1ZFSA

Solution structure of s100a1 bound to calcium
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 protein, alpha chain
publication title The three-dimensional solution structure of Ca(2+)-bound S100A1 as determined by NMR spectroscopy
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zfsA00
1NX0A 1KFUL 3KO0A 2CXJA 2GGMA 1KCYA 1NCYA 3DF0A 3GK2A 1SCMC 1GJYA 5D7FA 5ER4X 2ZRSA 1J7PA 4JWQA 1S3PA 1PULA 3D0YA 2K7BA 1F54A 1BJFA 1U5IA 1M45A 1S6JA 1KFXS 2GGZA 2MHHA 3PATA 4WQ3A 1JBAA 1N2DA 2LUXA 3DVEA 1IWQA 4NDDA 1E8AA 1JSAA 2KHNA 2K7CA 1YUSA 2K2FA 1TNWA 4GAOA 1DJIA 4OKHA 2BL0C 3O6BA 3O4YA 2LE9B 5JOLA 5AANA 5HYDA 3SG6A 1XFZO 2KI4B 1XYDA 4L9MA 1NCZA 2BCAA 3I5GB 3BQ3A 1XO5A 1Q80A 4MSPA 1JFKA 4N5XA 3AAKA 4PHJA 1AP4A 1JF2A 2OTGB 3CGAA 3DVJA 2H2KA 4BY5A 1JC2A 5D69A 5HLVA 3SIBA 1J7RA 4QJ3B 1SMGA 2LP2A 4GUKA 3EVUA 5DKQA 1CLBA 1PRWA 2JTTA 4I5NB 3KEVA 1Y1AA 4PHKA 5CSFA 2P6BB 1BT6A 1LVCD 1UHHA 1MR8A 1CMGA 1IH0A 2L4HA 2EC6B 5FYXA 4I5LB 5CSNA 3A8RA 2M3WA 1WY9A 2KAVA 1IQ5A 2WORA 1QLSA 3IQOA 3SG4A 1LA0A 2KQ6A 4DS7A 1SRAA 4DUQA 1PSBA 2HPSA 5K89A 1DGUA 1UURA 2ZNDA 2K7OA 1IQ3A 1LA3A 3PN7B 2Y1NA 3TUYB 2F3YA 1XK4C 4GBAA 3KF9A 1MQ1A 4YGBB 2O5GA 3FIAA 5KTYA 1NX1A 1S1EA 3NSKA 1K96A 3BXKA 3DF0B 3TS5C 1OZOA 2GV5A 4GGNA 1A03A 2PASA 1J7QA 2WCEA 3EKJA 2AMIA 3NSLA 1GGWA 1EJ3A 4ICBA 4MZJA 1QX5B 2KYCA 3D0YB 1EG4A 1TNPA 4MLWA 3ZNIA 1J1DA 1U5IB 4PDZA 1TNQA 2JOJA 2ZN8A 4A4BA 1BOCA 1B47A 1RJVA 2KI4C 2HQ8A 3OX5A 1DF0A 1IKUA 3I5GC 1M46A 5I8NA 1QS7A 2OTGC 5GQQC 5DKNA 3JVTB 1TNXA 2FJUB 2DOQA 3LK1A 2JT3A 2F33A 3I5IB 3VGOA 1SK6D 4WQ2A 2CBLA 2BE6A 3BUWB 1BLQA 1F55A 1QATA 1WLMA 1J55A 1JUOA 1QASA 2JNXA 2EC6C 4PCWA 1NPQA 4QJ5B 2H61C 1CDLA 4PALA 3CS1A 1ALVA 2I7AA 1XFYO 5B8IB 2V53A 2JT0A 1UHIA 5CSJA 3AKBA 1S5GY 1C7VA 4PE7A 5CSIA 2WNDA 1XVJA 1SPYA 1KWOB 5AERA 3BYAA 1F4QA 2G2BA 4YGCB 1NIWA 1LXFC 1EL4A 3GOFA 3PN7C 3TUYC 1H4BA 2F2PA 2PRUA 1TOPA 2M7NA 2EGDA 1FI5A 1B9AA 5HKWA 3VRRA 4CFQA 1K9UA 2JNFA 1NYAA 3CR5X 5HKZA 1CNPA 1SCVA 4MVFA 1F71A 2CNPA 2L4IA 1NWDA 2RGIA 1R2UA 1F4OA 3BUNB 4FTGA 4C0JA 1SL7A 2KFHA 2KBMA 4YRUA 2JU0A 4PHNA 1RTP1 1AJ5A 2M29A 1L7ZA 1NX3A 1YUTA 3WNXB 4CPVA 3JVTC 3BUOB 5I2OA 1WLZA 1CKKA 1MWNA 2KNEA 3CTNA 5BPJA 2OS8C 2K0JA 3TS5B 1SY9A 3I5IC 5I2QA 1S26D 4CFRA 1AUIB 1DF0B 1A75A 1QX7A 2LMVA 3VRPA 4I5JA 1XFXO 1K9PA 5TNCA 1KQVA 3CR4X 1J7OA 4UPGA 2MRDA 4MRYA 1SBJA 1CFDA 4BY4A 4F0ZB 4N1FA 3NXAA 1XFVO 1RECA 2BBMA 4ETOA 1KWOC 1FF1A 5AXIA 2QACA 2PMYA 3EK8A 3QRXA 1YX7A 2PVBA 2LUCA 2BECA 3OX6A 4OCIA 1B8LA 4JPZB 3SG3A 1DJXA 2BKIB 2F8PA 4JQ0D 1DJHA 1QV0A 3ICBA 2M9GA 4PE4A 2ZKMX 1QX2A 1YR5A 3I5HB 3EKHA 2MJWB 4P2YB 5HKYA 3PSRA 2JC2A 1FI6A 3CLNA 4Q04A 3RM1A 2M8UA 3TDZA 4D1EA 3KPXA 1WDCB 4C0KA 3OHMB 2KFGA 4YI9A 1UWOA 4P5OE 4AOMA 2FCDA 3O78A 2KQYA 3OB2B 4NDBA 1L2OB 1KK7Z 1BODA 2JZIA 4MEWA 2EHBA 1CM1A 1XFWO 4AQJA 1HT9A 2JPTA 3AKAA 3DVMA 1IJ5A 2IS9A 1YX8A 4M2OA 2JQ6A 1DGVA 3CR2A 1QVIZ 3IF7A 2PSRA 2FCEA 2LMTA 1N65A 1ALWA 3I5FC 4YBHB 1CFCA 1BR4B 1MUXA 2I2RE 4DIRA 1K94A 2JULA 2KSPA 4M2QA 2KAYA 2LM5A 3ZWHA 1B1GA 1KK7Y 2BCBA 1A75B 1D1OA 4YI8A 2O60A 1W7JB 2L98A 1K95A 2NXQA 1CFPA 1KQMB 1MF8B 2LMUA 1PVBA 1B7TZ 1QVIY 1SYMA 1YTZC 1DJWA 2LVJA 1A2XA 1DVIA 1S5GZ 1SKTA 1YURA 2BKHB 1N0YA 2OPOA 2OS8B 1K93D 2LCPA 3PFVA 3WHUB 1CLLA 1RWYA 1BR1B 1S6IA 4NDCA 2ZNEA 2JT8A 4HSZA 1DJZA 3CWGA 3I5HC 4PE0A 3SG7A 1AHRA 2LLSA 1V1FA 3AAJA 2L5XB 1M63B 1ODBA 1V1GA 3E3RA 3OB1B 1B7TY 2BE4A 1YUUA 1J1EA 2CTNA 2LLTA 1UHJA 2NLNA 1WDCC 1XA5A 2Q91A 3VRNA 2CT9A 2WC8A 2CCMA 1KK8B 1DMOA 2A4JA 1AVSA 1IGVA 1CTRA 4MZKA 1L2OC 1BG1A 3LL8B 2KYFA 1NP8A 2MA2A 4R1EA 1X02A 1YRUB 1C7WA 1MXLC 2LHLA 2MAZA 1B8CA 5G08A 1OE9B 2KAXA 5F6TA 2KDHA 1BU3A 4WRIA 2NCOA 3SIAA 3DVKA 1XFUO 2LP3A 1IRJA 1QV1A 1W7IB 2HETA 1B4CA 1K2HA 4XJKA 4MBEA 1SR6B 2HQWA 3SG5A 2LC5A 2LVVA 2LHIA 3FWCA 1PVAA 2LNKA 3O2PA 5AEQA 3WXAA 5IBWA 1K8UA 1CDPA 1KQMC 1S6CA 2NZ0A 4ZCVA 1NCXA 1UHNA 3TDIA 1OQPA 1C07A 1OMVA 1H8BA 5AFPA 4YGEB 1DTLA 4GGFA 3I5FB 4CIDA 4PHMA 5KU1A 2K7DA 3LCPC 4ORCB 1YRTB 3JTDB 1TN4A 3A4UB 2LAPA 2JRFA 1TCFA 1NX2A 2E6WA 4OVNF 1JF0A 2KOTA 1M39A 1G33A 1UHKA 1NSHA 4C0LA 1VRKA 1OZSA 1WRZA 4N1GA 3CZTX 4A4CA 2WCBA 1KK8C 2BBNA 4AQIA 2AUCA 2K2AA 2M1UA 1MHOA 2M1KB 4TNCA 3PM8A 4PE1A 2L2EA 2HF5A 5PALA 1S36A 4DCKA 1F70A 2D8NA 4HRGA 2WCFA 4QJ4B 3EK4A 1CDNA 3M0WA 2LV7A 2F3ZA 4I5KA 1OSAA 1TCOB 1ZACA 2JWWA 2VRGA 2ZN9A 1IG5A 1Y1UA 3IQQA 3KHEA 3K21A 5CPVA 1QIVA 5HLOA 2KBIA 5J3XA 4ORBB 1FBVA 2K61A 3HX4A 1SR6C 4ZCUA 4GPLB 3BOWA 2JXLA 2M49B 3BUMB 5KSZA 1EXRA 1A4PA 3VRQA 1ZFSA 5JJGA 1RK9A 4HREE 1CFFA 3C1VA 3HCMA 1DJGA 4XJKB 1A29A 4FQOA 1TTXA 2KI6C 1PSRA 3TZ1A 1RFJA 1DJYA 1TIZA 1Y0VH 1QTXA 1K9KA 2F2OA 4E68A 1TRFA 2M0RA 5DKRA 3BUXB 2MLEC 2WOSA 2FOTA 3JTDC 3DD4A 1LKJA 4USLA 1K90D 1Y6WA 2SCPA 4ORAB 1F8HA 1NUBA 1KFUS 1WRKA 4GNKB 4MN0A 1QJTA 1ZMZA 2JTZA 1CDMA 1FPWA 3NSIA 4XYNA 4GFTA 2Q4UA 2MBXA 3SJSA 1EG3A 3GK1A 1WRLA 4M2PA 3FS7A 1M31A 1YVHA 1ZUZA 3SG2A 4CLNA 3OP0A 1B8RA 1ZOTB 2BCXA 1XK4A 2TN4A 1DT7B 3LLEA 2NCPA 1QIWA 1KFXL 1Y1XA 2L51A 1OMDA 2E30A 2I18A 1YVLA 2MLFC 2Y4QA 3F45A 2B1UA 1SCMB 1PK0D 3WHTB 1BF5A 2KI6D 1OMRA 2LVIA 2PALA 1KSMA 1SL9A 2ZRTA 2SASA 5I2LA 1GGZA 2KGBC 3LK0A 5ER5A 1HQVA 1GQMA 2K8MB 1CB1A 1G8IA 1JWDA 1RROA 2I94A 2Y1MA 1QXPA 1SL8A 3PALA 1SW8A 4IL1A 1AJ4A 2JXCA 1EH2A 2BL0B 2ISDA 3BOWB 2LLUA 1IJ6A 2LANA 3VROA 1FW4A 1PALA 1UUSA 2R2IA 2G9BA 3EK7A 2KGRA 3FWBA 3EVRA 2M97A 2ZFDA 4YGAA 2L0PA 2Y5IA 4HRHA 2H61A 4MZLA 4YGDB 1CMFA 1JFJA 4NQGA 4OR9B 3EVVA 4GGFC 1OOJA 1UP5A 3GK4X 2QPTA 2KFFA 3RLZA 1LINA 2AAOA 1BMOA 3MSEB 1CLMA 4OV2A 1CM4A 2COLB 4U8DA 3H4SE 1MXEA 3NSOA 4MRXA 1SNLA 3PLFB 3TDUA 2M7LA 1AK8A 1G4YR 4DRWA 3D10A 1R6PA 1QLKA 2L50A 2LVKA 1KSOA
chains in the Genus database with same CATH superfamily
1NX0A 1KFUL 3KO0A 2CXJA 2GGMA 1KCYA 1NCYA 3DF0A 3GK2A 3R1VA 1SCMC 1GJYA 5D7FA 5ER4X 2ZRSA 1J7PA 4JWQA 1S3PA 1PULA 3D0YA 2K7BA 1F54A 1BJFA 1U5IA 1M45A 1S6JA 1KFXS 2GGZA 2MHHA 3DYEA 3PATA 4WQ3A 1JBAA 1N2DA 2LUXA 3DVEA 1TWOA 4OZDA 1IWQA 4NDDA 1E8AA 1JSAA 2KHNA 2K7CA 1YUSA 2K2FA 1TNWA 4GAOA 2GTEA 1DJIA 4OKHA 5FI7A 2BL0C 2QEOA 3O4YA 2LE9B 3O6BA 5JOLA 5AANA 5HYDA 1IIOA 3SG6A 1XFZO 2KI4B 1XYDA 4L9MA 1NCZA 1Z2CB 2BCAA 3I5GB 3BQ3A 1XO5A 1Q80A 4MSPA 1JFKA 4N5XA 3AAKA 4PHJA 3S0GA 1AP4A 4KYNA 1JF2A 2OTGB 3CGAA 3DVJA 2H2KA 4BY5A 1JC2A 5D69A 5HLVA 3CZ1A 3SIBA 1J7RA 4QJ3B 1SMGA 2LP2A 2PYQA 3EVUA 4GUKA 5DKQA 1CLBA 1PRWA 2JTTA 4I5NB 2KPHA 3KEVA 1Y1AA 4PHKA 5CSFA 2P6BB 1BT6A 1LVCD 1UHHA 1MR8A 1CMGA 1IH0A 2L4HA 2EC6B 3D76A 5FYXA 1C3YA 4I5LB 3DXLA 5CSNA 3A8RA 2M3WA 1WY9A 2KAVA 1IQ5A 3S0EA 2WORA 2BAPA 1QLSA 3IQOA 3SG4A 1LA0A 2KQ6A 4DS7A 1SRAA 4DUQA 1PSBA 2HPSA 5K89A 1DGUA 1UURA 2ZNDA 2K7OA 1IQ3A 1LA3A 3PN7B 2Y1NA 3TUYB 2F3YA 1XK4C 5D3OA 4GBAA 3KF9A 1GM0A 1MQ1A 4YGBB 2O5GA 3D78A 3FIAA 1NX1A 5KTYA 1S1EA 3NSKA 1K96A 3BXKA 3DF0B 3TS5C 1OZOA 2GV5A 4GGNA 1A03A 2PASA 1J7QA 2WCEA 3EKJA 2AMIA 1OOGA 3NSLA 1GGWA 1EJ3A 4ICBA 4MZJA 1QX5B 2KYCA 3D0YB 1EG4A 1TNPA 4MLWA 3ZNIA 1J1DA 1U5IB 3K1EA 4PDZA 1TNQA 2JOJA 2ZN8A 4A4BA 1BOCA 1B47A 1RJVA 2KI4C 2HQ8A 3OX5A 5HL1A 1DF0A 1IKUA 3I5GC 1M46A 3CZ0A 5I8NA 1QS7A 2OTGC 3PJIA 5DKNA 3JVTB 5GQQC 1TNXA 2FJUB 2DOQA 3DZTA 3LK1A 2JT3A 2F33A 3I5IB 3VGOA 1SK6D 4WQ2A 2CBLA 2BE6A 3BUWB 1BLQA 1F55A 1QATA 1WLMA 1P28A 1J55A 2KLEA 2KLDA 1JUOA 1QASA 2JNXA 2EC6C 3DY9A 4PCWA 1NPQA 4QJ5B 2H61C 1CDLA 4PALA 3CS1A 3L4AA 1ALVA 2I7AA 1XFYO 5B8IB 3NHIA 2V53A 2JT0A 1UHIA 5CSJA 3AKBA 2YGUA 1S5GY 3S0AA 1C7VA 4PE7A 5CSIA 2WNDA 1XVJA 2PQLA 1SPYA 1KWOB 5AERA 3BYAA 1F4QA 2G2BA 4YGCB 3R1PA 1NIWA 1LXFC 1EL4A 3GOFA 3PN7C 3TUYC 1H4BA 2F2PA 2PRUA 1TOPA 1C3ZA 2M7NA 3B88A 2FJYA 2EGDA 1FI5A 1B9AA 5HKWA 3VRRA 4CFQA 1K9UA 2JNFA 1NYAA 3CR5X 5HKZA 2QDIA 1SCVA 3NHTA 3B86A 4MVFA 1CNPA 2CNPA 2L4IA 1NWDA 1F71A 2RGIA 1R2UA 1F4OA 3BUNB 4FTGA 4C0JA 2WCLA 1SL7A 2KFHA 2KBMA 4YRUA 2JU0A 4PHNA 1RTP1 1AJ5A 2M29A 1L7ZA 1NX3A 1YUTA 3WNXB 4CPVA 2QEHA 2WCKA 3JVTC 3BUOB 4INWA 1WLZA 5I2OA 1CKKA 1MWNA 2KNEA 5EL2A 3CTNA 5BPJA 2OS8C 1TUJA 2K0JA 2L5YA 1SY9A 3I5IC 3TS5B 1S26D 4CFRA 5I2QA 1AUIB 1DF0B 1A75A 1QX7A 2LMVA 3VRPA 4I5JA 1XFXO 1K9PA 5TNCA 1KQVA 3CR4X 1J7OA 4UPGA 2MRDA 3SS5A 4MRYA 2P71A 1SBJA 1CFDA 3OGNA 4BY4A 4F0ZB 4IJ7A 4N1FA 3L47A 3NXAA 1XFVO 1RECA 2BBMA 4ETOA 1KWOC 1FF1A 5AXIA 2QACA 2PMYA 3EK8A 3QRXA 1YX7A 2PVBA 2LUCA 2BECA 3OX6A 1OOFA 4OCIA 1B8LA 4JPZB 3SG3A 1DJXA 2BKIB 3D77A 3B87A 2F8PA 4JQ0D 1DJHA 1QV0A 3ICBA 2M9GA 3O4XA 2ZKMX 1QX2A 1YR5A 3I5HB 4PE4A 3EKHA 2MJWB 4P2YB 5HKYA 3PSRA 2WC6A 2JC2A 1TUZA 1FI6A 3CLNA 4Q04A 3RM1A 1Z4HA 2M8UA 3TDZA 4D1EA 3KPXA 1WDCB 3V2LA 4C0KA 3OHMB 2KFGA 4YI9A 1UWOA 4P5OE 4AOMA 2FCDA 3L4LA 3O78A 2KQYA 3OB2B 4NDBA 1L2OB 1KK7Z 1BODA 2JZIA 4MEWA 2EHBA 1CM1A 1XFWO 3D73A 1HT9A 2JPTA 3AKAA 3DVMA 4AQJA 1IJ5A 2IS9A 1YX8A 4M2OA 2JQ6A 1DELA 1DGVA 3CR2A 1QVIZ 3IF7A 2PSRA 2FCEA 2LMTA 1N65A 3BFAA 1ALWA 3I5FC 4YBHB 1CFCA 1BR4B 1MUXA 3S0FA 2I2RE 4DIRA 1K94A 2JULA 2KSPA 3EG5B 4M2QA 2KAYA 2LM5A 3ZWHA 1B1GA 1KK7Y 4PT1A 2BCBA 1A75B 1D1OA 4YI8A 2O60A 1W7JB 2L98A 1K95A 2NXQA 1CFPA 1KQMB 1MF8B 2LMUA 3BFBA 1PVBA 1B7TZ 1QVIY 1SYMA 1YTZC 1DJWA 2LVJA 1A2XA 1DVIA 1S5GZ 1SKTA 1YURA 1DEKA 1N0YA 2BKHB 2OPOA 2OS8B 1K93D 2LCPA 3PFVA 3R1OA 3WHUB 1CLLA 1RWYA 3UO9A 1BR1B 1S6IA 4NDCA 2ZNEA 2JT8A 3B6XA 4HSZA 1DJZA 3CWGA 3I5HC 4PE0A 3SG7A 1AHRA 2LLSA 1V1FA 3AAJA 2L5XB 1M63B 1ODBA 1V1GA 3E3RA 3OB1B 1B7TY 2BE4A 1YUUA 1J1EA 2CTNA 2LLTA 1UHJA 2NLNA 3S0BA 1WDCC 1XA5A 2Q91A 3VRNA 2CT9A 2WC8A 2CCMA 1KK8B 1DMOA 1OW4A 2A4JA 1AVSA 1IGVA 1CTRA 4MZKA 1L2OC 1BG1A 3LL8B 3FE9A 2KYFA 1NP8A 2MA2A 4R1EA 1X02A 1YRUB 1C7WA 1MXLC 2LHLA 2MAZA 1B8CA 5G08A 1OE9B 2KAXA 5F6TA 2KDHA 1BU3A 4WRIA 3NGVA 5DICA 2NCOA 3SIAA 3DVKA 2JPOA 1XFUO 2LP3A 1IRJA 1QV1A 1W7IB 4JD9A 2HETA 2WCHA 1W9ZA 1B4CA 1K2HA 4XJKA 4MBEA 1SR6B 2HQWA 2QEBA 3SG5A 2LC5A 2LVVA 2LHIA 3FWCA 1PVAA 2LNKA 3O2PA 4FQTA 5AEQA 3WXAA 1K8UA 1CDPA 1KQMC 1S6CA 2NZ0A 4ZCVA 1NCXA 3UNWA 1UHNA 3TDIA 1OQPA 1C07A 1OMVA 1H8BA 5AFPA 4YGEB 1DTLA 5I94A 4GGFA 3I5FB 4CIDA 4PHMA 3OBVA 5KU1A 2K7DA 2H8VA 3LCPC 1T14A 4ORCB 1YRTB 3JTDB 1TN4A 3A4UB 5IBWA 2LAPA 2JRFA 1TCFA 1NX2A 2E6WA 4OVNF 1JF0A 2KOTA 1M39A 1G33A 1UHKA 1NSHA 4C0LA 1VRKA 1OZSA 1WRZA 4N1GA 3CZTX 4A4CA 2WCBA 1KK8C 2BBNA 4AQIA 3N7HA 2AUCA 2K2AA 2M1UA 1MHOA 2M1KB 4TNCA 3PM8A 3D75A 4PE1A 2L2EA 1XFRA 3D74A 2HF5A 5PALA 1S36A 4DCKA 1F70A 2D8NA 4HRGA 2WCFA 4QJ4B 5FI6A 3EK4A 1ORGA 1CDNA 3R72A 3M0WA 2LV7A 2F3ZA 4I5KA 1OSAA 1TCOB 1ZACA 2JWWA 2VRGA 2ZN9A 1IG5A 1Y1UA 3IQQA 3KHEA 3K21A 5CPVA 1QIVA 5HLOA 2KBIA 5J3XA 4ORBB 1FBVA 2K61A 3HX4A 1SSEB 1SR6C 4ZCUA 4GPLB 3BOWA 2JXLA 2M49B 3BUMB 5KSZA 1EXRA 1A4PA 3IVTA 1ZFSA 3VRQA 5JJGA 1RK9A 3PM2A 4HREE 1CFFA 3Q8IA 3C1VA 2ERBA 1DJGA 3HCMA 5FI2A 3VB1A 4XJKB 1A29A 4FQOA 1TTXA 2KI6C 1PSRA 4INXA 3TZ1A 1RFJA 1DJYA 1TIZA 1Y0VH 1QTXA 1K9KA 2F2OA 4E68A 1TRFA 2M0RA 5DKRA 3BUXB 2L2CA 2MLEC 2WOSA 2FOTA 3B7AA 3DD4A 1LKJA 3JTDC 4USLA 1LS8A 1K90D 1Y6WA 2SCPA 4ORAB 1F8HA 1NUBA 1KFUS 1WRKA 4GNKB 4MN0A 1QJTA 1ZMZA 2JTZA 3CABA 1CDMA 1FPWA 3FE6A 3NSIA 4XYNA 4GFTA 2Q4UA 2MBXA 3SJSA 1EG3A 2WC5A 3GK1A 1WRLA 4M2PA 3RZSA 3FS7A 1M31A 1YVHA 1ZUZA 3CDNA 3SG2A 4CLNA 3OP0A 1B8RA 1ZOTB 2BCXA 1XK4A 2TN4A 1DT7B 3LLEA 2NCPA 1QIWA 2K60A 1KFXL 1Y1XA 2L51A 1OMDA 2E30A 2I18A 1YVLA 2MLFC 1OOHA 2Y4QA 3F45A 2QEVA 2B1UA 1SCMB 1PK0D 3CYZA 3WHTB 1OOIX 1BF5A 2KI6D 1OMRA 2LVIA 2PALA 1KSMA 1SL9A 2ZRTA 2SASA 5I2LA 1GGZA 2KGBC 3CZ2A 2WCJA 3LK0A 5ER5A 1HQVA 1GQMA 2K8MB 1CB1A 1DQEA 1G8IA 1JWDA 1RROA 2I94A 2Y1MA 1QXPA 1SL8A 3BFHA 3PALA 2WCMA 1SW8A 4IL1A 1AJ4A 2JXCA 1EH2A 2BL0B 2ISDA 3BOWB 2LLUA 1IJ6A 2LANA 3VROA 1FW4A 1PALA 1UUSA 3QMEA 1QWVA 2R2IA 4JKTA 2G9BA 3EK7A 2KGRA 3FWBA 4F7FA 3EVRA 2M97A 2ZFDA 4YGAA 2L0PA 2Y5IA 4HRHA 2H61A 4MZLA 4YGDB 1CMFA 1JFJA 3FE8A 4NQGA 4OR9B 3EVVA 4GGFC 1OOJA 1UP5A 3GK4X 2QPTA 2KFFA 3RLZA 1LINA 2AAOA 1BMOA 3MSEB 1CLMA 4OV2A 1CM4A 2COLB 4U8DA 3H4SE 1MXEA 3NSOA 4MRXA 3SS3A 1SNLA 2P70A 3PLFB 3BJHA 2M7LA 3TDUA 1AK8A 1G4YR 4DRWA 3D10A 1R6PA 1QLKA 3S0DA 3SS4A 1DC1A 2L50A 2LVKA 2BNXA 1KSOA
chains in the Genus database with same CATH topology
1NX0A 1KFUL 3KO0A 2CXJA 2GGMA 1KCYA 1NCYA 3DF0A 3GK2A 1SCMC 1GJYA 5D7FA 5ER4X 2ZRSA 1J7PA 4JWQA 1S3PA 1PULA 3D0YA 2K7BA 1F54A 1BJFA 1U5IA 1M45A 1S6JA 1KFXS 2GGZA 2MHHA 3PATA 4WQ3A 1JBAA 1N2DA 2LUXA 3DVEA 1IWQA 4NDDA 1E8AA 1JSAA 2KHNA 2K7CA 1YUSA 2K2FA 1TNWA 4GAOA 1DJIA 4OKHA 2BL0C 3O6BA 3O4YA 2LE9B 5JOLA 5AANA 5HYDA 3SG6A 1XFZO 2KI4B 1XYDA 4L9MA 1NCZA 2BCAA 3I5GB 3BQ3A 1XO5A 1Q80A 4MSPA 1JFKA 4N5XA 3AAKA 4PHJA 1AP4A 1JF2A 2OTGB 3CGAA 3DVJA 2H2KA 4BY5A 1JC2A 5D69A 5HLVA 3SIBA 1J7RA 4QJ3B 1SMGA 2LP2A 4GUKA 3EVUA 5DKQA 1CLBA 1PRWA 2JTTA 4I5NB 3KEVA 1Y1AA 4PHKA 5CSFA 2P6BB 1BT6A 1LVCD 1UHHA 1MR8A 1CMGA 1IH0A 2L4HA 2EC6B 5FYXA 4I5LB 5CSNA 3A8RA 2M3WA 1WY9A 2KAVA 1IQ5A 2WORA 1QLSA 3IQOA 3SG4A 1LA0A 2KQ6A 4DS7A 1SRAA 4DUQA 1PSBA 2HPSA 5K89A 1DGUA 1UURA 2ZNDA 2K7OA 1IQ3A 1LA3A 3PN7B 2Y1NA 3TUYB 2F3YA 1XK4C 4GBAA 3KF9A 1MQ1A 4YGBB 2O5GA 3FIAA 5KTYA 1NX1A 1S1EA 3NSKA 1K96A 3BXKA 3DF0B 3TS5C 1OZOA 2GV5A 4GGNA 1A03A 2PASA 1J7QA 2WCEA 3EKJA 2AMIA 3NSLA 1GGWA 1EJ3A 4ICBA 4MZJA 1QX5B 2KYCA 3D0YB 1EG4A 1TNPA 4MLWA 3ZNIA 1J1DA 1U5IB 4PDZA 1TNQA 2JOJA 2ZN8A 4A4BA 1BOCA 1B47A 1RJVA 2KI4C 2HQ8A 3OX5A 1DF0A 1IKUA 3I5GC 1M46A 5I8NA 1QS7A 2OTGC 5GQQC 5DKNA 3JVTB 1TNXA 2FJUB 2DOQA 3LK1A 2JT3A 2F33A 3I5IB 3VGOA 1SK6D 4WQ2A 2CBLA 2BE6A 3BUWB 1BLQA 1F55A 1QATA 1WLMA 1J55A 1JUOA 1QASA 2JNXA 2EC6C 4PCWA 1NPQA 4QJ5B 2H61C 1CDLA 4PALA 3CS1A 1ALVA 2I7AA 1XFYO 5B8IB 2V53A 2JT0A 1UHIA 5CSJA 3AKBA 1S5GY 1C7VA 4PE7A 5CSIA 2WNDA 1XVJA 1SPYA 1KWOB 5AERA 3BYAA 1F4QA 2G2BA 4YGCB 1NIWA 1LXFC 1EL4A 3GOFA 3PN7C 3TUYC 1H4BA 2F2PA 2PRUA 1TOPA 2M7NA 2EGDA 1FI5A 1B9AA 5HKWA 3VRRA 4CFQA 1K9UA 2JNFA 1NYAA 3CR5X 5HKZA 1CNPA 1SCVA 4MVFA 1F71A 2CNPA 2L4IA 1NWDA 2RGIA 1R2UA 1F4OA 3BUNB 4FTGA 4C0JA 1SL7A 2KFHA 2KBMA 4YRUA 2JU0A 4PHNA 1RTP1 1AJ5A 2M29A 1L7ZA 1NX3A 1YUTA 3WNXB 4CPVA 3JVTC 3BUOB 5I2OA 1WLZA 1CKKA 1MWNA 2KNEA 3CTNA 5BPJA 2OS8C 2K0JA 3TS5B 1SY9A 3I5IC 5I2QA 1S26D 4CFRA 1AUIB 1DF0B 1A75A 1QX7A 2LMVA 3VRPA 4I5JA 1XFXO 1K9PA 5TNCA 1KQVA 3CR4X 1J7OA 4UPGA 2MRDA 4MRYA 1SBJA 1CFDA 4BY4A 4F0ZB 4N1FA 3NXAA 1XFVO 1RECA 2BBMA 4ETOA 1KWOC 1FF1A 5AXIA 2QACA 2PMYA 3EK8A 3QRXA 1YX7A 2PVBA 2LUCA 2BECA 3OX6A 4OCIA 1B8LA 4JPZB 3SG3A 1DJXA 2BKIB 2F8PA 4JQ0D 1DJHA 1QV0A 3ICBA 2M9GA 4PE4A 2ZKMX 1QX2A 1YR5A 3I5HB 3EKHA 2MJWB 4P2YB 5HKYA 3PSRA 2JC2A 1FI6A 3CLNA 4Q04A 3RM1A 2M8UA 3TDZA 4D1EA 3KPXA 1WDCB 4C0KA 3OHMB 2KFGA 4YI9A 1UWOA 4P5OE 4AOMA 2FCDA 3O78A 2KQYA 3OB2B 4NDBA 1L2OB 1KK7Z 1BODA 2JZIA 4MEWA 2EHBA 1CM1A 1XFWO 4AQJA 1HT9A 2JPTA 3AKAA 3DVMA 1IJ5A 2IS9A 1YX8A 4M2OA 2JQ6A 1DGVA 3CR2A 1QVIZ 3IF7A 2PSRA 2FCEA 2LMTA 1N65A 1ALWA 3I5FC 4YBHB 1CFCA 1BR4B 1MUXA 2I2RE 4DIRA 1K94A 2JULA 2KSPA 4M2QA 2KAYA 2LM5A 3ZWHA 1B1GA 1KK7Y 2BCBA 1A75B 1D1OA 4YI8A 2O60A 1W7JB 2L98A 1K95A 2NXQA 1CFPA 1KQMB 1MF8B 2LMUA 1PVBA 1B7TZ 1QVIY 1SYMA 1YTZC 1DJWA 2LVJA 1A2XA 1DVIA 1S5GZ 1SKTA 1YURA 2BKHB 1N0YA 2OPOA 2OS8B 1K93D 2LCPA 3PFVA 3WHUB 1CLLA 1RWYA 1BR1B 1S6IA 4NDCA 2ZNEA 2JT8A 4HSZA 1DJZA 3CWGA 3I5HC 4PE0A 3SG7A 1AHRA 2LLSA 1V1FA 3AAJA 2L5XB 1M63B 1ODBA 1V1GA 3E3RA 3OB1B 1B7TY 2BE4A 1YUUA 1J1EA 2CTNA 2LLTA 1UHJA 2NLNA 1WDCC 1XA5A 2Q91A 3VRNA 2CT9A 2WC8A 2CCMA 1KK8B 1DMOA 2A4JA 1AVSA 1IGVA 1CTRA 4MZKA 1L2OC 1BG1A 3LL8B 2KYFA 1NP8A 2MA2A 4R1EA 1X02A 1YRUB 1C7WA 1MXLC 2LHLA 2MAZA 1B8CA 5G08A 1OE9B 2KAXA 5F6TA 2KDHA 1BU3A 4WRIA 2NCOA 3SIAA 3DVKA 1XFUO 2LP3A 1IRJA 1QV1A 1W7IB 2HETA 1B4CA 1K2HA 4XJKA 4MBEA 1SR6B 2HQWA 3SG5A 2LC5A 2LVVA 2LHIA 3FWCA 1PVAA 2LNKA 3O2PA 5AEQA 3WXAA 5IBWA 1K8UA 1CDPA 1KQMC 1S6CA 2NZ0A 4ZCVA 1NCXA 1UHNA 3TDIA 1OQPA 1C07A 1OMVA 1H8BA 5AFPA 4YGEB 1DTLA 4GGFA 3I5FB 4CIDA 4PHMA 5KU1A 2K7DA 3LCPC 4ORCB 1YRTB 3JTDB 1TN4A 3A4UB 2LAPA 2JRFA 1TCFA 1NX2A 2E6WA 4OVNF 1JF0A 2KOTA 1M39A 1G33A 1UHKA 1NSHA 4C0LA 1VRKA 1OZSA 1WRZA 4N1GA 3CZTX 4A4CA 2WCBA 1KK8C 2BBNA 4AQIA 2AUCA 2K2AA 2M1UA 1MHOA 2M1KB 4TNCA 3PM8A 4PE1A 2L2EA 2HF5A 5PALA 1S36A 4DCKA 1F70A 2D8NA 4HRGA 2WCFA 4QJ4B 3EK4A 1CDNA 3M0WA 2LV7A 2F3ZA 4I5KA 1OSAA 1TCOB 1ZACA 2JWWA 2VRGA 2ZN9A 1IG5A 1Y1UA 3IQQA 3KHEA 3K21A 5CPVA 1QIVA 5HLOA 2KBIA 5J3XA 4ORBB 1FBVA 2K61A 3HX4A 1SR6C 4ZCUA 4GPLB 3BOWA 2JXLA 2M49B 3BUMB 5KSZA 1EXRA 1A4PA 3VRQA 1ZFSA 5JJGA 1RK9A 4HREE 1CFFA 3C1VA 3HCMA 1DJGA 4XJKB 1A29A 4FQOA 1TTXA 2KI6C 1PSRA 3TZ1A 1RFJA 1DJYA 1TIZA 1Y0VH 1QTXA 1K9KA 2F2OA 4E68A 1TRFA 2M0RA 5DKRA 3BUXB 2MLEC 2WOSA 2FOTA 3JTDC 3DD4A 1LKJA 4USLA 1K90D 1Y6WA 2SCPA 4ORAB 1F8HA 1NUBA 1KFUS 1WRKA 4GNKB 4MN0A 1QJTA 1ZMZA 2JTZA 1CDMA 1FPWA 3NSIA 4XYNA 4GFTA 2Q4UA 2MBXA 3SJSA 1EG3A 3GK1A 1WRLA 4M2PA 3FS7A 1M31A 1YVHA 1ZUZA 3SG2A 4CLNA 3OP0A 1B8RA 1ZOTB 2BCXA 1XK4A 2TN4A 1DT7B 3LLEA 2NCPA 1QIWA 1KFXL 1Y1XA 2L51A 1OMDA 2E30A 2I18A 1YVLA 2MLFC 2Y4QA 3F45A 2B1UA 1SCMB 1PK0D 3WHTB 1BF5A 2KI6D 1OMRA 2LVIA 2PALA 1KSMA 1SL9A 2ZRTA 2SASA 5I2LA 1GGZA 2KGBC 3LK0A 5ER5A 1HQVA 1GQMA 2K8MB 1CB1A 1G8IA 1JWDA 1RROA 2I94A 2Y1MA 1QXPA 1SL8A 3PALA 1SW8A 4IL1A 1AJ4A 2JXCA 1EH2A 2BL0B 2ISDA 3BOWB 2LLUA 1IJ6A 2LANA 3VROA 1FW4A 1PALA 1UUSA 2R2IA 2G9BA 3EK7A 2KGRA 3FWBA 3EVRA 2M97A 2ZFDA 4YGAA 2L0PA 2Y5IA 4HRHA 2H61A 4MZLA 4YGDB 1CMFA 1JFJA 4NQGA 4OR9B 3EVVA 4GGFC 1OOJA 1UP5A 3GK4X 2QPTA 2KFFA 3RLZA 1LINA 2AAOA 1BMOA 3MSEB 1CLMA 4OV2A 1CM4A 2COLB 4U8DA 3H4SE 1MXEA 3NSOA 4MRXA 1SNLA 3PLFB 3TDUA 2M7LA 1AK8A 1G4YR 4DRWA 3D10A 1R6PA 1QLKA 2L50A 2LVKA 1KSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NX0 A;  1KFU L;  3KO0 A;  2CXJ A;  2GGM A;  1KCY A;  1NCY A;  3DF0 A;  3GK2 A;  1SCM C;  1GJY A;  5D7F A;  5ER4 X;  2ZRS A;  1J7P A;  4JWQ A;  1S3P A;  1PUL A;  3D0Y A;  2K7B A;  1F54 A;  1BJF A;  1U5I A;  1M45 A;  1S6J A;  1KFX S;  2GGZ A;  2MHH A;  3PAT A;  4WQ3 A;  1JBA A;  1N2D A;  2LUX A;  3DVE A;  1IWQ A;  4NDD A;  1E8A A;  1JSA A;  2KHN A;  2K7C A;  1YUS A;  2K2F A;  1TNW A;  4GAO A;  1DJI A;  4OKH A;  2BL0 C;  3O6B A;  3O4Y A;  2LE9 B;  5JOL A;  5AAN A;  5HYD A;  3SG6 A;  1XFZ O;  2KI4 B;  1XYD A;  4L9M A;  1NCZ A;  2BCA A;  3I5G B;  3BQ3 A;  1XO5 A;  1Q80 A;  4MSP A;  1JFK A;  4N5X A;  3AAK A;  4PHJ A;  1AP4 A;  1JF2 A;  2OTG B;  3CGA A;  3DVJ A;  2H2K A;  4BY5 A;  1JC2 A;  5D69 A;  5HLV A;  3SIB A;  1J7R A;  4QJ3 B;  1SMG A;  2LP2 A;  4GUK A;  3EVU A;  5DKQ A;  1CLB A;  1PRW A;  2JTT A;  4I5N B;  3KEV A;  1Y1A A;  4PHK A;  5CSF A;  2P6B B;  1BT6 A;  1LVC D;  1UHH A;  1MR8 A;  1CMG A;  1IH0 A;  2L4H A;  2EC6 B;  5FYX A;  4I5L B;  5CSN A;  3A8R A;  2M3W A;  1WY9 A;  2KAV A;  1IQ5 A;  2WOR A;  1QLS A;  3IQO A;  3SG4 A;  1LA0 A;  2KQ6 A;  4DS7 A;  1SRA A;  4DUQ A;  1PSB A;  2HPS A;  5K89 A;  1DGU A;  1UUR A;  2ZND A;  2K7O A;  1IQ3 A;  1LA3 A;  3PN7 B;  2Y1N A;  3TUY B;  2F3Y A;  1XK4 C;  4GBA A;  3KF9 A;  1MQ1 A;  4YGB B;  2O5G A;  3FIA A;  5KTY A;  1NX1 A;  1S1E A;  3NSK A;  1K96 A;  3BXK A;  3DF0 B;  3TS5 C;  1OZO A;  2GV5 A;  4GGN A;  1A03 A;  2PAS A;  1J7Q A;  2WCE A;  3EKJ A;  2AMI A;  3NSL A;  1GGW A;  1EJ3 A;  4ICB A;  4MZJ A;  1QX5 B;  2KYC A;  3D0Y B;  1EG4 A;  1TNP A;  4MLW A;  3ZNI A;  1J1D A;  1U5I B;  4PDZ A;  1TNQ A;  2JOJ A;  2ZN8 A;  4A4B A;  1BOC A;  1B47 A;  1RJV A;  2KI4 C;  2HQ8 A;  3OX5 A;  1DF0 A;  1IKU A;  3I5G C;  1M46 A;  5I8N A;  1QS7 A;  2OTG C;  5GQQ C;  5DKN A;  3JVT B;  1TNX A;  2FJU B;  2DOQ A;  3LK1 A;  2JT3 A;  2F33 A;  3I5I B;  3VGO A;  1SK6 D;  4WQ2 A;  2CBL A;  2BE6 A;  3BUW B;  1BLQ A;  1F55 A;  1QAT A;  1WLM A;  1J55 A;  1JUO A;  1QAS A;  2JNX A;  2EC6 C;  4PCW A;  1NPQ A;  4QJ5 B;  2H61 C;  1CDL A;  4PAL A;  3CS1 A;  1ALV A;  2I7A A;  1XFY O;  5B8I B;  2V53 A;  2JT0 A;  1UHI A;  5CSJ A;  3AKB A;  1S5G Y;  1C7V A;  4PE7 A;  5CSI A;  2WND A;  1XVJ A;  1SPY A;  1KWO B;  5AER A;  3BYA A;  1F4Q A;  2G2B A;  4YGC B;  1NIW A;  1LXF C;  1EL4 A;  3GOF A;  3PN7 C;  3TUY C;  1H4B A;  2F2P A;  2PRU A;  1TOP A;  2M7N A;  2EGD A;  1FI5 A;  1B9A A;  5HKW A;  3VRR A;  4CFQ A;  1K9U A;  2JNF A;  1NYA A;  3CR5 X;  5HKZ A;  1CNP A;  1SCV A;  4MVF A;  1F71 A;  2CNP A;  2L4I A;  1NWD A;  2RGI A;  1R2U A;  1F4O A;  3BUN B;  4FTG A;  4C0J A;  1SL7 A;  2KFH A;  2KBM A;  4YRU A;  2JU0 A;  4PHN A;  1RTP 1;  1AJ5 A;  2M29 A;  1L7Z A;  1NX3 A;  1YUT A;  3WNX B;  4CPV A;  3JVT C;  3BUO B;  5I2O A;  1WLZ A;  1CKK A;  1MWN A;  2KNE A;  3CTN A;  5BPJ A;  2OS8 C;  2K0J A;  3TS5 B;  1SY9 A;  3I5I C;  5I2Q A;  1S26 D;  4CFR A;  1AUI B;  1DF0 B;  1A75 A;  1QX7 A;  2LMV A;  3VRP A;  4I5J A;  1XFX O;  1K9P A;  5TNC A;  1KQV A;  3CR4 X;  1J7O A;  4UPG A;  2MRD A;  4MRY A;  1SBJ A;  1CFD A;  4BY4 A;  4F0Z B;  4N1F A;  3NXA A;  1XFV O;  1REC A;  2BBM A;  4ETO A;  1KWO C;  1FF1 A;  5AXI A;  2QAC A;  2PMY A;  3EK8 A;  3QRX A;  1YX7 A;  2PVB A;  2LUC A;  2BEC A;  3OX6 A;  4OCI A;  1B8L A;  4JPZ B;  3SG3 A;  1DJX A;  2BKI B;  2F8P A;  4JQ0 D;  1DJH A;  1QV0 A;  3ICB A;  2M9G A;  4PE4 A;  2ZKM X;  1QX2 A;  1YR5 A;  3I5H B;  3EKH A;  2MJW B;  4P2Y B;  5HKY A;  3PSR A;  2JC2 A;  1FI6 A;  3CLN A;  4Q04 A;  3RM1 A;  2M8U A;  3TDZ A;  4D1E A;  3KPX A;  1WDC B;  4C0K A;  3OHM B;  2KFG A;  4YI9 A;  1UWO A;  4P5O E;  4AOM A;  2FCD A;  3O78 A;  2KQY A;  3OB2 B;  4NDB A;  1L2O B;  1KK7 Z;  1BOD A;  2JZI A;  4MEW A;  2EHB A;  1CM1 A;  1XFW O;  4AQJ A;  1HT9 A;  2JPT A;  3AKA A;  3DVM A;  1IJ5 A;  2IS9 A;  1YX8 A;  4M2O A;  2JQ6 A;  1DGV A;  3CR2 A;  1QVI Z;  3IF7 A;  2PSR A;  2FCE A;  2LMT A;  1N65 A;  1ALW A;  3I5F C;  4YBH B;  1CFC A;  1BR4 B;  1MUX A;  2I2R E;  4DIR A;  1K94 A;  2JUL A;  2KSP A;  4M2Q A;  2KAY A;  2LM5 A;  3ZWH A;  1B1G A;  1KK7 Y;  2BCB A;  1A75 B;  1D1O A;  4YI8 A;  2O60 A;  1W7J B;  2L98 A;  1K95 A;  2NXQ A;  1CFP A;  1KQM B;  1MF8 B;  2LMU A;  1PVB A;  1B7T Z;  1QVI Y;  1SYM A;  1YTZ C;  1DJW A;  2LVJ A;  1A2X A;  1DVI A;  1S5G Z;  1SKT A;  1YUR A;  2BKH B;  1N0Y A;  2OPO A;  2OS8 B;  1K93 D;  2LCP A;  3PFV A;  3WHU B;  1CLL A;  1RWY A;  1BR1 B;  1S6I A;  4NDC A;  2ZNE A;  2JT8 A;  4HSZ A;  1DJZ A;  3CWG A;  3I5H C;  4PE0 A;  3SG7 A;  1AHR A;  2LLS A;  1V1F A;  3AAJ A;  2L5X B;  1M63 B;  1ODB A;  1V1G A;  3E3R A;  3OB1 B;  1B7T Y;  2BE4 A;  1YUU A;  1J1E A;  2CTN A;  2LLT A;  1UHJ A;  2NLN A;  1WDC C;  1XA5 A;  2Q91 A;  3VRN A;  2CT9 A;  2WC8 A;  2CCM A;  1KK8 B;  1DMO A;  2A4J A;  1AVS A;  1IGV A;  1CTR A;  4MZK A;  1L2O C;  1BG1 A;  3LL8 B;  2KYF A;  1NP8 A;  2MA2 A;  4R1E A;  1X02 A;  1YRU B;  1C7W A;  1MXL C;  2LHL A;  2MAZ A;  1B8C A;  5G08 A;  1OE9 B;  2KAX A;  5F6T A;  2KDH A;  1BU3 A;  4WRI A;  2NCO A;  3SIA A;  3DVK A;  1XFU O;  2LP3 A;  1IRJ A;  1QV1 A;  1W7I B;  2HET A;  1B4C A;  1K2H A;  4XJK A;  4MBE A;  1SR6 B;  2HQW A;  3SG5 A;  2LC5 A;  2LVV A;  2LHI A;  3FWC A;  1PVA A;  2LNK A;  3O2P A;  5AEQ A;  3WXA A;  5IBW A;  1K8U A;  1CDP A;  1KQM C;  1S6C A;  2NZ0 A;  4ZCV A;  1NCX A;  1UHN A;  3TDI A;  1OQP A;  1C07 A;  1OMV A;  1H8B A;  5AFP A;  4YGE B;  1DTL A;  4GGF A;  3I5F B;  4CID A;  4PHM A;  5KU1 A;  2K7D A;  3LCP C;  4ORC B;  1YRT B;  3JTD B;  1TN4 A;  3A4U B;  2LAP A;  2JRF A;  1TCF A;  1NX2 A;  2E6W A;  4OVN F;  1JF0 A;  2KOT A;  1M39 A;  1G33 A;  1UHK A;  1NSH A;  4C0L A;  1VRK A;  1OZS A;  1WRZ A;  4N1G A;  3CZT X;  4A4C A;  2WCB A;  1KK8 C;  2BBN A;  4AQI A;  2AUC A;  2K2A A;  2M1U A;  1MHO A;  2M1K B;  4TNC A;  3PM8 A;  4PE1 A;  2L2E A;  2HF5 A;  5PAL A;  1S36 A;  4DCK A;  1F70 A;  2D8N A;  4HRG A;  2WCF A;  4QJ4 B;  3EK4 A;  1CDN A;  3M0W A;  2LV7 A;  2F3Z A;  4I5K A;  1OSA A;  1TCO B;  1ZAC A;  2JWW A;  2VRG A;  2ZN9 A;  1IG5 A;  1Y1U A;  3IQQ A;  3KHE A;  3K21 A;  5CPV A;  1QIV A;  5HLO A;  2KBI A;  5J3X A;  4ORB B;  1FBV A;  2K61 A;  3HX4 A;  1SR6 C;  4ZCU A;  4GPL B;  3BOW A;  2JXL A;  2M49 B;  3BUM B;  5KSZ A;  1EXR A;  1A4P A;  3VRQ A;  1ZFS A;  5JJG A;  1RK9 A;  4HRE E;  1CFF A;  3C1V A;  3HCM A;  1DJG A;  4XJK B;  1A29 A;  4FQO A;  1TTX A;  2KI6 C;  1PSR A;  3TZ1 A;  1RFJ A;  1DJY A;  1TIZ A;  1Y0V H;  1QTX A;  1K9K A;  2F2O A;  4E68 A;  1TRF A;  2M0R A;  5DKR A;  3BUX B;  2MLE C;  2WOS A;  2FOT A;  3JTD C;  3DD4 A;  1LKJ A;  4USL A;  1K90 D;  1Y6W A;  2SCP A;  4ORA B;  1F8H A;  1NUB A;  1KFU S;  1WRK A;  4GNK B;  4MN0 A;  1QJT A;  1ZMZ A;  2JTZ A;  1CDM A;  1FPW A;  3NSI A;  4XYN A;  4GFT A;  2Q4U A;  2MBX A;  3SJS A;  1EG3 A;  3GK1 A;  1WRL A;  4M2P A;  3FS7 A;  1M31 A;  1YVH A;  1ZUZ A;  3SG2 A;  4CLN A;  3OP0 A;  1B8R A;  1ZOT B;  2BCX A;  1XK4 A;  2TN4 A;  1DT7 B;  3LLE A;  2NCP A;  1QIW A;  1KFX L;  1Y1X A;  2L51 A;  1OMD A;  2E30 A;  2I18 A;  1YVL A;  2MLF C;  2Y4Q A;  3F45 A;  2B1U A;  1SCM B;  1PK0 D;  3WHT B;  1BF5 A;  2KI6 D;  1OMR A;  2LVI A;  2PAL A;  1KSM A;  1SL9 A;  2ZRT A;  2SAS A;  5I2L A;  1GGZ A;  2KGB C;  3LK0 A;  5ER5 A;  1HQV A;  1GQM A;  2K8M B;  1CB1 A;  1G8I A;  1JWD A;  1RRO A;  2I94 A;  2Y1M A;  1QXP A;  1SL8 A;  3PAL A;  1SW8 A;  4IL1 A;  1AJ4 A;  2JXC A;  1EH2 A;  2BL0 B;  2ISD A;  3BOW B;  2LLU A;  1IJ6 A;  2LAN A;  3VRO A;  1FW4 A;  1PAL A;  1UUS A;  2R2I A;  2G9B A;  3EK7 A;  2KGR A;  3FWB A;  3EVR A;  2M97 A;  2ZFD A;  4YGA A;  2L0P A;  2Y5I A;  4HRH A;  2H61 A;  4MZL A;  4YGD B;  1CMF A;  1JFJ A;  4NQG A;  4OR9 B;  3EVV A;  4GGF C;  1OOJ A;  1UP5 A;  3GK4 X;  2QPT A;  2KFF A;  3RLZ A;  1LIN A;  2AAO A;  1BMO A;  3MSE B;  1CLM A;  4OV2 A;  1CM4 A;  2COL B;  4U8D A;  3H4S E;  1MXE A;  3NSO A;  4MRX A;  1SNL A;  3PLF B;  3TDU A;  2M7L A;  1AK8 A;  1G4Y R;  4DRW A;  3D10 A;  1R6P A;  1QLK A;  2L50 A;  2LVK A;  1KSO A; 
#chains in the Genus database with same CATH topology
 1NX0 A;  1KFU L;  3KO0 A;  2CXJ A;  2GGM A;  1KCY A;  1NCY A;  3DF0 A;  3GK2 A;  3R1V A;  1SCM C;  1GJY A;  5D7F A;  5ER4 X;  2ZRS A;  1J7P A;  4JWQ A;  1S3P A;  1PUL A;  3D0Y A;  2K7B A;  1F54 A;  1BJF A;  1U5I A;  1M45 A;  1S6J A;  1KFX S;  2GGZ A;  2MHH A;  3DYE A;  3PAT A;  4WQ3 A;  1JBA A;  1N2D A;  2LUX A;  3DVE A;  1TWO A;  4OZD A;  1IWQ A;  4NDD A;  1E8A A;  1JSA A;  2KHN A;  2K7C A;  1YUS A;  2K2F A;  1TNW A;  4GAO A;  2GTE A;  1DJI A;  4OKH A;  5FI7 A;  2BL0 C;  2QEO A;  3O4Y A;  2LE9 B;  3O6B A;  5JOL A;  5AAN A;  5HYD A;  1IIO A;  3SG6 A;  1XFZ O;  2KI4 B;  1XYD A;  4L9M A;  1NCZ A;  1Z2C B;  2BCA A;  3I5G B;  3BQ3 A;  1XO5 A;  1Q80 A;  4MSP A;  1JFK A;  4N5X A;  3AAK A;  4PHJ A;  3S0G A;  1AP4 A;  4KYN A;  1JF2 A;  2OTG B;  3CGA A;  3DVJ A;  2H2K A;  4BY5 A;  1JC2 A;  5D69 A;  5HLV A;  3CZ1 A;  3SIB A;  1J7R A;  4QJ3 B;  1SMG A;  2LP2 A;  2PYQ A;  3EVU A;  4GUK A;  5DKQ A;  1CLB A;  1PRW A;  2JTT A;  4I5N B;  2KPH A;  3KEV A;  1Y1A A;  4PHK A;  5CSF A;  2P6B B;  1BT6 A;  1LVC D;  1UHH A;  1MR8 A;  1CMG A;  1IH0 A;  2L4H A;  2EC6 B;  3D76 A;  5FYX A;  1C3Y A;  4I5L B;  3DXL A;  5CSN A;  3A8R A;  2M3W A;  1WY9 A;  2KAV A;  1IQ5 A;  3S0E A;  2WOR A;  2BAP A;  1QLS A;  3IQO A;  3SG4 A;  1LA0 A;  2KQ6 A;  4DS7 A;  1SRA A;  4DUQ A;  1PSB A;  2HPS A;  5K89 A;  1DGU A;  1UUR A;  2ZND A;  2K7O A;  1IQ3 A;  1LA3 A;  3PN7 B;  2Y1N A;  3TUY B;  2F3Y A;  1XK4 C;  5D3O A;  4GBA A;  3KF9 A;  1GM0 A;  1MQ1 A;  4YGB B;  2O5G A;  3D78 A;  3FIA A;  1NX1 A;  5KTY A;  1S1E A;  3NSK A;  1K96 A;  3BXK A;  3DF0 B;  3TS5 C;  1OZO A;  2GV5 A;  4GGN A;  1A03 A;  2PAS A;  1J7Q A;  2WCE A;  3EKJ A;  2AMI A;  1OOG A;  3NSL A;  1GGW A;  1EJ3 A;  4ICB A;  4MZJ A;  1QX5 B;  2KYC A;  3D0Y B;  1EG4 A;  1TNP A;  4MLW A;  3ZNI A;  1J1D A;  1U5I B;  3K1E A;  4PDZ A;  1TNQ A;  2JOJ A;  2ZN8 A;  4A4B A;  1BOC A;  1B47 A;  1RJV A;  2KI4 C;  2HQ8 A;  3OX5 A;  5HL1 A;  1DF0 A;  1IKU A;  3I5G C;  1M46 A;  3CZ0 A;  5I8N A;  1QS7 A;  2OTG C;  3PJI A;  5DKN A;  3JVT B;  5GQQ C;  1TNX A;  2FJU B;  2DOQ A;  3DZT A;  3LK1 A;  2JT3 A;  2F33 A;  3I5I B;  3VGO A;  1SK6 D;  4WQ2 A;  2CBL A;  2BE6 A;  3BUW B;  1BLQ A;  1F55 A;  1QAT A;  1WLM A;  1P28 A;  1J55 A;  2KLE A;  2KLD A;  1JUO A;  1QAS A;  2JNX A;  2EC6 C;  3DY9 A;  4PCW A;  1NPQ A;  4QJ5 B;  2H61 C;  1CDL A;  4PAL A;  3CS1 A;  3L4A A;  1ALV A;  2I7A A;  1XFY O;  5B8I B;  3NHI A;  2V53 A;  2JT0 A;  1UHI A;  5CSJ A;  3AKB A;  2YGU A;  1S5G Y;  3S0A A;  1C7V A;  4PE7 A;  5CSI A;  2WND A;  1XVJ A;  2PQL A;  1SPY A;  1KWO B;  5AER A;  3BYA A;  1F4Q A;  2G2B A;  4YGC B;  3R1P A;  1NIW A;  1LXF C;  1EL4 A;  3GOF A;  3PN7 C;  3TUY C;  1H4B A;  2F2P A;  2PRU A;  1TOP A;  1C3Z A;  2M7N A;  3B88 A;  2FJY A;  2EGD A;  1FI5 A;  1B9A A;  5HKW A;  3VRR A;  4CFQ A;  1K9U A;  2JNF A;  1NYA A;  3CR5 X;  5HKZ A;  2QDI A;  1SCV A;  3NHT A;  3B86 A;  4MVF A;  1CNP A;  2CNP A;  2L4I A;  1NWD A;  1F71 A;  2RGI A;  1R2U A;  1F4O A;  3BUN B;  4FTG A;  4C0J A;  2WCL A;  1SL7 A;  2KFH A;  2KBM A;  4YRU A;  2JU0 A;  4PHN A;  1RTP 1;  1AJ5 A;  2M29 A;  1L7Z A;  1NX3 A;  1YUT A;  3WNX B;  4CPV A;  2QEH A;  2WCK A;  3JVT C;  3BUO B;  4INW A;  1WLZ A;  5I2O A;  1CKK A;  1MWN A;  2KNE A;  5EL2 A;  3CTN A;  5BPJ A;  2OS8 C;  1TUJ A;  2K0J A;  2L5Y A;  1SY9 A;  3I5I C;  3TS5 B;  1S26 D;  4CFR A;  5I2Q A;  1AUI B;  1DF0 B;  1A75 A;  1QX7 A;  2LMV A;  3VRP A;  4I5J A;  1XFX O;  1K9P A;  5TNC A;  1KQV A;  3CR4 X;  1J7O A;  4UPG A;  2MRD A;  3SS5 A;  4MRY A;  2P71 A;  1SBJ A;  1CFD A;  3OGN A;  4BY4 A;  4F0Z B;  4IJ7 A;  4N1F A;  3L47 A;  3NXA A;  1XFV O;  1REC A;  2BBM A;  4ETO A;  1KWO C;  1FF1 A;  5AXI A;  2QAC A;  2PMY A;  3EK8 A;  3QRX A;  1YX7 A;  2PVB A;  2LUC A;  2BEC A;  3OX6 A;  1OOF A;  4OCI A;  1B8L A;  4JPZ B;  3SG3 A;  1DJX A;  2BKI B;  3D77 A;  3B87 A;  2F8P A;  4JQ0 D;  1DJH A;  1QV0 A;  3ICB A;  2M9G A;  3O4X A;  2ZKM X;  1QX2 A;  1YR5 A;  3I5H B;  4PE4 A;  3EKH A;  2MJW B;  4P2Y B;  5HKY A;  3PSR A;  2WC6 A;  2JC2 A;  1TUZ A;  1FI6 A;  3CLN A;  4Q04 A;  3RM1 A;  1Z4H A;  2M8U A;  3TDZ A;  4D1E A;  3KPX A;  1WDC B;  3V2L A;  4C0K A;  3OHM B;  2KFG A;  4YI9 A;  1UWO A;  4P5O E;  4AOM A;  2FCD A;  3L4L A;  3O78 A;  2KQY A;  3OB2 B;  4NDB A;  1L2O B;  1KK7 Z;  1BOD A;  2JZI A;  4MEW A;  2EHB A;  1CM1 A;  1XFW O;  3D73 A;  1HT9 A;  2JPT A;  3AKA A;  3DVM A;  4AQJ A;  1IJ5 A;  2IS9 A;  1YX8 A;  4M2O A;  2JQ6 A;  1DEL A;  1DGV A;  3CR2 A;  1QVI Z;  3IF7 A;  2PSR A;  2FCE A;  2LMT A;  1N65 A;  3BFA A;  1ALW A;  3I5F C;  4YBH B;  1CFC A;  1BR4 B;  1MUX A;  3S0F A;  2I2R E;  4DIR A;  1K94 A;  2JUL A;  2KSP A;  3EG5 B;  4M2Q A;  2KAY A;  2LM5 A;  3ZWH A;  1B1G A;  1KK7 Y;  4PT1 A;  2BCB A;  1A75 B;  1D1O A;  4YI8 A;  2O60 A;  1W7J B;  2L98 A;  1K95 A;  2NXQ A;  1CFP A;  1KQM B;  1MF8 B;  2LMU A;  3BFB A;  1PVB A;  1B7T Z;  1QVI Y;  1SYM A;  1YTZ C;  1DJW A;  2LVJ A;  1A2X A;  1DVI A;  1S5G Z;  1SKT A;  1YUR A;  1DEK A;  1N0Y A;  2BKH B;  2OPO A;  2OS8 B;  1K93 D;  2LCP A;  3PFV A;  3R1O A;  3WHU B;  1CLL A;  1RWY A;  3UO9 A;  1BR1 B;  1S6I A;  4NDC A;  2ZNE A;  2JT8 A;  3B6X A;  4HSZ A;  1DJZ A;  3CWG A;  3I5H C;  4PE0 A;  3SG7 A;  1AHR A;  2LLS A;  1V1F A;  3AAJ A;  2L5X B;  1M63 B;  1ODB A;  1V1G A;  3E3R A;  3OB1 B;  1B7T Y;  2BE4 A;  1YUU A;  1J1E A;  2CTN A;  2LLT A;  1UHJ A;  2NLN A;  3S0B A;  1WDC C;  1XA5 A;  2Q91 A;  3VRN A;  2CT9 A;  2WC8 A;  2CCM A;  1KK8 B;  1DMO A;  1OW4 A;  2A4J A;  1AVS A;  1IGV A;  1CTR A;  4MZK A;  1L2O C;  1BG1 A;  3LL8 B;  3FE9 A;  2KYF A;  1NP8 A;  2MA2 A;  4R1E A;  1X02 A;  1YRU B;  1C7W A;  1MXL C;  2LHL A;  2MAZ A;  1B8C A;  5G08 A;  1OE9 B;  2KAX A;  5F6T A;  2KDH A;  1BU3 A;  4WRI A;  3NGV A;  5DIC A;  2NCO A;  3SIA A;  3DVK A;  2JPO A;  1XFU O;  2LP3 A;  1IRJ A;  1QV1 A;  1W7I B;  4JD9 A;  2HET A;  2WCH A;  1W9Z A;  1B4C A;  1K2H A;  4XJK A;  4MBE A;  1SR6 B;  2HQW A;  2QEB A;  3SG5 A;  2LC5 A;  2LVV A;  2LHI A;  3FWC A;  1PVA A;  2LNK A;  3O2P A;  4FQT A;  5AEQ A;  3WXA A;  1K8U A;  1CDP A;  1KQM C;  1S6C A;  2NZ0 A;  4ZCV A;  1NCX A;  3UNW A;  1UHN A;  3TDI A;  1OQP A;  1C07 A;  1OMV A;  1H8B A;  5AFP A;  4YGE B;  1DTL A;  5I94 A;  4GGF A;  3I5F B;  4CID A;  4PHM A;  3OBV A;  5KU1 A;  2K7D A;  2H8V A;  3LCP C;  1T14 A;  4ORC B;  1YRT B;  3JTD B;  1TN4 A;  3A4U B;  5IBW A;  2LAP A;  2JRF A;  1TCF A;  1NX2 A;  2E6W A;  4OVN F;  1JF0 A;  2KOT A;  1M39 A;  1G33 A;  1UHK A;  1NSH A;  4C0L A;  1VRK A;  1OZS A;  1WRZ A;  4N1G A;  3CZT X;  4A4C A;  2WCB A;  1KK8 C;  2BBN A;  4AQI A;  3N7H A;  2AUC A;  2K2A A;  2M1U A;  1MHO A;  2M1K B;  4TNC A;  3PM8 A;  3D75 A;  4PE1 A;  2L2E A;  1XFR A;  3D74 A;  2HF5 A;  5PAL A;  1S36 A;  4DCK A;  1F70 A;  2D8N A;  4HRG A;  2WCF A;  4QJ4 B;  5FI6 A;  3EK4 A;  1ORG A;  1CDN A;  3R72 A;  3M0W A;  2LV7 A;  2F3Z A;  4I5K A;  1OSA A;  1TCO B;  1ZAC A;  2JWW A;  2VRG A;  2ZN9 A;  1IG5 A;  1Y1U A;  3IQQ A;  3KHE A;  3K21 A;  5CPV A;  1QIV A;  5HLO A;  2KBI A;  5J3X A;  4ORB B;  1FBV A;  2K61 A;  3HX4 A;  1SSE B;  1SR6 C;  4ZCU A;  4GPL B;  3BOW A;  2JXL A;  2M49 B;  3BUM B;  5KSZ A;  1EXR A;  1A4P A;  3IVT A;  1ZFS A;  3VRQ A;  5JJG A;  1RK9 A;  3PM2 A;  4HRE E;  1CFF A;  3Q8I A;  3C1V A;  2ERB A;  1DJG A;  3HCM A;  5FI2 A;  3VB1 A;  4XJK B;  1A29 A;  4FQO A;  1TTX A;  2KI6 C;  1PSR A;  4INX A;  3TZ1 A;  1RFJ A;  1DJY A;  1TIZ A;  1Y0V H;  1QTX A;  1K9K A;  2F2O A;  4E68 A;  1TRF A;  2M0R A;  5DKR A;  3BUX B;  2L2C A;  2MLE C;  2WOS A;  2FOT A;  3B7A A;  3DD4 A;  1LKJ A;  3JTD C;  4USL A;  1LS8 A;  1K90 D;  1Y6W A;  2SCP A;  4ORA B;  1F8H A;  1NUB A;  1KFU S;  1WRK A;  4GNK B;  4MN0 A;  1QJT A;  1ZMZ A;  2JTZ A;  3CAB A;  1CDM A;  1FPW A;  3FE6 A;  3NSI A;  4XYN A;  4GFT A;  2Q4U A;  2MBX A;  3SJS A;  1EG3 A;  2WC5 A;  3GK1 A;  1WRL A;  4M2P A;  3RZS A;  3FS7 A;  1M31 A;  1YVH A;  1ZUZ A;  3CDN A;  3SG2 A;  4CLN A;  3OP0 A;  1B8R A;  1ZOT B;  2BCX A;  1XK4 A;  2TN4 A;  1DT7 B;  3LLE A;  2NCP A;  1QIW A;  2K60 A;  1KFX L;  1Y1X A;  2L51 A;  1OMD A;  2E30 A;  2I18 A;  1YVL A;  2MLF C;  1OOH A;  2Y4Q A;  3F45 A;  2QEV A;  2B1U A;  1SCM B;  1PK0 D;  3CYZ A;  3WHT B;  1OOI X;  1BF5 A;  2KI6 D;  1OMR A;  2LVI A;  2PAL A;  1KSM A;  1SL9 A;  2ZRT A;  2SAS A;  5I2L A;  1GGZ A;  2KGB C;  3CZ2 A;  2WCJ A;  3LK0 A;  5ER5 A;  1HQV A;  1GQM A;  2K8M B;  1CB1 A;  1DQE A;  1G8I A;  1JWD A;  1RRO A;  2I94 A;  2Y1M A;  1QXP A;  1SL8 A;  3BFH A;  3PAL A;  2WCM A;  1SW8 A;  4IL1 A;  1AJ4 A;  2JXC A;  1EH2 A;  2BL0 B;  2ISD A;  3BOW B;  2LLU A;  1IJ6 A;  2LAN A;  3VRO A;  1FW4 A;  1PAL A;  1UUS A;  3QME A;  1QWV A;  2R2I A;  4JKT A;  2G9B A;  3EK7 A;  2KGR A;  3FWB A;  4F7F A;  3EVR A;  2M97 A;  2ZFD A;  4YGA A;  2L0P A;  2Y5I A;  4HRH A;  2H61 A;  4MZL A;  4YGD B;  1CMF A;  1JFJ A;  3FE8 A;  4NQG A;  4OR9 B;  3EVV A;  4GGF C;  1OOJ A;  1UP5 A;  3GK4 X;  2QPT A;  2KFF A;  3RLZ A;  1LIN A;  2AAO A;  1BMO A;  3MSE B;  1CLM A;  4OV2 A;  1CM4 A;  2COL B;  4U8D A;  3H4S E;  1MXE A;  3NSO A;  4MRX A;  3SS3 A;  1SNL A;  2P70 A;  3PLF B;  3BJH A;  2M7L A;  3TDU A;  1AK8 A;  1G4Y R;  4DRW A;  3D10 A;  1R6P A;  1QLK A;  3S0D A;  3SS4 A;  1DC1 A;  2L50 A;  2LVK A;  2BNX A;  1KSO A; 
#chains in the Genus database with same CATH homology
 1NX0 A;  1KFU L;  3KO0 A;  2CXJ A;  2GGM A;  1KCY A;  1NCY A;  3DF0 A;  3GK2 A;  1SCM C;  1GJY A;  5D7F A;  5ER4 X;  2ZRS A;  1J7P A;  4JWQ A;  1S3P A;  1PUL A;  3D0Y A;  2K7B A;  1F54 A;  1BJF A;  1U5I A;  1M45 A;  1S6J A;  1KFX S;  2GGZ A;  2MHH A;  3PAT A;  4WQ3 A;  1JBA A;  1N2D A;  2LUX A;  3DVE A;  1IWQ A;  4NDD A;  1E8A A;  1JSA A;  2KHN A;  2K7C A;  1YUS A;  2K2F A;  1TNW A;  4GAO A;  1DJI A;  4OKH A;  2BL0 C;  3O6B A;  3O4Y A;  2LE9 B;  5JOL A;  5AAN A;  5HYD A;  3SG6 A;  1XFZ O;  2KI4 B;  1XYD A;  4L9M A;  1NCZ A;  2BCA A;  3I5G B;  3BQ3 A;  1XO5 A;  1Q80 A;  4MSP A;  1JFK A;  4N5X A;  3AAK A;  4PHJ A;  1AP4 A;  1JF2 A;  2OTG B;  3CGA A;  3DVJ A;  2H2K A;  4BY5 A;  1JC2 A;  5D69 A;  5HLV A;  3SIB A;  1J7R A;  4QJ3 B;  1SMG A;  2LP2 A;  4GUK A;  3EVU A;  5DKQ A;  1CLB A;  1PRW A;  2JTT A;  4I5N B;  3KEV A;  1Y1A A;  4PHK A;  5CSF A;  2P6B B;  1BT6 A;  1LVC D;  1UHH A;  1MR8 A;  1CMG A;  1IH0 A;  2L4H A;  2EC6 B;  5FYX A;  4I5L B;  5CSN A;  3A8R A;  2M3W A;  1WY9 A;  2KAV A;  1IQ5 A;  2WOR A;  1QLS A;  3IQO A;  3SG4 A;  1LA0 A;  2KQ6 A;  4DS7 A;  1SRA A;  4DUQ A;  1PSB A;  2HPS A;  5K89 A;  1DGU A;  1UUR A;  2ZND A;  2K7O A;  1IQ3 A;  1LA3 A;  3PN7 B;  2Y1N A;  3TUY B;  2F3Y A;  1XK4 C;  4GBA A;  3KF9 A;  1MQ1 A;  4YGB B;  2O5G A;  3FIA A;  5KTY A;  1NX1 A;  1S1E A;  3NSK A;  1K96 A;  3BXK A;  3DF0 B;  3TS5 C;  1OZO A;  2GV5 A;  4GGN A;  1A03 A;  2PAS A;  1J7Q A;  2WCE A;  3EKJ A;  2AMI A;  3NSL A;  1GGW A;  1EJ3 A;  4ICB A;  4MZJ A;  1QX5 B;  2KYC A;  3D0Y B;  1EG4 A;  1TNP A;  4MLW A;  3ZNI A;  1J1D A;  1U5I B;  4PDZ A;  1TNQ A;  2JOJ A;  2ZN8 A;  4A4B A;  1BOC A;  1B47 A;  1RJV A;  2KI4 C;  2HQ8 A;  3OX5 A;  1DF0 A;  1IKU A;  3I5G C;  1M46 A;  5I8N A;  1QS7 A;  2OTG C;  5GQQ C;  5DKN A;  3JVT B;  1TNX A;  2FJU B;  2DOQ A;  3LK1 A;  2JT3 A;  2F33 A;  3I5I B;  3VGO A;  1SK6 D;  4WQ2 A;  2CBL A;  2BE6 A;  3BUW B;  1BLQ A;  1F55 A;  1QAT A;  1WLM A;  1J55 A;  1JUO A;  1QAS A;  2JNX A;  2EC6 C;  4PCW A;  1NPQ A;  4QJ5 B;  2H61 C;  1CDL A;  4PAL A;  3CS1 A;  1ALV A;  2I7A A;  1XFY O;  5B8I B;  2V53 A;  2JT0 A;  1UHI A;  5CSJ A;  3AKB A;  1S5G Y;  1C7V A;  4PE7 A;  5CSI A;  2WND A;  1XVJ A;  1SPY A;  1KWO B;  5AER A;  3BYA A;  1F4Q A;  2G2B A;  4YGC B;  1NIW A;  1LXF C;  1EL4 A;  3GOF A;  3PN7 C;  3TUY C;  1H4B A;  2F2P A;  2PRU A;  1TOP A;  2M7N A;  2EGD A;  1FI5 A;  1B9A A;  5HKW A;  3VRR A;  4CFQ A;  1K9U A;  2JNF A;  1NYA A;  3CR5 X;  5HKZ A;  1CNP A;  1SCV A;  4MVF A;  1F71 A;  2CNP A;  2L4I A;  1NWD A;  2RGI A;  1R2U A;  1F4O A;  3BUN B;  4FTG A;  4C0J A;  1SL7 A;  2KFH A;  2KBM A;  4YRU A;  2JU0 A;  4PHN A;  1RTP 1;  1AJ5 A;  2M29 A;  1L7Z A;  1NX3 A;  1YUT A;  3WNX B;  4CPV A;  3JVT C;  3BUO B;  5I2O A;  1WLZ A;  1CKK A;  1MWN A;  2KNE A;  3CTN A;  5BPJ A;  2OS8 C;  2K0J A;  3TS5 B;  1SY9 A;  3I5I C;  5I2Q A;  1S26 D;  4CFR A;  1AUI B;  1DF0 B;  1A75 A;  1QX7 A;  2LMV A;  3VRP A;  4I5J A;  1XFX O;  1K9P A;  5TNC A;  1KQV A;  3CR4 X;  1J7O A;  4UPG A;  2MRD A;  4MRY A;  1SBJ A;  1CFD A;  4BY4 A;  4F0Z B;  4N1F A;  3NXA A;  1XFV O;  1REC A;  2BBM A;  4ETO A;  1KWO C;  1FF1 A;  5AXI A;  2QAC A;  2PMY A;  3EK8 A;  3QRX A;  1YX7 A;  2PVB A;  2LUC A;  2BEC A;  3OX6 A;  4OCI A;  1B8L A;  4JPZ B;  3SG3 A;  1DJX A;  2BKI B;  2F8P A;  4JQ0 D;  1DJH A;  1QV0 A;  3ICB A;  2M9G A;  4PE4 A;  2ZKM X;  1QX2 A;  1YR5 A;  3I5H B;  3EKH A;  2MJW B;  4P2Y B;  5HKY A;  3PSR A;  2JC2 A;  1FI6 A;  3CLN A;  4Q04 A;  3RM1 A;  2M8U A;  3TDZ A;  4D1E A;  3KPX A;  1WDC B;  4C0K A;  3OHM B;  2KFG A;  4YI9 A;  1UWO A;  4P5O E;  4AOM A;  2FCD A;  3O78 A;  2KQY A;  3OB2 B;  4NDB A;  1L2O B;  1KK7 Z;  1BOD A;  2JZI A;  4MEW A;  2EHB A;  1CM1 A;  1XFW O;  4AQJ A;  1HT9 A;  2JPT A;  3AKA A;  3DVM A;  1IJ5 A;  2IS9 A;  1YX8 A;  4M2O A;  2JQ6 A;  1DGV A;  3CR2 A;  1QVI Z;  3IF7 A;  2PSR A;  2FCE A;  2LMT A;  1N65 A;  1ALW A;  3I5F C;  4YBH B;  1CFC A;  1BR4 B;  1MUX A;  2I2R E;  4DIR A;  1K94 A;  2JUL A;  2KSP A;  4M2Q A;  2KAY A;  2LM5 A;  3ZWH A;  1B1G A;  1KK7 Y;  2BCB A;  1A75 B;  1D1O A;  4YI8 A;  2O60 A;  1W7J B;  2L98 A;  1K95 A;  2NXQ A;  1CFP A;  1KQM B;  1MF8 B;  2LMU A;  1PVB A;  1B7T Z;  1QVI Y;  1SYM A;  1YTZ C;  1DJW A;  2LVJ A;  1A2X A;  1DVI A;  1S5G Z;  1SKT A;  1YUR A;  2BKH B;  1N0Y A;  2OPO A;  2OS8 B;  1K93 D;  2LCP A;  3PFV A;  3WHU B;  1CLL A;  1RWY A;  1BR1 B;  1S6I A;  4NDC A;  2ZNE A;  2JT8 A;  4HSZ A;  1DJZ A;  3CWG A;  3I5H C;  4PE0 A;  3SG7 A;  1AHR A;  2LLS A;  1V1F A;  3AAJ A;  2L5X B;  1M63 B;  1ODB A;  1V1G A;  3E3R A;  3OB1 B;  1B7T Y;  2BE4 A;  1YUU A;  1J1E A;  2CTN A;  2LLT A;  1UHJ A;  2NLN A;  1WDC C;  1XA5 A;  2Q91 A;  3VRN A;  2CT9 A;  2WC8 A;  2CCM A;  1KK8 B;  1DMO A;  2A4J A;  1AVS A;  1IGV A;  1CTR A;  4MZK A;  1L2O C;  1BG1 A;  3LL8 B;  2KYF A;  1NP8 A;  2MA2 A;  4R1E A;  1X02 A;  1YRU B;  1C7W A;  1MXL C;  2LHL A;  2MAZ A;  1B8C A;  5G08 A;  1OE9 B;  2KAX A;  5F6T A;  2KDH A;  1BU3 A;  4WRI A;  2NCO A;  3SIA A;  3DVK A;  1XFU O;  2LP3 A;  1IRJ A;  1QV1 A;  1W7I B;  2HET A;  1B4C A;  1K2H A;  4XJK A;  4MBE A;  1SR6 B;  2HQW A;  3SG5 A;  2LC5 A;  2LVV A;  2LHI A;  3FWC A;  1PVA A;  2LNK A;  3O2P A;  5AEQ A;  3WXA A;  5IBW A;  1K8U A;  1CDP A;  1KQM C;  1S6C A;  2NZ0 A;  4ZCV A;  1NCX A;  1UHN A;  3TDI A;  1OQP A;  1C07 A;  1OMV A;  1H8B A;  5AFP A;  4YGE B;  1DTL A;  4GGF A;  3I5F B;  4CID A;  4PHM A;  5KU1 A;  2K7D A;  3LCP C;  4ORC B;  1YRT B;  3JTD B;  1TN4 A;  3A4U B;  2LAP A;  2JRF A;  1TCF A;  1NX2 A;  2E6W A;  4OVN F;  1JF0 A;  2KOT A;  1M39 A;  1G33 A;  1UHK A;  1NSH A;  4C0L A;  1VRK A;  1OZS A;  1WRZ A;  4N1G A;  3CZT X;  4A4C A;  2WCB A;  1KK8 C;  2BBN A;  4AQI A;  2AUC A;  2K2A A;  2M1U A;  1MHO A;  2M1K B;  4TNC A;  3PM8 A;  4PE1 A;  2L2E A;  2HF5 A;  5PAL A;  1S36 A;  4DCK A;  1F70 A;  2D8N A;  4HRG A;  2WCF A;  4QJ4 B;  3EK4 A;  1CDN A;  3M0W A;  2LV7 A;  2F3Z A;  4I5K A;  1OSA A;  1TCO B;  1ZAC A;  2JWW A;  2VRG A;  2ZN9 A;  1IG5 A;  1Y1U A;  3IQQ A;  3KHE A;  3K21 A;  5CPV A;  1QIV A;  5HLO A;  2KBI A;  5J3X A;  4ORB B;  1FBV A;  2K61 A;  3HX4 A;  1SR6 C;  4ZCU A;  4GPL B;  3BOW A;  2JXL A;  2M49 B;  3BUM B;  5KSZ A;  1EXR A;  1A4P A;  3VRQ A;  1ZFS A;  5JJG A;  1RK9 A;  4HRE E;  1CFF A;  3C1V A;  3HCM A;  1DJG A;  4XJK B;  1A29 A;  4FQO A;  1TTX A;  2KI6 C;  1PSR A;  3TZ1 A;  1RFJ A;  1DJY A;  1TIZ A;  1Y0V H;  1QTX A;  1K9K A;  2F2O A;  4E68 A;  1TRF A;  2M0R A;  5DKR A;  3BUX B;  2MLE C;  2WOS A;  2FOT A;  3JTD C;  3DD4 A;  1LKJ A;  4USL A;  1K90 D;  1Y6W A;  2SCP A;  4ORA B;  1F8H A;  1NUB A;  1KFU S;  1WRK A;  4GNK B;  4MN0 A;  1QJT A;  1ZMZ A;  2JTZ A;  1CDM A;  1FPW A;  3NSI A;  4XYN A;  4GFT A;  2Q4U A;  2MBX A;  3SJS A;  1EG3 A;  3GK1 A;  1WRL A;  4M2P A;  3FS7 A;  1M31 A;  1YVH A;  1ZUZ A;  3SG2 A;  4CLN A;  3OP0 A;  1B8R A;  1ZOT B;  2BCX A;  1XK4 A;  2TN4 A;  1DT7 B;  3LLE A;  2NCP A;  1QIW A;  1KFX L;  1Y1X A;  2L51 A;  1OMD A;  2E30 A;  2I18 A;  1YVL A;  2MLF C;  2Y4Q A;  3F45 A;  2B1U A;  1SCM B;  1PK0 D;  3WHT B;  1BF5 A;  2KI6 D;  1OMR A;  2LVI A;  2PAL A;  1KSM A;  1SL9 A;  2ZRT A;  2SAS A;  5I2L A;  1GGZ A;  2KGB C;  3LK0 A;  5ER5 A;  1HQV A;  1GQM A;  2K8M B;  1CB1 A;  1G8I A;  1JWD A;  1RRO A;  2I94 A;  2Y1M A;  1QXP A;  1SL8 A;  3PAL A;  1SW8 A;  4IL1 A;  1AJ4 A;  2JXC A;  1EH2 A;  2BL0 B;  2ISD A;  3BOW B;  2LLU A;  1IJ6 A;  2LAN A;  3VRO A;  1FW4 A;  1PAL A;  1UUS A;  2R2I A;  2G9B A;  3EK7 A;  2KGR A;  3FWB A;  3EVR A;  2M97 A;  2ZFD A;  4YGA A;  2L0P A;  2Y5I A;  4HRH A;  2H61 A;  4MZL A;  4YGD B;  1CMF A;  1JFJ A;  4NQG A;  4OR9 B;  3EVV A;  4GGF C;  1OOJ A;  1UP5 A;  3GK4 X;  2QPT A;  2KFF A;  3RLZ A;  1LIN A;  2AAO A;  1BMO A;  3MSE B;  1CLM A;  4OV2 A;  1CM4 A;  2COL B;  4U8D A;  3H4S E;  1MXE A;  3NSO A;  4MRX A;  1SNL A;  3PLF B;  3TDU A;  2M7L A;  1AK8 A;  1G4Y R;  4DRW A;  3D10 A;  1R6P A;  1QLK A;  2L50 A;  2LVK A;  1KSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...