1ZFSA

Solution structure of s100a1 bound to calcium
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional solution structure of Ca(2+)-bound S100A1 as determined by NMR spectroscopy
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
molecule keywords S-100 protein, alpha chain
total genus 25
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zfsA00
4U8DA 3I5HC 5KTYA 2JT0A 1A75B 1RROA 2IS9A 4DIRA 1UHJA 3I5FC 1L7ZA 5IBWA 1NP8A 4YGEB 3GK4X 3RM1A 3WNXB 1TN4A 2KQYA 2L4HA 1WRZA 2KYCA 1RJVA 2JPTA 2K7OA 4N5XA 1EXRA 2WOSA 4JPZB 3BXKA 4MN0A 5CSIA 4PHMA 1DJHA 4F0ZB 1DJGA 2F8PA 2JQ6A 1WRKA 1NPQA 1FPWA 3DD4A 1G33A 4YGAA 2LHIA 2RGIA 1F70A 1SR6C 2KDHA 4ETOA 4JWQA 1KK8B 1M31A 1M39A 3ZNIA 1SBJA 2LM5A 1LXFC 2KFHA 1KFUL 1SPYA 1QLSA 2MLEC 3FIAA 2K7BA 4IL1A 1SNLA 1B8CA 1R2UA 4NDBA 4PE4A 2LUCA 2V53A 1UHKA 4PHNA 5GQQC 3CGAA 3SG5A 1AK8A 1B7TY 1UP5A 1PULA 1BODA 2PASA 2K7CA 3OHMB 2PVBA 1YVLA 2ISDA 4PDZA 1SY9A 1CLMA 1CDPA 1QX7A 5DKRA 1J7QA 2KI6C 1BF5A 1B4CA 5HKYA 4CFQA 2MJWB 1E8AA 1LA0A 2KI4B 1TRFA 3GOFA 1YRUB 2KI4C 2SCPA 2LVKA 1H8BA 3VRQA 1TCOB 1CLBA 1UUSA 1SR6B 1NX2A 3SG2A 3VRRA 1SK6D 1AP4A 2JXCA 1EH2A 1EJ3A 1L2OC 5AXIA 1SRAA 4GAOA 3NSOA 3PM8A 5FYXA 4PHJA 1MXEA 2AAOA 3NSIA 1IJ6A 3DF0A 1CFCA 4CLNA 4NQGA 5AERA 1SCVA 1W7IB 3KPXA 3PN7B 1L2OB 2LV7A 1NX1A 3BUOB 2O60A 2ZN8A 4HREE 1Q80A 3I5IB 1ALVA 2BECA 1C7VA 2LHLA 1CFPA 3VGOA 1K90D 3SG3A 1YVHA 2VRGA 1H4BA 3CWGA 5CSNA 1DVIA 4OV2A 1VRKA 2BCXA 4CFRA 4M2PA 1BT6A 4I5JA 2HF5A 1G8IA 1XFUO 5ER4X 1BOCA 1K95A 2JTTA 2OS8C 2KBIA 1SW8A 4XYNA 1CTRA 2M49B 4MEWA 2E30A 5JJGA 2HQ8A 1SL9A 2WCBA 1KFXL 4OR9B 1SMGA 3A8RA 2JTZA 2FCEA 3CR5X 4C0LA 1DMOA 1XFZO 2I18A 1UHIA 3DVEA 5I8NA 2F2OA 1NYAA 1KWOB 2MBXA 2KNEA 3I5GB 4ZCVA 1FI5A 3TUYB 2L2EA 1M45A 1K93D 1NX3A 1JBAA 3SJSA 3TS5B 2QACA 4YGBB 2JT8A 3AKAA 1BMOA 1J55A 1GQMA 1JSAA 2G9BA 2WCEA 2L4IA 2AUCA 1K9UA 1MHOA 1QIVA 1RECA 2LVJA 3EK8A 4WQ2A 2A4JA 1YUSA 1XO5A 1Y1XA 2CT9A 5CSFA 1CLLA 3SG6A 2LAPA 2JRFA 4C0JA 3EVVA 4MVFA 2BBNA 1AHRA 1JUOA 1XA5A 1IJ5A 1N2DA 1OOJA 3O6BA 4GNKB 4M2QA 1ZFSA 2EC6B 1CB1A 3VRNA 2LLSA 2LLUA 1KCYA 1NX0A 5J3XA 2KAYA 5AEQA 3M0WA 2K2AA 4D1EA 3I5HB 3DVJA 1WDCC 1KSOA 1WLZA 4USLA 1BR1B 3KF9A 3CR2A 2GGMA 3OB1B 3TDUA 3ICBA 4OCIA 2HPSA 1RTP1 1NIWA 1IG5A 1SYMA 3KO0A 4AQIA 5CSJA 4QJ4B 5DKQA 1JF2A 1F4OA 2NXQA 2FOTA 1DJZA 3QRXA 2Y1MA 3LCPC 2JWWA 4DS7A 1MF8B 2LE9B 1DGUA 1QXPA 5D69A 4GUKA 1K8UA 4GGNA 5HKWA 5BPJA 2I7AA 1EL4A 3O78A 3KEVA 4QJ3B 1A03A 3KHEA 2KSPA 3LK1A 3PSRA 2M0RA 4HRHA 2F3YA 5D7FA 1A2XA 1QV1A 2Q4UA 3DF0B 2WORA 1JFKA 2LMTA 3CZTX 3PN7C 4XJKB 4YI9A 4BY4A 1GGWA 1B7TZ 1YR5A 5F6TA 1TNWA 2KOTA 2L51A 1QX5B 4ORBB 1LKJA 3O4YA 1OZOA 1DF0B 4ZCUA 3TS5C 1CFFA 1ZOTB 2BKIB 1Y6WA 2NCPA 3CTNA 1S1EA 2KQ6A 3PLFB 1PK0D 2Y1NA 2L98A 2PALA 1OE9B 2OTGC 3DVKA 1SL7A 1UHNA 1IRJA 2ZKMX 4QJ5B 4GPLB 2Y4QA 3AAJA 1FW4A 1KFUS 1RWYA 2MHHA 2M9GA 1TIZA 1DJWA 1UWOA 3BUWB 1LVCD 2JT3A 4L9MA 5B8IB 1QJTA 2LANA 1UURA 5AANA 1RK9A 1CKKA 4C0KA 2LVIA 1B9AA 1GGZA 1SCMB 1HQVA 5HKZA 1SCMC 2ZN9A 3BUNB 1K94A 4MSPA 2KGBC 2LLTA 3CLNA 2F3ZA 2JU0A 1D1OA 2KHNA 1S3PA 4PE1A 1PALA 3JTDB 1RFJA 2I94A 2K0JA 3BQ3A 5ER5A 4I5KA 2CTNA 4DCKA 4I5LB 2OPOA 1PSRA 3NXAA 4YBHB 1C7WA 3OX6A 1J7RA 1WLMA 4MZLA 3A4UB 2M8UA 1MQ1A 1OMDA 2H61A 3SG4A 3EKHA 1EG4A 1NUBA 2KFGA 4TNCA 1N0YA 4CPVA 3D0YB 1Y0VH 1ZUZA 3EKJA 1CDLA 4E68A 3C1VA 4GBAA 1AVSA 1MWNA 1NWDA 2LVVA 2PMYA 3IQOA 3AAKA 3FWCA 2KYFA 3GK2A 1Y1AA 1U5IB 3CS1A 1QASA 3LLEA 1XFXO 3GK1A 1QX2A 3VRPA 1JC2A 1ZMZA 1QVIZ 4P5OE 1WY9A 1DTLA 2ZNDA 1QLKA 3HCMA 1S6CA 2CNPA 2JNXA 1BR4B 2K7DA 2LMUA 1W7JB 2E6WA 3LL8B 1V1GA 5TNCA 1QV0A 3EVUA 3TZ1A 3TDIA 4R1EA 5HLVA 3SIAA 1KQMB 3PATA 4PCWA 1A75A 1KWOC 3LK0A 1DJYA 2F2PA 1DGVA 2ZRTA 4N1FA 1KK7Z 2M97A 1YRTB 2KAXA 1F4QA 4OVNF 1CM4A 4OKHA 1N65A 4XJKA 1OSAA 2KGRA 4Q04A 2K8MB 2G2BA 2KBMA 2HQWA 1YX7A 2NLNA 4WQ3A 3FS7A 2OTGB 1KQMC 4FTGA 2M7NA 2BL0C 4I5NB 1DF0A 3O2PA 1S5GY 2GGZA 3BUXB 1BG1A 3CR4X 3IF7A 1C07A 1IWQA 2LUXA 5AFPA 4DRWA 2BCAA 4YGDB 2PRUA 2LC5A 4ORAB 2PSRA 4WRIA 2MLFC 1LA3A 1PVBA 1G4YR 1XFVO 4ICBA 1CMFA 2CXJA 4FQOA 2Y5IA 1NCXA 2JOJA 1XYDA 2BL0B 3TUYC 5I2OA 1J7PA 1IQ3A 4YRUA 1QTXA 1S6IA 2BBMA 1KSMA 1B8LA 3HX4A 1OZSA 2DOQA 2M1UA 3K21A 5K89A 5PALA 2BCBA 2L5XB 2M29A 1WDCB 1J7OA 3TDZA 2LNKA 5DKNA 2EGDA 4AOMA 1J1DA 4NDCA 2OS8B 3SIBA 1IQ5A 2MRDA 1CNPA 1OMRA 2I2RE 3D10A 3BUMB 1A4PA 1YURA 2LCPA 3DVMA 1PVAA 1CDNA 1DJXA 4DUQA 4MLWA 2BKHB 1B47A 4MRYA 1F54A 1K2HA 1SL8A 1KK8C 1UHHA 2MA2A 1QIWA 1B8RA 2JZIA 4MZKA 2GV5A 2P6BB 1TOPA 2ZFDA 1F8HA 1K9PA 1YUUA 4YGCB 2ZRSA 3EK7A 1S36A 5HYDA 1OMVA 1MUXA 2COLB 3PFVA 4NDDA 1BLQA 1U5IA 1CM1A 1K9KA 4BY5A 1Y1UA 2O5GA 1XK4C 2MAZA 1KQVA 4MBEA 2JULA 2WCFA 1V1FA 4N1GA 4UPGA 1IKUA 2KI6D 1LINA 2KAVA 4GGFC 4HRGA 5I2QA 1MR8A 1ZACA 1FF1A 1NCZA 1CMGA 4A4CA 4ORCB 2JNFA 5CPVA 3BOWA 4YI8A 2SASA 1TNQA 3WHTB 4HSZA 1R6PA 1ODBA 2LMVA 2WC8A 3EVRA 5HLOA 2JC2A 1AJ4A 3FWBA 5G08A 4M2OA 4PE0A 1K96A 1FBVA 3JTDC 3AKBA 1NSHA 1PSBA 2K2FA 3H4SE 1AJ5A 1TNPA 3PALA 4MZJA 2FJUB 1ALWA 1DJIA 1S5GZ 2KFFA 5KSZA 1TCFA 2CBLA 3JVTC 3JVTB 1TNXA 1SKTA 1XVJA 1PRWA 2TN4A 3SG7A 1DT7B 1IGVA 1A29A 1CFDA 2M1KB 3NSKA 1JFJA 2HETA 1YTZC 1XK4A 2EC6C 2F33A 2M7LA 1M63B 1QATA 3VROA 1J1EA 1M46A 1F71A 3RLZA 2QPTA 1HT9A 2K61A 5JOLA 3BYAA 2NZ0A 1QS7A 3OP0A 4CIDA 1CDMA 3OB2B 2FCDA 1KFXS 2JXLA 3OX5A 1MXLC 3I5GC 1FI6A 1WRLA 3ZWHA 4GGFA 2NCOA 3WXAA 2M3WA 2Q91A 2D8NA 3WHUB 2B1UA 1B1GA 3I5IC 4JQ0D 1IH0A 1AUIB 1QVIY 1JWDA 3MSEB 1XFYO 4AQJA 1S26D 1GJYA 1JF0A 3D0YA 2H2KA 2ZNEA 2AMIA 4A4BA 2LP2A 1BU3A 4PHKA 4MRXA 2EHBA 1OQPA 2BE4A 2H61C 1BJFA 4PALA 1XFWO 5KU1A 3E3RA 1YUTA 3I5FB 1S6JA 3IQQA 1KK7Y 3NSLA 2R2IA 2WNDA 2CCMA 3BOWB 2L50A 1TTXA 4PE7A 4P2YB 3EK4A 1NCYA 4GFTA 1YX8A 1EG3A 2BE6A 2LP3A 3F45A 2L0PA 1F55A 1X02A 5I2LA
chains in the Genus database with same CATH superfamily
4U8DA 3I5HC 5KTYA 2JT0A 1A75B 1RROA 1DQEA 2IS9A 4DIRA 1UHJA 3I5FC 1L7ZA 5IBWA 3CDNA 1NP8A 4YGEB 3GK4X 1LS8A 3RM1A 3WNXB 1TN4A 2KQYA 2L4HA 1WRZA 2KYCA 1RJVA 2JPTA 1GM0A 2K7OA 4N5XA 1EXRA 2WOSA 4JPZB 3BXKA 4MN0A 4INXA 5CSIA 4PHMA 1DJHA 1P28A 4F0ZB 1DJGA 2F8PA 2JQ6A 1WRKA 1NPQA 1FPWA 3DD4A 1G33A 4YGAA 2LHIA 2RGIA 1F70A 1SR6C 2QEHA 2KDHA 2QEVA 4ETOA 4JWQA 1KK8B 1M31A 1M39A 3ZNIA 3BJHA 1SBJA 2LM5A 1LXFC 2KFHA 1KFUL 1SPYA 1QLSA 4INWA 2MLEC 3FIAA 2K7BA 1TUZA 3O4XA 2QEBA 2ERBA 4IL1A 1SNLA 1B8CA 1R2UA 4NDBA 4PE4A 2LUCA 2V53A 1UHKA 4PHNA 5GQQC 3CGAA 3SG5A 1AK8A 1B7TY 1UP5A 2WCKA 1PULA 2P70A 3D75A 1BODA 2PASA 2K7CA 3OHMB 2PVBA 1YVLA 2ISDA 3BFBA 4PDZA 1SY9A 1Z2CB 1CLMA 1CDPA 1QX7A 3DZTA 5DKRA 1J7QA 2KI6C 1BF5A 1B4CA 5HKYA 4CFQA 2MJWB 1E8AA 1LA0A 2KI4B 1TRFA 3GOFA 1YRUB 2KI4C 3EG5B 2SCPA 2LVKA 1H8BA 3VRQA 1TCOB 5DICA 1UUSA 1CLBA 1SR6B 1NX2A 3SG2A 3VRRA 3FE9A 1SK6D 1AP4A 2JXCA 1EH2A 1EJ3A 1L2OC 3PJIA 5AXIA 1SRAA 4GAOA 3NSOA 3PM8A 3SS5A 2L2CA 5FYXA 4PHJA 1MXEA 3S0FA 2AAOA 3NSIA 1IJ6A 3DF0A 3BFAA 5FI6A 1CFCA 4CLNA 4NQGA 5AERA 1SCVA 1W7IB 3KPXA 3PN7B 3D78A 3S0BA 1L2OB 2LV7A 1NX1A 3BUOB 2O60A 2ZN8A 4HREE 1Q80A 3I5IB 1ALVA 2BECA 5HL1A 1C7VA 2LHLA 1CFPA 3VGOA 1K90D 3SG3A 1YVHA 2VRGA 1H4BA 3CWGA 5CSNA 1DVIA 4OV2A 3BFHA 1VRKA 2BCXA 4CFRA 3D74A 4M2PA 3PM2A 1BT6A 4I5JA 2HF5A 1G8IA 1XFUO 5ER4X 1BOCA 1K95A 2JTTA 2OS8C 2KBIA 1SW8A 4XYNA 1CTRA 2M49B 4MEWA 2E30A 5JJGA 2HQ8A 1SL9A 2WCBA 1KFXL 4OR9B 3RZSA 1SMGA 3A8RA 2JTZA 2FCEA 3CR5X 4C0LA 1DMOA 1XFZO 2I18A 1UHIA 3DVEA 5I8NA 2F2OA 1NYAA 1KWOB 2MBXA 1OOGA 2KNEA 3I5GB 4ZCVA 1FI5A 3TUYB 2L2EA 1M45A 1K93D 1NX3A 1JBAA 3B6XA 3UO9A 3SJSA 3TS5B 2QACA 4YGBB 2JT8A 3AKAA 1BMOA 1J55A 1GQMA 1JSAA 2G9BA 2WCEA 1DC1A 2L4IA 2AUCA 1K9UA 1MHOA 1QIVA 1RECA 2LVJA 3EK8A 4WQ2A 5I94A 2A4JA 1YUSA 4OZDA 1XO5A 1Y1XA 2CT9A 5CSFA 1CLLA 5EL2A 2LAPA 2JRFA 3SG6A 4C0JA 3EVVA 4MVFA 2BBNA 1AHRA 1JUOA 1XA5A 1IJ5A 1N2DA 1OOJA 3O6BA 4FQTA 3S0DA 3L4AA 4GNKB 4M2QA 1ZFSA 3L47A 2EC6B 3R1PA 1CB1A 3VRNA 2LLSA 2LLUA 1KCYA 1NX0A 5J3XA 2KAYA 5AEQA 3M0WA 2K2AA 4KYNA 3I5HB 4D1EA 4F7FA 3DVJA 1WDCC 1KSOA 1WLZA 4USLA 1BR1B 1T14A 3KF9A 3CR2A 2GGMA 3OB1B 3TDUA 3ICBA 4OCIA 2HPSA 1RTP1 3S0EA 1NIWA 1IG5A 1SYMA 3KO0A 4AQIA 5CSJA 4QJ4B 5DKQA 1JF2A 1F4OA 2NXQA 2WCHA 2FOTA 1DJZA 3QRXA 2Y1MA 3LCPC 2JWWA 3CABA 5D3OA 1DEKA 4DS7A 1MF8B 2LE9B 1DGUA 1QXPA 5D69A 2FJYA 1K8UA 1W9ZA 3DY9A 4GGNA 2I7AA 4GUKA 5HKWA 5BPJA 1EL4A 3O78A 3KEVA 4QJ3B 1DELA 1A03A 3KHEA 2L5YA 2KSPA 3LK1A 3PSRA 2M0RA 4HRHA 2F3YA 5D7FA 1A2XA 1QV1A 2Q4UA 3DF0B 1XFRA 2WORA 2QEOA 1JFKA 2LMTA 3CZTX 3PN7C 4XJKB 4YI9A 4BY4A 1GGWA 1B7TZ 1YR5A 5F6TA 1TNWA 2KOTA 2L51A 1QX5B 4ORBB 1LKJA 3O4YA 1OZOA 1DF0B 4ZCUA 2QDIA 3TS5C 3CZ1A 1CFFA 1ZOTB 2BKIB 1Y6WA 2NCPA 3CTNA 1S1EA 2KQ6A 3PLFB 2K60A 1PK0D 2Y1NA 2L98A 2PALA 1OE9B 2OTGC 3CYZA 1Z4HA 3DVKA 1SL7A 1UHNA 1IRJA 2ZKMX 4QJ5B 4GPLB 2Y4QA 3AAJA 1FW4A 1KFUS 1RWYA 2MHHA 3B88A 2M9GA 1TIZA 1DJWA 1UWOA 3BUWB 1LVCD 2JT3A 4L9MA 5B8IB 1ORGA 1QJTA 2LANA 1UURA 5AANA 1RK9A 1CKKA 4C0KA 2LVIA 1B9AA 1GGZA 1SCMB 1HQVA 5HKZA 1SCMC 2ZN9A 3BUNB 3R1VA 1K94A 1C3ZA 4MSPA 2KGBC 2LLTA 3NHIA 3CLNA 2F3ZA 2JU0A 1D1OA 2KHNA 3CZ2A 3N7HA 1S3PA 3S0AA 2P71A 4PE1A 1PALA 3JTDB 1RFJA 2I94A 2K0JA 3BQ3A 5ER5A 4I5KA 2CTNA 4DCKA 4I5LB 2OPOA 1PSRA 3NXAA 4YBHB 1C7WA 3OX6A 1J7RA 1OOIX 1WLMA 4MZLA 3A4UB 2M8UA 1MQ1A 1SSEB 1OMDA 2H61A 2JPOA 3SG4A 3SS4A 3EKHA 1EG4A 1NUBA 3IVTA 3QMEA 2KFGA 4TNCA 1N0YA 4CPVA 3D0YB 1Y0VH 1ZUZA 3EKJA 1CDLA 4E68A 3C1VA 4GBAA 1AVSA 1MWNA 1NWDA 2LVVA 2PMYA 3IQOA 3AAKA 3FWCA 2KYFA 3GK2A 1Y1AA 1U5IB 3CS1A 1QASA 3LLEA 1XFXO 3GK1A 1QX2A 3VRPA 1JC2A 1ZMZA 1QVIZ 4P5OE 1WY9A 1DTLA 2ZNDA 1QLKA 3R1OA 3HCMA 1S6CA 2CNPA 2JNXA 1BR4B 2K7DA 2LMUA 1W7JB 2PYQA 2E6WA 3LL8B 1V1GA 5TNCA 1QV0A 3EVUA 3R72A 3TDIA 3TZ1A 4R1EA 5HLVA 3SIAA 1TWOA 1C3YA 1KQMB 3PATA 4PCWA 1A75A 1KWOC 3FE8A 3LK0A 1DJYA 2F2PA 1DGVA 2WC5A 2ZRTA 4N1FA 1KK7Z 2M97A 2H8VA 3D76A 1YRTB 2KAXA 1F4QA 4OVNF 1CM4A 4OKHA 1N65A 4XJKA 1OSAA 2KGRA 4Q04A 2K8MB 2G2BA 2KBMA 2HQWA 1YX7A 2NLNA 3NHTA 4WQ3A 3FS7A 3CZ0A 2OTGB 1KQMC 4FTGA 1TUJA 2M7NA 2BL0C 4I5NB 1DF0A 2WCLA 3O2PA 3S0GA 1S5GY 2GGZA 3BUXB 1BG1A 3CR4X 3IF7A 1C07A 2YGUA 1IWQA 2LUXA 5AFPA 1OOFA 2WCMA 4DRWA 2BCAA 4PT1A 4YGDB 2PRUA 2LC5A 4ORAB 2PSRA 4WRIA 2MLFC 1LA3A 1PVBA 1G4YR 1XFVO 4ICBA 1CMFA 2CXJA 5FI2A 4FQOA 2Y5IA 1NCXA 2JOJA 1XYDA 2BL0B 2WCJA 5I2OA 3TUYC 1J7PA 4IJ7A 1IQ3A 4YRUA 1QTXA 1S6IA 2BBMA 1KSMA 1B8LA 3UNWA 3HX4A 1OZSA 2DOQA 2M1UA 3K21A 5K89A 5PALA 2BCBA 2L5XB 2M29A 1WDCB 3DXLA 3TDZA 1J7OA 2LNKA 5DKNA 2EGDA 2PQLA 4AOMA 2BAPA 1J1DA 4NDCA 3OGNA 2OS8B 3SIBA 1IQ5A 2MRDA 1CNPA 1OMRA 2I2RE 3D10A 3BUMB 1A4PA 1YURA 2LCPA 3DVMA 1PVAA 1CDNA 1DJXA 4DUQA 4MLWA 2BKHB 1B47A 4MRYA 1F54A 1K2HA 1SL8A 1KK8C 3DYEA 3B87A 1UHHA 2MA2A 1QIWA 1B8RA 2JZIA 4MZKA 1IIOA 2GV5A 2P6BB 1TOPA 2ZFDA 1F8HA 1K9PA 1YUUA 4YGCB 2ZRSA 3EK7A 1S36A 5HYDA 1OMVA 1MUXA 2COLB 3PFVA 3NGVA 4NDDA 3VB1A 1BLQA 1U5IA 1CM1A 1K9KA 4BY5A 1Y1UA 2O5GA 1XK4C 2MAZA 1KQVA 4MBEA 2JULA 2WCFA 1V1FA 4N1GA 4UPGA 1IKUA 1OOHA 2KI6D 1LINA 2KAVA 4GGFC 4HRGA 5I2QA 1MR8A 1ZACA 1FF1A 1NCZA 1CMGA 4A4CA 4ORCB 2JNFA 5CPVA 2BNXA 3BOWA 5FI7A 4YI8A 2SASA 1TNQA 3WHTB 3B7AA 4HSZA 1R6PA 1ODBA 4JD9A 2LMVA 2WC8A 3EVRA 5HLOA 2JC2A 2KLDA 1AJ4A 3FWBA 5G08A 4M2OA 4PE0A 1K96A 1FBVA 3JTDC 3AKBA 1NSHA 1PSBA 2K2FA 3H4SE 1AJ5A 1TNPA 3PALA 4MZJA 2FJUB 1ALWA 1DJIA 1S5GZ 2KFFA 5KSZA 1TCFA 2CBLA 3JVTC 3JVTB 1TNXA 1SKTA 1XVJA 1PRWA 2TN4A 3SG7A 3D73A 1IGVA 1DT7B 1A29A 1CFDA 2M1KB 3NSKA 1JFJA 1QWVA 2HETA 2KPHA 1YTZC 1XK4A 2EC6C 2F33A 2M7LA 1M63B 1QATA 3VROA 1J1EA 1M46A 3D77A 1F71A 3RLZA 2QPTA 3K1EA 1HT9A 1OW4A 2K61A 5JOLA 3BYAA 2NZ0A 1QS7A 3OP0A 4CIDA 1CDMA 3OB2B 2FCDA 1KFXS 2JXLA 3OX5A 1MXLC 3I5GC 1FI6A 1WRLA 3ZWHA 4GGFA 2NCOA 2WC6A 2M3WA 3V2LA 2Q91A 2D8NA 3WHUB 3WXAA 2B1UA 1B1GA 3I5IC 4JQ0D 1IH0A 1AUIB 1QVIY 1JWDA 3MSEB 1XFYO 4AQJA 1S26D 1GJYA 1JF0A 3D0YA 2H2KA 2ZNEA 2AMIA 4A4BA 3SS3A 3OBVA 4JKTA 2LP2A 3Q8IA 1BU3A 4PHKA 4MRXA 2EHBA 1OQPA 2BE4A 2H61C 1BJFA 3L4LA 4PALA 1XFWO 5KU1A 3E3RA 1YUTA 3I5FB 1S6JA 3IQQA 1KK7Y 3NSLA 2R2IA 2WNDA 2CCMA 3BOWB 2KLEA 2L50A 1TTXA 2GTEA 4PE7A 4P2YB 3EK4A 1NCYA 3FE6A 1YX8A 4GFTA 1EG3A 2BE6A 2LP3A 3F45A 2L0PA 1F55A 1X02A 3B86A 5I2LA
chains in the Genus database with same CATH topology
4U8DA 3I5HC 5KTYA 2JT0A 1A75B 1RROA 2IS9A 4DIRA 1UHJA 3I5FC 1L7ZA 5IBWA 1NP8A 4YGEB 3GK4X 3RM1A 3WNXB 1TN4A 2KQYA 2L4HA 1WRZA 2KYCA 1RJVA 2JPTA 2K7OA 4N5XA 1EXRA 2WOSA 4JPZB 3BXKA 4MN0A 5CSIA 4PHMA 1DJHA 4F0ZB 1DJGA 2F8PA 2JQ6A 1WRKA 1NPQA 1FPWA 3DD4A 1G33A 4YGAA 2LHIA 2RGIA 1F70A 1SR6C 2KDHA 4ETOA 4JWQA 1KK8B 1M31A 1M39A 3ZNIA 1SBJA 2LM5A 1LXFC 2KFHA 1KFUL 1SPYA 1QLSA 2MLEC 3FIAA 2K7BA 4IL1A 1SNLA 1B8CA 1R2UA 4NDBA 4PE4A 2LUCA 2V53A 1UHKA 4PHNA 5GQQC 3CGAA 3SG5A 1AK8A 1B7TY 1UP5A 1PULA 1BODA 2PASA 2K7CA 3OHMB 2PVBA 1YVLA 2ISDA 4PDZA 1SY9A 1CLMA 1CDPA 1QX7A 5DKRA 1J7QA 2KI6C 1BF5A 1B4CA 5HKYA 4CFQA 2MJWB 1E8AA 1LA0A 2KI4B 1TRFA 3GOFA 1YRUB 2KI4C 2SCPA 2LVKA 1H8BA 3VRQA 1TCOB 1CLBA 1UUSA 1SR6B 1NX2A 3SG2A 3VRRA 1SK6D 1AP4A 2JXCA 1EH2A 1EJ3A 1L2OC 5AXIA 1SRAA 4GAOA 3NSOA 3PM8A 5FYXA 4PHJA 1MXEA 2AAOA 3NSIA 1IJ6A 3DF0A 1CFCA 4CLNA 4NQGA 5AERA 1SCVA 1W7IB 3KPXA 3PN7B 1L2OB 2LV7A 1NX1A 3BUOB 2O60A 2ZN8A 4HREE 1Q80A 3I5IB 1ALVA 2BECA 1C7VA 2LHLA 1CFPA 3VGOA 1K90D 3SG3A 1YVHA 2VRGA 1H4BA 3CWGA 5CSNA 1DVIA 4OV2A 1VRKA 2BCXA 4CFRA 4M2PA 1BT6A 4I5JA 2HF5A 1G8IA 1XFUO 5ER4X 1BOCA 1K95A 2JTTA 2OS8C 2KBIA 1SW8A 4XYNA 1CTRA 2M49B 4MEWA 2E30A 5JJGA 2HQ8A 1SL9A 2WCBA 1KFXL 4OR9B 1SMGA 3A8RA 2JTZA 2FCEA 3CR5X 4C0LA 1DMOA 1XFZO 2I18A 1UHIA 3DVEA 5I8NA 2F2OA 1NYAA 1KWOB 2MBXA 2KNEA 3I5GB 4ZCVA 1FI5A 3TUYB 2L2EA 1M45A 1K93D 1NX3A 1JBAA 3SJSA 3TS5B 2QACA 4YGBB 2JT8A 3AKAA 1BMOA 1J55A 1GQMA 1JSAA 2G9BA 2WCEA 2L4IA 2AUCA 1K9UA 1MHOA 1QIVA 1RECA 2LVJA 3EK8A 4WQ2A 2A4JA 1YUSA 1XO5A 1Y1XA 2CT9A 5CSFA 1CLLA 3SG6A 2LAPA 2JRFA 4C0JA 3EVVA 4MVFA 2BBNA 1AHRA 1JUOA 1XA5A 1IJ5A 1N2DA 1OOJA 3O6BA 4GNKB 4M2QA 1ZFSA 2EC6B 1CB1A 3VRNA 2LLSA 2LLUA 1KCYA 1NX0A 5J3XA 2KAYA 5AEQA 3M0WA 2K2AA 4D1EA 3I5HB 3DVJA 1WDCC 1KSOA 1WLZA 4USLA 1BR1B 3KF9A 3CR2A 2GGMA 3OB1B 3TDUA 3ICBA 4OCIA 2HPSA 1RTP1 1NIWA 1IG5A 1SYMA 3KO0A 4AQIA 5CSJA 4QJ4B 5DKQA 1JF2A 1F4OA 2NXQA 2FOTA 1DJZA 3QRXA 2Y1MA 3LCPC 2JWWA 4DS7A 1MF8B 2LE9B 1DGUA 1QXPA 5D69A 4GUKA 1K8UA 4GGNA 5HKWA 5BPJA 2I7AA 1EL4A 3O78A 3KEVA 4QJ3B 1A03A 3KHEA 2KSPA 3LK1A 3PSRA 2M0RA 4HRHA 2F3YA 5D7FA 1A2XA 1QV1A 2Q4UA 3DF0B 2WORA 1JFKA 2LMTA 3CZTX 3PN7C 4XJKB 4YI9A 4BY4A 1GGWA 1B7TZ 1YR5A 5F6TA 1TNWA 2KOTA 2L51A 1QX5B 4ORBB 1LKJA 3O4YA 1OZOA 1DF0B 4ZCUA 3TS5C 1CFFA 1ZOTB 2BKIB 1Y6WA 2NCPA 3CTNA 1S1EA 2KQ6A 3PLFB 1PK0D 2Y1NA 2L98A 2PALA 1OE9B 2OTGC 3DVKA 1SL7A 1UHNA 1IRJA 2ZKMX 4QJ5B 4GPLB 2Y4QA 3AAJA 1FW4A 1KFUS 1RWYA 2MHHA 2M9GA 1TIZA 1DJWA 1UWOA 3BUWB 1LVCD 2JT3A 4L9MA 5B8IB 1QJTA 2LANA 1UURA 5AANA 1RK9A 1CKKA 4C0KA 2LVIA 1B9AA 1GGZA 1SCMB 1HQVA 5HKZA 1SCMC 2ZN9A 3BUNB 1K94A 4MSPA 2KGBC 2LLTA 3CLNA 2F3ZA 2JU0A 1D1OA 2KHNA 1S3PA 4PE1A 1PALA 3JTDB 1RFJA 2I94A 2K0JA 3BQ3A 5ER5A 4I5KA 2CTNA 4DCKA 4I5LB 2OPOA 1PSRA 3NXAA 4YBHB 1C7WA 3OX6A 1J7RA 1WLMA 4MZLA 3A4UB 2M8UA 1MQ1A 1OMDA 2H61A 3SG4A 3EKHA 1EG4A 1NUBA 2KFGA 4TNCA 1N0YA 4CPVA 3D0YB 1Y0VH 1ZUZA 3EKJA 1CDLA 4E68A 3C1VA 4GBAA 1AVSA 1MWNA 1NWDA 2LVVA 2PMYA 3IQOA 3AAKA 3FWCA 2KYFA 3GK2A 1Y1AA 1U5IB 3CS1A 1QASA 3LLEA 1XFXO 3GK1A 1QX2A 3VRPA 1JC2A 1ZMZA 1QVIZ 4P5OE 1WY9A 1DTLA 2ZNDA 1QLKA 3HCMA 1S6CA 2CNPA 2JNXA 1BR4B 2K7DA 2LMUA 1W7JB 2E6WA 3LL8B 1V1GA 5TNCA 1QV0A 3EVUA 3TZ1A 3TDIA 4R1EA 5HLVA 3SIAA 1KQMB 3PATA 4PCWA 1A75A 1KWOC 3LK0A 1DJYA 2F2PA 1DGVA 2ZRTA 4N1FA 1KK7Z 2M97A 1YRTB 2KAXA 1F4QA 4OVNF 1CM4A 4OKHA 1N65A 4XJKA 1OSAA 2KGRA 4Q04A 2K8MB 2G2BA 2KBMA 2HQWA 1YX7A 2NLNA 4WQ3A 3FS7A 2OTGB 1KQMC 4FTGA 2M7NA 2BL0C 4I5NB 1DF0A 3O2PA 1S5GY 2GGZA 3BUXB 1BG1A 3CR4X 3IF7A 1C07A 1IWQA 2LUXA 5AFPA 4DRWA 2BCAA 4YGDB 2PRUA 2LC5A 4ORAB 2PSRA 4WRIA 2MLFC 1LA3A 1PVBA 1G4YR 1XFVO 4ICBA 1CMFA 2CXJA 4FQOA 2Y5IA 1NCXA 2JOJA 1XYDA 2BL0B 3TUYC 5I2OA 1J7PA 1IQ3A 4YRUA 1QTXA 1S6IA 2BBMA 1KSMA 1B8LA 3HX4A 1OZSA 2DOQA 2M1UA 3K21A 5K89A 5PALA 2BCBA 2L5XB 2M29A 1WDCB 1J7OA 3TDZA 2LNKA 5DKNA 2EGDA 4AOMA 1J1DA 4NDCA 2OS8B 3SIBA 1IQ5A 2MRDA 1CNPA 1OMRA 2I2RE 3D10A 3BUMB 1A4PA 1YURA 2LCPA 3DVMA 1PVAA 1CDNA 1DJXA 4DUQA 4MLWA 2BKHB 1B47A 4MRYA 1F54A 1K2HA 1SL8A 1KK8C 1UHHA 2MA2A 1QIWA 1B8RA 2JZIA 4MZKA 2GV5A 2P6BB 1TOPA 2ZFDA 1F8HA 1K9PA 1YUUA 4YGCB 2ZRSA 3EK7A 1S36A 5HYDA 1OMVA 1MUXA 2COLB 3PFVA 4NDDA 1BLQA 1U5IA 1CM1A 1K9KA 4BY5A 1Y1UA 2O5GA 1XK4C 2MAZA 1KQVA 4MBEA 2JULA 2WCFA 1V1FA 4N1GA 4UPGA 1IKUA 2KI6D 1LINA 2KAVA 4GGFC 4HRGA 5I2QA 1MR8A 1ZACA 1FF1A 1NCZA 1CMGA 4A4CA 4ORCB 2JNFA 5CPVA 3BOWA 4YI8A 2SASA 1TNQA 3WHTB 4HSZA 1R6PA 1ODBA 2LMVA 2WC8A 3EVRA 5HLOA 2JC2A 1AJ4A 3FWBA 5G08A 4M2OA 4PE0A 1K96A 1FBVA 3JTDC 3AKBA 1NSHA 1PSBA 2K2FA 3H4SE 1AJ5A 1TNPA 3PALA 4MZJA 2FJUB 1ALWA 1DJIA 1S5GZ 2KFFA 5KSZA 1TCFA 2CBLA 3JVTC 3JVTB 1TNXA 1SKTA 1XVJA 1PRWA 2TN4A 3SG7A 1DT7B 1IGVA 1A29A 1CFDA 2M1KB 3NSKA 1JFJA 2HETA 1YTZC 1XK4A 2EC6C 2F33A 2M7LA 1M63B 1QATA 3VROA 1J1EA 1M46A 1F71A 3RLZA 2QPTA 1HT9A 2K61A 5JOLA 3BYAA 2NZ0A 1QS7A 3OP0A 4CIDA 1CDMA 3OB2B 2FCDA 1KFXS 2JXLA 3OX5A 1MXLC 3I5GC 1FI6A 1WRLA 3ZWHA 4GGFA 2NCOA 3WXAA 2M3WA 2Q91A 2D8NA 3WHUB 2B1UA 1B1GA 3I5IC 4JQ0D 1IH0A 1AUIB 1QVIY 1JWDA 3MSEB 1XFYO 4AQJA 1S26D 1GJYA 1JF0A 3D0YA 2H2KA 2ZNEA 2AMIA 4A4BA 2LP2A 1BU3A 4PHKA 4MRXA 2EHBA 1OQPA 2BE4A 2H61C 1BJFA 4PALA 1XFWO 5KU1A 3E3RA 1YUTA 3I5FB 1S6JA 3IQQA 1KK7Y 3NSLA 2R2IA 2WNDA 2CCMA 3BOWB 2L50A 1TTXA 4PE7A 4P2YB 3EK4A 1NCYA 4GFTA 1YX8A 1EG3A 2BE6A 2LP3A 3F45A 2L0PA 1F55A 1X02A 5I2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U8D A;  3I5H C;  5KTY A;  2JT0 A;  1A75 B;  1RRO A;  2IS9 A;  4DIR A;  1UHJ A;  3I5F C;  1L7Z A;  5IBW A;  1NP8 A;  4YGE B;  3GK4 X;  3RM1 A;  3WNX B;  1TN4 A;  2KQY A;  2L4H A;  1WRZ A;  2KYC A;  1RJV A;  2JPT A;  2K7O A;  4N5X A;  1EXR A;  2WOS A;  4JPZ B;  3BXK A;  4MN0 A;  5CSI A;  4PHM A;  1DJH A;  4F0Z B;  1DJG A;  2F8P A;  2JQ6 A;  1WRK A;  1NPQ A;  1FPW A;  3DD4 A;  1G33 A;  4YGA A;  2LHI A;  2RGI A;  1F70 A;  1SR6 C;  2KDH A;  4ETO A;  4JWQ A;  1KK8 B;  1M31 A;  1M39 A;  3ZNI A;  1SBJ A;  2LM5 A;  1LXF C;  2KFH A;  1KFU L;  1SPY A;  1QLS A;  2MLE C;  3FIA A;  2K7B A;  4IL1 A;  1SNL A;  1B8C A;  1R2U A;  4NDB A;  4PE4 A;  2LUC A;  2V53 A;  1UHK A;  4PHN A;  5GQQ C;  3CGA A;  3SG5 A;  1AK8 A;  1B7T Y;  1UP5 A;  1PUL A;  1BOD A;  2PAS A;  2K7C A;  3OHM B;  2PVB A;  1YVL A;  2ISD A;  4PDZ A;  1SY9 A;  1CLM A;  1CDP A;  1QX7 A;  5DKR A;  1J7Q A;  2KI6 C;  1BF5 A;  1B4C A;  5HKY A;  4CFQ A;  2MJW B;  1E8A A;  1LA0 A;  2KI4 B;  1TRF A;  3GOF A;  1YRU B;  2KI4 C;  2SCP A;  2LVK A;  1H8B A;  3VRQ A;  1TCO B;  1CLB A;  1UUS A;  1SR6 B;  1NX2 A;  3SG2 A;  3VRR A;  1SK6 D;  1AP4 A;  2JXC A;  1EH2 A;  1EJ3 A;  1L2O C;  5AXI A;  1SRA A;  4GAO A;  3NSO A;  3PM8 A;  5FYX A;  4PHJ A;  1MXE A;  2AAO A;  3NSI A;  1IJ6 A;  3DF0 A;  1CFC A;  4CLN A;  4NQG A;  5AER A;  1SCV A;  1W7I B;  3KPX A;  3PN7 B;  1L2O B;  2LV7 A;  1NX1 A;  3BUO B;  2O60 A;  2ZN8 A;  4HRE E;  1Q80 A;  3I5I B;  1ALV A;  2BEC A;  1C7V A;  2LHL A;  1CFP A;  3VGO A;  1K90 D;  3SG3 A;  1YVH A;  2VRG A;  1H4B A;  3CWG A;  5CSN A;  1DVI A;  4OV2 A;  1VRK A;  2BCX A;  4CFR A;  4M2P A;  1BT6 A;  4I5J A;  2HF5 A;  1G8I A;  1XFU O;  5ER4 X;  1BOC A;  1K95 A;  2JTT A;  2OS8 C;  2KBI A;  1SW8 A;  4XYN A;  1CTR A;  2M49 B;  4MEW A;  2E30 A;  5JJG A;  2HQ8 A;  1SL9 A;  2WCB A;  1KFX L;  4OR9 B;  1SMG A;  3A8R A;  2JTZ A;  2FCE A;  3CR5 X;  4C0L A;  1DMO A;  1XFZ O;  2I18 A;  1UHI A;  3DVE A;  5I8N A;  2F2O A;  1NYA A;  1KWO B;  2MBX A;  2KNE A;  3I5G B;  4ZCV A;  1FI5 A;  3TUY B;  2L2E A;  1M45 A;  1K93 D;  1NX3 A;  1JBA A;  3SJS A;  3TS5 B;  2QAC A;  4YGB B;  2JT8 A;  3AKA A;  1BMO A;  1J55 A;  1GQM A;  1JSA A;  2G9B A;  2WCE A;  2L4I A;  2AUC A;  1K9U A;  1MHO A;  1QIV A;  1REC A;  2LVJ A;  3EK8 A;  4WQ2 A;  2A4J A;  1YUS A;  1XO5 A;  1Y1X A;  2CT9 A;  5CSF A;  1CLL A;  3SG6 A;  2LAP A;  2JRF A;  4C0J A;  3EVV A;  4MVF A;  2BBN A;  1AHR A;  1JUO A;  1XA5 A;  1IJ5 A;  1N2D A;  1OOJ A;  3O6B A;  4GNK B;  4M2Q A;  1ZFS A;  2EC6 B;  1CB1 A;  3VRN A;  2LLS A;  2LLU A;  1KCY A;  1NX0 A;  5J3X A;  2KAY A;  5AEQ A;  3M0W A;  2K2A A;  4D1E A;  3I5H B;  3DVJ A;  1WDC C;  1KSO A;  1WLZ A;  4USL A;  1BR1 B;  3KF9 A;  3CR2 A;  2GGM A;  3OB1 B;  3TDU A;  3ICB A;  4OCI A;  2HPS A;  1RTP 1;  1NIW A;  1IG5 A;  1SYM A;  3KO0 A;  4AQI A;  5CSJ A;  4QJ4 B;  5DKQ A;  1JF2 A;  1F4O A;  2NXQ A;  2FOT A;  1DJZ A;  3QRX A;  2Y1M A;  3LCP C;  2JWW A;  4DS7 A;  1MF8 B;  2LE9 B;  1DGU A;  1QXP A;  5D69 A;  4GUK A;  1K8U A;  4GGN A;  5HKW A;  5BPJ A;  2I7A A;  1EL4 A;  3O78 A;  3KEV A;  4QJ3 B;  1A03 A;  3KHE A;  2KSP A;  3LK1 A;  3PSR A;  2M0R A;  4HRH A;  2F3Y A;  5D7F A;  1A2X A;  1QV1 A;  2Q4U A;  3DF0 B;  2WOR A;  1JFK A;  2LMT A;  3CZT X;  3PN7 C;  4XJK B;  4YI9 A;  4BY4 A;  1GGW A;  1B7T Z;  1YR5 A;  5F6T A;  1TNW A;  2KOT A;  2L51 A;  1QX5 B;  4ORB B;  1LKJ A;  3O4Y A;  1OZO A;  1DF0 B;  4ZCU A;  3TS5 C;  1CFF A;  1ZOT B;  2BKI B;  1Y6W A;  2NCP A;  3CTN A;  1S1E A;  2KQ6 A;  3PLF B;  1PK0 D;  2Y1N A;  2L98 A;  2PAL A;  1OE9 B;  2OTG C;  3DVK A;  1SL7 A;  1UHN A;  1IRJ A;  2ZKM X;  4QJ5 B;  4GPL B;  2Y4Q A;  3AAJ A;  1FW4 A;  1KFU S;  1RWY A;  2MHH A;  2M9G A;  1TIZ A;  1DJW A;  1UWO A;  3BUW B;  1LVC D;  2JT3 A;  4L9M A;  5B8I B;  1QJT A;  2LAN A;  1UUR A;  5AAN A;  1RK9 A;  1CKK A;  4C0K A;  2LVI A;  1B9A A;  1GGZ A;  1SCM B;  1HQV A;  5HKZ A;  1SCM C;  2ZN9 A;  3BUN B;  1K94 A;  4MSP A;  2KGB C;  2LLT A;  3CLN A;  2F3Z A;  2JU0 A;  1D1O A;  2KHN A;  1S3P A;  4PE1 A;  1PAL A;  3JTD B;  1RFJ A;  2I94 A;  2K0J A;  3BQ3 A;  5ER5 A;  4I5K A;  2CTN A;  4DCK A;  4I5L B;  2OPO A;  1PSR A;  3NXA A;  4YBH B;  1C7W A;  3OX6 A;  1J7R A;  1WLM A;  4MZL A;  3A4U B;  2M8U A;  1MQ1 A;  1OMD A;  2H61 A;  3SG4 A;  3EKH A;  1EG4 A;  1NUB A;  2KFG A;  4TNC A;  1N0Y A;  4CPV A;  3D0Y B;  1Y0V H;  1ZUZ A;  3EKJ A;  1CDL A;  4E68 A;  3C1V A;  4GBA A;  1AVS A;  1MWN A;  1NWD A;  2LVV A;  2PMY A;  3IQO A;  3AAK A;  3FWC A;  2KYF A;  3GK2 A;  1Y1A A;  1U5I B;  3CS1 A;  1QAS A;  3LLE A;  1XFX O;  3GK1 A;  1QX2 A;  3VRP A;  1JC2 A;  1ZMZ A;  1QVI Z;  4P5O E;  1WY9 A;  1DTL A;  2ZND A;  1QLK A;  3HCM A;  1S6C A;  2CNP A;  2JNX A;  1BR4 B;  2K7D A;  2LMU A;  1W7J B;  2E6W A;  3LL8 B;  1V1G A;  5TNC A;  1QV0 A;  3EVU A;  3TZ1 A;  3TDI A;  4R1E A;  5HLV A;  3SIA A;  1KQM B;  3PAT A;  4PCW A;  1A75 A;  1KWO C;  3LK0 A;  1DJY A;  2F2P A;  1DGV A;  2ZRT A;  4N1F A;  1KK7 Z;  2M97 A;  1YRT B;  2KAX A;  1F4Q A;  4OVN F;  1CM4 A;  4OKH A;  1N65 A;  4XJK A;  1OSA A;  2KGR A;  4Q04 A;  2K8M B;  2G2B A;  2KBM A;  2HQW A;  1YX7 A;  2NLN A;  4WQ3 A;  3FS7 A;  2OTG B;  1KQM C;  4FTG A;  2M7N A;  2BL0 C;  4I5N B;  1DF0 A;  3O2P A;  1S5G Y;  2GGZ A;  3BUX B;  1BG1 A;  3CR4 X;  3IF7 A;  1C07 A;  1IWQ A;  2LUX A;  5AFP A;  4DRW A;  2BCA A;  4YGD B;  2PRU A;  2LC5 A;  4ORA B;  2PSR A;  4WRI A;  2MLF C;  1LA3 A;  1PVB A;  1G4Y R;  1XFV O;  4ICB A;  1CMF A;  2CXJ A;  4FQO A;  2Y5I A;  1NCX A;  2JOJ A;  1XYD A;  2BL0 B;  3TUY C;  5I2O A;  1J7P A;  1IQ3 A;  4YRU A;  1QTX A;  1S6I A;  2BBM A;  1KSM A;  1B8L A;  3HX4 A;  1OZS A;  2DOQ A;  2M1U A;  3K21 A;  5K89 A;  5PAL A;  2BCB A;  2L5X B;  2M29 A;  1WDC B;  1J7O A;  3TDZ A;  2LNK A;  5DKN A;  2EGD A;  4AOM A;  1J1D A;  4NDC A;  2OS8 B;  3SIB A;  1IQ5 A;  2MRD A;  1CNP A;  1OMR A;  2I2R E;  3D10 A;  3BUM B;  1A4P A;  1YUR A;  2LCP A;  3DVM A;  1PVA A;  1CDN A;  1DJX A;  4DUQ A;  4MLW A;  2BKH B;  1B47 A;  4MRY A;  1F54 A;  1K2H A;  1SL8 A;  1KK8 C;  1UHH A;  2MA2 A;  1QIW A;  1B8R A;  2JZI A;  4MZK A;  2GV5 A;  2P6B B;  1TOP A;  2ZFD A;  1F8H A;  1K9P A;  1YUU A;  4YGC B;  2ZRS A;  3EK7 A;  1S36 A;  5HYD A;  1OMV A;  1MUX A;  2COL B;  3PFV A;  4NDD A;  1BLQ A;  1U5I A;  1CM1 A;  1K9K A;  4BY5 A;  1Y1U A;  2O5G A;  1XK4 C;  2MAZ A;  1KQV A;  4MBE A;  2JUL A;  2WCF A;  1V1F A;  4N1G A;  4UPG A;  1IKU A;  2KI6 D;  1LIN A;  2KAV A;  4GGF C;  4HRG A;  5I2Q A;  1MR8 A;  1ZAC A;  1FF1 A;  1NCZ A;  1CMG A;  4A4C A;  4ORC B;  2JNF A;  5CPV A;  3BOW A;  4YI8 A;  2SAS A;  1TNQ A;  3WHT B;  4HSZ A;  1R6P A;  1ODB A;  2LMV A;  2WC8 A;  3EVR A;  5HLO A;  2JC2 A;  1AJ4 A;  3FWB A;  5G08 A;  4M2O A;  4PE0 A;  1K96 A;  1FBV A;  3JTD C;  3AKB A;  1NSH A;  1PSB A;  2K2F A;  3H4S E;  1AJ5 A;  1TNP A;  3PAL A;  4MZJ A;  2FJU B;  1ALW A;  1DJI A;  1S5G Z;  2KFF A;  5KSZ A;  1TCF A;  2CBL A;  3JVT C;  3JVT B;  1TNX A;  1SKT A;  1XVJ A;  1PRW A;  2TN4 A;  3SG7 A;  1DT7 B;  1IGV A;  1A29 A;  1CFD A;  2M1K B;  3NSK A;  1JFJ A;  2HET A;  1YTZ C;  1XK4 A;  2EC6 C;  2F33 A;  2M7L A;  1M63 B;  1QAT A;  3VRO A;  1J1E A;  1M46 A;  1F71 A;  3RLZ A;  2QPT A;  1HT9 A;  2K61 A;  5JOL A;  3BYA A;  2NZ0 A;  1QS7 A;  3OP0 A;  4CID A;  1CDM A;  3OB2 B;  2FCD A;  1KFX S;  2JXL A;  3OX5 A;  1MXL C;  3I5G C;  1FI6 A;  1WRL A;  3ZWH A;  4GGF A;  2NCO A;  3WXA A;  2M3W A;  2Q91 A;  2D8N A;  3WHU B;  2B1U A;  1B1G A;  3I5I C;  4JQ0 D;  1IH0 A;  1AUI B;  1QVI Y;  1JWD A;  3MSE B;  1XFY O;  4AQJ A;  1S26 D;  1GJY A;  1JF0 A;  3D0Y A;  2H2K A;  2ZNE A;  2AMI A;  4A4B A;  2LP2 A;  1BU3 A;  4PHK A;  4MRX A;  2EHB A;  1OQP A;  2BE4 A;  2H61 C;  1BJF A;  4PAL A;  1XFW O;  5KU1 A;  3E3R A;  1YUT A;  3I5F B;  1S6J A;  3IQQ A;  1KK7 Y;  3NSL A;  2R2I A;  2WND A;  2CCM A;  3BOW B;  2L50 A;  1TTX A;  4PE7 A;  4P2Y B;  3EK4 A;  1NCY A;  4GFT A;  1YX8 A;  1EG3 A;  2BE6 A;  2LP3 A;  3F45 A;  2L0P A;  1F55 A;  1X02 A;  5I2L A; 
#chains in the Genus database with same CATH topology
 4U8D A;  3I5H C;  5KTY A;  2JT0 A;  1A75 B;  1RRO A;  1DQE A;  2IS9 A;  4DIR A;  1UHJ A;  3I5F C;  1L7Z A;  5IBW A;  3CDN A;  1NP8 A;  4YGE B;  3GK4 X;  1LS8 A;  3RM1 A;  3WNX B;  1TN4 A;  2KQY A;  2L4H A;  1WRZ A;  2KYC A;  1RJV A;  2JPT A;  1GM0 A;  2K7O A;  4N5X A;  1EXR A;  2WOS A;  4JPZ B;  3BXK A;  4MN0 A;  4INX A;  5CSI A;  4PHM A;  1DJH A;  1P28 A;  4F0Z B;  1DJG A;  2F8P A;  2JQ6 A;  1WRK A;  1NPQ A;  1FPW A;  3DD4 A;  1G33 A;  4YGA A;  2LHI A;  2RGI A;  1F70 A;  1SR6 C;  2QEH A;  2KDH A;  2QEV A;  4ETO A;  4JWQ A;  1KK8 B;  1M31 A;  1M39 A;  3ZNI A;  3BJH A;  1SBJ A;  2LM5 A;  1LXF C;  2KFH A;  1KFU L;  1SPY A;  1QLS A;  4INW A;  2MLE C;  3FIA A;  2K7B A;  1TUZ A;  3O4X A;  2QEB A;  2ERB A;  4IL1 A;  1SNL A;  1B8C A;  1R2U A;  4NDB A;  4PE4 A;  2LUC A;  2V53 A;  1UHK A;  4PHN A;  5GQQ C;  3CGA A;  3SG5 A;  1AK8 A;  1B7T Y;  1UP5 A;  2WCK A;  1PUL A;  2P70 A;  3D75 A;  1BOD A;  2PAS A;  2K7C A;  3OHM B;  2PVB A;  1YVL A;  2ISD A;  3BFB A;  4PDZ A;  1SY9 A;  1Z2C B;  1CLM A;  1CDP A;  1QX7 A;  3DZT A;  5DKR A;  1J7Q A;  2KI6 C;  1BF5 A;  1B4C A;  5HKY A;  4CFQ A;  2MJW B;  1E8A A;  1LA0 A;  2KI4 B;  1TRF A;  3GOF A;  1YRU B;  2KI4 C;  3EG5 B;  2SCP A;  2LVK A;  1H8B A;  3VRQ A;  1TCO B;  5DIC A;  1UUS A;  1CLB A;  1SR6 B;  1NX2 A;  3SG2 A;  3VRR A;  3FE9 A;  1SK6 D;  1AP4 A;  2JXC A;  1EH2 A;  1EJ3 A;  1L2O C;  3PJI A;  5AXI A;  1SRA A;  4GAO A;  3NSO A;  3PM8 A;  3SS5 A;  2L2C A;  5FYX A;  4PHJ A;  1MXE A;  3S0F A;  2AAO A;  3NSI A;  1IJ6 A;  3DF0 A;  3BFA A;  5FI6 A;  1CFC A;  4CLN A;  4NQG A;  5AER A;  1SCV A;  1W7I B;  3KPX A;  3PN7 B;  3D78 A;  3S0B A;  1L2O B;  2LV7 A;  1NX1 A;  3BUO B;  2O60 A;  2ZN8 A;  4HRE E;  1Q80 A;  3I5I B;  1ALV A;  2BEC A;  5HL1 A;  1C7V A;  2LHL A;  1CFP A;  3VGO A;  1K90 D;  3SG3 A;  1YVH A;  2VRG A;  1H4B A;  3CWG A;  5CSN A;  1DVI A;  4OV2 A;  3BFH A;  1VRK A;  2BCX A;  4CFR A;  3D74 A;  4M2P A;  3PM2 A;  1BT6 A;  4I5J A;  2HF5 A;  1G8I A;  1XFU O;  5ER4 X;  1BOC A;  1K95 A;  2JTT A;  2OS8 C;  2KBI A;  1SW8 A;  4XYN A;  1CTR A;  2M49 B;  4MEW A;  2E30 A;  5JJG A;  2HQ8 A;  1SL9 A;  2WCB A;  1KFX L;  4OR9 B;  3RZS A;  1SMG A;  3A8R A;  2JTZ A;  2FCE A;  3CR5 X;  4C0L A;  1DMO A;  1XFZ O;  2I18 A;  1UHI A;  3DVE A;  5I8N A;  2F2O A;  1NYA A;  1KWO B;  2MBX A;  1OOG A;  2KNE A;  3I5G B;  4ZCV A;  1FI5 A;  3TUY B;  2L2E A;  1M45 A;  1K93 D;  1NX3 A;  1JBA A;  3B6X A;  3UO9 A;  3SJS A;  3TS5 B;  2QAC A;  4YGB B;  2JT8 A;  3AKA A;  1BMO A;  1J55 A;  1GQM A;  1JSA A;  2G9B A;  2WCE A;  1DC1 A;  2L4I A;  2AUC A;  1K9U A;  1MHO A;  1QIV A;  1REC A;  2LVJ A;  3EK8 A;  4WQ2 A;  5I94 A;  2A4J A;  1YUS A;  4OZD A;  1XO5 A;  1Y1X A;  2CT9 A;  5CSF A;  1CLL A;  5EL2 A;  2LAP A;  2JRF A;  3SG6 A;  4C0J A;  3EVV A;  4MVF A;  2BBN A;  1AHR A;  1JUO A;  1XA5 A;  1IJ5 A;  1N2D A;  1OOJ A;  3O6B A;  4FQT A;  3S0D A;  3L4A A;  4GNK B;  4M2Q A;  1ZFS A;  3L47 A;  2EC6 B;  3R1P A;  1CB1 A;  3VRN A;  2LLS A;  2LLU A;  1KCY A;  1NX0 A;  5J3X A;  2KAY A;  5AEQ A;  3M0W A;  2K2A A;  4KYN A;  3I5H B;  4D1E A;  4F7F A;  3DVJ A;  1WDC C;  1KSO A;  1WLZ A;  4USL A;  1BR1 B;  1T14 A;  3KF9 A;  3CR2 A;  2GGM A;  3OB1 B;  3TDU A;  3ICB A;  4OCI A;  2HPS A;  1RTP 1;  3S0E A;  1NIW A;  1IG5 A;  1SYM A;  3KO0 A;  4AQI A;  5CSJ A;  4QJ4 B;  5DKQ A;  1JF2 A;  1F4O A;  2NXQ A;  2WCH A;  2FOT A;  1DJZ A;  3QRX A;  2Y1M A;  3LCP C;  2JWW A;  3CAB A;  5D3O A;  1DEK A;  4DS7 A;  1MF8 B;  2LE9 B;  1DGU A;  1QXP A;  5D69 A;  2FJY A;  1K8U A;  1W9Z A;  3DY9 A;  4GGN A;  2I7A A;  4GUK A;  5HKW A;  5BPJ A;  1EL4 A;  3O78 A;  3KEV A;  4QJ3 B;  1DEL A;  1A03 A;  3KHE A;  2L5Y A;  2KSP A;  3LK1 A;  3PSR A;  2M0R A;  4HRH A;  2F3Y A;  5D7F A;  1A2X A;  1QV1 A;  2Q4U A;  3DF0 B;  1XFR A;  2WOR A;  2QEO A;  1JFK A;  2LMT A;  3CZT X;  3PN7 C;  4XJK B;  4YI9 A;  4BY4 A;  1GGW A;  1B7T Z;  1YR5 A;  5F6T A;  1TNW A;  2KOT A;  2L51 A;  1QX5 B;  4ORB B;  1LKJ A;  3O4Y A;  1OZO A;  1DF0 B;  4ZCU A;  2QDI A;  3TS5 C;  3CZ1 A;  1CFF A;  1ZOT B;  2BKI B;  1Y6W A;  2NCP A;  3CTN A;  1S1E A;  2KQ6 A;  3PLF B;  2K60 A;  1PK0 D;  2Y1N A;  2L98 A;  2PAL A;  1OE9 B;  2OTG C;  3CYZ A;  1Z4H A;  3DVK A;  1SL7 A;  1UHN A;  1IRJ A;  2ZKM X;  4QJ5 B;  4GPL B;  2Y4Q A;  3AAJ A;  1FW4 A;  1KFU S;  1RWY A;  2MHH A;  3B88 A;  2M9G A;  1TIZ A;  1DJW A;  1UWO A;  3BUW B;  1LVC D;  2JT3 A;  4L9M A;  5B8I B;  1ORG A;  1QJT A;  2LAN A;  1UUR A;  5AAN A;  1RK9 A;  1CKK A;  4C0K A;  2LVI A;  1B9A A;  1GGZ A;  1SCM B;  1HQV A;  5HKZ A;  1SCM C;  2ZN9 A;  3BUN B;  3R1V A;  1K94 A;  1C3Z A;  4MSP A;  2KGB C;  2LLT A;  3NHI A;  3CLN A;  2F3Z A;  2JU0 A;  1D1O A;  2KHN A;  3CZ2 A;  3N7H A;  1S3P A;  3S0A A;  2P71 A;  4PE1 A;  1PAL A;  3JTD B;  1RFJ A;  2I94 A;  2K0J A;  3BQ3 A;  5ER5 A;  4I5K A;  2CTN A;  4DCK A;  4I5L B;  2OPO A;  1PSR A;  3NXA A;  4YBH B;  1C7W A;  3OX6 A;  1J7R A;  1OOI X;  1WLM A;  4MZL A;  3A4U B;  2M8U A;  1MQ1 A;  1SSE B;  1OMD A;  2H61 A;  2JPO A;  3SG4 A;  3SS4 A;  3EKH A;  1EG4 A;  1NUB A;  3IVT A;  3QME A;  2KFG A;  4TNC A;  1N0Y A;  4CPV A;  3D0Y B;  1Y0V H;  1ZUZ A;  3EKJ A;  1CDL A;  4E68 A;  3C1V A;  4GBA A;  1AVS A;  1MWN A;  1NWD A;  2LVV A;  2PMY A;  3IQO A;  3AAK A;  3FWC A;  2KYF A;  3GK2 A;  1Y1A A;  1U5I B;  3CS1 A;  1QAS A;  3LLE A;  1XFX O;  3GK1 A;  1QX2 A;  3VRP A;  1JC2 A;  1ZMZ A;  1QVI Z;  4P5O E;  1WY9 A;  1DTL A;  2ZND A;  1QLK A;  3R1O A;  3HCM A;  1S6C A;  2CNP A;  2JNX A;  1BR4 B;  2K7D A;  2LMU A;  1W7J B;  2PYQ A;  2E6W A;  3LL8 B;  1V1G A;  5TNC A;  1QV0 A;  3EVU A;  3R72 A;  3TDI A;  3TZ1 A;  4R1E A;  5HLV A;  3SIA A;  1TWO A;  1C3Y A;  1KQM B;  3PAT A;  4PCW A;  1A75 A;  1KWO C;  3FE8 A;  3LK0 A;  1DJY A;  2F2P A;  1DGV A;  2WC5 A;  2ZRT A;  4N1F A;  1KK7 Z;  2M97 A;  2H8V A;  3D76 A;  1YRT B;  2KAX A;  1F4Q A;  4OVN F;  1CM4 A;  4OKH A;  1N65 A;  4XJK A;  1OSA A;  2KGR A;  4Q04 A;  2K8M B;  2G2B A;  2KBM A;  2HQW A;  1YX7 A;  2NLN A;  3NHT A;  4WQ3 A;  3FS7 A;  3CZ0 A;  2OTG B;  1KQM C;  4FTG A;  1TUJ A;  2M7N A;  2BL0 C;  4I5N B;  1DF0 A;  2WCL A;  3O2P A;  3S0G A;  1S5G Y;  2GGZ A;  3BUX B;  1BG1 A;  3CR4 X;  3IF7 A;  1C07 A;  2YGU A;  1IWQ A;  2LUX A;  5AFP A;  1OOF A;  2WCM A;  4DRW A;  2BCA A;  4PT1 A;  4YGD B;  2PRU A;  2LC5 A;  4ORA B;  2PSR A;  4WRI A;  2MLF C;  1LA3 A;  1PVB A;  1G4Y R;  1XFV O;  4ICB A;  1CMF A;  2CXJ A;  5FI2 A;  4FQO A;  2Y5I A;  1NCX A;  2JOJ A;  1XYD A;  2BL0 B;  2WCJ A;  5I2O A;  3TUY C;  1J7P A;  4IJ7 A;  1IQ3 A;  4YRU A;  1QTX A;  1S6I A;  2BBM A;  1KSM A;  1B8L A;  3UNW A;  3HX4 A;  1OZS A;  2DOQ A;  2M1U A;  3K21 A;  5K89 A;  5PAL A;  2BCB A;  2L5X B;  2M29 A;  1WDC B;  3DXL A;  3TDZ A;  1J7O A;  2LNK A;  5DKN A;  2EGD A;  2PQL A;  4AOM A;  2BAP A;  1J1D A;  4NDC A;  3OGN A;  2OS8 B;  3SIB A;  1IQ5 A;  2MRD A;  1CNP A;  1OMR A;  2I2R E;  3D10 A;  3BUM B;  1A4P A;  1YUR A;  2LCP A;  3DVM A;  1PVA A;  1CDN A;  1DJX A;  4DUQ A;  4MLW A;  2BKH B;  1B47 A;  4MRY A;  1F54 A;  1K2H A;  1SL8 A;  1KK8 C;  3DYE A;  3B87 A;  1UHH A;  2MA2 A;  1QIW A;  1B8R A;  2JZI A;  4MZK A;  1IIO A;  2GV5 A;  2P6B B;  1TOP A;  2ZFD A;  1F8H A;  1K9P A;  1YUU A;  4YGC B;  2ZRS A;  3EK7 A;  1S36 A;  5HYD A;  1OMV A;  1MUX A;  2COL B;  3PFV A;  3NGV A;  4NDD A;  3VB1 A;  1BLQ A;  1U5I A;  1CM1 A;  1K9K A;  4BY5 A;  1Y1U A;  2O5G A;  1XK4 C;  2MAZ A;  1KQV A;  4MBE A;  2JUL A;  2WCF A;  1V1F A;  4N1G A;  4UPG A;  1IKU A;  1OOH A;  2KI6 D;  1LIN A;  2KAV A;  4GGF C;  4HRG A;  5I2Q A;  1MR8 A;  1ZAC A;  1FF1 A;  1NCZ A;  1CMG A;  4A4C A;  4ORC B;  2JNF A;  5CPV A;  2BNX A;  3BOW A;  5FI7 A;  4YI8 A;  2SAS A;  1TNQ A;  3WHT B;  3B7A A;  4HSZ A;  1R6P A;  1ODB A;  4JD9 A;  2LMV A;  2WC8 A;  3EVR A;  5HLO A;  2JC2 A;  2KLD A;  1AJ4 A;  3FWB A;  5G08 A;  4M2O A;  4PE0 A;  1K96 A;  1FBV A;  3JTD C;  3AKB A;  1NSH A;  1PSB A;  2K2F A;  3H4S E;  1AJ5 A;  1TNP A;  3PAL A;  4MZJ A;  2FJU B;  1ALW A;  1DJI A;  1S5G Z;  2KFF A;  5KSZ A;  1TCF A;  2CBL A;  3JVT C;  3JVT B;  1TNX A;  1SKT A;  1XVJ A;  1PRW A;  2TN4 A;  3SG7 A;  3D73 A;  1IGV A;  1DT7 B;  1A29 A;  1CFD A;  2M1K B;  3NSK A;  1JFJ A;  1QWV A;  2HET A;  2KPH A;  1YTZ C;  1XK4 A;  2EC6 C;  2F33 A;  2M7L A;  1M63 B;  1QAT A;  3VRO A;  1J1E A;  1M46 A;  3D77 A;  1F71 A;  3RLZ A;  2QPT A;  3K1E A;  1HT9 A;  1OW4 A;  2K61 A;  5JOL A;  3BYA A;  2NZ0 A;  1QS7 A;  3OP0 A;  4CID A;  1CDM A;  3OB2 B;  2FCD A;  1KFX S;  2JXL A;  3OX5 A;  1MXL C;  3I5G C;  1FI6 A;  1WRL A;  3ZWH A;  4GGF A;  2NCO A;  2WC6 A;  2M3W A;  3V2L A;  2Q91 A;  2D8N A;  3WHU B;  3WXA A;  2B1U A;  1B1G A;  3I5I C;  4JQ0 D;  1IH0 A;  1AUI B;  1QVI Y;  1JWD A;  3MSE B;  1XFY O;  4AQJ A;  1S26 D;  1GJY A;  1JF0 A;  3D0Y A;  2H2K A;  2ZNE A;  2AMI A;  4A4B A;  3SS3 A;  3OBV A;  4JKT A;  2LP2 A;  3Q8I A;  1BU3 A;  4PHK A;  4MRX A;  2EHB A;  1OQP A;  2BE4 A;  2H61 C;  1BJF A;  3L4L A;  4PAL A;  1XFW O;  5KU1 A;  3E3R A;  1YUT A;  3I5F B;  1S6J A;  3IQQ A;  1KK7 Y;  3NSL A;  2R2I A;  2WND A;  2CCM A;  3BOW B;  2KLE A;  2L50 A;  1TTX A;  2GTE A;  4PE7 A;  4P2Y B;  3EK4 A;  1NCY A;  3FE6 A;  1YX8 A;  4GFT A;  1EG3 A;  2BE6 A;  2LP3 A;  3F45 A;  2L0P A;  1F55 A;  1X02 A;  3B86 A;  5I2L A; 
#chains in the Genus database with same CATH homology
 4U8D A;  3I5H C;  5KTY A;  2JT0 A;  1A75 B;  1RRO A;  2IS9 A;  4DIR A;  1UHJ A;  3I5F C;  1L7Z A;  5IBW A;  1NP8 A;  4YGE B;  3GK4 X;  3RM1 A;  3WNX B;  1TN4 A;  2KQY A;  2L4H A;  1WRZ A;  2KYC A;  1RJV A;  2JPT A;  2K7O A;  4N5X A;  1EXR A;  2WOS A;  4JPZ B;  3BXK A;  4MN0 A;  5CSI A;  4PHM A;  1DJH A;  4F0Z B;  1DJG A;  2F8P A;  2JQ6 A;  1WRK A;  1NPQ A;  1FPW A;  3DD4 A;  1G33 A;  4YGA A;  2LHI A;  2RGI A;  1F70 A;  1SR6 C;  2KDH A;  4ETO A;  4JWQ A;  1KK8 B;  1M31 A;  1M39 A;  3ZNI A;  1SBJ A;  2LM5 A;  1LXF C;  2KFH A;  1KFU L;  1SPY A;  1QLS A;  2MLE C;  3FIA A;  2K7B A;  4IL1 A;  1SNL A;  1B8C A;  1R2U A;  4NDB A;  4PE4 A;  2LUC A;  2V53 A;  1UHK A;  4PHN A;  5GQQ C;  3CGA A;  3SG5 A;  1AK8 A;  1B7T Y;  1UP5 A;  1PUL A;  1BOD A;  2PAS A;  2K7C A;  3OHM B;  2PVB A;  1YVL A;  2ISD A;  4PDZ A;  1SY9 A;  1CLM A;  1CDP A;  1QX7 A;  5DKR A;  1J7Q A;  2KI6 C;  1BF5 A;  1B4C A;  5HKY A;  4CFQ A;  2MJW B;  1E8A A;  1LA0 A;  2KI4 B;  1TRF A;  3GOF A;  1YRU B;  2KI4 C;  2SCP A;  2LVK A;  1H8B A;  3VRQ A;  1TCO B;  1CLB A;  1UUS A;  1SR6 B;  1NX2 A;  3SG2 A;  3VRR A;  1SK6 D;  1AP4 A;  2JXC A;  1EH2 A;  1EJ3 A;  1L2O C;  5AXI A;  1SRA A;  4GAO A;  3NSO A;  3PM8 A;  5FYX A;  4PHJ A;  1MXE A;  2AAO A;  3NSI A;  1IJ6 A;  3DF0 A;  1CFC A;  4CLN A;  4NQG A;  5AER A;  1SCV A;  1W7I B;  3KPX A;  3PN7 B;  1L2O B;  2LV7 A;  1NX1 A;  3BUO B;  2O60 A;  2ZN8 A;  4HRE E;  1Q80 A;  3I5I B;  1ALV A;  2BEC A;  1C7V A;  2LHL A;  1CFP A;  3VGO A;  1K90 D;  3SG3 A;  1YVH A;  2VRG A;  1H4B A;  3CWG A;  5CSN A;  1DVI A;  4OV2 A;  1VRK A;  2BCX A;  4CFR A;  4M2P A;  1BT6 A;  4I5J A;  2HF5 A;  1G8I A;  1XFU O;  5ER4 X;  1BOC A;  1K95 A;  2JTT A;  2OS8 C;  2KBI A;  1SW8 A;  4XYN A;  1CTR A;  2M49 B;  4MEW A;  2E30 A;  5JJG A;  2HQ8 A;  1SL9 A;  2WCB A;  1KFX L;  4OR9 B;  1SMG A;  3A8R A;  2JTZ A;  2FCE A;  3CR5 X;  4C0L A;  1DMO A;  1XFZ O;  2I18 A;  1UHI A;  3DVE A;  5I8N A;  2F2O A;  1NYA A;  1KWO B;  2MBX A;  2KNE A;  3I5G B;  4ZCV A;  1FI5 A;  3TUY B;  2L2E A;  1M45 A;  1K93 D;  1NX3 A;  1JBA A;  3SJS A;  3TS5 B;  2QAC A;  4YGB B;  2JT8 A;  3AKA A;  1BMO A;  1J55 A;  1GQM A;  1JSA A;  2G9B A;  2WCE A;  2L4I A;  2AUC A;  1K9U A;  1MHO A;  1QIV A;  1REC A;  2LVJ A;  3EK8 A;  4WQ2 A;  2A4J A;  1YUS A;  1XO5 A;  1Y1X A;  2CT9 A;  5CSF A;  1CLL A;  3SG6 A;  2LAP A;  2JRF A;  4C0J A;  3EVV A;  4MVF A;  2BBN A;  1AHR A;  1JUO A;  1XA5 A;  1IJ5 A;  1N2D A;  1OOJ A;  3O6B A;  4GNK B;  4M2Q A;  1ZFS A;  2EC6 B;  1CB1 A;  3VRN A;  2LLS A;  2LLU A;  1KCY A;  1NX0 A;  5J3X A;  2KAY A;  5AEQ A;  3M0W A;  2K2A A;  4D1E A;  3I5H B;  3DVJ A;  1WDC C;  1KSO A;  1WLZ A;  4USL A;  1BR1 B;  3KF9 A;  3CR2 A;  2GGM A;  3OB1 B;  3TDU A;  3ICB A;  4OCI A;  2HPS A;  1RTP 1;  1NIW A;  1IG5 A;  1SYM A;  3KO0 A;  4AQI A;  5CSJ A;  4QJ4 B;  5DKQ A;  1JF2 A;  1F4O A;  2NXQ A;  2FOT A;  1DJZ A;  3QRX A;  2Y1M A;  3LCP C;  2JWW A;  4DS7 A;  1MF8 B;  2LE9 B;  1DGU A;  1QXP A;  5D69 A;  4GUK A;  1K8U A;  4GGN A;  5HKW A;  5BPJ A;  2I7A A;  1EL4 A;  3O78 A;  3KEV A;  4QJ3 B;  1A03 A;  3KHE A;  2KSP A;  3LK1 A;  3PSR A;  2M0R A;  4HRH A;  2F3Y A;  5D7F A;  1A2X A;  1QV1 A;  2Q4U A;  3DF0 B;  2WOR A;  1JFK A;  2LMT A;  3CZT X;  3PN7 C;  4XJK B;  4YI9 A;  4BY4 A;  1GGW A;  1B7T Z;  1YR5 A;  5F6T A;  1TNW A;  2KOT A;  2L51 A;  1QX5 B;  4ORB B;  1LKJ A;  3O4Y A;  1OZO A;  1DF0 B;  4ZCU A;  3TS5 C;  1CFF A;  1ZOT B;  2BKI B;  1Y6W A;  2NCP A;  3CTN A;  1S1E A;  2KQ6 A;  3PLF B;  1PK0 D;  2Y1N A;  2L98 A;  2PAL A;  1OE9 B;  2OTG C;  3DVK A;  1SL7 A;  1UHN A;  1IRJ A;  2ZKM X;  4QJ5 B;  4GPL B;  2Y4Q A;  3AAJ A;  1FW4 A;  1KFU S;  1RWY A;  2MHH A;  2M9G A;  1TIZ A;  1DJW A;  1UWO A;  3BUW B;  1LVC D;  2JT3 A;  4L9M A;  5B8I B;  1QJT A;  2LAN A;  1UUR A;  5AAN A;  1RK9 A;  1CKK A;  4C0K A;  2LVI A;  1B9A A;  1GGZ A;  1SCM B;  1HQV A;  5HKZ A;  1SCM C;  2ZN9 A;  3BUN B;  1K94 A;  4MSP A;  2KGB C;  2LLT A;  3CLN A;  2F3Z A;  2JU0 A;  1D1O A;  2KHN A;  1S3P A;  4PE1 A;  1PAL A;  3JTD B;  1RFJ A;  2I94 A;  2K0J A;  3BQ3 A;  5ER5 A;  4I5K A;  2CTN A;  4DCK A;  4I5L B;  2OPO A;  1PSR A;  3NXA A;  4YBH B;  1C7W A;  3OX6 A;  1J7R A;  1WLM A;  4MZL A;  3A4U B;  2M8U A;  1MQ1 A;  1OMD A;  2H61 A;  3SG4 A;  3EKH A;  1EG4 A;  1NUB A;  2KFG A;  4TNC A;  1N0Y A;  4CPV A;  3D0Y B;  1Y0V H;  1ZUZ A;  3EKJ A;  1CDL A;  4E68 A;  3C1V A;  4GBA A;  1AVS A;  1MWN A;  1NWD A;  2LVV A;  2PMY A;  3IQO A;  3AAK A;  3FWC A;  2KYF A;  3GK2 A;  1Y1A A;  1U5I B;  3CS1 A;  1QAS A;  3LLE A;  1XFX O;  3GK1 A;  1QX2 A;  3VRP A;  1JC2 A;  1ZMZ A;  1QVI Z;  4P5O E;  1WY9 A;  1DTL A;  2ZND A;  1QLK A;  3HCM A;  1S6C A;  2CNP A;  2JNX A;  1BR4 B;  2K7D A;  2LMU A;  1W7J B;  2E6W A;  3LL8 B;  1V1G A;  5TNC A;  1QV0 A;  3EVU A;  3TZ1 A;  3TDI A;  4R1E A;  5HLV A;  3SIA A;  1KQM B;  3PAT A;  4PCW A;  1A75 A;  1KWO C;  3LK0 A;  1DJY A;  2F2P A;  1DGV A;  2ZRT A;  4N1F A;  1KK7 Z;  2M97 A;  1YRT B;  2KAX A;  1F4Q A;  4OVN F;  1CM4 A;  4OKH A;  1N65 A;  4XJK A;  1OSA A;  2KGR A;  4Q04 A;  2K8M B;  2G2B A;  2KBM A;  2HQW A;  1YX7 A;  2NLN A;  4WQ3 A;  3FS7 A;  2OTG B;  1KQM C;  4FTG A;  2M7N A;  2BL0 C;  4I5N B;  1DF0 A;  3O2P A;  1S5G Y;  2GGZ A;  3BUX B;  1BG1 A;  3CR4 X;  3IF7 A;  1C07 A;  1IWQ A;  2LUX A;  5AFP A;  4DRW A;  2BCA A;  4YGD B;  2PRU A;  2LC5 A;  4ORA B;  2PSR A;  4WRI A;  2MLF C;  1LA3 A;  1PVB A;  1G4Y R;  1XFV O;  4ICB A;  1CMF A;  2CXJ A;  4FQO A;  2Y5I A;  1NCX A;  2JOJ A;  1XYD A;  2BL0 B;  3TUY C;  5I2O A;  1J7P A;  1IQ3 A;  4YRU A;  1QTX A;  1S6I A;  2BBM A;  1KSM A;  1B8L A;  3HX4 A;  1OZS A;  2DOQ A;  2M1U A;  3K21 A;  5K89 A;  5PAL A;  2BCB A;  2L5X B;  2M29 A;  1WDC B;  1J7O A;  3TDZ A;  2LNK A;  5DKN A;  2EGD A;  4AOM A;  1J1D A;  4NDC A;  2OS8 B;  3SIB A;  1IQ5 A;  2MRD A;  1CNP A;  1OMR A;  2I2R E;  3D10 A;  3BUM B;  1A4P A;  1YUR A;  2LCP A;  3DVM A;  1PVA A;  1CDN A;  1DJX A;  4DUQ A;  4MLW A;  2BKH B;  1B47 A;  4MRY A;  1F54 A;  1K2H A;  1SL8 A;  1KK8 C;  1UHH A;  2MA2 A;  1QIW A;  1B8R A;  2JZI A;  4MZK A;  2GV5 A;  2P6B B;  1TOP A;  2ZFD A;  1F8H A;  1K9P A;  1YUU A;  4YGC B;  2ZRS A;  3EK7 A;  1S36 A;  5HYD A;  1OMV A;  1MUX A;  2COL B;  3PFV A;  4NDD A;  1BLQ A;  1U5I A;  1CM1 A;  1K9K A;  4BY5 A;  1Y1U A;  2O5G A;  1XK4 C;  2MAZ A;  1KQV A;  4MBE A;  2JUL A;  2WCF A;  1V1F A;  4N1G A;  4UPG A;  1IKU A;  2KI6 D;  1LIN A;  2KAV A;  4GGF C;  4HRG A;  5I2Q A;  1MR8 A;  1ZAC A;  1FF1 A;  1NCZ A;  1CMG A;  4A4C A;  4ORC B;  2JNF A;  5CPV A;  3BOW A;  4YI8 A;  2SAS A;  1TNQ A;  3WHT B;  4HSZ A;  1R6P A;  1ODB A;  2LMV A;  2WC8 A;  3EVR A;  5HLO A;  2JC2 A;  1AJ4 A;  3FWB A;  5G08 A;  4M2O A;  4PE0 A;  1K96 A;  1FBV A;  3JTD C;  3AKB A;  1NSH A;  1PSB A;  2K2F A;  3H4S E;  1AJ5 A;  1TNP A;  3PAL A;  4MZJ A;  2FJU B;  1ALW A;  1DJI A;  1S5G Z;  2KFF A;  5KSZ A;  1TCF A;  2CBL A;  3JVT C;  3JVT B;  1TNX A;  1SKT A;  1XVJ A;  1PRW A;  2TN4 A;  3SG7 A;  1DT7 B;  1IGV A;  1A29 A;  1CFD A;  2M1K B;  3NSK A;  1JFJ A;  2HET A;  1YTZ C;  1XK4 A;  2EC6 C;  2F33 A;  2M7L A;  1M63 B;  1QAT A;  3VRO A;  1J1E A;  1M46 A;  1F71 A;  3RLZ A;  2QPT A;  1HT9 A;  2K61 A;  5JOL A;  3BYA A;  2NZ0 A;  1QS7 A;  3OP0 A;  4CID A;  1CDM A;  3OB2 B;  2FCD A;  1KFX S;  2JXL A;  3OX5 A;  1MXL C;  3I5G C;  1FI6 A;  1WRL A;  3ZWH A;  4GGF A;  2NCO A;  3WXA A;  2M3W A;  2Q91 A;  2D8N A;  3WHU B;  2B1U A;  1B1G A;  3I5I C;  4JQ0 D;  1IH0 A;  1AUI B;  1QVI Y;  1JWD A;  3MSE B;  1XFY O;  4AQJ A;  1S26 D;  1GJY A;  1JF0 A;  3D0Y A;  2H2K A;  2ZNE A;  2AMI A;  4A4B A;  2LP2 A;  1BU3 A;  4PHK A;  4MRX A;  2EHB A;  1OQP A;  2BE4 A;  2H61 C;  1BJF A;  4PAL A;  1XFW O;  5KU1 A;  3E3R A;  1YUT A;  3I5F B;  1S6J A;  3IQQ A;  1KK7 Y;  3NSL A;  2R2I A;  2WND A;  2CCM A;  3BOW B;  2L50 A;  1TTX A;  4PE7 A;  4P2Y B;  3EK4 A;  1NCY A;  4GFT A;  1YX8 A;  1EG3 A;  2BE6 A;  2LP3 A;  3F45 A;  2L0P A;  1F55 A;  1X02 A;  5I2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...