1SSEB

Solution structure of the oxidized form of the yap1 redox domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
NGSSLQNADKINNGNDNDNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-1 like transcription factor YAP1
publication title Structural basis for redox regulation of Yap1 transcription factor localization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription activator
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.100 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 YAP1 redox domain. Chain B 1sseB00
1SSEB
chains in the Genus database with same CATH superfamily
1S6CA 1MQ1A 1F54A 1KK7Z 3DZTA 1ZMZA 2LM5A 4MSPA 3I5HC 5PALA 2IS9A 2Q91A 2BECA 2LP3A 1BODA 4TNCA 2JWWA 1T14A 2G9BA 2KI4C 1SKTA 1KWOC 1IJ6A 1EL4A 1MUXA 1C7WA 1B9AA 4C0LA 2ZNDA 1NSHA 3DXLA 1WDCB 2HF5A 4NDCA 5BPJA 1SPYA 1H8BA 1W9ZA 1TCFA 1Y1XA 4PE4A 1PVAA 2K7CA 4NQGA 1K2HA 2KDHA 2JQ6A 4GAOA 1NX1A 2HQWA 1NX3A 3BUMB 2WCHA 1NCXA 1UUSA 5DKRA 2KGBC 3TDZA 3DVKA 2BNXA 3SIBA 2JT0A 3F45A 4IJ7A 1F55A 2BBMA 2LUCA 4CIDA 2QEOA 3M0WA 2LVKA 3SG4A 4FQOA 3HX4A 1S6IA 2M0RA 4QJ5B 2O60A 2BCXA 4INXA 1OMDA 4GPLB 1C7VA 4MN0A 3BXKA 2O5GA 1XYDA 3PATA 3S0AA 3GK4X 3IQOA 3S0GA 2K2AA 2DOQA 2PYQA 3JTDB 3SIAA 1LKJA 2NZ0A 1N65A 5CSNA 1XFRA 1OMRA 4MRXA 3CZ0A 2I2RE 1DF0A 3O6BA 3R1PA 5CPVA 1K94A 1CDLA 4YRUA 1P28A 1V1GA 2TN4A 1CLBA 1ODBA 3KO0A 3L4LA 3NXAA 2PQLA 1DJZA 4MRYA 2LANA 2L2EA 1L7ZA 1XFXO 3WNXB 1CFDA 3K1EA 2KBMA 1E8AA 2V53A 1RFJA 2I94A 5DKNA 4QJ3B 2KQYA 1IG5A 5KU1A 1K8UA 1EXRA 1DJWA 3N7HA 3TDUA 5I2OA 1S36A 4ORAB 1NWDA 3CZ1A 2LP2A 3GK2A 4JD9A 2KI6C 2LMUA 3TS5B 4PE0A 5CSJA 2Y5IA 3EG5B 2KGRA 5I8NA 1IRJA 1JF0A 3R1VA 1BT6A 2WOSA 2ZNEA 1AK8A 2KYFA 3EVUA 2WCMA 3NHIA 1JC2A 1DJXA 1SRAA 1YX7A 2FOTA 4WQ2A 3ZWHA 4E68A 2K7DA 3L4AA 3SG6A 2L0PA 1F4OA 1DGVA 1ZOTB 5FI7A 5B8IB 2WC5A 3SJSA 1OOFA 1GGZA 3A4UB 1KFUL 2YGUA 3JVTC 4OZDA 3EVVA 1EJ3A 3KPXA 1NX0A 1PSBA 1SSEB 1XFWO 4GGFA 1KQMC 2MLEC 5AXIA 1GQMA 2QEHA 3SG5A 5HKZA 5AERA 3OGNA 3CR4X 4Q04A 1FI5A 3GK1A 1LS8A 4GGNA 1SL9A 3I5GB 2KYCA 1OZSA 3DVEA 1IGVA 1SCVA 3FIAA 1LVCD 1AJ5A 3DYEA 4HRGA 3CLNA 1QLKA 4I5NB 4XJKB 2M7LA 2WCLA 1UWOA 1B7TY 2K60A 3CABA 1KK8C 2PASA 3OX6A 3ZNIA 1XK4A 2L50A 2P6BB 3IVTA 2ZN8A 4R1EA 2F2OA 1B8LA 5D69A 1AP4A 1MR8A 1QVIY 2FJUB 2M97A 1DJGA 3RZSA 2L5XB 3EKJA 1YUUA 1UHIA 2D8NA 3BUWB 2BKHB 4JWQA 1B4CA 1G8IA 4N5XA 4DUQA 3IQQA 2KPHA 1QLSA 2F33A 4GGFC 1JSAA 1J7OA 2OS8B 1IQ5A 3BQ3A 5TNCA 1SK6D 2SASA 2E30A 1QX7A 3IF7A 2BL0C 5DKQA 3NSOA 3BFAA 3OBVA 1CKKA 3UO9A 2JXLA 1XO5A 3B88A 3S0DA 4I5JA 1EG4A 1DF0B 3NHTA 4U8DA 4MZJA 2JNXA 3VRNA 1UHKA 2KFHA 1RROA 3CZTX 1B7TZ 2F3ZA 4USLA 2F2PA 4MZKA 3PM8A 1XK4C 1B8RA 1NCYA 3LLEA 3RLZA 4M2PA 2CNPA 3JVTB 4YI9A 1PALA 3PN7B 4PHMA 2PRUA 3CWGA 2HQ8A 4PT1A 2M9GA 4ZCUA 1YVHA 1TNPA 1C3ZA 1TWOA 1QV0A 3PALA 2KSPA 1MXLC 1R6PA 1TUJA 1BR1B 5HYDA 2BCBA 5JOLA 3ICBA 1OMVA 1ZACA 3KF9A 1JFKA 3A8RA 3I5IC 2PSRA 4MZLA 4YGCB 1D1OA 3Q8IA 3LK1A 4N1FA 1A29A 1FW4A 1UHJA 2CTNA 1PVBA 1RJVA 2JXCA 1YUTA 4OR9B 4F0ZB 2Y1NA 1BMOA 1TOPA 2FJYA 1PK0D 4ETOA 1DC1A 2Q4UA 4PCWA 1XVJA 1WLZA 1FI6A 1OOIX 2KOTA 2KHNA 3VB1A 3OHMB 2ZN9A 1QXPA 2FCEA 5F6TA 5I94A 4C0KA 3BYAA 1IQ3A 1U5IA 4DRWA 1SW8A 3D76A 1ZUZA 1S1EA 3PFVA 2BL0B 2H8VA 1WY9A 4INWA 3EK7A 1SCMC 3AKAA 4KYNA 2LUXA 2KAYA 1F4QA 4PE1A 3EKHA 3HCMA 2NCPA 1F8HA 1SNLA 1XFYO 2GGMA 3VRRA 3R72A 4YGDB 4BY5A 3I5HB 2JT3A 3DD4A 1NPQA 1K93D 1RK9A 1AHRA 1PULA 1RTP1 2P70A 2I7AA 2BE4A 1QX2A 2KI6D 3OX5A 3S0BA 1DTLA 2JRFA 1QATA 1IJ5A 2KI4B 1KWOB 1OOHA 1YTZC 2QEBA 2ZFDA 3B7AA 4DS7A 4JQ0D 1XA5A 3BUNB 3WXAA 1UURA 2M49B 1NP8A 1S26D 2MJWB 5AANA 1H4BA 1W7JB 4GBAA 2MRDA 2WC6A 1W7IB 3AAKA 3FWBA 1Q80A 3FE8A 1WRKA 4WQ3A 2VRGA 1SL7A 2QACA 2K7OA 1WLMA 2BKIB 1MHOA 2LMTA 3K21A 1OE9B 1LA0A 5I2LA 1A75A 3L47A 3CYZA 2E6WA 3I5FC 4N1GA 1TTXA 1S6JA 2M3WA 4FTGA 1ALVA 2MLFC 3DVJA 2H2KA 3TDIA 1NYAA 2GGZA 4L9MA 1RECA 2ZKMX 5D7FA 4HREE 2GV5A 1J55A 3CZ2A 4GNKB 2K7BA 1ORGA 2WCFA 3BOWA 1CFPA 1EH2A 5GQQC 2WCBA 4D1EA 1FPWA 3SS5A 4PHJA 5CSFA 3SG7A 3S0FA 1CFFA 1SCMB 1SY9A 2F8PA 1L2OC 2G2BA 1ALWA 2KLDA 3FE9A 5AFPA 1K9UA 2AUCA 3BUOB 1YX8A 2WORA 4YGBB 1CNPA 1K96A 1KFXL 1N0YA 2EC6C 2L5YA 2M1UA 1CLLA 4ZCVA 3O78A 2OPOA 5HL1A 3WHUB 1AVSA 1DEKA 3FWCA 4PHNA 5FI2A 2KFGA 2L4HA 3CTNA 3D0YA 1SYMA 1WDCC 2LE9B 2MHHA 1SR6C 1Y0VH 1KFUS 4DCKA 2MBXA 2EGDA 1U5IB 4AQJA 1JF2A 5FYXA 4MEWA 5CSIA 1NIWA 2K61A 2LHIA 1YVLA 1QASA 1QWVA 3B86A 4MBEA 5HKYA 2AAOA 3EVRA 3SG3A 3BJHA 1OZOA 4ORBB 1IWQA 3E3RA 1TIZA 2GTEA 2JULA 2L51A 2WNDA 1QTXA 1CTRA 1V1FA 2FCDA 1DJHA 1LXFC 4GFTA 1QX5B 1QVIZ 1GGWA 2WC8A 4OVNF 1TCOB 3VROA 2H61A 3CS1A 1DGUA 2F3YA 5FI6A 1OW4A 1Z2CB 1KQMB 1TNXA 1GM0A 1YRUB 2NLNA 1J7RA 2I18A 2L4IA 3C1VA 1TNQA 2BE6A 2ISDA 1ZFSA 4YGAA 1R2UA 3O4XA 3TUYC 1G4YR 2SCPA 1K9KA 5EL2A 1L2OB 5HKWA 3V2LA 3DF0A 3B6XA 1A4PA 2WCJA 5ER4X 2HETA 1IKUA 1J1DA 1M63B 1CDMA 1A75B 2K0JA 4MLWA 1WRLA 1DJYA 1QJTA 1LINA 2EC6B 1CMFA 1KK8B 1KSMA 1M46A 2Y1MA 3NSIA 1BU3A 3O4YA 4FQTA 4CFRA 1TRFA 1SMGA 1XFZO 2BBNA 3UNWA 2K2FA 3AKBA 1K95A 1CDPA 5J3XA 1BLQA 4HRHA 1XFUO 2PVBA 1DVIA 2PALA 1YURA 2LVJA 2H61C 2NXQA 3PJIA 5IBWA 2QDIA 1NUBA 3BOWB 1WRZA 1SR6B 2M7NA 1X02A 3TS5C 1B8CA 4NDBA 1N2DA 2ERBA 3MSEB 4XJKA 1EG3A 3CGAA 1MXEA 2P71A 3QRXA 1BF5A 2LNKA 5KSZA 1Y1AA 1NX2A 1UHNA 4ICBA 3AAJA 2LCPA 2JZIA 3GOFA 1JUOA 3D77A 1HQVA 2M1KB 3QMEA 1C3YA 3B87A 2A4JA 1TN4A 2NCOA 5HLOA 2WCEA 3DVMA 2MAZA 1DJIA 3LK0A 2L98A 3EK4A 4BY4A 1J7PA 1OQPA 1XFVO 1AJ4A 2JT8A 4PDZA 4A4BA 5KTYA 4F7FA 1CDNA 5AEQA 3LL8B 1S5GY 1Y1UA 4YI8A 3D0YB 1DQEA 1DMOA 1RWYA 1CLMA 1J7QA 2HPSA 4ORCB 1DELA 4P2YB 2LAPA 3I5GC 3CDNA 2BCAA 1FBVA 3O2PA 3OB2B 2OTGC 3TUYB 3S0EA 3D74A 5I2QA 2MA2A 1TUZA 2LHLA 5HLVA 1AUIB 2R2IA 3EK8A 3NSLA 4JPZB 4PALA 3KEVA 1BR4B 1LA3A 3I5IB 3NSKA 1JWDA 2KNEA 2CXJA 4MVFA 2JPTA 1CFCA 3PLFB 1HT9A 4OCIA 3VRPA 1QIWA 2L2CA 3R1OA 1BOCA 5D3OA 1JBAA 2LLTA 2LMVA 4C0JA 1BG1A 1A2XA 3PSRA 2B1UA 1YUSA 3BUXB 1QIVA 1YRTB 4PE7A 1SL8A 4M2QA 3BFHA 1S5GZ 2OS8C 2KQ6A 2JPOA 1OOJA 1VRKA 4P5OE 1B47A 1Z4HA 2LVVA 2BAPA 1F71A 3VRQA 1UHHA 1Y6WA 2COLB 2LC5A 5G08A 1J1EA 3KHEA 2JNFA 1A03A 2CBLA 2LLUA 1S3PA 3CR5X 3SS4A 5DICA 2JTZA 4PHKA 1IIOA 2QPTA 1M31A 3DF0B 3OB1B 1C07A 2CCMA 3LCPC 3DY9A 4YGEB 3D78A 5JJGA 3CR2A 1CM1A 3H4SE 1TNWA 3FS7A 4AOMA 2EHBA 4XYNA 2ZRSA 3PN7C 2JU0A 5ER5A 1PSRA 1UP5A 3D73A 2KBIA 4UPGA 5K89A 1QV1A 1NCZA 2WCKA 3BFBA 3NGVA 3TZ1A 1JFJA 4NDDA 1K9PA 1KQVA 2PMYA 3FE6A 2JOJA 2KLEA 1M39A 4WRIA 1K90D 4A4CA 4JKTA 1G33A 2OTGB 4HSZA 4M2OA 3RM1A 1GJYA 4CPVA 4CFQA 4CLNA 4QJ4B 1CMGA 1PRWA 2CT9A 2K8MB 1B1GA 1KSOA 1MWNA 4I5LB 1KK7Y 2LV7A 3I5FB 3D10A 2JC2A 1CM4A 4YBHB 4DIRA 4AQIA 4GUKA 2KAVA 1M45A 1FF1A 1MF8B 3OP0A 1KFXS 1DT7B 4IL1A 1F70A 2JTTA 3D75A 3SS3A 3VGOA 1YR5A 2QEVA 3PM2A 3WHTB 1OSAA 2AMIA 3JTDC 1IH0A 2KFFA 2LVIA 2LLSA 2Y4QA 4OKHA 4OV2A 3SG2A 1SBJA 2M29A 2KAXA 1OOGA 1BJFA 1CB1A 4I5KA 1KCYA 1QS7A 2M8UA 2RGIA 2ZRTA
chains in the Genus database with same CATH topology
1SSEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSE B; 
#chains in the Genus database with same CATH topology
 1S6C A;  1MQ1 A;  1F54 A;  1KK7 Z;  3DZT A;  1ZMZ A;  2LM5 A;  4MSP A;  3I5H C;  5PAL A;  2IS9 A;  2Q91 A;  2BEC A;  2LP3 A;  1BOD A;  4TNC A;  2JWW A;  1T14 A;  2G9B A;  2KI4 C;  1SKT A;  1KWO C;  1IJ6 A;  1EL4 A;  1MUX A;  1C7W A;  1B9A A;  4C0L A;  2ZND A;  1NSH A;  3DXL A;  1WDC B;  2HF5 A;  4NDC A;  5BPJ A;  1SPY A;  1H8B A;  1W9Z A;  1TCF A;  1Y1X A;  4PE4 A;  1PVA A;  2K7C A;  4NQG A;  1K2H A;  2KDH A;  2JQ6 A;  4GAO A;  1NX1 A;  2HQW A;  1NX3 A;  3BUM B;  2WCH A;  1NCX A;  1UUS A;  5DKR A;  2KGB C;  3TDZ A;  3DVK A;  2BNX A;  3SIB A;  2JT0 A;  3F45 A;  4IJ7 A;  1F55 A;  2BBM A;  2LUC A;  4CID A;  2QEO A;  3M0W A;  2LVK A;  3SG4 A;  4FQO A;  3HX4 A;  1S6I A;  2M0R A;  4QJ5 B;  2O60 A;  2BCX A;  4INX A;  1OMD A;  4GPL B;  1C7V A;  4MN0 A;  3BXK A;  2O5G A;  1XYD A;  3PAT A;  3S0A A;  3GK4 X;  3IQO A;  3S0G A;  2K2A A;  2DOQ A;  2PYQ A;  3JTD B;  3SIA A;  1LKJ A;  2NZ0 A;  1N65 A;  5CSN A;  1XFR A;  1OMR A;  4MRX A;  3CZ0 A;  2I2R E;  1DF0 A;  3O6B A;  3R1P A;  5CPV A;  1K94 A;  1CDL A;  4YRU A;  1P28 A;  1V1G A;  2TN4 A;  1CLB A;  1ODB A;  3KO0 A;  3L4L A;  3NXA A;  2PQL A;  1DJZ A;  4MRY A;  2LAN A;  2L2E A;  1L7Z A;  1XFX O;  3WNX B;  1CFD A;  3K1E A;  2KBM A;  1E8A A;  2V53 A;  1RFJ A;  2I94 A;  5DKN A;  4QJ3 B;  2KQY A;  1IG5 A;  5KU1 A;  1K8U A;  1EXR A;  1DJW A;  3N7H A;  3TDU A;  5I2O A;  1S36 A;  4ORA B;  1NWD A;  3CZ1 A;  2LP2 A;  3GK2 A;  4JD9 A;  2KI6 C;  2LMU A;  3TS5 B;  4PE0 A;  5CSJ A;  2Y5I A;  3EG5 B;  2KGR A;  5I8N A;  1IRJ A;  1JF0 A;  3R1V A;  1BT6 A;  2WOS A;  2ZNE A;  1AK8 A;  2KYF A;  3EVU A;  2WCM A;  3NHI A;  1JC2 A;  1DJX A;  1SRA A;  1YX7 A;  2FOT A;  4WQ2 A;  3ZWH A;  4E68 A;  2K7D A;  3L4A A;  3SG6 A;  2L0P A;  1F4O A;  1DGV A;  1ZOT B;  5FI7 A;  5B8I B;  2WC5 A;  3SJS A;  1OOF A;  1GGZ A;  3A4U B;  1KFU L;  2YGU A;  3JVT C;  4OZD A;  3EVV A;  1EJ3 A;  3KPX A;  1NX0 A;  1PSB A;  1SSE B;  1XFW O;  4GGF A;  1KQM C;  2MLE C;  5AXI A;  1GQM A;  2QEH A;  3SG5 A;  5HKZ A;  5AER A;  3OGN A;  3CR4 X;  4Q04 A;  1FI5 A;  3GK1 A;  1LS8 A;  4GGN A;  1SL9 A;  3I5G B;  2KYC A;  1OZS A;  3DVE A;  1IGV A;  1SCV A;  3FIA A;  1LVC D;  1AJ5 A;  3DYE A;  4HRG A;  3CLN A;  1QLK A;  4I5N B;  4XJK B;  2M7L A;  2WCL A;  1UWO A;  1B7T Y;  2K60 A;  3CAB A;  1KK8 C;  2PAS A;  3OX6 A;  3ZNI A;  1XK4 A;  2L50 A;  2P6B B;  3IVT A;  2ZN8 A;  4R1E A;  2F2O A;  1B8L A;  5D69 A;  1AP4 A;  1MR8 A;  1QVI Y;  2FJU B;  2M97 A;  1DJG A;  3RZS A;  2L5X B;  3EKJ A;  1YUU A;  1UHI A;  2D8N A;  3BUW B;  2BKH B;  4JWQ A;  1B4C A;  1G8I A;  4N5X A;  4DUQ A;  3IQQ A;  2KPH A;  1QLS A;  2F33 A;  4GGF C;  1JSA A;  1J7O A;  2OS8 B;  1IQ5 A;  3BQ3 A;  5TNC A;  1SK6 D;  2SAS A;  2E30 A;  1QX7 A;  3IF7 A;  2BL0 C;  5DKQ A;  3NSO A;  3BFA A;  3OBV A;  1CKK A;  3UO9 A;  2JXL A;  1XO5 A;  3B88 A;  3S0D A;  4I5J A;  1EG4 A;  1DF0 B;  3NHT A;  4U8D A;  4MZJ A;  2JNX A;  3VRN A;  1UHK A;  2KFH A;  1RRO A;  3CZT X;  1B7T Z;  2F3Z A;  4USL A;  2F2P A;  4MZK A;  3PM8 A;  1XK4 C;  1B8R A;  1NCY A;  3LLE A;  3RLZ A;  4M2P A;  2CNP A;  3JVT B;  4YI9 A;  1PAL A;  3PN7 B;  4PHM A;  2PRU A;  3CWG A;  2HQ8 A;  4PT1 A;  2M9G A;  4ZCU A;  1YVH A;  1TNP A;  1C3Z A;  1TWO A;  1QV0 A;  3PAL A;  2KSP A;  1MXL C;  1R6P A;  1TUJ A;  1BR1 B;  5HYD A;  2BCB A;  5JOL A;  3ICB A;  1OMV A;  1ZAC A;  3KF9 A;  1JFK A;  3A8R A;  3I5I C;  2PSR A;  4MZL A;  4YGC B;  1D1O A;  3Q8I A;  3LK1 A;  4N1F A;  1A29 A;  1FW4 A;  1UHJ A;  2CTN A;  1PVB A;  1RJV A;  2JXC A;  1YUT A;  4OR9 B;  4F0Z B;  2Y1N A;  1BMO A;  1TOP A;  2FJY A;  1PK0 D;  4ETO A;  1DC1 A;  2Q4U A;  4PCW A;  1XVJ A;  1WLZ A;  1FI6 A;  1OOI X;  2KOT A;  2KHN A;  3VB1 A;  3OHM B;  2ZN9 A;  1QXP A;  2FCE A;  5F6T A;  5I94 A;  4C0K A;  3BYA A;  1IQ3 A;  1U5I A;  4DRW A;  1SW8 A;  3D76 A;  1ZUZ A;  1S1E A;  3PFV A;  2BL0 B;  2H8V A;  1WY9 A;  4INW A;  3EK7 A;  1SCM C;  3AKA A;  4KYN A;  2LUX A;  2KAY A;  1F4Q A;  4PE1 A;  3EKH A;  3HCM A;  2NCP A;  1F8H A;  1SNL A;  1XFY O;  2GGM A;  3VRR A;  3R72 A;  4YGD B;  4BY5 A;  3I5H B;  2JT3 A;  3DD4 A;  1NPQ A;  1K93 D;  1RK9 A;  1AHR A;  1PUL A;  1RTP 1;  2P70 A;  2I7A A;  2BE4 A;  1QX2 A;  2KI6 D;  3OX5 A;  3S0B A;  1DTL A;  2JRF A;  1QAT A;  1IJ5 A;  2KI4 B;  1KWO B;  1OOH A;  1YTZ C;  2QEB A;  2ZFD A;  3B7A A;  4DS7 A;  4JQ0 D;  1XA5 A;  3BUN B;  3WXA A;  1UUR A;  2M49 B;  1NP8 A;  1S26 D;  2MJW B;  5AAN A;  1H4B A;  1W7J B;  4GBA A;  2MRD A;  2WC6 A;  1W7I B;  3AAK A;  3FWB A;  1Q80 A;  3FE8 A;  1WRK A;  4WQ3 A;  2VRG A;  1SL7 A;  2QAC A;  2K7O A;  1WLM A;  2BKI B;  1MHO A;  2LMT A;  3K21 A;  1OE9 B;  1LA0 A;  5I2L A;  1A75 A;  3L47 A;  3CYZ A;  2E6W A;  3I5F C;  4N1G A;  1TTX A;  1S6J A;  2M3W A;  4FTG A;  1ALV A;  2MLF C;  3DVJ A;  2H2K A;  3TDI A;  1NYA A;  2GGZ A;  4L9M A;  1REC A;  2ZKM X;  5D7F A;  4HRE E;  2GV5 A;  1J55 A;  3CZ2 A;  4GNK B;  2K7B A;  1ORG A;  2WCF A;  3BOW A;  1CFP A;  1EH2 A;  5GQQ C;  2WCB A;  4D1E A;  1FPW A;  3SS5 A;  4PHJ A;  5CSF A;  3SG7 A;  3S0F A;  1CFF A;  1SCM B;  1SY9 A;  2F8P A;  1L2O C;  2G2B A;  1ALW A;  2KLD A;  3FE9 A;  5AFP A;  1K9U A;  2AUC A;  3BUO B;  1YX8 A;  2WOR A;  4YGB B;  1CNP A;  1K96 A;  1KFX L;  1N0Y A;  2EC6 C;  2L5Y A;  2M1U A;  1CLL A;  4ZCV A;  3O78 A;  2OPO A;  5HL1 A;  3WHU B;  1AVS A;  1DEK A;  3FWC A;  4PHN A;  5FI2 A;  2KFG A;  2L4H A;  3CTN A;  3D0Y A;  1SYM A;  1WDC C;  2LE9 B;  2MHH A;  1SR6 C;  1Y0V H;  1KFU S;  4DCK A;  2MBX A;  2EGD A;  1U5I B;  4AQJ A;  1JF2 A;  5FYX A;  4MEW A;  5CSI A;  1NIW A;  2K61 A;  2LHI A;  1YVL A;  1QAS A;  1QWV A;  3B86 A;  4MBE A;  5HKY A;  2AAO A;  3EVR A;  3SG3 A;  3BJH A;  1OZO A;  4ORB B;  1IWQ A;  3E3R A;  1TIZ A;  2GTE A;  2JUL A;  2L51 A;  2WND A;  1QTX A;  1CTR A;  1V1F A;  2FCD A;  1DJH A;  1LXF C;  4GFT A;  1QX5 B;  1QVI Z;  1GGW A;  2WC8 A;  4OVN F;  1TCO B;  3VRO A;  2H61 A;  3CS1 A;  1DGU A;  2F3Y A;  5FI6 A;  1OW4 A;  1Z2C B;  1KQM B;  1TNX A;  1GM0 A;  1YRU B;  2NLN A;  1J7R A;  2I18 A;  2L4I A;  3C1V A;  1TNQ A;  2BE6 A;  2ISD A;  1ZFS A;  4YGA A;  1R2U A;  3O4X A;  3TUY C;  1G4Y R;  2SCP A;  1K9K A;  5EL2 A;  1L2O B;  5HKW A;  3V2L A;  3DF0 A;  3B6X A;  1A4P A;  2WCJ A;  5ER4 X;  2HET A;  1IKU A;  1J1D A;  1M63 B;  1CDM A;  1A75 B;  2K0J A;  4MLW A;  1WRL A;  1DJY A;  1QJT A;  1LIN A;  2EC6 B;  1CMF A;  1KK8 B;  1KSM A;  1M46 A;  2Y1M A;  3NSI A;  1BU3 A;  3O4Y A;  4FQT A;  4CFR A;  1TRF A;  1SMG A;  1XFZ O;  2BBN A;  3UNW A;  2K2F A;  3AKB A;  1K95 A;  1CDP A;  5J3X A;  1BLQ A;  4HRH A;  1XFU O;  2PVB A;  1DVI A;  2PAL A;  1YUR A;  2LVJ A;  2H61 C;  2NXQ A;  3PJI A;  5IBW A;  2QDI A;  1NUB A;  3BOW B;  1WRZ A;  1SR6 B;  2M7N A;  1X02 A;  3TS5 C;  1B8C A;  4NDB A;  1N2D A;  2ERB A;  3MSE B;  4XJK A;  1EG3 A;  3CGA A;  1MXE A;  2P71 A;  3QRX A;  1BF5 A;  2LNK A;  5KSZ A;  1Y1A A;  1NX2 A;  1UHN A;  4ICB A;  3AAJ A;  2LCP A;  2JZI A;  3GOF A;  1JUO A;  3D77 A;  1HQV A;  2M1K B;  3QME A;  1C3Y A;  3B87 A;  2A4J A;  1TN4 A;  2NCO A;  5HLO A;  2WCE A;  3DVM A;  2MAZ A;  1DJI A;  3LK0 A;  2L98 A;  3EK4 A;  4BY4 A;  1J7P A;  1OQP A;  1XFV O;  1AJ4 A;  2JT8 A;  4PDZ A;  4A4B A;  5KTY A;  4F7F A;  1CDN A;  5AEQ A;  3LL8 B;  1S5G Y;  1Y1U A;  4YI8 A;  3D0Y B;  1DQE A;  1DMO A;  1RWY A;  1CLM A;  1J7Q A;  2HPS A;  4ORC B;  1DEL A;  4P2Y B;  2LAP A;  3I5G C;  3CDN A;  2BCA A;  1FBV A;  3O2P A;  3OB2 B;  2OTG C;  3TUY B;  3S0E A;  3D74 A;  5I2Q A;  2MA2 A;  1TUZ A;  2LHL A;  5HLV A;  1AUI B;  2R2I A;  3EK8 A;  3NSL A;  4JPZ B;  4PAL A;  3KEV A;  1BR4 B;  1LA3 A;  3I5I B;  3NSK A;  1JWD A;  2KNE A;  2CXJ A;  4MVF A;  2JPT A;  1CFC A;  3PLF B;  1HT9 A;  4OCI A;  3VRP A;  1QIW A;  2L2C A;  3R1O A;  1BOC A;  5D3O A;  1JBA A;  2LLT A;  2LMV A;  4C0J A;  1BG1 A;  1A2X A;  3PSR A;  2B1U A;  1YUS A;  3BUX B;  1QIV A;  1YRT B;  4PE7 A;  1SL8 A;  4M2Q A;  3BFH A;  1S5G Z;  2OS8 C;  2KQ6 A;  2JPO A;  1OOJ A;  1VRK A;  4P5O E;  1B47 A;  1Z4H A;  2LVV A;  2BAP A;  1F71 A;  3VRQ A;  1UHH A;  1Y6W A;  2COL B;  2LC5 A;  5G08 A;  1J1E A;  3KHE A;  2JNF A;  1A03 A;  2CBL A;  2LLU A;  1S3P A;  3CR5 X;  3SS4 A;  5DIC A;  2JTZ A;  4PHK A;  1IIO A;  2QPT A;  1M31 A;  3DF0 B;  3OB1 B;  1C07 A;  2CCM A;  3LCP C;  3DY9 A;  4YGE B;  3D78 A;  5JJG A;  3CR2 A;  1CM1 A;  3H4S E;  1TNW A;  3FS7 A;  4AOM A;  2EHB A;  4XYN A;  2ZRS A;  3PN7 C;  2JU0 A;  5ER5 A;  1PSR A;  1UP5 A;  3D73 A;  2KBI A;  4UPG A;  5K89 A;  1QV1 A;  1NCZ A;  2WCK A;  3BFB A;  3NGV A;  3TZ1 A;  1JFJ A;  4NDD A;  1K9P A;  1KQV A;  2PMY A;  3FE6 A;  2JOJ A;  2KLE A;  1M39 A;  4WRI A;  1K90 D;  4A4C A;  4JKT A;  1G33 A;  2OTG B;  4HSZ A;  4M2O A;  3RM1 A;  1GJY A;  4CPV A;  4CFQ A;  4CLN A;  4QJ4 B;  1CMG A;  1PRW A;  2CT9 A;  2K8M B;  1B1G A;  1KSO A;  1MWN A;  4I5L B;  1KK7 Y;  2LV7 A;  3I5F B;  3D10 A;  2JC2 A;  1CM4 A;  4YBH B;  4DIR A;  4AQI A;  4GUK A;  2KAV A;  1M45 A;  1FF1 A;  1MF8 B;  3OP0 A;  1KFX S;  1DT7 B;  4IL1 A;  1F70 A;  2JTT A;  3D75 A;  3SS3 A;  3VGO A;  1YR5 A;  2QEV A;  3PM2 A;  3WHT B;  1OSA A;  2AMI A;  3JTD C;  1IH0 A;  2KFF A;  2LVI A;  2LLS A;  2Y4Q A;  4OKH A;  4OV2 A;  3SG2 A;  1SBJ A;  2M29 A;  2KAX A;  1OOG A;  1BJF A;  1CB1 A;  4I5K A;  1KCY A;  1QS7 A;  2M8U A;  2RGI A;  2ZRT A; 
#chains in the Genus database with same CATH homology
 1SSE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...