1SSEB

Solution structure of the oxidized form of the yap1 redox domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
NGSSLQNADKINNGNDNDNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription activator
molecule keywords AP-1 like transcription factor YAP1
publication title Structural basis for redox regulation of Yap1 transcription factor localization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.100 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 YAP1 redox domain. Chain B 1sseB00
1SSEB
chains in the Genus database with same CATH superfamily
1FI5A 1XK4A 1ZFSA 4C0LA 1JF0A 3D0YB 3IQOA 1K94A 2P6BB 1QTXA 2BKHB 2K61A 3I5IC 4I5NB 4PE4A 1SY9A 1WRKA 1BJFA 1KSOA 1DQEA 2JXLA 2HETA 5KSZA 4ORCB 2NLNA 1ZOTB 1UUSA 1AJ4A 3NSKA 4AOMA 4BY5A 2ZNEA 2KFFA 3NXAA 3SJSA 3UO9A 4CFQA 1QASA 4OKHA 3DVEA 2JC2A 4PHNA 3S0FA 1JUOA 3FWBA 2JPOA 1R2UA 4N5XA 1RTP1 2F3YA 1Y6WA 5I8NA 1ALVA 2NZ0A 1OW4A 3DY9A 2LMUA 3DXLA 1WDCB 4MSPA 4OCIA 4UPGA 1J7PA 1SR6C 3B6XA 3FWCA 1QX5B 2HF5A 3RLZA 4C0KA 1YUSA 1S5GY 1KSMA 5IBWA 1SKTA 4D1EA 3R72A 1WY9A 2E30A 2WCLA 3S0GA 3EVVA 2M1KB 2AUCA 3ZNIA 4WQ2A 1FPWA 3I5GB 3JTDC 3B7AA 1TCFA 3SIAA 5HLVA 3O4XA 2MLFC 2OTGC 2MAZA 2ZNDA 1KK7Z 4TNCA 2LLTA 2ZRTA 3AKAA 4YGAA 5HLOA 3BUMB 3K21A 2LVVA 5GQQC 1V1FA 2LUCA 3I5FB 2JWWA 4QJ3B 4OV2A 2KYFA 1ZACA 5DICA 3DYEA 3UNWA 1G4YR 1SNLA 1VRKA 3FE8A 5EL2A 1JWDA 3OX5A 4MZLA 2MLEC 3SG7A 1SMGA 1B1GA 1DGVA 3ZWHA 2DOQA 1SCMB 3SS4A 1NIWA 2L98A 1CTRA 1JFKA 1TNWA 1W7IB 3D78A 4A4CA 2HQWA 1CDNA 1PVBA 1YR5A 1NCXA 3HCMA 1OOIX 1C7VA 1OZOA 1D1OA 1KQMC 1XFWO 1ODBA 1MQ1A 2CNPA 2JNFA 2E6WA 1QV1A 3D10A 3A8RA 1Z4HA 4XJKB 1CMFA 1EG4A 1IH0A 1BF5A 3SS3A 2K60A 4QJ4B 1C3ZA 3I5GC 3BJHA 1MF8B 1C07A 2H2KA 2LHIA 3PALA 4JD9A 1N65A 1QLKA 4FQTA 1SYMA 1NX2A 4IL1A 5JOLA 1GGZA 1B9AA 1XFVO 3PM2A 4GGNA 2WCFA 3BFAA 2EC6B 1R6PA 1EG3A 4XJKA 4MRYA 1IRJA 1QS7A 2BNXA 2QEOA 3PSRA 4M2OA 5AANA 1K90D 1Y1AA 2FCDA 3GK2A 4F0ZB 2CCMA 1QWVA 2KNEA 4XYNA 2LVJA 2M7LA 5FI2A 1MHOA 1SBJA 3GOFA 1PK0D 1TUJA 1F8HA 2M29A 4JWQA 3O6BA 2L4HA 2H61A 1F4QA 2A4JA 1DEKA 3CZTX 1N0YA 5J3XA 5D3OA 2LUXA 1UHJA 4R1EA 2KI4C 2KAYA 4JPZB 2JQ6A 2JTZA 2GTEA 2K7CA 1OOHA 2F8PA 3O2PA 5KTYA 1FW4A 1ZUZA 4P2YB 3DF0B 5D69A 3CDNA 1J1EA 3CYZA 3WHTB 2MJWB 4MLWA 1UWOA 3Q8IA 1S6JA 1XFXO 2KBMA 4NDBA 5AEQA 1NCYA 2KI6D 1TNQA 1XFZO 2JOJA 1M63B 5I94A 2M7NA 2LVIA 1IWQA 1F54A 4I5KA 1UHKA 2EC6C 1L7ZA 1SW8A 1KK7Y 3DF0A 1BLQA 3HX4A 1A03A 5I2OA 5AXIA 3TDIA 4ORBB 1J55A 2FJYA 4HRHA 5FI7A 4CLNA 2OTGB 3PN7C 5CSNA 1K8UA 1YX8A 3PFVA 4MZJA 3CWGA 2I7AA 3D75A 2WCJA 3GK4X 1HT9A 2LNKA 4PALA 1IQ3A 1GM0A 3S0DA 1XFRA 2M0RA 3SG5A 4Q04A 4PDZA 5FI6A 3FS7A 1NYAA 1K9KA 2Q91A 1OZSA 2KLDA 2VRGA 2LMVA 2OS8C 1OOFA 1SL7A 1S26D 1ORGA 1WRZA 2SASA 4YGCB 3FE6A 1DJHA 2WORA 3KO0A 1SPYA 5AERA 2WCEA 5HKZA 1LVCD 1G8IA 3SG3A 5KU1A 2FCEA 2MRDA 3D0YA 5CSIA 5B8IB 3M0WA 3LLEA 4PT1A 4JKTA 1B4CA 5HL1A 4GFTA 1K93D 2KBIA 3R1OA 4AQJA 1KQMB 4WQ3A 4DS7A 4GPLB 3CR5X 1KFUS 5TNCA 2LLSA 1JSAA 1PALA 1XA5A 2F2PA 1BR4B 1WLZA 2PVBA 3LK1A 1YVLA 1TCOB 4CIDA 4GUKA 2WCBA 5HYDA 4PE1A 1A29A 1UHIA 3L47A 1BU3A 1YURA 1OOGA 3OHMB 1K95A 2M3WA 5I2QA 1GGWA 5HKWA 3VRNA 2WCMA 2SCPA 2F33A 1QATA 1TIZA 1YRUB 2BKIB 1M31A 2JXCA 3CTNA 3DVMA 3O4YA 2KI6C 4YGBB 1C7WA 2ERBA 3OBVA 2BBMA 1UP5A 2MA2A 3AAJA 1PSRA 3PM8A 2F2OA 4NQGA 1AJ5A 1QLSA 2HPSA 1F71A 2COLB 2K2FA 1LS8A 2G9BA 3MSEB 2WCKA 2M1UA 1AHRA 2KLEA 2NXQA 2P71A 1DJIA 1XFUO 3PLFB 1JF2A 2KI4B 2IS9A 1YTZC 2O60A 5CPVA 4MBEA 2JPTA 3L4AA 3WHUB 2PRUA 1LA0A 1H4BA 2JZIA 1P28A 1B7TZ 4GGFC 1QVIZ 3CZ1A 1OMRA 1AP4A 2K2AA 3FE9A 1FI6A 1RJVA 1KWOC 3NHTA 4BY4A 2QEBA 3CS1A 1A4PA 3WNXB 2V53A 3EKHA 4L9MA 1CDPA 2WC5A 1DVIA 4MEWA 2PSRA 1PSBA 4ETOA 1AVSA 3IF7A 2KYCA 3EG5B 4INWA 1MR8A 2G2BA 4M2QA 3TS5C 1CKKA 2CBLA 1LA3A 2KAXA 2ZN8A 5ER4X 2HQ8A 1CDMA 3TZ1A 4ICBA 1Y0VH 4FQOA 2LAPA 1TTXA 3SG4A 2LHLA 3PN7B 1OQPA 1NUBA 5DKNA 4ZCVA 1CMGA 4OZDA 1M45A 1NPQA 1K2HA 3BUWB 1UHNA 3QRXA 2RGIA 1A75B 1PULA 1OE9B 5CSFA 5JJGA 1IG5A 1CLMA 1S1EA 3BOWB 2R2IA 4ZCUA 1JFJA 2LVKA 3ICBA 2WCHA 1MXLC 2OS8B 3SG2A 4PCWA 1CFDA 3CZ2A 2L5XB 4YGDB 5BPJA 1DTLA 2LANA 2P70A 3NSLA 5G08A 2GGMA 1GJYA 4FTGA 1C3YA 1QIVA 2QEVA 1QX7A 3OGNA 1QV0A 1E8AA 3L4LA 2PASA 3V2LA 3CZ0A 1DJZA 3RZSA 2BL0B 1MWNA 4ORAB 1UHHA 1CNPA 2JT0A 4MN0A 4P5OE 4CPVA 1HQVA 3VRPA 5DKQA 3BUNB 3WXAA 1UURA 2L0PA 1DJGA 1RWYA 1SCVA 2PMYA 2K0JA 3EVRA 3NHIA 3SIBA 1CLBA 1EL4A 1CM1A 3B87A 4N1GA 1B8LA 3BUXB 2L5YA 1BODA 5DKRA 1WLMA 4PE0A 1CM4A 4DUQA 2TN4A 1KFUL 3DVJA 3D73A 1Z2CB 1YX7A 3DVKA 2CXJA 3DZTA 3E3RA 4MZKA 2JNXA 5AFPA 2LE9B 1TUZA 1KCYA 4GBAA 3CGAA 1BMOA 3O78A 1PVAA 3SG6A 3OB1B 2BAPA 4CFRA 2QACA 3A4UB 3BXKA 4MRXA 5FYXA 4DCKA 1S6IA 1K96A 1OSAA 2Y1NA 3R1PA 1IJ6A 2ZKMX 3F45A 1NP8A 1BT6A 2BECA 3BFBA 2MHHA 4HREE 1DJXA 4PHMA 1CFPA 1BOCA 3BFHA 5CSJA 1JC2A 3DD4A 2BE4A 1LKJA 3EVUA 3C1VA 1FF1A 3KEVA 1B7TY 2H8VA 2BL0C 2LMTA 1QVIY 1S36A 1RFJA 1X02A 1KFXS 3EK8A 3VRQA 3CR2A 4YI8A 2JTTA 2L4IA 2NCOA 2EHBA 2M49B 2M8UA 2FJUB 1V1GA 4E68A 1Y1UA 3D77A 2JULA 1F70A 2QDIA 2WC8A 2KOTA 1KWOB 1NX1A 2I2RE 3OX6A 2LV7A 2WNDA 5PALA 1IJ5A 1S6CA 1CLLA 2JRFA 1SSEB 1G33A 4YI9A 1J7OA 4DRWA 1OMVA 2KAVA 1L2OB 1AUIB 3AKBA 4GGFA 2Y1MA 4PHKA 1IKUA 3TS5B 4NDCA 1XK4C 2OPOA 1LINA 1NX3A 3S0BA 1SRAA 3BYAA 2QPTA 4IJ7A 3S0EA 4C0JA 1DMOA 1A2XA 1QX2A 2M97A 3PATA 1TRFA 2Y5IA 2ZN9A 4M2PA 1IIOA 1BR1B 2BCBA 2GGZA 2L2EA 1KK8C 2CT9A 3B88A 2JU0A 3TUYC 2ISDA 1J1DA 1DT7B 4HRGA 1DC1A 4GAOA 3LL8B 1IGVA 3QMEA 1YVHA 2JT3A 1N2DA 1AK8A 2CTNA 2LP3A 1Y1XA 2K8MB 3AAKA 5I2LA 1QJTA 1TNXA 2JT8A 1BG1A 1SL9A 1RECA 1TWOA 2L50A 1MUXA 4F7FA 1RROA 3CABA 1ZMZA 3BUOB 3NSOA 2QEHA 4OVNF 4DIRA 3IQQA 4PHJA 2KHNA 3R1VA 3EKJA 1XFYO 5ER5A 1ALWA 1L2OC 2MBXA 1WDCC 2NCPA 2AMIA 2WOSA 1M46A 2KFGA 1XVJA 3I5HB 1DELA 2LC5A 3SS5A 1RK9A 4N1FA 4WRIA 2Y4QA 1PRWA 2PALA 2KQYA 1EJ3A 1SL8A 2I18A 4YBHB 1KQVA 2ZRSA 3VROA 1WRLA 2KQ6A 2KDHA 1S5GZ 3LCPC 1QXPA 2LP2A 3CLNA 4QJ5B 1QIWA 1M39A 2KGRA 3JVTB 1DJWA 2ZFDA 4KYNA 3OB2B 2PQLA 1YUTA 4I5LB 1YUUA 1SK6D 2D8NA 1OMDA 3NGVA 2Q4UA 2LCPA 2FOTA 1XO5A 3I5FC 1TNPA 4MVFA 4I5JA 5F6TA 1S3PA 3KPXA 4GNKB 1LXFC 1NWDA 5HKYA 5K89A 1CFFA 1CB1A 3PJIA 1TOPA 1A75A 1EH2A 3CR4X 3BQ3A 1GQMA 3VRRA 3BOWA 1F55A 3TDZA 1MXEA 2LLUA 1IQ5A 4JQ0D 2KGBC 4PE7A 1W7JB 1SCMC 3OP0A 3N7HA 1K9UA 3I5IB 1Q80A 2KSPA 3LK0A 3B86A 1FBVA 1EXRA 1K9PA 2K7OA 2F3ZA 1W9ZA 3I5HC 2BBNA 4INXA 3K1EA 2L2CA 2AAOA 3KF9A 1CDLA 1TN4A 3S0AA 2I94A 3VB1A 1KFXL 1F4OA 1DF0B 2K7DA 2KPHA 1J7QA 1B8CA 3VGOA 2BCAA 4YRUA 3IVTA 1XYDA 3JVTC 4A4BA 1JBAA 1B47A 2M9GA 1B8RA 1J7RA 3EK4A 1NX0A 3GK1A 2L51A 1NSHA 1SR6B 1DJYA 3NSIA 1U5IB 4OR9B 4U8DA 4AQIA 1H8BA 2KFHA 2H61C 2K7BA 4YGEB 2BE6A 2BCXA 1NCZA 3D76A 3RM1A 2WC6A 1CFCA 2LM5A 1DF0A 2YGUA 1YRTB 3TDUA 1DGUA 5D7FA 2PYQA 1OOJA 3KHEA 3JTDB 1KK8B 4NDDA 4USLA 4HSZA 1T14A 3H4SE 3D74A 3FIAA 3TUYB 3EK7A 2O5GA 2B1UA 2EGDA 2GV5A 1U5IA
chains in the Genus database with same CATH topology
1SSEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSE B; 
#chains in the Genus database with same CATH topology
 1FI5 A;  1XK4 A;  1ZFS A;  4C0L A;  1JF0 A;  3D0Y B;  3IQO A;  1K94 A;  2P6B B;  1QTX A;  2BKH B;  2K61 A;  3I5I C;  4I5N B;  4PE4 A;  1SY9 A;  1WRK A;  1BJF A;  1KSO A;  1DQE A;  2JXL A;  2HET A;  5KSZ A;  4ORC B;  2NLN A;  1ZOT B;  1UUS A;  1AJ4 A;  3NSK A;  4AOM A;  4BY5 A;  2ZNE A;  2KFF A;  3NXA A;  3SJS A;  3UO9 A;  4CFQ A;  1QAS A;  4OKH A;  3DVE A;  2JC2 A;  4PHN A;  3S0F A;  1JUO A;  3FWB A;  2JPO A;  1R2U A;  4N5X A;  1RTP 1;  2F3Y A;  1Y6W A;  5I8N A;  1ALV A;  2NZ0 A;  1OW4 A;  3DY9 A;  2LMU A;  3DXL A;  1WDC B;  4MSP A;  4OCI A;  4UPG A;  1J7P A;  1SR6 C;  3B6X A;  3FWC A;  1QX5 B;  2HF5 A;  3RLZ A;  4C0K A;  1YUS A;  1S5G Y;  1KSM A;  5IBW A;  1SKT A;  4D1E A;  3R72 A;  1WY9 A;  2E30 A;  2WCL A;  3S0G A;  3EVV A;  2M1K B;  2AUC A;  3ZNI A;  4WQ2 A;  1FPW A;  3I5G B;  3JTD C;  3B7A A;  1TCF A;  3SIA A;  5HLV A;  3O4X A;  2MLF C;  2OTG C;  2MAZ A;  2ZND A;  1KK7 Z;  4TNC A;  2LLT A;  2ZRT A;  3AKA A;  4YGA A;  5HLO A;  3BUM B;  3K21 A;  2LVV A;  5GQQ C;  1V1F A;  2LUC A;  3I5F B;  2JWW A;  4QJ3 B;  4OV2 A;  2KYF A;  1ZAC A;  5DIC A;  3DYE A;  3UNW A;  1G4Y R;  1SNL A;  1VRK A;  3FE8 A;  5EL2 A;  1JWD A;  3OX5 A;  4MZL A;  2MLE C;  3SG7 A;  1SMG A;  1B1G A;  1DGV A;  3ZWH A;  2DOQ A;  1SCM B;  3SS4 A;  1NIW A;  2L98 A;  1CTR A;  1JFK A;  1TNW A;  1W7I B;  3D78 A;  4A4C A;  2HQW A;  1CDN A;  1PVB A;  1YR5 A;  1NCX A;  3HCM A;  1OOI X;  1C7V A;  1OZO A;  1D1O A;  1KQM C;  1XFW O;  1ODB A;  1MQ1 A;  2CNP A;  2JNF A;  2E6W A;  1QV1 A;  3D10 A;  3A8R A;  1Z4H A;  4XJK B;  1CMF A;  1EG4 A;  1IH0 A;  1BF5 A;  3SS3 A;  2K60 A;  4QJ4 B;  1C3Z A;  3I5G C;  3BJH A;  1MF8 B;  1C07 A;  2H2K A;  2LHI A;  3PAL A;  4JD9 A;  1N65 A;  1QLK A;  4FQT A;  1SYM A;  1NX2 A;  4IL1 A;  5JOL A;  1GGZ A;  1B9A A;  1XFV O;  3PM2 A;  4GGN A;  2WCF A;  3BFA A;  2EC6 B;  1R6P A;  1EG3 A;  4XJK A;  4MRY A;  1IRJ A;  1QS7 A;  2BNX A;  2QEO A;  3PSR A;  4M2O A;  5AAN A;  1K90 D;  1Y1A A;  2FCD A;  3GK2 A;  4F0Z B;  2CCM A;  1QWV A;  2KNE A;  4XYN A;  2LVJ A;  2M7L A;  5FI2 A;  1MHO A;  1SBJ A;  3GOF A;  1PK0 D;  1TUJ A;  1F8H A;  2M29 A;  4JWQ A;  3O6B A;  2L4H A;  2H61 A;  1F4Q A;  2A4J A;  1DEK A;  3CZT X;  1N0Y A;  5J3X A;  5D3O A;  2LUX A;  1UHJ A;  4R1E A;  2KI4 C;  2KAY A;  4JPZ B;  2JQ6 A;  2JTZ A;  2GTE A;  2K7C A;  1OOH A;  2F8P A;  3O2P A;  5KTY A;  1FW4 A;  1ZUZ A;  4P2Y B;  3DF0 B;  5D69 A;  3CDN A;  1J1E A;  3CYZ A;  3WHT B;  2MJW B;  4MLW A;  1UWO A;  3Q8I A;  1S6J A;  1XFX O;  2KBM A;  4NDB A;  5AEQ A;  1NCY A;  2KI6 D;  1TNQ A;  1XFZ O;  2JOJ A;  1M63 B;  5I94 A;  2M7N A;  2LVI A;  1IWQ A;  1F54 A;  4I5K A;  1UHK A;  2EC6 C;  1L7Z A;  1SW8 A;  1KK7 Y;  3DF0 A;  1BLQ A;  3HX4 A;  1A03 A;  5I2O A;  5AXI A;  3TDI A;  4ORB B;  1J55 A;  2FJY A;  4HRH A;  5FI7 A;  4CLN A;  2OTG B;  3PN7 C;  5CSN A;  1K8U A;  1YX8 A;  3PFV A;  4MZJ A;  3CWG A;  2I7A A;  3D75 A;  2WCJ A;  3GK4 X;  1HT9 A;  2LNK A;  4PAL A;  1IQ3 A;  1GM0 A;  3S0D A;  1XFR A;  2M0R A;  3SG5 A;  4Q04 A;  4PDZ A;  5FI6 A;  3FS7 A;  1NYA A;  1K9K A;  2Q91 A;  1OZS A;  2KLD A;  2VRG A;  2LMV A;  2OS8 C;  1OOF A;  1SL7 A;  1S26 D;  1ORG A;  1WRZ A;  2SAS A;  4YGC B;  3FE6 A;  1DJH A;  2WOR A;  3KO0 A;  1SPY A;  5AER A;  2WCE A;  5HKZ A;  1LVC D;  1G8I A;  3SG3 A;  5KU1 A;  2FCE A;  2MRD A;  3D0Y A;  5CSI A;  5B8I B;  3M0W A;  3LLE A;  4PT1 A;  4JKT A;  1B4C A;  5HL1 A;  4GFT A;  1K93 D;  2KBI A;  3R1O A;  4AQJ A;  1KQM B;  4WQ3 A;  4DS7 A;  4GPL B;  3CR5 X;  1KFU S;  5TNC A;  2LLS A;  1JSA A;  1PAL A;  1XA5 A;  2F2P A;  1BR4 B;  1WLZ A;  2PVB A;  3LK1 A;  1YVL A;  1TCO B;  4CID A;  4GUK A;  2WCB A;  5HYD A;  4PE1 A;  1A29 A;  1UHI A;  3L47 A;  1BU3 A;  1YUR A;  1OOG A;  3OHM B;  1K95 A;  2M3W A;  5I2Q A;  1GGW A;  5HKW A;  3VRN A;  2WCM A;  2SCP A;  2F33 A;  1QAT A;  1TIZ A;  1YRU B;  2BKI B;  1M31 A;  2JXC A;  3CTN A;  3DVM A;  3O4Y A;  2KI6 C;  4YGB B;  1C7W A;  2ERB A;  3OBV A;  2BBM A;  1UP5 A;  2MA2 A;  3AAJ A;  1PSR A;  3PM8 A;  2F2O A;  4NQG A;  1AJ5 A;  1QLS A;  2HPS A;  1F71 A;  2COL B;  2K2F A;  1LS8 A;  2G9B A;  3MSE B;  2WCK A;  2M1U A;  1AHR A;  2KLE A;  2NXQ A;  2P71 A;  1DJI A;  1XFU O;  3PLF B;  1JF2 A;  2KI4 B;  2IS9 A;  1YTZ C;  2O60 A;  5CPV A;  4MBE A;  2JPT A;  3L4A A;  3WHU B;  2PRU A;  1LA0 A;  1H4B A;  2JZI A;  1P28 A;  1B7T Z;  4GGF C;  1QVI Z;  3CZ1 A;  1OMR A;  1AP4 A;  2K2A A;  3FE9 A;  1FI6 A;  1RJV A;  1KWO C;  3NHT A;  4BY4 A;  2QEB A;  3CS1 A;  1A4P A;  3WNX B;  2V53 A;  3EKH A;  4L9M A;  1CDP A;  2WC5 A;  1DVI A;  4MEW A;  2PSR A;  1PSB A;  4ETO A;  1AVS A;  3IF7 A;  2KYC A;  3EG5 B;  4INW A;  1MR8 A;  2G2B A;  4M2Q A;  3TS5 C;  1CKK A;  2CBL A;  1LA3 A;  2KAX A;  2ZN8 A;  5ER4 X;  2HQ8 A;  1CDM A;  3TZ1 A;  4ICB A;  1Y0V H;  4FQO A;  2LAP A;  1TTX A;  3SG4 A;  2LHL A;  3PN7 B;  1OQP A;  1NUB A;  5DKN A;  4ZCV A;  1CMG A;  4OZD A;  1M45 A;  1NPQ A;  1K2H A;  3BUW B;  1UHN A;  3QRX A;  2RGI A;  1A75 B;  1PUL A;  1OE9 B;  5CSF A;  5JJG A;  1IG5 A;  1CLM A;  1S1E A;  3BOW B;  2R2I A;  4ZCU A;  1JFJ A;  2LVK A;  3ICB A;  2WCH A;  1MXL C;  2OS8 B;  3SG2 A;  4PCW A;  1CFD A;  3CZ2 A;  2L5X B;  4YGD B;  5BPJ A;  1DTL A;  2LAN A;  2P70 A;  3NSL A;  5G08 A;  2GGM A;  1GJY A;  4FTG A;  1C3Y A;  1QIV A;  2QEV A;  1QX7 A;  3OGN A;  1QV0 A;  1E8A A;  3L4L A;  2PAS A;  3V2L A;  3CZ0 A;  1DJZ A;  3RZS A;  2BL0 B;  1MWN A;  4ORA B;  1UHH A;  1CNP A;  2JT0 A;  4MN0 A;  4P5O E;  4CPV A;  1HQV A;  3VRP A;  5DKQ A;  3BUN B;  3WXA A;  1UUR A;  2L0P A;  1DJG A;  1RWY A;  1SCV A;  2PMY A;  2K0J A;  3EVR A;  3NHI A;  3SIB A;  1CLB A;  1EL4 A;  1CM1 A;  3B87 A;  4N1G A;  1B8L A;  3BUX B;  2L5Y A;  1BOD A;  5DKR A;  1WLM A;  4PE0 A;  1CM4 A;  4DUQ A;  2TN4 A;  1KFU L;  3DVJ A;  3D73 A;  1Z2C B;  1YX7 A;  3DVK A;  2CXJ A;  3DZT A;  3E3R A;  4MZK A;  2JNX A;  5AFP A;  2LE9 B;  1TUZ A;  1KCY A;  4GBA A;  3CGA A;  1BMO A;  3O78 A;  1PVA A;  3SG6 A;  3OB1 B;  2BAP A;  4CFR A;  2QAC A;  3A4U B;  3BXK A;  4MRX A;  5FYX A;  4DCK A;  1S6I A;  1K96 A;  1OSA A;  2Y1N A;  3R1P A;  1IJ6 A;  2ZKM X;  3F45 A;  1NP8 A;  1BT6 A;  2BEC A;  3BFB A;  2MHH A;  4HRE E;  1DJX A;  4PHM A;  1CFP A;  1BOC A;  3BFH A;  5CSJ A;  1JC2 A;  3DD4 A;  2BE4 A;  1LKJ A;  3EVU A;  3C1V A;  1FF1 A;  3KEV A;  1B7T Y;  2H8V A;  2BL0 C;  2LMT A;  1QVI Y;  1S36 A;  1RFJ A;  1X02 A;  1KFX S;  3EK8 A;  3VRQ A;  3CR2 A;  4YI8 A;  2JTT A;  2L4I A;  2NCO A;  2EHB A;  2M49 B;  2M8U A;  2FJU B;  1V1G A;  4E68 A;  1Y1U A;  3D77 A;  2JUL A;  1F70 A;  2QDI A;  2WC8 A;  2KOT A;  1KWO B;  1NX1 A;  2I2R E;  3OX6 A;  2LV7 A;  2WND A;  5PAL A;  1IJ5 A;  1S6C A;  1CLL A;  2JRF A;  1SSE B;  1G33 A;  4YI9 A;  1J7O A;  4DRW A;  1OMV A;  2KAV A;  1L2O B;  1AUI B;  3AKB A;  4GGF A;  2Y1M A;  4PHK A;  1IKU A;  3TS5 B;  4NDC A;  1XK4 C;  2OPO A;  1LIN A;  1NX3 A;  3S0B A;  1SRA A;  3BYA A;  2QPT A;  4IJ7 A;  3S0E A;  4C0J A;  1DMO A;  1A2X A;  1QX2 A;  2M97 A;  3PAT A;  1TRF A;  2Y5I A;  2ZN9 A;  4M2P A;  1IIO A;  1BR1 B;  2BCB A;  2GGZ A;  2L2E A;  1KK8 C;  2CT9 A;  3B88 A;  2JU0 A;  3TUY C;  2ISD A;  1J1D A;  1DT7 B;  4HRG A;  1DC1 A;  4GAO A;  3LL8 B;  1IGV A;  3QME A;  1YVH A;  2JT3 A;  1N2D A;  1AK8 A;  2CTN A;  2LP3 A;  1Y1X A;  2K8M B;  3AAK A;  5I2L A;  1QJT A;  1TNX A;  2JT8 A;  1BG1 A;  1SL9 A;  1REC A;  1TWO A;  2L50 A;  1MUX A;  4F7F A;  1RRO A;  3CAB A;  1ZMZ A;  3BUO B;  3NSO A;  2QEH A;  4OVN F;  4DIR A;  3IQQ A;  4PHJ A;  2KHN A;  3R1V A;  3EKJ A;  1XFY O;  5ER5 A;  1ALW A;  1L2O C;  2MBX A;  1WDC C;  2NCP A;  2AMI A;  2WOS A;  1M46 A;  2KFG A;  1XVJ A;  3I5H B;  1DEL A;  2LC5 A;  3SS5 A;  1RK9 A;  4N1F A;  4WRI A;  2Y4Q A;  1PRW A;  2PAL A;  2KQY A;  1EJ3 A;  1SL8 A;  2I18 A;  4YBH B;  1KQV A;  2ZRS A;  3VRO A;  1WRL A;  2KQ6 A;  2KDH A;  1S5G Z;  3LCP C;  1QXP A;  2LP2 A;  3CLN A;  4QJ5 B;  1QIW A;  1M39 A;  2KGR A;  3JVT B;  1DJW A;  2ZFD A;  4KYN A;  3OB2 B;  2PQL A;  1YUT A;  4I5L B;  1YUU A;  1SK6 D;  2D8N A;  1OMD A;  3NGV A;  2Q4U A;  2LCP A;  2FOT A;  1XO5 A;  3I5F C;  1TNP A;  4MVF A;  4I5J A;  5F6T A;  1S3P A;  3KPX A;  4GNK B;  1LXF C;  1NWD A;  5HKY A;  5K89 A;  1CFF A;  1CB1 A;  3PJI A;  1TOP A;  1A75 A;  1EH2 A;  3CR4 X;  3BQ3 A;  1GQM A;  3VRR A;  3BOW A;  1F55 A;  3TDZ A;  1MXE A;  2LLU A;  1IQ5 A;  4JQ0 D;  2KGB C;  4PE7 A;  1W7J B;  1SCM C;  3OP0 A;  3N7H A;  1K9U A;  3I5I B;  1Q80 A;  2KSP A;  3LK0 A;  3B86 A;  1FBV A;  1EXR A;  1K9P A;  2K7O A;  2F3Z A;  1W9Z A;  3I5H C;  2BBN A;  4INX A;  3K1E A;  2L2C A;  2AAO A;  3KF9 A;  1CDL A;  1TN4 A;  3S0A A;  2I94 A;  3VB1 A;  1KFX L;  1F4O A;  1DF0 B;  2K7D A;  2KPH A;  1J7Q A;  1B8C A;  3VGO A;  2BCA A;  4YRU A;  3IVT A;  1XYD A;  3JVT C;  4A4B A;  1JBA A;  1B47 A;  2M9G A;  1B8R A;  1J7R A;  3EK4 A;  1NX0 A;  3GK1 A;  2L51 A;  1NSH A;  1SR6 B;  1DJY A;  3NSI A;  1U5I B;  4OR9 B;  4U8D A;  4AQI A;  1H8B A;  2KFH A;  2H61 C;  2K7B A;  4YGE B;  2BE6 A;  2BCX A;  1NCZ A;  3D76 A;  3RM1 A;  2WC6 A;  1CFC A;  2LM5 A;  1DF0 A;  2YGU A;  1YRT B;  3TDU A;  1DGU A;  5D7F A;  2PYQ A;  1OOJ A;  3KHE A;  3JTD B;  1KK8 B;  4NDD A;  4USL A;  4HSZ A;  1T14 A;  3H4S E;  3D74 A;  3FIA A;  3TUY B;  3EK7 A;  2O5G A;  2B1U A;  2EGD A;  2GV5 A;  1U5I A; 
#chains in the Genus database with same CATH homology
 1SSE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...