1K9KA

Crystal structure of calcium bound human s100a6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
89
structure length
89
Chain Sequence
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9kA00
2PALA 1K94A 5J3XA 3BOWA 1J7RA 1XVJA 3SJSA 2KNEA 1L2OB 1J7QA 2KAVA 2V53A 4M2QA 1BMOA 5AEQA 4R1EA 3TS5C 3GK4X 2KDHA 1KFUL 1RJVA 2MRDA 3BXKA 5CSNA 4TNCA 1XK4C 2K7BA 4PHMA 1F4OA 2JRFA 2PMYA 4OR9B 1R2UA 4ZCUA 5K89A 4BY5A 3WHUB 1A75A 4P5OE 4F0ZB 2I94A 5DKRA 3QRXA 4YGCB 1S6CA 1JFJA 1DJYA 4JPZB 2ZNDA 1PALA 2HETA 2LVVA 1YX7A 5GQQC 3TS5B 3DVKA 1SY9A 1K90D 2KFFA 2SASA 3I5FC 2JT3A 1ODBA 1Y6WA 2QPTA 3PN7B 3CR4X 3RLZA 1PVBA 4MSPA 5HKWA 1V1FA 2M0RA 1QX7A 3NSIA 1DMOA 5ER5A 1OOJA 1SKTA 2WC8A 1WY9A 1IWQA 1SCVA 1YTZC 2LLSA 3BOWB 1LXFC 2JWWA 4P2YB 1K93D 3KEVA 2KYFA 2EC6B 3JVTC 3K21A 3VRQA 1DVIA 3AAJA 2GGMA 1CB1A 1K2HA 4AQJA 1M39A 1PK0D 3I5FB 1QXPA 1IKUA 4MEWA 5PALA 2H61A 5HYDA 1S36A 1FBVA 1S6IA 1AVSA 2MAZA 1Q80A 1KK7Z 1KWOC 1PSBA 1S1EA 2TN4A 3WNXB 4E68A 1CFDA 2WCEA 1A75B 2LCPA 4DIRA 4GGNA 1S3PA 1XFWO 1TNPA 3IQOA 3BUWB 3IF7A 1JFKA 1QVIY 2JT8A 2WORA 2O5GA 1NIWA 5I2LA 2CTNA 4ETOA 1SCMC 1NX1A 1R6PA 2E30A 2L98A 4PE0A 4PHJA 1JBAA 1OMRA 1AJ5A 1CDMA 1QS7A 1NYAA 3ICBA 2OPOA 1PRWA 1KWOB 3O6BA 3I5HB 2H61C 1KK8C 2JC2A 2K2AA 3DF0A 3LLEA 2WCFA 1A03A 1NSHA 2KGBC 4CFQA 4NQGA 2KQ6A 3EVRA 4YGDB 1WRKA 1CTRA 1MR8A 5G08A 2KYCA 2LUXA 2JTZA 1B7TZ 1SCMB 2LLUA 4AOMA 1CKKA 2KAXA 4YI9A 2ZN8A 4PCWA 1S5GY 2CCMA 2K2FA 2LP3A 1TN4A 4NDDA 1XO5A 2LVJA 3VGOA 2F2OA 3JTDC 1GGWA 1KK8B 1QV1A 1J1EA 1XA5A 4USLA 1Y1UA 4FQOA 1K96A 3EKJA 2BCBA 2SCPA 4C0LA 1TNQA 1Y1XA 2Y1NA 1TNXA 1WDCC 3D10A 2KFHA 1DGVA 1QASA 2KSPA 3BUOB 3FWBA 1W7JB 2BBMA 1RTP1 3TDUA 1TOPA 4ORBB 2BCAA 5HKZA 3AAKA 3MSEB 2KGRA 2LLTA 1MHOA 3JTDB 1KSOA 3SG3A 4JQ0D 1CFPA 4N5XA 4IL1A 2JQ6A 1UHHA 3C1VA 1WDCB 2JXLA 3DF0B 1OZOA 3FS7A 1J7OA 1JUOA 3WHTB 1KQMC 1QLSA 3KF9A 4ICBA 1H8BA 3PATA 5JOLA 3LCPC 3CZTX 4CPVA 3RM1A 3NSKA 4ZCVA 5D69A 1MXLC 3IQQA 2BE6A 2FOTA 1G8IA 1QIVA 1BT6A 2JPTA 3KHEA 1SRAA 4MBEA 4GBAA 2MLFC 3EK8A 2AUCA 1LVCD 1IJ5A 1WLMA 3AKBA 4A4BA 2G9BA 2HQ8A 5FYXA 1KQMB 1OMDA 3PN7C 1YURA 4YRUA 3OX5A 2RGIA 1K8UA 4QJ4B 2LHLA 3TDZA 3PLFB 4FTGA 1XFVO 2JULA 3I5IC 1B8RA 4AQIA 2PSRA 3SG6A 4DUQA 1TRFA 1YX8A 1RROA 1CLLA 1WRZA 1XYDA 2EC6C 2LP2A 2K7OA 2M29A 5CPVA 3VRNA 1NPQA 1C7VA 1M63B 2AAOA 1QATA 1SPYA 2IS9A 1F70A 2LUCA 2OTGC 4ORCB 1ALVA 5CSJA 1QJTA 5KU1A 1YUTA 1TNWA 2JT0A 2BL0B 2AMIA 4I5NB 3GK2A 3NSLA 4GNKB 4PHKA 1OMVA 1OSAA 1CLMA 2L4HA 4OKHA 4C0JA 2LNKA 3I5IB 1SNLA 4ORAB 2ZKMX 1V1GA 4HRGA 3GK1A 2OS8C 1AUIB 2JZIA 2ISDA 1JC2A 2EGDA 1BOCA 1BU3A 1EG4A 2OTGB 1AJ4A 3EVUA 2KI6C 3O78A 2LVKA 2LV7A 1X02A 2KHNA 1OQPA 2LE9B 2CBLA 1DJZA 1IG5A 2R2IA 3LK1A 4N1GA 2BKHB 1XFYO 4NDBA 5I8NA 4GGFA 3I5HC 1AK8A 4YGAA 1DJHA 4MZKA 2MLEC 3E3RA 1SW8A 2LMUA 3BQ3A 1IQ3A 1BR4B 5KTYA 1LA3A 2OS8B 2GV5A 1LKJA 4MZLA 1SR6C 2GGZA 1CDNA 4XJKA 1DGUA 1QX2A 4PALA 2M1KB 1B47A 1YRUB 5BPJA 4M2PA 1NX0A 2JNXA 2F33A 1SMGA 1NX3A 3OP0A 1A4PA 5ER4X 2M49B 1NUBA 3D0YA 3M0WA 2L2EA 1IJ6A 3OHMB 1MWNA 1UHKA 5AANA 2K8MB 2NCPA 1JF2A 3FIAA 1KFXS 1FI6A 1LINA 1QV0A 1YVHA 1IGVA 3KPXA 4YGBB 4GGFC 1A2XA 4UPGA 2MJWB 1GQMA 2ZNEA 1ALWA 1SR6B 2NCOA 2COLB 2Y4QA 3EK4A 2JOJA 1SL8A 4PHNA 1DJWA 1NCYA 3TDIA 3CS1A 2LANA 1QVIZ 1YVLA 2PVBA 1NWDA 1F71A 3CWGA 1NP8A 4WQ3A 2K61A 4A4CA 3HX4A 2PRUA 2CT9A 2JTTA 3I5GC 1F55A 3EVVA 1F4QA 3TZ1A 1SBJA 1D1OA 2KOTA 5D7FA 1EXRA 2I7AA 1TTXA 1Y1AA 3CR5X 3GOFA 4XJKB 1YUSA 2LMVA 1OZSA 4GFTA 4MN0A 4OCIA 4C0KA 1K9UA 2LMTA 3CLNA 3PM8A 2LAPA 1UHJA 2BKIB 4L9MA 4N1FA 2G2BA 1CFCA 1BODA 3DD4A 1ZUZA 3D0YB 1N65A 2HPSA 2M97A 1TCOB 2Y1MA 3I5GB 1IRJA 5DKNA 1DJIA 1EG3A 4PE1A 1M31A 3CR2A 3DVEA 1IH0A 1C7WA 1CDLA 3BUNB 2F2PA 4CLNA 1QX5B 1CDPA 1DJXA 2WCBA 3EK7A 5TNCA 2EHBA 1EH2A 1QLKA 1UURA 1NCXA 5AFPA 1JWDA 2M7NA 4HSZA 2I18A 2KI4C 2L50A 1YUUA 4GAOA 4CIDA 1CMGA 4M2OA 3NSOA 2FCDA 4MRYA 1B8LA 4XYNA 2E6WA 1ZACA 1OE9B 1UHNA 2NLNA 1FW4A 1S6JA 2DOQA 1LA0A 2FCEA 1CMFA 2M3WA 1M46A 4MZJA 1K95A 1K9PA 1BG1A 1KFUS 2Y5IA 1QIWA 1FF1A 1DTLA 1PSRA 1M45A 2BL0C 2F3YA 1NCZA 1U5IB 2KQYA 2L5XB 3AKAA 3SG7A 1ZOTB 1G33A 1DF0A 2KI4B 4DS7A 4I5LB 1DJGA 1RK9A 2Q4UA 2L0PA 3PSRA 4U8DA 1A29A 4YGEB 2BCXA 5CSIA 3DVJA 1F54A 2D8NA 1SK6D 4HRHA 2K0JA 1WLZA 1E8AA 1MQ1A 1CM1A 2JXCA 2WOSA 2M9GA 1CLBA 1UP5A 5AERA 5KSZA 1VRKA 4MVFA 4Q04A 2M8UA 4OVNF 1EJ3A 2JU0A 5CSFA 2F3ZA 2ZN9A 2BBNA 3PALA 1UUSA 1J1DA 4PE7A 1BR1B 2KBMA 4QJ5B 1JSAA 4YI8A 2ZFDA 1QTXA 5I2OA 5HLOA 2LC5A 1UHIA 1DT7B 1WRLA 1C07A 1KK7Y 1ZFSA 2HF5A 4HREE 4I5KA 1ZMZA 2LHIA 1RFJA 3O2PA 3SG5A 3ZWHA 3HCMA 5HLVA 1L7ZA 3DVMA 1RECA 1CM4A 5AXIA 2LM5A 1B1GA 1NX2A 1DF0B 2ZRSA 1B4CA 3SIAA 2KFGA 4WRIA 4CFRA 1FPWA 2PASA 4WQ2A 3CTNA 3VRRA 3BYAA 5JJGA 4QJ3B 2L4IA 1PVAA 2LVIA 1N0YA 1CNPA 4GPLB 2MA2A 1B7TY 3ZNIA 3BUXB 1PULA 1TCFA 2HQWA 3SG2A 1F8HA 2F8PA 3LK0A 3JVTB 3EKHA 2P6BB 1TIZA 2M1UA 5IBWA 2WNDA 2H2KA 2QACA 4PDZA 1AP4A 1S26D 1YR5A 2MBXA 1RWYA 5B8IB 3VROA 3OX6A 1KFXL 3CGAA 4MRXA 3LL8B 1FI5A 1GJYA 2KAYA 1K9KA 1J55A 3F45A 2CNPA 3PFVA 3TUYC 2O60A 5HKYA 1JF0A 2NXQA 2A4JA 1KCYA 2KBIA 4DRWA 1SL7A 1Y0VH 2K7CA 1BJFA 3SG4A 1SL9A 3SIBA 1U5IA 2MHHA 3FWCA 1BLQA 4D1EA 2K7DA 3O4YA 4JWQA 1B8CA 3NXAA 5DKQA 1B9AA 1UWOA 3OB2B 3OB1B 3WXAA 3A4UB 4OV2A 4I5JA 2I2RE 5I2QA 1S5GZ 3TUYB 1XFZO 1H4BA 2FJUB 1G4YR 4GUKA 1GGZA 1MUXA 2BE4A 2VRGA 4BY4A 1XFUO 2B1UA 2L51A 1HT9A 1CFFA 1YRTB 2ZRTA 3BUMB 1MXEA 5F6TA 2NZ0A 4NDCA 1SYMA 1N2DA 1KSMA 1BF5A 4YBHB 1IQ5A 2JNFA 4PE4A 3H4SE 2CXJA 1L2OC 2M7LA 4DCKA 1AHRA 2Q91A 3VRPA 1XFXO 1XK4A 2BECA 1MF8B 3KO0A 1KQVA 3A8RA 2KI6D 1EL4A 1W7IB 1HQVA 1J7PA 4MLWA
chains in the Genus database with same CATH superfamily
2PALA 1K94A 5J3XA 3BOWA 3S0EA 1J7RA 1XVJA 3SJSA 3OBVA 2KNEA 1L2OB 4JD9A 1J7QA 2KAVA 2V53A 4M2QA 1BMOA 2P70A 5AEQA 4R1EA 3TS5C 3GK4X 2KDHA 1KFUL 1RJVA 2MRDA 2QEHA 4INWA 3BXKA 5CSNA 3RZSA 4TNCA 4JKTA 1XK4C 2K7BA 4KYNA 2QEBA 3QMEA 4PHMA 1F4OA 3S0GA 2JRFA 2PMYA 4OR9B 1R2UA 1C3YA 4ZCUA 5K89A 4BY5A 3WHUB 1A75A 4P5OE 4F0ZB 2I94A 3R72A 5DKRA 3CZ0A 3QRXA 4YGCB 1S6CA 3NHTA 1JFJA 3S0BA 1DJYA 4JPZB 2ZNDA 4C0LA 1PALA 2HETA 2LVVA 1YX7A 3EG5B 5DICA 5GQQC 3TS5B 3DVKA 1SY9A 1K90D 2KFFA 2SASA 3I5FC 2JT3A 1ODBA 1Y6WA 2QPTA 3PN7B 3CR4X 3RLZA 1PVBA 4MSPA 5HKWA 1V1FA 2M0RA 3L47A 1DELA 2KLDA 1QX7A 3NSIA 1DMOA 5ER5A 1OOJA 1SKTA 3SS3A 2WC8A 1WY9A 1IWQA 1SCVA 1YTZC 2LLSA 3BOWB 3FE8A 1LXFC 2JWWA 1OOFA 1K93D 4P2YB 3KEVA 4PT1A 2KYFA 2EC6B 3JVTC 3K21A 3VRQA 1DVIA 3AAJA 2GGMA 1CB1A 1K2HA 4AQJA 1M39A 1PK0D 3I5FB 1QXPA 3L4AA 4FQTA 4MEWA 1IKUA 5PALA 2H61A 5HYDA 1S36A 1FBVA 1S6IA 1AVSA 2WCLA 2MAZA 1Q80A 1KK7Z 1KWOC 1PSBA 1S1EA 2TN4A 3S0DA 3WNXB 4E68A 1CFDA 3CDNA 2WCEA 4OZDA 1A75B 2LCPA 4DIRA 4GGNA 1S3PA 1XFWO 1TNPA 3IQOA 3BUWB 3IF7A 3R1OA 1DC1A 5D3OA 1JFKA 1QVIY 2JT8A 2WORA 2O5GA 1NIWA 4F7FA 5I2LA 2CTNA 4ETOA 1SCMC 1NX1A 1R6PA 2E30A 2L98A 1P28A 4PE0A 1XFRA 4PHJA 1JBAA 1OMRA 5I94A 3B7AA 3B88A 1AJ5A 1CDMA 1QS7A 1NYAA 3ICBA 2OPOA 2WCKA 1PRWA 1KWOB 3O6BA 3I5HB 2H61C 1KK8C 2JC2A 3D74A 2K2AA 3DF0A 3LLEA 2WCFA 1A03A 1NSHA 2WC5A 2KGBC 3FE6A 4CFQA 4NQGA 2KQ6A 3EVRA 4YGDB 1WRKA 1CTRA 1MR8A 5G08A 2KYCA 2LUXA 2JTZA 1B7TZ 1SCMB 2LLUA 4AOMA 1CKKA 2KAXA 4YI9A 2ZN8A 4PCWA 1S5GY 2CCMA 2K2FA 3IVTA 2LP3A 1TN4A 4NDDA 1XO5A 2LVJA 3VGOA 2F2OA 3JTDC 1GGWA 1KK8B 1QV1A 1J1EA 1XA5A 4USLA 1Y1UA 4FQOA 1K96A 3EKJA 2BCBA 2SCPA 3D73A 3PM2A 1TNQA 1Y1XA 3CZ1A 2Y1NA 1TNXA 1WDCC 3D10A 2KFHA 3NHIA 3DY9A 1DGVA 1LS8A 1QASA 5FI2A 2KSPA 3BUOB 3FWBA 1W7JB 2BBMA 1RTP1 3TDUA 3S0AA 1TOPA 3V2LA 4ORBB 2BCAA 2PYQA 2L5YA 3AAKA 3MSEB 2KGRA 5HKZA 1TUZA 1MHOA 2LLTA 3JTDB 1DEKA 1KSOA 3SG3A 4JQ0D 1CFPA 4N5XA 4IL1A 3R1PA 2JQ6A 1UHHA 2BNXA 1WDCB 2JXLA 3C1VA 3DF0B 3S0FA 1OZOA 3FS7A 1J7OA 1JUOA 3WHTB 1KQMC 1QLSA 1SSEB 3KF9A 4ICBA 1H8BA 3PATA 5JOLA 3LCPC 3CZTX 4CPVA 3RM1A 3NSKA 4ZCVA 5D69A 2QDIA 1MXLC 3IQQA 1W9ZA 2BE6A 2FOTA 1G8IA 1QIVA 1BT6A 2JPTA 3KHEA 1SRAA 4MBEA 4GBAA 2MLFC 3EK8A 2AUCA 1LVCD 1IJ5A 1WLMA 3AKBA 3CZ2A 4A4BA 2G9BA 2HQ8A 5FYXA 1KQMB 3UO9A 1OMDA 3PN7C 1YURA 4YRUA 3OX5A 2RGIA 1K8UA 3DXLA 4QJ4B 2LHLA 3TDZA 3PLFB 4FTGA 1XFVO 2JULA 3I5IC 3OGNA 1B8RA 1ORGA 4AQIA 2PSRA 3SG6A 4DUQA 1TRFA 1YX8A 1RROA 1CLLA 1WRZA 1XYDA 2EC6C 2LP2A 2K7OA 2M29A 5CPVA 3VRNA 1NPQA 1C7VA 1M63B 2AAOA 1QATA 1SPYA 2IS9A 2JPOA 1F70A 2LUCA 2OTGC 2P71A 4ORCB 1ALVA 5CSJA 1QJTA 5KU1A 2YGUA 1YUTA 1TNWA 2JT0A 2BL0B 2AMIA 4I5NB 3GK2A 3NSLA 4GNKB 4PHKA 1OMVA 1OSAA 1CLMA 2L4HA 4OKHA 4C0JA 2LNKA 3I5IB 1SNLA 4ORAB 3SS4A 1OOIX 2ZKMX 1V1GA 4HRGA 3GK1A 2OS8C 3PJIA 1AUIB 2JZIA 3B86A 2ISDA 1JC2A 2EGDA 1BOCA 1BU3A 1EG4A 2OTGB 1AJ4A 3EVUA 2KI6C 3O78A 2LVKA 2LV7A 3BFHA 1X02A 2KHNA 1OQPA 2LE9B 3B87A 2CBLA 1DJZA 1IG5A 2R2IA 3LK1A 4N1GA 2BKHB 1XFYO 4NDBA 3VB1A 4GGFA 3I5HC 1AK8A 4YGAA 1DJHA 4MZKA 2MLEC 3E3RA 2BAPA 1SW8A 2LMUA 3BQ3A 1IQ3A 1BR4B 5KTYA 1LA3A 2OS8B 2GV5A 1LKJA 4MZLA 1SR6C 2GGZA 1CDNA 4XJKA 1DGUA 1QX2A 4PALA 2M1KB 1B47A 1YRUB 5BPJA 4M2PA 1NX0A 2GTEA 2JNXA 2F33A 2WCHA 1SMGA 1NX3A 3OP0A 1A4PA 5ER4X 2M49B 1NUBA 3D0YA 3M0WA 2L2EA 1IJ6A 3OHMB 1MWNA 1UHKA 5AANA 2K8MB 2NCPA 1JF2A 3FIAA 1KFXS 3BJHA 1FI6A 1LINA 1QV0A 1YVHA 2K60A 1IGVA 3KPXA 1QWVA 4GGFC 1A2XA 4YGBB 4UPGA 2MJWB 1GQMA 1T14A 2ZNEA 1ALWA 1SR6B 2NCOA 3DYEA 2COLB 2Y4QA 3EK4A 2JOJA 1SL8A 4PHNA 1DJWA 1NCYA 3TDIA 3CS1A 2LANA 1QVIZ 1YVLA 2PVBA 3L4LA 1NWDA 1F71A 3CWGA 1NP8A 4WQ3A 2K61A 4A4CA 3HX4A 5HL1A 2PRUA 1GM0A 2WCMA 2CT9A 2JTTA 1TWOA 3I5GC 1F55A 3EVVA 1F4QA 3TZ1A 1SBJA 1D1OA 2KOTA 5D7FA 5EL2A 1EXRA 2I7AA 1TTXA 1Y1AA 2ERBA 3CR5X 3GOFA 1YUSA 4XJKB 2LMVA 1DQEA 1OZSA 4GFTA 4MN0A 4OCIA 2FJYA 2KLEA 4C0KA 1K9UA 2LMTA 3CLNA 3PM8A 2LAPA 1UHJA 2BKIB 4L9MA 4N1FA 2G2BA 1CFCA 1BODA 3DD4A 1ZUZA 2KPHA 1N65A 2HPSA 2M97A 1TCOB 2Y1MA 3D0YB 1IRJA 3I5GB 5DKNA 1DJIA 1EG3A 4PE1A 1M31A 3CR2A 3DVEA 3D76A 1C7WA 3SS5A 1CDLA 1IH0A 1TUJA 3D75A 3B6XA 3BFAA 3BUNB 2F2PA 2WCJA 3FE9A 4CLNA 1QX5B 1CDPA 1DJXA 2WCBA 3EK7A 5TNCA 2EHBA 1EH2A 1QLKA 1UURA 1NCXA 5AFPA 1JWDA 2M7NA 4HSZA 2I18A 2KI4C 3R1VA 2L50A 1YUUA 4GAOA 4CIDA 1CMGA 4M2OA 1OOHA 3NSOA 2FCDA 4MRYA 1B8LA 4XYNA 2E6WA 1ZACA 1OE9B 1UHNA 2NLNA 1FW4A 1S6JA 2DOQA 1LA0A 2FCEA 1CMFA 2M3WA 1M46A 4MZJA 5FI6A 1K95A 1K9PA 1BG1A 1KFUS 2Y5IA 1QIWA 2QEOA 1FF1A 1DTLA 1PSRA 1M45A 2BL0C 2F3YA 1NCZA 1U5IB 2KQYA 2L5XB 3AKAA 3BFBA 3SG7A 1ZOTB 1G33A 1DF0A 1Z2CB 3NGVA 2KI4B 4DS7A 3O4XA 4I5LB 1DJGA 1RK9A 2QEVA 2Q4UA 2L0PA 3PSRA 4U8DA 1A29A 4YGEB 2BCXA 5CSIA 3DVJA 1F54A 2D8NA 1SK6D 4HRHA 2K0JA 3D78A 1WLZA 1E8AA 1MQ1A 1CM1A 2JXCA 2WOSA 2M9GA 1CLBA 1UP5A 5AERA 5KSZA 1VRKA 3CYZA 4MVFA 4Q04A 2M8UA 4OVNF 1EJ3A 2H8VA 2JU0A 5CSFA 2F3ZA 2ZN9A 2BBNA 3D77A 3PALA 1UUSA 1J1DA 4PE7A 3Q8IA 1BR1B 2KBMA 4QJ5B 1JSAA 4YI8A 2ZFDA 1QTXA 5I2OA 5HLOA 3DZTA 2LC5A 4INXA 1UHIA 1DT7B 1WRLA 1C07A 1KK7Y 1ZFSA 2HF5A 4HREE 4I5KA 1ZMZA 2LHIA 1RFJA 3O2PA 3SG5A 3ZWHA 3HCMA 5HLVA 1L7ZA 3DVMA 1IIOA 1RECA 1CM4A 5AXIA 2LM5A 1B1GA 1NX2A 1DF0B 2ZRSA 1B4CA 3SIAA 3CABA 2KFGA 4WRIA 4CFRA 1OW4A 1FPWA 2PASA 4WQ2A 3CTNA 3VRRA 3BYAA 5JJGA 4QJ3B 2L4IA 1PVAA 2LVIA 1N0YA 1CNPA 3UNWA 4GPLB 2MA2A 1B7TY 1OOGA 2L2CA 3ZNIA 3BUXB 1PULA 1TCFA 2HQWA 3SG2A 1F8HA 2F8PA 3LK0A 3JVTB 3EKHA 2P6BB 1TIZA 2M1UA 5IBWA 2WNDA 2H2KA 2QACA 4PDZA 1AP4A 1S26D 1YR5A 2MBXA 1RWYA 5B8IB 3VROA 3OX6A 1KFXL 3CGAA 4MRXA 3LL8B 1FI5A 1GJYA 2KAYA 1K9KA 1J55A 3F45A 2CNPA 3N7HA 3PFVA 3TUYC 2O60A 5HKYA 1JF0A 2NXQA 2A4JA 1KCYA 2KBIA 4DRWA 1SL7A 1Y0VH 2K7CA 1BJFA 3SG4A 1SL9A 3SIBA 1U5IA 5I8NA 2MHHA 3FWCA 1BLQA 4D1EA 2K7DA 3O4YA 4JWQA 1B8CA 3NXAA 5DKQA 1B9AA 1UWOA 1Z4HA 3OB2B 3OB1B 3WXAA 3A4UB 4OV2A 4I5JA 2I2RE 5I2QA 1S5GZ 3TUYB 1XFZO 1H4BA 1C3ZA 2FJUB 1G4YR 4GUKA 1GGZA 1MUXA 2BE4A 2VRGA 4BY4A 1XFUO 2B1UA 2L51A 1HT9A 1CFFA 1YRTB 2ZRTA 2WC6A 3BUMB 1MXEA 5F6TA 2NZ0A 3K1EA 4NDCA 1SYMA 1N2DA 1KSMA 1BF5A 4YBHB 1IQ5A 2JNFA 4PE4A 3H4SE 2CXJA 1L2OC 2M7LA 4DCKA 1AHRA 2Q91A 3VRPA 1XFXO 1XK4A 2BECA 1MF8B 3KO0A 5FI7A 1KQVA 2PQLA 3A8RA 2KI6D 1EL4A 4IJ7A 1W7IB 1HQVA 1J7PA 4MLWA
chains in the Genus database with same CATH topology
2PALA 1K94A 5J3XA 3BOWA 1J7RA 1XVJA 3SJSA 2KNEA 1L2OB 1J7QA 2KAVA 2V53A 4M2QA 1BMOA 5AEQA 4R1EA 3TS5C 3GK4X 2KDHA 1KFUL 1RJVA 2MRDA 3BXKA 5CSNA 4TNCA 1XK4C 2K7BA 4PHMA 1F4OA 2JRFA 2PMYA 4OR9B 1R2UA 4ZCUA 5K89A 4BY5A 3WHUB 1A75A 4P5OE 4F0ZB 2I94A 5DKRA 3QRXA 4YGCB 1S6CA 1JFJA 1DJYA 4JPZB 2ZNDA 1PALA 2HETA 2LVVA 1YX7A 5GQQC 3TS5B 3DVKA 1SY9A 1K90D 2KFFA 2SASA 3I5FC 2JT3A 1ODBA 1Y6WA 2QPTA 3PN7B 3CR4X 3RLZA 1PVBA 4MSPA 5HKWA 1V1FA 2M0RA 1QX7A 3NSIA 1DMOA 5ER5A 1OOJA 1SKTA 2WC8A 1WY9A 1IWQA 1SCVA 1YTZC 2LLSA 3BOWB 1LXFC 2JWWA 4P2YB 1K93D 3KEVA 2KYFA 2EC6B 3JVTC 3K21A 3VRQA 1DVIA 3AAJA 2GGMA 1CB1A 1K2HA 4AQJA 1M39A 1PK0D 3I5FB 1QXPA 1IKUA 4MEWA 5PALA 2H61A 5HYDA 1S36A 1FBVA 1S6IA 1AVSA 2MAZA 1Q80A 1KK7Z 1KWOC 1PSBA 1S1EA 2TN4A 3WNXB 4E68A 1CFDA 2WCEA 1A75B 2LCPA 4DIRA 4GGNA 1S3PA 1XFWO 1TNPA 3IQOA 3BUWB 3IF7A 1JFKA 1QVIY 2JT8A 2WORA 2O5GA 1NIWA 5I2LA 2CTNA 4ETOA 1SCMC 1NX1A 1R6PA 2E30A 2L98A 4PE0A 4PHJA 1JBAA 1OMRA 1AJ5A 1CDMA 1QS7A 1NYAA 3ICBA 2OPOA 1PRWA 1KWOB 3O6BA 3I5HB 2H61C 1KK8C 2JC2A 2K2AA 3DF0A 3LLEA 2WCFA 1A03A 1NSHA 2KGBC 4CFQA 4NQGA 2KQ6A 3EVRA 4YGDB 1WRKA 1CTRA 1MR8A 5G08A 2KYCA 2LUXA 2JTZA 1B7TZ 1SCMB 2LLUA 4AOMA 1CKKA 2KAXA 4YI9A 2ZN8A 4PCWA 1S5GY 2CCMA 2K2FA 2LP3A 1TN4A 4NDDA 1XO5A 2LVJA 3VGOA 2F2OA 3JTDC 1GGWA 1KK8B 1QV1A 1J1EA 1XA5A 4USLA 1Y1UA 4FQOA 1K96A 3EKJA 2BCBA 2SCPA 4C0LA 1TNQA 1Y1XA 2Y1NA 1TNXA 1WDCC 3D10A 2KFHA 1DGVA 1QASA 2KSPA 3BUOB 3FWBA 1W7JB 2BBMA 1RTP1 3TDUA 1TOPA 4ORBB 2BCAA 5HKZA 3AAKA 3MSEB 2KGRA 2LLTA 1MHOA 3JTDB 1KSOA 3SG3A 4JQ0D 1CFPA 4N5XA 4IL1A 2JQ6A 1UHHA 3C1VA 1WDCB 2JXLA 3DF0B 1OZOA 3FS7A 1J7OA 1JUOA 3WHTB 1KQMC 1QLSA 3KF9A 4ICBA 1H8BA 3PATA 5JOLA 3LCPC 3CZTX 4CPVA 3RM1A 3NSKA 4ZCVA 5D69A 1MXLC 3IQQA 2BE6A 2FOTA 1G8IA 1QIVA 1BT6A 2JPTA 3KHEA 1SRAA 4MBEA 4GBAA 2MLFC 3EK8A 2AUCA 1LVCD 1IJ5A 1WLMA 3AKBA 4A4BA 2G9BA 2HQ8A 5FYXA 1KQMB 1OMDA 3PN7C 1YURA 4YRUA 3OX5A 2RGIA 1K8UA 4QJ4B 2LHLA 3TDZA 3PLFB 4FTGA 1XFVO 2JULA 3I5IC 1B8RA 4AQIA 2PSRA 3SG6A 4DUQA 1TRFA 1YX8A 1RROA 1CLLA 1WRZA 1XYDA 2EC6C 2LP2A 2K7OA 2M29A 5CPVA 3VRNA 1NPQA 1C7VA 1M63B 2AAOA 1QATA 1SPYA 2IS9A 1F70A 2LUCA 2OTGC 4ORCB 1ALVA 5CSJA 1QJTA 5KU1A 1YUTA 1TNWA 2JT0A 2BL0B 2AMIA 4I5NB 3GK2A 3NSLA 4GNKB 4PHKA 1OMVA 1OSAA 1CLMA 2L4HA 4OKHA 4C0JA 2LNKA 3I5IB 1SNLA 4ORAB 2ZKMX 1V1GA 4HRGA 3GK1A 2OS8C 1AUIB 2JZIA 2ISDA 1JC2A 2EGDA 1BOCA 1BU3A 1EG4A 2OTGB 1AJ4A 3EVUA 2KI6C 3O78A 2LVKA 2LV7A 1X02A 2KHNA 1OQPA 2LE9B 2CBLA 1DJZA 1IG5A 2R2IA 3LK1A 4N1GA 2BKHB 1XFYO 4NDBA 5I8NA 4GGFA 3I5HC 1AK8A 4YGAA 1DJHA 4MZKA 2MLEC 3E3RA 1SW8A 2LMUA 3BQ3A 1IQ3A 1BR4B 5KTYA 1LA3A 2OS8B 2GV5A 1LKJA 4MZLA 1SR6C 2GGZA 1CDNA 4XJKA 1DGUA 1QX2A 4PALA 2M1KB 1B47A 1YRUB 5BPJA 4M2PA 1NX0A 2JNXA 2F33A 1SMGA 1NX3A 3OP0A 1A4PA 5ER4X 2M49B 1NUBA 3D0YA 3M0WA 2L2EA 1IJ6A 3OHMB 1MWNA 1UHKA 5AANA 2K8MB 2NCPA 1JF2A 3FIAA 1KFXS 1FI6A 1LINA 1QV0A 1YVHA 1IGVA 3KPXA 4YGBB 4GGFC 1A2XA 4UPGA 2MJWB 1GQMA 2ZNEA 1ALWA 1SR6B 2NCOA 2COLB 2Y4QA 3EK4A 2JOJA 1SL8A 4PHNA 1DJWA 1NCYA 3TDIA 3CS1A 2LANA 1QVIZ 1YVLA 2PVBA 1NWDA 1F71A 3CWGA 1NP8A 4WQ3A 2K61A 4A4CA 3HX4A 2PRUA 2CT9A 2JTTA 3I5GC 1F55A 3EVVA 1F4QA 3TZ1A 1SBJA 1D1OA 2KOTA 5D7FA 1EXRA 2I7AA 1TTXA 1Y1AA 3CR5X 3GOFA 4XJKB 1YUSA 2LMVA 1OZSA 4GFTA 4MN0A 4OCIA 4C0KA 1K9UA 2LMTA 3CLNA 3PM8A 2LAPA 1UHJA 2BKIB 4L9MA 4N1FA 2G2BA 1CFCA 1BODA 3DD4A 1ZUZA 3D0YB 1N65A 2HPSA 2M97A 1TCOB 2Y1MA 3I5GB 1IRJA 5DKNA 1DJIA 1EG3A 4PE1A 1M31A 3CR2A 3DVEA 1IH0A 1C7WA 1CDLA 3BUNB 2F2PA 4CLNA 1QX5B 1CDPA 1DJXA 2WCBA 3EK7A 5TNCA 2EHBA 1EH2A 1QLKA 1UURA 1NCXA 5AFPA 1JWDA 2M7NA 4HSZA 2I18A 2KI4C 2L50A 1YUUA 4GAOA 4CIDA 1CMGA 4M2OA 3NSOA 2FCDA 4MRYA 1B8LA 4XYNA 2E6WA 1ZACA 1OE9B 1UHNA 2NLNA 1FW4A 1S6JA 2DOQA 1LA0A 2FCEA 1CMFA 2M3WA 1M46A 4MZJA 1K95A 1K9PA 1BG1A 1KFUS 2Y5IA 1QIWA 1FF1A 1DTLA 1PSRA 1M45A 2BL0C 2F3YA 1NCZA 1U5IB 2KQYA 2L5XB 3AKAA 3SG7A 1ZOTB 1G33A 1DF0A 2KI4B 4DS7A 4I5LB 1DJGA 1RK9A 2Q4UA 2L0PA 3PSRA 4U8DA 1A29A 4YGEB 2BCXA 5CSIA 3DVJA 1F54A 2D8NA 1SK6D 4HRHA 2K0JA 1WLZA 1E8AA 1MQ1A 1CM1A 2JXCA 2WOSA 2M9GA 1CLBA 1UP5A 5AERA 5KSZA 1VRKA 4MVFA 4Q04A 2M8UA 4OVNF 1EJ3A 2JU0A 5CSFA 2F3ZA 2ZN9A 2BBNA 3PALA 1UUSA 1J1DA 4PE7A 1BR1B 2KBMA 4QJ5B 1JSAA 4YI8A 2ZFDA 1QTXA 5I2OA 5HLOA 2LC5A 1UHIA 1DT7B 1WRLA 1C07A 1KK7Y 1ZFSA 2HF5A 4HREE 4I5KA 1ZMZA 2LHIA 1RFJA 3O2PA 3SG5A 3ZWHA 3HCMA 5HLVA 1L7ZA 3DVMA 1RECA 1CM4A 5AXIA 2LM5A 1B1GA 1NX2A 1DF0B 2ZRSA 1B4CA 3SIAA 2KFGA 4WRIA 4CFRA 1FPWA 2PASA 4WQ2A 3CTNA 3VRRA 3BYAA 5JJGA 4QJ3B 2L4IA 1PVAA 2LVIA 1N0YA 1CNPA 4GPLB 2MA2A 1B7TY 3ZNIA 3BUXB 1PULA 1TCFA 2HQWA 3SG2A 1F8HA 2F8PA 3LK0A 3JVTB 3EKHA 2P6BB 1TIZA 2M1UA 5IBWA 2WNDA 2H2KA 2QACA 4PDZA 1AP4A 1S26D 1YR5A 2MBXA 1RWYA 5B8IB 3VROA 3OX6A 1KFXL 3CGAA 4MRXA 3LL8B 1FI5A 1GJYA 2KAYA 1K9KA 1J55A 3F45A 2CNPA 3PFVA 3TUYC 2O60A 5HKYA 1JF0A 2NXQA 2A4JA 1KCYA 2KBIA 4DRWA 1SL7A 1Y0VH 2K7CA 1BJFA 3SG4A 1SL9A 3SIBA 1U5IA 2MHHA 3FWCA 1BLQA 4D1EA 2K7DA 3O4YA 4JWQA 1B8CA 3NXAA 5DKQA 1B9AA 1UWOA 3OB2B 3OB1B 3WXAA 3A4UB 4OV2A 4I5JA 2I2RE 5I2QA 1S5GZ 3TUYB 1XFZO 1H4BA 2FJUB 1G4YR 4GUKA 1GGZA 1MUXA 2BE4A 2VRGA 4BY4A 1XFUO 2B1UA 2L51A 1HT9A 1CFFA 1YRTB 2ZRTA 3BUMB 1MXEA 5F6TA 2NZ0A 4NDCA 1SYMA 1N2DA 1KSMA 1BF5A 4YBHB 1IQ5A 2JNFA 4PE4A 3H4SE 2CXJA 1L2OC 2M7LA 4DCKA 1AHRA 2Q91A 3VRPA 1XFXO 1XK4A 2BECA 1MF8B 3KO0A 1KQVA 3A8RA 2KI6D 1EL4A 1W7IB 1HQVA 1J7PA 4MLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PAL A;  1K94 A;  5J3X A;  3BOW A;  1J7R A;  1XVJ A;  3SJS A;  2KNE A;  1L2O B;  1J7Q A;  2KAV A;  2V53 A;  4M2Q A;  1BMO A;  5AEQ A;  4R1E A;  3TS5 C;  3GK4 X;  2KDH A;  1KFU L;  1RJV A;  2MRD A;  3BXK A;  5CSN A;  4TNC A;  1XK4 C;  2K7B A;  4PHM A;  1F4O A;  2JRF A;  2PMY A;  4OR9 B;  1R2U A;  4ZCU A;  5K89 A;  4BY5 A;  3WHU B;  1A75 A;  4P5O E;  4F0Z B;  2I94 A;  5DKR A;  3QRX A;  4YGC B;  1S6C A;  1JFJ A;  1DJY A;  4JPZ B;  2ZND A;  1PAL A;  2HET A;  2LVV A;  1YX7 A;  5GQQ C;  3TS5 B;  3DVK A;  1SY9 A;  1K90 D;  2KFF A;  2SAS A;  3I5F C;  2JT3 A;  1ODB A;  1Y6W A;  2QPT A;  3PN7 B;  3CR4 X;  3RLZ A;  1PVB A;  4MSP A;  5HKW A;  1V1F A;  2M0R A;  1QX7 A;  3NSI A;  1DMO A;  5ER5 A;  1OOJ A;  1SKT A;  2WC8 A;  1WY9 A;  1IWQ A;  1SCV A;  1YTZ C;  2LLS A;  3BOW B;  1LXF C;  2JWW A;  4P2Y B;  1K93 D;  3KEV A;  2KYF A;  2EC6 B;  3JVT C;  3K21 A;  3VRQ A;  1DVI A;  3AAJ A;  2GGM A;  1CB1 A;  1K2H A;  4AQJ A;  1M39 A;  1PK0 D;  3I5F B;  1QXP A;  1IKU A;  4MEW A;  5PAL A;  2H61 A;  5HYD A;  1S36 A;  1FBV A;  1S6I A;  1AVS A;  2MAZ A;  1Q80 A;  1KK7 Z;  1KWO C;  1PSB A;  1S1E A;  2TN4 A;  3WNX B;  4E68 A;  1CFD A;  2WCE A;  1A75 B;  2LCP A;  4DIR A;  4GGN A;  1S3P A;  1XFW O;  1TNP A;  3IQO A;  3BUW B;  3IF7 A;  1JFK A;  1QVI Y;  2JT8 A;  2WOR A;  2O5G A;  1NIW A;  5I2L A;  2CTN A;  4ETO A;  1SCM C;  1NX1 A;  1R6P A;  2E30 A;  2L98 A;  4PE0 A;  4PHJ A;  1JBA A;  1OMR A;  1AJ5 A;  1CDM A;  1QS7 A;  1NYA A;  3ICB A;  2OPO A;  1PRW A;  1KWO B;  3O6B A;  3I5H B;  2H61 C;  1KK8 C;  2JC2 A;  2K2A A;  3DF0 A;  3LLE A;  2WCF A;  1A03 A;  1NSH A;  2KGB C;  4CFQ A;  4NQG A;  2KQ6 A;  3EVR A;  4YGD B;  1WRK A;  1CTR A;  1MR8 A;  5G08 A;  2KYC A;  2LUX A;  2JTZ A;  1B7T Z;  1SCM B;  2LLU A;  4AOM A;  1CKK A;  2KAX A;  4YI9 A;  2ZN8 A;  4PCW A;  1S5G Y;  2CCM A;  2K2F A;  2LP3 A;  1TN4 A;  4NDD A;  1XO5 A;  2LVJ A;  3VGO A;  2F2O A;  3JTD C;  1GGW A;  1KK8 B;  1QV1 A;  1J1E A;  1XA5 A;  4USL A;  1Y1U A;  4FQO A;  1K96 A;  3EKJ A;  2BCB A;  2SCP A;  4C0L A;  1TNQ A;  1Y1X A;  2Y1N A;  1TNX A;  1WDC C;  3D10 A;  2KFH A;  1DGV A;  1QAS A;  2KSP A;  3BUO B;  3FWB A;  1W7J B;  2BBM A;  1RTP 1;  3TDU A;  1TOP A;  4ORB B;  2BCA A;  5HKZ A;  3AAK A;  3MSE B;  2KGR A;  2LLT A;  1MHO A;  3JTD B;  1KSO A;  3SG3 A;  4JQ0 D;  1CFP A;  4N5X A;  4IL1 A;  2JQ6 A;  1UHH A;  3C1V A;  1WDC B;  2JXL A;  3DF0 B;  1OZO A;  3FS7 A;  1J7O A;  1JUO A;  3WHT B;  1KQM C;  1QLS A;  3KF9 A;  4ICB A;  1H8B A;  3PAT A;  5JOL A;  3LCP C;  3CZT X;  4CPV A;  3RM1 A;  3NSK A;  4ZCV A;  5D69 A;  1MXL C;  3IQQ A;  2BE6 A;  2FOT A;  1G8I A;  1QIV A;  1BT6 A;  2JPT A;  3KHE A;  1SRA A;  4MBE A;  4GBA A;  2MLF C;  3EK8 A;  2AUC A;  1LVC D;  1IJ5 A;  1WLM A;  3AKB A;  4A4B A;  2G9B A;  2HQ8 A;  5FYX A;  1KQM B;  1OMD A;  3PN7 C;  1YUR A;  4YRU A;  3OX5 A;  2RGI A;  1K8U A;  4QJ4 B;  2LHL A;  3TDZ A;  3PLF B;  4FTG A;  1XFV O;  2JUL A;  3I5I C;  1B8R A;  4AQI A;  2PSR A;  3SG6 A;  4DUQ A;  1TRF A;  1YX8 A;  1RRO A;  1CLL A;  1WRZ A;  1XYD A;  2EC6 C;  2LP2 A;  2K7O A;  2M29 A;  5CPV A;  3VRN A;  1NPQ A;  1C7V A;  1M63 B;  2AAO A;  1QAT A;  1SPY A;  2IS9 A;  1F70 A;  2LUC A;  2OTG C;  4ORC B;  1ALV A;  5CSJ A;  1QJT A;  5KU1 A;  1YUT A;  1TNW A;  2JT0 A;  2BL0 B;  2AMI A;  4I5N B;  3GK2 A;  3NSL A;  4GNK B;  4PHK A;  1OMV A;  1OSA A;  1CLM A;  2L4H A;  4OKH A;  4C0J A;  2LNK A;  3I5I B;  1SNL A;  4ORA B;  2ZKM X;  1V1G A;  4HRG A;  3GK1 A;  2OS8 C;  1AUI B;  2JZI A;  2ISD A;  1JC2 A;  2EGD A;  1BOC A;  1BU3 A;  1EG4 A;  2OTG B;  1AJ4 A;  3EVU A;  2KI6 C;  3O78 A;  2LVK A;  2LV7 A;  1X02 A;  2KHN A;  1OQP A;  2LE9 B;  2CBL A;  1DJZ A;  1IG5 A;  2R2I A;  3LK1 A;  4N1G A;  2BKH B;  1XFY O;  4NDB A;  5I8N A;  4GGF A;  3I5H C;  1AK8 A;  4YGA A;  1DJH A;  4MZK A;  2MLE C;  3E3R A;  1SW8 A;  2LMU A;  3BQ3 A;  1IQ3 A;  1BR4 B;  5KTY A;  1LA3 A;  2OS8 B;  2GV5 A;  1LKJ A;  4MZL A;  1SR6 C;  2GGZ A;  1CDN A;  4XJK A;  1DGU A;  1QX2 A;  4PAL A;  2M1K B;  1B47 A;  1YRU B;  5BPJ A;  4M2P A;  1NX0 A;  2JNX A;  2F33 A;  1SMG A;  1NX3 A;  3OP0 A;  1A4P A;  5ER4 X;  2M49 B;  1NUB A;  3D0Y A;  3M0W A;  2L2E A;  1IJ6 A;  3OHM B;  1MWN A;  1UHK A;  5AAN A;  2K8M B;  2NCP A;  1JF2 A;  3FIA A;  1KFX S;  1FI6 A;  1LIN A;  1QV0 A;  1YVH A;  1IGV A;  3KPX A;  4YGB B;  4GGF C;  1A2X A;  4UPG A;  2MJW B;  1GQM A;  2ZNE A;  1ALW A;  1SR6 B;  2NCO A;  2COL B;  2Y4Q A;  3EK4 A;  2JOJ A;  1SL8 A;  4PHN A;  1DJW A;  1NCY A;  3TDI A;  3CS1 A;  2LAN A;  1QVI Z;  1YVL A;  2PVB A;  1NWD A;  1F71 A;  3CWG A;  1NP8 A;  4WQ3 A;  2K61 A;  4A4C A;  3HX4 A;  2PRU A;  2CT9 A;  2JTT A;  3I5G C;  1F55 A;  3EVV A;  1F4Q A;  3TZ1 A;  1SBJ A;  1D1O A;  2KOT A;  5D7F A;  1EXR A;  2I7A A;  1TTX A;  1Y1A A;  3CR5 X;  3GOF A;  4XJK B;  1YUS A;  2LMV A;  1OZS A;  4GFT A;  4MN0 A;  4OCI A;  4C0K A;  1K9U A;  2LMT A;  3CLN A;  3PM8 A;  2LAP A;  1UHJ A;  2BKI B;  4L9M A;  4N1F A;  2G2B A;  1CFC A;  1BOD A;  3DD4 A;  1ZUZ A;  3D0Y B;  1N65 A;  2HPS A;  2M97 A;  1TCO B;  2Y1M A;  3I5G B;  1IRJ A;  5DKN A;  1DJI A;  1EG3 A;  4PE1 A;  1M31 A;  3CR2 A;  3DVE A;  1IH0 A;  1C7W A;  1CDL A;  3BUN B;  2F2P A;  4CLN A;  1QX5 B;  1CDP A;  1DJX A;  2WCB A;  3EK7 A;  5TNC A;  2EHB A;  1EH2 A;  1QLK A;  1UUR A;  1NCX A;  5AFP A;  1JWD A;  2M7N A;  4HSZ A;  2I18 A;  2KI4 C;  2L50 A;  1YUU A;  4GAO A;  4CID A;  1CMG A;  4M2O A;  3NSO A;  2FCD A;  4MRY A;  1B8L A;  4XYN A;  2E6W A;  1ZAC A;  1OE9 B;  1UHN A;  2NLN A;  1FW4 A;  1S6J A;  2DOQ A;  1LA0 A;  2FCE A;  1CMF A;  2M3W A;  1M46 A;  4MZJ A;  1K95 A;  1K9P A;  1BG1 A;  1KFU S;  2Y5I A;  1QIW A;  1FF1 A;  1DTL A;  1PSR A;  1M45 A;  2BL0 C;  2F3Y A;  1NCZ A;  1U5I B;  2KQY A;  2L5X B;  3AKA A;  3SG7 A;  1ZOT B;  1G33 A;  1DF0 A;  2KI4 B;  4DS7 A;  4I5L B;  1DJG A;  1RK9 A;  2Q4U A;  2L0P A;  3PSR A;  4U8D A;  1A29 A;  4YGE B;  2BCX A;  5CSI A;  3DVJ A;  1F54 A;  2D8N A;  1SK6 D;  4HRH A;  2K0J A;  1WLZ A;  1E8A A;  1MQ1 A;  1CM1 A;  2JXC A;  2WOS A;  2M9G A;  1CLB A;  1UP5 A;  5AER A;  5KSZ A;  1VRK A;  4MVF A;  4Q04 A;  2M8U A;  4OVN F;  1EJ3 A;  2JU0 A;  5CSF A;  2F3Z A;  2ZN9 A;  2BBN A;  3PAL A;  1UUS A;  1J1D A;  4PE7 A;  1BR1 B;  2KBM A;  4QJ5 B;  1JSA A;  4YI8 A;  2ZFD A;  1QTX A;  5I2O A;  5HLO A;  2LC5 A;  1UHI A;  1DT7 B;  1WRL A;  1C07 A;  1KK7 Y;  1ZFS A;  2HF5 A;  4HRE E;  4I5K A;  1ZMZ A;  2LHI A;  1RFJ A;  3O2P A;  3SG5 A;  3ZWH A;  3HCM A;  5HLV A;  1L7Z A;  3DVM A;  1REC A;  1CM4 A;  5AXI A;  2LM5 A;  1B1G A;  1NX2 A;  1DF0 B;  2ZRS A;  1B4C A;  3SIA A;  2KFG A;  4WRI A;  4CFR A;  1FPW A;  2PAS A;  4WQ2 A;  3CTN A;  3VRR A;  3BYA A;  5JJG A;  4QJ3 B;  2L4I A;  1PVA A;  2LVI A;  1N0Y A;  1CNP A;  4GPL B;  2MA2 A;  1B7T Y;  3ZNI A;  3BUX B;  1PUL A;  1TCF A;  2HQW A;  3SG2 A;  1F8H A;  2F8P A;  3LK0 A;  3JVT B;  3EKH A;  2P6B B;  1TIZ A;  2M1U A;  5IBW A;  2WND A;  2H2K A;  2QAC A;  4PDZ A;  1AP4 A;  1S26 D;  1YR5 A;  2MBX A;  1RWY A;  5B8I B;  3VRO A;  3OX6 A;  1KFX L;  3CGA A;  4MRX A;  3LL8 B;  1FI5 A;  1GJY A;  2KAY A;  1K9K A;  1J55 A;  3F45 A;  2CNP A;  3PFV A;  3TUY C;  2O60 A;  5HKY A;  1JF0 A;  2NXQ A;  2A4J A;  1KCY A;  2KBI A;  4DRW A;  1SL7 A;  1Y0V H;  2K7C A;  1BJF A;  3SG4 A;  1SL9 A;  3SIB A;  1U5I A;  2MHH A;  3FWC A;  1BLQ A;  4D1E A;  2K7D A;  3O4Y A;  4JWQ A;  1B8C A;  3NXA A;  5DKQ A;  1B9A A;  1UWO A;  3OB2 B;  3OB1 B;  3WXA A;  3A4U B;  4OV2 A;  4I5J A;  2I2R E;  5I2Q A;  1S5G Z;  3TUY B;  1XFZ O;  1H4B A;  2FJU B;  1G4Y R;  4GUK A;  1GGZ A;  1MUX A;  2BE4 A;  2VRG A;  4BY4 A;  1XFU O;  2B1U A;  2L51 A;  1HT9 A;  1CFF A;  1YRT B;  2ZRT A;  3BUM B;  1MXE A;  5F6T A;  2NZ0 A;  4NDC A;  1SYM A;  1N2D A;  1KSM A;  1BF5 A;  4YBH B;  1IQ5 A;  2JNF A;  4PE4 A;  3H4S E;  2CXJ A;  1L2O C;  2M7L A;  4DCK A;  1AHR A;  2Q91 A;  3VRP A;  1XFX O;  1XK4 A;  2BEC A;  1MF8 B;  3KO0 A;  1KQV A;  3A8R A;  2KI6 D;  1EL4 A;  1W7I B;  1HQV A;  1J7P A;  4MLW A; 
#chains in the Genus database with same CATH topology
 2PAL A;  1K94 A;  5J3X A;  3BOW A;  3S0E A;  1J7R A;  1XVJ A;  3SJS A;  3OBV A;  2KNE A;  1L2O B;  4JD9 A;  1J7Q A;  2KAV A;  2V53 A;  4M2Q A;  1BMO A;  2P70 A;  5AEQ A;  4R1E A;  3TS5 C;  3GK4 X;  2KDH A;  1KFU L;  1RJV A;  2MRD A;  2QEH A;  4INW A;  3BXK A;  5CSN A;  3RZS A;  4TNC A;  4JKT A;  1XK4 C;  2K7B A;  4KYN A;  2QEB A;  3QME A;  4PHM A;  1F4O A;  3S0G A;  2JRF A;  2PMY A;  4OR9 B;  1R2U A;  1C3Y A;  4ZCU A;  5K89 A;  4BY5 A;  3WHU B;  1A75 A;  4P5O E;  4F0Z B;  2I94 A;  3R72 A;  5DKR A;  3CZ0 A;  3QRX A;  4YGC B;  1S6C A;  3NHT A;  1JFJ A;  3S0B A;  1DJY A;  4JPZ B;  2ZND A;  4C0L A;  1PAL A;  2HET A;  2LVV A;  1YX7 A;  3EG5 B;  5DIC A;  5GQQ C;  3TS5 B;  3DVK A;  1SY9 A;  1K90 D;  2KFF A;  2SAS A;  3I5F C;  2JT3 A;  1ODB A;  1Y6W A;  2QPT A;  3PN7 B;  3CR4 X;  3RLZ A;  1PVB A;  4MSP A;  5HKW A;  1V1F A;  2M0R A;  3L47 A;  1DEL A;  2KLD A;  1QX7 A;  3NSI A;  1DMO A;  5ER5 A;  1OOJ A;  1SKT A;  3SS3 A;  2WC8 A;  1WY9 A;  1IWQ A;  1SCV A;  1YTZ C;  2LLS A;  3BOW B;  3FE8 A;  1LXF C;  2JWW A;  1OOF A;  1K93 D;  4P2Y B;  3KEV A;  4PT1 A;  2KYF A;  2EC6 B;  3JVT C;  3K21 A;  3VRQ A;  1DVI A;  3AAJ A;  2GGM A;  1CB1 A;  1K2H A;  4AQJ A;  1M39 A;  1PK0 D;  3I5F B;  1QXP A;  3L4A A;  4FQT A;  4MEW A;  1IKU A;  5PAL A;  2H61 A;  5HYD A;  1S36 A;  1FBV A;  1S6I A;  1AVS A;  2WCL A;  2MAZ A;  1Q80 A;  1KK7 Z;  1KWO C;  1PSB A;  1S1E A;  2TN4 A;  3S0D A;  3WNX B;  4E68 A;  1CFD A;  3CDN A;  2WCE A;  4OZD A;  1A75 B;  2LCP A;  4DIR A;  4GGN A;  1S3P A;  1XFW O;  1TNP A;  3IQO A;  3BUW B;  3IF7 A;  3R1O A;  1DC1 A;  5D3O A;  1JFK A;  1QVI Y;  2JT8 A;  2WOR A;  2O5G A;  1NIW A;  4F7F A;  5I2L A;  2CTN A;  4ETO A;  1SCM C;  1NX1 A;  1R6P A;  2E30 A;  2L98 A;  1P28 A;  4PE0 A;  1XFR A;  4PHJ A;  1JBA A;  1OMR A;  5I94 A;  3B7A A;  3B88 A;  1AJ5 A;  1CDM A;  1QS7 A;  1NYA A;  3ICB A;  2OPO A;  2WCK A;  1PRW A;  1KWO B;  3O6B A;  3I5H B;  2H61 C;  1KK8 C;  2JC2 A;  3D74 A;  2K2A A;  3DF0 A;  3LLE A;  2WCF A;  1A03 A;  1NSH A;  2WC5 A;  2KGB C;  3FE6 A;  4CFQ A;  4NQG A;  2KQ6 A;  3EVR A;  4YGD B;  1WRK A;  1CTR A;  1MR8 A;  5G08 A;  2KYC A;  2LUX A;  2JTZ A;  1B7T Z;  1SCM B;  2LLU A;  4AOM A;  1CKK A;  2KAX A;  4YI9 A;  2ZN8 A;  4PCW A;  1S5G Y;  2CCM A;  2K2F A;  3IVT A;  2LP3 A;  1TN4 A;  4NDD A;  1XO5 A;  2LVJ A;  3VGO A;  2F2O A;  3JTD C;  1GGW A;  1KK8 B;  1QV1 A;  1J1E A;  1XA5 A;  4USL A;  1Y1U A;  4FQO A;  1K96 A;  3EKJ A;  2BCB A;  2SCP A;  3D73 A;  3PM2 A;  1TNQ A;  1Y1X A;  3CZ1 A;  2Y1N A;  1TNX A;  1WDC C;  3D10 A;  2KFH A;  3NHI A;  3DY9 A;  1DGV A;  1LS8 A;  1QAS A;  5FI2 A;  2KSP A;  3BUO B;  3FWB A;  1W7J B;  2BBM A;  1RTP 1;  3TDU A;  3S0A A;  1TOP A;  3V2L A;  4ORB B;  2BCA A;  2PYQ A;  2L5Y A;  3AAK A;  3MSE B;  2KGR A;  5HKZ A;  1TUZ A;  1MHO A;  2LLT A;  3JTD B;  1DEK A;  1KSO A;  3SG3 A;  4JQ0 D;  1CFP A;  4N5X A;  4IL1 A;  3R1P A;  2JQ6 A;  1UHH A;  2BNX A;  1WDC B;  2JXL A;  3C1V A;  3DF0 B;  3S0F A;  1OZO A;  3FS7 A;  1J7O A;  1JUO A;  3WHT B;  1KQM C;  1QLS A;  1SSE B;  3KF9 A;  4ICB A;  1H8B A;  3PAT A;  5JOL A;  3LCP C;  3CZT X;  4CPV A;  3RM1 A;  3NSK A;  4ZCV A;  5D69 A;  2QDI A;  1MXL C;  3IQQ A;  1W9Z A;  2BE6 A;  2FOT A;  1G8I A;  1QIV A;  1BT6 A;  2JPT A;  3KHE A;  1SRA A;  4MBE A;  4GBA A;  2MLF C;  3EK8 A;  2AUC A;  1LVC D;  1IJ5 A;  1WLM A;  3AKB A;  3CZ2 A;  4A4B A;  2G9B A;  2HQ8 A;  5FYX A;  1KQM B;  3UO9 A;  1OMD A;  3PN7 C;  1YUR A;  4YRU A;  3OX5 A;  2RGI A;  1K8U A;  3DXL A;  4QJ4 B;  2LHL A;  3TDZ A;  3PLF B;  4FTG A;  1XFV O;  2JUL A;  3I5I C;  3OGN A;  1B8R A;  1ORG A;  4AQI A;  2PSR A;  3SG6 A;  4DUQ A;  1TRF A;  1YX8 A;  1RRO A;  1CLL A;  1WRZ A;  1XYD A;  2EC6 C;  2LP2 A;  2K7O A;  2M29 A;  5CPV A;  3VRN A;  1NPQ A;  1C7V A;  1M63 B;  2AAO A;  1QAT A;  1SPY A;  2IS9 A;  2JPO A;  1F70 A;  2LUC A;  2OTG C;  2P71 A;  4ORC B;  1ALV A;  5CSJ A;  1QJT A;  5KU1 A;  2YGU A;  1YUT A;  1TNW A;  2JT0 A;  2BL0 B;  2AMI A;  4I5N B;  3GK2 A;  3NSL A;  4GNK B;  4PHK A;  1OMV A;  1OSA A;  1CLM A;  2L4H A;  4OKH A;  4C0J A;  2LNK A;  3I5I B;  1SNL A;  4ORA B;  3SS4 A;  1OOI X;  2ZKM X;  1V1G A;  4HRG A;  3GK1 A;  2OS8 C;  3PJI A;  1AUI B;  2JZI A;  3B86 A;  2ISD A;  1JC2 A;  2EGD A;  1BOC A;  1BU3 A;  1EG4 A;  2OTG B;  1AJ4 A;  3EVU A;  2KI6 C;  3O78 A;  2LVK A;  2LV7 A;  3BFH A;  1X02 A;  2KHN A;  1OQP A;  2LE9 B;  3B87 A;  2CBL A;  1DJZ A;  1IG5 A;  2R2I A;  3LK1 A;  4N1G A;  2BKH B;  1XFY O;  4NDB A;  3VB1 A;  4GGF A;  3I5H C;  1AK8 A;  4YGA A;  1DJH A;  4MZK A;  2MLE C;  3E3R A;  2BAP A;  1SW8 A;  2LMU A;  3BQ3 A;  1IQ3 A;  1BR4 B;  5KTY A;  1LA3 A;  2OS8 B;  2GV5 A;  1LKJ A;  4MZL A;  1SR6 C;  2GGZ A;  1CDN A;  4XJK A;  1DGU A;  1QX2 A;  4PAL A;  2M1K B;  1B47 A;  1YRU B;  5BPJ A;  4M2P A;  1NX0 A;  2GTE A;  2JNX A;  2F33 A;  2WCH A;  1SMG A;  1NX3 A;  3OP0 A;  1A4P A;  5ER4 X;  2M49 B;  1NUB A;  3D0Y A;  3M0W A;  2L2E A;  1IJ6 A;  3OHM B;  1MWN A;  1UHK A;  5AAN A;  2K8M B;  2NCP A;  1JF2 A;  3FIA A;  1KFX S;  3BJH A;  1FI6 A;  1LIN A;  1QV0 A;  1YVH A;  2K60 A;  1IGV A;  3KPX A;  1QWV A;  4GGF C;  1A2X A;  4YGB B;  4UPG A;  2MJW B;  1GQM A;  1T14 A;  2ZNE A;  1ALW A;  1SR6 B;  2NCO A;  3DYE A;  2COL B;  2Y4Q A;  3EK4 A;  2JOJ A;  1SL8 A;  4PHN A;  1DJW A;  1NCY A;  3TDI A;  3CS1 A;  2LAN A;  1QVI Z;  1YVL A;  2PVB A;  3L4L A;  1NWD A;  1F71 A;  3CWG A;  1NP8 A;  4WQ3 A;  2K61 A;  4A4C A;  3HX4 A;  5HL1 A;  2PRU A;  1GM0 A;  2WCM A;  2CT9 A;  2JTT A;  1TWO A;  3I5G C;  1F55 A;  3EVV A;  1F4Q A;  3TZ1 A;  1SBJ A;  1D1O A;  2KOT A;  5D7F A;  5EL2 A;  1EXR A;  2I7A A;  1TTX A;  1Y1A A;  2ERB A;  3CR5 X;  3GOF A;  1YUS A;  4XJK B;  2LMV A;  1DQE A;  1OZS A;  4GFT A;  4MN0 A;  4OCI A;  2FJY A;  2KLE A;  4C0K A;  1K9U A;  2LMT A;  3CLN A;  3PM8 A;  2LAP A;  1UHJ A;  2BKI B;  4L9M A;  4N1F A;  2G2B A;  1CFC A;  1BOD A;  3DD4 A;  1ZUZ A;  2KPH A;  1N65 A;  2HPS A;  2M97 A;  1TCO B;  2Y1M A;  3D0Y B;  1IRJ A;  3I5G B;  5DKN A;  1DJI A;  1EG3 A;  4PE1 A;  1M31 A;  3CR2 A;  3DVE A;  3D76 A;  1C7W A;  3SS5 A;  1CDL A;  1IH0 A;  1TUJ A;  3D75 A;  3B6X A;  3BFA A;  3BUN B;  2F2P A;  2WCJ A;  3FE9 A;  4CLN A;  1QX5 B;  1CDP A;  1DJX A;  2WCB A;  3EK7 A;  5TNC A;  2EHB A;  1EH2 A;  1QLK A;  1UUR A;  1NCX A;  5AFP A;  1JWD A;  2M7N A;  4HSZ A;  2I18 A;  2KI4 C;  3R1V A;  2L50 A;  1YUU A;  4GAO A;  4CID A;  1CMG A;  4M2O A;  1OOH A;  3NSO A;  2FCD A;  4MRY A;  1B8L A;  4XYN A;  2E6W A;  1ZAC A;  1OE9 B;  1UHN A;  2NLN A;  1FW4 A;  1S6J A;  2DOQ A;  1LA0 A;  2FCE A;  1CMF A;  2M3W A;  1M46 A;  4MZJ A;  5FI6 A;  1K95 A;  1K9P A;  1BG1 A;  1KFU S;  2Y5I A;  1QIW A;  2QEO A;  1FF1 A;  1DTL A;  1PSR A;  1M45 A;  2BL0 C;  2F3Y A;  1NCZ A;  1U5I B;  2KQY A;  2L5X B;  3AKA A;  3BFB A;  3SG7 A;  1ZOT B;  1G33 A;  1DF0 A;  1Z2C B;  3NGV A;  2KI4 B;  4DS7 A;  3O4X A;  4I5L B;  1DJG A;  1RK9 A;  2QEV A;  2Q4U A;  2L0P A;  3PSR A;  4U8D A;  1A29 A;  4YGE B;  2BCX A;  5CSI A;  3DVJ A;  1F54 A;  2D8N A;  1SK6 D;  4HRH A;  2K0J A;  3D78 A;  1WLZ A;  1E8A A;  1MQ1 A;  1CM1 A;  2JXC A;  2WOS A;  2M9G A;  1CLB A;  1UP5 A;  5AER A;  5KSZ A;  1VRK A;  3CYZ A;  4MVF A;  4Q04 A;  2M8U A;  4OVN F;  1EJ3 A;  2H8V A;  2JU0 A;  5CSF A;  2F3Z A;  2ZN9 A;  2BBN A;  3D77 A;  3PAL A;  1UUS A;  1J1D A;  4PE7 A;  3Q8I A;  1BR1 B;  2KBM A;  4QJ5 B;  1JSA A;  4YI8 A;  2ZFD A;  1QTX A;  5I2O A;  5HLO A;  3DZT A;  2LC5 A;  4INX A;  1UHI A;  1DT7 B;  1WRL A;  1C07 A;  1KK7 Y;  1ZFS A;  2HF5 A;  4HRE E;  4I5K A;  1ZMZ A;  2LHI A;  1RFJ A;  3O2P A;  3SG5 A;  3ZWH A;  3HCM A;  5HLV A;  1L7Z A;  3DVM A;  1IIO A;  1REC A;  1CM4 A;  5AXI A;  2LM5 A;  1B1G A;  1NX2 A;  1DF0 B;  2ZRS A;  1B4C A;  3SIA A;  3CAB A;  2KFG A;  4WRI A;  4CFR A;  1OW4 A;  1FPW A;  2PAS A;  4WQ2 A;  3CTN A;  3VRR A;  3BYA A;  5JJG A;  4QJ3 B;  2L4I A;  1PVA A;  2LVI A;  1N0Y A;  1CNP A;  3UNW A;  4GPL B;  2MA2 A;  1B7T Y;  1OOG A;  2L2C A;  3ZNI A;  3BUX B;  1PUL A;  1TCF A;  2HQW A;  3SG2 A;  1F8H A;  2F8P A;  3LK0 A;  3JVT B;  3EKH A;  2P6B B;  1TIZ A;  2M1U A;  5IBW A;  2WND A;  2H2K A;  2QAC A;  4PDZ A;  1AP4 A;  1S26 D;  1YR5 A;  2MBX A;  1RWY A;  5B8I B;  3VRO A;  3OX6 A;  1KFX L;  3CGA A;  4MRX A;  3LL8 B;  1FI5 A;  1GJY A;  2KAY A;  1K9K A;  1J55 A;  3F45 A;  2CNP A;  3N7H A;  3PFV A;  3TUY C;  2O60 A;  5HKY A;  1JF0 A;  2NXQ A;  2A4J A;  1KCY A;  2KBI A;  4DRW A;  1SL7 A;  1Y0V H;  2K7C A;  1BJF A;  3SG4 A;  1SL9 A;  3SIB A;  1U5I A;  5I8N A;  2MHH A;  3FWC A;  1BLQ A;  4D1E A;  2K7D A;  3O4Y A;  4JWQ A;  1B8C A;  3NXA A;  5DKQ A;  1B9A A;  1UWO A;  1Z4H A;  3OB2 B;  3OB1 B;  3WXA A;  3A4U B;  4OV2 A;  4I5J A;  2I2R E;  5I2Q A;  1S5G Z;  3TUY B;  1XFZ O;  1H4B A;  1C3Z A;  2FJU B;  1G4Y R;  4GUK A;  1GGZ A;  1MUX A;  2BE4 A;  2VRG A;  4BY4 A;  1XFU O;  2B1U A;  2L51 A;  1HT9 A;  1CFF A;  1YRT B;  2ZRT A;  2WC6 A;  3BUM B;  1MXE A;  5F6T A;  2NZ0 A;  3K1E A;  4NDC A;  1SYM A;  1N2D A;  1KSM A;  1BF5 A;  4YBH B;  1IQ5 A;  2JNF A;  4PE4 A;  3H4S E;  2CXJ A;  1L2O C;  2M7L A;  4DCK A;  1AHR A;  2Q91 A;  3VRP A;  1XFX O;  1XK4 A;  2BEC A;  1MF8 B;  3KO0 A;  5FI7 A;  1KQV A;  2PQL A;  3A8R A;  2KI6 D;  1EL4 A;  4IJ7 A;  1W7I B;  1HQV A;  1J7P A;  4MLW A; 
#chains in the Genus database with same CATH homology
 2PAL A;  1K94 A;  5J3X A;  3BOW A;  1J7R A;  1XVJ A;  3SJS A;  2KNE A;  1L2O B;  1J7Q A;  2KAV A;  2V53 A;  4M2Q A;  1BMO A;  5AEQ A;  4R1E A;  3TS5 C;  3GK4 X;  2KDH A;  1KFU L;  1RJV A;  2MRD A;  3BXK A;  5CSN A;  4TNC A;  1XK4 C;  2K7B A;  4PHM A;  1F4O A;  2JRF A;  2PMY A;  4OR9 B;  1R2U A;  4ZCU A;  5K89 A;  4BY5 A;  3WHU B;  1A75 A;  4P5O E;  4F0Z B;  2I94 A;  5DKR A;  3QRX A;  4YGC B;  1S6C A;  1JFJ A;  1DJY A;  4JPZ B;  2ZND A;  1PAL A;  2HET A;  2LVV A;  1YX7 A;  5GQQ C;  3TS5 B;  3DVK A;  1SY9 A;  1K90 D;  2KFF A;  2SAS A;  3I5F C;  2JT3 A;  1ODB A;  1Y6W A;  2QPT A;  3PN7 B;  3CR4 X;  3RLZ A;  1PVB A;  4MSP A;  5HKW A;  1V1F A;  2M0R A;  1QX7 A;  3NSI A;  1DMO A;  5ER5 A;  1OOJ A;  1SKT A;  2WC8 A;  1WY9 A;  1IWQ A;  1SCV A;  1YTZ C;  2LLS A;  3BOW B;  1LXF C;  2JWW A;  4P2Y B;  1K93 D;  3KEV A;  2KYF A;  2EC6 B;  3JVT C;  3K21 A;  3VRQ A;  1DVI A;  3AAJ A;  2GGM A;  1CB1 A;  1K2H A;  4AQJ A;  1M39 A;  1PK0 D;  3I5F B;  1QXP A;  1IKU A;  4MEW A;  5PAL A;  2H61 A;  5HYD A;  1S36 A;  1FBV A;  1S6I A;  1AVS A;  2MAZ A;  1Q80 A;  1KK7 Z;  1KWO C;  1PSB A;  1S1E A;  2TN4 A;  3WNX B;  4E68 A;  1CFD A;  2WCE A;  1A75 B;  2LCP A;  4DIR A;  4GGN A;  1S3P A;  1XFW O;  1TNP A;  3IQO A;  3BUW B;  3IF7 A;  1JFK A;  1QVI Y;  2JT8 A;  2WOR A;  2O5G A;  1NIW A;  5I2L A;  2CTN A;  4ETO A;  1SCM C;  1NX1 A;  1R6P A;  2E30 A;  2L98 A;  4PE0 A;  4PHJ A;  1JBA A;  1OMR A;  1AJ5 A;  1CDM A;  1QS7 A;  1NYA A;  3ICB A;  2OPO A;  1PRW A;  1KWO B;  3O6B A;  3I5H B;  2H61 C;  1KK8 C;  2JC2 A;  2K2A A;  3DF0 A;  3LLE A;  2WCF A;  1A03 A;  1NSH A;  2KGB C;  4CFQ A;  4NQG A;  2KQ6 A;  3EVR A;  4YGD B;  1WRK A;  1CTR A;  1MR8 A;  5G08 A;  2KYC A;  2LUX A;  2JTZ A;  1B7T Z;  1SCM B;  2LLU A;  4AOM A;  1CKK A;  2KAX A;  4YI9 A;  2ZN8 A;  4PCW A;  1S5G Y;  2CCM A;  2K2F A;  2LP3 A;  1TN4 A;  4NDD A;  1XO5 A;  2LVJ A;  3VGO A;  2F2O A;  3JTD C;  1GGW A;  1KK8 B;  1QV1 A;  1J1E A;  1XA5 A;  4USL A;  1Y1U A;  4FQO A;  1K96 A;  3EKJ A;  2BCB A;  2SCP A;  4C0L A;  1TNQ A;  1Y1X A;  2Y1N A;  1TNX A;  1WDC C;  3D10 A;  2KFH A;  1DGV A;  1QAS A;  2KSP A;  3BUO B;  3FWB A;  1W7J B;  2BBM A;  1RTP 1;  3TDU A;  1TOP A;  4ORB B;  2BCA A;  5HKZ A;  3AAK A;  3MSE B;  2KGR A;  2LLT A;  1MHO A;  3JTD B;  1KSO A;  3SG3 A;  4JQ0 D;  1CFP A;  4N5X A;  4IL1 A;  2JQ6 A;  1UHH A;  3C1V A;  1WDC B;  2JXL A;  3DF0 B;  1OZO A;  3FS7 A;  1J7O A;  1JUO A;  3WHT B;  1KQM C;  1QLS A;  3KF9 A;  4ICB A;  1H8B A;  3PAT A;  5JOL A;  3LCP C;  3CZT X;  4CPV A;  3RM1 A;  3NSK A;  4ZCV A;  5D69 A;  1MXL C;  3IQQ A;  2BE6 A;  2FOT A;  1G8I A;  1QIV A;  1BT6 A;  2JPT A;  3KHE A;  1SRA A;  4MBE A;  4GBA A;  2MLF C;  3EK8 A;  2AUC A;  1LVC D;  1IJ5 A;  1WLM A;  3AKB A;  4A4B A;  2G9B A;  2HQ8 A;  5FYX A;  1KQM B;  1OMD A;  3PN7 C;  1YUR A;  4YRU A;  3OX5 A;  2RGI A;  1K8U A;  4QJ4 B;  2LHL A;  3TDZ A;  3PLF B;  4FTG A;  1XFV O;  2JUL A;  3I5I C;  1B8R A;  4AQI A;  2PSR A;  3SG6 A;  4DUQ A;  1TRF A;  1YX8 A;  1RRO A;  1CLL A;  1WRZ A;  1XYD A;  2EC6 C;  2LP2 A;  2K7O A;  2M29 A;  5CPV A;  3VRN A;  1NPQ A;  1C7V A;  1M63 B;  2AAO A;  1QAT A;  1SPY A;  2IS9 A;  1F70 A;  2LUC A;  2OTG C;  4ORC B;  1ALV A;  5CSJ A;  1QJT A;  5KU1 A;  1YUT A;  1TNW A;  2JT0 A;  2BL0 B;  2AMI A;  4I5N B;  3GK2 A;  3NSL A;  4GNK B;  4PHK A;  1OMV A;  1OSA A;  1CLM A;  2L4H A;  4OKH A;  4C0J A;  2LNK A;  3I5I B;  1SNL A;  4ORA B;  2ZKM X;  1V1G A;  4HRG A;  3GK1 A;  2OS8 C;  1AUI B;  2JZI A;  2ISD A;  1JC2 A;  2EGD A;  1BOC A;  1BU3 A;  1EG4 A;  2OTG B;  1AJ4 A;  3EVU A;  2KI6 C;  3O78 A;  2LVK A;  2LV7 A;  1X02 A;  2KHN A;  1OQP A;  2LE9 B;  2CBL A;  1DJZ A;  1IG5 A;  2R2I A;  3LK1 A;  4N1G A;  2BKH B;  1XFY O;  4NDB A;  5I8N A;  4GGF A;  3I5H C;  1AK8 A;  4YGA A;  1DJH A;  4MZK A;  2MLE C;  3E3R A;  1SW8 A;  2LMU A;  3BQ3 A;  1IQ3 A;  1BR4 B;  5KTY A;  1LA3 A;  2OS8 B;  2GV5 A;  1LKJ A;  4MZL A;  1SR6 C;  2GGZ A;  1CDN A;  4XJK A;  1DGU A;  1QX2 A;  4PAL A;  2M1K B;  1B47 A;  1YRU B;  5BPJ A;  4M2P A;  1NX0 A;  2JNX A;  2F33 A;  1SMG A;  1NX3 A;  3OP0 A;  1A4P A;  5ER4 X;  2M49 B;  1NUB A;  3D0Y A;  3M0W A;  2L2E A;  1IJ6 A;  3OHM B;  1MWN A;  1UHK A;  5AAN A;  2K8M B;  2NCP A;  1JF2 A;  3FIA A;  1KFX S;  1FI6 A;  1LIN A;  1QV0 A;  1YVH A;  1IGV A;  3KPX A;  4YGB B;  4GGF C;  1A2X A;  4UPG A;  2MJW B;  1GQM A;  2ZNE A;  1ALW A;  1SR6 B;  2NCO A;  2COL B;  2Y4Q A;  3EK4 A;  2JOJ A;  1SL8 A;  4PHN A;  1DJW A;  1NCY A;  3TDI A;  3CS1 A;  2LAN A;  1QVI Z;  1YVL A;  2PVB A;  1NWD A;  1F71 A;  3CWG A;  1NP8 A;  4WQ3 A;  2K61 A;  4A4C A;  3HX4 A;  2PRU A;  2CT9 A;  2JTT A;  3I5G C;  1F55 A;  3EVV A;  1F4Q A;  3TZ1 A;  1SBJ A;  1D1O A;  2KOT A;  5D7F A;  1EXR A;  2I7A A;  1TTX A;  1Y1A A;  3CR5 X;  3GOF A;  4XJK B;  1YUS A;  2LMV A;  1OZS A;  4GFT A;  4MN0 A;  4OCI A;  4C0K A;  1K9U A;  2LMT A;  3CLN A;  3PM8 A;  2LAP A;  1UHJ A;  2BKI B;  4L9M A;  4N1F A;  2G2B A;  1CFC A;  1BOD A;  3DD4 A;  1ZUZ A;  3D0Y B;  1N65 A;  2HPS A;  2M97 A;  1TCO B;  2Y1M A;  3I5G B;  1IRJ A;  5DKN A;  1DJI A;  1EG3 A;  4PE1 A;  1M31 A;  3CR2 A;  3DVE A;  1IH0 A;  1C7W A;  1CDL A;  3BUN B;  2F2P A;  4CLN A;  1QX5 B;  1CDP A;  1DJX A;  2WCB A;  3EK7 A;  5TNC A;  2EHB A;  1EH2 A;  1QLK A;  1UUR A;  1NCX A;  5AFP A;  1JWD A;  2M7N A;  4HSZ A;  2I18 A;  2KI4 C;  2L50 A;  1YUU A;  4GAO A;  4CID A;  1CMG A;  4M2O A;  3NSO A;  2FCD A;  4MRY A;  1B8L A;  4XYN A;  2E6W A;  1ZAC A;  1OE9 B;  1UHN A;  2NLN A;  1FW4 A;  1S6J A;  2DOQ A;  1LA0 A;  2FCE A;  1CMF A;  2M3W A;  1M46 A;  4MZJ A;  1K95 A;  1K9P A;  1BG1 A;  1KFU S;  2Y5I A;  1QIW A;  1FF1 A;  1DTL A;  1PSR A;  1M45 A;  2BL0 C;  2F3Y A;  1NCZ A;  1U5I B;  2KQY A;  2L5X B;  3AKA A;  3SG7 A;  1ZOT B;  1G33 A;  1DF0 A;  2KI4 B;  4DS7 A;  4I5L B;  1DJG A;  1RK9 A;  2Q4U A;  2L0P A;  3PSR A;  4U8D A;  1A29 A;  4YGE B;  2BCX A;  5CSI A;  3DVJ A;  1F54 A;  2D8N A;  1SK6 D;  4HRH A;  2K0J A;  1WLZ A;  1E8A A;  1MQ1 A;  1CM1 A;  2JXC A;  2WOS A;  2M9G A;  1CLB A;  1UP5 A;  5AER A;  5KSZ A;  1VRK A;  4MVF A;  4Q04 A;  2M8U A;  4OVN F;  1EJ3 A;  2JU0 A;  5CSF A;  2F3Z A;  2ZN9 A;  2BBN A;  3PAL A;  1UUS A;  1J1D A;  4PE7 A;  1BR1 B;  2KBM A;  4QJ5 B;  1JSA A;  4YI8 A;  2ZFD A;  1QTX A;  5I2O A;  5HLO A;  2LC5 A;  1UHI A;  1DT7 B;  1WRL A;  1C07 A;  1KK7 Y;  1ZFS A;  2HF5 A;  4HRE E;  4I5K A;  1ZMZ A;  2LHI A;  1RFJ A;  3O2P A;  3SG5 A;  3ZWH A;  3HCM A;  5HLV A;  1L7Z A;  3DVM A;  1REC A;  1CM4 A;  5AXI A;  2LM5 A;  1B1G A;  1NX2 A;  1DF0 B;  2ZRS A;  1B4C A;  3SIA A;  2KFG A;  4WRI A;  4CFR A;  1FPW A;  2PAS A;  4WQ2 A;  3CTN A;  3VRR A;  3BYA A;  5JJG A;  4QJ3 B;  2L4I A;  1PVA A;  2LVI A;  1N0Y A;  1CNP A;  4GPL B;  2MA2 A;  1B7T Y;  3ZNI A;  3BUX B;  1PUL A;  1TCF A;  2HQW A;  3SG2 A;  1F8H A;  2F8P A;  3LK0 A;  3JVT B;  3EKH A;  2P6B B;  1TIZ A;  2M1U A;  5IBW A;  2WND A;  2H2K A;  2QAC A;  4PDZ A;  1AP4 A;  1S26 D;  1YR5 A;  2MBX A;  1RWY A;  5B8I B;  3VRO A;  3OX6 A;  1KFX L;  3CGA A;  4MRX A;  3LL8 B;  1FI5 A;  1GJY A;  2KAY A;  1K9K A;  1J55 A;  3F45 A;  2CNP A;  3PFV A;  3TUY C;  2O60 A;  5HKY A;  1JF0 A;  2NXQ A;  2A4J A;  1KCY A;  2KBI A;  4DRW A;  1SL7 A;  1Y0V H;  2K7C A;  1BJF A;  3SG4 A;  1SL9 A;  3SIB A;  1U5I A;  2MHH A;  3FWC A;  1BLQ A;  4D1E A;  2K7D A;  3O4Y A;  4JWQ A;  1B8C A;  3NXA A;  5DKQ A;  1B9A A;  1UWO A;  3OB2 B;  3OB1 B;  3WXA A;  3A4U B;  4OV2 A;  4I5J A;  2I2R E;  5I2Q A;  1S5G Z;  3TUY B;  1XFZ O;  1H4B A;  2FJU B;  1G4Y R;  4GUK A;  1GGZ A;  1MUX A;  2BE4 A;  2VRG A;  4BY4 A;  1XFU O;  2B1U A;  2L51 A;  1HT9 A;  1CFF A;  1YRT B;  2ZRT A;  3BUM B;  1MXE A;  5F6T A;  2NZ0 A;  4NDC A;  1SYM A;  1N2D A;  1KSM A;  1BF5 A;  4YBH B;  1IQ5 A;  2JNF A;  4PE4 A;  3H4S E;  2CXJ A;  1L2O C;  2M7L A;  4DCK A;  1AHR A;  2Q91 A;  3VRP A;  1XFX O;  1XK4 A;  2BEC A;  1MF8 B;  3KO0 A;  1KQV A;  3A8R A;  2KI6 D;  1EL4 A;  1W7I B;  1HQV A;  1J7P A;  4MLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...