1ZFSA

Solution structure of s100a1 bound to calcium
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
b'GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 protein, alpha chain
publication title The three-dimensional solution structure of Ca(2+)-bound S100A1 as determined by NMR spectroscopy
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zfsA00
2COLB 1EH2A 1KCYA 3IQQA 2JRFA 3BXKA 4PHKA 3SJSA 4BY4A 1J55A 1QIVA 2LNKA 1B8LA 2P6BB 1U5IB 3TDZA 3KPXA 2ZN8A 1L2OB 1QX5B 2I2RE 4XYNA 2LANA 1Y1UA 1RECA 1Y0VH 3BUXB 1EL4A 4ORBB 1A4PA 1C7WA 3FIAA 3EVRA 4MRXA 2K8MB 2SASA 2JT8A 5AERA 1CDNA 2JQ6A 1K9KA 1TIZA 5JJGA 1TTXA 1YX8A 4MBEA 4USLA 3QRXA 4AOMA 3OHMB 1FI6A 3EKHA 2L5XB 4ORCB 4NDDA 4I5KA 1CMGA 3SIAA 1SBJA 3A4UB 4HRHA 3BOWA 2TN4A 1K93D 2WNDA 2MBXA 1XFZO 3I5FB 5CPVA 1R2UA 1UHJA 1LVCD 1IWQA 1KK8B 3AKBA 1SY9A 2PASA 1TRFA 3EVVA 1CFFA 1OZOA 1KFXL 1RTP1 2I7AA 1J7OA 3AAJA 1Q80A 3I5FC 1OE9B 2WCEA 2E30A 1PSRA 1KK8C 4BY5A 1CKKA 1NX1A 1QV1A 1PVAA 2LLTA 1S6IA 2Q91A 3D0YA 5DKQA 4A4BA 4UPGA 2LP3A 1BOCA 3CR2A 3I5HB 4PE4A 3SG2A 3M0WA 1AUIB 2M7LA 2I18A 2LE9B 2LVIA 2PMYA 1NP8A 2FCDA 4MN0A 3I5HC 1OMDA 2BE6A 2JXCA 3E3RA 2LV7A 4MRYA 1LA0A 3NXAA 3A8RA 1PSBA 1DVIA 2NZ0A 4PE1A 2KAXA 2JXLA 3DVKA 4P2YB 2H2KA 1FPWA 1W7IB 1XFUO 2DOQA 1K9PA 2R2IA 1NX0A 2D8NA 2F33A 4ORAB 3VRQA 4FTGA 2HF5A 1MWNA 2M0RA 2B1UA 5KSZA 4MEWA 4N1FA 2M29A 2NLNA 1ZFSA 2M49B 5AXIA 5J3XA 2WCBA 1DJWA 5ER5A 3K21A 1NX3A 3GK2A 2CCMA 4CLNA 3I5IB 1LINA 4P5OE 2MLFC 1RWYA 1XFWO 2KQYA 4PALA 2L4IA 4MZKA 1W7JB 2BKHB 1GGWA 3CWGA 2H61C 3IQOA 1AHRA 2L51A 3FS7A 3I5IC 4NDCA 1DTLA 2BCBA 1K95A 1S6JA 4YGAA 1A29A 2K61A 1XFYO 2KI6D 1B8CA 3PSRA 1HT9A 1TCOB 2LUXA 1EXRA 2M1UA 4MZJA 1A75B 2F8PA 1PVBA 1SPYA 1XA5A 4AQJA 4I5NB 1TNXA 2LAPA 2CTNA 1DJGA 5F6TA 3VRRA 3JVTC 2OTGC 2WORA 4ZCVA 1QJTA 2IS9A 4GGFA 2G2BA 4PCWA 3PFVA 3ICBA 4DS7A 1QS7A 2F2OA 1YRTB 4R1EA 3BUWB 1DF0A 3KF9A 3WHTB 4OV2A 1UHNA 1YR5A 1B7TZ 2BBMA 2L0PA 4AQIA 1XVJA 3AAKA 4XJKB 1C07A 4U8DA 2K7BA 1XK4A 1S5GY 1N65A 2KSPA 1JF0A 4D1EA 1M31A 3BUOB 2LUCA 1MXEA 1TOPA 2BECA 1OOJA 2ZN9A 5KU1A 3AKAA 3TDUA 3SG5A 2CNPA 3SIBA 4M2QA 2HQWA 5JOLA 5D69A 1SCMB 1IRJA 1H8BA 1SRAA 1S36A 2JTZA 2L50A 1FF1A 1SCVA 1JSAA 2KBIA 2ZNDA 2FCEA 4N5XA 1X02A 1RK9A 2NCPA 2O5GA 1SW8A 3C1VA 3JTDB 3NSKA 2NCOA 1K90D 4ETOA 1N2DA 1KWOB 2K2FA 4ZCUA 1QLKA 3TDIA 1BJFA 1CM1A 4M2OA 3GOFA 1L2OC 1KSMA 2KGBC 3BUMB 2ISDA 1OMVA 5TNCA 1AK8A 1TN4A 1J1EA 1AP4A 3JTDC 1G4YR 2JT3A 5PALA 2F3ZA 1CTRA 3O2PA 3OX5A 4MZLA 1TNPA 2KGRA 1DJHA 3RLZA 1RROA 4JQ0D 4QJ5B 3EVUA 1LA3A 2BKIB 1V1FA 2M7NA 1BLQA 1CLMA 1L7ZA 1SYMA 3DVJA 3PLFB 4IL1A 4JPZB 1IG5A 4YGEB 3DD4A 4YBHB 2FOTA 1BODA 2CT9A 2KHNA 2EC6B 3O6BA 1WRZA 1EG3A 2LMTA 2QACA 1LXFC 3ZWHA 1SKTA 2HQ8A 4GUKA 4C0LA 2Y1NA 4FQOA 1NPQA 2L4HA 2JULA 2LC5A 1SR6B 1F54A 2KFGA 4DCKA 1IQ3A 2EC6C 1IJ6A 4CFQA 1CFCA 1MQ1A 1ALWA 3O78A 4Q04A 3BQ3A 3EK4A 3WXAA 2KAYA 2RGIA 4MVFA 1OZSA 4NDBA 1J1DA 2WC8A 2K0JA 3MSEB 2LM5A 4M2PA 1XYDA 5DKNA 1PK0D 4YRUA 2LP2A 4PE0A 2LVVA 5AANA 2BCXA 2G9BA 1J7QA 1RJVA 2K7CA 1KK7Y 1Y1XA 4CPVA 1K2HA 5IBWA 1CM4A 3HX4A 1DT7B 2KNEA 4I5JA 1S6CA 1CMFA 3DF0A 1BG1A 1YURA 1KFXS 5CSIA 1JWDA 5CSFA 4WQ2A 1XFXO 4YGDB 1QIWA 5CSJA 1F4OA 2LMUA 3EKJA 3TS5B 1NSHA 2AAOA 5I2LA 1G33A 4YI8A 1NUBA 1DJZA 1YX7A 1LKJA 4MLWA 3PATA 5B8IB 1YUSA 3CR5X 1NCXA 1MUXA 2M1KB 1NX2A 2KBMA 1J7PA 1YVLA 2KI4B 1H4BA 2WCFA 5HKYA 1Y1AA 1CLLA 1UWOA 5HLVA 3PN7B 2MHHA 5D7FA 4ICBA 2PVBA 1YUUA 1SL8A 3PM8A 1OSAA 1BT6A 1IKUA 1DJIA 1F8HA 1JF2A 2KOTA 4L9MA 4OKHA 4C0KA 1XK4C 3TUYB 1DJXA 3LL8B 2MRDA 4A4CA 2KFFA 1UURA 2SCPA 3DVEA 4GGNA 1CDMA 5DKRA 4DIRA 1WRKA 3ZNIA 3CS1A 1ZACA 1ALVA 3SG6A 1V1GA 1CDLA 5I8NA 1B1GA 2CBLA 3O4YA 1S5GZ 1QVIY 3LLEA 2LMVA 1XFVO 2LLSA 3NSIA 1QXPA 2OS8B 2JNFA 2ZRSA 3PALA 5I2OA 2F3YA 2F2PA 2K7DA 2KYCA 1CB1A 2PRUA 1A75A 3OB2B 2JZIA 2JTTA 1BR1B 3FWBA 5AFPA 1B9AA 1OQPA 1UHKA 3DVMA 5FYXA 1Y6WA 2KQ6A 1M63B 1KQMB 3KEVA 1JFKA 1SCMC 2M8UA 3BOWB 1WLZA 1TCFA 1CDPA 1PALA 1B47A 2WOSA 1WY9A 4OCIA 1D1OA 1ZOTB 1SNLA 1QATA 4E68A 2A4JA 3KO0A 1HQVA 4WRIA 3VROA 1KQMC 1YUTA 1KWOC 2K7OA 4C0JA 2M97A 1MF8B 4OVNF 4PE7A 4F0ZB 1F4QA 1SL9A 5HYDA 1QV0A 1S3PA 1AJ5A 2MLEC 3BUNB 4GPLB 3D0YB 2L98A 1B4CA 1BR4B 2Y1MA 3GK4X 1J7RA 2BE4A 2GV5A 1NYAA 1BMOA 4TNCA 1QLSA 1DJYA 2I94A 1QTXA 1NWDA 4PHNA 2ZFDA 2JT0A 4NQGA 1U5IA 1NCZA 4GNKB 1UHIA 1EJ3A 3LCPC 1CFPA 4CIDA 1VRKA 1WDCB 2BL0B 5AEQA 5BPJA 1YVHA 2ZKMX 1MXLC 3GK1A 2HPSA 4QJ3B 1FW4A 4PDZA 2E6WA 1KSOA 2JU0A 3WNXB 5K89A 3CTNA 1WDCC 3OX6A 2LHLA 1M46A 2BL0C 2NXQA 4GBAA 1BU3A 1JFJA 1G8IA 3WHUB 1F55A 2HETA 4DUQA 3DF0B 3OP0A 2Q4UA 1SR6C 2PALA 1FBVA 2V53A 1K8UA 2OPOA 2JWWA 5GQQC 1UP5A 4GAOA 1IJ5A 1PRWA 1ODBA 2ZRTA 1CNPA 5I2QA 1YTZC 4JWQA 2GGMA 3IF7A 3CGAA 4GFTA 3TZ1A 1ZMZA 1IH0A 1TNWA 3VRPA 2MA2A 1KFUL 3SG4A 1MR8A 1NCYA 2KAVA 1KK7Z 2QPTA 3LK1A 1CLBA 1WRLA 1GQMA 3BYAA 4WQ3A 3H4SE 1SL7A 3CZTX 1N0YA 1GGZA 4HREE 1UUSA 1XO5A 5KTYA 2O60A 1B8RA 2LHIA 2L2EA 5HKWA 1R6PA 1TNQA 2MAZA 5HKZA 4CFRA 1SK6D 1SMGA 2AMIA 3RM1A 4OR9B 2GGZA 2BCAA 3TS5C 1A03A 4PHJA 3VRNA 1PULA 2CXJA 1UHHA 1JUOA 1NIWA 4I5LB 1JC2A 1QX7A 2JPTA 1DF0B 2KFHA 1GJYA 2EGDA 3CR4X 3F45A 4MSPA 5ER4X 2ZNEA 2M3WA 1K9UA 2LVKA 4GGFC 4YGCB 3VGOA 1IQ5A 1QASA 2JNXA 1IGVA 2PSRA 1RFJA 5G08A 2EHBA 2KYFA 1AVSA 2KI4C 2LLUA 1KFUS 1EG4A 4HRGA 5HLOA 3EK7A 2M9GA 4HSZA 2H61A 3PN7C 4PHMA 1YRUB 3JVTB 2OTGB 2Y4QA 1DGUA 1K96A 3NSOA 2KDHA 1A2XA 1ZUZA 3HCMA 1WLMA 2FJUB 2K2AA 3TUYC 3KHEA 1F70A 2MJWB 2BBNA 2Y5IA 3SG7A 1C7VA 1JBAA 1FI5A 1K94A 1DMOA 3LK0A 1QVIZ 3EK8A 1B7TY 1M45A 1CFDA 3CLNA 3SG3A 3FWCA 2AUCA 3NSLA 1MHOA 2JC2A 4YI9A 1S1EA 1F71A 2KI6C 2OS8C 1S26D 3I5GB 3OB1B 1KQVA 4DRWA 2VRGA 2LCPA 4QJ4B 1M39A 3D10A 1AJ4A 4N1GA 5CSNA 4YGBB 1DGVA 2LVJA 1OMRA 2JOJA 1QX2A 3I5GC 1E8AA 1BF5A 4XJKA
chains in the Genus database with same CATH superfamily
2COLB 1EH2A 1KCYA 3S0EA 3IQQA 2JRFA 3BXKA 4PHKA 3SJSA 4BY4A 1J55A 1QIVA 2LNKA 1B8LA 2P6BB 1U5IB 3TDZA 3D77A 3KPXA 2ZN8A 1L2OB 4INXA 1QX5B 2I2RE 4XYNA 2LANA 1Y1UA 1RECA 1Y0VH 3BUXB 1EL4A 4ORBB 1A4PA 1C7WA 3FIAA 3EVRA 4MRXA 2K8MB 2SASA 2JT8A 5AERA 1CDNA 2JQ6A 1K9KA 3OBVA 1TIZA 5JJGA 1TTXA 1YX8A 4MBEA 4USLA 3QRXA 4AOMA 3OHMB 1FI6A 3EKHA 2L5XB 4ORCB 4NDDA 4I5KA 1CMGA 3SIAA 1SBJA 3BFHA 3A4UB 4HRHA 3BOWA 2TN4A 1K93D 2WNDA 2MBXA 1XFZO 3I5FB 5CPVA 1R2UA 1UHJA 1LVCD 1IWQA 1KK8B 3DZTA 3AKBA 1SY9A 2PASA 1TRFA 3EVVA 1CFFA 3SS5A 1OZOA 2YGUA 1KFXL 1RTP1 2I7AA 1J7OA 3AAJA 4IJ7A 1Q80A 3I5FC 1OE9B 3R1VA 2WCEA 3SS3A 2E30A 1PSRA 1KK8C 4BY5A 1CKKA 1Z4HA 2PQLA 1NX1A 1QV1A 1PVAA 2LLTA 1S6IA 2Q91A 3D0YA 5DKQA 2WCLA 4A4BA 2LP3A 1BOCA 3CR2A 3I5HB 4PE4A 3CZ0A 3SG2A 1OOFA 3M0WA 1AUIB 2M7LA 2I18A 2LE9B 2LVIA 2PMYA 1NP8A 1LS8A 2FCDA 4MN0A 3I5HC 1OMDA 2BE6A 2JXCA 3E3RA 2LV7A 4MRYA 1LA0A 3NXAA 3CYZA 3A8RA 1PSBA 1DVIA 2NZ0A 4PE1A 2KAXA 2JXLA 3DVKA 4P2YB 2H2KA 1FPWA 1W7IB 1XFUO 2DOQA 1K9PA 2R2IA 1NX0A 2D8NA 2F33A 4ORAB 3VRQA 4FTGA 2HF5A 1MWNA 2M0RA 2B1UA 5KSZA 4MEWA 4N1FA 2M29A 2NLNA 1ZFSA 2M49B 5AXIA 3DY9A 5J3XA 2WCBA 3VB1A 1DJWA 5ER5A 3K21A 1NX3A 3GK2A 2CCMA 4CLNA 3I5IB 1LINA 2P71A 4P5OE 2MLFC 2QEOA 1T14A 1RWYA 1XFWO 2KQYA 1P28A 2QEHA 2L4IA 4PALA 4MZKA 1W7JB 2BKHB 1GGWA 4UPGA 3CWGA 2H61C 3IQOA 3L4AA 1AHRA 3D74A 2L51A 3FS7A 3I5IC 1XFRA 4NDCA 3B86A 1DTLA 2BCBA 1K95A 1S6JA 3CZ2A 1A29A 2K61A 4YGAA 1XFYO 2KI6D 1B8CA 3PSRA 1HT9A 1TCOB 2LUXA 1EXRA 2M1UA 4MZJA 1A75B 1OW4A 2F8PA 1PVBA 1SPYA 1XA5A 4AQJA 2L2CA 4I5NB 5EL2A 1TNXA 2LAPA 3L4LA 2CTNA 1DJGA 5F6TA 3VRRA 3JVTC 2OTGC 2WORA 4ZCVA 1QJTA 5FI2A 2IS9A 2WC5A 4GGFA 2G2BA 4PCWA 3PFVA 3S0BA 3ICBA 4DS7A 1QS7A 2F2OA 2WC6A 1YRTB 4R1EA 3BUWB 1DF0A 3KF9A 3WHTB 4OV2A 1UHNA 1YR5A 1B7TZ 2BBMA 2L0PA 4AQIA 1XVJA 3AAKA 4XJKB 1C07A 2QEBA 4U8DA 2K7BA 1XK4A 3R1OA 1S5GY 1N65A 2KSPA 1JF0A 4D1EA 1M31A 3NHTA 3BUOB 2LUCA 3NHIA 1MXEA 1TOPA 5FI6A 2BECA 1OOJA 2ZN9A 3S0AA 5KU1A 3AKAA 3TDUA 3SG5A 2CNPA 3SIBA 3QMEA 4M2QA 2HQWA 4PT1A 5JOLA 5D69A 1SCMB 1IRJA 1H8BA 1SRAA 1S36A 2JTZA 2L50A 1FF1A 1SCVA 1JSAA 2KBIA 2ZNDA 2FCEA 4N5XA 1X02A 1RK9A 2NCPA 2O5GA 1SW8A 3C1VA 3JTDB 3NSKA 4JKTA 2WCMA 2NCOA 1K90D 3L47A 3B88A 4ETOA 1N2DA 1KWOB 2K2FA 4ZCUA 1QLKA 3TDIA 1BJFA 1CM1A 1SSEB 4M2OA 3GOFA 1L2OC 1KSMA 2KGBC 3BUMB 2ISDA 1OMVA 5TNCA 1AK8A 1TN4A 1J1EA 1AP4A 3JTDC 1G4YR 2JT3A 5PALA 2F3ZA 1CTRA 3O2PA 3FE8A 3OX5A 4MZLA 1TNPA 2KGRA 1DJHA 3RLZA 1RROA 4JQ0D 4QJ5B 3EVUA 1LA3A 2BKIB 1V1FA 1Z2CB 2M7NA 3D75A 1BLQA 1CLMA 1L7ZA 1SYMA 3DVJA 3PLFB 4IL1A 4JPZB 1IG5A 4YGEB 3DD4A 4YBHB 2FOTA 1BODA 2CT9A 2KHNA 2EC6B 3B7AA 3O6BA 3K1EA 1WRZA 1EG3A 2LMTA 2QACA 1LXFC 3ZWHA 1SKTA 2HQ8A 4GUKA 4C0LA 2Y1NA 4FQOA 3Q8IA 1NPQA 2L4HA 2JULA 2LC5A 1SR6B 1F54A 2KFGA 4DCKA 1IQ3A 2EC6C 1IJ6A 4CFQA 1CFCA 1MQ1A 1ALWA 3O78A 4Q04A 3BQ3A 3EK4A 3RZSA 3WXAA 2KAYA 2RGIA 4MVFA 1OZSA 4NDBA 3S0FA 1J1DA 2WC8A 1OOIX 2K0JA 3MSEB 2LM5A 4M2PA 1XYDA 5DKNA 1PK0D 4YRUA 2LP2A 4PE0A 2LVVA 3DYEA 5AANA 2BCXA 2G9BA 3UO9A 1J7QA 1RJVA 2K7CA 1KK7Y 1Y1XA 1TUJA 4CPVA 1K2HA 5IBWA 1CM4A 3HX4A 1DT7B 1QWVA 2KNEA 4I5JA 1S6CA 1CMFA 2ERBA 3DF0A 1DEKA 1YURA 3FE9A 1KFXS 5CSIA 1BG1A 1JWDA 5CSFA 4WQ2A 1XFXO 2H8VA 4INWA 1QIWA 4YGDB 5CSJA 1F4OA 2LMUA 3EKJA 3TS5B 2QDIA 1NSHA 5I94A 2AAOA 5I2LA 3PM2A 1G33A 4YI8A 3UNWA 1NUBA 1DJZA 1YX7A 1LKJA 4MLWA 3PATA 2GTEA 1YUSA 2BAPA 3CR5X 5B8IB 1TUZA 1NCXA 1MUXA 2P70A 2M1KB 1NX2A 4FQTA 2KBMA 1J7PA 1YVLA 2KI4B 1H4BA 2WCFA 3OGNA 1Y1AA 5HKYA 1CLLA 1UWOA 5HLVA 3PN7B 2MHHA 5D7FA 4ICBA 2PVBA 4KYNA 1YUUA 1SL8A 3PM8A 1OSAA 1BT6A 1IKUA 1DJIA 1F8HA 1JF2A 2KOTA 4L9MA 4OKHA 4C0KA 1XK4C 3TUYB 1DJXA 1C3YA 3LL8B 2MRDA 4A4CA 2KFFA 1UURA 2SCPA 3DVEA 4GGNA 1CDMA 5DKRA 4DIRA 1WRKA 3ZNIA 3CS1A 1ZACA 3BFBA 1ALVA 3FE6A 1V1GA 3SG6A 1CDLA 5I8NA 3V2LA 1B1GA 2CBLA 3EG5B 3O4YA 1S5GZ 1QVIY 2WCHA 3LLEA 2LMVA 1XFVO 2LLSA 3NSIA 1GM0A 3D78A 1QXPA 2OS8B 2JNFA 2ZRSA 3PALA 5I2OA 2F3YA 2F2PA 2K7DA 3N7HA 2KYCA 1CB1A 2PRUA 1A75A 3OB2B 2JZIA 2PYQA 2JTTA 1BR1B 3FWBA 3PJIA 4OZDA 2QEVA 5AFPA 1B9AA 1OQPA 1UHKA 3DVMA 5FYXA 1Y6WA 2KQ6A 1M63B 3B6XA 1KQMB 3KEVA 1JFKA 1SCMC 2M8UA 3BOWB 1WLZA 1TCFA 1CDPA 1PALA 1B47A 2WOSA 1WY9A 4OCIA 1D1OA 1ZOTB 2JPOA 1SNLA 1QATA 4E68A 2A4JA 3KO0A 2K60A 1HQVA 4WRIA 3VROA 1KQMC 1YUTA 1KWOC 2K7OA 3CZ1A 4C0JA 2M97A 1MF8B 4OVNF 4PE7A 4F0ZB 1F4QA 1SL9A 5HYDA 1QV0A 1S3PA 1AJ5A 2MLEC 1W9ZA 3BUNB 4GPLB 3D0YB 2L98A 1B4CA 1BR4B 2Y1MA 1IIOA 3GK4X 1J7RA 3BFAA 2BE4A 2GV5A 1NYAA 1BMOA 4TNCA 1QLSA 1DJYA 2I94A 1QTXA 1NWDA 2BNXA 4PHNA 2ZFDA 2JT0A 4NQGA 1U5IA 1NCZA 4GNKB 1UHIA 1EJ3A 3LCPC 1CFPA 4CIDA 1VRKA 2L5YA 1WDCB 2BL0B 5AEQA 5BPJA 1DQEA 1YVHA 2ZKMX 5DICA 1MXLC 3GK1A 3R72A 3B87A 2HPSA 4QJ3B 1FW4A 4JD9A 4PDZA 2E6WA 1KSOA 2JU0A 3WNXB 5K89A 3CTNA 1WDCC 3OX6A 2LHLA 1M46A 2BL0C 2NXQA 4GBAA 1BU3A 1JFJA 1G8IA 3WHUB 1F55A 2HETA 4DUQA 3DF0B 1DELA 3OP0A 2Q4UA 1SR6C 2PALA 1FBVA 2V53A 1K8UA 3NGVA 2OPOA 5HL1A 2JWWA 3R1PA 5GQQC 1UP5A 4GAOA 1IJ5A 1OOGA 1PRWA 1ODBA 2ZRTA 3D73A 1CNPA 5I2QA 1YTZC 4JWQA 2GGMA 3IF7A 3CGAA 4GFTA 3TZ1A 1ZMZA 1IH0A 1TNWA 2FJYA 2KLDA 3VRPA 2MA2A 5D3OA 1KFUL 3SG4A 1MR8A 1NCYA 2KAVA 1KK7Z 2QPTA 3LK1A 1CLBA 1WRLA 1GQMA 3BYAA 4WQ3A 3H4SE 1SL7A 3CZTX 1N0YA 1GGZA 4HREE 5FI7A 3BJHA 1UUSA 1XO5A 3S0DA 1DC1A 5KTYA 2O60A 1B8RA 3S0GA 2LHIA 2L2EA 5HKWA 1R6PA 1TNQA 2MAZA 5HKZA 4CFRA 1SK6D 1SMGA 2AMIA 3RM1A 4OR9B 2GGZA 2BCAA 1C3ZA 3TS5C 1A03A 4PHJA 3SS4A 1PULA 2CXJA 3VRNA 1UHHA 1JUOA 1NIWA 1OOHA 4I5LB 1JC2A 2KPHA 1QX7A 2JPTA 1DF0B 3CABA 2KFHA 1GJYA 2EGDA 3CR4X 3F45A 4MSPA 5ER4X 2ZNEA 2M3WA 1K9UA 2LVKA 4GGFC 4YGCB 3VGOA 2WCKA 1IQ5A 1QASA 2JNXA 1IGVA 2PSRA 1RFJA 5G08A 1TWOA 2EHBA 2KYFA 1AVSA 2KI4C 2LLUA 1KFUS 1EG4A 3D76A 4HRGA 5HLOA 4F7FA 3EK7A 2M9GA 4HSZA 2H61A 3PN7C 4PHMA 1YRUB 3JVTB 2OTGB 2Y4QA 1DGUA 1K96A 3CDNA 3NSOA 2KDHA 1A2XA 1ZUZA 3HCMA 1WLMA 2FJUB 1ORGA 2K2AA 3TUYC 3KHEA 1F70A 2MJWB 2BBNA 2Y5IA 3SG7A 1C7VA 3O4XA 1JBAA 1FI5A 1K94A 1DMOA 3LK0A 1QVIZ 3EK8A 1B7TY 1M45A 1CFDA 3CLNA 3IVTA 3SG3A 3FWCA 2AUCA 3NSLA 1MHOA 2JC2A 2WCJA 3DXLA 4YI9A 1S1EA 1F71A 2KI6C 2OS8C 1S26D 3I5GB 3OB1B 1KQVA 4DRWA 2VRGA 2LCPA 4QJ4B 1M39A 3D10A 1AJ4A 4N1GA 5CSNA 4YGBB 1DGVA 2LVJA 1OMRA 2KLEA 2JOJA 1QX2A 3I5GC 1E8AA 1BF5A 4XJKA
chains in the Genus database with same CATH topology
2COLB 1EH2A 1KCYA 3IQQA 2JRFA 3BXKA 4PHKA 3SJSA 4BY4A 1J55A 1QIVA 2LNKA 1B8LA 2P6BB 1U5IB 3TDZA 3KPXA 2ZN8A 1L2OB 1QX5B 2I2RE 4XYNA 2LANA 1Y1UA 1RECA 1Y0VH 3BUXB 1EL4A 4ORBB 1A4PA 1C7WA 3FIAA 3EVRA 4MRXA 2K8MB 2SASA 2JT8A 5AERA 1CDNA 2JQ6A 1K9KA 1TIZA 5JJGA 1TTXA 1YX8A 4MBEA 4USLA 3QRXA 4AOMA 3OHMB 1FI6A 3EKHA 2L5XB 4ORCB 4NDDA 4I5KA 1CMGA 3SIAA 1SBJA 3A4UB 4HRHA 3BOWA 2TN4A 1K93D 2WNDA 2MBXA 1XFZO 3I5FB 5CPVA 1R2UA 1UHJA 1LVCD 1IWQA 1KK8B 3AKBA 1SY9A 2PASA 1TRFA 3EVVA 1CFFA 1OZOA 1KFXL 1RTP1 2I7AA 1J7OA 3AAJA 1Q80A 3I5FC 1OE9B 2WCEA 2E30A 1PSRA 1KK8C 4BY5A 1CKKA 1NX1A 1QV1A 1PVAA 2LLTA 1S6IA 2Q91A 3D0YA 5DKQA 4A4BA 4UPGA 2LP3A 1BOCA 3CR2A 3I5HB 4PE4A 3SG2A 3M0WA 1AUIB 2M7LA 2I18A 2LE9B 2LVIA 2PMYA 1NP8A 2FCDA 4MN0A 3I5HC 1OMDA 2BE6A 2JXCA 3E3RA 2LV7A 4MRYA 1LA0A 3NXAA 3A8RA 1PSBA 1DVIA 2NZ0A 4PE1A 2KAXA 2JXLA 3DVKA 4P2YB 2H2KA 1FPWA 1W7IB 1XFUO 2DOQA 1K9PA 2R2IA 1NX0A 2D8NA 2F33A 4ORAB 3VRQA 4FTGA 2HF5A 1MWNA 2M0RA 2B1UA 5KSZA 4MEWA 4N1FA 2M29A 2NLNA 1ZFSA 2M49B 5AXIA 5J3XA 2WCBA 1DJWA 5ER5A 3K21A 1NX3A 3GK2A 2CCMA 4CLNA 3I5IB 1LINA 4P5OE 2MLFC 1RWYA 1XFWO 2KQYA 4PALA 2L4IA 4MZKA 1W7JB 2BKHB 1GGWA 3CWGA 2H61C 3IQOA 1AHRA 2L51A 3FS7A 3I5IC 4NDCA 1DTLA 2BCBA 1K95A 1S6JA 4YGAA 1A29A 2K61A 1XFYO 2KI6D 1B8CA 3PSRA 1HT9A 1TCOB 2LUXA 1EXRA 2M1UA 4MZJA 1A75B 2F8PA 1PVBA 1SPYA 1XA5A 4AQJA 4I5NB 1TNXA 2LAPA 2CTNA 1DJGA 5F6TA 3VRRA 3JVTC 2OTGC 2WORA 4ZCVA 1QJTA 2IS9A 4GGFA 2G2BA 4PCWA 3PFVA 3ICBA 4DS7A 1QS7A 2F2OA 1YRTB 4R1EA 3BUWB 1DF0A 3KF9A 3WHTB 4OV2A 1UHNA 1YR5A 1B7TZ 2BBMA 2L0PA 4AQIA 1XVJA 3AAKA 4XJKB 1C07A 4U8DA 2K7BA 1XK4A 1S5GY 1N65A 2KSPA 1JF0A 4D1EA 1M31A 3BUOB 2LUCA 1MXEA 1TOPA 2BECA 1OOJA 2ZN9A 5KU1A 3AKAA 3TDUA 3SG5A 2CNPA 3SIBA 4M2QA 2HQWA 5JOLA 5D69A 1SCMB 1IRJA 1H8BA 1SRAA 1S36A 2JTZA 2L50A 1FF1A 1SCVA 1JSAA 2KBIA 2ZNDA 2FCEA 4N5XA 1X02A 1RK9A 2NCPA 2O5GA 1SW8A 3C1VA 3JTDB 3NSKA 2NCOA 1K90D 4ETOA 1N2DA 1KWOB 2K2FA 4ZCUA 1QLKA 3TDIA 1BJFA 1CM1A 4M2OA 3GOFA 1L2OC 1KSMA 2KGBC 3BUMB 2ISDA 1OMVA 5TNCA 1AK8A 1TN4A 1J1EA 1AP4A 3JTDC 1G4YR 2JT3A 5PALA 2F3ZA 1CTRA 3O2PA 3OX5A 4MZLA 1TNPA 2KGRA 1DJHA 3RLZA 1RROA 4JQ0D 4QJ5B 3EVUA 1LA3A 2BKIB 1V1FA 2M7NA 1BLQA 1CLMA 1L7ZA 1SYMA 3DVJA 3PLFB 4IL1A 4JPZB 1IG5A 4YGEB 3DD4A 4YBHB 2FOTA 1BODA 2CT9A 2KHNA 2EC6B 3O6BA 1WRZA 1EG3A 2LMTA 2QACA 1LXFC 3ZWHA 1SKTA 2HQ8A 4GUKA 4C0LA 2Y1NA 4FQOA 1NPQA 2L4HA 2JULA 2LC5A 1SR6B 1F54A 2KFGA 4DCKA 1IQ3A 2EC6C 1IJ6A 4CFQA 1CFCA 1MQ1A 1ALWA 3O78A 4Q04A 3BQ3A 3EK4A 3WXAA 2KAYA 2RGIA 4MVFA 1OZSA 4NDBA 1J1DA 2WC8A 2K0JA 3MSEB 2LM5A 4M2PA 1XYDA 5DKNA 1PK0D 4YRUA 2LP2A 4PE0A 2LVVA 5AANA 2BCXA 2G9BA 1J7QA 1RJVA 2K7CA 1KK7Y 1Y1XA 4CPVA 1K2HA 5IBWA 1CM4A 3HX4A 1DT7B 2KNEA 4I5JA 1S6CA 1CMFA 3DF0A 1BG1A 1YURA 1KFXS 5CSIA 1JWDA 5CSFA 4WQ2A 1XFXO 4YGDB 1QIWA 5CSJA 1F4OA 2LMUA 3EKJA 3TS5B 1NSHA 2AAOA 5I2LA 1G33A 4YI8A 1NUBA 1DJZA 1YX7A 1LKJA 4MLWA 3PATA 5B8IB 1YUSA 3CR5X 1NCXA 1MUXA 2M1KB 1NX2A 2KBMA 1J7PA 1YVLA 2KI4B 1H4BA 2WCFA 5HKYA 1Y1AA 1CLLA 1UWOA 5HLVA 3PN7B 2MHHA 5D7FA 4ICBA 2PVBA 1YUUA 1SL8A 3PM8A 1OSAA 1BT6A 1IKUA 1DJIA 1F8HA 1JF2A 2KOTA 4L9MA 4OKHA 4C0KA 1XK4C 3TUYB 1DJXA 3LL8B 2MRDA 4A4CA 2KFFA 1UURA 2SCPA 3DVEA 4GGNA 1CDMA 5DKRA 4DIRA 1WRKA 3ZNIA 3CS1A 1ZACA 1ALVA 3SG6A 1V1GA 1CDLA 5I8NA 1B1GA 2CBLA 3O4YA 1S5GZ 1QVIY 3LLEA 2LMVA 1XFVO 2LLSA 3NSIA 1QXPA 2OS8B 2JNFA 2ZRSA 3PALA 5I2OA 2F3YA 2F2PA 2K7DA 2KYCA 1CB1A 2PRUA 1A75A 3OB2B 2JZIA 2JTTA 1BR1B 3FWBA 5AFPA 1B9AA 1OQPA 1UHKA 3DVMA 5FYXA 1Y6WA 2KQ6A 1M63B 1KQMB 3KEVA 1JFKA 1SCMC 2M8UA 3BOWB 1WLZA 1TCFA 1CDPA 1PALA 1B47A 2WOSA 1WY9A 4OCIA 1D1OA 1ZOTB 1SNLA 1QATA 4E68A 2A4JA 3KO0A 1HQVA 4WRIA 3VROA 1KQMC 1YUTA 1KWOC 2K7OA 4C0JA 2M97A 1MF8B 4OVNF 4PE7A 4F0ZB 1F4QA 1SL9A 5HYDA 1QV0A 1S3PA 1AJ5A 2MLEC 3BUNB 4GPLB 3D0YB 2L98A 1B4CA 1BR4B 2Y1MA 3GK4X 1J7RA 2BE4A 2GV5A 1NYAA 1BMOA 4TNCA 1QLSA 1DJYA 2I94A 1QTXA 1NWDA 4PHNA 2ZFDA 2JT0A 4NQGA 1U5IA 1NCZA 4GNKB 1UHIA 1EJ3A 3LCPC 1CFPA 4CIDA 1VRKA 1WDCB 2BL0B 5AEQA 5BPJA 1YVHA 2ZKMX 1MXLC 3GK1A 2HPSA 4QJ3B 1FW4A 4PDZA 2E6WA 1KSOA 2JU0A 3WNXB 5K89A 3CTNA 1WDCC 3OX6A 2LHLA 1M46A 2BL0C 2NXQA 4GBAA 1BU3A 1JFJA 1G8IA 3WHUB 1F55A 2HETA 4DUQA 3DF0B 3OP0A 2Q4UA 1SR6C 2PALA 1FBVA 2V53A 1K8UA 2OPOA 2JWWA 5GQQC 1UP5A 4GAOA 1IJ5A 1PRWA 1ODBA 2ZRTA 1CNPA 5I2QA 1YTZC 4JWQA 2GGMA 3IF7A 3CGAA 4GFTA 3TZ1A 1ZMZA 1IH0A 1TNWA 3VRPA 2MA2A 1KFUL 3SG4A 1MR8A 1NCYA 2KAVA 1KK7Z 2QPTA 3LK1A 1CLBA 1WRLA 1GQMA 3BYAA 4WQ3A 3H4SE 1SL7A 3CZTX 1N0YA 1GGZA 4HREE 1UUSA 1XO5A 5KTYA 2O60A 1B8RA 2LHIA 2L2EA 5HKWA 1R6PA 1TNQA 2MAZA 5HKZA 4CFRA 1SK6D 1SMGA 2AMIA 3RM1A 4OR9B 2GGZA 2BCAA 3TS5C 1A03A 4PHJA 3VRNA 1PULA 2CXJA 1UHHA 1JUOA 1NIWA 4I5LB 1JC2A 1QX7A 2JPTA 1DF0B 2KFHA 1GJYA 2EGDA 3CR4X 3F45A 4MSPA 5ER4X 2ZNEA 2M3WA 1K9UA 2LVKA 4GGFC 4YGCB 3VGOA 1IQ5A 1QASA 2JNXA 1IGVA 2PSRA 1RFJA 5G08A 2EHBA 2KYFA 1AVSA 2KI4C 2LLUA 1KFUS 1EG4A 4HRGA 5HLOA 3EK7A 2M9GA 4HSZA 2H61A 3PN7C 4PHMA 1YRUB 3JVTB 2OTGB 2Y4QA 1DGUA 1K96A 3NSOA 2KDHA 1A2XA 1ZUZA 3HCMA 1WLMA 2FJUB 2K2AA 3TUYC 3KHEA 1F70A 2MJWB 2BBNA 2Y5IA 3SG7A 1C7VA 1JBAA 1FI5A 1K94A 1DMOA 3LK0A 1QVIZ 3EK8A 1B7TY 1M45A 1CFDA 3CLNA 3SG3A 3FWCA 2AUCA 3NSLA 1MHOA 2JC2A 4YI9A 1S1EA 1F71A 2KI6C 2OS8C 1S26D 3I5GB 3OB1B 1KQVA 4DRWA 2VRGA 2LCPA 4QJ4B 1M39A 3D10A 1AJ4A 4N1GA 5CSNA 4YGBB 1DGVA 2LVJA 1OMRA 2JOJA 1QX2A 3I5GC 1E8AA 1BF5A 4XJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COL B;  1EH2 A;  1KCY A;  3IQQ A;  2JRF A;  3BXK A;  4PHK A;  3SJS A;  4BY4 A;  1J55 A;  1QIV A;  2LNK A;  1B8L A;  2P6B B;  1U5I B;  3TDZ A;  3KPX A;  2ZN8 A;  1L2O B;  1QX5 B;  2I2R E;  4XYN A;  2LAN A;  1Y1U A;  1REC A;  1Y0V H;  3BUX B;  1EL4 A;  4ORB B;  1A4P A;  1C7W A;  3FIA A;  3EVR A;  4MRX A;  2K8M B;  2SAS A;  2JT8 A;  5AER A;  1CDN A;  2JQ6 A;  1K9K A;  1TIZ A;  5JJG A;  1TTX A;  1YX8 A;  4MBE A;  4USL A;  3QRX A;  4AOM A;  3OHM B;  1FI6 A;  3EKH A;  2L5X B;  4ORC B;  4NDD A;  4I5K A;  1CMG A;  3SIA A;  1SBJ A;  3A4U B;  4HRH A;  3BOW A;  2TN4 A;  1K93 D;  2WND A;  2MBX A;  1XFZ O;  3I5F B;  5CPV A;  1R2U A;  1UHJ A;  1LVC D;  1IWQ A;  1KK8 B;  3AKB A;  1SY9 A;  2PAS A;  1TRF A;  3EVV A;  1CFF A;  1OZO A;  1KFX L;  1RTP 1;  2I7A A;  1J7O A;  3AAJ A;  1Q80 A;  3I5F C;  1OE9 B;  2WCE A;  2E30 A;  1PSR A;  1KK8 C;  4BY5 A;  1CKK A;  1NX1 A;  1QV1 A;  1PVA A;  2LLT A;  1S6I A;  2Q91 A;  3D0Y A;  5DKQ A;  4A4B A;  4UPG A;  2LP3 A;  1BOC A;  3CR2 A;  3I5H B;  4PE4 A;  3SG2 A;  3M0W A;  1AUI B;  2M7L A;  2I18 A;  2LE9 B;  2LVI A;  2PMY A;  1NP8 A;  2FCD A;  4MN0 A;  3I5H C;  1OMD A;  2BE6 A;  2JXC A;  3E3R A;  2LV7 A;  4MRY A;  1LA0 A;  3NXA A;  3A8R A;  1PSB A;  1DVI A;  2NZ0 A;  4PE1 A;  2KAX A;  2JXL A;  3DVK A;  4P2Y B;  2H2K A;  1FPW A;  1W7I B;  1XFU O;  2DOQ A;  1K9P A;  2R2I A;  1NX0 A;  2D8N A;  2F33 A;  4ORA B;  3VRQ A;  4FTG A;  2HF5 A;  1MWN A;  2M0R A;  2B1U A;  5KSZ A;  4MEW A;  4N1F A;  2M29 A;  2NLN A;  1ZFS A;  2M49 B;  5AXI A;  5J3X A;  2WCB A;  1DJW A;  5ER5 A;  3K21 A;  1NX3 A;  3GK2 A;  2CCM A;  4CLN A;  3I5I B;  1LIN A;  4P5O E;  2MLF C;  1RWY A;  1XFW O;  2KQY A;  4PAL A;  2L4I A;  4MZK A;  1W7J B;  2BKH B;  1GGW A;  3CWG A;  2H61 C;  3IQO A;  1AHR A;  2L51 A;  3FS7 A;  3I5I C;  4NDC A;  1DTL A;  2BCB A;  1K95 A;  1S6J A;  4YGA A;  1A29 A;  2K61 A;  1XFY O;  2KI6 D;  1B8C A;  3PSR A;  1HT9 A;  1TCO B;  2LUX A;  1EXR A;  2M1U A;  4MZJ A;  1A75 B;  2F8P A;  1PVB A;  1SPY A;  1XA5 A;  4AQJ A;  4I5N B;  1TNX A;  2LAP A;  2CTN A;  1DJG A;  5F6T A;  3VRR A;  3JVT C;  2OTG C;  2WOR A;  4ZCV A;  1QJT A;  2IS9 A;  4GGF A;  2G2B A;  4PCW A;  3PFV A;  3ICB A;  4DS7 A;  1QS7 A;  2F2O A;  1YRT B;  4R1E A;  3BUW B;  1DF0 A;  3KF9 A;  3WHT B;  4OV2 A;  1UHN A;  1YR5 A;  1B7T Z;  2BBM A;  2L0P A;  4AQI A;  1XVJ A;  3AAK A;  4XJK B;  1C07 A;  4U8D A;  2K7B A;  1XK4 A;  1S5G Y;  1N65 A;  2KSP A;  1JF0 A;  4D1E A;  1M31 A;  3BUO B;  2LUC A;  1MXE A;  1TOP A;  2BEC A;  1OOJ A;  2ZN9 A;  5KU1 A;  3AKA A;  3TDU A;  3SG5 A;  2CNP A;  3SIB A;  4M2Q A;  2HQW A;  5JOL A;  5D69 A;  1SCM B;  1IRJ A;  1H8B A;  1SRA A;  1S36 A;  2JTZ A;  2L50 A;  1FF1 A;  1SCV A;  1JSA A;  2KBI A;  2ZND A;  2FCE A;  4N5X A;  1X02 A;  1RK9 A;  2NCP A;  2O5G A;  1SW8 A;  3C1V A;  3JTD B;  3NSK A;  2NCO A;  1K90 D;  4ETO A;  1N2D A;  1KWO B;  2K2F A;  4ZCU A;  1QLK A;  3TDI A;  1BJF A;  1CM1 A;  4M2O A;  3GOF A;  1L2O C;  1KSM A;  2KGB C;  3BUM B;  2ISD A;  1OMV A;  5TNC A;  1AK8 A;  1TN4 A;  1J1E A;  1AP4 A;  3JTD C;  1G4Y R;  2JT3 A;  5PAL A;  2F3Z A;  1CTR A;  3O2P A;  3OX5 A;  4MZL A;  1TNP A;  2KGR A;  1DJH A;  3RLZ A;  1RRO A;  4JQ0 D;  4QJ5 B;  3EVU A;  1LA3 A;  2BKI B;  1V1F A;  2M7N A;  1BLQ A;  1CLM A;  1L7Z A;  1SYM A;  3DVJ A;  3PLF B;  4IL1 A;  4JPZ B;  1IG5 A;  4YGE B;  3DD4 A;  4YBH B;  2FOT A;  1BOD A;  2CT9 A;  2KHN A;  2EC6 B;  3O6B A;  1WRZ A;  1EG3 A;  2LMT A;  2QAC A;  1LXF C;  3ZWH A;  1SKT A;  2HQ8 A;  4GUK A;  4C0L A;  2Y1N A;  4FQO A;  1NPQ A;  2L4H A;  2JUL A;  2LC5 A;  1SR6 B;  1F54 A;  2KFG A;  4DCK A;  1IQ3 A;  2EC6 C;  1IJ6 A;  4CFQ A;  1CFC A;  1MQ1 A;  1ALW A;  3O78 A;  4Q04 A;  3BQ3 A;  3EK4 A;  3WXA A;  2KAY A;  2RGI A;  4MVF A;  1OZS A;  4NDB A;  1J1D A;  2WC8 A;  2K0J A;  3MSE B;  2LM5 A;  4M2P A;  1XYD A;  5DKN A;  1PK0 D;  4YRU A;  2LP2 A;  4PE0 A;  2LVV A;  5AAN A;  2BCX A;  2G9B A;  1J7Q A;  1RJV A;  2K7C A;  1KK7 Y;  1Y1X A;  4CPV A;  1K2H A;  5IBW A;  1CM4 A;  3HX4 A;  1DT7 B;  2KNE A;  4I5J A;  1S6C A;  1CMF A;  3DF0 A;  1BG1 A;  1YUR A;  1KFX S;  5CSI A;  1JWD A;  5CSF A;  4WQ2 A;  1XFX O;  4YGD B;  1QIW A;  5CSJ A;  1F4O A;  2LMU A;  3EKJ A;  3TS5 B;  1NSH A;  2AAO A;  5I2L A;  1G33 A;  4YI8 A;  1NUB A;  1DJZ A;  1YX7 A;  1LKJ A;  4MLW A;  3PAT A;  5B8I B;  1YUS A;  3CR5 X;  1NCX A;  1MUX A;  2M1K B;  1NX2 A;  2KBM A;  1J7P A;  1YVL A;  2KI4 B;  1H4B A;  2WCF A;  5HKY A;  1Y1A A;  1CLL A;  1UWO A;  5HLV A;  3PN7 B;  2MHH A;  5D7F A;  4ICB A;  2PVB A;  1YUU A;  1SL8 A;  3PM8 A;  1OSA A;  1BT6 A;  1IKU A;  1DJI A;  1F8H A;  1JF2 A;  2KOT A;  4L9M A;  4OKH A;  4C0K A;  1XK4 C;  3TUY B;  1DJX A;  3LL8 B;  2MRD A;  4A4C A;  2KFF A;  1UUR A;  2SCP A;  3DVE A;  4GGN A;  1CDM A;  5DKR A;  4DIR A;  1WRK A;  3ZNI A;  3CS1 A;  1ZAC A;  1ALV A;  3SG6 A;  1V1G A;  1CDL A;  5I8N A;  1B1G A;  2CBL A;  3O4Y A;  1S5G Z;  1QVI Y;  3LLE A;  2LMV A;  1XFV O;  2LLS A;  3NSI A;  1QXP A;  2OS8 B;  2JNF A;  2ZRS A;  3PAL A;  5I2O A;  2F3Y A;  2F2P A;  2K7D A;  2KYC A;  1CB1 A;  2PRU A;  1A75 A;  3OB2 B;  2JZI A;  2JTT A;  1BR1 B;  3FWB A;  5AFP A;  1B9A A;  1OQP A;  1UHK A;  3DVM A;  5FYX A;  1Y6W A;  2KQ6 A;  1M63 B;  1KQM B;  3KEV A;  1JFK A;  1SCM C;  2M8U A;  3BOW B;  1WLZ A;  1TCF A;  1CDP A;  1PAL A;  1B47 A;  2WOS A;  1WY9 A;  4OCI A;  1D1O A;  1ZOT B;  1SNL A;  1QAT A;  4E68 A;  2A4J A;  3KO0 A;  1HQV A;  4WRI A;  3VRO A;  1KQM C;  1YUT A;  1KWO C;  2K7O A;  4C0J A;  2M97 A;  1MF8 B;  4OVN F;  4PE7 A;  4F0Z B;  1F4Q A;  1SL9 A;  5HYD A;  1QV0 A;  1S3P A;  1AJ5 A;  2MLE C;  3BUN B;  4GPL B;  3D0Y B;  2L98 A;  1B4C A;  1BR4 B;  2Y1M A;  3GK4 X;  1J7R A;  2BE4 A;  2GV5 A;  1NYA A;  1BMO A;  4TNC A;  1QLS A;  1DJY A;  2I94 A;  1QTX A;  1NWD A;  4PHN A;  2ZFD A;  2JT0 A;  4NQG A;  1U5I A;  1NCZ A;  4GNK B;  1UHI A;  1EJ3 A;  3LCP C;  1CFP A;  4CID A;  1VRK A;  1WDC B;  2BL0 B;  5AEQ A;  5BPJ A;  1YVH A;  2ZKM X;  1MXL C;  3GK1 A;  2HPS A;  4QJ3 B;  1FW4 A;  4PDZ A;  2E6W A;  1KSO A;  2JU0 A;  3WNX B;  5K89 A;  3CTN A;  1WDC C;  3OX6 A;  2LHL A;  1M46 A;  2BL0 C;  2NXQ A;  4GBA A;  1BU3 A;  1JFJ A;  1G8I A;  3WHU B;  1F55 A;  2HET A;  4DUQ A;  3DF0 B;  3OP0 A;  2Q4U A;  1SR6 C;  2PAL A;  1FBV A;  2V53 A;  1K8U A;  2OPO A;  2JWW A;  5GQQ C;  1UP5 A;  4GAO A;  1IJ5 A;  1PRW A;  1ODB A;  2ZRT A;  1CNP A;  5I2Q A;  1YTZ C;  4JWQ A;  2GGM A;  3IF7 A;  3CGA A;  4GFT A;  3TZ1 A;  1ZMZ A;  1IH0 A;  1TNW A;  3VRP A;  2MA2 A;  1KFU L;  3SG4 A;  1MR8 A;  1NCY A;  2KAV A;  1KK7 Z;  2QPT A;  3LK1 A;  1CLB A;  1WRL A;  1GQM A;  3BYA A;  4WQ3 A;  3H4S E;  1SL7 A;  3CZT X;  1N0Y A;  1GGZ A;  4HRE E;  1UUS A;  1XO5 A;  5KTY A;  2O60 A;  1B8R A;  2LHI A;  2L2E A;  5HKW A;  1R6P A;  1TNQ A;  2MAZ A;  5HKZ A;  4CFR A;  1SK6 D;  1SMG A;  2AMI A;  3RM1 A;  4OR9 B;  2GGZ A;  2BCA A;  3TS5 C;  1A03 A;  4PHJ A;  3VRN A;  1PUL A;  2CXJ A;  1UHH A;  1JUO A;  1NIW A;  4I5L B;  1JC2 A;  1QX7 A;  2JPT A;  1DF0 B;  2KFH A;  1GJY A;  2EGD A;  3CR4 X;  3F45 A;  4MSP A;  5ER4 X;  2ZNE A;  2M3W A;  1K9U A;  2LVK A;  4GGF C;  4YGC B;  3VGO A;  1IQ5 A;  1QAS A;  2JNX A;  1IGV A;  2PSR A;  1RFJ A;  5G08 A;  2EHB A;  2KYF A;  1AVS A;  2KI4 C;  2LLU A;  1KFU S;  1EG4 A;  4HRG A;  5HLO A;  3EK7 A;  2M9G A;  4HSZ A;  2H61 A;  3PN7 C;  4PHM A;  1YRU B;  3JVT B;  2OTG B;  2Y4Q A;  1DGU A;  1K96 A;  3NSO A;  2KDH A;  1A2X A;  1ZUZ A;  3HCM A;  1WLM A;  2FJU B;  2K2A A;  3TUY C;  3KHE A;  1F70 A;  2MJW B;  2BBN A;  2Y5I A;  3SG7 A;  1C7V A;  1JBA A;  1FI5 A;  1K94 A;  1DMO A;  3LK0 A;  1QVI Z;  3EK8 A;  1B7T Y;  1M45 A;  1CFD A;  3CLN A;  3SG3 A;  3FWC A;  2AUC A;  3NSL A;  1MHO A;  2JC2 A;  4YI9 A;  1S1E A;  1F71 A;  2KI6 C;  2OS8 C;  1S26 D;  3I5G B;  3OB1 B;  1KQV A;  4DRW A;  2VRG A;  2LCP A;  4QJ4 B;  1M39 A;  3D10 A;  1AJ4 A;  4N1G A;  5CSN A;  4YGB B;  1DGV A;  2LVJ A;  1OMR A;  2JOJ A;  1QX2 A;  3I5G C;  1E8A A;  1BF5 A;  4XJK A; 
#chains in the Genus database with same CATH topology
 2COL B;  1EH2 A;  1KCY A;  3S0E A;  3IQQ A;  2JRF A;  3BXK A;  4PHK A;  3SJS A;  4BY4 A;  1J55 A;  1QIV A;  2LNK A;  1B8L A;  2P6B B;  1U5I B;  3TDZ A;  3D77 A;  3KPX A;  2ZN8 A;  1L2O B;  4INX A;  1QX5 B;  2I2R E;  4XYN A;  2LAN A;  1Y1U A;  1REC A;  1Y0V H;  3BUX B;  1EL4 A;  4ORB B;  1A4P A;  1C7W A;  3FIA A;  3EVR A;  4MRX A;  2K8M B;  2SAS A;  2JT8 A;  5AER A;  1CDN A;  2JQ6 A;  1K9K A;  3OBV A;  1TIZ A;  5JJG A;  1TTX A;  1YX8 A;  4MBE A;  4USL A;  3QRX A;  4AOM A;  3OHM B;  1FI6 A;  3EKH A;  2L5X B;  4ORC B;  4NDD A;  4I5K A;  1CMG A;  3SIA A;  1SBJ A;  3BFH A;  3A4U B;  4HRH A;  3BOW A;  2TN4 A;  1K93 D;  2WND A;  2MBX A;  1XFZ O;  3I5F B;  5CPV A;  1R2U A;  1UHJ A;  1LVC D;  1IWQ A;  1KK8 B;  3DZT A;  3AKB A;  1SY9 A;  2PAS A;  1TRF A;  3EVV A;  1CFF A;  3SS5 A;  1OZO A;  2YGU A;  1KFX L;  1RTP 1;  2I7A A;  1J7O A;  3AAJ A;  4IJ7 A;  1Q80 A;  3I5F C;  1OE9 B;  3R1V A;  2WCE A;  3SS3 A;  2E30 A;  1PSR A;  1KK8 C;  4BY5 A;  1CKK A;  1Z4H A;  2PQL A;  1NX1 A;  1QV1 A;  1PVA A;  2LLT A;  1S6I A;  2Q91 A;  3D0Y A;  5DKQ A;  2WCL A;  4A4B A;  2LP3 A;  1BOC A;  3CR2 A;  3I5H B;  4PE4 A;  3CZ0 A;  3SG2 A;  1OOF A;  3M0W A;  1AUI B;  2M7L A;  2I18 A;  2LE9 B;  2LVI A;  2PMY A;  1NP8 A;  1LS8 A;  2FCD A;  4MN0 A;  3I5H C;  1OMD A;  2BE6 A;  2JXC A;  3E3R A;  2LV7 A;  4MRY A;  1LA0 A;  3NXA A;  3CYZ A;  3A8R A;  1PSB A;  1DVI A;  2NZ0 A;  4PE1 A;  2KAX A;  2JXL A;  3DVK A;  4P2Y B;  2H2K A;  1FPW A;  1W7I B;  1XFU O;  2DOQ A;  1K9P A;  2R2I A;  1NX0 A;  2D8N A;  2F33 A;  4ORA B;  3VRQ A;  4FTG A;  2HF5 A;  1MWN A;  2M0R A;  2B1U A;  5KSZ A;  4MEW A;  4N1F A;  2M29 A;  2NLN A;  1ZFS A;  2M49 B;  5AXI A;  3DY9 A;  5J3X A;  2WCB A;  3VB1 A;  1DJW A;  5ER5 A;  3K21 A;  1NX3 A;  3GK2 A;  2CCM A;  4CLN A;  3I5I B;  1LIN A;  2P71 A;  4P5O E;  2MLF C;  2QEO A;  1T14 A;  1RWY A;  1XFW O;  2KQY A;  1P28 A;  2QEH A;  2L4I A;  4PAL A;  4MZK A;  1W7J B;  2BKH B;  1GGW A;  4UPG A;  3CWG A;  2H61 C;  3IQO A;  3L4A A;  1AHR A;  3D74 A;  2L51 A;  3FS7 A;  3I5I C;  1XFR A;  4NDC A;  3B86 A;  1DTL A;  2BCB A;  1K95 A;  1S6J A;  3CZ2 A;  1A29 A;  2K61 A;  4YGA A;  1XFY O;  2KI6 D;  1B8C A;  3PSR A;  1HT9 A;  1TCO B;  2LUX A;  1EXR A;  2M1U A;  4MZJ A;  1A75 B;  1OW4 A;  2F8P A;  1PVB A;  1SPY A;  1XA5 A;  4AQJ A;  2L2C A;  4I5N B;  5EL2 A;  1TNX A;  2LAP A;  3L4L A;  2CTN A;  1DJG A;  5F6T A;  3VRR A;  3JVT C;  2OTG C;  2WOR A;  4ZCV A;  1QJT A;  5FI2 A;  2IS9 A;  2WC5 A;  4GGF A;  2G2B A;  4PCW A;  3PFV A;  3S0B A;  3ICB A;  4DS7 A;  1QS7 A;  2F2O A;  2WC6 A;  1YRT B;  4R1E A;  3BUW B;  1DF0 A;  3KF9 A;  3WHT B;  4OV2 A;  1UHN A;  1YR5 A;  1B7T Z;  2BBM A;  2L0P A;  4AQI A;  1XVJ A;  3AAK A;  4XJK B;  1C07 A;  2QEB A;  4U8D A;  2K7B A;  1XK4 A;  3R1O A;  1S5G Y;  1N65 A;  2KSP A;  1JF0 A;  4D1E A;  1M31 A;  3NHT A;  3BUO B;  2LUC A;  3NHI A;  1MXE A;  1TOP A;  5FI6 A;  2BEC A;  1OOJ A;  2ZN9 A;  3S0A A;  5KU1 A;  3AKA A;  3TDU A;  3SG5 A;  2CNP A;  3SIB A;  3QME A;  4M2Q A;  2HQW A;  4PT1 A;  5JOL A;  5D69 A;  1SCM B;  1IRJ A;  1H8B A;  1SRA A;  1S36 A;  2JTZ A;  2L50 A;  1FF1 A;  1SCV A;  1JSA A;  2KBI A;  2ZND A;  2FCE A;  4N5X A;  1X02 A;  1RK9 A;  2NCP A;  2O5G A;  1SW8 A;  3C1V A;  3JTD B;  3NSK A;  4JKT A;  2WCM A;  2NCO A;  1K90 D;  3L47 A;  3B88 A;  4ETO A;  1N2D A;  1KWO B;  2K2F A;  4ZCU A;  1QLK A;  3TDI A;  1BJF A;  1CM1 A;  1SSE B;  4M2O A;  3GOF A;  1L2O C;  1KSM A;  2KGB C;  3BUM B;  2ISD A;  1OMV A;  5TNC A;  1AK8 A;  1TN4 A;  1J1E A;  1AP4 A;  3JTD C;  1G4Y R;  2JT3 A;  5PAL A;  2F3Z A;  1CTR A;  3O2P A;  3FE8 A;  3OX5 A;  4MZL A;  1TNP A;  2KGR A;  1DJH A;  3RLZ A;  1RRO A;  4JQ0 D;  4QJ5 B;  3EVU A;  1LA3 A;  2BKI B;  1V1F A;  1Z2C B;  2M7N A;  3D75 A;  1BLQ A;  1CLM A;  1L7Z A;  1SYM A;  3DVJ A;  3PLF B;  4IL1 A;  4JPZ B;  1IG5 A;  4YGE B;  3DD4 A;  4YBH B;  2FOT A;  1BOD A;  2CT9 A;  2KHN A;  2EC6 B;  3B7A A;  3O6B A;  3K1E A;  1WRZ A;  1EG3 A;  2LMT A;  2QAC A;  1LXF C;  3ZWH A;  1SKT A;  2HQ8 A;  4GUK A;  4C0L A;  2Y1N A;  4FQO A;  3Q8I A;  1NPQ A;  2L4H A;  2JUL A;  2LC5 A;  1SR6 B;  1F54 A;  2KFG A;  4DCK A;  1IQ3 A;  2EC6 C;  1IJ6 A;  4CFQ A;  1CFC A;  1MQ1 A;  1ALW A;  3O78 A;  4Q04 A;  3BQ3 A;  3EK4 A;  3RZS A;  3WXA A;  2KAY A;  2RGI A;  4MVF A;  1OZS A;  4NDB A;  3S0F A;  1J1D A;  2WC8 A;  1OOI X;  2K0J A;  3MSE B;  2LM5 A;  4M2P A;  1XYD A;  5DKN A;  1PK0 D;  4YRU A;  2LP2 A;  4PE0 A;  2LVV A;  3DYE A;  5AAN A;  2BCX A;  2G9B A;  3UO9 A;  1J7Q A;  1RJV A;  2K7C A;  1KK7 Y;  1Y1X A;  1TUJ A;  4CPV A;  1K2H A;  5IBW A;  1CM4 A;  3HX4 A;  1DT7 B;  1QWV A;  2KNE A;  4I5J A;  1S6C A;  1CMF A;  2ERB A;  3DF0 A;  1DEK A;  1YUR A;  3FE9 A;  1KFX S;  5CSI A;  1BG1 A;  1JWD A;  5CSF A;  4WQ2 A;  1XFX O;  2H8V A;  4INW A;  1QIW A;  4YGD B;  5CSJ A;  1F4O A;  2LMU A;  3EKJ A;  3TS5 B;  2QDI A;  1NSH A;  5I94 A;  2AAO A;  5I2L A;  3PM2 A;  1G33 A;  4YI8 A;  3UNW A;  1NUB A;  1DJZ A;  1YX7 A;  1LKJ A;  4MLW A;  3PAT A;  2GTE A;  1YUS A;  2BAP A;  3CR5 X;  5B8I B;  1TUZ A;  1NCX A;  1MUX A;  2P70 A;  2M1K B;  1NX2 A;  4FQT A;  2KBM A;  1J7P A;  1YVL A;  2KI4 B;  1H4B A;  2WCF A;  3OGN A;  1Y1A A;  5HKY A;  1CLL A;  1UWO A;  5HLV A;  3PN7 B;  2MHH A;  5D7F A;  4ICB A;  2PVB A;  4KYN A;  1YUU A;  1SL8 A;  3PM8 A;  1OSA A;  1BT6 A;  1IKU A;  1DJI A;  1F8H A;  1JF2 A;  2KOT A;  4L9M A;  4OKH A;  4C0K A;  1XK4 C;  3TUY B;  1DJX A;  1C3Y A;  3LL8 B;  2MRD A;  4A4C A;  2KFF A;  1UUR A;  2SCP A;  3DVE A;  4GGN A;  1CDM A;  5DKR A;  4DIR A;  1WRK A;  3ZNI A;  3CS1 A;  1ZAC A;  3BFB A;  1ALV A;  3FE6 A;  1V1G A;  3SG6 A;  1CDL A;  5I8N A;  3V2L A;  1B1G A;  2CBL A;  3EG5 B;  3O4Y A;  1S5G Z;  1QVI Y;  2WCH A;  3LLE A;  2LMV A;  1XFV O;  2LLS A;  3NSI A;  1GM0 A;  3D78 A;  1QXP A;  2OS8 B;  2JNF A;  2ZRS A;  3PAL A;  5I2O A;  2F3Y A;  2F2P A;  2K7D A;  3N7H A;  2KYC A;  1CB1 A;  2PRU A;  1A75 A;  3OB2 B;  2JZI A;  2PYQ A;  2JTT A;  1BR1 B;  3FWB A;  3PJI A;  4OZD A;  2QEV A;  5AFP A;  1B9A A;  1OQP A;  1UHK A;  3DVM A;  5FYX A;  1Y6W A;  2KQ6 A;  1M63 B;  3B6X A;  1KQM B;  3KEV A;  1JFK A;  1SCM C;  2M8U A;  3BOW B;  1WLZ A;  1TCF A;  1CDP A;  1PAL A;  1B47 A;  2WOS A;  1WY9 A;  4OCI A;  1D1O A;  1ZOT B;  2JPO A;  1SNL A;  1QAT A;  4E68 A;  2A4J A;  3KO0 A;  2K60 A;  1HQV A;  4WRI A;  3VRO A;  1KQM C;  1YUT A;  1KWO C;  2K7O A;  3CZ1 A;  4C0J A;  2M97 A;  1MF8 B;  4OVN F;  4PE7 A;  4F0Z B;  1F4Q A;  1SL9 A;  5HYD A;  1QV0 A;  1S3P A;  1AJ5 A;  2MLE C;  1W9Z A;  3BUN B;  4GPL B;  3D0Y B;  2L98 A;  1B4C A;  1BR4 B;  2Y1M A;  1IIO A;  3GK4 X;  1J7R A;  3BFA A;  2BE4 A;  2GV5 A;  1NYA A;  1BMO A;  4TNC A;  1QLS A;  1DJY A;  2I94 A;  1QTX A;  1NWD A;  2BNX A;  4PHN A;  2ZFD A;  2JT0 A;  4NQG A;  1U5I A;  1NCZ A;  4GNK B;  1UHI A;  1EJ3 A;  3LCP C;  1CFP A;  4CID A;  1VRK A;  2L5Y A;  1WDC B;  2BL0 B;  5AEQ A;  5BPJ A;  1DQE A;  1YVH A;  2ZKM X;  5DIC A;  1MXL C;  3GK1 A;  3R72 A;  3B87 A;  2HPS A;  4QJ3 B;  1FW4 A;  4JD9 A;  4PDZ A;  2E6W A;  1KSO A;  2JU0 A;  3WNX B;  5K89 A;  3CTN A;  1WDC C;  3OX6 A;  2LHL A;  1M46 A;  2BL0 C;  2NXQ A;  4GBA A;  1BU3 A;  1JFJ A;  1G8I A;  3WHU B;  1F55 A;  2HET A;  4DUQ A;  3DF0 B;  1DEL A;  3OP0 A;  2Q4U A;  1SR6 C;  2PAL A;  1FBV A;  2V53 A;  1K8U A;  3NGV A;  2OPO A;  5HL1 A;  2JWW A;  3R1P A;  5GQQ C;  1UP5 A;  4GAO A;  1IJ5 A;  1OOG A;  1PRW A;  1ODB A;  2ZRT A;  3D73 A;  1CNP A;  5I2Q A;  1YTZ C;  4JWQ A;  2GGM A;  3IF7 A;  3CGA A;  4GFT A;  3TZ1 A;  1ZMZ A;  1IH0 A;  1TNW A;  2FJY A;  2KLD A;  3VRP A;  2MA2 A;  5D3O A;  1KFU L;  3SG4 A;  1MR8 A;  1NCY A;  2KAV A;  1KK7 Z;  2QPT A;  3LK1 A;  1CLB A;  1WRL A;  1GQM A;  3BYA A;  4WQ3 A;  3H4S E;  1SL7 A;  3CZT X;  1N0Y A;  1GGZ A;  4HRE E;  5FI7 A;  3BJH A;  1UUS A;  1XO5 A;  3S0D A;  1DC1 A;  5KTY A;  2O60 A;  1B8R A;  3S0G A;  2LHI A;  2L2E A;  5HKW A;  1R6P A;  1TNQ A;  2MAZ A;  5HKZ A;  4CFR A;  1SK6 D;  1SMG A;  2AMI A;  3RM1 A;  4OR9 B;  2GGZ A;  2BCA A;  1C3Z A;  3TS5 C;  1A03 A;  4PHJ A;  3SS4 A;  1PUL A;  2CXJ A;  3VRN A;  1UHH A;  1JUO A;  1NIW A;  1OOH A;  4I5L B;  1JC2 A;  2KPH A;  1QX7 A;  2JPT A;  1DF0 B;  3CAB A;  2KFH A;  1GJY A;  2EGD A;  3CR4 X;  3F45 A;  4MSP A;  5ER4 X;  2ZNE A;  2M3W A;  1K9U A;  2LVK A;  4GGF C;  4YGC B;  3VGO A;  2WCK A;  1IQ5 A;  1QAS A;  2JNX A;  1IGV A;  2PSR A;  1RFJ A;  5G08 A;  1TWO A;  2EHB A;  2KYF A;  1AVS A;  2KI4 C;  2LLU A;  1KFU S;  1EG4 A;  3D76 A;  4HRG A;  5HLO A;  4F7F A;  3EK7 A;  2M9G A;  4HSZ A;  2H61 A;  3PN7 C;  4PHM A;  1YRU B;  3JVT B;  2OTG B;  2Y4Q A;  1DGU A;  1K96 A;  3CDN A;  3NSO A;  2KDH A;  1A2X A;  1ZUZ A;  3HCM A;  1WLM A;  2FJU B;  1ORG A;  2K2A A;  3TUY C;  3KHE A;  1F70 A;  2MJW B;  2BBN A;  2Y5I A;  3SG7 A;  1C7V A;  3O4X A;  1JBA A;  1FI5 A;  1K94 A;  1DMO A;  3LK0 A;  1QVI Z;  3EK8 A;  1B7T Y;  1M45 A;  1CFD A;  3CLN A;  3IVT A;  3SG3 A;  3FWC A;  2AUC A;  3NSL A;  1MHO A;  2JC2 A;  2WCJ A;  3DXL A;  4YI9 A;  1S1E A;  1F71 A;  2KI6 C;  2OS8 C;  1S26 D;  3I5G B;  3OB1 B;  1KQV A;  4DRW A;  2VRG A;  2LCP A;  4QJ4 B;  1M39 A;  3D10 A;  1AJ4 A;  4N1G A;  5CSN A;  4YGB B;  1DGV A;  2LVJ A;  1OMR A;  2KLE A;  2JOJ A;  1QX2 A;  3I5G C;  1E8A A;  1BF5 A;  4XJK A; 
#chains in the Genus database with same CATH homology
 2COL B;  1EH2 A;  1KCY A;  3IQQ A;  2JRF A;  3BXK A;  4PHK A;  3SJS A;  4BY4 A;  1J55 A;  1QIV A;  2LNK A;  1B8L A;  2P6B B;  1U5I B;  3TDZ A;  3KPX A;  2ZN8 A;  1L2O B;  1QX5 B;  2I2R E;  4XYN A;  2LAN A;  1Y1U A;  1REC A;  1Y0V H;  3BUX B;  1EL4 A;  4ORB B;  1A4P A;  1C7W A;  3FIA A;  3EVR A;  4MRX A;  2K8M B;  2SAS A;  2JT8 A;  5AER A;  1CDN A;  2JQ6 A;  1K9K A;  1TIZ A;  5JJG A;  1TTX A;  1YX8 A;  4MBE A;  4USL A;  3QRX A;  4AOM A;  3OHM B;  1FI6 A;  3EKH A;  2L5X B;  4ORC B;  4NDD A;  4I5K A;  1CMG A;  3SIA A;  1SBJ A;  3A4U B;  4HRH A;  3BOW A;  2TN4 A;  1K93 D;  2WND A;  2MBX A;  1XFZ O;  3I5F B;  5CPV A;  1R2U A;  1UHJ A;  1LVC D;  1IWQ A;  1KK8 B;  3AKB A;  1SY9 A;  2PAS A;  1TRF A;  3EVV A;  1CFF A;  1OZO A;  1KFX L;  1RTP 1;  2I7A A;  1J7O A;  3AAJ A;  1Q80 A;  3I5F C;  1OE9 B;  2WCE A;  2E30 A;  1PSR A;  1KK8 C;  4BY5 A;  1CKK A;  1NX1 A;  1QV1 A;  1PVA A;  2LLT A;  1S6I A;  2Q91 A;  3D0Y A;  5DKQ A;  4A4B A;  4UPG A;  2LP3 A;  1BOC A;  3CR2 A;  3I5H B;  4PE4 A;  3SG2 A;  3M0W A;  1AUI B;  2M7L A;  2I18 A;  2LE9 B;  2LVI A;  2PMY A;  1NP8 A;  2FCD A;  4MN0 A;  3I5H C;  1OMD A;  2BE6 A;  2JXC A;  3E3R A;  2LV7 A;  4MRY A;  1LA0 A;  3NXA A;  3A8R A;  1PSB A;  1DVI A;  2NZ0 A;  4PE1 A;  2KAX A;  2JXL A;  3DVK A;  4P2Y B;  2H2K A;  1FPW A;  1W7I B;  1XFU O;  2DOQ A;  1K9P A;  2R2I A;  1NX0 A;  2D8N A;  2F33 A;  4ORA B;  3VRQ A;  4FTG A;  2HF5 A;  1MWN A;  2M0R A;  2B1U A;  5KSZ A;  4MEW A;  4N1F A;  2M29 A;  2NLN A;  1ZFS A;  2M49 B;  5AXI A;  5J3X A;  2WCB A;  1DJW A;  5ER5 A;  3K21 A;  1NX3 A;  3GK2 A;  2CCM A;  4CLN A;  3I5I B;  1LIN A;  4P5O E;  2MLF C;  1RWY A;  1XFW O;  2KQY A;  4PAL A;  2L4I A;  4MZK A;  1W7J B;  2BKH B;  1GGW A;  3CWG A;  2H61 C;  3IQO A;  1AHR A;  2L51 A;  3FS7 A;  3I5I C;  4NDC A;  1DTL A;  2BCB A;  1K95 A;  1S6J A;  4YGA A;  1A29 A;  2K61 A;  1XFY O;  2KI6 D;  1B8C A;  3PSR A;  1HT9 A;  1TCO B;  2LUX A;  1EXR A;  2M1U A;  4MZJ A;  1A75 B;  2F8P A;  1PVB A;  1SPY A;  1XA5 A;  4AQJ A;  4I5N B;  1TNX A;  2LAP A;  2CTN A;  1DJG A;  5F6T A;  3VRR A;  3JVT C;  2OTG C;  2WOR A;  4ZCV A;  1QJT A;  2IS9 A;  4GGF A;  2G2B A;  4PCW A;  3PFV A;  3ICB A;  4DS7 A;  1QS7 A;  2F2O A;  1YRT B;  4R1E A;  3BUW B;  1DF0 A;  3KF9 A;  3WHT B;  4OV2 A;  1UHN A;  1YR5 A;  1B7T Z;  2BBM A;  2L0P A;  4AQI A;  1XVJ A;  3AAK A;  4XJK B;  1C07 A;  4U8D A;  2K7B A;  1XK4 A;  1S5G Y;  1N65 A;  2KSP A;  1JF0 A;  4D1E A;  1M31 A;  3BUO B;  2LUC A;  1MXE A;  1TOP A;  2BEC A;  1OOJ A;  2ZN9 A;  5KU1 A;  3AKA A;  3TDU A;  3SG5 A;  2CNP A;  3SIB A;  4M2Q A;  2HQW A;  5JOL A;  5D69 A;  1SCM B;  1IRJ A;  1H8B A;  1SRA A;  1S36 A;  2JTZ A;  2L50 A;  1FF1 A;  1SCV A;  1JSA A;  2KBI A;  2ZND A;  2FCE A;  4N5X A;  1X02 A;  1RK9 A;  2NCP A;  2O5G A;  1SW8 A;  3C1V A;  3JTD B;  3NSK A;  2NCO A;  1K90 D;  4ETO A;  1N2D A;  1KWO B;  2K2F A;  4ZCU A;  1QLK A;  3TDI A;  1BJF A;  1CM1 A;  4M2O A;  3GOF A;  1L2O C;  1KSM A;  2KGB C;  3BUM B;  2ISD A;  1OMV A;  5TNC A;  1AK8 A;  1TN4 A;  1J1E A;  1AP4 A;  3JTD C;  1G4Y R;  2JT3 A;  5PAL A;  2F3Z A;  1CTR A;  3O2P A;  3OX5 A;  4MZL A;  1TNP A;  2KGR A;  1DJH A;  3RLZ A;  1RRO A;  4JQ0 D;  4QJ5 B;  3EVU A;  1LA3 A;  2BKI B;  1V1F A;  2M7N A;  1BLQ A;  1CLM A;  1L7Z A;  1SYM A;  3DVJ A;  3PLF B;  4IL1 A;  4JPZ B;  1IG5 A;  4YGE B;  3DD4 A;  4YBH B;  2FOT A;  1BOD A;  2CT9 A;  2KHN A;  2EC6 B;  3O6B A;  1WRZ A;  1EG3 A;  2LMT A;  2QAC A;  1LXF C;  3ZWH A;  1SKT A;  2HQ8 A;  4GUK A;  4C0L A;  2Y1N A;  4FQO A;  1NPQ A;  2L4H A;  2JUL A;  2LC5 A;  1SR6 B;  1F54 A;  2KFG A;  4DCK A;  1IQ3 A;  2EC6 C;  1IJ6 A;  4CFQ A;  1CFC A;  1MQ1 A;  1ALW A;  3O78 A;  4Q04 A;  3BQ3 A;  3EK4 A;  3WXA A;  2KAY A;  2RGI A;  4MVF A;  1OZS A;  4NDB A;  1J1D A;  2WC8 A;  2K0J A;  3MSE B;  2LM5 A;  4M2P A;  1XYD A;  5DKN A;  1PK0 D;  4YRU A;  2LP2 A;  4PE0 A;  2LVV A;  5AAN A;  2BCX A;  2G9B A;  1J7Q A;  1RJV A;  2K7C A;  1KK7 Y;  1Y1X A;  4CPV A;  1K2H A;  5IBW A;  1CM4 A;  3HX4 A;  1DT7 B;  2KNE A;  4I5J A;  1S6C A;  1CMF A;  3DF0 A;  1BG1 A;  1YUR A;  1KFX S;  5CSI A;  1JWD A;  5CSF A;  4WQ2 A;  1XFX O;  4YGD B;  1QIW A;  5CSJ A;  1F4O A;  2LMU A;  3EKJ A;  3TS5 B;  1NSH A;  2AAO A;  5I2L A;  1G33 A;  4YI8 A;  1NUB A;  1DJZ A;  1YX7 A;  1LKJ A;  4MLW A;  3PAT A;  5B8I B;  1YUS A;  3CR5 X;  1NCX A;  1MUX A;  2M1K B;  1NX2 A;  2KBM A;  1J7P A;  1YVL A;  2KI4 B;  1H4B A;  2WCF A;  5HKY A;  1Y1A A;  1CLL A;  1UWO A;  5HLV A;  3PN7 B;  2MHH A;  5D7F A;  4ICB A;  2PVB A;  1YUU A;  1SL8 A;  3PM8 A;  1OSA A;  1BT6 A;  1IKU A;  1DJI A;  1F8H A;  1JF2 A;  2KOT A;  4L9M A;  4OKH A;  4C0K A;  1XK4 C;  3TUY B;  1DJX A;  3LL8 B;  2MRD A;  4A4C A;  2KFF A;  1UUR A;  2SCP A;  3DVE A;  4GGN A;  1CDM A;  5DKR A;  4DIR A;  1WRK A;  3ZNI A;  3CS1 A;  1ZAC A;  1ALV A;  3SG6 A;  1V1G A;  1CDL A;  5I8N A;  1B1G A;  2CBL A;  3O4Y A;  1S5G Z;  1QVI Y;  3LLE A;  2LMV A;  1XFV O;  2LLS A;  3NSI A;  1QXP A;  2OS8 B;  2JNF A;  2ZRS A;  3PAL A;  5I2O A;  2F3Y A;  2F2P A;  2K7D A;  2KYC A;  1CB1 A;  2PRU A;  1A75 A;  3OB2 B;  2JZI A;  2JTT A;  1BR1 B;  3FWB A;  5AFP A;  1B9A A;  1OQP A;  1UHK A;  3DVM A;  5FYX A;  1Y6W A;  2KQ6 A;  1M63 B;  1KQM B;  3KEV A;  1JFK A;  1SCM C;  2M8U A;  3BOW B;  1WLZ A;  1TCF A;  1CDP A;  1PAL A;  1B47 A;  2WOS A;  1WY9 A;  4OCI A;  1D1O A;  1ZOT B;  1SNL A;  1QAT A;  4E68 A;  2A4J A;  3KO0 A;  1HQV A;  4WRI A;  3VRO A;  1KQM C;  1YUT A;  1KWO C;  2K7O A;  4C0J A;  2M97 A;  1MF8 B;  4OVN F;  4PE7 A;  4F0Z B;  1F4Q A;  1SL9 A;  5HYD A;  1QV0 A;  1S3P A;  1AJ5 A;  2MLE C;  3BUN B;  4GPL B;  3D0Y B;  2L98 A;  1B4C A;  1BR4 B;  2Y1M A;  3GK4 X;  1J7R A;  2BE4 A;  2GV5 A;  1NYA A;  1BMO A;  4TNC A;  1QLS A;  1DJY A;  2I94 A;  1QTX A;  1NWD A;  4PHN A;  2ZFD A;  2JT0 A;  4NQG A;  1U5I A;  1NCZ A;  4GNK B;  1UHI A;  1EJ3 A;  3LCP C;  1CFP A;  4CID A;  1VRK A;  1WDC B;  2BL0 B;  5AEQ A;  5BPJ A;  1YVH A;  2ZKM X;  1MXL C;  3GK1 A;  2HPS A;  4QJ3 B;  1FW4 A;  4PDZ A;  2E6W A;  1KSO A;  2JU0 A;  3WNX B;  5K89 A;  3CTN A;  1WDC C;  3OX6 A;  2LHL A;  1M46 A;  2BL0 C;  2NXQ A;  4GBA A;  1BU3 A;  1JFJ A;  1G8I A;  3WHU B;  1F55 A;  2HET A;  4DUQ A;  3DF0 B;  3OP0 A;  2Q4U A;  1SR6 C;  2PAL A;  1FBV A;  2V53 A;  1K8U A;  2OPO A;  2JWW A;  5GQQ C;  1UP5 A;  4GAO A;  1IJ5 A;  1PRW A;  1ODB A;  2ZRT A;  1CNP A;  5I2Q A;  1YTZ C;  4JWQ A;  2GGM A;  3IF7 A;  3CGA A;  4GFT A;  3TZ1 A;  1ZMZ A;  1IH0 A;  1TNW A;  3VRP A;  2MA2 A;  1KFU L;  3SG4 A;  1MR8 A;  1NCY A;  2KAV A;  1KK7 Z;  2QPT A;  3LK1 A;  1CLB A;  1WRL A;  1GQM A;  3BYA A;  4WQ3 A;  3H4S E;  1SL7 A;  3CZT X;  1N0Y A;  1GGZ A;  4HRE E;  1UUS A;  1XO5 A;  5KTY A;  2O60 A;  1B8R A;  2LHI A;  2L2E A;  5HKW A;  1R6P A;  1TNQ A;  2MAZ A;  5HKZ A;  4CFR A;  1SK6 D;  1SMG A;  2AMI A;  3RM1 A;  4OR9 B;  2GGZ A;  2BCA A;  3TS5 C;  1A03 A;  4PHJ A;  3VRN A;  1PUL A;  2CXJ A;  1UHH A;  1JUO A;  1NIW A;  4I5L B;  1JC2 A;  1QX7 A;  2JPT A;  1DF0 B;  2KFH A;  1GJY A;  2EGD A;  3CR4 X;  3F45 A;  4MSP A;  5ER4 X;  2ZNE A;  2M3W A;  1K9U A;  2LVK A;  4GGF C;  4YGC B;  3VGO A;  1IQ5 A;  1QAS A;  2JNX A;  1IGV A;  2PSR A;  1RFJ A;  5G08 A;  2EHB A;  2KYF A;  1AVS A;  2KI4 C;  2LLU A;  1KFU S;  1EG4 A;  4HRG A;  5HLO A;  3EK7 A;  2M9G A;  4HSZ A;  2H61 A;  3PN7 C;  4PHM A;  1YRU B;  3JVT B;  2OTG B;  2Y4Q A;  1DGU A;  1K96 A;  3NSO A;  2KDH A;  1A2X A;  1ZUZ A;  3HCM A;  1WLM A;  2FJU B;  2K2A A;  3TUY C;  3KHE A;  1F70 A;  2MJW B;  2BBN A;  2Y5I A;  3SG7 A;  1C7V A;  1JBA A;  1FI5 A;  1K94 A;  1DMO A;  3LK0 A;  1QVI Z;  3EK8 A;  1B7T Y;  1M45 A;  1CFD A;  3CLN A;  3SG3 A;  3FWC A;  2AUC A;  3NSL A;  1MHO A;  2JC2 A;  4YI9 A;  1S1E A;  1F71 A;  2KI6 C;  2OS8 C;  1S26 D;  3I5G B;  3OB1 B;  1KQV A;  4DRW A;  2VRG A;  2LCP A;  4QJ4 B;  1M39 A;  3D10 A;  1AJ4 A;  4N1G A;  5CSN A;  4YGB B;  1DGV A;  2LVJ A;  1OMR A;  2JOJ A;  1QX2 A;  3I5G C;  1E8A A;  1BF5 A;  4XJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...