1K9KA

Crystal structure of calcium bound human s100a6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
89
structure length
89
Chain Sequence
b'ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 36
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9kA00
1E8AA 1PSRA 2L51A 3BUMB 3JTDC 1M39A 1QXPA 1J7OA 1XFZO 2Q4UA 1M45A 4P2YB 5HKZA 2OTGC 2LNKA 2WORA 1EJ3A 3NXAA 4DRWA 2HF5A 5I2OA 1K9PA 1NCYA 1QTXA 1F4QA 1H4BA 3DVMA 1PSBA 1N2DA 2I7AA 3DVKA 4YGCB 5HKWA 2A4JA 3GK4X 3NSKA 1KSOA 1AVSA 2M49B 3F45A 3I5GB 5K89A 4OV2A 2OS8B 1GQMA 5CSFA 1SK6D 1J55A 4QJ3B 1RJVA 2EGDA 4HRGA 1CDNA 2LVKA 3OX6A 1PVBA 2M1UA 2JNFA 3EKJA 1CLLA 1RTP1 1IGVA 1AHRA 1S6IA 2IS9A 3AKAA 3KHEA 1SBJA 4XYNA 2LAPA 1SNLA 2COLB 4OKHA 2M9GA 1SW8A 1J7RA 1A29A 1LA0A 1PALA 1RWYA 1KFUS 1UHNA 1Y1XA 1A4PA 3FWBA 2PRUA 3JVTC 2LUXA 1MR8A 1IH0A 1RFJA 2KBMA 2KSPA 1WRKA 2LMTA 4XJKB 2RGIA 1TN4A 1QATA 2KDHA 4NDDA 1LXFC 1OZOA 2LP3A 3SIBA 2LE9B 3E3RA 1UHHA 3SG4A 2EHBA 2KNEA 1K93D 1SR6B 1RECA 3KO0A 3CGAA 5AFPA 4YI9A 1ALWA 1YR5A 4MVFA 1F70A 3TUYB 2E30A 2ZN9A 4YGEB 2MA2A 1QASA 1CMFA 2KQYA 4OVNF 1AJ5A 5J3XA 1FI6A 2JT3A 1YURA 1SL8A 1U5IA 2KGBC 3FS7A 1K9KA 3VRQA 4NQGA 5HLOA 3AKBA 1JFKA 1QJTA 3ZWHA 1Y0VH 2AMIA 2WC8A 5CSNA 2L2EA 3O2PA 2ISDA 4AOMA 3SG2A 1C7VA 4M2QA 2M8UA 3CWGA 1K94A 5DKNA 1MXEA 2ZKMX 2PALA 4L9MA 3DF0A 1V1GA 1DGUA 1DJXA 2JZIA 2MHHA 4CLNA 1F71A 1AJ4A 2PMYA 2QACA 2LP2A 3FIAA 1PULA 4PHMA 4YI8A 2K0JA 4YGBB 5HYDA 2JT0A 3H4SE 2F2OA 2LVIA 1J1DA 2K7CA 1S5GY 2KFGA 3NSOA 1IJ5A 2LMUA 5ER5A 4GFTA 2KI4C 2JXCA 2CT9A 3CLNA 4GGFA 1B4CA 4QJ4B 2LVVA 4I5JA 1DJZA 3NSLA 3RLZA 5AERA 4C0JA 1BG1A 1H8BA 1WDCB 1RK9A 4ORBB 3TS5B 5ER4X 4UPGA 1Y1UA 1HQVA 1GGWA 3PM8A 1Y6WA 3PLFB 4I5LB 4GBAA 1JWDA 1J7QA 2K2AA 1NX1A 2BECA 4NDBA 3TDIA 1NX3A 2L5XB 1B47A 1VRKA 2BBMA 2EC6B 1DF0B 1QLKA 2BE6A 2WCEA 3IQQA 4USLA 1W7IB 4MRYA 1K9UA 4I5NB 2M0RA 1CDPA 1ALVA 1Y1AA 2K7DA 1K90D 1C07A 3DD4A 4YGDB 1F54A 2K7OA 1M31A 1S1EA 4AQJA 1F4OA 3BUNB 2BKHB 4WRIA 1CKKA 4PCWA 5AEQA 1WY9A 2P6BB 1G4YR 4P5OE 1XFUO 1K2HA 1LA3A 2GGMA 3CR2A 1NCXA 2M29A 5AXIA 4ETOA 1A75A 2WCFA 1FW4A 3A4UB 1AK8A 2Y4QA 1L2OB 1SL7A 2KI6D 2MBXA 1DMOA 1S3PA 1JBAA 2PVBA 3JTDB 3O78A 4MSPA 2ZN8A 4R1EA 1TNQA 2JOJA 3ZNIA 5D7FA 1B1GA 1UP5A 2BCBA 2CCMA 1PRWA 2L98A 2OTGB 2Y1MA 1S5GZ 1SKTA 1PVAA 1B9AA 4ORAB 1B7TZ 2AAOA 3O4YA 3CS1A 3I5FC 1XFYO 1A03A 1BLQA 1C7WA 3BQ3A 1V1FA 1PK0D 1U5IB 2BE4A 2ZFDA 3C1VA 1XFXO 1J7PA 1ZUZA 3BOWA 1KQVA 4GPLB 3HX4A 4ORCB 1AP4A 2ZRTA 3BXKA 4CFQA 4YBHB 5B8IB 1K95A 2LLUA 3D0YB 5JOLA 1SYMA 3I5IC 5CSJA 1SY9A 1M46A 3A8RA 4PHNA 1CB1A 2H61C 3CR5X 3GOFA 1GGZA 1KSMA 1HT9A 3LLEA 2F8PA 5CPVA 1OMRA 1IRJA 1FF1A 4JWQA 1W7JB 4C0KA 3FWCA 2KBIA 1TNWA 5HKYA 3EVVA 1B8LA 1NPQA 5KU1A 5D69A 1B8RA 1XK4A 2JT8A 4N1GA 1L7ZA 2BBNA 1CMGA 3KF9A 3QRXA 1CM4A 2NZ0A 3JVTB 2KAYA 2ZNEA 2KYCA 3LK0A 3WHUB 1MUXA 5PALA 1UWOA 1OE9B 3AAKA 1QX7A 4JQ0D 2NCPA 1SCVA 3EVUA 2LHIA 2AUCA 1YX8A 4NDCA 1KQMC 1ZMZA 1N0YA 1CFDA 1UHKA 1UURA 2JULA 1KK7Y 2JTZA 2LMVA 3BUOB 2H2KA 1BODA 1YVHA 2Y5IA 3GK2A 3K21A 4ZCUA 3LL8B 2LUCA 2LM5A 1KCYA 1BF5A 3M0WA 1JSAA 1QX5B 3PN7C 4FQOA 2PASA 3VRPA 1NYAA 1ZOTB 4A4BA 4DIRA 1YX7A 3KPXA 3PSRA 4AQIA 4PE4A 1TCOB 1MHOA 2M1KB 1R6PA 1QVIY 1XA5A 2HQWA 1A75B 4BY5A 1QV1A 3CR4X 1TCFA 1BT6A 4MEWA 3LCPC 2H61A 2BCXA 1QIWA 1SPYA 2O60A 2ZRSA 3GK1A 1XVJA 4DS7A 1MXLC 2LLTA 1KFXL 4ZCVA 1KWOC 1ZACA 4GNKB 2LHLA 1SRAA 2KI4B 1KK8C 5DKQA 1TIZA 5DKRA 2K7BA 2L0PA 2JWWA 2WCBA 4HSZA 1TOPA 4PALA 1N65A 2G2BA 3SG6A 3EVRA 3ICBA 1TNPA 2JXLA 2KFHA 1SCMC 2SCPA 2V53A 2BL0C 3I5HC 3PALA 2E6WA 2NLNA 1FI5A 1XFVO 1KK7Z 3OP0A 5AANA 1OMVA 4XJKA 2LVJA 2LANA 2MJWB 4MZLA 1XK4C 2F33A 1TTXA 2PSRA 4JPZB 2TN4A 2HPSA 2F2PA 4YGAA 4CIDA 1CDMA 1TNXA 1WLZA 3IF7A 1WLMA 1TRFA 3VGOA 2Q91A 4PDZA 3NSIA 4U8DA 5FYXA 2HETA 1NWDA 2F3YA 4DUQA 1F8HA 3KEVA 1QS7A 1QVIZ 2OPOA 1IKUA 2MLFC 2MAZA 2WOSA 3SG5A 2KI6C 2R2IA 5KSZA 1IQ3A 1NIWA 1S6JA 1JF2A 1B8CA 1MF8B 4PHKA 4F0ZB 2NCOA 1CM1A 1Q80A 2KAXA 5TNCA 5IBWA 1D1OA 3PFVA 1DTLA 1X02A 2CNPA 2L4IA 1UHJA 2BKIB 1DVIA 2KFFA 1MWNA 1S6CA 2KYFA 4FTGA 1JFJA 1GJYA 4BY4A 1DJHA 1EL4A 2SASA 5GQQC 1DJGA 3I5FB 1J1EA 2K2FA 3EK4A 3OX5A 2JPTA 3VROA 4WQ3A 3VRNA 1CNPA 2KQ6A 1CFCA 1YUUA 2NXQA 1DT7B 2KHNA 5I8NA 1YRUB 1XO5A 3WNXB 1YVLA 3DF0B 1OSAA 3I5GC 5G08A 3I5IB 1IWQA 1YUTA 2OS8C 4Q04A 2DOQA 3IQOA 3TZ1A 2LLSA 2ZNDA 2K8MB 2LCPA 1NP8A 1IG5A 1YUSA 2KGRA 1JUOA 4D1EA 1CLBA 1KFUL 3TDUA 4CFRA 3OHMB 3WHTB 2MRDA 2B1UA 1BR4B 4N5XA 2M7NA 1DF0A 3DVJA 1XYDA 4WQ2A 1BU3A 2M3WA 3EKHA 5HLVA 4QJ5B 1R2UA 1CDLA 1G8IA 2KAVA 4MZJA 2M7LA 1IJ6A 1NX0A 2FOTA 2KOTA 1NCZA 1NUBA 1QX2A 2JTTA 1A2XA 3EK7A 1EH2A 2LV7A 1FPWA 4C0LA 2JU0A 2FCDA 2QPTA 1BJFA 1UUSA 4M2PA 2JRFA 2HQ8A 1LINA 4MN0A 1KQMB 4MZKA 1SR6C 4OCIA 1M63B 1MQ1A 5F6TA 3SJSA 4GGNA 3MSEB 3SIAA 4PHJA 2D8NA 3TUYC 1EG4A 4OR9B 4PE7A 1JF0A 3PN7B 1DJWA 1UHIA 1OZSA 4TNCA 1S26D 4PE0A 4YRUA 2MLEC 2GGZA 4HRHA 1YRTB 1BR1B 4MLWA 5I2QA 1BMOA 3VRRA 1DJYA 5BPJA 1FBVA 1RROA 4GGFC 3RM1A 2JNXA 3BUWB 2JC2A 4I5KA 3BYAA 5CSIA 1OMDA 5JJGA 1ODBA 1EXRA 3OB2B 3SG7A 3D0YA 2I18A 4A4CA 2JQ6A 1DGVA 3BOWB 2G9BA 2O5GA 2WNDA 1KWOB 2I94A 3OB1B 1K8UA 1XFWO 3SG3A 4E68A 3O6BA 4M2OA 1KK8B 1G33A 1KFXS 1DJIA 1WDCC 2I2RE 2LC5A 4IL1A 4MRXA 3TS5C 1F55A 1CFFA 3WXAA 1K96A 1B7TY 3EK8A 3CZTX 1SCMB 2BL0B 1LVCD 3CTNA 2FCEA 3I5HB 1JC2A 1QV0A 5KTYA 2F3ZA 2L50A 3TDZA 1AUIB 2FJUB 4ICBA 2Y1NA 4GAOA 2EC6C 4MBEA 4DCKA 3LK1A 1IQ5A 3DVEA 1CTRA 3BUXB 1NSHA 1ZFSA 4PE1A 4HREE 5I2LA 1QIVA 1OQPA 1BOCA 2L4HA 2VRGA 1YTZC 3D10A 1SL9A 1SMGA 3HCMA 2GV5A 3PATA 1OOJA 1CFPA 1WRZA 2CBLA 2K61A 4CPVA 1EG3A 1NX2A 2M97A 2CXJA 3AAJA 2CTNA 1S36A 1LKJA 1WRLA 2BCAA 1QLSA 4GUKA 1L2OC 1CLMA 4N1FA
chains in the Genus database with same CATH superfamily
1E8AA 1PSRA 2L51A 3BUMB 3JTDC 1M39A 1QXPA 1SSEB 1J7OA 2H8VA 1XFZO 2Q4UA 1M45A 4P2YB 5HKZA 2OTGC 2LNKA 1QWVA 2WORA 3DY9A 1EJ3A 3NXAA 4DRWA 2HF5A 5I2OA 1K9PA 1NCYA 1QTXA 2KLEA 1F4QA 3D77A 1H4BA 3DVMA 1PSBA 1N2DA 2I7AA 2K60A 3DVKA 4YGCB 5HKWA 2A4JA 3GK4X 3NSKA 1KSOA 1AVSA 1OOGA 2M49B 3F45A 3I5GB 5K89A 3L47A 3K1EA 4OV2A 2OS8B 4JKTA 1GQMA 5CSFA 1SK6D 1J55A 4KYNA 2QDIA 1RJVA 2EGDA 4HRGA 4QJ3B 5HL1A 3Q8IA 1CDNA 2WCLA 2LVKA 3OX6A 1PVBA 2QEOA 2M1UA 2JNFA 3EKJA 1CLLA 1RTP1 1IGVA 1AHRA 1S6IA 2IS9A 3AKAA 3KHEA 1SBJA 4XYNA 2LAPA 1SNLA 2COLB 4OKHA 2M9GA 3R72A 1SW8A 1J7RA 1A29A 1LA0A 2PYQA 1PALA 3O4XA 1RWYA 1KFUS 1UHNA 1Y1XA 1A4PA 3FWBA 2PRUA 3JVTC 2LUXA 1MR8A 1IH0A 1RFJA 2FJYA 2KBMA 2KSPA 1WRKA 2LMTA 4XJKB 2RGIA 1TN4A 1QATA 2KDHA 4NDDA 1LXFC 1OZOA 2LP3A 3SIBA 2LE9B 3E3RA 3B86A 1UHHA 3SS3A 3SG4A 3SS4A 2EHBA 2KNEA 1K93D 1SR6B 1RECA 3BJHA 3CGAA 3KO0A 5AFPA 4YI9A 3D73A 4F7FA 1DC1A 1ALWA 1YR5A 3R1OA 2L2CA 4MVFA 1F70A 3S0BA 3TUYB 2E30A 2ZN9A 4YGEB 2MA2A 1DQEA 1LS8A 1QASA 1CMFA 2KQYA 4OVNF 1AJ5A 3R1VA 5J3XA 1FI6A 2JT3A 1YURA 1SL8A 1U5IA 2KGBC 3PJIA 3FS7A 1K9KA 3VRQA 4NQGA 5HLOA 3AKBA 1JFKA 1QJTA 3ZWHA 1Y0VH 2AMIA 2WC8A 3DXLA 5CSNA 2L2EA 3O2PA 2ISDA 4AOMA 3SG2A 1C7VA 4M2QA 2M8UA 3CWGA 1Z4HA 1K94A 5DKNA 5FI6A 1MXEA 2ZKMX 2PALA 4L9MA 3DF0A 1V1GA 1DGUA 1DJXA 2JZIA 2MHHA 4CLNA 1F71A 1AJ4A 2PMYA 2QACA 2LP2A 3DYEA 1PULA 3FIAA 4PHMA 4YI8A 2K0JA 4YGBB 5HYDA 2JT0A 3H4SE 2F2OA 2LVIA 1J1DA 2K7CA 3B87A 1S5GY 2KFGA 3NSOA 1IJ5A 2LMUA 5ER5A 4GFTA 2KI4C 2JXCA 2CT9A 3CLNA 4GGFA 1B4CA 1TUJA 4QJ4B 2LVVA 4I5JA 1DJZA 3NSLA 3RLZA 5AERA 4C0JA 3IVTA 1BG1A 1WDCB 1RK9A 4ORBB 3TS5B 1H8BA 5ER4X 4UPGA 1Y1UA 1HQVA 1GGWA 3PM8A 1Y6WA 3PLFB 4I5LB 4GBAA 2WC6A 1JWDA 1J7QA 2K2AA 1NX1A 2BECA 4NDBA 3TDIA 1NX3A 2L5XB 1B47A 1ORGA 1VRKA 2BBMA 2EC6B 1DF0B 1QLKA 2BE6A 2WCEA 3S0DA 3IQQA 4USLA 1W7IB 4MRYA 3SS5A 1K9UA 3B7AA 4I5NB 3CDNA 2M0RA 3OBVA 1CDPA 1ALVA 1Y1AA 2K7DA 1K90D 1C07A 3DD4A 4YGDB 3FE9A 1F54A 2K7OA 1M31A 1S1EA 4AQJA 1F4OA 3BUNB 2BKHB 4WRIA 1CKKA 4PCWA 5AEQA 1WY9A 2P6BB 1G4YR 4P5OE 2L5YA 1XFUO 5FI2A 1K2HA 1LA3A 2GGMA 3CR2A 1NCXA 2M29A 5AXIA 4ETOA 1A75A 3OGNA 2WCFA 3CZ1A 1FW4A 3A4UB 1AK8A 2Y4QA 1L2OB 1SL7A 2KI6D 3B88A 2MBXA 1DMOA 1S3PA 1JBAA 2PVBA 3JTDB 3O78A 4MSPA 2ZN8A 4R1EA 1TNQA 2JOJA 3ZNIA 5D7FA 1B1GA 1UP5A 2BCBA 2CCMA 1PRWA 2L98A 2OTGB 2Y1MA 1S5GZ 3R1PA 1SKTA 1PVAA 1B9AA 4ORAB 1B7TZ 2AAOA 3O4YA 3CS1A 3I5FC 1XFYO 1A03A 1BLQA 1C7WA 3BQ3A 1V1FA 1PK0D 1U5IB 2BE4A 2ZFDA 3C1VA 3S0FA 1XFXO 1J7PA 1ZUZA 3BOWA 1KQVA 4GPLB 3HX4A 3D74A 4ORCB 2ZRTA 1AP4A 1C3YA 3BXKA 3FE8A 4CFQA 4YBHB 5B8IB 4IJ7A 1K95A 2LLUA 3D0YB 5JOLA 1SYMA 3I5IC 5CSJA 1SY9A 1M46A 3A8RA 4PHNA 1CB1A 3UO9A 2H61C 3CR5X 3GOFA 3CABA 1GGZA 2WC5A 1KSMA 1Z2CB 1HT9A 3LLEA 2F8PA 5CPVA 5FI7A 1OMRA 1IRJA 1FF1A 4JWQA 1W7JB 4C0KA 3FWCA 2KBIA 1TNWA 5HKYA 3EVVA 1B8LA 1NPQA 5KU1A 5D69A 1B8RA 1XK4A 2JT8A 2WCMA 4N1GA 1L7ZA 2BBNA 4OZDA 1CMGA 3KF9A 3QRXA 1CM4A 2NZ0A 3B6XA 3JVTB 2KAYA 2ZNEA 2KYCA 3LK0A 3WHUB 1MUXA 1P28A 5PALA 1UWOA 1OE9B 3AAKA 1QX7A 4JQ0D 2NCPA 3NHTA 1SCVA 3EVUA 2LHIA 2AUCA 1YX8A 4NDCA 1KQMC 1ZMZA 4INXA 1IIOA 1N0YA 1CFDA 1UHKA 1UURA 3DZTA 2JULA 1KK7Y 2JTZA 2LMVA 1DELA 3CZ0A 3BUOB 2H2KA 1BODA 1YVHA 2Y5IA 3GK2A 3K21A 4ZCUA 3LL8B 2LUCA 2LM5A 1KCYA 3L4AA 1BF5A 3M0WA 1JSAA 1QX5B 3PN7C 4FQOA 1OOIX 2PASA 2QEBA 1NYAA 1ZOTB 3VRPA 4A4BA 4DIRA 1YX7A 3KPXA 3PSRA 4AQIA 4PE4A 1TCOB 1MHOA 2M1KB 1R6PA 1QVIY 3BFHA 1XA5A 2HQWA 1A75B 4BY5A 1QV1A 3CR4X 1TCFA 1BT6A 4MEWA 3LCPC 2H61A 2BCXA 1QIWA 1SPYA 2O60A 5DICA 2ZRSA 3GK1A 1XVJA 4DS7A 1MXLC 2LLTA 1KFXL 4ZCVA 1KWOC 1ZACA 4GNKB 2LHLA 1SRAA 4FQTA 2KI4B 1KK8C 5DKQA 1TIZA 5DKRA 2K7BA 2L0PA 2JWWA 4INWA 2WCBA 4HSZA 1TOPA 4PALA 1N65A 2G2BA 3SG6A 3EVRA 3NGVA 3ICBA 1TNPA 2JXLA 2KFHA 2WCHA 1SCMC 2SCPA 2V53A 2BL0C 3I5HC 3PALA 2E6WA 2NLNA 1FI5A 1XFVO 1KK7Z 3OP0A 5AANA 1OMVA 2ERBA 4XJKA 2LVJA 2LANA 2MJWB 4MZLA 2QEVA 1XK4C 2F33A 1TTXA 2PSRA 4JPZB 2TN4A 2HPSA 2F2PA 2KPHA 4YGAA 4CIDA 1CDMA 1TNXA 1WLZA 3IF7A 1WLMA 1TRFA 3VGOA 2Q91A 4PDZA 3NSIA 4U8DA 5FYXA 2HETA 1NWDA 2F3YA 4DUQA 1F8HA 3KEVA 1QS7A 1QVIZ 2OPOA 2PQLA 1IKUA 2MLFC 2MAZA 2WOSA 3SG5A 1OOFA 2KI6C 2R2IA 5KSZA 1IQ3A 1NIWA 1TWOA 1S6JA 1JF2A 1B8CA 1MF8B 4PHKA 4F0ZB 2NCOA 1CM1A 1Q80A 1DEKA 2KAXA 5TNCA 1TUZA 5IBWA 3D76A 1D1OA 3PFVA 1DTLA 1X02A 3PM2A 2CNPA 2L4IA 3N7HA 1UHJA 2BKIB 2KLDA 1DVIA 2KFFA 1MWNA 1S6CA 2KYFA 4FTGA 1JFJA 1GJYA 4BY4A 1DJHA 2JPOA 1EL4A 2SASA 5GQQC 1GM0A 1DJGA 2YGUA 3I5FB 1J1EA 2K2FA 3EK4A 3OX5A 2JPTA 2BNXA 3VB1A 3VROA 4WQ3A 3VRNA 1CNPA 2KQ6A 1CFCA 1YUUA 2NXQA 1T14A 1DT7B 2KHNA 3L4LA 5I8NA 1YRUB 1XO5A 3WNXB 1YVLA 3DF0B 1OSAA 3I5GC 5G08A 3I5IB 1IWQA 3UNWA 1YUTA 2OS8C 4Q04A 2DOQA 3IQOA 3TZ1A 2LLSA 3EG5B 2ZNDA 2K8MB 2LCPA 1NP8A 1IG5A 1YUSA 2KGRA 3S0AA 1JUOA 4D1EA 1CLBA 1KFUL 3TDUA 4CFRA 3OHMB 3WHTB 2MRDA 2B1UA 1BR4B 4N5XA 2M7NA 1DF0A 1OW4A 1XYDA 3DVJA 1BU3A 2M3WA 3EKHA 4WQ2A 5HLVA 4QJ5B 1R2UA 1CDLA 1G8IA 2KAVA 3FE6A 3S0GA 2P70A 4MZJA 2M7LA 1IJ6A 1NX0A 2FOTA 2KOTA 3BFAA 1NCZA 1NUBA 1QX2A 3NHIA 2JTTA 1A2XA 3EK7A 1EH2A 2LV7A 1FPWA 4C0LA 2JU0A 2FCDA 2QPTA 1BJFA 1W9ZA 1UUSA 4M2PA 2JRFA 3RZSA 2HQ8A 2QEHA 1LINA 4MN0A 1KQMB 4MZKA 2WCJA 1SR6C 3QMEA 4OCIA 1M63B 1MQ1A 5F6TA 3SJSA 4GGNA 3MSEB 3SIAA 4PHJA 1XFRA 2D8NA 3TUYC 1EG4A 3CYZA 4OR9B 4PE7A 1JF0A 3PN7B 1DJWA 1UHIA 1OZSA 4TNCA 1S26D 4PE0A 4YRUA 2MLEC 2GGZA 4HRHA 4JD9A 1YRTB 1BR1B 4MLWA 5I2QA 1BMOA 3VRRA 1DJYA 5BPJA 1FBVA 1RROA 4GGFC 3RM1A 3V2LA 2JNXA 3BUWB 1C3ZA 2P71A 5I94A 2JC2A 4I5KA 3BYAA 5CSIA 1OMDA 5JJGA 1ODBA 1EXRA 5EL2A 3OB2B 3SG7A 4PT1A 3CZ2A 3D0YA 2I18A 4A4CA 2BAPA 1DGVA 2JQ6A 3BOWB 2G9BA 2O5GA 2WNDA 1KWOB 2I94A 3OB1B 1K8UA 1XFWO 3SG3A 4E68A 1OOHA 3O6BA 4M2OA 1KK8B 1G33A 1KFXS 1DJIA 1WDCC 2I2RE 2LC5A 4IL1A 2GTEA 4MRXA 3TS5C 1F55A 1CFFA 3WXAA 1K96A 1B7TY 3D75A 3EK8A 3CZTX 1SCMB 2BL0B 1LVCD 3CTNA 2FCEA 3I5HB 1JC2A 1QV0A 5KTYA 2F3ZA 2L50A 3TDZA 1AUIB 2FJUB 4ICBA 2Y1NA 4GAOA 2EC6C 4MBEA 4DCKA 3LK1A 1IQ5A 3DVEA 1CTRA 3BUXB 1NSHA 1ZFSA 4PE1A 4HREE 5I2LA 1QIVA 1OQPA 1BOCA 2L4HA 2VRGA 1YTZC 3D10A 1SL9A 1SMGA 5D3OA 3BFBA 3HCMA 2GV5A 3PATA 1OOJA 1CFPA 1WRZA 2CBLA 2K61A 2WCKA 3D78A 4CPVA 1EG3A 1NX2A 2M97A 2CXJA 3AAJA 2CTNA 1S36A 1LKJA 1WRLA 2BCAA 1QLSA 4GUKA 3S0EA 1L2OC 1CLMA 4N1FA
chains in the Genus database with same CATH topology
1E8AA 1PSRA 2L51A 3BUMB 3JTDC 1M39A 1QXPA 1J7OA 1XFZO 2Q4UA 1M45A 4P2YB 5HKZA 2OTGC 2LNKA 2WORA 1EJ3A 3NXAA 4DRWA 2HF5A 5I2OA 1K9PA 1NCYA 1QTXA 1F4QA 1H4BA 3DVMA 1PSBA 1N2DA 2I7AA 3DVKA 4YGCB 5HKWA 2A4JA 3GK4X 3NSKA 1KSOA 1AVSA 2M49B 3F45A 3I5GB 5K89A 4OV2A 2OS8B 1GQMA 5CSFA 1SK6D 1J55A 4QJ3B 1RJVA 2EGDA 4HRGA 1CDNA 2LVKA 3OX6A 1PVBA 2M1UA 2JNFA 3EKJA 1CLLA 1RTP1 1IGVA 1AHRA 1S6IA 2IS9A 3AKAA 3KHEA 1SBJA 4XYNA 2LAPA 1SNLA 2COLB 4OKHA 2M9GA 1SW8A 1J7RA 1A29A 1LA0A 1PALA 1RWYA 1KFUS 1UHNA 1Y1XA 1A4PA 3FWBA 2PRUA 3JVTC 2LUXA 1MR8A 1IH0A 1RFJA 2KBMA 2KSPA 1WRKA 2LMTA 4XJKB 2RGIA 1TN4A 1QATA 2KDHA 4NDDA 1LXFC 1OZOA 2LP3A 3SIBA 2LE9B 3E3RA 1UHHA 3SG4A 2EHBA 2KNEA 1K93D 1SR6B 1RECA 3KO0A 3CGAA 5AFPA 4YI9A 1ALWA 1YR5A 4MVFA 1F70A 3TUYB 2E30A 2ZN9A 4YGEB 2MA2A 1QASA 1CMFA 2KQYA 4OVNF 1AJ5A 5J3XA 1FI6A 2JT3A 1YURA 1SL8A 1U5IA 2KGBC 3FS7A 1K9KA 3VRQA 4NQGA 5HLOA 3AKBA 1JFKA 1QJTA 3ZWHA 1Y0VH 2AMIA 2WC8A 5CSNA 2L2EA 3O2PA 2ISDA 4AOMA 3SG2A 1C7VA 4M2QA 2M8UA 3CWGA 1K94A 5DKNA 1MXEA 2ZKMX 2PALA 4L9MA 3DF0A 1V1GA 1DGUA 1DJXA 2JZIA 2MHHA 4CLNA 1F71A 1AJ4A 2PMYA 2QACA 2LP2A 3FIAA 1PULA 4PHMA 4YI8A 2K0JA 4YGBB 5HYDA 2JT0A 3H4SE 2F2OA 2LVIA 1J1DA 2K7CA 1S5GY 2KFGA 3NSOA 1IJ5A 2LMUA 5ER5A 4GFTA 2KI4C 2JXCA 2CT9A 3CLNA 4GGFA 1B4CA 4QJ4B 2LVVA 4I5JA 1DJZA 3NSLA 3RLZA 5AERA 4C0JA 1BG1A 1H8BA 1WDCB 1RK9A 4ORBB 3TS5B 5ER4X 4UPGA 1Y1UA 1HQVA 1GGWA 3PM8A 1Y6WA 3PLFB 4I5LB 4GBAA 1JWDA 1J7QA 2K2AA 1NX1A 2BECA 4NDBA 3TDIA 1NX3A 2L5XB 1B47A 1VRKA 2BBMA 2EC6B 1DF0B 1QLKA 2BE6A 2WCEA 3IQQA 4USLA 1W7IB 4MRYA 1K9UA 4I5NB 2M0RA 1CDPA 1ALVA 1Y1AA 2K7DA 1K90D 1C07A 3DD4A 4YGDB 1F54A 2K7OA 1M31A 1S1EA 4AQJA 1F4OA 3BUNB 2BKHB 4WRIA 1CKKA 4PCWA 5AEQA 1WY9A 2P6BB 1G4YR 4P5OE 1XFUO 1K2HA 1LA3A 2GGMA 3CR2A 1NCXA 2M29A 5AXIA 4ETOA 1A75A 2WCFA 1FW4A 3A4UB 1AK8A 2Y4QA 1L2OB 1SL7A 2KI6D 2MBXA 1DMOA 1S3PA 1JBAA 2PVBA 3JTDB 3O78A 4MSPA 2ZN8A 4R1EA 1TNQA 2JOJA 3ZNIA 5D7FA 1B1GA 1UP5A 2BCBA 2CCMA 1PRWA 2L98A 2OTGB 2Y1MA 1S5GZ 1SKTA 1PVAA 1B9AA 4ORAB 1B7TZ 2AAOA 3O4YA 3CS1A 3I5FC 1XFYO 1A03A 1BLQA 1C7WA 3BQ3A 1V1FA 1PK0D 1U5IB 2BE4A 2ZFDA 3C1VA 1XFXO 1J7PA 1ZUZA 3BOWA 1KQVA 4GPLB 3HX4A 4ORCB 1AP4A 2ZRTA 3BXKA 4CFQA 4YBHB 5B8IB 1K95A 2LLUA 3D0YB 5JOLA 1SYMA 3I5IC 5CSJA 1SY9A 1M46A 3A8RA 4PHNA 1CB1A 2H61C 3CR5X 3GOFA 1GGZA 1KSMA 1HT9A 3LLEA 2F8PA 5CPVA 1OMRA 1IRJA 1FF1A 4JWQA 1W7JB 4C0KA 3FWCA 2KBIA 1TNWA 5HKYA 3EVVA 1B8LA 1NPQA 5KU1A 5D69A 1B8RA 1XK4A 2JT8A 4N1GA 1L7ZA 2BBNA 1CMGA 3KF9A 3QRXA 1CM4A 2NZ0A 3JVTB 2KAYA 2ZNEA 2KYCA 3LK0A 3WHUB 1MUXA 5PALA 1UWOA 1OE9B 3AAKA 1QX7A 4JQ0D 2NCPA 1SCVA 3EVUA 2LHIA 2AUCA 1YX8A 4NDCA 1KQMC 1ZMZA 1N0YA 1CFDA 1UHKA 1UURA 2JULA 1KK7Y 2JTZA 2LMVA 3BUOB 2H2KA 1BODA 1YVHA 2Y5IA 3GK2A 3K21A 4ZCUA 3LL8B 2LUCA 2LM5A 1KCYA 1BF5A 3M0WA 1JSAA 1QX5B 3PN7C 4FQOA 2PASA 3VRPA 1NYAA 1ZOTB 4A4BA 4DIRA 1YX7A 3KPXA 3PSRA 4AQIA 4PE4A 1TCOB 1MHOA 2M1KB 1R6PA 1QVIY 1XA5A 2HQWA 1A75B 4BY5A 1QV1A 3CR4X 1TCFA 1BT6A 4MEWA 3LCPC 2H61A 2BCXA 1QIWA 1SPYA 2O60A 2ZRSA 3GK1A 1XVJA 4DS7A 1MXLC 2LLTA 1KFXL 4ZCVA 1KWOC 1ZACA 4GNKB 2LHLA 1SRAA 2KI4B 1KK8C 5DKQA 1TIZA 5DKRA 2K7BA 2L0PA 2JWWA 2WCBA 4HSZA 1TOPA 4PALA 1N65A 2G2BA 3SG6A 3EVRA 3ICBA 1TNPA 2JXLA 2KFHA 1SCMC 2SCPA 2V53A 2BL0C 3I5HC 3PALA 2E6WA 2NLNA 1FI5A 1XFVO 1KK7Z 3OP0A 5AANA 1OMVA 4XJKA 2LVJA 2LANA 2MJWB 4MZLA 1XK4C 2F33A 1TTXA 2PSRA 4JPZB 2TN4A 2HPSA 2F2PA 4YGAA 4CIDA 1CDMA 1TNXA 1WLZA 3IF7A 1WLMA 1TRFA 3VGOA 2Q91A 4PDZA 3NSIA 4U8DA 5FYXA 2HETA 1NWDA 2F3YA 4DUQA 1F8HA 3KEVA 1QS7A 1QVIZ 2OPOA 1IKUA 2MLFC 2MAZA 2WOSA 3SG5A 2KI6C 2R2IA 5KSZA 1IQ3A 1NIWA 1S6JA 1JF2A 1B8CA 1MF8B 4PHKA 4F0ZB 2NCOA 1CM1A 1Q80A 2KAXA 5TNCA 5IBWA 1D1OA 3PFVA 1DTLA 1X02A 2CNPA 2L4IA 1UHJA 2BKIB 1DVIA 2KFFA 1MWNA 1S6CA 2KYFA 4FTGA 1JFJA 1GJYA 4BY4A 1DJHA 1EL4A 2SASA 5GQQC 1DJGA 3I5FB 1J1EA 2K2FA 3EK4A 3OX5A 2JPTA 3VROA 4WQ3A 3VRNA 1CNPA 2KQ6A 1CFCA 1YUUA 2NXQA 1DT7B 2KHNA 5I8NA 1YRUB 1XO5A 3WNXB 1YVLA 3DF0B 1OSAA 3I5GC 5G08A 3I5IB 1IWQA 1YUTA 2OS8C 4Q04A 2DOQA 3IQOA 3TZ1A 2LLSA 2ZNDA 2K8MB 2LCPA 1NP8A 1IG5A 1YUSA 2KGRA 1JUOA 4D1EA 1CLBA 1KFUL 3TDUA 4CFRA 3OHMB 3WHTB 2MRDA 2B1UA 1BR4B 4N5XA 2M7NA 1DF0A 3DVJA 1XYDA 4WQ2A 1BU3A 2M3WA 3EKHA 5HLVA 4QJ5B 1R2UA 1CDLA 1G8IA 2KAVA 4MZJA 2M7LA 1IJ6A 1NX0A 2FOTA 2KOTA 1NCZA 1NUBA 1QX2A 2JTTA 1A2XA 3EK7A 1EH2A 2LV7A 1FPWA 4C0LA 2JU0A 2FCDA 2QPTA 1BJFA 1UUSA 4M2PA 2JRFA 2HQ8A 1LINA 4MN0A 1KQMB 4MZKA 1SR6C 4OCIA 1M63B 1MQ1A 5F6TA 3SJSA 4GGNA 3MSEB 3SIAA 4PHJA 2D8NA 3TUYC 1EG4A 4OR9B 4PE7A 1JF0A 3PN7B 1DJWA 1UHIA 1OZSA 4TNCA 1S26D 4PE0A 4YRUA 2MLEC 2GGZA 4HRHA 1YRTB 1BR1B 4MLWA 5I2QA 1BMOA 3VRRA 1DJYA 5BPJA 1FBVA 1RROA 4GGFC 3RM1A 2JNXA 3BUWB 2JC2A 4I5KA 3BYAA 5CSIA 1OMDA 5JJGA 1ODBA 1EXRA 3OB2B 3SG7A 3D0YA 2I18A 4A4CA 2JQ6A 1DGVA 3BOWB 2G9BA 2O5GA 2WNDA 1KWOB 2I94A 3OB1B 1K8UA 1XFWO 3SG3A 4E68A 3O6BA 4M2OA 1KK8B 1G33A 1KFXS 1DJIA 1WDCC 2I2RE 2LC5A 4IL1A 4MRXA 3TS5C 1F55A 1CFFA 3WXAA 1K96A 1B7TY 3EK8A 3CZTX 1SCMB 2BL0B 1LVCD 3CTNA 2FCEA 3I5HB 1JC2A 1QV0A 5KTYA 2F3ZA 2L50A 3TDZA 1AUIB 2FJUB 4ICBA 2Y1NA 4GAOA 2EC6C 4MBEA 4DCKA 3LK1A 1IQ5A 3DVEA 1CTRA 3BUXB 1NSHA 1ZFSA 4PE1A 4HREE 5I2LA 1QIVA 1OQPA 1BOCA 2L4HA 2VRGA 1YTZC 3D10A 1SL9A 1SMGA 3HCMA 2GV5A 3PATA 1OOJA 1CFPA 1WRZA 2CBLA 2K61A 4CPVA 1EG3A 1NX2A 2M97A 2CXJA 3AAJA 2CTNA 1S36A 1LKJA 1WRLA 2BCAA 1QLSA 4GUKA 1L2OC 1CLMA 4N1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E8A A;  1PSR A;  2L51 A;  3BUM B;  3JTD C;  1M39 A;  1QXP A;  1J7O A;  1XFZ O;  2Q4U A;  1M45 A;  4P2Y B;  5HKZ A;  2OTG C;  2LNK A;  2WOR A;  1EJ3 A;  3NXA A;  4DRW A;  2HF5 A;  5I2O A;  1K9P A;  1NCY A;  1QTX A;  1F4Q A;  1H4B A;  3DVM A;  1PSB A;  1N2D A;  2I7A A;  3DVK A;  4YGC B;  5HKW A;  2A4J A;  3GK4 X;  3NSK A;  1KSO A;  1AVS A;  2M49 B;  3F45 A;  3I5G B;  5K89 A;  4OV2 A;  2OS8 B;  1GQM A;  5CSF A;  1SK6 D;  1J55 A;  4QJ3 B;  1RJV A;  2EGD A;  4HRG A;  1CDN A;  2LVK A;  3OX6 A;  1PVB A;  2M1U A;  2JNF A;  3EKJ A;  1CLL A;  1RTP 1;  1IGV A;  1AHR A;  1S6I A;  2IS9 A;  3AKA A;  3KHE A;  1SBJ A;  4XYN A;  2LAP A;  1SNL A;  2COL B;  4OKH A;  2M9G A;  1SW8 A;  1J7R A;  1A29 A;  1LA0 A;  1PAL A;  1RWY A;  1KFU S;  1UHN A;  1Y1X A;  1A4P A;  3FWB A;  2PRU A;  3JVT C;  2LUX A;  1MR8 A;  1IH0 A;  1RFJ A;  2KBM A;  2KSP A;  1WRK A;  2LMT A;  4XJK B;  2RGI A;  1TN4 A;  1QAT A;  2KDH A;  4NDD A;  1LXF C;  1OZO A;  2LP3 A;  3SIB A;  2LE9 B;  3E3R A;  1UHH A;  3SG4 A;  2EHB A;  2KNE A;  1K93 D;  1SR6 B;  1REC A;  3KO0 A;  3CGA A;  5AFP A;  4YI9 A;  1ALW A;  1YR5 A;  4MVF A;  1F70 A;  3TUY B;  2E30 A;  2ZN9 A;  4YGE B;  2MA2 A;  1QAS A;  1CMF A;  2KQY A;  4OVN F;  1AJ5 A;  5J3X A;  1FI6 A;  2JT3 A;  1YUR A;  1SL8 A;  1U5I A;  2KGB C;  3FS7 A;  1K9K A;  3VRQ A;  4NQG A;  5HLO A;  3AKB A;  1JFK A;  1QJT A;  3ZWH A;  1Y0V H;  2AMI A;  2WC8 A;  5CSN A;  2L2E A;  3O2P A;  2ISD A;  4AOM A;  3SG2 A;  1C7V A;  4M2Q A;  2M8U A;  3CWG A;  1K94 A;  5DKN A;  1MXE A;  2ZKM X;  2PAL A;  4L9M A;  3DF0 A;  1V1G A;  1DGU A;  1DJX A;  2JZI A;  2MHH A;  4CLN A;  1F71 A;  1AJ4 A;  2PMY A;  2QAC A;  2LP2 A;  3FIA A;  1PUL A;  4PHM A;  4YI8 A;  2K0J A;  4YGB B;  5HYD A;  2JT0 A;  3H4S E;  2F2O A;  2LVI A;  1J1D A;  2K7C A;  1S5G Y;  2KFG A;  3NSO A;  1IJ5 A;  2LMU A;  5ER5 A;  4GFT A;  2KI4 C;  2JXC A;  2CT9 A;  3CLN A;  4GGF A;  1B4C A;  4QJ4 B;  2LVV A;  4I5J A;  1DJZ A;  3NSL A;  3RLZ A;  5AER A;  4C0J A;  1BG1 A;  1H8B A;  1WDC B;  1RK9 A;  4ORB B;  3TS5 B;  5ER4 X;  4UPG A;  1Y1U A;  1HQV A;  1GGW A;  3PM8 A;  1Y6W A;  3PLF B;  4I5L B;  4GBA A;  1JWD A;  1J7Q A;  2K2A A;  1NX1 A;  2BEC A;  4NDB A;  3TDI A;  1NX3 A;  2L5X B;  1B47 A;  1VRK A;  2BBM A;  2EC6 B;  1DF0 B;  1QLK A;  2BE6 A;  2WCE A;  3IQQ A;  4USL A;  1W7I B;  4MRY A;  1K9U A;  4I5N B;  2M0R A;  1CDP A;  1ALV A;  1Y1A A;  2K7D A;  1K90 D;  1C07 A;  3DD4 A;  4YGD B;  1F54 A;  2K7O A;  1M31 A;  1S1E A;  4AQJ A;  1F4O A;  3BUN B;  2BKH B;  4WRI A;  1CKK A;  4PCW A;  5AEQ A;  1WY9 A;  2P6B B;  1G4Y R;  4P5O E;  1XFU O;  1K2H A;  1LA3 A;  2GGM A;  3CR2 A;  1NCX A;  2M29 A;  5AXI A;  4ETO A;  1A75 A;  2WCF A;  1FW4 A;  3A4U B;  1AK8 A;  2Y4Q A;  1L2O B;  1SL7 A;  2KI6 D;  2MBX A;  1DMO A;  1S3P A;  1JBA A;  2PVB A;  3JTD B;  3O78 A;  4MSP A;  2ZN8 A;  4R1E A;  1TNQ A;  2JOJ A;  3ZNI A;  5D7F A;  1B1G A;  1UP5 A;  2BCB A;  2CCM A;  1PRW A;  2L98 A;  2OTG B;  2Y1M A;  1S5G Z;  1SKT A;  1PVA A;  1B9A A;  4ORA B;  1B7T Z;  2AAO A;  3O4Y A;  3CS1 A;  3I5F C;  1XFY O;  1A03 A;  1BLQ A;  1C7W A;  3BQ3 A;  1V1F A;  1PK0 D;  1U5I B;  2BE4 A;  2ZFD A;  3C1V A;  1XFX O;  1J7P A;  1ZUZ A;  3BOW A;  1KQV A;  4GPL B;  3HX4 A;  4ORC B;  1AP4 A;  2ZRT A;  3BXK A;  4CFQ A;  4YBH B;  5B8I B;  1K95 A;  2LLU A;  3D0Y B;  5JOL A;  1SYM A;  3I5I C;  5CSJ A;  1SY9 A;  1M46 A;  3A8R A;  4PHN A;  1CB1 A;  2H61 C;  3CR5 X;  3GOF A;  1GGZ A;  1KSM A;  1HT9 A;  3LLE A;  2F8P A;  5CPV A;  1OMR A;  1IRJ A;  1FF1 A;  4JWQ A;  1W7J B;  4C0K A;  3FWC A;  2KBI A;  1TNW A;  5HKY A;  3EVV A;  1B8L A;  1NPQ A;  5KU1 A;  5D69 A;  1B8R A;  1XK4 A;  2JT8 A;  4N1G A;  1L7Z A;  2BBN A;  1CMG A;  3KF9 A;  3QRX A;  1CM4 A;  2NZ0 A;  3JVT B;  2KAY A;  2ZNE A;  2KYC A;  3LK0 A;  3WHU B;  1MUX A;  5PAL A;  1UWO A;  1OE9 B;  3AAK A;  1QX7 A;  4JQ0 D;  2NCP A;  1SCV A;  3EVU A;  2LHI A;  2AUC A;  1YX8 A;  4NDC A;  1KQM C;  1ZMZ A;  1N0Y A;  1CFD A;  1UHK A;  1UUR A;  2JUL A;  1KK7 Y;  2JTZ A;  2LMV A;  3BUO B;  2H2K A;  1BOD A;  1YVH A;  2Y5I A;  3GK2 A;  3K21 A;  4ZCU A;  3LL8 B;  2LUC A;  2LM5 A;  1KCY A;  1BF5 A;  3M0W A;  1JSA A;  1QX5 B;  3PN7 C;  4FQO A;  2PAS A;  3VRP A;  1NYA A;  1ZOT B;  4A4B A;  4DIR A;  1YX7 A;  3KPX A;  3PSR A;  4AQI A;  4PE4 A;  1TCO B;  1MHO A;  2M1K B;  1R6P A;  1QVI Y;  1XA5 A;  2HQW A;  1A75 B;  4BY5 A;  1QV1 A;  3CR4 X;  1TCF A;  1BT6 A;  4MEW A;  3LCP C;  2H61 A;  2BCX A;  1QIW A;  1SPY A;  2O60 A;  2ZRS A;  3GK1 A;  1XVJ A;  4DS7 A;  1MXL C;  2LLT A;  1KFX L;  4ZCV A;  1KWO C;  1ZAC A;  4GNK B;  2LHL A;  1SRA A;  2KI4 B;  1KK8 C;  5DKQ A;  1TIZ A;  5DKR A;  2K7B A;  2L0P A;  2JWW A;  2WCB A;  4HSZ A;  1TOP A;  4PAL A;  1N65 A;  2G2B A;  3SG6 A;  3EVR A;  3ICB A;  1TNP A;  2JXL A;  2KFH A;  1SCM C;  2SCP A;  2V53 A;  2BL0 C;  3I5H C;  3PAL A;  2E6W A;  2NLN A;  1FI5 A;  1XFV O;  1KK7 Z;  3OP0 A;  5AAN A;  1OMV A;  4XJK A;  2LVJ A;  2LAN A;  2MJW B;  4MZL A;  1XK4 C;  2F33 A;  1TTX A;  2PSR A;  4JPZ B;  2TN4 A;  2HPS A;  2F2P A;  4YGA A;  4CID A;  1CDM A;  1TNX A;  1WLZ A;  3IF7 A;  1WLM A;  1TRF A;  3VGO A;  2Q91 A;  4PDZ A;  3NSI A;  4U8D A;  5FYX A;  2HET A;  1NWD A;  2F3Y A;  4DUQ A;  1F8H A;  3KEV A;  1QS7 A;  1QVI Z;  2OPO A;  1IKU A;  2MLF C;  2MAZ A;  2WOS A;  3SG5 A;  2KI6 C;  2R2I A;  5KSZ A;  1IQ3 A;  1NIW A;  1S6J A;  1JF2 A;  1B8C A;  1MF8 B;  4PHK A;  4F0Z B;  2NCO A;  1CM1 A;  1Q80 A;  2KAX A;  5TNC A;  5IBW A;  1D1O A;  3PFV A;  1DTL A;  1X02 A;  2CNP A;  2L4I A;  1UHJ A;  2BKI B;  1DVI A;  2KFF A;  1MWN A;  1S6C A;  2KYF A;  4FTG A;  1JFJ A;  1GJY A;  4BY4 A;  1DJH A;  1EL4 A;  2SAS A;  5GQQ C;  1DJG A;  3I5F B;  1J1E A;  2K2F A;  3EK4 A;  3OX5 A;  2JPT A;  3VRO A;  4WQ3 A;  3VRN A;  1CNP A;  2KQ6 A;  1CFC A;  1YUU A;  2NXQ A;  1DT7 B;  2KHN A;  5I8N A;  1YRU B;  1XO5 A;  3WNX B;  1YVL A;  3DF0 B;  1OSA A;  3I5G C;  5G08 A;  3I5I B;  1IWQ A;  1YUT A;  2OS8 C;  4Q04 A;  2DOQ A;  3IQO A;  3TZ1 A;  2LLS A;  2ZND A;  2K8M B;  2LCP A;  1NP8 A;  1IG5 A;  1YUS A;  2KGR A;  1JUO A;  4D1E A;  1CLB A;  1KFU L;  3TDU A;  4CFR A;  3OHM B;  3WHT B;  2MRD A;  2B1U A;  1BR4 B;  4N5X A;  2M7N A;  1DF0 A;  3DVJ A;  1XYD A;  4WQ2 A;  1BU3 A;  2M3W A;  3EKH A;  5HLV A;  4QJ5 B;  1R2U A;  1CDL A;  1G8I A;  2KAV A;  4MZJ A;  2M7L A;  1IJ6 A;  1NX0 A;  2FOT A;  2KOT A;  1NCZ A;  1NUB A;  1QX2 A;  2JTT A;  1A2X A;  3EK7 A;  1EH2 A;  2LV7 A;  1FPW A;  4C0L A;  2JU0 A;  2FCD A;  2QPT A;  1BJF A;  1UUS A;  4M2P A;  2JRF A;  2HQ8 A;  1LIN A;  4MN0 A;  1KQM B;  4MZK A;  1SR6 C;  4OCI A;  1M63 B;  1MQ1 A;  5F6T A;  3SJS A;  4GGN A;  3MSE B;  3SIA A;  4PHJ A;  2D8N A;  3TUY C;  1EG4 A;  4OR9 B;  4PE7 A;  1JF0 A;  3PN7 B;  1DJW A;  1UHI A;  1OZS A;  4TNC A;  1S26 D;  4PE0 A;  4YRU A;  2MLE C;  2GGZ A;  4HRH A;  1YRT B;  1BR1 B;  4MLW A;  5I2Q A;  1BMO A;  3VRR A;  1DJY A;  5BPJ A;  1FBV A;  1RRO A;  4GGF C;  3RM1 A;  2JNX A;  3BUW B;  2JC2 A;  4I5K A;  3BYA A;  5CSI A;  1OMD A;  5JJG A;  1ODB A;  1EXR A;  3OB2 B;  3SG7 A;  3D0Y A;  2I18 A;  4A4C A;  2JQ6 A;  1DGV A;  3BOW B;  2G9B A;  2O5G A;  2WND A;  1KWO B;  2I94 A;  3OB1 B;  1K8U A;  1XFW O;  3SG3 A;  4E68 A;  3O6B A;  4M2O A;  1KK8 B;  1G33 A;  1KFX S;  1DJI A;  1WDC C;  2I2R E;  2LC5 A;  4IL1 A;  4MRX A;  3TS5 C;  1F55 A;  1CFF A;  3WXA A;  1K96 A;  1B7T Y;  3EK8 A;  3CZT X;  1SCM B;  2BL0 B;  1LVC D;  3CTN A;  2FCE A;  3I5H B;  1JC2 A;  1QV0 A;  5KTY A;  2F3Z A;  2L50 A;  3TDZ A;  1AUI B;  2FJU B;  4ICB A;  2Y1N A;  4GAO A;  2EC6 C;  4MBE A;  4DCK A;  3LK1 A;  1IQ5 A;  3DVE A;  1CTR A;  3BUX B;  1NSH A;  1ZFS A;  4PE1 A;  4HRE E;  5I2L A;  1QIV A;  1OQP A;  1BOC A;  2L4H A;  2VRG A;  1YTZ C;  3D10 A;  1SL9 A;  1SMG A;  3HCM A;  2GV5 A;  3PAT A;  1OOJ A;  1CFP A;  1WRZ A;  2CBL A;  2K61 A;  4CPV A;  1EG3 A;  1NX2 A;  2M97 A;  2CXJ A;  3AAJ A;  2CTN A;  1S36 A;  1LKJ A;  1WRL A;  2BCA A;  1QLS A;  4GUK A;  1L2O C;  1CLM A;  4N1F A; 
#chains in the Genus database with same CATH topology
 1E8A A;  1PSR A;  2L51 A;  3BUM B;  3JTD C;  1M39 A;  1QXP A;  1SSE B;  1J7O A;  2H8V A;  1XFZ O;  2Q4U A;  1M45 A;  4P2Y B;  5HKZ A;  2OTG C;  2LNK A;  1QWV A;  2WOR A;  3DY9 A;  1EJ3 A;  3NXA A;  4DRW A;  2HF5 A;  5I2O A;  1K9P A;  1NCY A;  1QTX A;  2KLE A;  1F4Q A;  3D77 A;  1H4B A;  3DVM A;  1PSB A;  1N2D A;  2I7A A;  2K60 A;  3DVK A;  4YGC B;  5HKW A;  2A4J A;  3GK4 X;  3NSK A;  1KSO A;  1AVS A;  1OOG A;  2M49 B;  3F45 A;  3I5G B;  5K89 A;  3L47 A;  3K1E A;  4OV2 A;  2OS8 B;  4JKT A;  1GQM A;  5CSF A;  1SK6 D;  1J55 A;  4KYN A;  2QDI A;  1RJV A;  2EGD A;  4HRG A;  4QJ3 B;  5HL1 A;  3Q8I A;  1CDN A;  2WCL A;  2LVK A;  3OX6 A;  1PVB A;  2QEO A;  2M1U A;  2JNF A;  3EKJ A;  1CLL A;  1RTP 1;  1IGV A;  1AHR A;  1S6I A;  2IS9 A;  3AKA A;  3KHE A;  1SBJ A;  4XYN A;  2LAP A;  1SNL A;  2COL B;  4OKH A;  2M9G A;  3R72 A;  1SW8 A;  1J7R A;  1A29 A;  1LA0 A;  2PYQ A;  1PAL A;  3O4X A;  1RWY A;  1KFU S;  1UHN A;  1Y1X A;  1A4P A;  3FWB A;  2PRU A;  3JVT C;  2LUX A;  1MR8 A;  1IH0 A;  1RFJ A;  2FJY A;  2KBM A;  2KSP A;  1WRK A;  2LMT A;  4XJK B;  2RGI A;  1TN4 A;  1QAT A;  2KDH A;  4NDD A;  1LXF C;  1OZO A;  2LP3 A;  3SIB A;  2LE9 B;  3E3R A;  3B86 A;  1UHH A;  3SS3 A;  3SG4 A;  3SS4 A;  2EHB A;  2KNE A;  1K93 D;  1SR6 B;  1REC A;  3BJH A;  3CGA A;  3KO0 A;  5AFP A;  4YI9 A;  3D73 A;  4F7F A;  1DC1 A;  1ALW A;  1YR5 A;  3R1O A;  2L2C A;  4MVF A;  1F70 A;  3S0B A;  3TUY B;  2E30 A;  2ZN9 A;  4YGE B;  2MA2 A;  1DQE A;  1LS8 A;  1QAS A;  1CMF A;  2KQY A;  4OVN F;  1AJ5 A;  3R1V A;  5J3X A;  1FI6 A;  2JT3 A;  1YUR A;  1SL8 A;  1U5I A;  2KGB C;  3PJI A;  3FS7 A;  1K9K A;  3VRQ A;  4NQG A;  5HLO A;  3AKB A;  1JFK A;  1QJT A;  3ZWH A;  1Y0V H;  2AMI A;  2WC8 A;  3DXL A;  5CSN A;  2L2E A;  3O2P A;  2ISD A;  4AOM A;  3SG2 A;  1C7V A;  4M2Q A;  2M8U A;  3CWG A;  1Z4H A;  1K94 A;  5DKN A;  5FI6 A;  1MXE A;  2ZKM X;  2PAL A;  4L9M A;  3DF0 A;  1V1G A;  1DGU A;  1DJX A;  2JZI A;  2MHH A;  4CLN A;  1F71 A;  1AJ4 A;  2PMY A;  2QAC A;  2LP2 A;  3DYE A;  1PUL A;  3FIA A;  4PHM A;  4YI8 A;  2K0J A;  4YGB B;  5HYD A;  2JT0 A;  3H4S E;  2F2O A;  2LVI A;  1J1D A;  2K7C A;  3B87 A;  1S5G Y;  2KFG A;  3NSO A;  1IJ5 A;  2LMU A;  5ER5 A;  4GFT A;  2KI4 C;  2JXC A;  2CT9 A;  3CLN A;  4GGF A;  1B4C A;  1TUJ A;  4QJ4 B;  2LVV A;  4I5J A;  1DJZ A;  3NSL A;  3RLZ A;  5AER A;  4C0J A;  3IVT A;  1BG1 A;  1WDC B;  1RK9 A;  4ORB B;  3TS5 B;  1H8B A;  5ER4 X;  4UPG A;  1Y1U A;  1HQV A;  1GGW A;  3PM8 A;  1Y6W A;  3PLF B;  4I5L B;  4GBA A;  2WC6 A;  1JWD A;  1J7Q A;  2K2A A;  1NX1 A;  2BEC A;  4NDB A;  3TDI A;  1NX3 A;  2L5X B;  1B47 A;  1ORG A;  1VRK A;  2BBM A;  2EC6 B;  1DF0 B;  1QLK A;  2BE6 A;  2WCE A;  3S0D A;  3IQQ A;  4USL A;  1W7I B;  4MRY A;  3SS5 A;  1K9U A;  3B7A A;  4I5N B;  3CDN A;  2M0R A;  3OBV A;  1CDP A;  1ALV A;  1Y1A A;  2K7D A;  1K90 D;  1C07 A;  3DD4 A;  4YGD B;  3FE9 A;  1F54 A;  2K7O A;  1M31 A;  1S1E A;  4AQJ A;  1F4O A;  3BUN B;  2BKH B;  4WRI A;  1CKK A;  4PCW A;  5AEQ A;  1WY9 A;  2P6B B;  1G4Y R;  4P5O E;  2L5Y A;  1XFU O;  5FI2 A;  1K2H A;  1LA3 A;  2GGM A;  3CR2 A;  1NCX A;  2M29 A;  5AXI A;  4ETO A;  1A75 A;  3OGN A;  2WCF A;  3CZ1 A;  1FW4 A;  3A4U B;  1AK8 A;  2Y4Q A;  1L2O B;  1SL7 A;  2KI6 D;  3B88 A;  2MBX A;  1DMO A;  1S3P A;  1JBA A;  2PVB A;  3JTD B;  3O78 A;  4MSP A;  2ZN8 A;  4R1E A;  1TNQ A;  2JOJ A;  3ZNI A;  5D7F A;  1B1G A;  1UP5 A;  2BCB A;  2CCM A;  1PRW A;  2L98 A;  2OTG B;  2Y1M A;  1S5G Z;  3R1P A;  1SKT A;  1PVA A;  1B9A A;  4ORA B;  1B7T Z;  2AAO A;  3O4Y A;  3CS1 A;  3I5F C;  1XFY O;  1A03 A;  1BLQ A;  1C7W A;  3BQ3 A;  1V1F A;  1PK0 D;  1U5I B;  2BE4 A;  2ZFD A;  3C1V A;  3S0F A;  1XFX O;  1J7P A;  1ZUZ A;  3BOW A;  1KQV A;  4GPL B;  3HX4 A;  3D74 A;  4ORC B;  2ZRT A;  1AP4 A;  1C3Y A;  3BXK A;  3FE8 A;  4CFQ A;  4YBH B;  5B8I B;  4IJ7 A;  1K95 A;  2LLU A;  3D0Y B;  5JOL A;  1SYM A;  3I5I C;  5CSJ A;  1SY9 A;  1M46 A;  3A8R A;  4PHN A;  1CB1 A;  3UO9 A;  2H61 C;  3CR5 X;  3GOF A;  3CAB A;  1GGZ A;  2WC5 A;  1KSM A;  1Z2C B;  1HT9 A;  3LLE A;  2F8P A;  5CPV A;  5FI7 A;  1OMR A;  1IRJ A;  1FF1 A;  4JWQ A;  1W7J B;  4C0K A;  3FWC A;  2KBI A;  1TNW A;  5HKY A;  3EVV A;  1B8L A;  1NPQ A;  5KU1 A;  5D69 A;  1B8R A;  1XK4 A;  2JT8 A;  2WCM A;  4N1G A;  1L7Z A;  2BBN A;  4OZD A;  1CMG A;  3KF9 A;  3QRX A;  1CM4 A;  2NZ0 A;  3B6X A;  3JVT B;  2KAY A;  2ZNE A;  2KYC A;  3LK0 A;  3WHU B;  1MUX A;  1P28 A;  5PAL A;  1UWO A;  1OE9 B;  3AAK A;  1QX7 A;  4JQ0 D;  2NCP A;  3NHT A;  1SCV A;  3EVU A;  2LHI A;  2AUC A;  1YX8 A;  4NDC A;  1KQM C;  1ZMZ A;  4INX A;  1IIO A;  1N0Y A;  1CFD A;  1UHK A;  1UUR A;  3DZT A;  2JUL A;  1KK7 Y;  2JTZ A;  2LMV A;  1DEL A;  3CZ0 A;  3BUO B;  2H2K A;  1BOD A;  1YVH A;  2Y5I A;  3GK2 A;  3K21 A;  4ZCU A;  3LL8 B;  2LUC A;  2LM5 A;  1KCY A;  3L4A A;  1BF5 A;  3M0W A;  1JSA A;  1QX5 B;  3PN7 C;  4FQO A;  1OOI X;  2PAS A;  2QEB A;  1NYA A;  1ZOT B;  3VRP A;  4A4B A;  4DIR A;  1YX7 A;  3KPX A;  3PSR A;  4AQI A;  4PE4 A;  1TCO B;  1MHO A;  2M1K B;  1R6P A;  1QVI Y;  3BFH A;  1XA5 A;  2HQW A;  1A75 B;  4BY5 A;  1QV1 A;  3CR4 X;  1TCF A;  1BT6 A;  4MEW A;  3LCP C;  2H61 A;  2BCX A;  1QIW A;  1SPY A;  2O60 A;  5DIC A;  2ZRS A;  3GK1 A;  1XVJ A;  4DS7 A;  1MXL C;  2LLT A;  1KFX L;  4ZCV A;  1KWO C;  1ZAC A;  4GNK B;  2LHL A;  1SRA A;  4FQT A;  2KI4 B;  1KK8 C;  5DKQ A;  1TIZ A;  5DKR A;  2K7B A;  2L0P A;  2JWW A;  4INW A;  2WCB A;  4HSZ A;  1TOP A;  4PAL A;  1N65 A;  2G2B A;  3SG6 A;  3EVR A;  3NGV A;  3ICB A;  1TNP A;  2JXL A;  2KFH A;  2WCH A;  1SCM C;  2SCP A;  2V53 A;  2BL0 C;  3I5H C;  3PAL A;  2E6W A;  2NLN A;  1FI5 A;  1XFV O;  1KK7 Z;  3OP0 A;  5AAN A;  1OMV A;  2ERB A;  4XJK A;  2LVJ A;  2LAN A;  2MJW B;  4MZL A;  2QEV A;  1XK4 C;  2F33 A;  1TTX A;  2PSR A;  4JPZ B;  2TN4 A;  2HPS A;  2F2P A;  2KPH A;  4YGA A;  4CID A;  1CDM A;  1TNX A;  1WLZ A;  3IF7 A;  1WLM A;  1TRF A;  3VGO A;  2Q91 A;  4PDZ A;  3NSI A;  4U8D A;  5FYX A;  2HET A;  1NWD A;  2F3Y A;  4DUQ A;  1F8H A;  3KEV A;  1QS7 A;  1QVI Z;  2OPO A;  2PQL A;  1IKU A;  2MLF C;  2MAZ A;  2WOS A;  3SG5 A;  1OOF A;  2KI6 C;  2R2I A;  5KSZ A;  1IQ3 A;  1NIW A;  1TWO A;  1S6J A;  1JF2 A;  1B8C A;  1MF8 B;  4PHK A;  4F0Z B;  2NCO A;  1CM1 A;  1Q80 A;  1DEK A;  2KAX A;  5TNC A;  1TUZ A;  5IBW A;  3D76 A;  1D1O A;  3PFV A;  1DTL A;  1X02 A;  3PM2 A;  2CNP A;  2L4I A;  3N7H A;  1UHJ A;  2BKI B;  2KLD A;  1DVI A;  2KFF A;  1MWN A;  1S6C A;  2KYF A;  4FTG A;  1JFJ A;  1GJY A;  4BY4 A;  1DJH A;  2JPO A;  1EL4 A;  2SAS A;  5GQQ C;  1GM0 A;  1DJG A;  2YGU A;  3I5F B;  1J1E A;  2K2F A;  3EK4 A;  3OX5 A;  2JPT A;  2BNX A;  3VB1 A;  3VRO A;  4WQ3 A;  3VRN A;  1CNP A;  2KQ6 A;  1CFC A;  1YUU A;  2NXQ A;  1T14 A;  1DT7 B;  2KHN A;  3L4L A;  5I8N A;  1YRU B;  1XO5 A;  3WNX B;  1YVL A;  3DF0 B;  1OSA A;  3I5G C;  5G08 A;  3I5I B;  1IWQ A;  3UNW A;  1YUT A;  2OS8 C;  4Q04 A;  2DOQ A;  3IQO A;  3TZ1 A;  2LLS A;  3EG5 B;  2ZND A;  2K8M B;  2LCP A;  1NP8 A;  1IG5 A;  1YUS A;  2KGR A;  3S0A A;  1JUO A;  4D1E A;  1CLB A;  1KFU L;  3TDU A;  4CFR A;  3OHM B;  3WHT B;  2MRD A;  2B1U A;  1BR4 B;  4N5X A;  2M7N A;  1DF0 A;  1OW4 A;  1XYD A;  3DVJ A;  1BU3 A;  2M3W A;  3EKH A;  4WQ2 A;  5HLV A;  4QJ5 B;  1R2U A;  1CDL A;  1G8I A;  2KAV A;  3FE6 A;  3S0G A;  2P70 A;  4MZJ A;  2M7L A;  1IJ6 A;  1NX0 A;  2FOT A;  2KOT A;  3BFA A;  1NCZ A;  1NUB A;  1QX2 A;  3NHI A;  2JTT A;  1A2X A;  3EK7 A;  1EH2 A;  2LV7 A;  1FPW A;  4C0L A;  2JU0 A;  2FCD A;  2QPT A;  1BJF A;  1W9Z A;  1UUS A;  4M2P A;  2JRF A;  3RZS A;  2HQ8 A;  2QEH A;  1LIN A;  4MN0 A;  1KQM B;  4MZK A;  2WCJ A;  1SR6 C;  3QME A;  4OCI A;  1M63 B;  1MQ1 A;  5F6T A;  3SJS A;  4GGN A;  3MSE B;  3SIA A;  4PHJ A;  1XFR A;  2D8N A;  3TUY C;  1EG4 A;  3CYZ A;  4OR9 B;  4PE7 A;  1JF0 A;  3PN7 B;  1DJW A;  1UHI A;  1OZS A;  4TNC A;  1S26 D;  4PE0 A;  4YRU A;  2MLE C;  2GGZ A;  4HRH A;  4JD9 A;  1YRT B;  1BR1 B;  4MLW A;  5I2Q A;  1BMO A;  3VRR A;  1DJY A;  5BPJ A;  1FBV A;  1RRO A;  4GGF C;  3RM1 A;  3V2L A;  2JNX A;  3BUW B;  1C3Z A;  2P71 A;  5I94 A;  2JC2 A;  4I5K A;  3BYA A;  5CSI A;  1OMD A;  5JJG A;  1ODB A;  1EXR A;  5EL2 A;  3OB2 B;  3SG7 A;  4PT1 A;  3CZ2 A;  3D0Y A;  2I18 A;  4A4C A;  2BAP A;  1DGV A;  2JQ6 A;  3BOW B;  2G9B A;  2O5G A;  2WND A;  1KWO B;  2I94 A;  3OB1 B;  1K8U A;  1XFW O;  3SG3 A;  4E68 A;  1OOH A;  3O6B A;  4M2O A;  1KK8 B;  1G33 A;  1KFX S;  1DJI A;  1WDC C;  2I2R E;  2LC5 A;  4IL1 A;  2GTE A;  4MRX A;  3TS5 C;  1F55 A;  1CFF A;  3WXA A;  1K96 A;  1B7T Y;  3D75 A;  3EK8 A;  3CZT X;  1SCM B;  2BL0 B;  1LVC D;  3CTN A;  2FCE A;  3I5H B;  1JC2 A;  1QV0 A;  5KTY A;  2F3Z A;  2L50 A;  3TDZ A;  1AUI B;  2FJU B;  4ICB A;  2Y1N A;  4GAO A;  2EC6 C;  4MBE A;  4DCK A;  3LK1 A;  1IQ5 A;  3DVE A;  1CTR A;  3BUX B;  1NSH A;  1ZFS A;  4PE1 A;  4HRE E;  5I2L A;  1QIV A;  1OQP A;  1BOC A;  2L4H A;  2VRG A;  1YTZ C;  3D10 A;  1SL9 A;  1SMG A;  5D3O A;  3BFB A;  3HCM A;  2GV5 A;  3PAT A;  1OOJ A;  1CFP A;  1WRZ A;  2CBL A;  2K61 A;  2WCK A;  3D78 A;  4CPV A;  1EG3 A;  1NX2 A;  2M97 A;  2CXJ A;  3AAJ A;  2CTN A;  1S36 A;  1LKJ A;  1WRL A;  2BCA A;  1QLS A;  4GUK A;  3S0E A;  1L2O C;  1CLM A;  4N1F A; 
#chains in the Genus database with same CATH homology
 1E8A A;  1PSR A;  2L51 A;  3BUM B;  3JTD C;  1M39 A;  1QXP A;  1J7O A;  1XFZ O;  2Q4U A;  1M45 A;  4P2Y B;  5HKZ A;  2OTG C;  2LNK A;  2WOR A;  1EJ3 A;  3NXA A;  4DRW A;  2HF5 A;  5I2O A;  1K9P A;  1NCY A;  1QTX A;  1F4Q A;  1H4B A;  3DVM A;  1PSB A;  1N2D A;  2I7A A;  3DVK A;  4YGC B;  5HKW A;  2A4J A;  3GK4 X;  3NSK A;  1KSO A;  1AVS A;  2M49 B;  3F45 A;  3I5G B;  5K89 A;  4OV2 A;  2OS8 B;  1GQM A;  5CSF A;  1SK6 D;  1J55 A;  4QJ3 B;  1RJV A;  2EGD A;  4HRG A;  1CDN A;  2LVK A;  3OX6 A;  1PVB A;  2M1U A;  2JNF A;  3EKJ A;  1CLL A;  1RTP 1;  1IGV A;  1AHR A;  1S6I A;  2IS9 A;  3AKA A;  3KHE A;  1SBJ A;  4XYN A;  2LAP A;  1SNL A;  2COL B;  4OKH A;  2M9G A;  1SW8 A;  1J7R A;  1A29 A;  1LA0 A;  1PAL A;  1RWY A;  1KFU S;  1UHN A;  1Y1X A;  1A4P A;  3FWB A;  2PRU A;  3JVT C;  2LUX A;  1MR8 A;  1IH0 A;  1RFJ A;  2KBM A;  2KSP A;  1WRK A;  2LMT A;  4XJK B;  2RGI A;  1TN4 A;  1QAT A;  2KDH A;  4NDD A;  1LXF C;  1OZO A;  2LP3 A;  3SIB A;  2LE9 B;  3E3R A;  1UHH A;  3SG4 A;  2EHB A;  2KNE A;  1K93 D;  1SR6 B;  1REC A;  3KO0 A;  3CGA A;  5AFP A;  4YI9 A;  1ALW A;  1YR5 A;  4MVF A;  1F70 A;  3TUY B;  2E30 A;  2ZN9 A;  4YGE B;  2MA2 A;  1QAS A;  1CMF A;  2KQY A;  4OVN F;  1AJ5 A;  5J3X A;  1FI6 A;  2JT3 A;  1YUR A;  1SL8 A;  1U5I A;  2KGB C;  3FS7 A;  1K9K A;  3VRQ A;  4NQG A;  5HLO A;  3AKB A;  1JFK A;  1QJT A;  3ZWH A;  1Y0V H;  2AMI A;  2WC8 A;  5CSN A;  2L2E A;  3O2P A;  2ISD A;  4AOM A;  3SG2 A;  1C7V A;  4M2Q A;  2M8U A;  3CWG A;  1K94 A;  5DKN A;  1MXE A;  2ZKM X;  2PAL A;  4L9M A;  3DF0 A;  1V1G A;  1DGU A;  1DJX A;  2JZI A;  2MHH A;  4CLN A;  1F71 A;  1AJ4 A;  2PMY A;  2QAC A;  2LP2 A;  3FIA A;  1PUL A;  4PHM A;  4YI8 A;  2K0J A;  4YGB B;  5HYD A;  2JT0 A;  3H4S E;  2F2O A;  2LVI A;  1J1D A;  2K7C A;  1S5G Y;  2KFG A;  3NSO A;  1IJ5 A;  2LMU A;  5ER5 A;  4GFT A;  2KI4 C;  2JXC A;  2CT9 A;  3CLN A;  4GGF A;  1B4C A;  4QJ4 B;  2LVV A;  4I5J A;  1DJZ A;  3NSL A;  3RLZ A;  5AER A;  4C0J A;  1BG1 A;  1H8B A;  1WDC B;  1RK9 A;  4ORB B;  3TS5 B;  5ER4 X;  4UPG A;  1Y1U A;  1HQV A;  1GGW A;  3PM8 A;  1Y6W A;  3PLF B;  4I5L B;  4GBA A;  1JWD A;  1J7Q A;  2K2A A;  1NX1 A;  2BEC A;  4NDB A;  3TDI A;  1NX3 A;  2L5X B;  1B47 A;  1VRK A;  2BBM A;  2EC6 B;  1DF0 B;  1QLK A;  2BE6 A;  2WCE A;  3IQQ A;  4USL A;  1W7I B;  4MRY A;  1K9U A;  4I5N B;  2M0R A;  1CDP A;  1ALV A;  1Y1A A;  2K7D A;  1K90 D;  1C07 A;  3DD4 A;  4YGD B;  1F54 A;  2K7O A;  1M31 A;  1S1E A;  4AQJ A;  1F4O A;  3BUN B;  2BKH B;  4WRI A;  1CKK A;  4PCW A;  5AEQ A;  1WY9 A;  2P6B B;  1G4Y R;  4P5O E;  1XFU O;  1K2H A;  1LA3 A;  2GGM A;  3CR2 A;  1NCX A;  2M29 A;  5AXI A;  4ETO A;  1A75 A;  2WCF A;  1FW4 A;  3A4U B;  1AK8 A;  2Y4Q A;  1L2O B;  1SL7 A;  2KI6 D;  2MBX A;  1DMO A;  1S3P A;  1JBA A;  2PVB A;  3JTD B;  3O78 A;  4MSP A;  2ZN8 A;  4R1E A;  1TNQ A;  2JOJ A;  3ZNI A;  5D7F A;  1B1G A;  1UP5 A;  2BCB A;  2CCM A;  1PRW A;  2L98 A;  2OTG B;  2Y1M A;  1S5G Z;  1SKT A;  1PVA A;  1B9A A;  4ORA B;  1B7T Z;  2AAO A;  3O4Y A;  3CS1 A;  3I5F C;  1XFY O;  1A03 A;  1BLQ A;  1C7W A;  3BQ3 A;  1V1F A;  1PK0 D;  1U5I B;  2BE4 A;  2ZFD A;  3C1V A;  1XFX O;  1J7P A;  1ZUZ A;  3BOW A;  1KQV A;  4GPL B;  3HX4 A;  4ORC B;  1AP4 A;  2ZRT A;  3BXK A;  4CFQ A;  4YBH B;  5B8I B;  1K95 A;  2LLU A;  3D0Y B;  5JOL A;  1SYM A;  3I5I C;  5CSJ A;  1SY9 A;  1M46 A;  3A8R A;  4PHN A;  1CB1 A;  2H61 C;  3CR5 X;  3GOF A;  1GGZ A;  1KSM A;  1HT9 A;  3LLE A;  2F8P A;  5CPV A;  1OMR A;  1IRJ A;  1FF1 A;  4JWQ A;  1W7J B;  4C0K A;  3FWC A;  2KBI A;  1TNW A;  5HKY A;  3EVV A;  1B8L A;  1NPQ A;  5KU1 A;  5D69 A;  1B8R A;  1XK4 A;  2JT8 A;  4N1G A;  1L7Z A;  2BBN A;  1CMG A;  3KF9 A;  3QRX A;  1CM4 A;  2NZ0 A;  3JVT B;  2KAY A;  2ZNE A;  2KYC A;  3LK0 A;  3WHU B;  1MUX A;  5PAL A;  1UWO A;  1OE9 B;  3AAK A;  1QX7 A;  4JQ0 D;  2NCP A;  1SCV A;  3EVU A;  2LHI A;  2AUC A;  1YX8 A;  4NDC A;  1KQM C;  1ZMZ A;  1N0Y A;  1CFD A;  1UHK A;  1UUR A;  2JUL A;  1KK7 Y;  2JTZ A;  2LMV A;  3BUO B;  2H2K A;  1BOD A;  1YVH A;  2Y5I A;  3GK2 A;  3K21 A;  4ZCU A;  3LL8 B;  2LUC A;  2LM5 A;  1KCY A;  1BF5 A;  3M0W A;  1JSA A;  1QX5 B;  3PN7 C;  4FQO A;  2PAS A;  3VRP A;  1NYA A;  1ZOT B;  4A4B A;  4DIR A;  1YX7 A;  3KPX A;  3PSR A;  4AQI A;  4PE4 A;  1TCO B;  1MHO A;  2M1K B;  1R6P A;  1QVI Y;  1XA5 A;  2HQW A;  1A75 B;  4BY5 A;  1QV1 A;  3CR4 X;  1TCF A;  1BT6 A;  4MEW A;  3LCP C;  2H61 A;  2BCX A;  1QIW A;  1SPY A;  2O60 A;  2ZRS A;  3GK1 A;  1XVJ A;  4DS7 A;  1MXL C;  2LLT A;  1KFX L;  4ZCV A;  1KWO C;  1ZAC A;  4GNK B;  2LHL A;  1SRA A;  2KI4 B;  1KK8 C;  5DKQ A;  1TIZ A;  5DKR A;  2K7B A;  2L0P A;  2JWW A;  2WCB A;  4HSZ A;  1TOP A;  4PAL A;  1N65 A;  2G2B A;  3SG6 A;  3EVR A;  3ICB A;  1TNP A;  2JXL A;  2KFH A;  1SCM C;  2SCP A;  2V53 A;  2BL0 C;  3I5H C;  3PAL A;  2E6W A;  2NLN A;  1FI5 A;  1XFV O;  1KK7 Z;  3OP0 A;  5AAN A;  1OMV A;  4XJK A;  2LVJ A;  2LAN A;  2MJW B;  4MZL A;  1XK4 C;  2F33 A;  1TTX A;  2PSR A;  4JPZ B;  2TN4 A;  2HPS A;  2F2P A;  4YGA A;  4CID A;  1CDM A;  1TNX A;  1WLZ A;  3IF7 A;  1WLM A;  1TRF A;  3VGO A;  2Q91 A;  4PDZ A;  3NSI A;  4U8D A;  5FYX A;  2HET A;  1NWD A;  2F3Y A;  4DUQ A;  1F8H A;  3KEV A;  1QS7 A;  1QVI Z;  2OPO A;  1IKU A;  2MLF C;  2MAZ A;  2WOS A;  3SG5 A;  2KI6 C;  2R2I A;  5KSZ A;  1IQ3 A;  1NIW A;  1S6J A;  1JF2 A;  1B8C A;  1MF8 B;  4PHK A;  4F0Z B;  2NCO A;  1CM1 A;  1Q80 A;  2KAX A;  5TNC A;  5IBW A;  1D1O A;  3PFV A;  1DTL A;  1X02 A;  2CNP A;  2L4I A;  1UHJ A;  2BKI B;  1DVI A;  2KFF A;  1MWN A;  1S6C A;  2KYF A;  4FTG A;  1JFJ A;  1GJY A;  4BY4 A;  1DJH A;  1EL4 A;  2SAS A;  5GQQ C;  1DJG A;  3I5F B;  1J1E A;  2K2F A;  3EK4 A;  3OX5 A;  2JPT A;  3VRO A;  4WQ3 A;  3VRN A;  1CNP A;  2KQ6 A;  1CFC A;  1YUU A;  2NXQ A;  1DT7 B;  2KHN A;  5I8N A;  1YRU B;  1XO5 A;  3WNX B;  1YVL A;  3DF0 B;  1OSA A;  3I5G C;  5G08 A;  3I5I B;  1IWQ A;  1YUT A;  2OS8 C;  4Q04 A;  2DOQ A;  3IQO A;  3TZ1 A;  2LLS A;  2ZND A;  2K8M B;  2LCP A;  1NP8 A;  1IG5 A;  1YUS A;  2KGR A;  1JUO A;  4D1E A;  1CLB A;  1KFU L;  3TDU A;  4CFR A;  3OHM B;  3WHT B;  2MRD A;  2B1U A;  1BR4 B;  4N5X A;  2M7N A;  1DF0 A;  3DVJ A;  1XYD A;  4WQ2 A;  1BU3 A;  2M3W A;  3EKH A;  5HLV A;  4QJ5 B;  1R2U A;  1CDL A;  1G8I A;  2KAV A;  4MZJ A;  2M7L A;  1IJ6 A;  1NX0 A;  2FOT A;  2KOT A;  1NCZ A;  1NUB A;  1QX2 A;  2JTT A;  1A2X A;  3EK7 A;  1EH2 A;  2LV7 A;  1FPW A;  4C0L A;  2JU0 A;  2FCD A;  2QPT A;  1BJF A;  1UUS A;  4M2P A;  2JRF A;  2HQ8 A;  1LIN A;  4MN0 A;  1KQM B;  4MZK A;  1SR6 C;  4OCI A;  1M63 B;  1MQ1 A;  5F6T A;  3SJS A;  4GGN A;  3MSE B;  3SIA A;  4PHJ A;  2D8N A;  3TUY C;  1EG4 A;  4OR9 B;  4PE7 A;  1JF0 A;  3PN7 B;  1DJW A;  1UHI A;  1OZS A;  4TNC A;  1S26 D;  4PE0 A;  4YRU A;  2MLE C;  2GGZ A;  4HRH A;  1YRT B;  1BR1 B;  4MLW A;  5I2Q A;  1BMO A;  3VRR A;  1DJY A;  5BPJ A;  1FBV A;  1RRO A;  4GGF C;  3RM1 A;  2JNX A;  3BUW B;  2JC2 A;  4I5K A;  3BYA A;  5CSI A;  1OMD A;  5JJG A;  1ODB A;  1EXR A;  3OB2 B;  3SG7 A;  3D0Y A;  2I18 A;  4A4C A;  2JQ6 A;  1DGV A;  3BOW B;  2G9B A;  2O5G A;  2WND A;  1KWO B;  2I94 A;  3OB1 B;  1K8U A;  1XFW O;  3SG3 A;  4E68 A;  3O6B A;  4M2O A;  1KK8 B;  1G33 A;  1KFX S;  1DJI A;  1WDC C;  2I2R E;  2LC5 A;  4IL1 A;  4MRX A;  3TS5 C;  1F55 A;  1CFF A;  3WXA A;  1K96 A;  1B7T Y;  3EK8 A;  3CZT X;  1SCM B;  2BL0 B;  1LVC D;  3CTN A;  2FCE A;  3I5H B;  1JC2 A;  1QV0 A;  5KTY A;  2F3Z A;  2L50 A;  3TDZ A;  1AUI B;  2FJU B;  4ICB A;  2Y1N A;  4GAO A;  2EC6 C;  4MBE A;  4DCK A;  3LK1 A;  1IQ5 A;  3DVE A;  1CTR A;  3BUX B;  1NSH A;  1ZFS A;  4PE1 A;  4HRE E;  5I2L A;  1QIV A;  1OQP A;  1BOC A;  2L4H A;  2VRG A;  1YTZ C;  3D10 A;  1SL9 A;  1SMG A;  3HCM A;  2GV5 A;  3PAT A;  1OOJ A;  1CFP A;  1WRZ A;  2CBL A;  2K61 A;  4CPV A;  1EG3 A;  1NX2 A;  2M97 A;  2CXJ A;  3AAJ A;  2CTN A;  1S36 A;  1LKJ A;  1WRL A;  2BCA A;  1QLS A;  4GUK A;  1L2O C;  1CLM A;  4N1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...