1K9KA

Crystal structure of calcium bound human s100a6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
89
structure length
89
Chain Sequence
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 36
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9kA00
4F0ZB 3IF7A 2D8NA 5PALA 1CFDA 1E8AA 2ZFDA 4PHKA 1OZOA 2Y4QA 1J7OA 1V1GA 1UHKA 1F55A 1BG1A 5DKRA 4QJ5B 1R6PA 1C07A 1S26D 1MUXA 2BECA 2M1UA 4USLA 2PMYA 3SIBA 4YBHB 1SR6C 2JXLA 3K21A 1ALWA 1HT9A 2LCPA 1WY9A 3EVVA 3SG7A 1B8CA 2K8MB 4JPZB 1K9UA 2KFGA 1BU3A 1S5GY 4MEWA 1CDNA 3SG3A 2PALA 1K9KA 1F71A 1J1DA 2JT8A 3OB1B 1EL4A 1U5IA 3KPXA 2LLSA 5D7FA 1Y1UA 4N1GA 3CS1A 1G8IA 1RFJA 1B8RA 2BL0B 3NXAA 4M2PA 4GPLB 3PM8A 2K7CA 2MJWB 2K7BA 1DJIA 3BXKA 1CTRA 2KHNA 1XFVO 3WNXB 4AOMA 1CFPA 1QV1A 1F4QA 2H2KA 1NUBA 3TUYB 3DVKA 2NXQA 3DF0B 3F45A 2MBXA 4OCIA 1IQ3A 5AXIA 1S3PA 1YR5A 4A4CA 4YGBB 1J55A 5AANA 4PE0A 2BE6A 3GK2A 3OHMB 2PASA 2BCXA 2I18A 1GGZA 4MSPA 1DF0B 1KK7Y 2JOJA 4GGFA 4MLWA 3CR5X 1A75A 3O6BA 5I8NA 5I2OA 2M1KB 2KYFA 1ZOTB 1TNXA 5HLOA 1B7TY 3ZNIA 1L2OB 1LXFC 1WRZA 1M45A 2KSPA 5D69A 1AUIB 3LK0A 2LM5A 1OSAA 1DTLA 2BBNA 1BLQA 1QX2A 1K96A 4PE1A 1ZUZA 3CGAA 3CWGA 3VRNA 2OS8C 2P6BB 3PFVA 4GGFC 1S6IA 1SNLA 4GUKA 1SCMC 4ZCVA 4CFQA 2JNFA 2M8UA 2LMTA 5G08A 2COLB 1EG4A 1CFCA 1SPYA 1RROA 1SL9A 1KSMA 3VRQA 2AAOA 3BOWB 1YRTB 3M0WA 5I2QA 1FBVA 1JF2A 1CDMA 3VRRA 2G9BA 1M46A 2MAZA 2F3ZA 1CM1A 2HQWA 1MQ1A 4CLNA 1R2UA 5KTYA 2LHIA 4FTGA 3I5HB 2I94A 2LV7A 1GQMA 1NWDA 1UHJA 2BCAA 2LMUA 3EKHA 3JTDC 2QACA 4YI8A 2F8PA 4HRGA 3BUNB 2LAPA 2NZ0A 4MZKA 2BKIB 3PN7B 1W7IB 1QLSA 2FJUB 2LVIA 1KK7Z 1SL8A 1ZFSA 3MSEB 4CIDA 1KFUL 4QJ4B 2EC6C 3GK1A 2KI6D 1A2XA 2MA2A 2EHBA 2Y1NA 5KSZA 1LINA 2LUXA 4DS7A 1NSHA 3SJSA 2KYCA 1KWOB 2BKHB 1IJ5A 3JVTC 3FWCA 1SW8A 3H4SE 4I5JA 4XYNA 1QIVA 1EXRA 1AJ4A 3SG6A 2KI6C 1NCXA 3I5GB 4DIRA 4MVFA 3AKBA 1KQMB 4OR9B 4PHMA 4MN0A 3NSKA 2M7NA 1OZSA 1DJHA 1TNWA 5DKQA 2HF5A 1TTXA 1XO5A 5I2LA 1UUSA 1B9AA 4L9MA 1X02A 2M0RA 3LLEA 1OOJA 5ER4X 4YGAA 4FQOA 1NPQA 3EVRA 1CKKA 1NX2A 1DJGA 1TCOB 1K94A 1MF8B 3LL8B 1RK9A 2JTZA 5F6TA 1YUTA 2JT3A 2HPSA 1IJ6A 1ZACA 1BJFA 4XJKB 5HYDA 4DCKA 1SL7A 1XFXO 2KBIA 2L4IA 1KK8C 1CLBA 1TCFA 5ER5A 4A4BA 4P2YB 1XYDA 2BCBA 2HQ8A 4M2OA 1NIWA 1C7WA 1A03A 2ZNDA 1S1EA 2O60A 1WDCC 1H8BA 3D0YB 3BUXB 2ZKMX 2SCPA 2EGDA 2HETA 1DJWA 1Y0VH 2KFFA 1DF0A 1CFFA 4CPVA 1SR6B 4JWQA 1Y1XA 3TUYC 3TDUA 2Q91A 1CLLA 1N65A 5CSJA 1J1EA 3TS5C 1B4CA 1XA5A 3AAKA 2KI4C 4ETOA 4WQ2A 5GQQC 2H61A 1TRFA 4AQIA 3KO0A 5HKWA 2KFHA 2L5XB 2L50A 2JULA 5CSFA 1IWQA 1S6CA 2LLTA 4R1EA 3OB2B 5J3XA 1MXLC 2M3WA 1KQVA 1XFUO 5HKZA 4YI9A 1NP8A 1PSRA 2JU0A 4I5LB 2WC8A 5CSIA 2LLUA 1WLZA 2L0PA 1PK0D 3AKAA 2JPTA 4HREE 1PRWA 2K2AA 4OVNF 5HLVA 1DGUA 2JZIA 4PALA 1TNPA 1YTZC 1U5IB 1UHHA 1KCYA 4NDBA 1VRKA 1QLKA 2G2BA 2M29A 3PATA 1FW4A 2B1UA 2CNPA 4MZLA 1B1GA 4MRYA 4DUQA 1QJTA 3CZTX 2LVVA 3VRPA 4YGCB 1BF5A 1NCYA 4GBAA 4HRHA 1EH2A 1QATA 2JRFA 1F70A 1LKJA 1PULA 2JQ6A 1MXEA 1OMRA 2LE9B 2V53A 1W7JB 3I5IC 1SKTA 1BR1B 3NSIA 2OPOA 3KEVA 2E30A 3NSLA 4PHNA 1TIZA 1K95A 3O4YA 1KFXS 1UP5A 2OS8B 4PE4A 1PALA 3I5FC 1SYMA 2OTGC 2ZN8A 1UURA 1SCMB 1JWDA 1Y6WA 2A4JA 3SG2A 1AHRA 4I5NB 2MHHA 1PSBA 2QPTA 2Y5IA 2ZRTA 4PCWA 1QTXA 3CTNA 3DVMA 2KOTA 4DRWA 2FCDA 3CLNA 3PN7C 2KBMA 2JNXA 2I7AA 1QVIY 2JXCA 4JQ0D 2KQ6A 4NDDA 1JFJA 2M9GA 1QXPA 5AFPA 1YVLA 1KSOA 1K8UA 1OMDA 2SASA 2M49B 1PVAA 1QX7A 3HX4A 5JOLA 2WORA 2ZRSA 2F2PA 1V1FA 2E6WA 3JTDB 1DJXA 1JFKA 2O5GA 1AP4A 3RLZA 1AK8A 1RJVA 1BT6A 2LVKA 1LA3A 1DGVA 1YUUA 2GGMA 3BQ3A 3EK4A 1CB1A 4XJKA 1NX0A 1KFUS 1WRKA 1SCVA 2EC6B 1CMFA 1CM4A 3WXAA 1IGVA 2KGRA 4ORCB 1D1OA 1NCZA 1LVCD 4YGDB 1EJ3A 1JUOA 4QJ3B 1A4PA 4BY4A 1OQPA 1OE9B 3JVTB 5B8IB 1FI5A 2F3YA 2FOTA 2LNKA 2GV5A 3DD4A 2IS9A 1AVSA 2ZNEA 2KAVA 3OP0A 1TN4A 1G33A 2CTNA 2ZN9A 3IQQA 2JT0A 2VRGA 1QASA 1DJZA 4HSZA 2LHLA 4NDCA 2K61A 2LC5A 1CNPA 1DJYA 5K89A 3DF0A 3ZWHA 2JC2A 1ALVA 1OMVA 4M2QA 3NSOA 2BBMA 2MRDA 1IRJA 1K9PA 3OX5A 4GGNA 1QVIZ 2DOQA 3EVUA 4ICBA 1S6JA 1SMGA 2BL0C 2F2OA 2TN4A 3RM1A 1EG3A 1BOCA 2Y1MA 3D10A 1RWYA 1IQ5A 2KDHA 2L4HA 2R2IA 2FCEA 1SY9A 3C1VA 1MR8A 1Q80A 1BR4B 4GNKB 1KK8B 2ISDA 2Q4UA 3KHEA 3HCMA 1YURA 1YX8A 1YVHA 1M63B 3QRXA 1IH0A 2KNEA 4UPGA 3A8RA 3EKJA 2NCPA 1MWNA 1WDCB 3O2PA 3AAJA 3EK7A 2MLFC 4WRIA 1QS7A 4GAOA 1XFYO 1YX7A 1WRLA 2K7OA 2PSRA 4NQGA 2JTTA 2AUCA 3GOFA 3LK1A 3VGOA 1FF1A 3BUWB 2RGIA 5CSNA 2L51A 1XFWO 2NLNA 1K2HA 1L2OC 1L7ZA 4MRXA 4D1EA 1S36A 1K90D 1BODA 3BUMB 1JBAA 4C0JA 3BOWA 4E68A 1RTP1 3EK8A 2PVBA 1G4YR 3CR2A 1XVJA 1XK4A 1FPWA 5BPJA 2H61C 1SBJA 1SRAA 3TS5B 1GGWA 2LANA 2KI4B 4ORBB 3WHTB 1WLMA 2WOSA 4OKHA 3SG4A 5KU1A 3KF9A 1UHIA 1F8HA 2K0JA 2KAYA 3PSRA 1CLMA 2KGBC 1JSAA 1BMOA 4Q04A 1N2DA 3TDZA 5HKYA 4AQJA 2MLEC 4PE7A 1QIWA 3BUOB 1NYAA 1DMOA 3TZ1A 2GGZA 1XK4C 1QX5B 2LMVA 3TDIA 1K93D 4GFTA 2CT9A 1PVBA 1KFXL 2WCBA 1A75B 3O78A 4U8DA 3I5HC 2PRUA 3SG5A 4TNCA 1NX3A 1YRUB 1H4BA 1DT7B 4BY5A 2I2RE 1RECA 1S5GZ 3SIAA 2CXJA 1M31A 1F54A 4N5XA 4YGEB 2LUCA 4ZCUA 2AMIA 3FIAA 4P5OE 1IG5A 2JWWA 1CMGA 3I5IB 1J7QA 2F33A 1SK6D 1JF0A 3PALA 4CFRA 4PDZA 1Y1AA 4MBEA 1DVIA 1C7VA 1MHOA 4I5KA 1XFZO 1IKUA 3I5FB 2OTGB 3ICBA 1M39A 4PHJA 4C0KA 3FWBA 1A29A 1F4OA 2L2EA 1KWOC 1TNQA 4ORAB 5DKNA 2L98A 2CCMA 4C0LA 3GK4X 2LP2A 2M97A 2WCFA 1J7RA 1TOPA 2WNDA 4N1FA 1YUSA 3I5GC 5AERA 1FI6A 1KQMC 5AEQA 3VROA 2LVJA 1B7TZ 1CDPA 1JC2A 1NX1A 5IBWA 1ODBA 3DVEA 2NCOA 3CR4X 5TNCA 1UHNA 4IL1A 1HQVA 2LP3A 5CPVA 3FS7A 4YRUA 2KQYA 3OX6A 1GJYA 1QV0A 1B47A 1CDLA 2WCEA 1B8LA 1ZMZA 3D0YA 2K7DA 1UWOA 4MZJA 2BE4A 5JJGA 3E3RA 2K2FA 3PLFB 2CBLA 2KAXA 2M7LA 4OV2A 4WQ3A 3DVJA 3IQOA 1AJ5A 1N0YA 3LCPC 5FYXA 3WHUB 3A4UB 3BYAA 1LA0A 1J7PA
chains in the Genus database with same CATH superfamily
3R72A 4F0ZB 3IF7A 2D8NA 5PALA 1CFDA 1E8AA 2ZFDA 4PHKA 3CZ2A 1OZOA 2Y4QA 1J7OA 1V1GA 1UHKA 1F55A 1BG1A 5DKRA 4QJ5B 1R6PA 1C07A 2QEOA 1S26D 3S0GA 1MUXA 2BECA 2M1UA 4USLA 2PMYA 3SIBA 4YBHB 1SR6C 2JXLA 3EG5B 3K21A 1ALWA 1HT9A 2LCPA 1WY9A 3EVVA 3SG7A 1B8CA 2K8MB 4JPZB 3WHUB 1K9UA 2KFGA 1BU3A 1S5GY 4MEWA 1CDNA 3SG3A 2PALA 1K9KA 1F71A 1J1DA 2JT8A 3OB1B 1EL4A 1U5IA 3KPXA 2LLSA 5D7FA 1Y1UA 4N1GA 3CS1A 1G8IA 1RFJA 1B8RA 2BL0B 3NXAA 4M2PA 2K60A 4GPLB 3PM8A 2K7CA 2MJWB 2K7BA 1DJIA 3BXKA 1CTRA 2KHNA 1XFVO 3WNXB 4AOMA 1CFPA 1QV1A 1F4QA 2H2KA 1NUBA 3FE8A 4INXA 3TUYB 3DVKA 2NXQA 3DF0B 3F45A 1DQEA 2MBXA 4OCIA 1IQ3A 5AXIA 1S3PA 1YR5A 4A4CA 4YGBB 1J55A 5AANA 3DXLA 4PE0A 3CZ1A 2BE6A 3GK2A 3OHMB 2PASA 2BCXA 2I18A 1GGZA 4MSPA 1DF0B 1KK7Y 2JOJA 4GGFA 4MLWA 3B87A 3CR5X 1A75A 3O6BA 5I8NA 5I2OA 2M1KB 2KYFA 1ZOTB 3N7HA 1TNXA 2KLDA 5I94A 5HLOA 1B7TY 3ZNIA 1L2OB 1LXFC 1WRZA 1M45A 2QEHA 2KSPA 5D69A 1AUIB 3LK0A 2LM5A 1OSAA 1DTLA 2BBNA 1BLQA 1QX2A 1K96A 4PE1A 1ZUZA 3CGAA 3CWGA 3VRNA 2OS8C 2P6BB 3PFVA 4GGFC 1S6IA 1SNLA 4GUKA 1SCMC 4ZCVA 4CFQA 2JNFA 2M8UA 2LMTA 5G08A 2COLB 1EG4A 1CFCA 1SPYA 1TUZA 3CABA 2WCLA 1RROA 1SL9A 2YGUA 1KSMA 5FI2A 3VRQA 2AAOA 3BOWB 1YRTB 3M0WA 5I2QA 1FBVA 3CDNA 1JF2A 1CDMA 3VRRA 2G9BA 3PM2A 1M46A 2MAZA 2F3ZA 1CM1A 2HQWA 1MQ1A 4CLNA 1R2UA 5KTYA 2LHIA 4FTGA 5FI7A 3I5HB 2I94A 2LV7A 1GQMA 1NWDA 1UHJA 2BCAA 3B7AA 2LMUA 3EKHA 3JTDC 2QACA 4YI8A 2F8PA 2P71A 1C3ZA 5HL1A 4HRGA 3BUNB 2LAPA 1ORGA 2L2CA 2NZ0A 4MZKA 3CZ0A 2BKIB 3PN7B 1W7IB 1QLSA 2FJUB 2LVIA 1KK7Z 1SL8A 1ZFSA 3MSEB 4CIDA 1KFUL 4QJ4B 2EC6C 2KPHA 3GK1A 2KI6D 1A2XA 2MA2A 2EHBA 2Y1NA 5KSZA 1LINA 2LUXA 4JD9A 4DS7A 1NSHA 3SJSA 3L4LA 2KYCA 1KWOB 2BKHB 1IJ5A 3JVTC 3FWCA 1SW8A 3H4SE 3CYZA 4I5JA 4XYNA 1QIVA 1TUJA 1EXRA 3B6XA 1AJ4A 3D74A 3SG6A 2KI6C 3NHIA 1NCXA 3I5GB 4DIRA 4MVFA 3AKBA 1KQMB 1T14A 4JKTA 4OR9B 4PHMA 4MN0A 3NSKA 2M7NA 1OZSA 1DJHA 1TNWA 5DKQA 2HF5A 1TTXA 1XO5A 5I2LA 1UUSA 1B9AA 4L9MA 1X02A 2M0RA 3LLEA 1OOJA 3DYEA 5ER4X 4YGAA 4FQOA 1NPQA 3EVRA 1CKKA 1NX2A 1DJGA 1TCOB 1K94A 1MF8B 3LL8B 1RK9A 2JTZA 3D76A 5F6TA 1YUTA 2JT3A 2HPSA 1IJ6A 1ZACA 1BJFA 4XJKB 1OOHA 3D77A 1SL7A 3UO9A 4DCKA 5HYDA 1XFXO 2KBIA 2L4IA 1KK8C 5FI6A 1CLBA 1TCFA 5ER5A 4A4BA 4P2YB 1XYDA 2BCBA 2HQ8A 2QDIA 4M2OA 1NIWA 1C7WA 1A03A 2ZNDA 4INWA 1S1EA 2O60A 1WDCC 1H8BA 3IVTA 3D0YB 2H8VA 3BUXB 1QWVA 2ZKMX 5D3OA 2SCPA 2EGDA 2HETA 1DJWA 4IJ7A 1Y0VH 2KFFA 1DF0A 1CFFA 3V2LA 4CPVA 1SR6B 4JWQA 1Y1XA 3S0BA 3TUYC 2KLEA 3TDUA 3NGVA 2Q91A 1CLLA 1N65A 5CSJA 1J1EA 3BJHA 3TS5C 1B4CA 1XA5A 3AAKA 2KI4C 4ETOA 4WQ2A 5GQQC 2H61A 1TRFA 4AQIA 3KO0A 5HKWA 2WCJA 2KFHA 2L5XB 2L50A 2JULA 5CSFA 1IWQA 1S6CA 2LLTA 4R1EA 3OBVA 3OB2B 5J3XA 1MXLC 2M3WA 1KQVA 1XFUO 5HKZA 4YI9A 1NP8A 1PSRA 2FJYA 2JU0A 4I5LB 2WC8A 5CSIA 2LLUA 1WLZA 2L0PA 1PK0D 3AKAA 2JPTA 4HREE 1PRWA 2K2AA 4OVNF 5HLVA 1DGUA 2JZIA 4PALA 1TNPA 1YTZC 1U5IB 3R1PA 1UHHA 1KCYA 4NDBA 1VRKA 1QLKA 2G2BA 2M29A 3PATA 1FW4A 1P28A 1Z2CB 2B1UA 1DEKA 2CNPA 4MZLA 4MRYA 4DUQA 1B1GA 3SS5A 1QJTA 3CZTX 2PYQA 2LVVA 3VRPA 4YGCB 1BF5A 1NCYA 4GBAA 4HRHA 1DC1A 3BFBA 1C3YA 1EH2A 1QATA 2JRFA 3OGNA 1F70A 1LKJA 1PULA 2JQ6A 3UNWA 1MXEA 1OMRA 4FQTA 1IIOA 2LE9B 2V53A 1W7JB 3I5IC 3R1VA 1SKTA 1BR1B 3NSIA 2OPOA 3KEVA 2E30A 3NSLA 4PHNA 1TIZA 1K95A 3O4YA 1KFXS 2GTEA 3NHTA 1UP5A 2OS8B 4PE4A 1PALA 2WC5A 1SYMA 2OTGC 2ZN8A 1UURA 3I5FC 1OOFA 1SCMB 1JWDA 1Y6WA 2A4JA 3SG2A 3BFHA 1AHRA 4I5NB 2MHHA 1PSBA 2QPTA 2Y5IA 2ZRTA 3FE9A 4PCWA 1QTXA 3CTNA 3DVMA 2KOTA 4DRWA 2FCDA 2JPOA 3CLNA 3PN7C 2KBMA 3S0FA 2JNXA 3S0AA 1OOGA 2WCKA 2I7AA 1QVIY 2JXCA 4JQ0D 2KQ6A 4NDDA 1JFJA 2M9GA 1QXPA 1SSEB 5AFPA 1YVLA 1KSOA 1K8UA 1OMDA 2SASA 3DY9A 3S0EA 2BAPA 2M49B 1PVAA 1QX7A 3HX4A 5JOLA 2WORA 2ZRSA 2F2PA 2PQLA 1V1FA 2E6WA 3JTDB 1DJXA 1JFKA 2O5GA 1AP4A 3RLZA 1AK8A 1RJVA 1BT6A 2LVKA 1LA3A 1DGVA 3D78A 1YUUA 2GGMA 3BQ3A 3EK4A 1CB1A 4XJKA 1NX0A 1KFUS 1WRKA 1SCVA 2EC6B 1CMFA 1CM4A 3WXAA 1IGVA 2KGRA 4ORCB 3R1OA 1D1OA 1NCZA 1LVCD 4YGDB 1EJ3A 1JUOA 4QJ3B 1A4PA 4BY4A 1OQPA 1OE9B 3JVTB 5B8IB 1FI5A 2F3YA 2FOTA 2LNKA 2GV5A 3DD4A 2IS9A 3Q8IA 3QMEA 1AVSA 2ZNEA 2KAVA 3OP0A 1TN4A 1G33A 2CTNA 2BNXA 2ZN9A 3IQQA 2JT0A 2VRGA 1QASA 3D73A 1DJZA 4HSZA 2LHLA 4NDCA 2K61A 2LC5A 1CNPA 1DJYA 5K89A 3DF0A 3VB1A 3ZWHA 3L47A 2JC2A 1XFRA 1ALVA 1OMVA 4M2QA 3NSOA 2WCHA 2BBMA 2MRDA 1IRJA 1K9PA 3FE6A 3OX5A 1QVIZ 4GGNA 4OZDA 2DOQA 3EVUA 4ICBA 1S6JA 1SMGA 2BL0C 2F2OA 2TN4A 2WC6A 3RM1A 1EG3A 4F7FA 1BOCA 2Y1MA 3D10A 1RWYA 1IQ5A 2KDHA 2L4HA 2R2IA 3O4XA 2FCEA 1SY9A 1TWOA 1MR8A 3C1VA 1Q80A 1W9ZA 1BR4B 4GNKB 1KK8B 2ISDA 2Q4UA 3KHEA 3HCMA 1YURA 1YX8A 1YVHA 1M63B 3QRXA 1IH0A 2KNEA 1Z4HA 3A8RA 3B86A 4UPGA 2QEVA 3EKJA 2NCPA 1MWNA 1WDCB 3O2PA 3AAJA 3EK7A 2MLFC 4WRIA 1QS7A 4GAOA 1XFYO 1YX7A 1WRLA 2K7OA 2PSRA 4NQGA 2JTTA 2AUCA 3GOFA 3LK1A 3VGOA 1FF1A 3BUWB 2RGIA 5CSNA 2L51A 1XFWO 2NLNA 1K2HA 1L2OC 1L7ZA 4MRXA 4D1EA 5EL2A 1S36A 1K90D 1BODA 3BUMB 3D75A 1JBAA 4C0JA 3BOWA 3RZSA 4E68A 1RTP1 3EK8A 2PVBA 1G4YR 3CR2A 1XVJA 1XK4A 1FPWA 5BPJA 2H61C 1SBJA 1SRAA 4PT1A 4KYNA 3TS5B 1GGWA 2L5YA 2LANA 2KI4B 3DZTA 4ORBB 3WHTB 1WLMA 2WOSA 4OKHA 3SG4A 5KU1A 3KF9A 1UHIA 1F8HA 2K0JA 3S0DA 2KAYA 3PSRA 1CLMA 2KGBC 1JSAA 1BMOA 4Q04A 1N2DA 3TDZA 5HKYA 4AQJA 3SS3A 2MLEC 4PE7A 1QIWA 3BUOB 1NYAA 1DMOA 3TZ1A 2GGZA 1XK4C 1QX5B 2LMVA 3TDIA 1K93D 4GFTA 2CT9A 2QEBA 1PVBA 1KFXL 3B88A 2WCBA 1A75B 3O78A 4U8DA 3I5HC 2PRUA 3SG5A 4TNCA 1NX3A 1YRUB 1H4BA 1DT7B 4BY5A 2I2RE 1RECA 1OOIX 1S5GZ 3SIAA 3K1EA 2CXJA 1M31A 1F54A 4N5XA 4YGEB 2LUCA 4ZCUA 2AMIA 3FIAA 4P5OE 1IG5A 2JWWA 1CMGA 3I5IB 3SS4A 3PJIA 1J7QA 2F33A 1SK6D 1JF0A 3PALA 4CFRA 1OW4A 4PDZA 1Y1AA 4MBEA 1DVIA 1C7VA 2WCMA 1MHOA 4I5KA 1XFZO 1IKUA 3I5FB 2OTGB 3ICBA 1M39A 4PHJA 4C0KA 1GM0A 3FWBA 1A29A 1F4OA 2L2EA 1KWOC 1TNQA 4ORAB 5DKNA 2L98A 2CCMA 4C0LA 3GK4X 2LP2A 1DELA 2M97A 1J7RA 1TOPA 2WCFA 2WNDA 4N1FA 1YUSA 3I5GC 5AERA 1FI6A 1KQMC 5AEQA 3VROA 1LS8A 2ERBA 1B7TZ 1CDPA 2LVJA 1NX1A 1JC2A 5IBWA 1ODBA 3DVEA 2NCOA 3CR4X 5TNCA 1UHNA 4IL1A 1HQVA 2LP3A 5CPVA 3FS7A 5DICA 4YRUA 2KQYA 3OX6A 1GJYA 1QV0A 1B47A 1CDLA 3BFAA 2WCEA 1ZMZA 1B8LA 3D0YA 2K7DA 1UWOA 4MZJA 2BE4A 5JJGA 3E3RA 2K2FA 3PLFB 2CBLA 2KAXA 2M7LA 4OV2A 4WQ3A 3DVJA 3IQOA 1AJ5A 1N0YA 3LCPC 3L4AA 5FYXA 3A4UB 3BYAA 1LA0A 1J7PA 2P70A
chains in the Genus database with same CATH topology
4F0ZB 3IF7A 2D8NA 5PALA 1CFDA 1E8AA 2ZFDA 4PHKA 1OZOA 2Y4QA 1J7OA 1V1GA 1UHKA 1F55A 1BG1A 5DKRA 4QJ5B 1R6PA 1C07A 1S26D 1MUXA 2BECA 2M1UA 4USLA 2PMYA 3SIBA 4YBHB 1SR6C 2JXLA 3K21A 1ALWA 1HT9A 2LCPA 1WY9A 3EVVA 3SG7A 1B8CA 2K8MB 4JPZB 1K9UA 2KFGA 1BU3A 1S5GY 4MEWA 1CDNA 3SG3A 2PALA 1K9KA 1F71A 1J1DA 2JT8A 3OB1B 1EL4A 1U5IA 3KPXA 2LLSA 5D7FA 1Y1UA 4N1GA 3CS1A 1G8IA 1RFJA 1B8RA 2BL0B 3NXAA 4M2PA 4GPLB 3PM8A 2K7CA 2MJWB 2K7BA 1DJIA 3BXKA 1CTRA 2KHNA 1XFVO 3WNXB 4AOMA 1CFPA 1QV1A 1F4QA 2H2KA 1NUBA 3TUYB 3DVKA 2NXQA 3DF0B 3F45A 2MBXA 4OCIA 1IQ3A 5AXIA 1S3PA 1YR5A 4A4CA 4YGBB 1J55A 5AANA 4PE0A 2BE6A 3GK2A 3OHMB 2PASA 2BCXA 2I18A 1GGZA 4MSPA 1DF0B 1KK7Y 2JOJA 4GGFA 4MLWA 3CR5X 1A75A 3O6BA 5I8NA 5I2OA 2M1KB 2KYFA 1ZOTB 1TNXA 5HLOA 1B7TY 3ZNIA 1L2OB 1LXFC 1WRZA 1M45A 2KSPA 5D69A 1AUIB 3LK0A 2LM5A 1OSAA 1DTLA 2BBNA 1BLQA 1QX2A 1K96A 4PE1A 1ZUZA 3CGAA 3CWGA 3VRNA 2OS8C 2P6BB 3PFVA 4GGFC 1S6IA 1SNLA 4GUKA 1SCMC 4ZCVA 4CFQA 2JNFA 2M8UA 2LMTA 5G08A 2COLB 1EG4A 1CFCA 1SPYA 1RROA 1SL9A 1KSMA 3VRQA 2AAOA 3BOWB 1YRTB 3M0WA 5I2QA 1FBVA 1JF2A 1CDMA 3VRRA 2G9BA 1M46A 2MAZA 2F3ZA 1CM1A 2HQWA 1MQ1A 4CLNA 1R2UA 5KTYA 2LHIA 4FTGA 3I5HB 2I94A 2LV7A 1GQMA 1NWDA 1UHJA 2BCAA 2LMUA 3EKHA 3JTDC 2QACA 4YI8A 2F8PA 4HRGA 3BUNB 2LAPA 2NZ0A 4MZKA 2BKIB 3PN7B 1W7IB 1QLSA 2FJUB 2LVIA 1KK7Z 1SL8A 1ZFSA 3MSEB 4CIDA 1KFUL 4QJ4B 2EC6C 3GK1A 2KI6D 1A2XA 2MA2A 2EHBA 2Y1NA 5KSZA 1LINA 2LUXA 4DS7A 1NSHA 3SJSA 2KYCA 1KWOB 2BKHB 1IJ5A 3JVTC 3FWCA 1SW8A 3H4SE 4I5JA 4XYNA 1QIVA 1EXRA 1AJ4A 3SG6A 2KI6C 1NCXA 3I5GB 4DIRA 4MVFA 3AKBA 1KQMB 4OR9B 4PHMA 4MN0A 3NSKA 2M7NA 1OZSA 1DJHA 1TNWA 5DKQA 2HF5A 1TTXA 1XO5A 5I2LA 1UUSA 1B9AA 4L9MA 1X02A 2M0RA 3LLEA 1OOJA 5ER4X 4YGAA 4FQOA 1NPQA 3EVRA 1CKKA 1NX2A 1DJGA 1TCOB 1K94A 1MF8B 3LL8B 1RK9A 2JTZA 5F6TA 1YUTA 2JT3A 2HPSA 1IJ6A 1ZACA 1BJFA 4XJKB 5HYDA 4DCKA 1SL7A 1XFXO 2KBIA 2L4IA 1KK8C 1CLBA 1TCFA 5ER5A 4A4BA 4P2YB 1XYDA 2BCBA 2HQ8A 4M2OA 1NIWA 1C7WA 1A03A 2ZNDA 1S1EA 2O60A 1WDCC 1H8BA 3D0YB 3BUXB 2ZKMX 2SCPA 2EGDA 2HETA 1DJWA 1Y0VH 2KFFA 1DF0A 1CFFA 4CPVA 1SR6B 4JWQA 1Y1XA 3TUYC 3TDUA 2Q91A 1CLLA 1N65A 5CSJA 1J1EA 3TS5C 1B4CA 1XA5A 3AAKA 2KI4C 4ETOA 4WQ2A 5GQQC 2H61A 1TRFA 4AQIA 3KO0A 5HKWA 2KFHA 2L5XB 2L50A 2JULA 5CSFA 1IWQA 1S6CA 2LLTA 4R1EA 3OB2B 5J3XA 1MXLC 2M3WA 1KQVA 1XFUO 5HKZA 4YI9A 1NP8A 1PSRA 2JU0A 4I5LB 2WC8A 5CSIA 2LLUA 1WLZA 2L0PA 1PK0D 3AKAA 2JPTA 4HREE 1PRWA 2K2AA 4OVNF 5HLVA 1DGUA 2JZIA 4PALA 1TNPA 1YTZC 1U5IB 1UHHA 1KCYA 4NDBA 1VRKA 1QLKA 2G2BA 2M29A 3PATA 1FW4A 2B1UA 2CNPA 4MZLA 1B1GA 4MRYA 4DUQA 1QJTA 3CZTX 2LVVA 3VRPA 4YGCB 1BF5A 1NCYA 4GBAA 4HRHA 1EH2A 1QATA 2JRFA 1F70A 1LKJA 1PULA 2JQ6A 1MXEA 1OMRA 2LE9B 2V53A 1W7JB 3I5IC 1SKTA 1BR1B 3NSIA 2OPOA 3KEVA 2E30A 3NSLA 4PHNA 1TIZA 1K95A 3O4YA 1KFXS 1UP5A 2OS8B 4PE4A 1PALA 3I5FC 1SYMA 2OTGC 2ZN8A 1UURA 1SCMB 1JWDA 1Y6WA 2A4JA 3SG2A 1AHRA 4I5NB 2MHHA 1PSBA 2QPTA 2Y5IA 2ZRTA 4PCWA 1QTXA 3CTNA 3DVMA 2KOTA 4DRWA 2FCDA 3CLNA 3PN7C 2KBMA 2JNXA 2I7AA 1QVIY 2JXCA 4JQ0D 2KQ6A 4NDDA 1JFJA 2M9GA 1QXPA 5AFPA 1YVLA 1KSOA 1K8UA 1OMDA 2SASA 2M49B 1PVAA 1QX7A 3HX4A 5JOLA 2WORA 2ZRSA 2F2PA 1V1FA 2E6WA 3JTDB 1DJXA 1JFKA 2O5GA 1AP4A 3RLZA 1AK8A 1RJVA 1BT6A 2LVKA 1LA3A 1DGVA 1YUUA 2GGMA 3BQ3A 3EK4A 1CB1A 4XJKA 1NX0A 1KFUS 1WRKA 1SCVA 2EC6B 1CMFA 1CM4A 3WXAA 1IGVA 2KGRA 4ORCB 1D1OA 1NCZA 1LVCD 4YGDB 1EJ3A 1JUOA 4QJ3B 1A4PA 4BY4A 1OQPA 1OE9B 3JVTB 5B8IB 1FI5A 2F3YA 2FOTA 2LNKA 2GV5A 3DD4A 2IS9A 1AVSA 2ZNEA 2KAVA 3OP0A 1TN4A 1G33A 2CTNA 2ZN9A 3IQQA 2JT0A 2VRGA 1QASA 1DJZA 4HSZA 2LHLA 4NDCA 2K61A 2LC5A 1CNPA 1DJYA 5K89A 3DF0A 3ZWHA 2JC2A 1ALVA 1OMVA 4M2QA 3NSOA 2BBMA 2MRDA 1IRJA 1K9PA 3OX5A 4GGNA 1QVIZ 2DOQA 3EVUA 4ICBA 1S6JA 1SMGA 2BL0C 2F2OA 2TN4A 3RM1A 1EG3A 1BOCA 2Y1MA 3D10A 1RWYA 1IQ5A 2KDHA 2L4HA 2R2IA 2FCEA 1SY9A 3C1VA 1MR8A 1Q80A 1BR4B 4GNKB 1KK8B 2ISDA 2Q4UA 3KHEA 3HCMA 1YURA 1YX8A 1YVHA 1M63B 3QRXA 1IH0A 2KNEA 4UPGA 3A8RA 3EKJA 2NCPA 1MWNA 1WDCB 3O2PA 3AAJA 3EK7A 2MLFC 4WRIA 1QS7A 4GAOA 1XFYO 1YX7A 1WRLA 2K7OA 2PSRA 4NQGA 2JTTA 2AUCA 3GOFA 3LK1A 3VGOA 1FF1A 3BUWB 2RGIA 5CSNA 2L51A 1XFWO 2NLNA 1K2HA 1L2OC 1L7ZA 4MRXA 4D1EA 1S36A 1K90D 1BODA 3BUMB 1JBAA 4C0JA 3BOWA 4E68A 1RTP1 3EK8A 2PVBA 1G4YR 3CR2A 1XVJA 1XK4A 1FPWA 5BPJA 2H61C 1SBJA 1SRAA 3TS5B 1GGWA 2LANA 2KI4B 4ORBB 3WHTB 1WLMA 2WOSA 4OKHA 3SG4A 5KU1A 3KF9A 1UHIA 1F8HA 2K0JA 2KAYA 3PSRA 1CLMA 2KGBC 1JSAA 1BMOA 4Q04A 1N2DA 3TDZA 5HKYA 4AQJA 2MLEC 4PE7A 1QIWA 3BUOB 1NYAA 1DMOA 3TZ1A 2GGZA 1XK4C 1QX5B 2LMVA 3TDIA 1K93D 4GFTA 2CT9A 1PVBA 1KFXL 2WCBA 1A75B 3O78A 4U8DA 3I5HC 2PRUA 3SG5A 4TNCA 1NX3A 1YRUB 1H4BA 1DT7B 4BY5A 2I2RE 1RECA 1S5GZ 3SIAA 2CXJA 1M31A 1F54A 4N5XA 4YGEB 2LUCA 4ZCUA 2AMIA 3FIAA 4P5OE 1IG5A 2JWWA 1CMGA 3I5IB 1J7QA 2F33A 1SK6D 1JF0A 3PALA 4CFRA 4PDZA 1Y1AA 4MBEA 1DVIA 1C7VA 1MHOA 4I5KA 1XFZO 1IKUA 3I5FB 2OTGB 3ICBA 1M39A 4PHJA 4C0KA 3FWBA 1A29A 1F4OA 2L2EA 1KWOC 1TNQA 4ORAB 5DKNA 2L98A 2CCMA 4C0LA 3GK4X 2LP2A 2M97A 2WCFA 1J7RA 1TOPA 2WNDA 4N1FA 1YUSA 3I5GC 5AERA 1FI6A 1KQMC 5AEQA 3VROA 2LVJA 1B7TZ 1CDPA 1JC2A 1NX1A 5IBWA 1ODBA 3DVEA 2NCOA 3CR4X 5TNCA 1UHNA 4IL1A 1HQVA 2LP3A 5CPVA 3FS7A 4YRUA 2KQYA 3OX6A 1GJYA 1QV0A 1B47A 1CDLA 2WCEA 1B8LA 1ZMZA 3D0YA 2K7DA 1UWOA 4MZJA 2BE4A 5JJGA 3E3RA 2K2FA 3PLFB 2CBLA 2KAXA 2M7LA 4OV2A 4WQ3A 3DVJA 3IQOA 1AJ5A 1N0YA 3LCPC 5FYXA 3WHUB 3A4UB 3BYAA 1LA0A 1J7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0Z B;  3IF7 A;  2D8N A;  5PAL A;  1CFD A;  1E8A A;  2ZFD A;  4PHK A;  1OZO A;  2Y4Q A;  1J7O A;  1V1G A;  1UHK A;  1F55 A;  1BG1 A;  5DKR A;  4QJ5 B;  1R6P A;  1C07 A;  1S26 D;  1MUX A;  2BEC A;  2M1U A;  4USL A;  2PMY A;  3SIB A;  4YBH B;  1SR6 C;  2JXL A;  3K21 A;  1ALW A;  1HT9 A;  2LCP A;  1WY9 A;  3EVV A;  3SG7 A;  1B8C A;  2K8M B;  4JPZ B;  1K9U A;  2KFG A;  1BU3 A;  1S5G Y;  4MEW A;  1CDN A;  3SG3 A;  2PAL A;  1K9K A;  1F71 A;  1J1D A;  2JT8 A;  3OB1 B;  1EL4 A;  1U5I A;  3KPX A;  2LLS A;  5D7F A;  1Y1U A;  4N1G A;  3CS1 A;  1G8I A;  1RFJ A;  1B8R A;  2BL0 B;  3NXA A;  4M2P A;  4GPL B;  3PM8 A;  2K7C A;  2MJW B;  2K7B A;  1DJI A;  3BXK A;  1CTR A;  2KHN A;  1XFV O;  3WNX B;  4AOM A;  1CFP A;  1QV1 A;  1F4Q A;  2H2K A;  1NUB A;  3TUY B;  3DVK A;  2NXQ A;  3DF0 B;  3F45 A;  2MBX A;  4OCI A;  1IQ3 A;  5AXI A;  1S3P A;  1YR5 A;  4A4C A;  4YGB B;  1J55 A;  5AAN A;  4PE0 A;  2BE6 A;  3GK2 A;  3OHM B;  2PAS A;  2BCX A;  2I18 A;  1GGZ A;  4MSP A;  1DF0 B;  1KK7 Y;  2JOJ A;  4GGF A;  4MLW A;  3CR5 X;  1A75 A;  3O6B A;  5I8N A;  5I2O A;  2M1K B;  2KYF A;  1ZOT B;  1TNX A;  5HLO A;  1B7T Y;  3ZNI A;  1L2O B;  1LXF C;  1WRZ A;  1M45 A;  2KSP A;  5D69 A;  1AUI B;  3LK0 A;  2LM5 A;  1OSA A;  1DTL A;  2BBN A;  1BLQ A;  1QX2 A;  1K96 A;  4PE1 A;  1ZUZ A;  3CGA A;  3CWG A;  3VRN A;  2OS8 C;  2P6B B;  3PFV A;  4GGF C;  1S6I A;  1SNL A;  4GUK A;  1SCM C;  4ZCV A;  4CFQ A;  2JNF A;  2M8U A;  2LMT A;  5G08 A;  2COL B;  1EG4 A;  1CFC A;  1SPY A;  1RRO A;  1SL9 A;  1KSM A;  3VRQ A;  2AAO A;  3BOW B;  1YRT B;  3M0W A;  5I2Q A;  1FBV A;  1JF2 A;  1CDM A;  3VRR A;  2G9B A;  1M46 A;  2MAZ A;  2F3Z A;  1CM1 A;  2HQW A;  1MQ1 A;  4CLN A;  1R2U A;  5KTY A;  2LHI A;  4FTG A;  3I5H B;  2I94 A;  2LV7 A;  1GQM A;  1NWD A;  1UHJ A;  2BCA A;  2LMU A;  3EKH A;  3JTD C;  2QAC A;  4YI8 A;  2F8P A;  4HRG A;  3BUN B;  2LAP A;  2NZ0 A;  4MZK A;  2BKI B;  3PN7 B;  1W7I B;  1QLS A;  2FJU B;  2LVI A;  1KK7 Z;  1SL8 A;  1ZFS A;  3MSE B;  4CID A;  1KFU L;  4QJ4 B;  2EC6 C;  3GK1 A;  2KI6 D;  1A2X A;  2MA2 A;  2EHB A;  2Y1N A;  5KSZ A;  1LIN A;  2LUX A;  4DS7 A;  1NSH A;  3SJS A;  2KYC A;  1KWO B;  2BKH B;  1IJ5 A;  3JVT C;  3FWC A;  1SW8 A;  3H4S E;  4I5J A;  4XYN A;  1QIV A;  1EXR A;  1AJ4 A;  3SG6 A;  2KI6 C;  1NCX A;  3I5G B;  4DIR A;  4MVF A;  3AKB A;  1KQM B;  4OR9 B;  4PHM A;  4MN0 A;  3NSK A;  2M7N A;  1OZS A;  1DJH A;  1TNW A;  5DKQ A;  2HF5 A;  1TTX A;  1XO5 A;  5I2L A;  1UUS A;  1B9A A;  4L9M A;  1X02 A;  2M0R A;  3LLE A;  1OOJ A;  5ER4 X;  4YGA A;  4FQO A;  1NPQ A;  3EVR A;  1CKK A;  1NX2 A;  1DJG A;  1TCO B;  1K94 A;  1MF8 B;  3LL8 B;  1RK9 A;  2JTZ A;  5F6T A;  1YUT A;  2JT3 A;  2HPS A;  1IJ6 A;  1ZAC A;  1BJF A;  4XJK B;  5HYD A;  4DCK A;  1SL7 A;  1XFX O;  2KBI A;  2L4I A;  1KK8 C;  1CLB A;  1TCF A;  5ER5 A;  4A4B A;  4P2Y B;  1XYD A;  2BCB A;  2HQ8 A;  4M2O A;  1NIW A;  1C7W A;  1A03 A;  2ZND A;  1S1E A;  2O60 A;  1WDC C;  1H8B A;  3D0Y B;  3BUX B;  2ZKM X;  2SCP A;  2EGD A;  2HET A;  1DJW A;  1Y0V H;  2KFF A;  1DF0 A;  1CFF A;  4CPV A;  1SR6 B;  4JWQ A;  1Y1X A;  3TUY C;  3TDU A;  2Q91 A;  1CLL A;  1N65 A;  5CSJ A;  1J1E A;  3TS5 C;  1B4C A;  1XA5 A;  3AAK A;  2KI4 C;  4ETO A;  4WQ2 A;  5GQQ C;  2H61 A;  1TRF A;  4AQI A;  3KO0 A;  5HKW A;  2KFH A;  2L5X B;  2L50 A;  2JUL A;  5CSF A;  1IWQ A;  1S6C A;  2LLT A;  4R1E A;  3OB2 B;  5J3X A;  1MXL C;  2M3W A;  1KQV A;  1XFU O;  5HKZ A;  4YI9 A;  1NP8 A;  1PSR A;  2JU0 A;  4I5L B;  2WC8 A;  5CSI A;  2LLU A;  1WLZ A;  2L0P A;  1PK0 D;  3AKA A;  2JPT A;  4HRE E;  1PRW A;  2K2A A;  4OVN F;  5HLV A;  1DGU A;  2JZI A;  4PAL A;  1TNP A;  1YTZ C;  1U5I B;  1UHH A;  1KCY A;  4NDB A;  1VRK A;  1QLK A;  2G2B A;  2M29 A;  3PAT A;  1FW4 A;  2B1U A;  2CNP A;  4MZL A;  1B1G A;  4MRY A;  4DUQ A;  1QJT A;  3CZT X;  2LVV A;  3VRP A;  4YGC B;  1BF5 A;  1NCY A;  4GBA A;  4HRH A;  1EH2 A;  1QAT A;  2JRF A;  1F70 A;  1LKJ A;  1PUL A;  2JQ6 A;  1MXE A;  1OMR A;  2LE9 B;  2V53 A;  1W7J B;  3I5I C;  1SKT A;  1BR1 B;  3NSI A;  2OPO A;  3KEV A;  2E30 A;  3NSL A;  4PHN A;  1TIZ A;  1K95 A;  3O4Y A;  1KFX S;  1UP5 A;  2OS8 B;  4PE4 A;  1PAL A;  3I5F C;  1SYM A;  2OTG C;  2ZN8 A;  1UUR A;  1SCM B;  1JWD A;  1Y6W A;  2A4J A;  3SG2 A;  1AHR A;  4I5N B;  2MHH A;  1PSB A;  2QPT A;  2Y5I A;  2ZRT A;  4PCW A;  1QTX A;  3CTN A;  3DVM A;  2KOT A;  4DRW A;  2FCD A;  3CLN A;  3PN7 C;  2KBM A;  2JNX A;  2I7A A;  1QVI Y;  2JXC A;  4JQ0 D;  2KQ6 A;  4NDD A;  1JFJ A;  2M9G A;  1QXP A;  5AFP A;  1YVL A;  1KSO A;  1K8U A;  1OMD A;  2SAS A;  2M49 B;  1PVA A;  1QX7 A;  3HX4 A;  5JOL A;  2WOR A;  2ZRS A;  2F2P A;  1V1F A;  2E6W A;  3JTD B;  1DJX A;  1JFK A;  2O5G A;  1AP4 A;  3RLZ A;  1AK8 A;  1RJV A;  1BT6 A;  2LVK A;  1LA3 A;  1DGV A;  1YUU A;  2GGM A;  3BQ3 A;  3EK4 A;  1CB1 A;  4XJK A;  1NX0 A;  1KFU S;  1WRK A;  1SCV A;  2EC6 B;  1CMF A;  1CM4 A;  3WXA A;  1IGV A;  2KGR A;  4ORC B;  1D1O A;  1NCZ A;  1LVC D;  4YGD B;  1EJ3 A;  1JUO A;  4QJ3 B;  1A4P A;  4BY4 A;  1OQP A;  1OE9 B;  3JVT B;  5B8I B;  1FI5 A;  2F3Y A;  2FOT A;  2LNK A;  2GV5 A;  3DD4 A;  2IS9 A;  1AVS A;  2ZNE A;  2KAV A;  3OP0 A;  1TN4 A;  1G33 A;  2CTN A;  2ZN9 A;  3IQQ A;  2JT0 A;  2VRG A;  1QAS A;  1DJZ A;  4HSZ A;  2LHL A;  4NDC A;  2K61 A;  2LC5 A;  1CNP A;  1DJY A;  5K89 A;  3DF0 A;  3ZWH A;  2JC2 A;  1ALV A;  1OMV A;  4M2Q A;  3NSO A;  2BBM A;  2MRD A;  1IRJ A;  1K9P A;  3OX5 A;  4GGN A;  1QVI Z;  2DOQ A;  3EVU A;  4ICB A;  1S6J A;  1SMG A;  2BL0 C;  2F2O A;  2TN4 A;  3RM1 A;  1EG3 A;  1BOC A;  2Y1M A;  3D10 A;  1RWY A;  1IQ5 A;  2KDH A;  2L4H A;  2R2I A;  2FCE A;  1SY9 A;  3C1V A;  1MR8 A;  1Q80 A;  1BR4 B;  4GNK B;  1KK8 B;  2ISD A;  2Q4U A;  3KHE A;  3HCM A;  1YUR A;  1YX8 A;  1YVH A;  1M63 B;  3QRX A;  1IH0 A;  2KNE A;  4UPG A;  3A8R A;  3EKJ A;  2NCP A;  1MWN A;  1WDC B;  3O2P A;  3AAJ A;  3EK7 A;  2MLF C;  4WRI A;  1QS7 A;  4GAO A;  1XFY O;  1YX7 A;  1WRL A;  2K7O A;  2PSR A;  4NQG A;  2JTT A;  2AUC A;  3GOF A;  3LK1 A;  3VGO A;  1FF1 A;  3BUW B;  2RGI A;  5CSN A;  2L51 A;  1XFW O;  2NLN A;  1K2H A;  1L2O C;  1L7Z A;  4MRX A;  4D1E A;  1S36 A;  1K90 D;  1BOD A;  3BUM B;  1JBA A;  4C0J A;  3BOW A;  4E68 A;  1RTP 1;  3EK8 A;  2PVB A;  1G4Y R;  3CR2 A;  1XVJ A;  1XK4 A;  1FPW A;  5BPJ A;  2H61 C;  1SBJ A;  1SRA A;  3TS5 B;  1GGW A;  2LAN A;  2KI4 B;  4ORB B;  3WHT B;  1WLM A;  2WOS A;  4OKH A;  3SG4 A;  5KU1 A;  3KF9 A;  1UHI A;  1F8H A;  2K0J A;  2KAY A;  3PSR A;  1CLM A;  2KGB C;  1JSA A;  1BMO A;  4Q04 A;  1N2D A;  3TDZ A;  5HKY A;  4AQJ A;  2MLE C;  4PE7 A;  1QIW A;  3BUO B;  1NYA A;  1DMO A;  3TZ1 A;  2GGZ A;  1XK4 C;  1QX5 B;  2LMV A;  3TDI A;  1K93 D;  4GFT A;  2CT9 A;  1PVB A;  1KFX L;  2WCB A;  1A75 B;  3O78 A;  4U8D A;  3I5H C;  2PRU A;  3SG5 A;  4TNC A;  1NX3 A;  1YRU B;  1H4B A;  1DT7 B;  4BY5 A;  2I2R E;  1REC A;  1S5G Z;  3SIA A;  2CXJ A;  1M31 A;  1F54 A;  4N5X A;  4YGE B;  2LUC A;  4ZCU A;  2AMI A;  3FIA A;  4P5O E;  1IG5 A;  2JWW A;  1CMG A;  3I5I B;  1J7Q A;  2F33 A;  1SK6 D;  1JF0 A;  3PAL A;  4CFR A;  4PDZ A;  1Y1A A;  4MBE A;  1DVI A;  1C7V A;  1MHO A;  4I5K A;  1XFZ O;  1IKU A;  3I5F B;  2OTG B;  3ICB A;  1M39 A;  4PHJ A;  4C0K A;  3FWB A;  1A29 A;  1F4O A;  2L2E A;  1KWO C;  1TNQ A;  4ORA B;  5DKN A;  2L98 A;  2CCM A;  4C0L A;  3GK4 X;  2LP2 A;  2M97 A;  2WCF A;  1J7R A;  1TOP A;  2WND A;  4N1F A;  1YUS A;  3I5G C;  5AER A;  1FI6 A;  1KQM C;  5AEQ A;  3VRO A;  2LVJ A;  1B7T Z;  1CDP A;  1JC2 A;  1NX1 A;  5IBW A;  1ODB A;  3DVE A;  2NCO A;  3CR4 X;  5TNC A;  1UHN A;  4IL1 A;  1HQV A;  2LP3 A;  5CPV A;  3FS7 A;  4YRU A;  2KQY A;  3OX6 A;  1GJY A;  1QV0 A;  1B47 A;  1CDL A;  2WCE A;  1B8L A;  1ZMZ A;  3D0Y A;  2K7D A;  1UWO A;  4MZJ A;  2BE4 A;  5JJG A;  3E3R A;  2K2F A;  3PLF B;  2CBL A;  2KAX A;  2M7L A;  4OV2 A;  4WQ3 A;  3DVJ A;  3IQO A;  1AJ5 A;  1N0Y A;  3LCP C;  5FYX A;  3WHU B;  3A4U B;  3BYA A;  1LA0 A;  1J7P A; 
#chains in the Genus database with same CATH topology
 3R72 A;  4F0Z B;  3IF7 A;  2D8N A;  5PAL A;  1CFD A;  1E8A A;  2ZFD A;  4PHK A;  3CZ2 A;  1OZO A;  2Y4Q A;  1J7O A;  1V1G A;  1UHK A;  1F55 A;  1BG1 A;  5DKR A;  4QJ5 B;  1R6P A;  1C07 A;  2QEO A;  1S26 D;  3S0G A;  1MUX A;  2BEC A;  2M1U A;  4USL A;  2PMY A;  3SIB A;  4YBH B;  1SR6 C;  2JXL A;  3EG5 B;  3K21 A;  1ALW A;  1HT9 A;  2LCP A;  1WY9 A;  3EVV A;  3SG7 A;  1B8C A;  2K8M B;  4JPZ B;  3WHU B;  1K9U A;  2KFG A;  1BU3 A;  1S5G Y;  4MEW A;  1CDN A;  3SG3 A;  2PAL A;  1K9K A;  1F71 A;  1J1D A;  2JT8 A;  3OB1 B;  1EL4 A;  1U5I A;  3KPX A;  2LLS A;  5D7F A;  1Y1U A;  4N1G A;  3CS1 A;  1G8I A;  1RFJ A;  1B8R A;  2BL0 B;  3NXA A;  4M2P A;  2K60 A;  4GPL B;  3PM8 A;  2K7C A;  2MJW B;  2K7B A;  1DJI A;  3BXK A;  1CTR A;  2KHN A;  1XFV O;  3WNX B;  4AOM A;  1CFP A;  1QV1 A;  1F4Q A;  2H2K A;  1NUB A;  3FE8 A;  4INX A;  3TUY B;  3DVK A;  2NXQ A;  3DF0 B;  3F45 A;  1DQE A;  2MBX A;  4OCI A;  1IQ3 A;  5AXI A;  1S3P A;  1YR5 A;  4A4C A;  4YGB B;  1J55 A;  5AAN A;  3DXL A;  4PE0 A;  3CZ1 A;  2BE6 A;  3GK2 A;  3OHM B;  2PAS A;  2BCX A;  2I18 A;  1GGZ A;  4MSP A;  1DF0 B;  1KK7 Y;  2JOJ A;  4GGF A;  4MLW A;  3B87 A;  3CR5 X;  1A75 A;  3O6B A;  5I8N A;  5I2O A;  2M1K B;  2KYF A;  1ZOT B;  3N7H A;  1TNX A;  2KLD A;  5I94 A;  5HLO A;  1B7T Y;  3ZNI A;  1L2O B;  1LXF C;  1WRZ A;  1M45 A;  2QEH A;  2KSP A;  5D69 A;  1AUI B;  3LK0 A;  2LM5 A;  1OSA A;  1DTL A;  2BBN A;  1BLQ A;  1QX2 A;  1K96 A;  4PE1 A;  1ZUZ A;  3CGA A;  3CWG A;  3VRN A;  2OS8 C;  2P6B B;  3PFV A;  4GGF C;  1S6I A;  1SNL A;  4GUK A;  1SCM C;  4ZCV A;  4CFQ A;  2JNF A;  2M8U A;  2LMT A;  5G08 A;  2COL B;  1EG4 A;  1CFC A;  1SPY A;  1TUZ A;  3CAB A;  2WCL A;  1RRO A;  1SL9 A;  2YGU A;  1KSM A;  5FI2 A;  3VRQ A;  2AAO A;  3BOW B;  1YRT B;  3M0W A;  5I2Q A;  1FBV A;  3CDN A;  1JF2 A;  1CDM A;  3VRR A;  2G9B A;  3PM2 A;  1M46 A;  2MAZ A;  2F3Z A;  1CM1 A;  2HQW A;  1MQ1 A;  4CLN A;  1R2U A;  5KTY A;  2LHI A;  4FTG A;  5FI7 A;  3I5H B;  2I94 A;  2LV7 A;  1GQM A;  1NWD A;  1UHJ A;  2BCA A;  3B7A A;  2LMU A;  3EKH A;  3JTD C;  2QAC A;  4YI8 A;  2F8P A;  2P71 A;  1C3Z A;  5HL1 A;  4HRG A;  3BUN B;  2LAP A;  1ORG A;  2L2C A;  2NZ0 A;  4MZK A;  3CZ0 A;  2BKI B;  3PN7 B;  1W7I B;  1QLS A;  2FJU B;  2LVI A;  1KK7 Z;  1SL8 A;  1ZFS A;  3MSE B;  4CID A;  1KFU L;  4QJ4 B;  2EC6 C;  2KPH A;  3GK1 A;  2KI6 D;  1A2X A;  2MA2 A;  2EHB A;  2Y1N A;  5KSZ A;  1LIN A;  2LUX A;  4JD9 A;  4DS7 A;  1NSH A;  3SJS A;  3L4L A;  2KYC A;  1KWO B;  2BKH B;  1IJ5 A;  3JVT C;  3FWC A;  1SW8 A;  3H4S E;  3CYZ A;  4I5J A;  4XYN A;  1QIV A;  1TUJ A;  1EXR A;  3B6X A;  1AJ4 A;  3D74 A;  3SG6 A;  2KI6 C;  3NHI A;  1NCX A;  3I5G B;  4DIR A;  4MVF A;  3AKB A;  1KQM B;  1T14 A;  4JKT A;  4OR9 B;  4PHM A;  4MN0 A;  3NSK A;  2M7N A;  1OZS A;  1DJH A;  1TNW A;  5DKQ A;  2HF5 A;  1TTX A;  1XO5 A;  5I2L A;  1UUS A;  1B9A A;  4L9M A;  1X02 A;  2M0R A;  3LLE A;  1OOJ A;  3DYE A;  5ER4 X;  4YGA A;  4FQO A;  1NPQ A;  3EVR A;  1CKK A;  1NX2 A;  1DJG A;  1TCO B;  1K94 A;  1MF8 B;  3LL8 B;  1RK9 A;  2JTZ A;  3D76 A;  5F6T A;  1YUT A;  2JT3 A;  2HPS A;  1IJ6 A;  1ZAC A;  1BJF A;  4XJK B;  1OOH A;  3D77 A;  1SL7 A;  3UO9 A;  4DCK A;  5HYD A;  1XFX O;  2KBI A;  2L4I A;  1KK8 C;  5FI6 A;  1CLB A;  1TCF A;  5ER5 A;  4A4B A;  4P2Y B;  1XYD A;  2BCB A;  2HQ8 A;  2QDI A;  4M2O A;  1NIW A;  1C7W A;  1A03 A;  2ZND A;  4INW A;  1S1E A;  2O60 A;  1WDC C;  1H8B A;  3IVT A;  3D0Y B;  2H8V A;  3BUX B;  1QWV A;  2ZKM X;  5D3O A;  2SCP A;  2EGD A;  2HET A;  1DJW A;  4IJ7 A;  1Y0V H;  2KFF A;  1DF0 A;  1CFF A;  3V2L A;  4CPV A;  1SR6 B;  4JWQ A;  1Y1X A;  3S0B A;  3TUY C;  2KLE A;  3TDU A;  3NGV A;  2Q91 A;  1CLL A;  1N65 A;  5CSJ A;  1J1E A;  3BJH A;  3TS5 C;  1B4C A;  1XA5 A;  3AAK A;  2KI4 C;  4ETO A;  4WQ2 A;  5GQQ C;  2H61 A;  1TRF A;  4AQI A;  3KO0 A;  5HKW A;  2WCJ A;  2KFH A;  2L5X B;  2L50 A;  2JUL A;  5CSF A;  1IWQ A;  1S6C A;  2LLT A;  4R1E A;  3OBV A;  3OB2 B;  5J3X A;  1MXL C;  2M3W A;  1KQV A;  1XFU O;  5HKZ A;  4YI9 A;  1NP8 A;  1PSR A;  2FJY A;  2JU0 A;  4I5L B;  2WC8 A;  5CSI A;  2LLU A;  1WLZ A;  2L0P A;  1PK0 D;  3AKA A;  2JPT A;  4HRE E;  1PRW A;  2K2A A;  4OVN F;  5HLV A;  1DGU A;  2JZI A;  4PAL A;  1TNP A;  1YTZ C;  1U5I B;  3R1P A;  1UHH A;  1KCY A;  4NDB A;  1VRK A;  1QLK A;  2G2B A;  2M29 A;  3PAT A;  1FW4 A;  1P28 A;  1Z2C B;  2B1U A;  1DEK A;  2CNP A;  4MZL A;  4MRY A;  4DUQ A;  1B1G A;  3SS5 A;  1QJT A;  3CZT X;  2PYQ A;  2LVV A;  3VRP A;  4YGC B;  1BF5 A;  1NCY A;  4GBA A;  4HRH A;  1DC1 A;  3BFB A;  1C3Y A;  1EH2 A;  1QAT A;  2JRF A;  3OGN A;  1F70 A;  1LKJ A;  1PUL A;  2JQ6 A;  3UNW A;  1MXE A;  1OMR A;  4FQT A;  1IIO A;  2LE9 B;  2V53 A;  1W7J B;  3I5I C;  3R1V A;  1SKT A;  1BR1 B;  3NSI A;  2OPO A;  3KEV A;  2E30 A;  3NSL A;  4PHN A;  1TIZ A;  1K95 A;  3O4Y A;  1KFX S;  2GTE A;  3NHT A;  1UP5 A;  2OS8 B;  4PE4 A;  1PAL A;  2WC5 A;  1SYM A;  2OTG C;  2ZN8 A;  1UUR A;  3I5F C;  1OOF A;  1SCM B;  1JWD A;  1Y6W A;  2A4J A;  3SG2 A;  3BFH A;  1AHR A;  4I5N B;  2MHH A;  1PSB A;  2QPT A;  2Y5I A;  2ZRT A;  3FE9 A;  4PCW A;  1QTX A;  3CTN A;  3DVM A;  2KOT A;  4DRW A;  2FCD A;  2JPO A;  3CLN A;  3PN7 C;  2KBM A;  3S0F A;  2JNX A;  3S0A A;  1OOG A;  2WCK A;  2I7A A;  1QVI Y;  2JXC A;  4JQ0 D;  2KQ6 A;  4NDD A;  1JFJ A;  2M9G A;  1QXP A;  1SSE B;  5AFP A;  1YVL A;  1KSO A;  1K8U A;  1OMD A;  2SAS A;  3DY9 A;  3S0E A;  2BAP A;  2M49 B;  1PVA A;  1QX7 A;  3HX4 A;  5JOL A;  2WOR A;  2ZRS A;  2F2P A;  2PQL A;  1V1F A;  2E6W A;  3JTD B;  1DJX A;  1JFK A;  2O5G A;  1AP4 A;  3RLZ A;  1AK8 A;  1RJV A;  1BT6 A;  2LVK A;  1LA3 A;  1DGV A;  3D78 A;  1YUU A;  2GGM A;  3BQ3 A;  3EK4 A;  1CB1 A;  4XJK A;  1NX0 A;  1KFU S;  1WRK A;  1SCV A;  2EC6 B;  1CMF A;  1CM4 A;  3WXA A;  1IGV A;  2KGR A;  4ORC B;  3R1O A;  1D1O A;  1NCZ A;  1LVC D;  4YGD B;  1EJ3 A;  1JUO A;  4QJ3 B;  1A4P A;  4BY4 A;  1OQP A;  1OE9 B;  3JVT B;  5B8I B;  1FI5 A;  2F3Y A;  2FOT A;  2LNK A;  2GV5 A;  3DD4 A;  2IS9 A;  3Q8I A;  3QME A;  1AVS A;  2ZNE A;  2KAV A;  3OP0 A;  1TN4 A;  1G33 A;  2CTN A;  2BNX A;  2ZN9 A;  3IQQ A;  2JT0 A;  2VRG A;  1QAS A;  3D73 A;  1DJZ A;  4HSZ A;  2LHL A;  4NDC A;  2K61 A;  2LC5 A;  1CNP A;  1DJY A;  5K89 A;  3DF0 A;  3VB1 A;  3ZWH A;  3L47 A;  2JC2 A;  1XFR A;  1ALV A;  1OMV A;  4M2Q A;  3NSO A;  2WCH A;  2BBM A;  2MRD A;  1IRJ A;  1K9P A;  3FE6 A;  3OX5 A;  1QVI Z;  4GGN A;  4OZD A;  2DOQ A;  3EVU A;  4ICB A;  1S6J A;  1SMG A;  2BL0 C;  2F2O A;  2TN4 A;  2WC6 A;  3RM1 A;  1EG3 A;  4F7F A;  1BOC A;  2Y1M A;  3D10 A;  1RWY A;  1IQ5 A;  2KDH A;  2L4H A;  2R2I A;  3O4X A;  2FCE A;  1SY9 A;  1TWO A;  1MR8 A;  3C1V A;  1Q80 A;  1W9Z A;  1BR4 B;  4GNK B;  1KK8 B;  2ISD A;  2Q4U A;  3KHE A;  3HCM A;  1YUR A;  1YX8 A;  1YVH A;  1M63 B;  3QRX A;  1IH0 A;  2KNE A;  1Z4H A;  3A8R A;  3B86 A;  4UPG A;  2QEV A;  3EKJ A;  2NCP A;  1MWN A;  1WDC B;  3O2P A;  3AAJ A;  3EK7 A;  2MLF C;  4WRI A;  1QS7 A;  4GAO A;  1XFY O;  1YX7 A;  1WRL A;  2K7O A;  2PSR A;  4NQG A;  2JTT A;  2AUC A;  3GOF A;  3LK1 A;  3VGO A;  1FF1 A;  3BUW B;  2RGI A;  5CSN A;  2L51 A;  1XFW O;  2NLN A;  1K2H A;  1L2O C;  1L7Z A;  4MRX A;  4D1E A;  5EL2 A;  1S36 A;  1K90 D;  1BOD A;  3BUM B;  3D75 A;  1JBA A;  4C0J A;  3BOW A;  3RZS A;  4E68 A;  1RTP 1;  3EK8 A;  2PVB A;  1G4Y R;  3CR2 A;  1XVJ A;  1XK4 A;  1FPW A;  5BPJ A;  2H61 C;  1SBJ A;  1SRA A;  4PT1 A;  4KYN A;  3TS5 B;  1GGW A;  2L5Y A;  2LAN A;  2KI4 B;  3DZT A;  4ORB B;  3WHT B;  1WLM A;  2WOS A;  4OKH A;  3SG4 A;  5KU1 A;  3KF9 A;  1UHI A;  1F8H A;  2K0J A;  3S0D A;  2KAY A;  3PSR A;  1CLM A;  2KGB C;  1JSA A;  1BMO A;  4Q04 A;  1N2D A;  3TDZ A;  5HKY A;  4AQJ A;  3SS3 A;  2MLE C;  4PE7 A;  1QIW A;  3BUO B;  1NYA A;  1DMO A;  3TZ1 A;  2GGZ A;  1XK4 C;  1QX5 B;  2LMV A;  3TDI A;  1K93 D;  4GFT A;  2CT9 A;  2QEB A;  1PVB A;  1KFX L;  3B88 A;  2WCB A;  1A75 B;  3O78 A;  4U8D A;  3I5H C;  2PRU A;  3SG5 A;  4TNC A;  1NX3 A;  1YRU B;  1H4B A;  1DT7 B;  4BY5 A;  2I2R E;  1REC A;  1OOI X;  1S5G Z;  3SIA A;  3K1E A;  2CXJ A;  1M31 A;  1F54 A;  4N5X A;  4YGE B;  2LUC A;  4ZCU A;  2AMI A;  3FIA A;  4P5O E;  1IG5 A;  2JWW A;  1CMG A;  3I5I B;  3SS4 A;  3PJI A;  1J7Q A;  2F33 A;  1SK6 D;  1JF0 A;  3PAL A;  4CFR A;  1OW4 A;  4PDZ A;  1Y1A A;  4MBE A;  1DVI A;  1C7V A;  2WCM A;  1MHO A;  4I5K A;  1XFZ O;  1IKU A;  3I5F B;  2OTG B;  3ICB A;  1M39 A;  4PHJ A;  4C0K A;  1GM0 A;  3FWB A;  1A29 A;  1F4O A;  2L2E A;  1KWO C;  1TNQ A;  4ORA B;  5DKN A;  2L98 A;  2CCM A;  4C0L A;  3GK4 X;  2LP2 A;  1DEL A;  2M97 A;  1J7R A;  1TOP A;  2WCF A;  2WND A;  4N1F A;  1YUS A;  3I5G C;  5AER A;  1FI6 A;  1KQM C;  5AEQ A;  3VRO A;  1LS8 A;  2ERB A;  1B7T Z;  1CDP A;  2LVJ A;  1NX1 A;  1JC2 A;  5IBW A;  1ODB A;  3DVE A;  2NCO A;  3CR4 X;  5TNC A;  1UHN A;  4IL1 A;  1HQV A;  2LP3 A;  5CPV A;  3FS7 A;  5DIC A;  4YRU A;  2KQY A;  3OX6 A;  1GJY A;  1QV0 A;  1B47 A;  1CDL A;  3BFA A;  2WCE A;  1ZMZ A;  1B8L A;  3D0Y A;  2K7D A;  1UWO A;  4MZJ A;  2BE4 A;  5JJG A;  3E3R A;  2K2F A;  3PLF B;  2CBL A;  2KAX A;  2M7L A;  4OV2 A;  4WQ3 A;  3DVJ A;  3IQO A;  1AJ5 A;  1N0Y A;  3LCP C;  3L4A A;  5FYX A;  3A4U B;  3BYA A;  1LA0 A;  1J7P A;  2P70 A; 
#chains in the Genus database with same CATH homology
 4F0Z B;  3IF7 A;  2D8N A;  5PAL A;  1CFD A;  1E8A A;  2ZFD A;  4PHK A;  1OZO A;  2Y4Q A;  1J7O A;  1V1G A;  1UHK A;  1F55 A;  1BG1 A;  5DKR A;  4QJ5 B;  1R6P A;  1C07 A;  1S26 D;  1MUX A;  2BEC A;  2M1U A;  4USL A;  2PMY A;  3SIB A;  4YBH B;  1SR6 C;  2JXL A;  3K21 A;  1ALW A;  1HT9 A;  2LCP A;  1WY9 A;  3EVV A;  3SG7 A;  1B8C A;  2K8M B;  4JPZ B;  1K9U A;  2KFG A;  1BU3 A;  1S5G Y;  4MEW A;  1CDN A;  3SG3 A;  2PAL A;  1K9K A;  1F71 A;  1J1D A;  2JT8 A;  3OB1 B;  1EL4 A;  1U5I A;  3KPX A;  2LLS A;  5D7F A;  1Y1U A;  4N1G A;  3CS1 A;  1G8I A;  1RFJ A;  1B8R A;  2BL0 B;  3NXA A;  4M2P A;  4GPL B;  3PM8 A;  2K7C A;  2MJW B;  2K7B A;  1DJI A;  3BXK A;  1CTR A;  2KHN A;  1XFV O;  3WNX B;  4AOM A;  1CFP A;  1QV1 A;  1F4Q A;  2H2K A;  1NUB A;  3TUY B;  3DVK A;  2NXQ A;  3DF0 B;  3F45 A;  2MBX A;  4OCI A;  1IQ3 A;  5AXI A;  1S3P A;  1YR5 A;  4A4C A;  4YGB B;  1J55 A;  5AAN A;  4PE0 A;  2BE6 A;  3GK2 A;  3OHM B;  2PAS A;  2BCX A;  2I18 A;  1GGZ A;  4MSP A;  1DF0 B;  1KK7 Y;  2JOJ A;  4GGF A;  4MLW A;  3CR5 X;  1A75 A;  3O6B A;  5I8N A;  5I2O A;  2M1K B;  2KYF A;  1ZOT B;  1TNX A;  5HLO A;  1B7T Y;  3ZNI A;  1L2O B;  1LXF C;  1WRZ A;  1M45 A;  2KSP A;  5D69 A;  1AUI B;  3LK0 A;  2LM5 A;  1OSA A;  1DTL A;  2BBN A;  1BLQ A;  1QX2 A;  1K96 A;  4PE1 A;  1ZUZ A;  3CGA A;  3CWG A;  3VRN A;  2OS8 C;  2P6B B;  3PFV A;  4GGF C;  1S6I A;  1SNL A;  4GUK A;  1SCM C;  4ZCV A;  4CFQ A;  2JNF A;  2M8U A;  2LMT A;  5G08 A;  2COL B;  1EG4 A;  1CFC A;  1SPY A;  1RRO A;  1SL9 A;  1KSM A;  3VRQ A;  2AAO A;  3BOW B;  1YRT B;  3M0W A;  5I2Q A;  1FBV A;  1JF2 A;  1CDM A;  3VRR A;  2G9B A;  1M46 A;  2MAZ A;  2F3Z A;  1CM1 A;  2HQW A;  1MQ1 A;  4CLN A;  1R2U A;  5KTY A;  2LHI A;  4FTG A;  3I5H B;  2I94 A;  2LV7 A;  1GQM A;  1NWD A;  1UHJ A;  2BCA A;  2LMU A;  3EKH A;  3JTD C;  2QAC A;  4YI8 A;  2F8P A;  4HRG A;  3BUN B;  2LAP A;  2NZ0 A;  4MZK A;  2BKI B;  3PN7 B;  1W7I B;  1QLS A;  2FJU B;  2LVI A;  1KK7 Z;  1SL8 A;  1ZFS A;  3MSE B;  4CID A;  1KFU L;  4QJ4 B;  2EC6 C;  3GK1 A;  2KI6 D;  1A2X A;  2MA2 A;  2EHB A;  2Y1N A;  5KSZ A;  1LIN A;  2LUX A;  4DS7 A;  1NSH A;  3SJS A;  2KYC A;  1KWO B;  2BKH B;  1IJ5 A;  3JVT C;  3FWC A;  1SW8 A;  3H4S E;  4I5J A;  4XYN A;  1QIV A;  1EXR A;  1AJ4 A;  3SG6 A;  2KI6 C;  1NCX A;  3I5G B;  4DIR A;  4MVF A;  3AKB A;  1KQM B;  4OR9 B;  4PHM A;  4MN0 A;  3NSK A;  2M7N A;  1OZS A;  1DJH A;  1TNW A;  5DKQ A;  2HF5 A;  1TTX A;  1XO5 A;  5I2L A;  1UUS A;  1B9A A;  4L9M A;  1X02 A;  2M0R A;  3LLE A;  1OOJ A;  5ER4 X;  4YGA A;  4FQO A;  1NPQ A;  3EVR A;  1CKK A;  1NX2 A;  1DJG A;  1TCO B;  1K94 A;  1MF8 B;  3LL8 B;  1RK9 A;  2JTZ A;  5F6T A;  1YUT A;  2JT3 A;  2HPS A;  1IJ6 A;  1ZAC A;  1BJF A;  4XJK B;  5HYD A;  4DCK A;  1SL7 A;  1XFX O;  2KBI A;  2L4I A;  1KK8 C;  1CLB A;  1TCF A;  5ER5 A;  4A4B A;  4P2Y B;  1XYD A;  2BCB A;  2HQ8 A;  4M2O A;  1NIW A;  1C7W A;  1A03 A;  2ZND A;  1S1E A;  2O60 A;  1WDC C;  1H8B A;  3D0Y B;  3BUX B;  2ZKM X;  2SCP A;  2EGD A;  2HET A;  1DJW A;  1Y0V H;  2KFF A;  1DF0 A;  1CFF A;  4CPV A;  1SR6 B;  4JWQ A;  1Y1X A;  3TUY C;  3TDU A;  2Q91 A;  1CLL A;  1N65 A;  5CSJ A;  1J1E A;  3TS5 C;  1B4C A;  1XA5 A;  3AAK A;  2KI4 C;  4ETO A;  4WQ2 A;  5GQQ C;  2H61 A;  1TRF A;  4AQI A;  3KO0 A;  5HKW A;  2KFH A;  2L5X B;  2L50 A;  2JUL A;  5CSF A;  1IWQ A;  1S6C A;  2LLT A;  4R1E A;  3OB2 B;  5J3X A;  1MXL C;  2M3W A;  1KQV A;  1XFU O;  5HKZ A;  4YI9 A;  1NP8 A;  1PSR A;  2JU0 A;  4I5L B;  2WC8 A;  5CSI A;  2LLU A;  1WLZ A;  2L0P A;  1PK0 D;  3AKA A;  2JPT A;  4HRE E;  1PRW A;  2K2A A;  4OVN F;  5HLV A;  1DGU A;  2JZI A;  4PAL A;  1TNP A;  1YTZ C;  1U5I B;  1UHH A;  1KCY A;  4NDB A;  1VRK A;  1QLK A;  2G2B A;  2M29 A;  3PAT A;  1FW4 A;  2B1U A;  2CNP A;  4MZL A;  1B1G A;  4MRY A;  4DUQ A;  1QJT A;  3CZT X;  2LVV A;  3VRP A;  4YGC B;  1BF5 A;  1NCY A;  4GBA A;  4HRH A;  1EH2 A;  1QAT A;  2JRF A;  1F70 A;  1LKJ A;  1PUL A;  2JQ6 A;  1MXE A;  1OMR A;  2LE9 B;  2V53 A;  1W7J B;  3I5I C;  1SKT A;  1BR1 B;  3NSI A;  2OPO A;  3KEV A;  2E30 A;  3NSL A;  4PHN A;  1TIZ A;  1K95 A;  3O4Y A;  1KFX S;  1UP5 A;  2OS8 B;  4PE4 A;  1PAL A;  3I5F C;  1SYM A;  2OTG C;  2ZN8 A;  1UUR A;  1SCM B;  1JWD A;  1Y6W A;  2A4J A;  3SG2 A;  1AHR A;  4I5N B;  2MHH A;  1PSB A;  2QPT A;  2Y5I A;  2ZRT A;  4PCW A;  1QTX A;  3CTN A;  3DVM A;  2KOT A;  4DRW A;  2FCD A;  3CLN A;  3PN7 C;  2KBM A;  2JNX A;  2I7A A;  1QVI Y;  2JXC A;  4JQ0 D;  2KQ6 A;  4NDD A;  1JFJ A;  2M9G A;  1QXP A;  5AFP A;  1YVL A;  1KSO A;  1K8U A;  1OMD A;  2SAS A;  2M49 B;  1PVA A;  1QX7 A;  3HX4 A;  5JOL A;  2WOR A;  2ZRS A;  2F2P A;  1V1F A;  2E6W A;  3JTD B;  1DJX A;  1JFK A;  2O5G A;  1AP4 A;  3RLZ A;  1AK8 A;  1RJV A;  1BT6 A;  2LVK A;  1LA3 A;  1DGV A;  1YUU A;  2GGM A;  3BQ3 A;  3EK4 A;  1CB1 A;  4XJK A;  1NX0 A;  1KFU S;  1WRK A;  1SCV A;  2EC6 B;  1CMF A;  1CM4 A;  3WXA A;  1IGV A;  2KGR A;  4ORC B;  1D1O A;  1NCZ A;  1LVC D;  4YGD B;  1EJ3 A;  1JUO A;  4QJ3 B;  1A4P A;  4BY4 A;  1OQP A;  1OE9 B;  3JVT B;  5B8I B;  1FI5 A;  2F3Y A;  2FOT A;  2LNK A;  2GV5 A;  3DD4 A;  2IS9 A;  1AVS A;  2ZNE A;  2KAV A;  3OP0 A;  1TN4 A;  1G33 A;  2CTN A;  2ZN9 A;  3IQQ A;  2JT0 A;  2VRG A;  1QAS A;  1DJZ A;  4HSZ A;  2LHL A;  4NDC A;  2K61 A;  2LC5 A;  1CNP A;  1DJY A;  5K89 A;  3DF0 A;  3ZWH A;  2JC2 A;  1ALV A;  1OMV A;  4M2Q A;  3NSO A;  2BBM A;  2MRD A;  1IRJ A;  1K9P A;  3OX5 A;  4GGN A;  1QVI Z;  2DOQ A;  3EVU A;  4ICB A;  1S6J A;  1SMG A;  2BL0 C;  2F2O A;  2TN4 A;  3RM1 A;  1EG3 A;  1BOC A;  2Y1M A;  3D10 A;  1RWY A;  1IQ5 A;  2KDH A;  2L4H A;  2R2I A;  2FCE A;  1SY9 A;  3C1V A;  1MR8 A;  1Q80 A;  1BR4 B;  4GNK B;  1KK8 B;  2ISD A;  2Q4U A;  3KHE A;  3HCM A;  1YUR A;  1YX8 A;  1YVH A;  1M63 B;  3QRX A;  1IH0 A;  2KNE A;  4UPG A;  3A8R A;  3EKJ A;  2NCP A;  1MWN A;  1WDC B;  3O2P A;  3AAJ A;  3EK7 A;  2MLF C;  4WRI A;  1QS7 A;  4GAO A;  1XFY O;  1YX7 A;  1WRL A;  2K7O A;  2PSR A;  4NQG A;  2JTT A;  2AUC A;  3GOF A;  3LK1 A;  3VGO A;  1FF1 A;  3BUW B;  2RGI A;  5CSN A;  2L51 A;  1XFW O;  2NLN A;  1K2H A;  1L2O C;  1L7Z A;  4MRX A;  4D1E A;  1S36 A;  1K90 D;  1BOD A;  3BUM B;  1JBA A;  4C0J A;  3BOW A;  4E68 A;  1RTP 1;  3EK8 A;  2PVB A;  1G4Y R;  3CR2 A;  1XVJ A;  1XK4 A;  1FPW A;  5BPJ A;  2H61 C;  1SBJ A;  1SRA A;  3TS5 B;  1GGW A;  2LAN A;  2KI4 B;  4ORB B;  3WHT B;  1WLM A;  2WOS A;  4OKH A;  3SG4 A;  5KU1 A;  3KF9 A;  1UHI A;  1F8H A;  2K0J A;  2KAY A;  3PSR A;  1CLM A;  2KGB C;  1JSA A;  1BMO A;  4Q04 A;  1N2D A;  3TDZ A;  5HKY A;  4AQJ A;  2MLE C;  4PE7 A;  1QIW A;  3BUO B;  1NYA A;  1DMO A;  3TZ1 A;  2GGZ A;  1XK4 C;  1QX5 B;  2LMV A;  3TDI A;  1K93 D;  4GFT A;  2CT9 A;  1PVB A;  1KFX L;  2WCB A;  1A75 B;  3O78 A;  4U8D A;  3I5H C;  2PRU A;  3SG5 A;  4TNC A;  1NX3 A;  1YRU B;  1H4B A;  1DT7 B;  4BY5 A;  2I2R E;  1REC A;  1S5G Z;  3SIA A;  2CXJ A;  1M31 A;  1F54 A;  4N5X A;  4YGE B;  2LUC A;  4ZCU A;  2AMI A;  3FIA A;  4P5O E;  1IG5 A;  2JWW A;  1CMG A;  3I5I B;  1J7Q A;  2F33 A;  1SK6 D;  1JF0 A;  3PAL A;  4CFR A;  4PDZ A;  1Y1A A;  4MBE A;  1DVI A;  1C7V A;  1MHO A;  4I5K A;  1XFZ O;  1IKU A;  3I5F B;  2OTG B;  3ICB A;  1M39 A;  4PHJ A;  4C0K A;  3FWB A;  1A29 A;  1F4O A;  2L2E A;  1KWO C;  1TNQ A;  4ORA B;  5DKN A;  2L98 A;  2CCM A;  4C0L A;  3GK4 X;  2LP2 A;  2M97 A;  2WCF A;  1J7R A;  1TOP A;  2WND A;  4N1F A;  1YUS A;  3I5G C;  5AER A;  1FI6 A;  1KQM C;  5AEQ A;  3VRO A;  2LVJ A;  1B7T Z;  1CDP A;  1JC2 A;  1NX1 A;  5IBW A;  1ODB A;  3DVE A;  2NCO A;  3CR4 X;  5TNC A;  1UHN A;  4IL1 A;  1HQV A;  2LP3 A;  5CPV A;  3FS7 A;  4YRU A;  2KQY A;  3OX6 A;  1GJY A;  1QV0 A;  1B47 A;  1CDL A;  2WCE A;  1B8L A;  1ZMZ A;  3D0Y A;  2K7D A;  1UWO A;  4MZJ A;  2BE4 A;  5JJG A;  3E3R A;  2K2F A;  3PLF B;  2CBL A;  2KAX A;  2M7L A;  4OV2 A;  4WQ3 A;  3DVJ A;  3IQO A;  1AJ5 A;  1N0Y A;  3LCP C;  5FYX A;  3WHU B;  3A4U B;  3BYA A;  1LA0 A;  1J7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...