1ZFSA

Solution structure of s100a1 bound to calcium
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 protein, alpha chain
publication title The three-dimensional solution structure of Ca(2+)-bound S100A1 as determined by NMR spectroscopy
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zfsA00
1B1GA 1YRUB 2KI4B 2K7BA 2LM5A 4NDCA 1S6JA 3OHMB 3BUMB 4PE4A 1XFUO 2BKIB 3OX6A 1AK8A 1LA0A 3VRRA 4PALA 1ZOTB 1NCXA 2RGIA 2WCEA 4CPVA 1SL8A 1SMGA 1BR4B 3OB2B 2M8UA 3AKBA 1YVLA 1DGUA 3I5IB 1XVJA 4N1FA 4CIDA 1SRAA 1C07A 1CFFA 5G08A 2OTGC 4MRYA 2CCMA 4C0JA 3PALA 1PSBA 2JQ6A 3KPXA 3MSEB 3PFVA 1TNPA 3NSLA 1K9PA 1WLMA 2JTTA 2LLTA 1SKTA 2EC6C 3OB1B 1MR8A 1XFVO 4N5XA 1J1EA 5KSZA 1DJZA 4GAOA 1K96A 5JOLA 5B8IB 2B1UA 1CLBA 2KGBC 1AUIB 3BUOB 2BL0C 2CBLA 4N1GA 4AOMA 2FCEA 1WRLA 1N0YA 3AKAA 1B47A 1JFJA 3RLZA 3QRXA 4YGBB 2KI6C 4AQIA 3NSKA 1NUBA 4MLWA 2ZFDA 4XYNA 1KFUL 1AJ4A 2I2RE 2I18A 3SG6A 4E68A 3TS5C 2LUCA 1SCMC 2WNDA 1DTLA 1OE9B 2JC2A 3LK1A 1JF0A 1SR6B 1CMFA 2JTZA 2JPTA 2V53A 1OZOA 1JWDA 2KOTA 3BQ3A 3PATA 1CLMA 1ZACA 2ZKMX 1Q80A 2AUCA 2EHBA 2LHIA 4WQ3A 1LKJA 1A75A 2MBXA 1UHNA 1NCYA 1W7JB 2BCXA 2M3WA 4GNKB 4I5LB 2KI4C 1BOCA 1NPQA 3DVJA 2KGRA 1S6CA 1GQMA 1TNXA 5FYXA 4OVNF 1S6IA 1V1FA 2CNPA 1V1GA 1J7QA 1RROA 1N2DA 5IBWA 1IJ5A 2M7NA 5HKZA 1Y1AA 1M63B 1K2HA 1GGZA 3WXAA 4PDZA 1EL4A 4Q04A 1CDPA 1QLSA 1KWOB 2DOQA 3CS1A 3I5IC 2PALA 2BKHB 2JZIA 1UWOA 4JPZB 2Q4UA 4PCWA 4BY5A 2M9GA 4OKHA 1MWNA 2JRFA 1WRZA 1LINA 1FI5A 2BE6A 1F8HA 1CFCA 2LLSA 1WRKA 4I5NB 1PK0D 2PSRA 1MHOA 2D8NA 3BYAA 1XFWO 4XJKB 1ODBA 1FPWA 1S26D 2PMYA 1L7ZA 2CTNA 2PASA 1SK6D 3O6BA 1SCVA 4GGFA 3ZWHA 4M2QA 2ZN9A 2FOTA 2AAOA 1OSAA 1MF8B 3WHUB 4PHKA 1IQ5A 3AAKA 1UP5A 4MBEA 1R2UA 4XJKA 1M46A 1CDNA 3SIAA 3C1VA 3M0WA 3VRQA 2KAVA 2M49B 1AHRA 1PSRA 3DVMA 4P5OE 4YGCB 1SL7A 2LVVA 4L9MA 3EK7A 1CDLA 3D0YB 1UHJA 1CFPA 3I5HB 3BXKA 4A4CA 1DJIA 2M1KB 3AAJA 1PRWA 2R2IA 1S5GZ 3I5FB 1IQ3A 2OS8B 4MZKA 1BODA 1SR6C 2F2OA 1S5GY 2KFHA 2L4HA 4WRIA 2MLEC 5D7FA 3D0YA 4QJ5B 4CLNA 3KF9A 1NX3A 3PN7B 1B8RA 2LNKA 4FTGA 3KHEA 1QV1A 3WHTB 1MQ1A 3LL8B 2LUXA 1M45A 1IRJA 2K7DA 1YX7A 1KK7Z 4P2YB 3LK0A 5CPVA 1WLZA 1F54A 2QPTA 3A8RA 3BUWB 4GBAA 2LE9B 2MRDA 1J7RA 1JFKA 3OP0A 3EK4A 1ZFSA 4F0ZB 1B7TZ 4USLA 4NDBA 1NIWA 1R6PA 2ZRTA 2H61A 1KWOC 4ICBA 1CM4A 1TCOB 2Y1MA 2KI6D 3I5GB 1KK8B 5HKWA 3FWBA 3F45A 4R1EA 2CT9A 2M97A 1B8LA 1OOJA 1E8AA 1TCFA 2MJWB 3O78A 4GGFC 3JVTB 5BPJA 1EH2A 1RK9A 2LP3A 1NP8A 4DRWA 2LLUA 1F4QA 1KFUS 4YBHB 3DF0B 3CLNA 3TUYB 5AFPA 3GOFA 2AMIA 5F6TA 1JC2A 2E30A 5CSNA 2JXLA 2KQYA 2K7OA 1SNLA 2KNEA 1C7VA 3TZ1A 2F8PA 3FS7A 3EVVA 1X02A 4NDDA 4CFQA 1K9UA 1H8BA 1K95A 2M7LA 3DF0A 1OMDA 3FIAA 1S3PA 1KFXS 4GFTA 1ALVA 4PHMA 2Q91A 5I2QA 2GV5A 2NCOA 2MHHA 1OZSA 2I94A 4MEWA 1L2OB 1OQPA 5DKQA 3I5HC 4PHNA 2FJUB 3HCMA 3EVRA 1PVAA 1KFXL 4ZCVA 1LVCD 3OX5A 3I5FC 2MAZA 1A29A 2OS8C 1W7IB 4HSZA 2JNXA 2MA2A 1SYMA 1F55A 4MVFA 1RECA 3EK8A 3VROA 1VRKA 3CWGA 2KFFA 2BBMA 4C0KA 1FW4A 3PN7C 1K94A 3SIBA 3LLEA 3EKJA 3SG4A 2LC5A 1OMRA 1TOPA 1DF0B 1B9AA 4DIRA 1XYDA 2H61C 1EXRA 2KYFA 1QIWA 1OMVA 1S1EA 2LVKA 1G8IA 2ISDA 2BECA 1TIZA 3PM8A 1XFZO 1DT7B 1A4PA 1BLQA 3NXAA 1YX8A 4WQ2A 1YUTA 2BE4A 3VRNA 1J55A 3JTDB 4ETOA 1IJ6A 1K90D 2F3YA 2L0PA 1QTXA 1DGVA 2BCAA 3I5GC 1KK8C 1DJYA 2HQWA 3CR5X 3PLFB 4PE7A 4DS7A 5HKYA 2KAXA 1LXFC 1G33A 1NX1A 3JVTC 3CZTX 3EKHA 4OR9B 3TUYC 1RTP1 5DKNA 4FQOA 1QASA 3SG3A 3CR2A 1JUOA 1G4YR 1YRTB 2M0RA 1YUUA 1YVHA 3HX4A 3WNXB 1RJVA 2PRUA 1C7WA 4YRUA 3CR4X 5KU1A 1BT6A 1Y6WA 1IKUA 1DJXA 1CM1A 3SG7A 4I5KA 1GGWA 1TN4A 2LAPA 1CFDA 1CMGA 2K2AA 2NLNA 1UHKA 2KAYA 1TNQA 2ZN8A 3FWCA 2HF5A 1SBJA 1DJGA 2NZ0A 1HT9A 5AEQA 1B8CA 3SG2A 3DVEA 1QVIZ 1CDMA 1HQVA 2K61A 1S36A 1QVIY 2P6BB 3VGOA 4IL1A 5GQQC 1F4OA 1MXLC 4OV2A 1QXPA 1ZMZA 3D10A 1KK7Y 1GJYA 1K9KA 1RWYA 3CTNA 2JU0A 1TTXA 2JULA 1YR5A 2O60A 1TNWA 4A4BA 1QX2A 2WCBA 4YGAA 1NYAA 2F33A 4CFRA 4QJ3B 5ER4X 1B7TY 2IS9A 1IG5A 1TRFA 1KQMB 5HYDA 1ALWA 4YGDB 2M29A 3BOWB 2VRGA 4JWQA 2MLFC 5I2LA 2LP2A 3VRPA 2Y4QA 1WDCB 2JT0A 1XFYO 2HPSA 3KO0A 2F2PA 1CNPA 4ORAB 4GGNA 1FBVA 3JTDC 3TDIA 3BOWA 5HLVA 4MZLA 4M2OA 1UUSA 4PHJA 1BG1A 1FI6A 1NCZA 2JWWA 1XK4A 4GPLB 5D69A 1EG4A 5I8NA 2Y5IA 3K21A 4ZCUA 4YGEB 3SJSA 1BF5A 3GK1A 1NSHA 1QIVA 1CTRA 1M31A 2SCPA 2WOSA 3IF7A 3NSIA 4TNCA 1KQVA 1ZUZA 2LANA 1BR1B 2GGZA 1JSAA 4I5JA 1NWDA 4OCIA 5JJGA 3IQQA 1M39A 1UURA 1MUXA 2BCBA 1RFJA 2A4JA 1QATA 1H4BA 5TNCA 1F71A 2LCPA 2G2BA 1IH0A 1QX5B 1Y1UA 4M2PA 2QACA 4GUKA 1XA5A 1AJ5A 1QJTA 1Y1XA 1FF1A 1YURA 3O2PA 1JF2A 3CGAA 2L4IA 5HLOA 5I2OA 1DJWA 1IGVA 4QJ4B 1QV0A 2FCDA 2G9BA 1SW8A 4NQGA 1QS7A 2I7AA 3KEVA 1A75B 1BJFA 4YI9A 2HETA 2KDHA 3TDUA 2GGMA 4MN0A 4HREE 1QLKA 4MSPA 4U8DA 1B4CA 2SASA 2JNFA 2KSPA 3GK4X 2WORA 2L5XB 2CXJA 1AP4A 3RM1A 3DD4A 4MZJA 1K93D 4HRHA 3NSOA 4C0LA 4DUQA 1PVBA 4AQJA 3DVKA 1DF0A 1U5IB 2LHLA 4PE1A 2TN4A 2KFGA 1KQMC 1SL9A 4YI8A 3E3RA 2LMTA 1XFXO 1KSMA 2LVIA 4BY4A 5K89A 1F70A 2LMUA 2O5GA 2HQ8A 3LCPC 1WDCC 1D1OA 1U5IA 1XO5A 1PALA 3IQOA 3SG5A 5KTYA 5ER5A 2K8MB 1XK4C 5PALA 1YUSA 2E6WA 2OTGB 1MXEA 2COLB 1SPYA 2LMVA 2EGDA 3H4SE 1CKKA 2BBNA 5AERA 5CSIA 1EJ3A 2M1UA 1BMOA 2H2KA 2JOJA 3A4UB 1LA3A 3TDZA 2WC8A 1A03A 2LVJA 1DJHA 2EC6B 3EVUA 1J7OA 5AANA 5J3XA 2JT8A 1J7PA 5CSJA 1WY9A 1UHHA 4MRXA 4DCKA 1DVIA 4ORCB 2BL0B 2KQ6A 1JBAA 5AXIA 2NXQA 2OPOA 1BU3A 4ORBB 4HRGA 1DMOA 2K7CA 5CSFA 2KHNA 2ZNEA 1KSOA 2K0JA 1K8UA 2KYCA 3GK2A 2PVBA 1L2OC 2L51A 3BUNB 4PE0A 2LV7A 4D1EA 3TS5B 1CB1A 1N65A 1SCMB 2KBMA 3ZNIA 2KBIA 2WCFA 2Y1NA 2JT3A 2ZNDA 2JXCA 1NX2A 1CLLA 5DKRA 1NX0A 1SY9A 2L98A 2ZRSA 1PULA 4JQ0D 1KCYA 1QX7A 1Y0VH 3PSRA 1EG3A 2K2FA 2NCPA 1J1DA 3ICBA 2L2EA 4UPGA 1AVSA 3O4YA 1YTZC 1IWQA 1UHIA 2L50A 1A2XA 2F3ZA 3BUXB
chains in the Genus database with same CATH superfamily
3L4LA 1B1GA 1YRUB 2KI4B 2K7BA 2LM5A 4NDCA 1S6JA 3OHMB 3D77A 3BUMB 4PE4A 1XFUO 2BKIB 3OX6A 1AK8A 1LA0A 3VRRA 3FE6A 2BAPA 4PALA 1ZOTB 5EL2A 1NCXA 2RGIA 2WCEA 4CPVA 2H8VA 2PQLA 1SL8A 2WCMA 1SMGA 1BR4B 3OB2B 2M8UA 3AKBA 1YVLA 1DGUA 3I5IB 1XVJA 4N1FA 4CIDA 3FE8A 1SRAA 1C07A 1CFFA 3DYEA 1DEKA 5G08A 2OTGC 4MRYA 2CCMA 4C0JA 3PALA 1PSBA 2JQ6A 2L2CA 3KPXA 3MSEB 3PFVA 1TNPA 3NSLA 1K9PA 1WLMA 2JTTA 2LLTA 1SKTA 2EC6C 3OB1B 1MR8A 1XFVO 4N5XA 1J1EA 5KSZA 1DJZA 4GAOA 1K96A 3V2LA 5JOLA 5B8IB 2B1UA 1CLBA 2KGBC 1Z4HA 1AUIB 3BUOB 2BL0C 2CBLA 2QEBA 4N1GA 4AOMA 2FCEA 1WRLA 1N0YA 3AKAA 1B47A 1JFJA 5HL1A 3RLZA 2YGUA 3QRXA 4YGBB 2KI6C 3R72A 4AQIA 3NSKA 1NUBA 4MLWA 2ZFDA 4XYNA 1KFUL 1AJ4A 2I2RE 2I18A 3SG6A 4E68A 3TS5C 2LUCA 1SCMC 2WNDA 1DTLA 1OE9B 2JC2A 3LK1A 1JF0A 1SR6B 3N7HA 2WCHA 1CMFA 2JTZA 2JPTA 2V53A 1OZOA 1JWDA 2KOTA 3BQ3A 1DQEA 1CLMA 1ZACA 3PATA 2ZKMX 1Q80A 1IIOA 2AUCA 2EHBA 2LHIA 4WQ3A 3BFAA 1LKJA 1A75A 2MBXA 1UHNA 1NCYA 1W7JB 2BCXA 1Z2CB 2M3WA 4GNKB 1C3ZA 4I5LB 2KI4C 1BOCA 1NPQA 3DVJA 2KGRA 1S6CA 1GQMA 1TNXA 3B6XA 3D73A 5FYXA 3Q8IA 4OVNF 1S6IA 1V1FA 2CNPA 3UNWA 1V1GA 1J7QA 1RROA 1N2DA 5IBWA 1IJ5A 2M7NA 5HKZA 1Y1AA 1M63B 1K2HA 1GGZA 3WXAA 4PDZA 1EL4A 2QDIA 4Q04A 1CDPA 1QLSA 1KWOB 2DOQA 3CS1A 3I5IC 2PALA 2BKHB 2JZIA 1UWOA 4JPZB 2Q4UA 4PCWA 4BY5A 2M9GA 4OKHA 1MWNA 2JRFA 1WRZA 1LINA 1FI5A 2BE6A 1F8HA 1CFCA 2LLSA 1WRKA 4I5NB 1PK0D 2PSRA 1MHOA 1XFRA 5FI7A 2D8NA 1OOHA 3BYAA 1XFWO 3SS3A 4XJKB 1ODBA 1FPWA 1S26D 2PMYA 3DY9A 1L7ZA 2CTNA 2PASA 1SK6D 3O6BA 1SCVA 2KLDA 4GGFA 3ZWHA 3PM2A 1W9ZA 4M2QA 2ZN9A 2FOTA 2AAOA 1OSAA 1MF8B 3UO9A 3WHUB 4PHKA 1IQ5A 3AAKA 1UP5A 4MBEA 1R2UA 4XJKA 1M46A 1CDNA 3SIAA 3C1VA 3M0WA 3VRQA 2KAVA 1T14A 2M49B 1AHRA 1PSRA 3DVMA 4P5OE 4YGCB 1SL7A 2LVVA 4L9MA 3D75A 3EK7A 1CDLA 3CYZA 3D0YB 1UHJA 3NHTA 1CFPA 3VB1A 3FE9A 3I5HB 3BXKA 4A4CA 1DJIA 2M1KB 3AAJA 1PRWA 2R2IA 1S5GZ 3I5FB 1IQ3A 2OS8B 4MZKA 1BODA 1SR6C 2F2OA 1S5GY 3CZ0A 2KFHA 2L4HA 4WRIA 2MLEC 3CZ2A 3D0YA 5D7FA 4QJ5B 4CLNA 3KF9A 1NX3A 1DELA 1TUZA 2QEHA 3B88A 3PN7B 1B8RA 2P71A 3S0DA 2LNKA 4JKTA 4FTGA 3KHEA 1QV1A 3WHTB 1MQ1A 3LL8B 2LUXA 1GM0A 1M45A 1IRJA 2K7DA 1YX7A 1KK7Z 4P2YB 3LK0A 5CPVA 1WLZA 1F54A 2QPTA 3A8RA 3BUWB 4GBAA 2LE9B 2MRDA 2WCKA 1J7RA 1JFKA 3DZTA 3OP0A 3EK4A 2WC5A 1ZFSA 4F0ZB 1B7TZ 4USLA 4NDBA 1NIWA 1R6PA 3S0BA 2ZRTA 2H61A 1KWOC 2KLEA 4ICBA 1CM4A 1TCOB 2Y1MA 2KI6D 3I5GB 1KK8B 5HKWA 3FWBA 3F45A 4PT1A 4R1EA 2CT9A 2M97A 1B8LA 1OOJA 1E8AA 1TCFA 2MJWB 3O78A 4GGFC 3JVTB 5BPJA 1EH2A 1RK9A 2LP3A 1NP8A 4DRWA 2LLUA 1F4QA 1KFUS 4YBHB 3DF0B 3CLNA 3TUYB 5AFPA 3GOFA 2AMIA 2WC6A 5F6TA 1JC2A 2E30A 5CSNA 2JXLA 2KQYA 2K7OA 1SNLA 2KNEA 3OBVA 1C7VA 3TZ1A 2F8PA 5DICA 3FS7A 3EVVA 1X02A 4NDDA 4CFQA 1K9UA 5I94A 1K95A 2M7LA 3DF0A 1OMDA 3FIAA 1H8BA 1S3PA 1KFXS 4GFTA 1ALVA 1ORGA 4PHMA 2Q91A 5I2QA 3BFBA 2GV5A 2NCOA 2MHHA 1OZSA 2I94A 4MEWA 1L2OB 1OQPA 5DKQA 3I5HC 2ERBA 2FJUB 3HCMA 3EVRA 4PHNA 1PVAA 1KFXL 4ZCVA 1LVCD 3OX5A 3I5FC 2MAZA 1A29A 2OS8C 1W7IB 4HSZA 2JNXA 2MA2A 3IVTA 1SYMA 1F55A 4MVFA 1RECA 3EK8A 3VROA 1VRKA 3CWGA 2KFFA 2BBMA 4C0KA 1FW4A 3PN7C 1K94A 4FQTA 3SIBA 3LLEA 3EKJA 3SG4A 2LC5A 1OMRA 1OOFA 1TOPA 1DF0B 1B9AA 3R1VA 4DIRA 1XYDA 3NHIA 2H61C 1EXRA 2KYFA 3L4AA 4JD9A 1QIWA 1OMVA 2BNXA 1S1EA 2LVKA 1G8IA 2ISDA 2BECA 1TIZA 3PM8A 1XFZO 1DT7B 1A4PA 1BLQA 3NXAA 1YX8A 4WQ2A 1YUTA 2BE4A 2WCJA 3VRNA 1J55A 3JTDB 4ETOA 1IJ6A 1K90D 2F3YA 2L0PA 1QTXA 3B7AA 4KYNA 1DGVA 2BCAA 2KPHA 3I5GC 1KK8C 1DJYA 3QMEA 2HQWA 3SS5A 3CR5X 3PLFB 4PE7A 3NGVA 4DS7A 5HKYA 2KAXA 2WCLA 3CABA 1LXFC 1G33A 1NX1A 3JVTC 3CZTX 3EKHA 4OR9B 3TUYC 1RTP1 5DKNA 4FQOA 1QASA 2P70A 3CR2A 1JUOA 3SG3A 1G4YR 1YRTB 2M0RA 1YUUA 1YVHA 3HX4A 3WNXB 1RJVA 1IWQA 2PRUA 1C7WA 4YRUA 2K60A 2JPOA 1QWVA 3CR4X 5KU1A 1BT6A 1OOIX 1Y6WA 1IKUA 1DJXA 1CM1A 3SG7A 3S0EA 4I5KA 1GGWA 1TN4A 2LAPA 1CFDA 1CMGA 2K2AA 2NLNA 1UHKA 2KAYA 1TNQA 2ZN8A 3FWCA 2HF5A 1SBJA 1DJGA 2NZ0A 1HT9A 5AEQA 1B8CA 3S0AA 3SG2A 3DVEA 1QVIZ 1CDMA 1HQVA 2K61A 1S36A 1QVIY 1SSEB 2P6BB 3VGOA 4IL1A 5GQQC 1F4OA 1MXLC 4OV2A 1QXPA 1ZMZA 3D10A 3RZSA 1KK7Y 1GJYA 1K9KA 1RWYA 3CTNA 2JU0A 1TTXA 2JULA 1YR5A 2O60A 1TNWA 3S0FA 4A4BA 1QX2A 2WCBA 4YGAA 1NYAA 2F33A 3BFHA 4CFRA 4QJ3B 5ER4X 1B7TY 2IS9A 1IG5A 1TRFA 1KQMB 5HYDA 1ALWA 4YGDB 2M29A 3BOWB 2QEOA 2VRGA 4JWQA 2MLFC 5I2LA 2LP2A 3VRPA 2L5YA 2Y4QA 1WDCB 2JT0A 1XFYO 2HPSA 3KO0A 3R1OA 2F2PA 1CNPA 4ORAB 4GGNA 1FBVA 3JTDC 3TDIA 3BOWA 5HLVA 4MZLA 1OW4A 1LS8A 3BJHA 4M2OA 1UUSA 4PHJA 5FI6A 1BG1A 1FI6A 1NCZA 2JWWA 1XK4A 4GPLB 5D69A 1EG4A 3CZ1A 5I8NA 3SS4A 2Y5IA 3K21A 4ZCUA 4YGEB 3SJSA 1BF5A 3GK1A 1NSHA 1QIVA 1CTRA 1M31A 2SCPA 2WOSA 3IF7A 3NSIA 4TNCA 1KQVA 1ZUZA 2LANA 1BR1B 1C3YA 2GGZA 1JSAA 4I5JA 1NWDA 4OCIA 5JJGA 3IQQA 1M39A 1UURA 1MUXA 2BCBA 1RFJA 2A4JA 1QATA 1H4BA 5TNCA 1F71A 2LCPA 2G2BA 1IH0A 1QX5B 1Y1UA 4M2PA 2QACA 4GUKA 1XA5A 1AJ5A 1QJTA 1Y1XA 1FF1A 1YURA 3O2PA 1JF2A 3CGAA 2L4IA 5HLOA 5I2OA 1DJWA 1IGVA 4QJ4B 3D76A 1QV0A 2FCDA 4INWA 2G9BA 1SW8A 4NQGA 1QS7A 2I7AA 3KEVA 1A75B 1BJFA 4YI9A 1P28A 3O4XA 2HETA 2KDHA 3TDUA 2GGMA 4MN0A 4HREE 1QLKA 2QEVA 4MSPA 4U8DA 1B4CA 2SASA 2JNFA 2KSPA 3GK4X 2WORA 2L5XB 2CXJA 1DC1A 3RM1A 1AP4A 3DD4A 4MZJA 1K93D 2FJYA 3PJIA 4HRHA 3NSOA 4C0LA 4DUQA 1PVBA 3D74A 5D3OA 4AQJA 3DVKA 1DF0A 1U5IB 2LHLA 4PE1A 3R1PA 2TN4A 2KFGA 3K1EA 1KQMC 1SL9A 4YI8A 3E3RA 2LMTA 1XFXO 1KSMA 2LVIA 4BY4A 5K89A 1F70A 2LMUA 3EG5B 2O5GA 2HQ8A 3LCPC 1WDCC 1D1OA 1U5IA 1XO5A 1PALA 3IQOA 3S0GA 3SG5A 5KTYA 5ER5A 2K8MB 1XK4C 5PALA 1YUSA 2E6WA 3CDNA 2OTGB 1MXEA 2COLB 1SPYA 2LMVA 3D78A 2EGDA 3H4SE 1CKKA 2BBNA 5AERA 5CSIA 1EJ3A 2M1UA 1BMOA 2H2KA 2JOJA 3A4UB 1LA3A 3TDZA 2WC8A 1A03A 2LVJA 1DJHA 2EC6B 3EVUA 1J7OA 5AANA 5J3XA 2JT8A 2PYQA 1J7PA 5CSJA 1WY9A 1UHHA 4MRXA 4DCKA 1DVIA 4ORCB 2BL0B 2KQ6A 3L47A 4IJ7A 1JBAA 5AXIA 2NXQA 2OPOA 1BU3A 4ORBB 4HRGA 1TWOA 1DMOA 2K7CA 5CSFA 2KHNA 2ZNEA 1KSOA 2K0JA 1K8UA 2KYCA 3DXLA 1TUJA 2PVBA 1L2OC 2L51A 3GK2A 3BUNB 4PE0A 2LV7A 3B86A 4D1EA 4OZDA 3TS5B 1CB1A 1N65A 1SCMB 2KBMA 3ZNIA 2KBIA 2WCFA 2Y1NA 2JT3A 2ZNDA 2JXCA 1NX2A 3B87A 1CLLA 5DKRA 1NX0A 1SY9A 2L98A 2ZRSA 1PULA 4JQ0D 1KCYA 1QX7A 1Y0VH 2GTEA 3PSRA 1EG3A 2K2FA 2NCPA 1J1DA 3ICBA 4INXA 4F7FA 2L2EA 3OGNA 4UPGA 1AVSA 3O4YA 1YTZC 5FI2A 1OOGA 1UHIA 2L50A 1A2XA 2F3ZA 3BUXB
chains in the Genus database with same CATH topology
1B1GA 1YRUB 2KI4B 2K7BA 2LM5A 4NDCA 1S6JA 3OHMB 3BUMB 4PE4A 1XFUO 2BKIB 3OX6A 1AK8A 1LA0A 3VRRA 4PALA 1ZOTB 1NCXA 2RGIA 2WCEA 4CPVA 1SL8A 1SMGA 1BR4B 3OB2B 2M8UA 3AKBA 1YVLA 1DGUA 3I5IB 1XVJA 4N1FA 4CIDA 1SRAA 1C07A 1CFFA 5G08A 2OTGC 4MRYA 2CCMA 4C0JA 3PALA 1PSBA 2JQ6A 3KPXA 3MSEB 3PFVA 1TNPA 3NSLA 1K9PA 1WLMA 2JTTA 2LLTA 1SKTA 2EC6C 3OB1B 1MR8A 1XFVO 4N5XA 1J1EA 5KSZA 1DJZA 4GAOA 1K96A 5JOLA 5B8IB 2B1UA 1CLBA 2KGBC 1AUIB 3BUOB 2BL0C 2CBLA 4N1GA 4AOMA 2FCEA 1WRLA 1N0YA 3AKAA 1B47A 1JFJA 3RLZA 3QRXA 4YGBB 2KI6C 4AQIA 3NSKA 1NUBA 4MLWA 2ZFDA 4XYNA 1KFUL 1AJ4A 2I2RE 2I18A 3SG6A 4E68A 3TS5C 2LUCA 1SCMC 2WNDA 1DTLA 1OE9B 2JC2A 3LK1A 1JF0A 1SR6B 1CMFA 2JTZA 2JPTA 2V53A 1OZOA 1JWDA 2KOTA 3BQ3A 3PATA 1CLMA 1ZACA 2ZKMX 1Q80A 2AUCA 2EHBA 2LHIA 4WQ3A 1LKJA 1A75A 2MBXA 1UHNA 1NCYA 1W7JB 2BCXA 2M3WA 4GNKB 4I5LB 2KI4C 1BOCA 1NPQA 3DVJA 2KGRA 1S6CA 1GQMA 1TNXA 5FYXA 4OVNF 1S6IA 1V1FA 2CNPA 1V1GA 1J7QA 1RROA 1N2DA 5IBWA 1IJ5A 2M7NA 5HKZA 1Y1AA 1M63B 1K2HA 1GGZA 3WXAA 4PDZA 1EL4A 4Q04A 1CDPA 1QLSA 1KWOB 2DOQA 3CS1A 3I5IC 2PALA 2BKHB 2JZIA 1UWOA 4JPZB 2Q4UA 4PCWA 4BY5A 2M9GA 4OKHA 1MWNA 2JRFA 1WRZA 1LINA 1FI5A 2BE6A 1F8HA 1CFCA 2LLSA 1WRKA 4I5NB 1PK0D 2PSRA 1MHOA 2D8NA 3BYAA 1XFWO 4XJKB 1ODBA 1FPWA 1S26D 2PMYA 1L7ZA 2CTNA 2PASA 1SK6D 3O6BA 1SCVA 4GGFA 3ZWHA 4M2QA 2ZN9A 2FOTA 2AAOA 1OSAA 1MF8B 3WHUB 4PHKA 1IQ5A 3AAKA 1UP5A 4MBEA 1R2UA 4XJKA 1M46A 1CDNA 3SIAA 3C1VA 3M0WA 3VRQA 2KAVA 2M49B 1AHRA 1PSRA 3DVMA 4P5OE 4YGCB 1SL7A 2LVVA 4L9MA 3EK7A 1CDLA 3D0YB 1UHJA 1CFPA 3I5HB 3BXKA 4A4CA 1DJIA 2M1KB 3AAJA 1PRWA 2R2IA 1S5GZ 3I5FB 1IQ3A 2OS8B 4MZKA 1BODA 1SR6C 2F2OA 1S5GY 2KFHA 2L4HA 4WRIA 2MLEC 5D7FA 3D0YA 4QJ5B 4CLNA 3KF9A 1NX3A 3PN7B 1B8RA 2LNKA 4FTGA 3KHEA 1QV1A 3WHTB 1MQ1A 3LL8B 2LUXA 1M45A 1IRJA 2K7DA 1YX7A 1KK7Z 4P2YB 3LK0A 5CPVA 1WLZA 1F54A 2QPTA 3A8RA 3BUWB 4GBAA 2LE9B 2MRDA 1J7RA 1JFKA 3OP0A 3EK4A 1ZFSA 4F0ZB 1B7TZ 4USLA 4NDBA 1NIWA 1R6PA 2ZRTA 2H61A 1KWOC 4ICBA 1CM4A 1TCOB 2Y1MA 2KI6D 3I5GB 1KK8B 5HKWA 3FWBA 3F45A 4R1EA 2CT9A 2M97A 1B8LA 1OOJA 1E8AA 1TCFA 2MJWB 3O78A 4GGFC 3JVTB 5BPJA 1EH2A 1RK9A 2LP3A 1NP8A 4DRWA 2LLUA 1F4QA 1KFUS 4YBHB 3DF0B 3CLNA 3TUYB 5AFPA 3GOFA 2AMIA 5F6TA 1JC2A 2E30A 5CSNA 2JXLA 2KQYA 2K7OA 1SNLA 2KNEA 1C7VA 3TZ1A 2F8PA 3FS7A 3EVVA 1X02A 4NDDA 4CFQA 1K9UA 1H8BA 1K95A 2M7LA 3DF0A 1OMDA 3FIAA 1S3PA 1KFXS 4GFTA 1ALVA 4PHMA 2Q91A 5I2QA 2GV5A 2NCOA 2MHHA 1OZSA 2I94A 4MEWA 1L2OB 1OQPA 5DKQA 3I5HC 4PHNA 2FJUB 3HCMA 3EVRA 1PVAA 1KFXL 4ZCVA 1LVCD 3OX5A 3I5FC 2MAZA 1A29A 2OS8C 1W7IB 4HSZA 2JNXA 2MA2A 1SYMA 1F55A 4MVFA 1RECA 3EK8A 3VROA 1VRKA 3CWGA 2KFFA 2BBMA 4C0KA 1FW4A 3PN7C 1K94A 3SIBA 3LLEA 3EKJA 3SG4A 2LC5A 1OMRA 1TOPA 1DF0B 1B9AA 4DIRA 1XYDA 2H61C 1EXRA 2KYFA 1QIWA 1OMVA 1S1EA 2LVKA 1G8IA 2ISDA 2BECA 1TIZA 3PM8A 1XFZO 1DT7B 1A4PA 1BLQA 3NXAA 1YX8A 4WQ2A 1YUTA 2BE4A 3VRNA 1J55A 3JTDB 4ETOA 1IJ6A 1K90D 2F3YA 2L0PA 1QTXA 1DGVA 2BCAA 3I5GC 1KK8C 1DJYA 2HQWA 3CR5X 3PLFB 4PE7A 4DS7A 5HKYA 2KAXA 1LXFC 1G33A 1NX1A 3JVTC 3CZTX 3EKHA 4OR9B 3TUYC 1RTP1 5DKNA 4FQOA 1QASA 3SG3A 3CR2A 1JUOA 1G4YR 1YRTB 2M0RA 1YUUA 1YVHA 3HX4A 3WNXB 1RJVA 2PRUA 1C7WA 4YRUA 3CR4X 5KU1A 1BT6A 1Y6WA 1IKUA 1DJXA 1CM1A 3SG7A 4I5KA 1GGWA 1TN4A 2LAPA 1CFDA 1CMGA 2K2AA 2NLNA 1UHKA 2KAYA 1TNQA 2ZN8A 3FWCA 2HF5A 1SBJA 1DJGA 2NZ0A 1HT9A 5AEQA 1B8CA 3SG2A 3DVEA 1QVIZ 1CDMA 1HQVA 2K61A 1S36A 1QVIY 2P6BB 3VGOA 4IL1A 5GQQC 1F4OA 1MXLC 4OV2A 1QXPA 1ZMZA 3D10A 1KK7Y 1GJYA 1K9KA 1RWYA 3CTNA 2JU0A 1TTXA 2JULA 1YR5A 2O60A 1TNWA 4A4BA 1QX2A 2WCBA 4YGAA 1NYAA 2F33A 4CFRA 4QJ3B 5ER4X 1B7TY 2IS9A 1IG5A 1TRFA 1KQMB 5HYDA 1ALWA 4YGDB 2M29A 3BOWB 2VRGA 4JWQA 2MLFC 5I2LA 2LP2A 3VRPA 2Y4QA 1WDCB 2JT0A 1XFYO 2HPSA 3KO0A 2F2PA 1CNPA 4ORAB 4GGNA 1FBVA 3JTDC 3TDIA 3BOWA 5HLVA 4MZLA 4M2OA 1UUSA 4PHJA 1BG1A 1FI6A 1NCZA 2JWWA 1XK4A 4GPLB 5D69A 1EG4A 5I8NA 2Y5IA 3K21A 4ZCUA 4YGEB 3SJSA 1BF5A 3GK1A 1NSHA 1QIVA 1CTRA 1M31A 2SCPA 2WOSA 3IF7A 3NSIA 4TNCA 1KQVA 1ZUZA 2LANA 1BR1B 2GGZA 1JSAA 4I5JA 1NWDA 4OCIA 5JJGA 3IQQA 1M39A 1UURA 1MUXA 2BCBA 1RFJA 2A4JA 1QATA 1H4BA 5TNCA 1F71A 2LCPA 2G2BA 1IH0A 1QX5B 1Y1UA 4M2PA 2QACA 4GUKA 1XA5A 1AJ5A 1QJTA 1Y1XA 1FF1A 1YURA 3O2PA 1JF2A 3CGAA 2L4IA 5HLOA 5I2OA 1DJWA 1IGVA 4QJ4B 1QV0A 2FCDA 2G9BA 1SW8A 4NQGA 1QS7A 2I7AA 3KEVA 1A75B 1BJFA 4YI9A 2HETA 2KDHA 3TDUA 2GGMA 4MN0A 4HREE 1QLKA 4MSPA 4U8DA 1B4CA 2SASA 2JNFA 2KSPA 3GK4X 2WORA 2L5XB 2CXJA 1AP4A 3RM1A 3DD4A 4MZJA 1K93D 4HRHA 3NSOA 4C0LA 4DUQA 1PVBA 4AQJA 3DVKA 1DF0A 1U5IB 2LHLA 4PE1A 2TN4A 2KFGA 1KQMC 1SL9A 4YI8A 3E3RA 2LMTA 1XFXO 1KSMA 2LVIA 4BY4A 5K89A 1F70A 2LMUA 2O5GA 2HQ8A 3LCPC 1WDCC 1D1OA 1U5IA 1XO5A 1PALA 3IQOA 3SG5A 5KTYA 5ER5A 2K8MB 1XK4C 5PALA 1YUSA 2E6WA 2OTGB 1MXEA 2COLB 1SPYA 2LMVA 2EGDA 3H4SE 1CKKA 2BBNA 5AERA 5CSIA 1EJ3A 2M1UA 1BMOA 2H2KA 2JOJA 3A4UB 1LA3A 3TDZA 2WC8A 1A03A 2LVJA 1DJHA 2EC6B 3EVUA 1J7OA 5AANA 5J3XA 2JT8A 1J7PA 5CSJA 1WY9A 1UHHA 4MRXA 4DCKA 1DVIA 4ORCB 2BL0B 2KQ6A 1JBAA 5AXIA 2NXQA 2OPOA 1BU3A 4ORBB 4HRGA 1DMOA 2K7CA 5CSFA 2KHNA 2ZNEA 1KSOA 2K0JA 1K8UA 2KYCA 3GK2A 2PVBA 1L2OC 2L51A 3BUNB 4PE0A 2LV7A 4D1EA 3TS5B 1CB1A 1N65A 1SCMB 2KBMA 3ZNIA 2KBIA 2WCFA 2Y1NA 2JT3A 2ZNDA 2JXCA 1NX2A 1CLLA 5DKRA 1NX0A 1SY9A 2L98A 2ZRSA 1PULA 4JQ0D 1KCYA 1QX7A 1Y0VH 3PSRA 1EG3A 2K2FA 2NCPA 1J1DA 3ICBA 2L2EA 4UPGA 1AVSA 3O4YA 1YTZC 1IWQA 1UHIA 2L50A 1A2XA 2F3ZA 3BUXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B1G A;  1YRU B;  2KI4 B;  2K7B A;  2LM5 A;  4NDC A;  1S6J A;  3OHM B;  3BUM B;  4PE4 A;  1XFU O;  2BKI B;  3OX6 A;  1AK8 A;  1LA0 A;  3VRR A;  4PAL A;  1ZOT B;  1NCX A;  2RGI A;  2WCE A;  4CPV A;  1SL8 A;  1SMG A;  1BR4 B;  3OB2 B;  2M8U A;  3AKB A;  1YVL A;  1DGU A;  3I5I B;  1XVJ A;  4N1F A;  4CID A;  1SRA A;  1C07 A;  1CFF A;  5G08 A;  2OTG C;  4MRY A;  2CCM A;  4C0J A;  3PAL A;  1PSB A;  2JQ6 A;  3KPX A;  3MSE B;  3PFV A;  1TNP A;  3NSL A;  1K9P A;  1WLM A;  2JTT A;  2LLT A;  1SKT A;  2EC6 C;  3OB1 B;  1MR8 A;  1XFV O;  4N5X A;  1J1E A;  5KSZ A;  1DJZ A;  4GAO A;  1K96 A;  5JOL A;  5B8I B;  2B1U A;  1CLB A;  2KGB C;  1AUI B;  3BUO B;  2BL0 C;  2CBL A;  4N1G A;  4AOM A;  2FCE A;  1WRL A;  1N0Y A;  3AKA A;  1B47 A;  1JFJ A;  3RLZ A;  3QRX A;  4YGB B;  2KI6 C;  4AQI A;  3NSK A;  1NUB A;  4MLW A;  2ZFD A;  4XYN A;  1KFU L;  1AJ4 A;  2I2R E;  2I18 A;  3SG6 A;  4E68 A;  3TS5 C;  2LUC A;  1SCM C;  2WND A;  1DTL A;  1OE9 B;  2JC2 A;  3LK1 A;  1JF0 A;  1SR6 B;  1CMF A;  2JTZ A;  2JPT A;  2V53 A;  1OZO A;  1JWD A;  2KOT A;  3BQ3 A;  3PAT A;  1CLM A;  1ZAC A;  2ZKM X;  1Q80 A;  2AUC A;  2EHB A;  2LHI A;  4WQ3 A;  1LKJ A;  1A75 A;  2MBX A;  1UHN A;  1NCY A;  1W7J B;  2BCX A;  2M3W A;  4GNK B;  4I5L B;  2KI4 C;  1BOC A;  1NPQ A;  3DVJ A;  2KGR A;  1S6C A;  1GQM A;  1TNX A;  5FYX A;  4OVN F;  1S6I A;  1V1F A;  2CNP A;  1V1G A;  1J7Q A;  1RRO A;  1N2D A;  5IBW A;  1IJ5 A;  2M7N A;  5HKZ A;  1Y1A A;  1M63 B;  1K2H A;  1GGZ A;  3WXA A;  4PDZ A;  1EL4 A;  4Q04 A;  1CDP A;  1QLS A;  1KWO B;  2DOQ A;  3CS1 A;  3I5I C;  2PAL A;  2BKH B;  2JZI A;  1UWO A;  4JPZ B;  2Q4U A;  4PCW A;  4BY5 A;  2M9G A;  4OKH A;  1MWN A;  2JRF A;  1WRZ A;  1LIN A;  1FI5 A;  2BE6 A;  1F8H A;  1CFC A;  2LLS A;  1WRK A;  4I5N B;  1PK0 D;  2PSR A;  1MHO A;  2D8N A;  3BYA A;  1XFW O;  4XJK B;  1ODB A;  1FPW A;  1S26 D;  2PMY A;  1L7Z A;  2CTN A;  2PAS A;  1SK6 D;  3O6B A;  1SCV A;  4GGF A;  3ZWH A;  4M2Q A;  2ZN9 A;  2FOT A;  2AAO A;  1OSA A;  1MF8 B;  3WHU B;  4PHK A;  1IQ5 A;  3AAK A;  1UP5 A;  4MBE A;  1R2U A;  4XJK A;  1M46 A;  1CDN A;  3SIA A;  3C1V A;  3M0W A;  3VRQ A;  2KAV A;  2M49 B;  1AHR A;  1PSR A;  3DVM A;  4P5O E;  4YGC B;  1SL7 A;  2LVV A;  4L9M A;  3EK7 A;  1CDL A;  3D0Y B;  1UHJ A;  1CFP A;  3I5H B;  3BXK A;  4A4C A;  1DJI A;  2M1K B;  3AAJ A;  1PRW A;  2R2I A;  1S5G Z;  3I5F B;  1IQ3 A;  2OS8 B;  4MZK A;  1BOD A;  1SR6 C;  2F2O A;  1S5G Y;  2KFH A;  2L4H A;  4WRI A;  2MLE C;  5D7F A;  3D0Y A;  4QJ5 B;  4CLN A;  3KF9 A;  1NX3 A;  3PN7 B;  1B8R A;  2LNK A;  4FTG A;  3KHE A;  1QV1 A;  3WHT B;  1MQ1 A;  3LL8 B;  2LUX A;  1M45 A;  1IRJ A;  2K7D A;  1YX7 A;  1KK7 Z;  4P2Y B;  3LK0 A;  5CPV A;  1WLZ A;  1F54 A;  2QPT A;  3A8R A;  3BUW B;  4GBA A;  2LE9 B;  2MRD A;  1J7R A;  1JFK A;  3OP0 A;  3EK4 A;  1ZFS A;  4F0Z B;  1B7T Z;  4USL A;  4NDB A;  1NIW A;  1R6P A;  2ZRT A;  2H61 A;  1KWO C;  4ICB A;  1CM4 A;  1TCO B;  2Y1M A;  2KI6 D;  3I5G B;  1KK8 B;  5HKW A;  3FWB A;  3F45 A;  4R1E A;  2CT9 A;  2M97 A;  1B8L A;  1OOJ A;  1E8A A;  1TCF A;  2MJW B;  3O78 A;  4GGF C;  3JVT B;  5BPJ A;  1EH2 A;  1RK9 A;  2LP3 A;  1NP8 A;  4DRW A;  2LLU A;  1F4Q A;  1KFU S;  4YBH B;  3DF0 B;  3CLN A;  3TUY B;  5AFP A;  3GOF A;  2AMI A;  5F6T A;  1JC2 A;  2E30 A;  5CSN A;  2JXL A;  2KQY A;  2K7O A;  1SNL A;  2KNE A;  1C7V A;  3TZ1 A;  2F8P A;  3FS7 A;  3EVV A;  1X02 A;  4NDD A;  4CFQ A;  1K9U A;  1H8B A;  1K95 A;  2M7L A;  3DF0 A;  1OMD A;  3FIA A;  1S3P A;  1KFX S;  4GFT A;  1ALV A;  4PHM A;  2Q91 A;  5I2Q A;  2GV5 A;  2NCO A;  2MHH A;  1OZS A;  2I94 A;  4MEW A;  1L2O B;  1OQP A;  5DKQ A;  3I5H C;  4PHN A;  2FJU B;  3HCM A;  3EVR A;  1PVA A;  1KFX L;  4ZCV A;  1LVC D;  3OX5 A;  3I5F C;  2MAZ A;  1A29 A;  2OS8 C;  1W7I B;  4HSZ A;  2JNX A;  2MA2 A;  1SYM A;  1F55 A;  4MVF A;  1REC A;  3EK8 A;  3VRO A;  1VRK A;  3CWG A;  2KFF A;  2BBM A;  4C0K A;  1FW4 A;  3PN7 C;  1K94 A;  3SIB A;  3LLE A;  3EKJ A;  3SG4 A;  2LC5 A;  1OMR A;  1TOP A;  1DF0 B;  1B9A A;  4DIR A;  1XYD A;  2H61 C;  1EXR A;  2KYF A;  1QIW A;  1OMV A;  1S1E A;  2LVK A;  1G8I A;  2ISD A;  2BEC A;  1TIZ A;  3PM8 A;  1XFZ O;  1DT7 B;  1A4P A;  1BLQ A;  3NXA A;  1YX8 A;  4WQ2 A;  1YUT A;  2BE4 A;  3VRN A;  1J55 A;  3JTD B;  4ETO A;  1IJ6 A;  1K90 D;  2F3Y A;  2L0P A;  1QTX A;  1DGV A;  2BCA A;  3I5G C;  1KK8 C;  1DJY A;  2HQW A;  3CR5 X;  3PLF B;  4PE7 A;  4DS7 A;  5HKY A;  2KAX A;  1LXF C;  1G33 A;  1NX1 A;  3JVT C;  3CZT X;  3EKH A;  4OR9 B;  3TUY C;  1RTP 1;  5DKN A;  4FQO A;  1QAS A;  3SG3 A;  3CR2 A;  1JUO A;  1G4Y R;  1YRT B;  2M0R A;  1YUU A;  1YVH A;  3HX4 A;  3WNX B;  1RJV A;  2PRU A;  1C7W A;  4YRU A;  3CR4 X;  5KU1 A;  1BT6 A;  1Y6W A;  1IKU A;  1DJX A;  1CM1 A;  3SG7 A;  4I5K A;  1GGW A;  1TN4 A;  2LAP A;  1CFD A;  1CMG A;  2K2A A;  2NLN A;  1UHK A;  2KAY A;  1TNQ A;  2ZN8 A;  3FWC A;  2HF5 A;  1SBJ A;  1DJG A;  2NZ0 A;  1HT9 A;  5AEQ A;  1B8C A;  3SG2 A;  3DVE A;  1QVI Z;  1CDM A;  1HQV A;  2K61 A;  1S36 A;  1QVI Y;  2P6B B;  3VGO A;  4IL1 A;  5GQQ C;  1F4O A;  1MXL C;  4OV2 A;  1QXP A;  1ZMZ A;  3D10 A;  1KK7 Y;  1GJY A;  1K9K A;  1RWY A;  3CTN A;  2JU0 A;  1TTX A;  2JUL A;  1YR5 A;  2O60 A;  1TNW A;  4A4B A;  1QX2 A;  2WCB A;  4YGA A;  1NYA A;  2F33 A;  4CFR A;  4QJ3 B;  5ER4 X;  1B7T Y;  2IS9 A;  1IG5 A;  1TRF A;  1KQM B;  5HYD A;  1ALW A;  4YGD B;  2M29 A;  3BOW B;  2VRG A;  4JWQ A;  2MLF C;  5I2L A;  2LP2 A;  3VRP A;  2Y4Q A;  1WDC B;  2JT0 A;  1XFY O;  2HPS A;  3KO0 A;  2F2P A;  1CNP A;  4ORA B;  4GGN A;  1FBV A;  3JTD C;  3TDI A;  3BOW A;  5HLV A;  4MZL A;  4M2O A;  1UUS A;  4PHJ A;  1BG1 A;  1FI6 A;  1NCZ A;  2JWW A;  1XK4 A;  4GPL B;  5D69 A;  1EG4 A;  5I8N A;  2Y5I A;  3K21 A;  4ZCU A;  4YGE B;  3SJS A;  1BF5 A;  3GK1 A;  1NSH A;  1QIV A;  1CTR A;  1M31 A;  2SCP A;  2WOS A;  3IF7 A;  3NSI A;  4TNC A;  1KQV A;  1ZUZ A;  2LAN A;  1BR1 B;  2GGZ A;  1JSA A;  4I5J A;  1NWD A;  4OCI A;  5JJG A;  3IQQ A;  1M39 A;  1UUR A;  1MUX A;  2BCB A;  1RFJ A;  2A4J A;  1QAT A;  1H4B A;  5TNC A;  1F71 A;  2LCP A;  2G2B A;  1IH0 A;  1QX5 B;  1Y1U A;  4M2P A;  2QAC A;  4GUK A;  1XA5 A;  1AJ5 A;  1QJT A;  1Y1X A;  1FF1 A;  1YUR A;  3O2P A;  1JF2 A;  3CGA A;  2L4I A;  5HLO A;  5I2O A;  1DJW A;  1IGV A;  4QJ4 B;  1QV0 A;  2FCD A;  2G9B A;  1SW8 A;  4NQG A;  1QS7 A;  2I7A A;  3KEV A;  1A75 B;  1BJF A;  4YI9 A;  2HET A;  2KDH A;  3TDU A;  2GGM A;  4MN0 A;  4HRE E;  1QLK A;  4MSP A;  4U8D A;  1B4C A;  2SAS A;  2JNF A;  2KSP A;  3GK4 X;  2WOR A;  2L5X B;  2CXJ A;  1AP4 A;  3RM1 A;  3DD4 A;  4MZJ A;  1K93 D;  4HRH A;  3NSO A;  4C0L A;  4DUQ A;  1PVB A;  4AQJ A;  3DVK A;  1DF0 A;  1U5I B;  2LHL A;  4PE1 A;  2TN4 A;  2KFG A;  1KQM C;  1SL9 A;  4YI8 A;  3E3R A;  2LMT A;  1XFX O;  1KSM A;  2LVI A;  4BY4 A;  5K89 A;  1F70 A;  2LMU A;  2O5G A;  2HQ8 A;  3LCP C;  1WDC C;  1D1O A;  1U5I A;  1XO5 A;  1PAL A;  3IQO A;  3SG5 A;  5KTY A;  5ER5 A;  2K8M B;  1XK4 C;  5PAL A;  1YUS A;  2E6W A;  2OTG B;  1MXE A;  2COL B;  1SPY A;  2LMV A;  2EGD A;  3H4S E;  1CKK A;  2BBN A;  5AER A;  5CSI A;  1EJ3 A;  2M1U A;  1BMO A;  2H2K A;  2JOJ A;  3A4U B;  1LA3 A;  3TDZ A;  2WC8 A;  1A03 A;  2LVJ A;  1DJH A;  2EC6 B;  3EVU A;  1J7O A;  5AAN A;  5J3X A;  2JT8 A;  1J7P A;  5CSJ A;  1WY9 A;  1UHH A;  4MRX A;  4DCK A;  1DVI A;  4ORC B;  2BL0 B;  2KQ6 A;  1JBA A;  5AXI A;  2NXQ A;  2OPO A;  1BU3 A;  4ORB B;  4HRG A;  1DMO A;  2K7C A;  5CSF A;  2KHN A;  2ZNE A;  1KSO A;  2K0J A;  1K8U A;  2KYC A;  3GK2 A;  2PVB A;  1L2O C;  2L51 A;  3BUN B;  4PE0 A;  2LV7 A;  4D1E A;  3TS5 B;  1CB1 A;  1N65 A;  1SCM B;  2KBM A;  3ZNI A;  2KBI A;  2WCF A;  2Y1N A;  2JT3 A;  2ZND A;  2JXC A;  1NX2 A;  1CLL A;  5DKR A;  1NX0 A;  1SY9 A;  2L98 A;  2ZRS A;  1PUL A;  4JQ0 D;  1KCY A;  1QX7 A;  1Y0V H;  3PSR A;  1EG3 A;  2K2F A;  2NCP A;  1J1D A;  3ICB A;  2L2E A;  4UPG A;  1AVS A;  3O4Y A;  1YTZ C;  1IWQ A;  1UHI A;  2L50 A;  1A2X A;  2F3Z A;  3BUX B; 
#chains in the Genus database with same CATH topology
 3L4L A;  1B1G A;  1YRU B;  2KI4 B;  2K7B A;  2LM5 A;  4NDC A;  1S6J A;  3OHM B;  3D77 A;  3BUM B;  4PE4 A;  1XFU O;  2BKI B;  3OX6 A;  1AK8 A;  1LA0 A;  3VRR A;  3FE6 A;  2BAP A;  4PAL A;  1ZOT B;  5EL2 A;  1NCX A;  2RGI A;  2WCE A;  4CPV A;  2H8V A;  2PQL A;  1SL8 A;  2WCM A;  1SMG A;  1BR4 B;  3OB2 B;  2M8U A;  3AKB A;  1YVL A;  1DGU A;  3I5I B;  1XVJ A;  4N1F A;  4CID A;  3FE8 A;  1SRA A;  1C07 A;  1CFF A;  3DYE A;  1DEK A;  5G08 A;  2OTG C;  4MRY A;  2CCM A;  4C0J A;  3PAL A;  1PSB A;  2JQ6 A;  2L2C A;  3KPX A;  3MSE B;  3PFV A;  1TNP A;  3NSL A;  1K9P A;  1WLM A;  2JTT A;  2LLT A;  1SKT A;  2EC6 C;  3OB1 B;  1MR8 A;  1XFV O;  4N5X A;  1J1E A;  5KSZ A;  1DJZ A;  4GAO A;  1K96 A;  3V2L A;  5JOL A;  5B8I B;  2B1U A;  1CLB A;  2KGB C;  1Z4H A;  1AUI B;  3BUO B;  2BL0 C;  2CBL A;  2QEB A;  4N1G A;  4AOM A;  2FCE A;  1WRL A;  1N0Y A;  3AKA A;  1B47 A;  1JFJ A;  5HL1 A;  3RLZ A;  2YGU A;  3QRX A;  4YGB B;  2KI6 C;  3R72 A;  4AQI A;  3NSK A;  1NUB A;  4MLW A;  2ZFD A;  4XYN A;  1KFU L;  1AJ4 A;  2I2R E;  2I18 A;  3SG6 A;  4E68 A;  3TS5 C;  2LUC A;  1SCM C;  2WND A;  1DTL A;  1OE9 B;  2JC2 A;  3LK1 A;  1JF0 A;  1SR6 B;  3N7H A;  2WCH A;  1CMF A;  2JTZ A;  2JPT A;  2V53 A;  1OZO A;  1JWD A;  2KOT A;  3BQ3 A;  1DQE A;  1CLM A;  1ZAC A;  3PAT A;  2ZKM X;  1Q80 A;  1IIO A;  2AUC A;  2EHB A;  2LHI A;  4WQ3 A;  3BFA A;  1LKJ A;  1A75 A;  2MBX A;  1UHN A;  1NCY A;  1W7J B;  2BCX A;  1Z2C B;  2M3W A;  4GNK B;  1C3Z A;  4I5L B;  2KI4 C;  1BOC A;  1NPQ A;  3DVJ A;  2KGR A;  1S6C A;  1GQM A;  1TNX A;  3B6X A;  3D73 A;  5FYX A;  3Q8I A;  4OVN F;  1S6I A;  1V1F A;  2CNP A;  3UNW A;  1V1G A;  1J7Q A;  1RRO A;  1N2D A;  5IBW A;  1IJ5 A;  2M7N A;  5HKZ A;  1Y1A A;  1M63 B;  1K2H A;  1GGZ A;  3WXA A;  4PDZ A;  1EL4 A;  2QDI A;  4Q04 A;  1CDP A;  1QLS A;  1KWO B;  2DOQ A;  3CS1 A;  3I5I C;  2PAL A;  2BKH B;  2JZI A;  1UWO A;  4JPZ B;  2Q4U A;  4PCW A;  4BY5 A;  2M9G A;  4OKH A;  1MWN A;  2JRF A;  1WRZ A;  1LIN A;  1FI5 A;  2BE6 A;  1F8H A;  1CFC A;  2LLS A;  1WRK A;  4I5N B;  1PK0 D;  2PSR A;  1MHO A;  1XFR A;  5FI7 A;  2D8N A;  1OOH A;  3BYA A;  1XFW O;  3SS3 A;  4XJK B;  1ODB A;  1FPW A;  1S26 D;  2PMY A;  3DY9 A;  1L7Z A;  2CTN A;  2PAS A;  1SK6 D;  3O6B A;  1SCV A;  2KLD A;  4GGF A;  3ZWH A;  3PM2 A;  1W9Z A;  4M2Q A;  2ZN9 A;  2FOT A;  2AAO A;  1OSA A;  1MF8 B;  3UO9 A;  3WHU B;  4PHK A;  1IQ5 A;  3AAK A;  1UP5 A;  4MBE A;  1R2U A;  4XJK A;  1M46 A;  1CDN A;  3SIA A;  3C1V A;  3M0W A;  3VRQ A;  2KAV A;  1T14 A;  2M49 B;  1AHR A;  1PSR A;  3DVM A;  4P5O E;  4YGC B;  1SL7 A;  2LVV A;  4L9M A;  3D75 A;  3EK7 A;  1CDL A;  3CYZ A;  3D0Y B;  1UHJ A;  3NHT A;  1CFP A;  3VB1 A;  3FE9 A;  3I5H B;  3BXK A;  4A4C A;  1DJI A;  2M1K B;  3AAJ A;  1PRW A;  2R2I A;  1S5G Z;  3I5F B;  1IQ3 A;  2OS8 B;  4MZK A;  1BOD A;  1SR6 C;  2F2O A;  1S5G Y;  3CZ0 A;  2KFH A;  2L4H A;  4WRI A;  2MLE C;  3CZ2 A;  3D0Y A;  5D7F A;  4QJ5 B;  4CLN A;  3KF9 A;  1NX3 A;  1DEL A;  1TUZ A;  2QEH A;  3B88 A;  3PN7 B;  1B8R A;  2P71 A;  3S0D A;  2LNK A;  4JKT A;  4FTG A;  3KHE A;  1QV1 A;  3WHT B;  1MQ1 A;  3LL8 B;  2LUX A;  1GM0 A;  1M45 A;  1IRJ A;  2K7D A;  1YX7 A;  1KK7 Z;  4P2Y B;  3LK0 A;  5CPV A;  1WLZ A;  1F54 A;  2QPT A;  3A8R A;  3BUW B;  4GBA A;  2LE9 B;  2MRD A;  2WCK A;  1J7R A;  1JFK A;  3DZT A;  3OP0 A;  3EK4 A;  2WC5 A;  1ZFS A;  4F0Z B;  1B7T Z;  4USL A;  4NDB A;  1NIW A;  1R6P A;  3S0B A;  2ZRT A;  2H61 A;  1KWO C;  2KLE A;  4ICB A;  1CM4 A;  1TCO B;  2Y1M A;  2KI6 D;  3I5G B;  1KK8 B;  5HKW A;  3FWB A;  3F45 A;  4PT1 A;  4R1E A;  2CT9 A;  2M97 A;  1B8L A;  1OOJ A;  1E8A A;  1TCF A;  2MJW B;  3O78 A;  4GGF C;  3JVT B;  5BPJ A;  1EH2 A;  1RK9 A;  2LP3 A;  1NP8 A;  4DRW A;  2LLU A;  1F4Q A;  1KFU S;  4YBH B;  3DF0 B;  3CLN A;  3TUY B;  5AFP A;  3GOF A;  2AMI A;  2WC6 A;  5F6T A;  1JC2 A;  2E30 A;  5CSN A;  2JXL A;  2KQY A;  2K7O A;  1SNL A;  2KNE A;  3OBV A;  1C7V A;  3TZ1 A;  2F8P A;  5DIC A;  3FS7 A;  3EVV A;  1X02 A;  4NDD A;  4CFQ A;  1K9U A;  5I94 A;  1K95 A;  2M7L A;  3DF0 A;  1OMD A;  3FIA A;  1H8B A;  1S3P A;  1KFX S;  4GFT A;  1ALV A;  1ORG A;  4PHM A;  2Q91 A;  5I2Q A;  3BFB A;  2GV5 A;  2NCO A;  2MHH A;  1OZS A;  2I94 A;  4MEW A;  1L2O B;  1OQP A;  5DKQ A;  3I5H C;  2ERB A;  2FJU B;  3HCM A;  3EVR A;  4PHN A;  1PVA A;  1KFX L;  4ZCV A;  1LVC D;  3OX5 A;  3I5F C;  2MAZ A;  1A29 A;  2OS8 C;  1W7I B;  4HSZ A;  2JNX A;  2MA2 A;  3IVT A;  1SYM A;  1F55 A;  4MVF A;  1REC A;  3EK8 A;  3VRO A;  1VRK A;  3CWG A;  2KFF A;  2BBM A;  4C0K A;  1FW4 A;  3PN7 C;  1K94 A;  4FQT A;  3SIB A;  3LLE A;  3EKJ A;  3SG4 A;  2LC5 A;  1OMR A;  1OOF A;  1TOP A;  1DF0 B;  1B9A A;  3R1V A;  4DIR A;  1XYD A;  3NHI A;  2H61 C;  1EXR A;  2KYF A;  3L4A A;  4JD9 A;  1QIW A;  1OMV A;  2BNX A;  1S1E A;  2LVK A;  1G8I A;  2ISD A;  2BEC A;  1TIZ A;  3PM8 A;  1XFZ O;  1DT7 B;  1A4P A;  1BLQ A;  3NXA A;  1YX8 A;  4WQ2 A;  1YUT A;  2BE4 A;  2WCJ A;  3VRN A;  1J55 A;  3JTD B;  4ETO A;  1IJ6 A;  1K90 D;  2F3Y A;  2L0P A;  1QTX A;  3B7A A;  4KYN A;  1DGV A;  2BCA A;  2KPH A;  3I5G C;  1KK8 C;  1DJY A;  3QME A;  2HQW A;  3SS5 A;  3CR5 X;  3PLF B;  4PE7 A;  3NGV A;  4DS7 A;  5HKY A;  2KAX A;  2WCL A;  3CAB A;  1LXF C;  1G33 A;  1NX1 A;  3JVT C;  3CZT X;  3EKH A;  4OR9 B;  3TUY C;  1RTP 1;  5DKN A;  4FQO A;  1QAS A;  2P70 A;  3CR2 A;  1JUO A;  3SG3 A;  1G4Y R;  1YRT B;  2M0R A;  1YUU A;  1YVH A;  3HX4 A;  3WNX B;  1RJV A;  1IWQ A;  2PRU A;  1C7W A;  4YRU A;  2K60 A;  2JPO A;  1QWV A;  3CR4 X;  5KU1 A;  1BT6 A;  1OOI X;  1Y6W A;  1IKU A;  1DJX A;  1CM1 A;  3SG7 A;  3S0E A;  4I5K A;  1GGW A;  1TN4 A;  2LAP A;  1CFD A;  1CMG A;  2K2A A;  2NLN A;  1UHK A;  2KAY A;  1TNQ A;  2ZN8 A;  3FWC A;  2HF5 A;  1SBJ A;  1DJG A;  2NZ0 A;  1HT9 A;  5AEQ A;  1B8C A;  3S0A A;  3SG2 A;  3DVE A;  1QVI Z;  1CDM A;  1HQV A;  2K61 A;  1S36 A;  1QVI Y;  1SSE B;  2P6B B;  3VGO A;  4IL1 A;  5GQQ C;  1F4O A;  1MXL C;  4OV2 A;  1QXP A;  1ZMZ A;  3D10 A;  3RZS A;  1KK7 Y;  1GJY A;  1K9K A;  1RWY A;  3CTN A;  2JU0 A;  1TTX A;  2JUL A;  1YR5 A;  2O60 A;  1TNW A;  3S0F A;  4A4B A;  1QX2 A;  2WCB A;  4YGA A;  1NYA A;  2F33 A;  3BFH A;  4CFR A;  4QJ3 B;  5ER4 X;  1B7T Y;  2IS9 A;  1IG5 A;  1TRF A;  1KQM B;  5HYD A;  1ALW A;  4YGD B;  2M29 A;  3BOW B;  2QEO A;  2VRG A;  4JWQ A;  2MLF C;  5I2L A;  2LP2 A;  3VRP A;  2L5Y A;  2Y4Q A;  1WDC B;  2JT0 A;  1XFY O;  2HPS A;  3KO0 A;  3R1O A;  2F2P A;  1CNP A;  4ORA B;  4GGN A;  1FBV A;  3JTD C;  3TDI A;  3BOW A;  5HLV A;  4MZL A;  1OW4 A;  1LS8 A;  3BJH A;  4M2O A;  1UUS A;  4PHJ A;  5FI6 A;  1BG1 A;  1FI6 A;  1NCZ A;  2JWW A;  1XK4 A;  4GPL B;  5D69 A;  1EG4 A;  3CZ1 A;  5I8N A;  3SS4 A;  2Y5I A;  3K21 A;  4ZCU A;  4YGE B;  3SJS A;  1BF5 A;  3GK1 A;  1NSH A;  1QIV A;  1CTR A;  1M31 A;  2SCP A;  2WOS A;  3IF7 A;  3NSI A;  4TNC A;  1KQV A;  1ZUZ A;  2LAN A;  1BR1 B;  1C3Y A;  2GGZ A;  1JSA A;  4I5J A;  1NWD A;  4OCI A;  5JJG A;  3IQQ A;  1M39 A;  1UUR A;  1MUX A;  2BCB A;  1RFJ A;  2A4J A;  1QAT A;  1H4B A;  5TNC A;  1F71 A;  2LCP A;  2G2B A;  1IH0 A;  1QX5 B;  1Y1U A;  4M2P A;  2QAC A;  4GUK A;  1XA5 A;  1AJ5 A;  1QJT A;  1Y1X A;  1FF1 A;  1YUR A;  3O2P A;  1JF2 A;  3CGA A;  2L4I A;  5HLO A;  5I2O A;  1DJW A;  1IGV A;  4QJ4 B;  3D76 A;  1QV0 A;  2FCD A;  4INW A;  2G9B A;  1SW8 A;  4NQG A;  1QS7 A;  2I7A A;  3KEV A;  1A75 B;  1BJF A;  4YI9 A;  1P28 A;  3O4X A;  2HET A;  2KDH A;  3TDU A;  2GGM A;  4MN0 A;  4HRE E;  1QLK A;  2QEV A;  4MSP A;  4U8D A;  1B4C A;  2SAS A;  2JNF A;  2KSP A;  3GK4 X;  2WOR A;  2L5X B;  2CXJ A;  1DC1 A;  3RM1 A;  1AP4 A;  3DD4 A;  4MZJ A;  1K93 D;  2FJY A;  3PJI A;  4HRH A;  3NSO A;  4C0L A;  4DUQ A;  1PVB A;  3D74 A;  5D3O A;  4AQJ A;  3DVK A;  1DF0 A;  1U5I B;  2LHL A;  4PE1 A;  3R1P A;  2TN4 A;  2KFG A;  3K1E A;  1KQM C;  1SL9 A;  4YI8 A;  3E3R A;  2LMT A;  1XFX O;  1KSM A;  2LVI A;  4BY4 A;  5K89 A;  1F70 A;  2LMU A;  3EG5 B;  2O5G A;  2HQ8 A;  3LCP C;  1WDC C;  1D1O A;  1U5I A;  1XO5 A;  1PAL A;  3IQO A;  3S0G A;  3SG5 A;  5KTY A;  5ER5 A;  2K8M B;  1XK4 C;  5PAL A;  1YUS A;  2E6W A;  3CDN A;  2OTG B;  1MXE A;  2COL B;  1SPY A;  2LMV A;  3D78 A;  2EGD A;  3H4S E;  1CKK A;  2BBN A;  5AER A;  5CSI A;  1EJ3 A;  2M1U A;  1BMO A;  2H2K A;  2JOJ A;  3A4U B;  1LA3 A;  3TDZ A;  2WC8 A;  1A03 A;  2LVJ A;  1DJH A;  2EC6 B;  3EVU A;  1J7O A;  5AAN A;  5J3X A;  2JT8 A;  2PYQ A;  1J7P A;  5CSJ A;  1WY9 A;  1UHH A;  4MRX A;  4DCK A;  1DVI A;  4ORC B;  2BL0 B;  2KQ6 A;  3L47 A;  4IJ7 A;  1JBA A;  5AXI A;  2NXQ A;  2OPO A;  1BU3 A;  4ORB B;  4HRG A;  1TWO A;  1DMO A;  2K7C A;  5CSF A;  2KHN A;  2ZNE A;  1KSO A;  2K0J A;  1K8U A;  2KYC A;  3DXL A;  1TUJ A;  2PVB A;  1L2O C;  2L51 A;  3GK2 A;  3BUN B;  4PE0 A;  2LV7 A;  3B86 A;  4D1E A;  4OZD A;  3TS5 B;  1CB1 A;  1N65 A;  1SCM B;  2KBM A;  3ZNI A;  2KBI A;  2WCF A;  2Y1N A;  2JT3 A;  2ZND A;  2JXC A;  1NX2 A;  3B87 A;  1CLL A;  5DKR A;  1NX0 A;  1SY9 A;  2L98 A;  2ZRS A;  1PUL A;  4JQ0 D;  1KCY A;  1QX7 A;  1Y0V H;  2GTE A;  3PSR A;  1EG3 A;  2K2F A;  2NCP A;  1J1D A;  3ICB A;  4INX A;  4F7F A;  2L2E A;  3OGN A;  4UPG A;  1AVS A;  3O4Y A;  1YTZ C;  5FI2 A;  1OOG A;  1UHI A;  2L50 A;  1A2X A;  2F3Z A;  3BUX B; 
#chains in the Genus database with same CATH homology
 1B1G A;  1YRU B;  2KI4 B;  2K7B A;  2LM5 A;  4NDC A;  1S6J A;  3OHM B;  3BUM B;  4PE4 A;  1XFU O;  2BKI B;  3OX6 A;  1AK8 A;  1LA0 A;  3VRR A;  4PAL A;  1ZOT B;  1NCX A;  2RGI A;  2WCE A;  4CPV A;  1SL8 A;  1SMG A;  1BR4 B;  3OB2 B;  2M8U A;  3AKB A;  1YVL A;  1DGU A;  3I5I B;  1XVJ A;  4N1F A;  4CID A;  1SRA A;  1C07 A;  1CFF A;  5G08 A;  2OTG C;  4MRY A;  2CCM A;  4C0J A;  3PAL A;  1PSB A;  2JQ6 A;  3KPX A;  3MSE B;  3PFV A;  1TNP A;  3NSL A;  1K9P A;  1WLM A;  2JTT A;  2LLT A;  1SKT A;  2EC6 C;  3OB1 B;  1MR8 A;  1XFV O;  4N5X A;  1J1E A;  5KSZ A;  1DJZ A;  4GAO A;  1K96 A;  5JOL A;  5B8I B;  2B1U A;  1CLB A;  2KGB C;  1AUI B;  3BUO B;  2BL0 C;  2CBL A;  4N1G A;  4AOM A;  2FCE A;  1WRL A;  1N0Y A;  3AKA A;  1B47 A;  1JFJ A;  3RLZ A;  3QRX A;  4YGB B;  2KI6 C;  4AQI A;  3NSK A;  1NUB A;  4MLW A;  2ZFD A;  4XYN A;  1KFU L;  1AJ4 A;  2I2R E;  2I18 A;  3SG6 A;  4E68 A;  3TS5 C;  2LUC A;  1SCM C;  2WND A;  1DTL A;  1OE9 B;  2JC2 A;  3LK1 A;  1JF0 A;  1SR6 B;  1CMF A;  2JTZ A;  2JPT A;  2V53 A;  1OZO A;  1JWD A;  2KOT A;  3BQ3 A;  3PAT A;  1CLM A;  1ZAC A;  2ZKM X;  1Q80 A;  2AUC A;  2EHB A;  2LHI A;  4WQ3 A;  1LKJ A;  1A75 A;  2MBX A;  1UHN A;  1NCY A;  1W7J B;  2BCX A;  2M3W A;  4GNK B;  4I5L B;  2KI4 C;  1BOC A;  1NPQ A;  3DVJ A;  2KGR A;  1S6C A;  1GQM A;  1TNX A;  5FYX A;  4OVN F;  1S6I A;  1V1F A;  2CNP A;  1V1G A;  1J7Q A;  1RRO A;  1N2D A;  5IBW A;  1IJ5 A;  2M7N A;  5HKZ A;  1Y1A A;  1M63 B;  1K2H A;  1GGZ A;  3WXA A;  4PDZ A;  1EL4 A;  4Q04 A;  1CDP A;  1QLS A;  1KWO B;  2DOQ A;  3CS1 A;  3I5I C;  2PAL A;  2BKH B;  2JZI A;  1UWO A;  4JPZ B;  2Q4U A;  4PCW A;  4BY5 A;  2M9G A;  4OKH A;  1MWN A;  2JRF A;  1WRZ A;  1LIN A;  1FI5 A;  2BE6 A;  1F8H A;  1CFC A;  2LLS A;  1WRK A;  4I5N B;  1PK0 D;  2PSR A;  1MHO A;  2D8N A;  3BYA A;  1XFW O;  4XJK B;  1ODB A;  1FPW A;  1S26 D;  2PMY A;  1L7Z A;  2CTN A;  2PAS A;  1SK6 D;  3O6B A;  1SCV A;  4GGF A;  3ZWH A;  4M2Q A;  2ZN9 A;  2FOT A;  2AAO A;  1OSA A;  1MF8 B;  3WHU B;  4PHK A;  1IQ5 A;  3AAK A;  1UP5 A;  4MBE A;  1R2U A;  4XJK A;  1M46 A;  1CDN A;  3SIA A;  3C1V A;  3M0W A;  3VRQ A;  2KAV A;  2M49 B;  1AHR A;  1PSR A;  3DVM A;  4P5O E;  4YGC B;  1SL7 A;  2LVV A;  4L9M A;  3EK7 A;  1CDL A;  3D0Y B;  1UHJ A;  1CFP A;  3I5H B;  3BXK A;  4A4C A;  1DJI A;  2M1K B;  3AAJ A;  1PRW A;  2R2I A;  1S5G Z;  3I5F B;  1IQ3 A;  2OS8 B;  4MZK A;  1BOD A;  1SR6 C;  2F2O A;  1S5G Y;  2KFH A;  2L4H A;  4WRI A;  2MLE C;  5D7F A;  3D0Y A;  4QJ5 B;  4CLN A;  3KF9 A;  1NX3 A;  3PN7 B;  1B8R A;  2LNK A;  4FTG A;  3KHE A;  1QV1 A;  3WHT B;  1MQ1 A;  3LL8 B;  2LUX A;  1M45 A;  1IRJ A;  2K7D A;  1YX7 A;  1KK7 Z;  4P2Y B;  3LK0 A;  5CPV A;  1WLZ A;  1F54 A;  2QPT A;  3A8R A;  3BUW B;  4GBA A;  2LE9 B;  2MRD A;  1J7R A;  1JFK A;  3OP0 A;  3EK4 A;  1ZFS A;  4F0Z B;  1B7T Z;  4USL A;  4NDB A;  1NIW A;  1R6P A;  2ZRT A;  2H61 A;  1KWO C;  4ICB A;  1CM4 A;  1TCO B;  2Y1M A;  2KI6 D;  3I5G B;  1KK8 B;  5HKW A;  3FWB A;  3F45 A;  4R1E A;  2CT9 A;  2M97 A;  1B8L A;  1OOJ A;  1E8A A;  1TCF A;  2MJW B;  3O78 A;  4GGF C;  3JVT B;  5BPJ A;  1EH2 A;  1RK9 A;  2LP3 A;  1NP8 A;  4DRW A;  2LLU A;  1F4Q A;  1KFU S;  4YBH B;  3DF0 B;  3CLN A;  3TUY B;  5AFP A;  3GOF A;  2AMI A;  5F6T A;  1JC2 A;  2E30 A;  5CSN A;  2JXL A;  2KQY A;  2K7O A;  1SNL A;  2KNE A;  1C7V A;  3TZ1 A;  2F8P A;  3FS7 A;  3EVV A;  1X02 A;  4NDD A;  4CFQ A;  1K9U A;  1H8B A;  1K95 A;  2M7L A;  3DF0 A;  1OMD A;  3FIA A;  1S3P A;  1KFX S;  4GFT A;  1ALV A;  4PHM A;  2Q91 A;  5I2Q A;  2GV5 A;  2NCO A;  2MHH A;  1OZS A;  2I94 A;  4MEW A;  1L2O B;  1OQP A;  5DKQ A;  3I5H C;  4PHN A;  2FJU B;  3HCM A;  3EVR A;  1PVA A;  1KFX L;  4ZCV A;  1LVC D;  3OX5 A;  3I5F C;  2MAZ A;  1A29 A;  2OS8 C;  1W7I B;  4HSZ A;  2JNX A;  2MA2 A;  1SYM A;  1F55 A;  4MVF A;  1REC A;  3EK8 A;  3VRO A;  1VRK A;  3CWG A;  2KFF A;  2BBM A;  4C0K A;  1FW4 A;  3PN7 C;  1K94 A;  3SIB A;  3LLE A;  3EKJ A;  3SG4 A;  2LC5 A;  1OMR A;  1TOP A;  1DF0 B;  1B9A A;  4DIR A;  1XYD A;  2H61 C;  1EXR A;  2KYF A;  1QIW A;  1OMV A;  1S1E A;  2LVK A;  1G8I A;  2ISD A;  2BEC A;  1TIZ A;  3PM8 A;  1XFZ O;  1DT7 B;  1A4P A;  1BLQ A;  3NXA A;  1YX8 A;  4WQ2 A;  1YUT A;  2BE4 A;  3VRN A;  1J55 A;  3JTD B;  4ETO A;  1IJ6 A;  1K90 D;  2F3Y A;  2L0P A;  1QTX A;  1DGV A;  2BCA A;  3I5G C;  1KK8 C;  1DJY A;  2HQW A;  3CR5 X;  3PLF B;  4PE7 A;  4DS7 A;  5HKY A;  2KAX A;  1LXF C;  1G33 A;  1NX1 A;  3JVT C;  3CZT X;  3EKH A;  4OR9 B;  3TUY C;  1RTP 1;  5DKN A;  4FQO A;  1QAS A;  3SG3 A;  3CR2 A;  1JUO A;  1G4Y R;  1YRT B;  2M0R A;  1YUU A;  1YVH A;  3HX4 A;  3WNX B;  1RJV A;  2PRU A;  1C7W A;  4YRU A;  3CR4 X;  5KU1 A;  1BT6 A;  1Y6W A;  1IKU A;  1DJX A;  1CM1 A;  3SG7 A;  4I5K A;  1GGW A;  1TN4 A;  2LAP A;  1CFD A;  1CMG A;  2K2A A;  2NLN A;  1UHK A;  2KAY A;  1TNQ A;  2ZN8 A;  3FWC A;  2HF5 A;  1SBJ A;  1DJG A;  2NZ0 A;  1HT9 A;  5AEQ A;  1B8C A;  3SG2 A;  3DVE A;  1QVI Z;  1CDM A;  1HQV A;  2K61 A;  1S36 A;  1QVI Y;  2P6B B;  3VGO A;  4IL1 A;  5GQQ C;  1F4O A;  1MXL C;  4OV2 A;  1QXP A;  1ZMZ A;  3D10 A;  1KK7 Y;  1GJY A;  1K9K A;  1RWY A;  3CTN A;  2JU0 A;  1TTX A;  2JUL A;  1YR5 A;  2O60 A;  1TNW A;  4A4B A;  1QX2 A;  2WCB A;  4YGA A;  1NYA A;  2F33 A;  4CFR A;  4QJ3 B;  5ER4 X;  1B7T Y;  2IS9 A;  1IG5 A;  1TRF A;  1KQM B;  5HYD A;  1ALW A;  4YGD B;  2M29 A;  3BOW B;  2VRG A;  4JWQ A;  2MLF C;  5I2L A;  2LP2 A;  3VRP A;  2Y4Q A;  1WDC B;  2JT0 A;  1XFY O;  2HPS A;  3KO0 A;  2F2P A;  1CNP A;  4ORA B;  4GGN A;  1FBV A;  3JTD C;  3TDI A;  3BOW A;  5HLV A;  4MZL A;  4M2O A;  1UUS A;  4PHJ A;  1BG1 A;  1FI6 A;  1NCZ A;  2JWW A;  1XK4 A;  4GPL B;  5D69 A;  1EG4 A;  5I8N A;  2Y5I A;  3K21 A;  4ZCU A;  4YGE B;  3SJS A;  1BF5 A;  3GK1 A;  1NSH A;  1QIV A;  1CTR A;  1M31 A;  2SCP A;  2WOS A;  3IF7 A;  3NSI A;  4TNC A;  1KQV A;  1ZUZ A;  2LAN A;  1BR1 B;  2GGZ A;  1JSA A;  4I5J A;  1NWD A;  4OCI A;  5JJG A;  3IQQ A;  1M39 A;  1UUR A;  1MUX A;  2BCB A;  1RFJ A;  2A4J A;  1QAT A;  1H4B A;  5TNC A;  1F71 A;  2LCP A;  2G2B A;  1IH0 A;  1QX5 B;  1Y1U A;  4M2P A;  2QAC A;  4GUK A;  1XA5 A;  1AJ5 A;  1QJT A;  1Y1X A;  1FF1 A;  1YUR A;  3O2P A;  1JF2 A;  3CGA A;  2L4I A;  5HLO A;  5I2O A;  1DJW A;  1IGV A;  4QJ4 B;  1QV0 A;  2FCD A;  2G9B A;  1SW8 A;  4NQG A;  1QS7 A;  2I7A A;  3KEV A;  1A75 B;  1BJF A;  4YI9 A;  2HET A;  2KDH A;  3TDU A;  2GGM A;  4MN0 A;  4HRE E;  1QLK A;  4MSP A;  4U8D A;  1B4C A;  2SAS A;  2JNF A;  2KSP A;  3GK4 X;  2WOR A;  2L5X B;  2CXJ A;  1AP4 A;  3RM1 A;  3DD4 A;  4MZJ A;  1K93 D;  4HRH A;  3NSO A;  4C0L A;  4DUQ A;  1PVB A;  4AQJ A;  3DVK A;  1DF0 A;  1U5I B;  2LHL A;  4PE1 A;  2TN4 A;  2KFG A;  1KQM C;  1SL9 A;  4YI8 A;  3E3R A;  2LMT A;  1XFX O;  1KSM A;  2LVI A;  4BY4 A;  5K89 A;  1F70 A;  2LMU A;  2O5G A;  2HQ8 A;  3LCP C;  1WDC C;  1D1O A;  1U5I A;  1XO5 A;  1PAL A;  3IQO A;  3SG5 A;  5KTY A;  5ER5 A;  2K8M B;  1XK4 C;  5PAL A;  1YUS A;  2E6W A;  2OTG B;  1MXE A;  2COL B;  1SPY A;  2LMV A;  2EGD A;  3H4S E;  1CKK A;  2BBN A;  5AER A;  5CSI A;  1EJ3 A;  2M1U A;  1BMO A;  2H2K A;  2JOJ A;  3A4U B;  1LA3 A;  3TDZ A;  2WC8 A;  1A03 A;  2LVJ A;  1DJH A;  2EC6 B;  3EVU A;  1J7O A;  5AAN A;  5J3X A;  2JT8 A;  1J7P A;  5CSJ A;  1WY9 A;  1UHH A;  4MRX A;  4DCK A;  1DVI A;  4ORC B;  2BL0 B;  2KQ6 A;  1JBA A;  5AXI A;  2NXQ A;  2OPO A;  1BU3 A;  4ORB B;  4HRG A;  1DMO A;  2K7C A;  5CSF A;  2KHN A;  2ZNE A;  1KSO A;  2K0J A;  1K8U A;  2KYC A;  3GK2 A;  2PVB A;  1L2O C;  2L51 A;  3BUN B;  4PE0 A;  2LV7 A;  4D1E A;  3TS5 B;  1CB1 A;  1N65 A;  1SCM B;  2KBM A;  3ZNI A;  2KBI A;  2WCF A;  2Y1N A;  2JT3 A;  2ZND A;  2JXC A;  1NX2 A;  1CLL A;  5DKR A;  1NX0 A;  1SY9 A;  2L98 A;  2ZRS A;  1PUL A;  4JQ0 D;  1KCY A;  1QX7 A;  1Y0V H;  3PSR A;  1EG3 A;  2K2F A;  2NCP A;  1J1D A;  3ICB A;  2L2E A;  4UPG A;  1AVS A;  3O4Y A;  1YTZ C;  1IWQ A;  1UHI A;  2L50 A;  1A2X A;  2F3Z A;  3BUX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...