ZNIA 2KAYA 1SPYA 2QEBA 4YBHB 2SCPA 1PVAA 1YUSA 4P2YB 1NX3A 2ZN8A 3NHIA 4NDDA 4FTGA 5CSFA 2OTGB 4ORCB 2G9BA 2QEHA 3SIBA 3TS5B 1CLMA 1JUOA 3IVTA 5IBWA 3WXAA 1ODBA 1S3PA 1QVIY 4TNCA 2LAPA 1XFUO 3KO0A 5ER4X 2KHNA 5I2LA 4AQIA 4OR9B 3TUYB 2JT0A 1M31A 2GV5A 3SG4A 4I5JA 2H2KA 2Y4QA 4QJ4B 1CDNA 2I94A 1WRKA 3VGOA 1F8HA 1UHNA 2KI6D 5AERA 1AJ5A 1OMDA 1XFWO 4GAOA 1CMGA 2PALA 1NWDA 1SK6D 3DY9A 2YGUA 1BF5A 1RFJA 1FBVA 2K0JA 1S36A 2B1UA 3DF0B 2CXJA 3IQOA 1KQMC 1QLKA 4PHMA 4JWQA 2JZIA 4M2OA 1XA5A 1VRKA 2KDHA 3D0YA 2LMUA 3I5HC 2JPTA 1JFKA 1SBJA 2M29A 3SS5A 1SNLA 1B9AA 3EG5B 3K1EA 3TDUA 1UHHA 3HX4A 2KNEA 1PRWA 2EGDA 1S26D 2K60A 1M63B 3CR4X 3IF7A 3PJIA 2M97A 3SG7A 4MSPA 5GQQC 2VRGA 2QDIA 1X02A 2MLFC 3QRXA 3DVEA 4QJ3B 2IS9A 3VRPA 2CT9A 4M2PA 2QACA 1S5GZ 2H61A 4P5OE 1HQVA 1OSAA 1XFRA 1CDMA 1YX8A 2KGRA 3AKBA 2HQWA 4PHKA 2Y5IA 4OKHA 4R1EA 1S6IA 1Y1XA 1DJXA 2KI4B 4MEWA 1WRLA 2A4JA 5J3XA 3D73A 3CZ1A 4JKTA 2LVVA 1OOJA 3WHTB 2QEVA 3KF9A 1MXLC 1AVSA 3GK4X 2CCMA 3LCPC 1DF0A 1F71A 1L7ZA 2LC5A 3EK8A 3K21A 2NLNA 2M7NA 1XFZO 5I8NA 1DJGA 1IKUA 1CTRA 3BFHA 4XJKA 1KWOC 4FQOA 1DJWA 1NX1A 1L2OC 3FE6A 1LINA 2KOTA 2MHHA 1SL7A 2PVBA 2LVIA 2CBLA 2JTTA 3PSRA 1K96A 3WHUB 1C07A 3BUXB 1DJZA 1CMFA 4PDZA 1F4QA 4YGAA 1K8UA 3FIAA 2BE4A 1QLSA 1AJ4A 2H8VA 1BOCA 1YRTB 1IGVA 3DF0A 1XFXO 2FCDA 1FI5A 2QPTA 1NIWA 1GGWA 1UURA 3I5FC 1HT9A 3AKAA 2KBMA 1N0YA 1Z4HA 3I5GB 2HQ8A 3R72A 4OVNF 2BAPA 2BE6A 4PHJA 1OOIX 2LMTA 1EXRA 3B86A 3CLNA 1IJ6A 4DIRA 2BL0B 3PATA 2LP3A 3B6XA 4GFTA 2MA2A 1QX2A 1GQMA 3VRNA 1IG5A 1G4YR 1SR6B 5FYXA 1RJVA 1UHJA 5AEQA 2ZRSA 4ORAB 2LUXA 2PSRA 1UP5A 3BUWB 1NYAA 1TNXA 2FJYA 2GGMA 5B8IB 1MQ1A 4CPVA 3L4LA 3CGAA 3B88A 4PCWA 3B87A 3VB1A 4ETOA 4IL1A 5CSJA 1U5IB 1EL4A 3CR5X 2D8NA 3PM8A 1DJIA 1TIZA 1GGZA 2JC2A 1K9PA 2LNKA 4MN0A 5ER5A 3S0DA 2K2AA 3KPXA 5KU1A 1OMVA 1S6JA 2JQ6A 2R2IA 3BQ3A 3M0WA 4NDCA 1J1EA 3EKJA 2KBIA 1KFXS 4ZCVA 1K94A 4D1EA 1CDLA 5DKQA 3O78A 4PALA 5DKNA 3CZTX 3DYEA 3NSKA 3DVMA 1MUXA 1SMGA 1UHKA 3MSEB 5HKYA 2DOQA 1CFCA 1KK8C 2H61C 3CYZA 2ISDA 1DVIA 1WDCB 3BFAA 2WOSA 2JXCA 1B4CA 1R2UA 2E30A 1LS8A 3EK4A 1DQEA 3D10A 1DT7B 2JT3A 5AFPA 2WCLA 1G8IA 1KK7Y 2MAZA 1C7WA 3OBVA 1DELA 2AMIA 1OOFA 3TS5C 1B47A 1YVLA 3RLZA 1MF8B 1QVIZ 2WNDA 2WCFA 4AOMA 1CFDA 1A75B 3OHMB 3ZWHA 3R1VA 3SJSA 1A03A 4YGDB 2PRUA 1GJYA 3NSLA 4WQ3A 3S0AA 4BY5A 4MLWA 3OX6A 2KFFA 3S0FA 4I5LB 4CLNA 1KSMA 2JOJA 4GNKB 1N2DA 3JTDC 1XFYO 3NSOA 1J7OA 3SIAA 2LHLA 4IJ7A 3I5IC 3BOWA 3SS3A 1DGVA 2WC6A 1QX5B 2L5YA 2P6BB 5CSIA 1LA0A 1SCMC 2ZFDA 1LA3A 1WLZA 1MHOA 1BR1B 1DJYA 1K93D 3TDZA 3D74A 1R6PA 2WC8A 4F7FA 1KQMB 3FS7A 4I5NB 3PN7C 5D3OA 4MVFA 1DTLA 5F6TA 3DXLA 1XYDA 2NCOA 1TCFA 3I5HB 1RROA 1XK4C 1BMOA 2ZRTA 4JPZB 1W7IB 1ZFSA 1J7RA 1QIWA 1QWVA 1UUSA 2LVKA 3CABA 4DUQA 1TTXA 1NUBA 1YURA 3OGNA 1AK8A 2KFGA 2MLEC 1ZOTB 1IQ3A 1Y1UA 2JPOA 5HLVA 3EVRA 1B7TY 5D69A 4AQJA 1B8RA 4PT1A 4C0LA 1OZOA 2LLSA 1QV0A 3O6BA 1T14A 1NX0A 3GK1A 4C0KA 1A29A 2EC6C 1PSRA 3LK1A 5I2QA 3EK7A 1ALVA 2L51A 2Q91A 1Y0VH 3A8RA 1K9UA 3S0EA 3CTNA 3SG2A 1WLMA 2OS8C 2WCHA 4PE0A 1JFJA 2JNFA 2K61A 4A4BA 4MRXA 1OQPA 2AUCA 2FJUB 1QV1A 5DKRA 3KEVA 2ZKMX 2NXQA 4E68A 1XO5A 2CTNA 3DVJA 1IIOA 1CLLA 3FWBA 4L9MA 5EL2A 2K7CA 1KWOB 3QMEA 4HRGA 2P70A 1L2OB 4GUKA 5JJGA 3RM1A 1IWQA 3VRQA 2BECA 1QS7A 1UWOA 4GGFA 3OB1B 2KFHA 5CSNA 3BUOB 1BG1A 1V1FA 1CFPA 4U8DA 2ERBA 2L98A 4JD9A 1CKKA 3C1VA 1M45A 4YI9A 3WNXB 2V53A 2O60A 3SG6A 3EVUA 3LK0A 1F54A 4HRHA 1PK0D 1JF2A 1EG4A 1YVHA 2L4HA 3O2PA 4UPGA 2KGBC 5HYDA 3JVTC 1JWDA 1QJTA 4A4CA 1MR8A 1G33A 2M8UA 3I5FB 3UNWA 1OOGA 1TNWA 3NSIA 4GPLB 1M46A 2BCXA 3CDNA 2BKHB 3OB2B 5JOLA 1CDPA 1YR5A 2K2FA 1NSHA 2KLEA 2KYCA 4N1FA 1H8BA 3CWGA 2L0PA 3R1OA 3BJHA 3D77A 2ZNEA 3O4YA 4HREE 1B8CA 3H4SE 4ZCUA 2WCMA 1ZMZA 2HPSA 2MRDA 2BBNA 1AUIB 1OZSA 1UHIA 1B8LA 2QEOA 4YGCB 3L47A 3R1PA 3VRRA 1OW4A 1TUJA 1CM4A 1Q80A 4YGEB 1TNPA 5DICA 3V2LA 1DC1A 1W7JB 5D7FA 1BJFA 3GOFA 1P28A 1CM1A 2EHBA 4C0JA 5HL1A 5AXIA 1RECA 1V1GA 3PLFB 1J7PA 1J55A 5G08A 4NQGA 1JSAA 5HKWA 2KLDA 2PQLA 4WQ2A 2HETA 4M2QA 3E3RA 2L2CA 3VROA 1RWYA 1SL9A 2OTGC 2TN4A 5FI6A 3HCMA 5KTYA 3GK2A 1IRJA 1Y6WA 1YTZC 2SASA 3SS4A 2LLUA 1KK7Z 1NX2A 2F33A 2JULA 3BFBA 1TRFA 1KK8B 2FCEA 2KYFA 3FE9A 4I5KA 3TUYC 2L2EA 2WC5A 1J7QA 2LANA 1SKTA 4ICBA 2L4IA 3OP0A 1WRZA 1TOPA 1QIVA 2F2PA 1Y1AA 1QTXA 1C3YA 1NCYA 1DF0B 1KFUS 5CPVA 4DRWA 4MZLA 1SY9A 1ZUZA 3NXAA 3N7HA 3KHEA 1A2XA 5FI2A 4ORBB 4QJ5B 1BODA 2L50A 2Y1MA 1CLBA 3BXKA 2LE9B 4XYNA 1JC2A 4XJKB 2JNXA 2K7BA 2WCEA 3DD4A 1FF1A 2JT8A 1LXFC 1S6CA 3DZTA 3F45A 1KCYA 4GGFC 2F3ZA 1AHRA 3EKHA 5HKZA 1FPWA 4Q04A 1U5IA 3IQQA 1QATA 3NHTA 3JTDB 1TCOB 4YRUA 1CB1A 1ORGA 2MJWB 1PULA 1PSBA 3A4UB 3I5IB 2LMVA 4BY4A 2JTZA 1KSOA 4OCIA 3BUMB 4OV2A 1TNQA 1SRAA 2ZN9A 5I2OA 1SCMB 2KI6C 3PALA 2LV7A 1EH2A 1MXEA 3D75A 1DMOA 2JXLA 1BU3A 1OMRA 2COLB 1RK9A 2LVJA 2WCJA 1RTP1 3S0BA 1K9KA 3EVVA 2M3WA 3CZ0A 3LLEA 2GGZA 2M0RA 5TNCA 3SG5A 3PN7B 1GM0A 4INWA 1C3ZA 1F55A 1S1EA 2KI4C 1B7TZ 1TWOA 3PFVA 2BCAA 4KYNA 2F3YA 1H4BA 3DVKA 1S5GY 2K7OA 1PVBA 2WCBA 1J1DA 2M7LA 1EG3A 2M9GA 3AAJA 1D1OA 1FI6A 2LUCA 2I7AA 2F2OA 3ICBA 4PE7A 1A75A 1K2HA 4PHNA 2PYQA 2HF5A 3O4XA 1E8AA 3FE8A 3BYAA 2Y1NA 1ALWA 4N1GA 3TDIA 3FWCA 4HSZA 3CS1A 1YUTA 2MBXA 1EJ3A 5FI7A 1W9ZA 2EC6B 1BR4B 2BCBA 2K8MB 4YGBB 2JRFA 1TUZA 1DGUA 4GBAA 3SG3A 2CNPA 1LKJA 2WCKA 1IQ5A 4F0ZB 4MZJA 2KSPA 3TZ1A 2OS8B 1AP4A 5K89A 2P71A 1KFXL 3PM2A 1MWNA 2F8PA 1NCXA 2M1KB 5BPJA 1PALA 1NPQA 3I5GC 4MBEA 2BKIB 4PE4A 5PALA 2Q4UA 1IH0A 4NDBA 3RZSA 4MZKA 1QXPA 3D76A 2BL0C 1CFFA 4N5XA 1WY9A 1SCVA 1Z2CB 3D78A 1IJ5A 1N65A 2JWWA 2M49B 1SR6C 1ZACA 3CZ2A 5AANA 1SYMA 3LL8B 2BBMA 2PASA 2KQYA 2GTEA 2NZ0A 2JU0A 5I94A 1A4PA 2ZNDA 3JVTB 1B1GA 2BNXA 3CR2A 3OX5A 2KAXA 1F4OA 2AAOA 2I18A 3Q8IA 4PE1A 1FW4A 1TN4A 1YX7A 4OZDA 3S0GA 3BUNB 1XK4A 1QX7A
chains in the Genus database with same CATH topology
3DXLA 1QWVA 3CABA 1C3YA 3OGNA 4INXA 2H8VA 3N7HA 4FQTA 2JPOA 4PT1A 1OOHA 1T14A 3L4AA 3R72A 3DZTA 1OOIX 3B86A 3NHTA 3B7AA 1ORGA 3B6XA 2KPHA 3NGVA 3S0EA 2WCHA 2QEBA 3D75A 3NHIA 2FJYA 2WCJA 3L4LA 3S0BA 3B88A 3CZ0A 3B87A 5EL2A 3VB1A 3QMEA 2P70A 1GM0A 4INWA 1C3ZA 2ERBA 1TWOA 4JD9A 3S0DA 3DY9A 3DYEA 3FE8A 3CYZA 1OOGA 3BFAA 3CDNA 1LS8A 1DQEA 2WCLA 2WCKA 1OOFA 3R1OA 3K1EA 3BJHA 3D77A 2P71A 2WCMA 3PJIA 2QEOA 3R1VA 3L47A 3R1PA 2QDIA 3S0AA 1OW4A 1TUJA 5DICA 3S0FA 3V2LA 3RZSA 1XFRA 1P28A 3D76A 3D78A 2WC6A 3D73A 3CZ1A 2PQLA 3CZ2A 2QEVA 2L2CA 2GTEA 3D74A 3BFBA 3BFHA 3Q8IA 3FE9A 3FE6A 4F7FA 2WC5A 4OZDA 3S0GA 2QEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXL A;  1QWV A;  3CAB A;  1C3Y A;  3OGN A;  4INX A;  2H8V A;  3N7H A;  4FQT A;  2JPO A;  4PT1 A;  1OOH A;  1T14 A;  3L4A A;  3R72 A;  3DZT A;  1OOI X;  3B86 A;  3NHT A;  3B7A A;  1ORG A;  3B6X A;  2KPH A;  3NGV A;  3S0E A;  2WCH A;  2QEB A;  3D75 A;  3NHI A;  2FJY A;  2WCJ A;  3L4L A;  3S0B A;  3B88 A;  3CZ0 A;  3B87 A;  5EL2 A;  3VB1 A;  3QME A;  2P70 A;  1GM0 A;  4INW A;  1C3Z A;  2ERB A;  1TWO A;  4JD9 A;  3S0D A;  3DY9 A;  3DYE A;  3FE8 A;  3CYZ A;  1OOG A;  3BFA A;  3CDN A;  1LS8 A;  1DQE A;  2WCL A;  2WCK A;  1OOF A;  3R1O A;  3K1E A;  3BJH A;  3D77 A;  2P71 A;  2WCM A;  3PJI A;  2QEO A;  3R1V A;  3L47 A;  3R1P A;  2QDI A;  3S0A A;  1OW4 A;  1TUJ A;  5DIC A;  3S0F A;  3V2L A;  3RZS A;  1XFR A;  1P28 A;  3D76 A;  3D78 A;  2WC6 A;  3D73 A;  3CZ1 A;  2PQL A;  3CZ2 A;  2QEV A;  2L2C A;  2GTE A;  3D74 A;  3BFB A;  3BFH A;  3Q8I A;  3FE9 A;  3FE6 A;  4F7F A;  2WC5 A;  4OZD A;  3S0G A;  2QEH A; 
#chains in the Genus database with same CATH topology
 3BOW B;  5KSZ A;  1KFU L;  1C7V A;  1K95 A;  1LVC D;  1NCZ A;  3D0Y B;  3UO9 A;  1BLQ A;  1SL8 A;  4CFQ A;  2LP2 A;  4WRI A;  2NCP A;  2O5G A;  2E6W A;  4INX A;  1NP8 A;  2G2B A;  1BT6 A;  1JF0 A;  1QAS A;  1OE9 B;  2LLT A;  1F70 A;  4FQT A;  1YUU A;  1DJH A;  1SW8 A;  2L5X B;  2PMY A;  1XFV O;  1DEK A;  1KQV A;  1SSE B;  1YRU B;  1CNP A;  1M39 A;  4CFR A;  2RGI A;  1OOH A;  1K90 D;  1WDC C;  3L4A A;  4MRY A;  4JQ0 D;  2LM5 A;  1XVJ A;  2OPO A;  2LHI A;  2K7D A;  2KAV A;  4DS7 A;  4DCK A;  4USL A;  3B7A A;  2M1U A;  3AAK A;  2KPH A;  5HLO A;  2KQ6 A;  3NGV A;  4CID A;  4GGN A;  4YI8 A;  2FOT A;  1JBA A;  2WOR A;  2LCP A;  2I2R E;  3ZNI A;  2KAY A;  1SPY A;  2QEB A;  4YBH B;  2SCP A;  1PVA A;  1YUS A;  4P2Y B;  1NX3 A;  2ZN8 A;  3NHI A;  4NDD A;  4FTG A;  5CSF A;  2OTG B;  4ORC B;  2G9B A;  2QEH A;  3SIB A;  3TS5 B;  1CLM A;  1JUO A;  3IVT A;  5IBW A;  3WXA A;  1ODB A;  1S3P A;  1QVI Y;  4TNC A;  2LAP A;  1XFU O;  3KO0 A;  5ER4 X;  2KHN A;  5I2L A;  4AQI A;  4OR9 B;  3TUY B;  2JT0 A;  1M31 A;  2GV5 A;  3SG4 A;  4I5J A;  2H2K A;  2Y4Q A;  4QJ4 B;  1CDN A;  2I94 A;  1WRK A;  3VGO A;  1F8H A;  1UHN A;  2KI6 D;  5AER A;  1AJ5 A;  1OMD A;  1XFW O;  4GAO A;  1CMG A;  2PAL A;  1NWD A;  1SK6 D;  3DY9 A;  2YGU A;  1BF5 A;  1RFJ A;  1FBV A;  2K0J A;  1S36 A;  2B1U A;  3DF0 B;  2CXJ A;  3IQO A;  1KQM C;  1QLK A;  4PHM A;  4JWQ A;  2JZI A;  4M2O A;  1XA5 A;  1VRK A;  2KDH A;  3D0Y A;  2LMU A;  3I5H C;  2JPT A;  1JFK A;  1SBJ A;  2M29 A;  3SS5 A;  1SNL A;  1B9A A;  3EG5 B;  3K1E A;  3TDU A;  1UHH A;  3HX4 A;  2KNE A;  1PRW A;  2EGD A;  1S26 D;  2K60 A;  1M63 B;  3CR4 X;  3IF7 A;  3PJI A;  2M97 A;  3SG7 A;  4MSP A;  5GQQ C;  2VRG A;  2QDI A;  1X02 A;  2MLF C;  3QRX A;  3DVE A;  4QJ3 B;  2IS9 A;  3VRP A;  2CT9 A;  4M2P A;  2QAC A;  1S5G Z;  2H61 A;  4P5O E;  1HQV A;  1OSA A;  1XFR A;  1CDM A;  1YX8 A;  2KGR A;  3AKB A;  2HQW A;  4PHK A;  2Y5I A;  4OKH A;  4R1E A;  1S6I A;  1Y1X A;  1DJX A;  2KI4 B;  4MEW A;  1WRL A;  2A4J A;  5J3X A;  3D73 A;  3CZ1 A;  4JKT A;  2LVV A;  1OOJ A;  3WHT B;  2QEV A;  3KF9 A;  1MXL C;  1AVS A;  3GK4 X;  2CCM A;  3LCP C;  1DF0 A;  1F71 A;  1L7Z A;  2LC5 A;  3EK8 A;  3K21 A;  2NLN A;  2M7N A;  1XFZ O;  5I8N A;  1DJG A;  1IKU A;  1CTR A;  3BFH A;  4XJK A;  1KWO C;  4FQO A;  1DJW A;  1NX1 A;  1L2O C;  3FE6 A;  1LIN A;  2KOT A;  2MHH A;  1SL7 A;  2PVB A;  2LVI A;  2CBL A;  2JTT A;  3PSR A;  1K96 A;  3WHU B;  1C07 A;  3BUX B;  1DJZ A;  1CMF A;  4PDZ A;  1F4Q A;  4YGA A;  1K8U A;  3FIA A;  2BE4 A;  1QLS A;  1AJ4 A;  2H8V A;  1BOC A;  1YRT B;  1IGV A;  3DF0 A;  1XFX O;  2FCD A;  1FI5 A;  2QPT A;  1NIW A;  1GGW A;  1UUR A;  3I5F C;  1HT9 A;  3AKA A;  2KBM A;  1N0Y A;  1Z4H A;  3I5G B;  2HQ8 A;  3R72 A;  4OVN F;  2BAP A;  2BE6 A;  4PHJ A;  1OOI X;  2LMT A;  1EXR A;  3B86 A;  3CLN A;  1IJ6 A;  4DIR A;  2BL0 B;  3PAT A;  2LP3 A;  3B6X A;  4GFT A;  2MA2 A;  1QX2 A;  1GQM A;  3VRN A;  1IG5 A;  1G4Y R;  1SR6 B;  5FYX A;  1RJV A;  1UHJ A;  5AEQ A;  2ZRS A;  4ORA B;  2LUX A;  2PSR A;  1UP5 A;  3BUW B;  1NYA A;  1TNX A;  2FJY A;  2GGM A;  5B8I B;  1MQ1 A;  4CPV A;  3L4L A;  3CGA A;  3B88 A;  4PCW A;  3B87 A;  3VB1 A;  4ETO A;  4IL1 A;  5CSJ A;  1U5I B;  1EL4 A;  3CR5 X;  2D8N A;  3PM8 A;  1DJI A;  1TIZ A;  1GGZ A;  2JC2 A;  1K9P A;  2LNK A;  4MN0 A;  5ER5 A;  3S0D A;  2K2A A;  3KPX A;  5KU1 A;  1OMV A;  1S6J A;  2JQ6 A;  2R2I A;  3BQ3 A;  3M0W A;  4NDC A;  1J1E A;  3EKJ A;  2KBI A;  1KFX S;  4ZCV A;  1K94 A;  4D1E A;  1CDL A;  5DKQ A;  3O78 A;  4PAL A;  5DKN A;  3CZT X;  3DYE A;  3NSK A;  3DVM A;  1MUX A;  1SMG A;  1UHK A;  3MSE B;  5HKY A;  2DOQ A;  1CFC A;  1KK8 C;  2H61 C;  3CYZ A;  2ISD A;  1DVI A;  1WDC B;  3BFA A;  2WOS A;  2JXC A;  1B4C A;  1R2U A;  2E30 A;  1LS8 A;  3EK4 A;  1DQE A;  3D10 A;  1DT7 B;  2JT3 A;  5AFP A;  2WCL A;  1G8I A;  1KK7 Y;  2MAZ A;  1C7W A;  3OBV A;  1DEL A;  2AMI A;  1OOF A;  3TS5 C;  1B47 A;  1YVL A;  3RLZ A;  1MF8 B;  1QVI Z;  2WND A;  2WCF A;  4AOM A;  1CFD A;  1A75 B;  3OHM B;  3ZWH A;  3R1V A;  3SJS A;  1A03 A;  4YGD B;  2PRU A;  1GJY A;  3NSL A;  4WQ3 A;  3S0A A;  4BY5 A;  4MLW A;  3OX6 A;  2KFF A;  3S0F A;  4I5L B;  4CLN A;  1KSM A;  2JOJ A;  4GNK B;  1N2D A;  3JTD C;  1XFY O;  3NSO A;  1J7O A;  3SIA A;  2LHL A;  4IJ7 A;  3I5I C;  3BOW A;  3SS3 A;  1DGV A;  2WC6 A;  1QX5 B;  2L5Y A;  2P6B B;  5CSI A;  1LA0 A;  1SCM C;  2ZFD A;  1LA3 A;  1WLZ A;  1MHO A;  1BR1 B;  1DJY A;  1K93 D;  3TDZ A;  3D74 A;  1R6P A;  2WC8 A;  4F7F A;  1KQM B;  3FS7 A;  4I5N B;  3PN7 C;  5D3O A;  4MVF A;  1DTL A;  5F6T A;  3DXL A;  1XYD A;  2NCO A;  1TCF A;  3I5H B;  1RRO A;  1XK4 C;  1BMO A;  2ZRT A;  4JPZ B;  1W7I B;  1ZFS A;  1J7R A;  1QIW A;  1QWV A;  1UUS A;  2LVK A;  3CAB A;  4DUQ A;  1TTX A;  1NUB A;  1YUR A;  3OGN A;  1AK8 A;  2KFG A;  2MLE C;  1ZOT B;  1IQ3 A;  1Y1U A;  2JPO A;  5HLV A;  3EVR A;  1B7T Y;  5D69 A;  4AQJ A;  1B8R A;  4PT1 A;  4C0L A;  1OZO A;  2LLS A;  1QV0 A;  3O6B A;  1T14 A;  1NX0 A;  3GK1 A;  4C0K A;  1A29 A;  2EC6 C;  1PSR A;  3LK1 A;  5I2Q A;  3EK7 A;  1ALV A;  2L51 A;  2Q91 A;  1Y0V H;  3A8R A;  1K9U A;  3S0E A;  3CTN A;  3SG2 A;  1WLM A;  2OS8 C;  2WCH A;  4PE0 A;  1JFJ A;  2JNF A;  2K61 A;  4A4B A;  4MRX A;  1OQP A;  2AUC A;  2FJU B;  1QV1 A;  5DKR A;  3KEV A;  2ZKM X;  2NXQ A;  4E68 A;  1XO5 A;  2CTN A;  3DVJ A;  1IIO A;  1CLL A;  3FWB A;  4L9M A;  5EL2 A;  2K7C A;  1KWO B;  3QME A;  4HRG A;  2P70 A;  1L2O B;  4GUK A;  5JJG A;  3RM1 A;  1IWQ A;  3VRQ A;  2BEC A;  1QS7 A;  1UWO A;  4GGF A;  3OB1 B;  2KFH A;  5CSN A;  3BUO B;  1BG1 A;  1V1F A;  1CFP A;  4U8D A;  2ERB A;  2L98 A;  4JD9 A;  1CKK A;  3C1V A;  1M45 A;  4YI9 A;  3WNX B;  2V53 A;  2O60 A;  3SG6 A;  3EVU A;  3LK0 A;  1F54 A;  4HRH A;  1PK0 D;  1JF2 A;  1EG4 A;  1YVH A;  2L4H A;  3O2P A;  4UPG A;  2KGB C;  5HYD A;  3JVT C;  1JWD A;  1QJT A;  4A4C A;  1MR8 A;  1G33 A;  2M8U A;  3I5F B;  3UNW A;  1OOG A;  1TNW A;  3NSI A;  4GPL B;  1M46 A;  2BCX A;  3CDN A;  2BKH B;  3OB2 B;  5JOL A;  1CDP A;  1YR5 A;  2K2F A;  1NSH A;  2KLE A;  2KYC A;  4N1F A;  1H8B A;  3CWG A;  2L0P A;  3R1O A;  3BJH A;  3D77 A;  2ZNE A;  3O4Y A;  4HRE E;  1B8C A;  3H4S E;  4ZCU A;  2WCM A;  1ZMZ A;  2HPS A;  2MRD A;  2BBN A;  1AUI B;  1OZS A;  1UHI A;  1B8L A;  2QEO A;  4YGC B;  3L47 A;  3R1P A;  3VRR A;  1OW4 A;  1TUJ A;  1CM4 A;  1Q80 A;  4YGE B;  1TNP A;  5DIC A;  3V2L A;  1DC1 A;  1W7J B;  5D7F A;  1BJF A;  3GOF A;  1P28 A;  1CM1 A;  2EHB A;  4C0J A;  5HL1 A;  5AXI A;  1REC A;  1V1G A;  3PLF B;  1J7P A;  1J55 A;  5G08 A;  4NQG A;  1JSA A;  5HKW A;  2KLD A;  2PQL A;  4WQ2 A;  2HET A;  4M2Q A;  3E3R A;  2L2C A;  3VRO A;  1RWY A;  1SL9 A;  2OTG C;  2TN4 A;  5FI6 A;  3HCM A;  5KTY A;  3GK2 A;  1IRJ A;  1Y6W A;  1YTZ C;  2SAS A;  3SS4 A;  2LLU A;  1KK7 Z;  1NX2 A;  2F33 A;  2JUL A;  3BFB A;  1TRF A;  1KK8 B;  2FCE A;  2KYF A;  3FE9 A;  4I5K A;  3TUY C;  2L2E A;  2WC5 A;  1J7Q A;  2LAN A;  1SKT A;  4ICB A;  2L4I A;  3OP0 A;  1WRZ A;  1TOP A;  1QIV A;  2F2P A;  1Y1A A;  1QTX A;  1C3Y A;  1NCY A;  1DF0 B;  1KFU S;  5CPV A;  4DRW A;  4MZL A;  1SY9 A;  1ZUZ A;  3NXA A;  3N7H A;  3KHE A;  1A2X A;  5FI2 A;  4ORB B;  4QJ5 B;  1BOD A;  2L50 A;  2Y1M A;  1CLB A;  3BXK A;  2LE9 B;  4XYN A;  1JC2 A;  4XJK B;  2JNX A;  2K7B A;  2WCE A;  3DD4 A;  1FF1 A;  2JT8 A;  1LXF C;  1S6C A;  3DZT A;  3F45 A;  1KCY A;  4GGF C;  2F3Z A;  1AHR A;  3EKH A;  5HKZ A;  1FPW A;  4Q04 A;  1U5I A;  3IQQ A;  1QAT A;  3NHT A;  3JTD B;  1TCO B;  4YRU A;  1CB1 A;  1ORG A;  2MJW B;  1PUL A;  1PSB A;  3A4U B;  3I5I B;  2LMV A;  4BY4 A;  2JTZ A;  1KSO A;  4OCI A;  3BUM B;  4OV2 A;  1TNQ A;  1SRA A;  2ZN9 A;  5I2O A;  1SCM B;  2KI6 C;  3PAL A;  2LV7 A;  1EH2 A;  1MXE A;  3D75 A;  1DMO A;  2JXL A;  1BU3 A;  1OMR A;  2COL B;  1RK9 A;  2LVJ A;  2WCJ A;  1RTP 1;  3S0B A;  1K9K A;  3EVV A;  2M3W A;  3CZ0 A;  3LLE A;  2GGZ A;  2M0R A;  5TNC A;  3SG5 A;  3PN7 B;  1GM0 A;  4INW A;  1C3Z A;  1F55 A;  1S1E A;  2KI4 C;  1B7T Z;  1TWO A;  3PFV A;  2BCA A;  4KYN A;  2F3Y A;  1H4B A;  3DVK A;  1S5G Y;  2K7O A;  1PVB A;  2WCB A;  1J1D A;  2M7L A;  1EG3 A;  2M9G A;  3AAJ A;  1D1O A;  1FI6 A;  2LUC A;  2I7A A;  2F2O A;  3ICB A;  4PE7 A;  1A75 A;  1K2H A;  4PHN A;  2PYQ A;  2HF5 A;  3O4X A;  1E8A A;  3FE8 A;  3BYA A;  2Y1N A;  1ALW A;  4N1G A;  3TDI A;  3FWC A;  4HSZ A;  3CS1 A;  1YUT A;  2MBX A;  1EJ3 A;  5FI7 A;  1W9Z A;  2EC6 B;  1BR4 B;  2BCB A;  2K8M B;  4YGB B;  2JRF A;  1TUZ A;  1DGU A;  4GBA A;  3SG3 A;  2CNP A;  1LKJ A;  2WCK A;  1IQ5 A;  4F0Z B;  4MZJ A;  2KSP A;  3TZ1 A;  2OS8 B;  1AP4 A;  5K89 A;  2P71 A;  1KFX L;  3PM2 A;  1MWN A;  2F8P A;  1NCX A;  2M1K B;  5BPJ A;  1PAL A;  1NPQ A;  3I5G C;  4MBE A;  2BKI B;  4PE4 A;  5PAL A;  2Q4U A;  1IH0 A;  4NDB A;  3RZS A;  4MZK A;  1QXP A;  3D76 A;  2BL0 C;  1CFF A;  4N5X A;  1WY9 A;  1SCV A;  1Z2C B;  3D78 A;  1IJ5 A;  1N65 A;  2JWW A;  2M49 B;  1SR6 C;  1ZAC A;  3CZ2 A;  5AAN A;  1SYM A;  3LL8 B;  2BBM A;  2PAS A;  2KQY A;  2GTE A;  2NZ0 A;  2JU0 A;  5I94 A;  1A4P A;  2ZND A;  3JVT B;  1B1G A;  2BNX A;  3CR2 A;  3OX5 A;  2KAX A;  1F4O A;  2AAO A;  2I18 A;  3Q8I A;  4PE1 A;  1FW4 A;  1TN4 A;  1YX7 A;  4OZD A;  3S0G A;  3BUN B;  1XK4 A;  1QX7 A; 
#chains in the Genus database with same CATH homology
 3DXL A;  1QWV A;  3CAB A;  1C3Y A;  3OGN A;  4INX A;  2H8V A;  3N7H A;  4FQT A;  2JPO A;  4PT1 A;  1OOH A;  1T14 A;  3L4A A;  3R72 A;  3DZT A;  1OOI X;  3B86 A;  3NHT A;  3B7A A;  1ORG A;  3B6X A;  2KPH A;  3NGV A;  3S0E A;  2WCH A;  2QEB A;  3D75 A;  3NHI A;  2FJY A;  2WCJ A;  3L4L A;  3S0B A;  3B88 A;  3CZ0 A;  3B87 A;  5EL2 A;  3VB1 A;  3QME A;  2P70 A;  1GM0 A;  4INW A;  1C3Z A;  2ERB A;  1TWO A;  4JD9 A;  3S0D A;  3DY9 A;  3DYE A;  3FE8 A;  3CYZ A;  1OOG A;  3BFA A;  3CDN A;  1LS8 A;  1DQE A;  2WCL A;  2WCK A;  1OOF A;  3R1O A;  3K1E A;  3BJH A;  3D77 A;  2P71 A;  2WCM A;  3PJI A;  2QEO A;  3R1V A;  3L47 A;  3R1P A;  2QDI A;  3S0A A;  1OW4 A;  1TUJ A;  5DIC A;  3S0F A;  3V2L A;  3RZS A;  1XFR A;  1P28 A;  3D76 A;  3D78 A;  2WC6 A;  3D73 A;  3CZ1 A;  2PQL A;  3CZ2 A;  2QEV A;  2L2C A;  2GTE A;  3D74 A;  3BFB A;  3BFH A;  3Q8I A;  3FE9 A;  3FE6 A;  4F7F A;  2WC5 A;  4OZD A;  3S0G A;  2QEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...