1K9KA

Crystal structure of calcium bound human s100a6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
89
structure length
89
Chain Sequence
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 36
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9kA00
2PMYA 1KFXL 1ZMZA 4C0LA 4L9MA 4M2OA 4HSZA 2KHNA 1DJWA 1WY9A 2F3ZA 2NCPA 5DKNA 3PALA 1K90D 1BJFA 2KGRA 4AOMA 2F2OA 1NCXA 2KYCA 2LVIA 1NX1A 1YX8A 4OV2A 2H61C 2JXLA 1H8BA 1YVHA 2QACA 4YI9A 1QX7A 1SY9A 1UHNA 1JUOA 1TOPA 2A4JA 1JBAA 1KFXS 2G9BA 2LUCA 1ALWA 4OKHA 3TZ1A 1DGUA 3FIAA 3OP0A 4NQGA 1UUSA 1UP5A 3DVJA 3FS7A 4BY4A 2PRUA 4MVFA 3AAKA 1XFVO 2SASA 3DVEA 1AK8A 1CMFA 3TS5B 4PE7A 1QTXA 4GNKB 2LP2A 1NP8A 1IQ5A 1FW4A 1TNQA 1MQ1A 5HYDA 3OX6A 1Y1UA 1AP4A 5F6TA 1LVCD 2HETA 2GGZA 3FWCA 3JVTC 1YUTA 3QRXA 1YRUB 3WNXB 2B1UA 2KQYA 3GOFA 4M2PA 4E68A 2F8PA 1AHRA 3GK4X 1PK0D 1YUSA 3WXAA 1YRTB 3O6BA 3CR5X 5AERA 2L2EA 5J3XA 2LHIA 1UURA 1QASA 1CFDA 1JF0A 1SRAA 1TRFA 2D8NA 3M0WA 3RLZA 2KSPA 1BOCA 2M29A 1Y6WA 5K89A 1WDCC 4CIDA 3I5IC 3KO0A 4MRXA 1JF2A 1DTLA 2Y4QA 1A03A 1AJ4A 1WRLA 2BKIB 4AQJA 1LA0A 2AAOA 3DVKA 2H61A 2L0PA 3F45A 3PM8A 4GBAA 2K61A 1LA3A 1DVIA 2CCMA 2HQWA 2L5XB 2LNKA 4GFTA 1RTP1 2LVVA 4YBHB 3VRRA 3SIAA 4ICBA 2EGDA 1QV1A 2CNPA 1C7WA 4MSPA 2BECA 2KFGA 3TUYC 3C1VA 4PDZA 2NLNA 3EK4A 4YGBB 4USLA 1IH0A 2FOTA 2BCBA 4D1EA 1Y1AA 2MLEC 1QVIZ 1GGZA 3PN7C 1BLQA 1BG1A 3MSEB 1ZOTB 4PHKA 3SG6A 1OOJA 1A29A 1SKTA 4N5XA 2JU0A 3BQ3A 4N1FA 5PALA 5KTYA 3CS1A 1WRKA 5HKZA 3D0YA 4QJ4B 4MRYA 1EG3A 4GAOA 3BUMB 2CT9A 1ALVA 3BUWB 2ZKMX 2M7LA 1KK7Z 2DOQA 1E8AA 2JPTA 1MXLC 1QLKA 1OMDA 5I2OA 3OHMB 1WLMA 1NCYA 2JWWA 2OPOA 2K0JA 1K96A 1K9PA 1GJYA 4YI8A 1SCMB 2M97A 1RWYA 1IWQA 1NWDA 3NSOA 2COLB 1NUBA 1QLSA 1KFUL 4YGCB 2AMIA 1XO5A 2WCFA 4YGDB 2PASA 2MA2A 1JC2A 2M49B 3LK0A 1DJZA 3NSKA 2KI4C 3DF0B 2K2AA 1IQ3A 2FJUB 5AANA 3HX4A 4N1GA 4I5NB 1R2UA 4JPZB 2OS8B 1CLMA 1YTZC 4F0ZB 5I2QA 3CGAA 5CSFA 4XYNA 2KNEA 5HLOA 1CKKA 1KFUS 2LE9B 1JWDA 1OMRA 1MWNA 1K9UA 2KBIA 2BL0C 2LMVA 1S1EA 3SG5A 1L2OC 2K7CA 2KBMA 1WRZA 1IJ6A 1F54A 2I7AA 1CTRA 3BXKA 2AUCA 4HREE 1QIWA 5CPVA 3SG3A 3E3RA 1UHJA 1DJHA 1MUXA 3NXAA 1PRWA 1BT6A 1W7JB 1XFWO 2MJWB 1C07A 2FCEA 4JQ0D 4OR9B 4DCKA 2JXCA 2L50A 5DKRA 4M2QA 5TNCA 3KEVA 2M9GA 2I2RE 2M0RA 3I5HB 1F55A 1FI6A 1MXEA 1B8RA 3LK1A 5GQQC 3FWBA 5CSIA 2P6BB 3EVRA 2LM5A 4HRHA 1NYAA 1J55A 3VGOA 1XYDA 1CFFA 3BUOB 1MR8A 1RK9A 1NIWA 2BE6A 1CB1A 1SL9A 3SG2A 2EC6C 1OSAA 1DJXA 4CFQA 2WORA 5JJGA 2ZRTA 1BR4B 4PALA 1OZSA 1BR1B 4BY5A 2JULA 2LUXA 1KQMC 2HPSA 1U5IB 3CTNA 4GUKA 2JT8A 1YVLA 1RECA 2BKHB 4JWQA 1K95A 2LHLA 3O2PA 4ORBB 1BF5A 3EKJA 1TNPA 2JNFA 3VRNA 3KHEA 1A75A 1M45A 1HQVA 4A4BA 4DRWA 3ZNIA 1CDMA 2JT3A 2BBNA 2LV7A 5D7FA 4PHNA 2K8MB 1OQPA 1Y0VH 1J1EA 1L7ZA 3EK7A 2Q4UA 3VRQA 1KQVA 4OVNF 5AXIA 4DUQA 1M31A 4XJKA 1N65A 4MZJA 2F3YA 1SL8A 2JC2A 1QJTA 1BMOA 3CR2A 1S6IA 3PFVA 1XFXO 3A8RA 1ZUZA 1EH2A 2M3WA 2JQ6A 2KAYA 3O4YA 1WDCB 3I5IB 2K7OA 2ZNDA 4MZKA 3SIBA 2Y5IA 4MEWA 3GK1A 3H4SE 1MHOA 2JTZA 2Q91A 2LMUA 1KK8B 2WCEA 2V53A 1YX7A 2K7DA 2IS9A 1ZACA 1OE9B 1VRKA 1YUUA 2LAPA 2LLUA 2Y1MA 1M63B 1S5GZ 1XFZO 1SYMA 3OB1B 1CNPA 2SCPA 3WHTB 4ZCUA 1A2XA 1TCFA 3TUYB 2GGMA 1NX3A 1TIZA 1TN4A 1G8IA 2PALA 1SPYA 5B8IB 1KWOC 4YGEB 5HLVA 1B9AA 1D1OA 1XK4C 2M7NA 3PN7B 1OZOA 1CDPA 2GV5A 2KQ6A 2WCBA 3I5GC 2HF5A 2KYFA 4HRGA 1B7TZ 1CFPA 4U8DA 4OCIA 1NCZA 3JTDC 4WRIA 1PSRA 5AFPA 1SR6C 2O5GA 4PE4A 3PSRA 2ZNEA 3PLFB 2KFHA 1B8LA 3I5FC 4PHMA 2K7BA 1YR5A 1RJVA 3TDIA 1NX0A 1CDLA 3SG4A 2KDHA 2KFFA 4A4CA 1DJIA 2L4IA 1NPQA 1XFYO 4ORAB 1BODA 3ICBA 1S26D 1J7OA 1K9KA 1LXFC 1PALA 1TTXA 4NDDA 1GQMA 3VRPA 2I18A 3PATA 5AEQA 3BUNB 3EVVA 2EHBA 1KCYA 3RM1A 1UHHA 2KI4B 4UPGA 5JOLA 1V1FA 2K2FA 3KF9A 4QJ3B 2OTGC 4I5LB 4WQ3A 5CSJA 1QVIY 1CM4A 2L4HA 4FTGA 3BOWA 5KU1A 1J1DA 2WNDA 4CPVA 1IRJA 1HT9A 2LP3A 2CTNA 1YURA 1DMOA 2BL0B 1XK4A 4CFRA 1TNWA 1N2DA 1CFCA 1DT7B 3EKHA 1PVAA 3IQQA 1CLBA 2KOTA 1KK7Y 5HKYA 2BCXA 5I8NA 1S3PA 4GGFC 1LINA 2E30A 1A75B 2M1KB 2G2BA 3DF0A 2ZN9A 2L98A 5DKQA 1J7QA 3EK8A 3TS5C 2R2IA 1Q80A 1KSOA 4CLNA 1AJ5A 1XVJA 3D10A 2WC8A 1B7TY 4I5JA 1N0YA 5BPJA 1DJYA 1V1GA 1W7IB 4XJKB 1B8CA 1DF0A 1UWOA 2RGIA 1CM1A 1SK6D 3O78A 3OX5A 2ZRSA 1JFJA 1K8UA 1SBJA 2CXJA 2WOSA 3HCMA 2LMTA 4MBEA 4C0JA 1AUIB 4YRUA 1ZFSA 4ZCVA 2EC6B 2JTTA 1KSMA 1PVBA 1IGVA 1TCOB 1JSAA 1CLLA 3CR4X 2F33A 4NDBA 3ZWHA 1IG5A 2LANA 3CWGA 4DIRA 2CBLA 3LL8B 1IKUA 3IF7A 1KQMB 3D0YB 3JVTB 1SNLA 3NSLA 2KGBC 4MLWA 1X02A 2JOJA 3VROA 1G33A 5G08A 4GGNA 3KPXA 1LKJA 4GGFA 4AQIA 3IQOA 1IJ5A 2TN4A 4TNCA 1QS7A 2MBXA 2KAXA 4PE1A 1J7RA 1QX2A 2MLFC 5ER5A 1EL4A 1R6PA 5IBWA 1DJGA 3SJSA 2JT0A 2M1UA 1UHKA 5D69A 5ER4X 1S6CA 4PCWA 1S6JA 2F2PA 4GPLB 1KK8C 1F8HA 1PSBA 1TNXA 3BUXB 2NXQA 2NZ0A 1U5IA 1CDNA 1XFUO 2Y1NA 5HKWA 3WHUB 1NX2A 2MRDA 4C0KA 3NSIA 2JZIA 4PHJA 2M8UA 2ZFDA 1UHIA 1QXPA 1EG4A 4P2YB 2ISDA 4Q04A 2LVKA 3CLNA 1CMGA 3AKBA 4DS7A 1NSHA 1M39A 2VRGA 1F4OA 1B4CA 1FI5A 1MF8B 1SCMC 2PSRA 1AVSA 1FBVA 2KI6D 1RROA 1F4QA 4IL1A 2NCOA 2PVBA 3DD4A 2HQ8A 4MN0A 3AAJA 1RFJA 5CSNA 4ORCB 2OS8C 4PE0A 3BOWB 1SMGA 4MZLA 1BU3A 1KWOB 3AKAA 4R1EA 4I5KA 2L51A 1K94A 1QATA 1QV0A 1QX5B 2LVJA 5FYXA 2BCAA 2I94A 3K21A 5KSZA 1F70A 2E6WA 4NDCA 1M46A 3I5GB 2KAVA 3A4UB 4ETOA 2LLTA 5I2LA 1QIVA 2LCPA 1SL7A 2MAZA 2MHHA 3CZTX 1GGWA 1DGVA 3BYAA 3JTDB 4YGAA 2ZN8A 1SR6B 1Y1XA 4QJ5B 1G4YR 1OMVA 2FCDA 1FF1A 1K2HA 3I5FB 3TDUA 1SCVA 1WLZA 1B47A 3GK2A 2O60A 2QPTA 3EVUA 2BBMA 1PULA 3DVMA 3LCPC 2H2KA 1JFKA 2JNXA 1DF0B 2BE4A 3I5HC 1C7VA 1EXRA 4P5OE 1S36A 1SW8A 2KI6C 1F71A 3SG7A 1L2OB 4FQOA 1S5GY 2JRFA 1XA5A 2LLSA 1J7PA 3LLEA 4WQ2A 2LC5A 1H4BA 3OB2B 1A4PA 1FPWA 1B1GA 1EJ3A 1K93D 3TDZA 1ODBA 2OTGB
chains in the Genus database with same CATH superfamily
2PMYA 1KFXL 3L47A 1ZMZA 4C0LA 4L9MA 4M2OA 1DQEA 1TUZA 4HSZA 5EL2A 2KHNA 1DJWA 1WY9A 2F3ZA 2NCPA 3B86A 3PALA 5DKNA 1K90D 1BJFA 2KGRA 4AOMA 2F2OA 1NCXA 2KYCA 2LVIA 1NX1A 1YX8A 4OV2A 2H61C 2JXLA 1H8BA 1YVHA 2QACA 4YI9A 1QX7A 1SY9A 3N7HA 1UHNA 1JUOA 1TOPA 2A4JA 1JBAA 1KFXS 3B87A 2G9BA 2LUCA 1ALWA 4OKHA 3TZ1A 1DGUA 1TUJA 3FIAA 3OP0A 4NQGA 1UUSA 1UP5A 3NGVA 3DVJA 3FS7A 4BY4A 1OOIX 2PRUA 3L4AA 4MVFA 3AAKA 1XFVO 2SASA 3DVEA 1AK8A 1CMFA 3TS5B 4PE7A 1QTXA 4GNKB 2LP2A 1NP8A 1IQ5A 3IVTA 1FW4A 1TNQA 1MQ1A 5HYDA 3OX6A 1Y1UA 1AP4A 5F6TA 3DYEA 1LVCD 2HETA 2GGZA 3FWCA 3JVTC 1YUTA 3QRXA 1YRUB 3WNXB 3CZ2A 2B1UA 2KQYA 3GOFA 4M2PA 4E68A 2F8PA 1AHRA 3GK4X 1PK0D 1YUSA 3WXAA 3S0GA 1YRTB 3O6BA 3CR5X 5AERA 2L2EA 5J3XA 2LHIA 1UURA 1QASA 1CFDA 1JF0A 1SRAA 1TRFA 2D8NA 3M0WA 3RLZA 2KSPA 1BOCA 2M29A 3VB1A 1C3ZA 1Y6WA 1WDCC 4CIDA 3I5IC 5FI7A 5K89A 3KO0A 4MRXA 1JF2A 1DTLA 2Y4QA 1GM0A 1A03A 1AJ4A 1CLBA 2WCLA 1WRLA 2BKIB 4AQJA 1LA0A 2AAOA 3DVKA 2H61A 2L0PA 3F45A 2WC5A 3PM8A 4GBAA 2K61A 1LA3A 1DVIA 2CCMA 2HQWA 2L5XB 2LNKA 3R1VA 4GFTA 1RTP1 2LVVA 2K60A 4YBHB 3VRRA 3SIAA 4ICBA 4OZDA 2EGDA 1QV1A 1C7WA 2CNPA 4MSPA 2BECA 2KFGA 3TUYC 3C1VA 4PDZA 2NLNA 3EK4A 4YGBB 4USLA 1IH0A 2FOTA 2BCBA 4D1EA 1Y1AA 2MLEC 1QVIZ 1GGZA 3PN7C 1BLQA 3B7AA 1BG1A 3MSEB 3CZ1A 1ZOTB 4PHKA 3SG6A 1OOJA 1A29A 1SKTA 4N5XA 2JU0A 3BQ3A 4N1FA 5PALA 5KTYA 3CS1A 1WRKA 5HKZA 3D0YA 4QJ4B 4MRYA 1EG3A 4GAOA 3BUMB 2CT9A 1ALVA 3BUWB 2ZKMX 2M7LA 1KK7Z 3BJHA 2DOQA 1E8AA 2JPTA 3FE8A 1MXLC 1QLKA 1OMDA 5I2OA 3OHMB 1WLMA 1NCYA 2JWWA 2OPOA 2K0JA 2QEHA 1K96A 1K9PA 1GJYA 1QWVA 3D77A 4YI8A 1ORGA 3BFBA 1SCMB 2M97A 1RWYA 1IWQA 1NWDA 3NSOA 2COLB 1NUBA 1QLSA 1KFUL 4YGCB 2AMIA 1XO5A 2WCFA 4YGDB 2PASA 2MA2A 1JC2A 2M49B 3LK0A 4KYNA 1DJZA 3NSKA 2KI4C 3DF0B 2K2AA 1IQ3A 3EG5B 2FJUB 5AANA 3HX4A 4N1GA 3S0FA 4I5NB 1DELA 1R2UA 3B6XA 4JPZB 2OS8B 2QEVA 1CLMA 1YTZC 4F0ZB 5I2QA 3CGAA 5CSFA 4XYNA 2KNEA 5HLOA 1TWOA 1CKKA 1KFUS 2LE9B 5D3OA 1JWDA 1OMRA 1MWNA 1K9UA 2KBIA 2BL0C 2LMVA 1S1EA 3SG5A 1L2OC 2WCJA 2K7CA 2KBMA 4F7FA 1WRZA 1IJ6A 1F54A 2I7AA 1CTRA 3BXKA 2AUCA 4HREE 1QIWA 5CPVA 3SG3A 3E3RA 1UHJA 1DJHA 1MUXA 3NXAA 1PRWA 2BNXA 1BT6A 1W7JB 1XFWO 2MJWB 5FI2A 1C07A 2FCEA 4JQ0D 4OR9B 4DCKA 2JXCA 2L50A 3BFHA 5DKRA 4M2QA 5TNCA 3KEVA 2M9GA 2I2RE 2M0RA 3BFAA 3I5HB 1F55A 1MXEA 1B8RA 1XFRA 3LK1A 5GQQC 1FI6A 3FWBA 5CSIA 2P6BB 3EVRA 2LM5A 4HRHA 1NYAA 1J55A 3VGOA 1XYDA 1CFFA 3BUOB 1MR8A 1RK9A 1NIWA 2BE6A 1CB1A 1SL9A 2P70A 3SG2A 2EC6C 1OSAA 1DJXA 4CFQA 2WORA 5DICA 5JJGA 2ZRTA 1BR4B 4FQTA 4PALA 1OZSA 5HL1A 1OOHA 1BR1B 4BY5A 4IJ7A 2JULA 2LUXA 1KQMC 2HPSA 1U5IB 3CTNA 4GUKA 2JT8A 2PQLA 1YVLA 1RECA 2BKHB 4JWQA 1K95A 2LHLA 3O2PA 4ORBB 1BF5A 3EKJA 1TNPA 2JNFA 4JD9A 3VRNA 3KHEA 1A75A 1M45A 1HQVA 1T14A 2FJYA 4A4BA 3Q8IA 4DRWA 3ZNIA 1CDMA 2JT3A 2BBNA 2LV7A 5D7FA 4PHNA 2K8MB 1OQPA 1Y0VH 1J1EA 2GTEA 1L7ZA 3EK7A 2Q4UA 1IIOA 3VRQA 1KQVA 3UO9A 4OVNF 5AXIA 3R1PA 1M31A 3NHTA 4XJKA 4DUQA 1N65A 3B88A 4MZJA 3CYZA 2F3YA 3CDNA 1P28A 1SSEB 1SL8A 2JC2A 1QJTA 1BMOA 3CR2A 1S6IA 3PFVA 1XFXO 3A8RA 1ZUZA 5FI6A 1EH2A 2M3WA 2JQ6A 2KAYA 3O4YA 3FE9A 1WDCB 3I5IB 2K7OA 2ZNDA 4MZKA 3SIBA 2Y5IA 4MEWA 3GK1A 3H4SE 1MHOA 2JTZA 2Q91A 2LMUA 1KK8B 2WCEA 2V53A 1YX7A 2K7DA 1DEKA 2IS9A 1ZACA 1OE9B 1VRKA 1YUUA 3D78A 2LAPA 2LLUA 2Y1MA 1M63B 1S5GZ 1XFZO 1SYMA 3OB1B 3OGNA 2SCPA 1CNPA 3WHTB 4ZCUA 1A2XA 1TCFA 3TUYB 2GGMA 3CZ0A 1NX3A 1TIZA 1W9ZA 2KLDA 1TN4A 1G8IA 2PALA 1SPYA 5B8IB 1KWOC 4YGEB 5HLVA 1B9AA 1D1OA 1XK4C 2M7NA 3PN7B 3S0DA 1OZOA 1CDPA 2GV5A 2KQ6A 2WCBA 3I5GC 2HF5A 2KYFA 4HRGA 1B7TZ 1CFPA 4U8DA 4OCIA 1NCZA 2KPHA 2QDIA 3JTDC 4WRIA 1PSRA 1OOGA 5AFPA 1SR6C 3S0BA 2O5GA 4PE4A 3PSRA 2ZNEA 3PLFB 2KFHA 1B8LA 3I5FC 4PHMA 2K7BA 1YR5A 1RJVA 3TDIA 1NX0A 1CDLA 2KLEA 2KDHA 2KFFA 3SG4A 1DJIA 2L4IA 4A4CA 1OW4A 1NPQA 1XFYO 4ORAB 1BODA 3ICBA 1S26D 1J7OA 1K9KA 1LXFC 1PALA 1TTXA 3FE6A 2WCHA 4NDDA 1GQMA 3VRPA 2I18A 3CABA 3PATA 3BUNB 3EVVA 2EHBA 5AEQA 1KCYA 3RM1A 1UHHA 2KI4B 4UPGA 5JOLA 3D74A 1V1FA 2K2FA 3KF9A 4QJ3B 2OTGC 3R1OA 4I5LB 4WQ3A 5CSJA 1QVIY 1CM4A 2L4HA 4FTGA 2YGUA 3BOWA 1J1DA 5KU1A 2WNDA 3K1EA 4CPVA 1IRJA 1HT9A 2LP3A 2CTNA 1YURA 1DMOA 2BL0B 1XK4A 4CFRA 1TNWA 1N2DA 1CFCA 3S0EA 1DT7B 3EKHA 1PVAA 3IQQA 4JKTA 2KOTA 1KK7Y 3SS4A 5HKYA 2BCXA 5I8NA 1S3PA 2QEBA 1LINA 4GGFC 2E30A 1A75B 2M1KB 2G2BA 2WC6A 3DF0A 2JPOA 2ZN9A 2L98A 5DKQA 1J7QA 3EK8A 3TS5C 2R2IA 3NHIA 1Q80A 1KSOA 4CLNA 1AJ5A 1XVJA 3D10A 2WC8A 2WCKA 1B7TY 1OOFA 4I5JA 1N0YA 5BPJA 1DJYA 1V1GA 1W7IB 4XJKB 1B8CA 1DF0A 1UWOA 2BAPA 2RGIA 1CM1A 1SK6D 3O78A 3OX5A 2ZRSA 1JFJA 3SS5A 1K8UA 1SBJA 2CXJA 2P71A 2WOSA 3HCMA 2LMTA 4MBEA 4C0JA 1AUIB 4YRUA 1ZFSA 4ZCVA 2EC6B 2JTTA 1KSMA 1PVBA 1IGVA 1TCOB 2PYQA 3DY9A 3O4XA 1JSAA 1CLLA 3CR4X 2F33A 4NDBA 3ZWHA 3D75A 1IG5A 2ERBA 2LANA 3CWGA 4DIRA 2CBLA 3LL8B 3QMEA 3RZSA 1IKUA 3IF7A 1KQMB 3D0YB 3JVTB 1SNLA 3NSLA 2KGBC 4MLWA 1X02A 2JOJA 2L2CA 1G33A 5G08A 4GGNA 3VROA 3KPXA 1LKJA 4GGFA 4AQIA 3IQOA 1IJ5A 2TN4A 4TNCA 1QS7A 2MBXA 2KAXA 4PE1A 1J7RA 1QX2A 2MLFC 5ER5A 1EL4A 1R6PA 5IBWA 1DJGA 3SJSA 3D76A 2JT0A 3L4LA 2M1UA 1UHKA 5D69A 5ER4X 1S6CA 4PCWA 1S6JA 3DXLA 1Z2CB 2F2PA 4GPLB 1KK8C 1F8HA 1PSBA 1TNXA 3BUXB 2NXQA 2NZ0A 3PJIA 1U5IA 1CDNA 1XFUO 2Y1NA 5HKWA 3WHUB 1NX2A 2MRDA 4C0KA 1Z4HA 3NSIA 2JZIA 4PHJA 2M8UA 2ZFDA 1UHIA 1QXPA 1EG4A 4P2YB 2ISDA 3DZTA 4Q04A 2LVKA 3CLNA 1CMGA 3AKBA 4DS7A 1NSHA 1M39A 2VRGA 1F4OA 1B4CA 1FI5A 1MF8B 1SCMC 2PSRA 4INWA 1AVSA 1FBVA 3V2LA 2KI6D 1RROA 1F4QA 5I94A 4IL1A 3R72A 2NCOA 2PVBA 3DD4A 2HQ8A 4MN0A 3AAJA 1RFJA 5CSNA 4ORCB 2OS8C 4PE0A 3BOWB 1SMGA 4MZLA 1BU3A 3D73A 4INXA 1KWOB 3AKAA 1LS8A 4R1EA 4I5KA 2L51A 1K94A 1QATA 1QV0A 1QX5B 2LVJA 5FYXA 2BCAA 2I94A 3K21A 5KSZA 3S0AA 1F70A 2E6WA 2QEOA 1M46A 4NDCA 3I5GB 3PM2A 2KAVA 3A4UB 3SS3A 4ETOA 2LLTA 5I2LA 1QIVA 2LCPA 1SL7A 2MAZA 2MHHA 3CZTX 1GGWA 1DGVA 3BYAA 3JTDB 4YGAA 2ZN8A 1SR6B 1Y1XA 4QJ5B 1G4YR 1OMVA 2FCDA 1FF1A 1K2HA 3I5FB 1C3YA 3TDUA 1SCVA 1WLZA 1B47A 3GK2A 3UNWA 2O60A 2QPTA 3EVUA 2BBMA 1PULA 3DVMA 3LCPC 2H2KA 1JFKA 2JNXA 1DF0B 2BE4A 3I5HC 1C7VA 1EXRA 4P5OE 1S36A 1SW8A 2KI6C 1F71A 2H8VA 2WCMA 3OBVA 3SG7A 1L2OB 4FQOA 1S5GY 2JRFA 1XA5A 2LLSA 1J7PA 3LLEA 4WQ2A 1DC1A 2LC5A 2L5YA 3OB2B 1A4PA 1H4BA 4PT1A 1FPWA 1B1GA 1EJ3A 1K93D 3TDZA 1ODBA 2OTGB
chains in the Genus database with same CATH topology
2PMYA 1KFXL 1ZMZA 4C0LA 4L9MA 4M2OA 4HSZA 2KHNA 1DJWA 1WY9A 2F3ZA 2NCPA 5DKNA 3PALA 1K90D 1BJFA 2KGRA 4AOMA 2F2OA 1NCXA 2KYCA 2LVIA 1NX1A 1YX8A 4OV2A 2H61C 2JXLA 1H8BA 1YVHA 2QACA 4YI9A 1QX7A 1SY9A 1UHNA 1JUOA 1TOPA 2A4JA 1JBAA 1KFXS 2G9BA 2LUCA 1ALWA 4OKHA 3TZ1A 1DGUA 3FIAA 3OP0A 4NQGA 1UUSA 1UP5A 3DVJA 3FS7A 4BY4A 2PRUA 4MVFA 3AAKA 1XFVO 2SASA 3DVEA 1AK8A 1CMFA 3TS5B 4PE7A 1QTXA 4GNKB 2LP2A 1NP8A 1IQ5A 1FW4A 1TNQA 1MQ1A 5HYDA 3OX6A 1Y1UA 1AP4A 5F6TA 1LVCD 2HETA 2GGZA 3FWCA 3JVTC 1YUTA 3QRXA 1YRUB 3WNXB 2B1UA 2KQYA 3GOFA 4M2PA 4E68A 2F8PA 1AHRA 3GK4X 1PK0D 1YUSA 3WXAA 1YRTB 3O6BA 3CR5X 5AERA 2L2EA 5J3XA 2LHIA 1UURA 1QASA 1CFDA 1JF0A 1SRAA 1TRFA 2D8NA 3M0WA 3RLZA 2KSPA 1BOCA 2M29A 1Y6WA 5K89A 1WDCC 4CIDA 3I5IC 3KO0A 4MRXA 1JF2A 1DTLA 2Y4QA 1A03A 1AJ4A 1WRLA 2BKIB 4AQJA 1LA0A 2AAOA 3DVKA 2H61A 2L0PA 3F45A 3PM8A 4GBAA 2K61A 1LA3A 1DVIA 2CCMA 2HQWA 2L5XB 2LNKA 4GFTA 1RTP1 2LVVA 4YBHB 3VRRA 3SIAA 4ICBA 2EGDA 1QV1A 2CNPA 1C7WA 4MSPA 2BECA 2KFGA 3TUYC 3C1VA 4PDZA 2NLNA 3EK4A 4YGBB 4USLA 1IH0A 2FOTA 2BCBA 4D1EA 1Y1AA 2MLEC 1QVIZ 1GGZA 3PN7C 1BLQA 1BG1A 3MSEB 1ZOTB 4PHKA 3SG6A 1OOJA 1A29A 1SKTA 4N5XA 2JU0A 3BQ3A 4N1FA 5PALA 5KTYA 3CS1A 1WRKA 5HKZA 3D0YA 4QJ4B 4MRYA 1EG3A 4GAOA 3BUMB 2CT9A 1ALVA 3BUWB 2ZKMX 2M7LA 1KK7Z 2DOQA 1E8AA 2JPTA 1MXLC 1QLKA 1OMDA 5I2OA 3OHMB 1WLMA 1NCYA 2JWWA 2OPOA 2K0JA 1K96A 1K9PA 1GJYA 4YI8A 1SCMB 2M97A 1RWYA 1IWQA 1NWDA 3NSOA 2COLB 1NUBA 1QLSA 1KFUL 4YGCB 2AMIA 1XO5A 2WCFA 4YGDB 2PASA 2MA2A 1JC2A 2M49B 3LK0A 1DJZA 3NSKA 2KI4C 3DF0B 2K2AA 1IQ3A 2FJUB 5AANA 3HX4A 4N1GA 4I5NB 1R2UA 4JPZB 2OS8B 1CLMA 1YTZC 4F0ZB 5I2QA 3CGAA 5CSFA 4XYNA 2KNEA 5HLOA 1CKKA 1KFUS 2LE9B 1JWDA 1OMRA 1MWNA 1K9UA 2KBIA 2BL0C 2LMVA 1S1EA 3SG5A 1L2OC 2K7CA 2KBMA 1WRZA 1IJ6A 1F54A 2I7AA 1CTRA 3BXKA 2AUCA 4HREE 1QIWA 5CPVA 3SG3A 3E3RA 1UHJA 1DJHA 1MUXA 3NXAA 1PRWA 1BT6A 1W7JB 1XFWO 2MJWB 1C07A 2FCEA 4JQ0D 4OR9B 4DCKA 2JXCA 2L50A 5DKRA 4M2QA 5TNCA 3KEVA 2M9GA 2I2RE 2M0RA 3I5HB 1F55A 1FI6A 1MXEA 1B8RA 3LK1A 5GQQC 3FWBA 5CSIA 2P6BB 3EVRA 2LM5A 4HRHA 1NYAA 1J55A 3VGOA 1XYDA 1CFFA 3BUOB 1MR8A 1RK9A 1NIWA 2BE6A 1CB1A 1SL9A 3SG2A 2EC6C 1OSAA 1DJXA 4CFQA 2WORA 5JJGA 2ZRTA 1BR4B 4PALA 1OZSA 1BR1B 4BY5A 2JULA 2LUXA 1KQMC 2HPSA 1U5IB 3CTNA 4GUKA 2JT8A 1YVLA 1RECA 2BKHB 4JWQA 1K95A 2LHLA 3O2PA 4ORBB 1BF5A 3EKJA 1TNPA 2JNFA 3VRNA 3KHEA 1A75A 1M45A 1HQVA 4A4BA 4DRWA 3ZNIA 1CDMA 2JT3A 2BBNA 2LV7A 5D7FA 4PHNA 2K8MB 1OQPA 1Y0VH 1J1EA 1L7ZA 3EK7A 2Q4UA 3VRQA 1KQVA 4OVNF 5AXIA 4DUQA 1M31A 4XJKA 1N65A 4MZJA 2F3YA 1SL8A 2JC2A 1QJTA 1BMOA 3CR2A 1S6IA 3PFVA 1XFXO 3A8RA 1ZUZA 1EH2A 2M3WA 2JQ6A 2KAYA 3O4YA 1WDCB 3I5IB 2K7OA 2ZNDA 4MZKA 3SIBA 2Y5IA 4MEWA 3GK1A 3H4SE 1MHOA 2JTZA 2Q91A 2LMUA 1KK8B 2WCEA 2V53A 1YX7A 2K7DA 2IS9A 1ZACA 1OE9B 1VRKA 1YUUA 2LAPA 2LLUA 2Y1MA 1M63B 1S5GZ 1XFZO 1SYMA 3OB1B 1CNPA 2SCPA 3WHTB 4ZCUA 1A2XA 1TCFA 3TUYB 2GGMA 1NX3A 1TIZA 1TN4A 1G8IA 2PALA 1SPYA 5B8IB 1KWOC 4YGEB 5HLVA 1B9AA 1D1OA 1XK4C 2M7NA 3PN7B 1OZOA 1CDPA 2GV5A 2KQ6A 2WCBA 3I5GC 2HF5A 2KYFA 4HRGA 1B7TZ 1CFPA 4U8DA 4OCIA 1NCZA 3JTDC 4WRIA 1PSRA 5AFPA 1SR6C 2O5GA 4PE4A 3PSRA 2ZNEA 3PLFB 2KFHA 1B8LA 3I5FC 4PHMA 2K7BA 1YR5A 1RJVA 3TDIA 1NX0A 1CDLA 3SG4A 2KDHA 2KFFA 4A4CA 1DJIA 2L4IA 1NPQA 1XFYO 4ORAB 1BODA 3ICBA 1S26D 1J7OA 1K9KA 1LXFC 1PALA 1TTXA 4NDDA 1GQMA 3VRPA 2I18A 3PATA 5AEQA 3BUNB 3EVVA 2EHBA 1KCYA 3RM1A 1UHHA 2KI4B 4UPGA 5JOLA 1V1FA 2K2FA 3KF9A 4QJ3B 2OTGC 4I5LB 4WQ3A 5CSJA 1QVIY 1CM4A 2L4HA 4FTGA 3BOWA 5KU1A 1J1DA 2WNDA 4CPVA 1IRJA 1HT9A 2LP3A 2CTNA 1YURA 1DMOA 2BL0B 1XK4A 4CFRA 1TNWA 1N2DA 1CFCA 1DT7B 3EKHA 1PVAA 3IQQA 1CLBA 2KOTA 1KK7Y 5HKYA 2BCXA 5I8NA 1S3PA 4GGFC 1LINA 2E30A 1A75B 2M1KB 2G2BA 3DF0A 2ZN9A 2L98A 5DKQA 1J7QA 3EK8A 3TS5C 2R2IA 1Q80A 1KSOA 4CLNA 1AJ5A 1XVJA 3D10A 2WC8A 1B7TY 4I5JA 1N0YA 5BPJA 1DJYA 1V1GA 1W7IB 4XJKB 1B8CA 1DF0A 1UWOA 2RGIA 1CM1A 1SK6D 3O78A 3OX5A 2ZRSA 1JFJA 1K8UA 1SBJA 2CXJA 2WOSA 3HCMA 2LMTA 4MBEA 4C0JA 1AUIB 4YRUA 1ZFSA 4ZCVA 2EC6B 2JTTA 1KSMA 1PVBA 1IGVA 1TCOB 1JSAA 1CLLA 3CR4X 2F33A 4NDBA 3ZWHA 1IG5A 2LANA 3CWGA 4DIRA 2CBLA 3LL8B 1IKUA 3IF7A 1KQMB 3D0YB 3JVTB 1SNLA 3NSLA 2KGBC 4MLWA 1X02A 2JOJA 3VROA 1G33A 5G08A 4GGNA 3KPXA 1LKJA 4GGFA 4AQIA 3IQOA 1IJ5A 2TN4A 4TNCA 1QS7A 2MBXA 2KAXA 4PE1A 1J7RA 1QX2A 2MLFC 5ER5A 1EL4A 1R6PA 5IBWA 1DJGA 3SJSA 2JT0A 2M1UA 1UHKA 5D69A 5ER4X 1S6CA 4PCWA 1S6JA 2F2PA 4GPLB 1KK8C 1F8HA 1PSBA 1TNXA 3BUXB 2NXQA 2NZ0A 1U5IA 1CDNA 1XFUO 2Y1NA 5HKWA 3WHUB 1NX2A 2MRDA 4C0KA 3NSIA 2JZIA 4PHJA 2M8UA 2ZFDA 1UHIA 1QXPA 1EG4A 4P2YB 2ISDA 4Q04A 2LVKA 3CLNA 1CMGA 3AKBA 4DS7A 1NSHA 1M39A 2VRGA 1F4OA 1B4CA 1FI5A 1MF8B 1SCMC 2PSRA 1AVSA 1FBVA 2KI6D 1RROA 1F4QA 4IL1A 2NCOA 2PVBA 3DD4A 2HQ8A 4MN0A 3AAJA 1RFJA 5CSNA 4ORCB 2OS8C 4PE0A 3BOWB 1SMGA 4MZLA 1BU3A 1KWOB 3AKAA 4R1EA 4I5KA 2L51A 1K94A 1QATA 1QV0A 1QX5B 2LVJA 5FYXA 2BCAA 2I94A 3K21A 5KSZA 1F70A 2E6WA 4NDCA 1M46A 3I5GB 2KAVA 3A4UB 4ETOA 2LLTA 5I2LA 1QIVA 2LCPA 1SL7A 2MAZA 2MHHA 3CZTX 1GGWA 1DGVA 3BYAA 3JTDB 4YGAA 2ZN8A 1SR6B 1Y1XA 4QJ5B 1G4YR 1OMVA 2FCDA 1FF1A 1K2HA 3I5FB 3TDUA 1SCVA 1WLZA 1B47A 3GK2A 2O60A 2QPTA 3EVUA 2BBMA 1PULA 3DVMA 3LCPC 2H2KA 1JFKA 2JNXA 1DF0B 2BE4A 3I5HC 1C7VA 1EXRA 4P5OE 1S36A 1SW8A 2KI6C 1F71A 3SG7A 1L2OB 4FQOA 1S5GY 2JRFA 1XA5A 2LLSA 1J7PA 3LLEA 4WQ2A 2LC5A 1H4BA 3OB2B 1A4PA 1FPWA 1B1GA 1EJ3A 1K93D 3TDZA 1ODBA 2OTGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMY A;  1KFX L;  1ZMZ A;  4C0L A;  4L9M A;  4M2O A;  4HSZ A;  2KHN A;  1DJW A;  1WY9 A;  2F3Z A;  2NCP A;  5DKN A;  3PAL A;  1K90 D;  1BJF A;  2KGR A;  4AOM A;  2F2O A;  1NCX A;  2KYC A;  2LVI A;  1NX1 A;  1YX8 A;  4OV2 A;  2H61 C;  2JXL A;  1H8B A;  1YVH A;  2QAC A;  4YI9 A;  1QX7 A;  1SY9 A;  1UHN A;  1JUO A;  1TOP A;  2A4J A;  1JBA A;  1KFX S;  2G9B A;  2LUC A;  1ALW A;  4OKH A;  3TZ1 A;  1DGU A;  3FIA A;  3OP0 A;  4NQG A;  1UUS A;  1UP5 A;  3DVJ A;  3FS7 A;  4BY4 A;  2PRU A;  4MVF A;  3AAK A;  1XFV O;  2SAS A;  3DVE A;  1AK8 A;  1CMF A;  3TS5 B;  4PE7 A;  1QTX A;  4GNK B;  2LP2 A;  1NP8 A;  1IQ5 A;  1FW4 A;  1TNQ A;  1MQ1 A;  5HYD A;  3OX6 A;  1Y1U A;  1AP4 A;  5F6T A;  1LVC D;  2HET A;  2GGZ A;  3FWC A;  3JVT C;  1YUT A;  3QRX A;  1YRU B;  3WNX B;  2B1U A;  2KQY A;  3GOF A;  4M2P A;  4E68 A;  2F8P A;  1AHR A;  3GK4 X;  1PK0 D;  1YUS A;  3WXA A;  1YRT B;  3O6B A;  3CR5 X;  5AER A;  2L2E A;  5J3X A;  2LHI A;  1UUR A;  1QAS A;  1CFD A;  1JF0 A;  1SRA A;  1TRF A;  2D8N A;  3M0W A;  3RLZ A;  2KSP A;  1BOC A;  2M29 A;  1Y6W A;  5K89 A;  1WDC C;  4CID A;  3I5I C;  3KO0 A;  4MRX A;  1JF2 A;  1DTL A;  2Y4Q A;  1A03 A;  1AJ4 A;  1WRL A;  2BKI B;  4AQJ A;  1LA0 A;  2AAO A;  3DVK A;  2H61 A;  2L0P A;  3F45 A;  3PM8 A;  4GBA A;  2K61 A;  1LA3 A;  1DVI A;  2CCM A;  2HQW A;  2L5X B;  2LNK A;  4GFT A;  1RTP 1;  2LVV A;  4YBH B;  3VRR A;  3SIA A;  4ICB A;  2EGD A;  1QV1 A;  2CNP A;  1C7W A;  4MSP A;  2BEC A;  2KFG A;  3TUY C;  3C1V A;  4PDZ A;  2NLN A;  3EK4 A;  4YGB B;  4USL A;  1IH0 A;  2FOT A;  2BCB A;  4D1E A;  1Y1A A;  2MLE C;  1QVI Z;  1GGZ A;  3PN7 C;  1BLQ A;  1BG1 A;  3MSE B;  1ZOT B;  4PHK A;  3SG6 A;  1OOJ A;  1A29 A;  1SKT A;  4N5X A;  2JU0 A;  3BQ3 A;  4N1F A;  5PAL A;  5KTY A;  3CS1 A;  1WRK A;  5HKZ A;  3D0Y A;  4QJ4 B;  4MRY A;  1EG3 A;  4GAO A;  3BUM B;  2CT9 A;  1ALV A;  3BUW B;  2ZKM X;  2M7L A;  1KK7 Z;  2DOQ A;  1E8A A;  2JPT A;  1MXL C;  1QLK A;  1OMD A;  5I2O A;  3OHM B;  1WLM A;  1NCY A;  2JWW A;  2OPO A;  2K0J A;  1K96 A;  1K9P A;  1GJY A;  4YI8 A;  1SCM B;  2M97 A;  1RWY A;  1IWQ A;  1NWD A;  3NSO A;  2COL B;  1NUB A;  1QLS A;  1KFU L;  4YGC B;  2AMI A;  1XO5 A;  2WCF A;  4YGD B;  2PAS A;  2MA2 A;  1JC2 A;  2M49 B;  3LK0 A;  1DJZ A;  3NSK A;  2KI4 C;  3DF0 B;  2K2A A;  1IQ3 A;  2FJU B;  5AAN A;  3HX4 A;  4N1G A;  4I5N B;  1R2U A;  4JPZ B;  2OS8 B;  1CLM A;  1YTZ C;  4F0Z B;  5I2Q A;  3CGA A;  5CSF A;  4XYN A;  2KNE A;  5HLO A;  1CKK A;  1KFU S;  2LE9 B;  1JWD A;  1OMR A;  1MWN A;  1K9U A;  2KBI A;  2BL0 C;  2LMV A;  1S1E A;  3SG5 A;  1L2O C;  2K7C A;  2KBM A;  1WRZ A;  1IJ6 A;  1F54 A;  2I7A A;  1CTR A;  3BXK A;  2AUC A;  4HRE E;  1QIW A;  5CPV A;  3SG3 A;  3E3R A;  1UHJ A;  1DJH A;  1MUX A;  3NXA A;  1PRW A;  1BT6 A;  1W7J B;  1XFW O;  2MJW B;  1C07 A;  2FCE A;  4JQ0 D;  4OR9 B;  4DCK A;  2JXC A;  2L50 A;  5DKR A;  4M2Q A;  5TNC A;  3KEV A;  2M9G A;  2I2R E;  2M0R A;  3I5H B;  1F55 A;  1FI6 A;  1MXE A;  1B8R A;  3LK1 A;  5GQQ C;  3FWB A;  5CSI A;  2P6B B;  3EVR A;  2LM5 A;  4HRH A;  1NYA A;  1J55 A;  3VGO A;  1XYD A;  1CFF A;  3BUO B;  1MR8 A;  1RK9 A;  1NIW A;  2BE6 A;  1CB1 A;  1SL9 A;  3SG2 A;  2EC6 C;  1OSA A;  1DJX A;  4CFQ A;  2WOR A;  5JJG A;  2ZRT A;  1BR4 B;  4PAL A;  1OZS A;  1BR1 B;  4BY5 A;  2JUL A;  2LUX A;  1KQM C;  2HPS A;  1U5I B;  3CTN A;  4GUK A;  2JT8 A;  1YVL A;  1REC A;  2BKH B;  4JWQ A;  1K95 A;  2LHL A;  3O2P A;  4ORB B;  1BF5 A;  3EKJ A;  1TNP A;  2JNF A;  3VRN A;  3KHE A;  1A75 A;  1M45 A;  1HQV A;  4A4B A;  4DRW A;  3ZNI A;  1CDM A;  2JT3 A;  2BBN A;  2LV7 A;  5D7F A;  4PHN A;  2K8M B;  1OQP A;  1Y0V H;  1J1E A;  1L7Z A;  3EK7 A;  2Q4U A;  3VRQ A;  1KQV A;  4OVN F;  5AXI A;  4DUQ A;  1M31 A;  4XJK A;  1N65 A;  4MZJ A;  2F3Y A;  1SL8 A;  2JC2 A;  1QJT A;  1BMO A;  3CR2 A;  1S6I A;  3PFV A;  1XFX O;  3A8R A;  1ZUZ A;  1EH2 A;  2M3W A;  2JQ6 A;  2KAY A;  3O4Y A;  1WDC B;  3I5I B;  2K7O A;  2ZND A;  4MZK A;  3SIB A;  2Y5I A;  4MEW A;  3GK1 A;  3H4S E;  1MHO A;  2JTZ A;  2Q91 A;  2LMU A;  1KK8 B;  2WCE A;  2V53 A;  1YX7 A;  2K7D A;  2IS9 A;  1ZAC A;  1OE9 B;  1VRK A;  1YUU A;  2LAP A;  2LLU A;  2Y1M A;  1M63 B;  1S5G Z;  1XFZ O;  1SYM A;  3OB1 B;  1CNP A;  2SCP A;  3WHT B;  4ZCU A;  1A2X A;  1TCF A;  3TUY B;  2GGM A;  1NX3 A;  1TIZ A;  1TN4 A;  1G8I A;  2PAL A;  1SPY A;  5B8I B;  1KWO C;  4YGE B;  5HLV A;  1B9A A;  1D1O A;  1XK4 C;  2M7N A;  3PN7 B;  1OZO A;  1CDP A;  2GV5 A;  2KQ6 A;  2WCB A;  3I5G C;  2HF5 A;  2KYF A;  4HRG A;  1B7T Z;  1CFP A;  4U8D A;  4OCI A;  1NCZ A;  3JTD C;  4WRI A;  1PSR A;  5AFP A;  1SR6 C;  2O5G A;  4PE4 A;  3PSR A;  2ZNE A;  3PLF B;  2KFH A;  1B8L A;  3I5F C;  4PHM A;  2K7B A;  1YR5 A;  1RJV A;  3TDI A;  1NX0 A;  1CDL A;  3SG4 A;  2KDH A;  2KFF A;  4A4C A;  1DJI A;  2L4I A;  1NPQ A;  1XFY O;  4ORA B;  1BOD A;  3ICB A;  1S26 D;  1J7O A;  1K9K A;  1LXF C;  1PAL A;  1TTX A;  4NDD A;  1GQM A;  3VRP A;  2I18 A;  3PAT A;  5AEQ A;  3BUN B;  3EVV A;  2EHB A;  1KCY A;  3RM1 A;  1UHH A;  2KI4 B;  4UPG A;  5JOL A;  1V1F A;  2K2F A;  3KF9 A;  4QJ3 B;  2OTG C;  4I5L B;  4WQ3 A;  5CSJ A;  1QVI Y;  1CM4 A;  2L4H A;  4FTG A;  3BOW A;  5KU1 A;  1J1D A;  2WND A;  4CPV A;  1IRJ A;  1HT9 A;  2LP3 A;  2CTN A;  1YUR A;  1DMO A;  2BL0 B;  1XK4 A;  4CFR A;  1TNW A;  1N2D A;  1CFC A;  1DT7 B;  3EKH A;  1PVA A;  3IQQ A;  1CLB A;  2KOT A;  1KK7 Y;  5HKY A;  2BCX A;  5I8N A;  1S3P A;  4GGF C;  1LIN A;  2E30 A;  1A75 B;  2M1K B;  2G2B A;  3DF0 A;  2ZN9 A;  2L98 A;  5DKQ A;  1J7Q A;  3EK8 A;  3TS5 C;  2R2I A;  1Q80 A;  1KSO A;  4CLN A;  1AJ5 A;  1XVJ A;  3D10 A;  2WC8 A;  1B7T Y;  4I5J A;  1N0Y A;  5BPJ A;  1DJY A;  1V1G A;  1W7I B;  4XJK B;  1B8C A;  1DF0 A;  1UWO A;  2RGI A;  1CM1 A;  1SK6 D;  3O78 A;  3OX5 A;  2ZRS A;  1JFJ A;  1K8U A;  1SBJ A;  2CXJ A;  2WOS A;  3HCM A;  2LMT A;  4MBE A;  4C0J A;  1AUI B;  4YRU A;  1ZFS A;  4ZCV A;  2EC6 B;  2JTT A;  1KSM A;  1PVB A;  1IGV A;  1TCO B;  1JSA A;  1CLL A;  3CR4 X;  2F33 A;  4NDB A;  3ZWH A;  1IG5 A;  2LAN A;  3CWG A;  4DIR A;  2CBL A;  3LL8 B;  1IKU A;  3IF7 A;  1KQM B;  3D0Y B;  3JVT B;  1SNL A;  3NSL A;  2KGB C;  4MLW A;  1X02 A;  2JOJ A;  3VRO A;  1G33 A;  5G08 A;  4GGN A;  3KPX A;  1LKJ A;  4GGF A;  4AQI A;  3IQO A;  1IJ5 A;  2TN4 A;  4TNC A;  1QS7 A;  2MBX A;  2KAX A;  4PE1 A;  1J7R A;  1QX2 A;  2MLF C;  5ER5 A;  1EL4 A;  1R6P A;  5IBW A;  1DJG A;  3SJS A;  2JT0 A;  2M1U A;  1UHK A;  5D69 A;  5ER4 X;  1S6C A;  4PCW A;  1S6J A;  2F2P A;  4GPL B;  1KK8 C;  1F8H A;  1PSB A;  1TNX A;  3BUX B;  2NXQ A;  2NZ0 A;  1U5I A;  1CDN A;  1XFU O;  2Y1N A;  5HKW A;  3WHU B;  1NX2 A;  2MRD A;  4C0K A;  3NSI A;  2JZI A;  4PHJ A;  2M8U A;  2ZFD A;  1UHI A;  1QXP A;  1EG4 A;  4P2Y B;  2ISD A;  4Q04 A;  2LVK A;  3CLN A;  1CMG A;  3AKB A;  4DS7 A;  1NSH A;  1M39 A;  2VRG A;  1F4O A;  1B4C A;  1FI5 A;  1MF8 B;  1SCM C;  2PSR A;  1AVS A;  1FBV A;  2KI6 D;  1RRO A;  1F4Q A;  4IL1 A;  2NCO A;  2PVB A;  3DD4 A;  2HQ8 A;  4MN0 A;  3AAJ A;  1RFJ A;  5CSN A;  4ORC B;  2OS8 C;  4PE0 A;  3BOW B;  1SMG A;  4MZL A;  1BU3 A;  1KWO B;  3AKA A;  4R1E A;  4I5K A;  2L51 A;  1K94 A;  1QAT A;  1QV0 A;  1QX5 B;  2LVJ A;  5FYX A;  2BCA A;  2I94 A;  3K21 A;  5KSZ A;  1F70 A;  2E6W A;  4NDC A;  1M46 A;  3I5G B;  2KAV A;  3A4U B;  4ETO A;  2LLT A;  5I2L A;  1QIV A;  2LCP A;  1SL7 A;  2MAZ A;  2MHH A;  3CZT X;  1GGW A;  1DGV A;  3BYA A;  3JTD B;  4YGA A;  2ZN8 A;  1SR6 B;  1Y1X A;  4QJ5 B;  1G4Y R;  1OMV A;  2FCD A;  1FF1 A;  1K2H A;  3I5F B;  3TDU A;  1SCV A;  1WLZ A;  1B47 A;  3GK2 A;  2O60 A;  2QPT A;  3EVU A;  2BBM A;  1PUL A;  3DVM A;  3LCP C;  2H2K A;  1JFK A;  2JNX A;  1DF0 B;  2BE4 A;  3I5H C;  1C7V A;  1EXR A;  4P5O E;  1S36 A;  1SW8 A;  2KI6 C;  1F71 A;  3SG7 A;  1L2O B;  4FQO A;  1S5G Y;  2JRF A;  1XA5 A;  2LLS A;  1J7P A;  3LLE A;  4WQ2 A;  2LC5 A;  1H4B A;  3OB2 B;  1A4P A;  1FPW A;  1B1G A;  1EJ3 A;  1K93 D;  3TDZ A;  1ODB A;  2OTG B; 
#chains in the Genus database with same CATH topology
 2PMY A;  1KFX L;  3L47 A;  1ZMZ A;  4C0L A;  4L9M A;  4M2O A;  1DQE A;  1TUZ A;  4HSZ A;  5EL2 A;  2KHN A;  1DJW A;  1WY9 A;  2F3Z A;  2NCP A;  3B86 A;  3PAL A;  5DKN A;  1K90 D;  1BJF A;  2KGR A;  4AOM A;  2F2O A;  1NCX A;  2KYC A;  2LVI A;  1NX1 A;  1YX8 A;  4OV2 A;  2H61 C;  2JXL A;  1H8B A;  1YVH A;  2QAC A;  4YI9 A;  1QX7 A;  1SY9 A;  3N7H A;  1UHN A;  1JUO A;  1TOP A;  2A4J A;  1JBA A;  1KFX S;  3B87 A;  2G9B A;  2LUC A;  1ALW A;  4OKH A;  3TZ1 A;  1DGU A;  1TUJ A;  3FIA A;  3OP0 A;  4NQG A;  1UUS A;  1UP5 A;  3NGV A;  3DVJ A;  3FS7 A;  4BY4 A;  1OOI X;  2PRU A;  3L4A A;  4MVF A;  3AAK A;  1XFV O;  2SAS A;  3DVE A;  1AK8 A;  1CMF A;  3TS5 B;  4PE7 A;  1QTX A;  4GNK B;  2LP2 A;  1NP8 A;  1IQ5 A;  3IVT A;  1FW4 A;  1TNQ A;  1MQ1 A;  5HYD A;  3OX6 A;  1Y1U A;  1AP4 A;  5F6T A;  3DYE A;  1LVC D;  2HET A;  2GGZ A;  3FWC A;  3JVT C;  1YUT A;  3QRX A;  1YRU B;  3WNX B;  3CZ2 A;  2B1U A;  2KQY A;  3GOF A;  4M2P A;  4E68 A;  2F8P A;  1AHR A;  3GK4 X;  1PK0 D;  1YUS A;  3WXA A;  3S0G A;  1YRT B;  3O6B A;  3CR5 X;  5AER A;  2L2E A;  5J3X A;  2LHI A;  1UUR A;  1QAS A;  1CFD A;  1JF0 A;  1SRA A;  1TRF A;  2D8N A;  3M0W A;  3RLZ A;  2KSP A;  1BOC A;  2M29 A;  3VB1 A;  1C3Z A;  1Y6W A;  1WDC C;  4CID A;  3I5I C;  5FI7 A;  5K89 A;  3KO0 A;  4MRX A;  1JF2 A;  1DTL A;  2Y4Q A;  1GM0 A;  1A03 A;  1AJ4 A;  1CLB A;  2WCL A;  1WRL A;  2BKI B;  4AQJ A;  1LA0 A;  2AAO A;  3DVK A;  2H61 A;  2L0P A;  3F45 A;  2WC5 A;  3PM8 A;  4GBA A;  2K61 A;  1LA3 A;  1DVI A;  2CCM A;  2HQW A;  2L5X B;  2LNK A;  3R1V A;  4GFT A;  1RTP 1;  2LVV A;  2K60 A;  4YBH B;  3VRR A;  3SIA A;  4ICB A;  4OZD A;  2EGD A;  1QV1 A;  1C7W A;  2CNP A;  4MSP A;  2BEC A;  2KFG A;  3TUY C;  3C1V A;  4PDZ A;  2NLN A;  3EK4 A;  4YGB B;  4USL A;  1IH0 A;  2FOT A;  2BCB A;  4D1E A;  1Y1A A;  2MLE C;  1QVI Z;  1GGZ A;  3PN7 C;  1BLQ A;  3B7A A;  1BG1 A;  3MSE B;  3CZ1 A;  1ZOT B;  4PHK A;  3SG6 A;  1OOJ A;  1A29 A;  1SKT A;  4N5X A;  2JU0 A;  3BQ3 A;  4N1F A;  5PAL A;  5KTY A;  3CS1 A;  1WRK A;  5HKZ A;  3D0Y A;  4QJ4 B;  4MRY A;  1EG3 A;  4GAO A;  3BUM B;  2CT9 A;  1ALV A;  3BUW B;  2ZKM X;  2M7L A;  1KK7 Z;  3BJH A;  2DOQ A;  1E8A A;  2JPT A;  3FE8 A;  1MXL C;  1QLK A;  1OMD A;  5I2O A;  3OHM B;  1WLM A;  1NCY A;  2JWW A;  2OPO A;  2K0J A;  2QEH A;  1K96 A;  1K9P A;  1GJY A;  1QWV A;  3D77 A;  4YI8 A;  1ORG A;  3BFB A;  1SCM B;  2M97 A;  1RWY A;  1IWQ A;  1NWD A;  3NSO A;  2COL B;  1NUB A;  1QLS A;  1KFU L;  4YGC B;  2AMI A;  1XO5 A;  2WCF A;  4YGD B;  2PAS A;  2MA2 A;  1JC2 A;  2M49 B;  3LK0 A;  4KYN A;  1DJZ A;  3NSK A;  2KI4 C;  3DF0 B;  2K2A A;  1IQ3 A;  3EG5 B;  2FJU B;  5AAN A;  3HX4 A;  4N1G A;  3S0F A;  4I5N B;  1DEL A;  1R2U A;  3B6X A;  4JPZ B;  2OS8 B;  2QEV A;  1CLM A;  1YTZ C;  4F0Z B;  5I2Q A;  3CGA A;  5CSF A;  4XYN A;  2KNE A;  5HLO A;  1TWO A;  1CKK A;  1KFU S;  2LE9 B;  5D3O A;  1JWD A;  1OMR A;  1MWN A;  1K9U A;  2KBI A;  2BL0 C;  2LMV A;  1S1E A;  3SG5 A;  1L2O C;  2WCJ A;  2K7C A;  2KBM A;  4F7F A;  1WRZ A;  1IJ6 A;  1F54 A;  2I7A A;  1CTR A;  3BXK A;  2AUC A;  4HRE E;  1QIW A;  5CPV A;  3SG3 A;  3E3R A;  1UHJ A;  1DJH A;  1MUX A;  3NXA A;  1PRW A;  2BNX A;  1BT6 A;  1W7J B;  1XFW O;  2MJW B;  5FI2 A;  1C07 A;  2FCE A;  4JQ0 D;  4OR9 B;  4DCK A;  2JXC A;  2L50 A;  3BFH A;  5DKR A;  4M2Q A;  5TNC A;  3KEV A;  2M9G A;  2I2R E;  2M0R A;  3BFA A;  3I5H B;  1F55 A;  1MXE A;  1B8R A;  1XFR A;  3LK1 A;  5GQQ C;  1FI6 A;  3FWB A;  5CSI A;  2P6B B;  3EVR A;  2LM5 A;  4HRH A;  1NYA A;  1J55 A;  3VGO A;  1XYD A;  1CFF A;  3BUO B;  1MR8 A;  1RK9 A;  1NIW A;  2BE6 A;  1CB1 A;  1SL9 A;  2P70 A;  3SG2 A;  2EC6 C;  1OSA A;  1DJX A;  4CFQ A;  2WOR A;  5DIC A;  5JJG A;  2ZRT A;  1BR4 B;  4FQT A;  4PAL A;  1OZS A;  5HL1 A;  1OOH A;  1BR1 B;  4BY5 A;  4IJ7 A;  2JUL A;  2LUX A;  1KQM C;  2HPS A;  1U5I B;  3CTN A;  4GUK A;  2JT8 A;  2PQL A;  1YVL A;  1REC A;  2BKH B;  4JWQ A;  1K95 A;  2LHL A;  3O2P A;  4ORB B;  1BF5 A;  3EKJ A;  1TNP A;  2JNF A;  4JD9 A;  3VRN A;  3KHE A;  1A75 A;  1M45 A;  1HQV A;  1T14 A;  2FJY A;  4A4B A;  3Q8I A;  4DRW A;  3ZNI A;  1CDM A;  2JT3 A;  2BBN A;  2LV7 A;  5D7F A;  4PHN A;  2K8M B;  1OQP A;  1Y0V H;  1J1E A;  2GTE A;  1L7Z A;  3EK7 A;  2Q4U A;  1IIO A;  3VRQ A;  1KQV A;  3UO9 A;  4OVN F;  5AXI A;  3R1P A;  1M31 A;  3NHT A;  4XJK A;  4DUQ A;  1N65 A;  3B88 A;  4MZJ A;  3CYZ A;  2F3Y A;  3CDN A;  1P28 A;  1SSE B;  1SL8 A;  2JC2 A;  1QJT A;  1BMO A;  3CR2 A;  1S6I A;  3PFV A;  1XFX O;  3A8R A;  1ZUZ A;  5FI6 A;  1EH2 A;  2M3W A;  2JQ6 A;  2KAY A;  3O4Y A;  3FE9 A;  1WDC B;  3I5I B;  2K7O A;  2ZND A;  4MZK A;  3SIB A;  2Y5I A;  4MEW A;  3GK1 A;  3H4S E;  1MHO A;  2JTZ A;  2Q91 A;  2LMU A;  1KK8 B;  2WCE A;  2V53 A;  1YX7 A;  2K7D A;  1DEK A;  2IS9 A;  1ZAC A;  1OE9 B;  1VRK A;  1YUU A;  3D78 A;  2LAP A;  2LLU A;  2Y1M A;  1M63 B;  1S5G Z;  1XFZ O;  1SYM A;  3OB1 B;  3OGN A;  2SCP A;  1CNP A;  3WHT B;  4ZCU A;  1A2X A;  1TCF A;  3TUY B;  2GGM A;  3CZ0 A;  1NX3 A;  1TIZ A;  1W9Z A;  2KLD A;  1TN4 A;  1G8I A;  2PAL A;  1SPY A;  5B8I B;  1KWO C;  4YGE B;  5HLV A;  1B9A A;  1D1O A;  1XK4 C;  2M7N A;  3PN7 B;  3S0D A;  1OZO A;  1CDP A;  2GV5 A;  2KQ6 A;  2WCB A;  3I5G C;  2HF5 A;  2KYF A;  4HRG A;  1B7T Z;  1CFP A;  4U8D A;  4OCI A;  1NCZ A;  2KPH A;  2QDI A;  3JTD C;  4WRI A;  1PSR A;  1OOG A;  5AFP A;  1SR6 C;  3S0B A;  2O5G A;  4PE4 A;  3PSR A;  2ZNE A;  3PLF B;  2KFH A;  1B8L A;  3I5F C;  4PHM A;  2K7B A;  1YR5 A;  1RJV A;  3TDI A;  1NX0 A;  1CDL A;  2KLE A;  2KDH A;  2KFF A;  3SG4 A;  1DJI A;  2L4I A;  4A4C A;  1OW4 A;  1NPQ A;  1XFY O;  4ORA B;  1BOD A;  3ICB A;  1S26 D;  1J7O A;  1K9K A;  1LXF C;  1PAL A;  1TTX A;  3FE6 A;  2WCH A;  4NDD A;  1GQM A;  3VRP A;  2I18 A;  3CAB A;  3PAT A;  3BUN B;  3EVV A;  2EHB A;  5AEQ A;  1KCY A;  3RM1 A;  1UHH A;  2KI4 B;  4UPG A;  5JOL A;  3D74 A;  1V1F A;  2K2F A;  3KF9 A;  4QJ3 B;  2OTG C;  3R1O A;  4I5L B;  4WQ3 A;  5CSJ A;  1QVI Y;  1CM4 A;  2L4H A;  4FTG A;  2YGU A;  3BOW A;  1J1D A;  5KU1 A;  2WND A;  3K1E A;  4CPV A;  1IRJ A;  1HT9 A;  2LP3 A;  2CTN A;  1YUR A;  1DMO A;  2BL0 B;  1XK4 A;  4CFR A;  1TNW A;  1N2D A;  1CFC A;  3S0E A;  1DT7 B;  3EKH A;  1PVA A;  3IQQ A;  4JKT A;  2KOT A;  1KK7 Y;  3SS4 A;  5HKY A;  2BCX A;  5I8N A;  1S3P A;  2QEB A;  1LIN A;  4GGF C;  2E30 A;  1A75 B;  2M1K B;  2G2B A;  2WC6 A;  3DF0 A;  2JPO A;  2ZN9 A;  2L98 A;  5DKQ A;  1J7Q A;  3EK8 A;  3TS5 C;  2R2I A;  3NHI A;  1Q80 A;  1KSO A;  4CLN A;  1AJ5 A;  1XVJ A;  3D10 A;  2WC8 A;  2WCK A;  1B7T Y;  1OOF A;  4I5J A;  1N0Y A;  5BPJ A;  1DJY A;  1V1G A;  1W7I B;  4XJK B;  1B8C A;  1DF0 A;  1UWO A;  2BAP A;  2RGI A;  1CM1 A;  1SK6 D;  3O78 A;  3OX5 A;  2ZRS A;  1JFJ A;  3SS5 A;  1K8U A;  1SBJ A;  2CXJ A;  2P71 A;  2WOS A;  3HCM A;  2LMT A;  4MBE A;  4C0J A;  1AUI B;  4YRU A;  1ZFS A;  4ZCV A;  2EC6 B;  2JTT A;  1KSM A;  1PVB A;  1IGV A;  1TCO B;  2PYQ A;  3DY9 A;  3O4X A;  1JSA A;  1CLL A;  3CR4 X;  2F33 A;  4NDB A;  3ZWH A;  3D75 A;  1IG5 A;  2ERB A;  2LAN A;  3CWG A;  4DIR A;  2CBL A;  3LL8 B;  3QME A;  3RZS A;  1IKU A;  3IF7 A;  1KQM B;  3D0Y B;  3JVT B;  1SNL A;  3NSL A;  2KGB C;  4MLW A;  1X02 A;  2JOJ A;  2L2C A;  1G33 A;  5G08 A;  4GGN A;  3VRO A;  3KPX A;  1LKJ A;  4GGF A;  4AQI A;  3IQO A;  1IJ5 A;  2TN4 A;  4TNC A;  1QS7 A;  2MBX A;  2KAX A;  4PE1 A;  1J7R A;  1QX2 A;  2MLF C;  5ER5 A;  1EL4 A;  1R6P A;  5IBW A;  1DJG A;  3SJS A;  3D76 A;  2JT0 A;  3L4L A;  2M1U A;  1UHK A;  5D69 A;  5ER4 X;  1S6C A;  4PCW A;  1S6J A;  3DXL A;  1Z2C B;  2F2P A;  4GPL B;  1KK8 C;  1F8H A;  1PSB A;  1TNX A;  3BUX B;  2NXQ A;  2NZ0 A;  3PJI A;  1U5I A;  1CDN A;  1XFU O;  2Y1N A;  5HKW A;  3WHU B;  1NX2 A;  2MRD A;  4C0K A;  1Z4H A;  3NSI A;  2JZI A;  4PHJ A;  2M8U A;  2ZFD A;  1UHI A;  1QXP A;  1EG4 A;  4P2Y B;  2ISD A;  3DZT A;  4Q04 A;  2LVK A;  3CLN A;  1CMG A;  3AKB A;  4DS7 A;  1NSH A;  1M39 A;  2VRG A;  1F4O A;  1B4C A;  1FI5 A;  1MF8 B;  1SCM C;  2PSR A;  4INW A;  1AVS A;  1FBV A;  3V2L A;  2KI6 D;  1RRO A;  1F4Q A;  5I94 A;  4IL1 A;  3R72 A;  2NCO A;  2PVB A;  3DD4 A;  2HQ8 A;  4MN0 A;  3AAJ A;  1RFJ A;  5CSN A;  4ORC B;  2OS8 C;  4PE0 A;  3BOW B;  1SMG A;  4MZL A;  1BU3 A;  3D73 A;  4INX A;  1KWO B;  3AKA A;  1LS8 A;  4R1E A;  4I5K A;  2L51 A;  1K94 A;  1QAT A;  1QV0 A;  1QX5 B;  2LVJ A;  5FYX A;  2BCA A;  2I94 A;  3K21 A;  5KSZ A;  3S0A A;  1F70 A;  2E6W A;  2QEO A;  1M46 A;  4NDC A;  3I5G B;  3PM2 A;  2KAV A;  3A4U B;  3SS3 A;  4ETO A;  2LLT A;  5I2L A;  1QIV A;  2LCP A;  1SL7 A;  2MAZ A;  2MHH A;  3CZT X;  1GGW A;  1DGV A;  3BYA A;  3JTD B;  4YGA A;  2ZN8 A;  1SR6 B;  1Y1X A;  4QJ5 B;  1G4Y R;  1OMV A;  2FCD A;  1FF1 A;  1K2H A;  3I5F B;  1C3Y A;  3TDU A;  1SCV A;  1WLZ A;  1B47 A;  3GK2 A;  3UNW A;  2O60 A;  2QPT A;  3EVU A;  2BBM A;  1PUL A;  3DVM A;  3LCP C;  2H2K A;  1JFK A;  2JNX A;  1DF0 B;  2BE4 A;  3I5H C;  1C7V A;  1EXR A;  4P5O E;  1S36 A;  1SW8 A;  2KI6 C;  1F71 A;  2H8V A;  2WCM A;  3OBV A;  3SG7 A;  1L2O B;  4FQO A;  1S5G Y;  2JRF A;  1XA5 A;  2LLS A;  1J7P A;  3LLE A;  4WQ2 A;  1DC1 A;  2LC5 A;  2L5Y A;  3OB2 B;  1A4P A;  1H4B A;  4PT1 A;  1FPW A;  1B1G A;  1EJ3 A;  1K93 D;  3TDZ A;  1ODB A;  2OTG B; 
#chains in the Genus database with same CATH homology
 2PMY A;  1KFX L;  1ZMZ A;  4C0L A;  4L9M A;  4M2O A;  4HSZ A;  2KHN A;  1DJW A;  1WY9 A;  2F3Z A;  2NCP A;  5DKN A;  3PAL A;  1K90 D;  1BJF A;  2KGR A;  4AOM A;  2F2O A;  1NCX A;  2KYC A;  2LVI A;  1NX1 A;  1YX8 A;  4OV2 A;  2H61 C;  2JXL A;  1H8B A;  1YVH A;  2QAC A;  4YI9 A;  1QX7 A;  1SY9 A;  1UHN A;  1JUO A;  1TOP A;  2A4J A;  1JBA A;  1KFX S;  2G9B A;  2LUC A;  1ALW A;  4OKH A;  3TZ1 A;  1DGU A;  3FIA A;  3OP0 A;  4NQG A;  1UUS A;  1UP5 A;  3DVJ A;  3FS7 A;  4BY4 A;  2PRU A;  4MVF A;  3AAK A;  1XFV O;  2SAS A;  3DVE A;  1AK8 A;  1CMF A;  3TS5 B;  4PE7 A;  1QTX A;  4GNK B;  2LP2 A;  1NP8 A;  1IQ5 A;  1FW4 A;  1TNQ A;  1MQ1 A;  5HYD A;  3OX6 A;  1Y1U A;  1AP4 A;  5F6T A;  1LVC D;  2HET A;  2GGZ A;  3FWC A;  3JVT C;  1YUT A;  3QRX A;  1YRU B;  3WNX B;  2B1U A;  2KQY A;  3GOF A;  4M2P A;  4E68 A;  2F8P A;  1AHR A;  3GK4 X;  1PK0 D;  1YUS A;  3WXA A;  1YRT B;  3O6B A;  3CR5 X;  5AER A;  2L2E A;  5J3X A;  2LHI A;  1UUR A;  1QAS A;  1CFD A;  1JF0 A;  1SRA A;  1TRF A;  2D8N A;  3M0W A;  3RLZ A;  2KSP A;  1BOC A;  2M29 A;  1Y6W A;  5K89 A;  1WDC C;  4CID A;  3I5I C;  3KO0 A;  4MRX A;  1JF2 A;  1DTL A;  2Y4Q A;  1A03 A;  1AJ4 A;  1WRL A;  2BKI B;  4AQJ A;  1LA0 A;  2AAO A;  3DVK A;  2H61 A;  2L0P A;  3F45 A;  3PM8 A;  4GBA A;  2K61 A;  1LA3 A;  1DVI A;  2CCM A;  2HQW A;  2L5X B;  2LNK A;  4GFT A;  1RTP 1;  2LVV A;  4YBH B;  3VRR A;  3SIA A;  4ICB A;  2EGD A;  1QV1 A;  2CNP A;  1C7W A;  4MSP A;  2BEC A;  2KFG A;  3TUY C;  3C1V A;  4PDZ A;  2NLN A;  3EK4 A;  4YGB B;  4USL A;  1IH0 A;  2FOT A;  2BCB A;  4D1E A;  1Y1A A;  2MLE C;  1QVI Z;  1GGZ A;  3PN7 C;  1BLQ A;  1BG1 A;  3MSE B;  1ZOT B;  4PHK A;  3SG6 A;  1OOJ A;  1A29 A;  1SKT A;  4N5X A;  2JU0 A;  3BQ3 A;  4N1F A;  5PAL A;  5KTY A;  3CS1 A;  1WRK A;  5HKZ A;  3D0Y A;  4QJ4 B;  4MRY A;  1EG3 A;  4GAO A;  3BUM B;  2CT9 A;  1ALV A;  3BUW B;  2ZKM X;  2M7L A;  1KK7 Z;  2DOQ A;  1E8A A;  2JPT A;  1MXL C;  1QLK A;  1OMD A;  5I2O A;  3OHM B;  1WLM A;  1NCY A;  2JWW A;  2OPO A;  2K0J A;  1K96 A;  1K9P A;  1GJY A;  4YI8 A;  1SCM B;  2M97 A;  1RWY A;  1IWQ A;  1NWD A;  3NSO A;  2COL B;  1NUB A;  1QLS A;  1KFU L;  4YGC B;  2AMI A;  1XO5 A;  2WCF A;  4YGD B;  2PAS A;  2MA2 A;  1JC2 A;  2M49 B;  3LK0 A;  1DJZ A;  3NSK A;  2KI4 C;  3DF0 B;  2K2A A;  1IQ3 A;  2FJU B;  5AAN A;  3HX4 A;  4N1G A;  4I5N B;  1R2U A;  4JPZ B;  2OS8 B;  1CLM A;  1YTZ C;  4F0Z B;  5I2Q A;  3CGA A;  5CSF A;  4XYN A;  2KNE A;  5HLO A;  1CKK A;  1KFU S;  2LE9 B;  1JWD A;  1OMR A;  1MWN A;  1K9U A;  2KBI A;  2BL0 C;  2LMV A;  1S1E A;  3SG5 A;  1L2O C;  2K7C A;  2KBM A;  1WRZ A;  1IJ6 A;  1F54 A;  2I7A A;  1CTR A;  3BXK A;  2AUC A;  4HRE E;  1QIW A;  5CPV A;  3SG3 A;  3E3R A;  1UHJ A;  1DJH A;  1MUX A;  3NXA A;  1PRW A;  1BT6 A;  1W7J B;  1XFW O;  2MJW B;  1C07 A;  2FCE A;  4JQ0 D;  4OR9 B;  4DCK A;  2JXC A;  2L50 A;  5DKR A;  4M2Q A;  5TNC A;  3KEV A;  2M9G A;  2I2R E;  2M0R A;  3I5H B;  1F55 A;  1FI6 A;  1MXE A;  1B8R A;  3LK1 A;  5GQQ C;  3FWB A;  5CSI A;  2P6B B;  3EVR A;  2LM5 A;  4HRH A;  1NYA A;  1J55 A;  3VGO A;  1XYD A;  1CFF A;  3BUO B;  1MR8 A;  1RK9 A;  1NIW A;  2BE6 A;  1CB1 A;  1SL9 A;  3SG2 A;  2EC6 C;  1OSA A;  1DJX A;  4CFQ A;  2WOR A;  5JJG A;  2ZRT A;  1BR4 B;  4PAL A;  1OZS A;  1BR1 B;  4BY5 A;  2JUL A;  2LUX A;  1KQM C;  2HPS A;  1U5I B;  3CTN A;  4GUK A;  2JT8 A;  1YVL A;  1REC A;  2BKH B;  4JWQ A;  1K95 A;  2LHL A;  3O2P A;  4ORB B;  1BF5 A;  3EKJ A;  1TNP A;  2JNF A;  3VRN A;  3KHE A;  1A75 A;  1M45 A;  1HQV A;  4A4B A;  4DRW A;  3ZNI A;  1CDM A;  2JT3 A;  2BBN A;  2LV7 A;  5D7F A;  4PHN A;  2K8M B;  1OQP A;  1Y0V H;  1J1E A;  1L7Z A;  3EK7 A;  2Q4U A;  3VRQ A;  1KQV A;  4OVN F;  5AXI A;  4DUQ A;  1M31 A;  4XJK A;  1N65 A;  4MZJ A;  2F3Y A;  1SL8 A;  2JC2 A;  1QJT A;  1BMO A;  3CR2 A;  1S6I A;  3PFV A;  1XFX O;  3A8R A;  1ZUZ A;  1EH2 A;  2M3W A;  2JQ6 A;  2KAY A;  3O4Y A;  1WDC B;  3I5I B;  2K7O A;  2ZND A;  4MZK A;  3SIB A;  2Y5I A;  4MEW A;  3GK1 A;  3H4S E;  1MHO A;  2JTZ A;  2Q91 A;  2LMU A;  1KK8 B;  2WCE A;  2V53 A;  1YX7 A;  2K7D A;  2IS9 A;  1ZAC A;  1OE9 B;  1VRK A;  1YUU A;  2LAP A;  2LLU A;  2Y1M A;  1M63 B;  1S5G Z;  1XFZ O;  1SYM A;  3OB1 B;  1CNP A;  2SCP A;  3WHT B;  4ZCU A;  1A2X A;  1TCF A;  3TUY B;  2GGM A;  1NX3 A;  1TIZ A;  1TN4 A;  1G8I A;  2PAL A;  1SPY A;  5B8I B;  1KWO C;  4YGE B;  5HLV A;  1B9A A;  1D1O A;  1XK4 C;  2M7N A;  3PN7 B;  1OZO A;  1CDP A;  2GV5 A;  2KQ6 A;  2WCB A;  3I5G C;  2HF5 A;  2KYF A;  4HRG A;  1B7T Z;  1CFP A;  4U8D A;  4OCI A;  1NCZ A;  3JTD C;  4WRI A;  1PSR A;  5AFP A;  1SR6 C;  2O5G A;  4PE4 A;  3PSR A;  2ZNE A;  3PLF B;  2KFH A;  1B8L A;  3I5F C;  4PHM A;  2K7B A;  1YR5 A;  1RJV A;  3TDI A;  1NX0 A;  1CDL A;  3SG4 A;  2KDH A;  2KFF A;  4A4C A;  1DJI A;  2L4I A;  1NPQ A;  1XFY O;  4ORA B;  1BOD A;  3ICB A;  1S26 D;  1J7O A;  1K9K A;  1LXF C;  1PAL A;  1TTX A;  4NDD A;  1GQM A;  3VRP A;  2I18 A;  3PAT A;  5AEQ A;  3BUN B;  3EVV A;  2EHB A;  1KCY A;  3RM1 A;  1UHH A;  2KI4 B;  4UPG A;  5JOL A;  1V1F A;  2K2F A;  3KF9 A;  4QJ3 B;  2OTG C;  4I5L B;  4WQ3 A;  5CSJ A;  1QVI Y;  1CM4 A;  2L4H A;  4FTG A;  3BOW A;  5KU1 A;  1J1D A;  2WND A;  4CPV A;  1IRJ A;  1HT9 A;  2LP3 A;  2CTN A;  1YUR A;  1DMO A;  2BL0 B;  1XK4 A;  4CFR A;  1TNW A;  1N2D A;  1CFC A;  1DT7 B;  3EKH A;  1PVA A;  3IQQ A;  1CLB A;  2KOT A;  1KK7 Y;  5HKY A;  2BCX A;  5I8N A;  1S3P A;  4GGF C;  1LIN A;  2E30 A;  1A75 B;  2M1K B;  2G2B A;  3DF0 A;  2ZN9 A;  2L98 A;  5DKQ A;  1J7Q A;  3EK8 A;  3TS5 C;  2R2I A;  1Q80 A;  1KSO A;  4CLN A;  1AJ5 A;  1XVJ A;  3D10 A;  2WC8 A;  1B7T Y;  4I5J A;  1N0Y A;  5BPJ A;  1DJY A;  1V1G A;  1W7I B;  4XJK B;  1B8C A;  1DF0 A;  1UWO A;  2RGI A;  1CM1 A;  1SK6 D;  3O78 A;  3OX5 A;  2ZRS A;  1JFJ A;  1K8U A;  1SBJ A;  2CXJ A;  2WOS A;  3HCM A;  2LMT A;  4MBE A;  4C0J A;  1AUI B;  4YRU A;  1ZFS A;  4ZCV A;  2EC6 B;  2JTT A;  1KSM A;  1PVB A;  1IGV A;  1TCO B;  1JSA A;  1CLL A;  3CR4 X;  2F33 A;  4NDB A;  3ZWH A;  1IG5 A;  2LAN A;  3CWG A;  4DIR A;  2CBL A;  3LL8 B;  1IKU A;  3IF7 A;  1KQM B;  3D0Y B;  3JVT B;  1SNL A;  3NSL A;  2KGB C;  4MLW A;  1X02 A;  2JOJ A;  3VRO A;  1G33 A;  5G08 A;  4GGN A;  3KPX A;  1LKJ A;  4GGF A;  4AQI A;  3IQO A;  1IJ5 A;  2TN4 A;  4TNC A;  1QS7 A;  2MBX A;  2KAX A;  4PE1 A;  1J7R A;  1QX2 A;  2MLF C;  5ER5 A;  1EL4 A;  1R6P A;  5IBW A;  1DJG A;  3SJS A;  2JT0 A;  2M1U A;  1UHK A;  5D69 A;  5ER4 X;  1S6C A;  4PCW A;  1S6J A;  2F2P A;  4GPL B;  1KK8 C;  1F8H A;  1PSB A;  1TNX A;  3BUX B;  2NXQ A;  2NZ0 A;  1U5I A;  1CDN A;  1XFU O;  2Y1N A;  5HKW A;  3WHU B;  1NX2 A;  2MRD A;  4C0K A;  3NSI A;  2JZI A;  4PHJ A;  2M8U A;  2ZFD A;  1UHI A;  1QXP A;  1EG4 A;  4P2Y B;  2ISD A;  4Q04 A;  2LVK A;  3CLN A;  1CMG A;  3AKB A;  4DS7 A;  1NSH A;  1M39 A;  2VRG A;  1F4O A;  1B4C A;  1FI5 A;  1MF8 B;  1SCM C;  2PSR A;  1AVS A;  1FBV A;  2KI6 D;  1RRO A;  1F4Q A;  4IL1 A;  2NCO A;  2PVB A;  3DD4 A;  2HQ8 A;  4MN0 A;  3AAJ A;  1RFJ A;  5CSN A;  4ORC B;  2OS8 C;  4PE0 A;  3BOW B;  1SMG A;  4MZL A;  1BU3 A;  1KWO B;  3AKA A;  4R1E A;  4I5K A;  2L51 A;  1K94 A;  1QAT A;  1QV0 A;  1QX5 B;  2LVJ A;  5FYX A;  2BCA A;  2I94 A;  3K21 A;  5KSZ A;  1F70 A;  2E6W A;  4NDC A;  1M46 A;  3I5G B;  2KAV A;  3A4U B;  4ETO A;  2LLT A;  5I2L A;  1QIV A;  2LCP A;  1SL7 A;  2MAZ A;  2MHH A;  3CZT X;  1GGW A;  1DGV A;  3BYA A;  3JTD B;  4YGA A;  2ZN8 A;  1SR6 B;  1Y1X A;  4QJ5 B;  1G4Y R;  1OMV A;  2FCD A;  1FF1 A;  1K2H A;  3I5F B;  3TDU A;  1SCV A;  1WLZ A;  1B47 A;  3GK2 A;  2O60 A;  2QPT A;  3EVU A;  2BBM A;  1PUL A;  3DVM A;  3LCP C;  2H2K A;  1JFK A;  2JNX A;  1DF0 B;  2BE4 A;  3I5H C;  1C7V A;  1EXR A;  4P5O E;  1S36 A;  1SW8 A;  2KI6 C;  1F71 A;  3SG7 A;  1L2O B;  4FQO A;  1S5G Y;  2JRF A;  1XA5 A;  2LLS A;  1J7P A;  3LLE A;  4WQ2 A;  2LC5 A;  1H4B A;  3OB2 B;  1A4P A;  1FPW A;  1B1G A;  1EJ3 A;  1K93 D;  3TDZ A;  1ODB A;  2OTG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...