1SSEB

Solution structure of the oxidized form of the yap1 redox domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
NGSSLQNADKINNGNDNDNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-1 like transcription factor YAP1
publication title Structural basis for redox regulation of Yap1 transcription factor localization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription activator
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.100 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 YAP1 redox domain. Chain B 1sseB00
1SSEB
chains in the Genus database with same CATH superfamily
5I94A 1MR8A 1QLKA 1DQEA 1XFXO 1EL4A 1M45A 2BE4A 1UHKA 3O4XA 2K2FA 4MN0A 2KHNA 3K1EA 1DC1A 4GGFA 4PHNA 4ZCUA 1IIOA 3TUYC 4FQTA 1B8CA 3BOWA 1KWOC 1QX7A 1S5GZ 1SR6C 1TRFA 2LVJA 3SG7A 3WHTB 4PT1A 3PN7C 1KQMC 3TDUA 1QXPA 5I8NA 2IS9A 4ICBA 2PQLA 2ZFDA 2CBLA 1Z4HA 3GK1A 4FQOA 1KFXS 1J7PA 1F4QA 1TNPA 3I5IB 3JVTB 4JWQA 3UNWA 1CDMA 2MLEC 3EK7A 2KGBC 2B1UA 5DKNA 1PK0D 3I5HB 4YGCB 3E3RA 1P28A 1QATA 2FJYA 3BOWB 3I5GC 4DCKA 3NXAA 5KSZA 3NHTA 1ZMZA 3VRNA 2M29A 3SS5A 1KSOA 1LVCD 1WRKA 5ER5A 3B88A 2QEHA 1JSAA 1J55A 2BBMA 2COLB 2P70A 3CZ2A 1TCFA 4PHKA 2PVBA 5JJGA 1UHJA 1L2OB 1XO5A 2HPSA 1JWDA 2KGRA 5FYXA 2MLFC 3BYAA 1AJ4A 3CTNA 1BU3A 2GTEA 5I2OA 1BJFA 2WCFA 3TZ1A 2PYQA 5I2LA 3SIAA 3D10A 4CFQA 3TUYB 1TTXA 2ERBA 3BFHA 1KWOB 1SR6B 3O4YA 4GFTA 2L5YA 2L2EA 2K7OA 3PN7B 2LVIA 1XK4A 3D73A 3PATA 3AAJA 1EG3A 2K7CA 1K8UA 1VRKA 1ZFSA 4P2YB 2KAVA 4INXA 3VROA 1B9AA 1NP8A 1BMOA 2JNFA 2M7NA 4C0LA 1TWOA 1CLLA 1SSEB 2KI4C 1BR1B 1UUSA 1K2HA 2JRFA 1CFCA 1SMGA 4PDZA 1CM4A 1CLBA 4N5XA 1A2XA 1CB1A 4GBAA 1SL9A 2LAPA 4HRGA 4ETOA 4D1EA 1LS8A 1CTRA 2CTNA 2HQWA 1Q80A 2M8UA 1M31A 2Y5IA 1J1EA 1NSHA 1XFYO 1QVIY 2NCPA 2M97A 3RZSA 2NLNA 2WOSA 3R72A 3LLEA 1HT9A 2TN4A 3D77A 1B47A 2KQYA 1DF0B 4HRHA 1L7ZA 2MRDA 3S0EA 4ORBB 2BCAA 1LA0A 2WC8A 1V1FA 1F4OA 1C7VA 2KPHA 1OZSA 3OB2B 3R1PA 2M1UA 4PE4A 1K96A 3PM8A 1UP5A 1TNWA 2LM5A 2FCEA 3UO9A 1S3PA 3FE8A 4GNKB 4N1FA 2BKIB 2D8NA 1CFFA 1ORGA 1GGWA 2I18A 1SPYA 3PLFB 2JZIA 5AERA 3VRQA 1S26D 2MBXA 2MHHA 4M2OA 5FI7A 1PSBA 1J7RA 2QEOA 4PCWA 3FIAA 1Y1XA 2KFFA 3D0YB 1NCYA 3BUMB 1CDPA 3DZTA 3KEVA 4YGAA 4AQIA 3KPXA 1UWOA 2BBNA 1K9PA 1GGZA 2FOTA 2K61A 3CLNA 3EVVA 4N1GA 4CIDA 1MF8B 3DVJA 3EVRA 1DGVA 2LE9B 2KI4B 4NDCA 1R2UA 1DJHA 2JTZA 4GGFC 5BPJA 1JFJA 1MUXA 1OQPA 3OBVA 4QJ5B 1F55A 1XFZO 1OMDA 1YX7A 2LVVA 2P6BB 1DEKA 2PASA 2JC2A 1C3ZA 2BCXA 3CR2A 3SG2A 2ZNEA 4IJ7A 1RWYA 1DJXA 1LINA 3OHMB 4PE0A 1N0YA 3EKHA 3RM1A 3SG3A 1EH2A 2F2OA 2QDIA 3TS5C 1A75A 1J7QA 1J7OA 3BFBA 5D7FA 1DJIA 1FF1A 3EVUA 3CR5X 4Q04A 4XJKB 4BY5A 2JOJA 4KYNA 4ORCB 1PVBA 2I2RE 2KFHA 1KK7Y 1DVIA 3N7HA 3B86A 5CSIA 2ZRTA 1GQMA 3DD4A 1U5IA 5CSJA 3S0FA 2AUCA 1QLSA 2F8PA 3EG5B 1F70A 2LLTA 2JNXA 2O60A 1G4YR 1NX3A 2Q91A 3MSEB 1JC2A 4DS7A 1GM0A 2L51A 1MQ1A 1QWVA 1A75B 2OS8B 3BUNB 1C3YA 3QMEA 1RFJA 2L2CA 1OOFA 3BQ3A 1B7TY 4MRXA 1PALA 2JXCA 1ZOTB 4AQJA 2KI6C 4OVNF 1CKKA 1NWDA 2PMYA 2YGUA 4F0ZB 3DYEA 1XFUO 2FCDA 3A4UB 1NCZA 1SYMA 1RK9A 4WQ3A 1U5IB 2JULA 2L4HA 1ZUZA 4MSPA 1DT7B 1UHHA 5HL1A 3NSLA 1JF2A 3LK0A 1M39A 1DJWA 2LHLA 1UHIA 5HYDA 2L98A 4MZKA 1IRJA 1HQVA 1OOGA 1DJYA 1XK4C 2KYFA 4C0JA 5GQQC 4YRUA 3M0WA 1SKTA 5AXIA 3TS5B 3CWGA 4BY4A 3PFVA 5IBWA 3B7AA 3BJHA 3D74A 3L4AA 1TIZA 1B8LA 4CPVA 5CSNA 1S6CA 1BT6A 3K21A 2JPTA 2BKHB 3CDNA 2MAZA 2KBMA 3OB1B 1K94A 2OTGC 3DY9A 3AAKA 5F6TA 1NX0A 5ER4X 1IG5A 3ICBA 1OMVA 1MWNA 1WDCC 1WRZA 1X02A 2K7BA 3HX4A 4OKHA 4R1EA 2F33A 1ZACA 1YR5A 3GK4X 3O78A 1XFWO 3BUOB 3IVTA 1JF0A 4MRYA 2K0JA 4MZJA 1N65A 2GGMA 1YUUA 2A4JA 2KAYA 2QEVA 4AOMA 1KK7Z 3KHEA 1OOJA 1KQMB 5TNCA 1AP4A 1CMFA 1KFXL 2ZN9A 3I5FC 1MXLC 4HREE 1C7WA 2LV7A 1BF5A 2LHIA 4OV2A 1NPQA 4DRWA 1XFVO 1UHNA 2KLDA 2MA2A 1GJYA 2MJWB 2F3ZA 4F7FA 2BL0C 2L0PA 1WLZA 2QACA 1T14A 1H8BA 1DMOA 3NGVA 4PALA 1PSRA 1CMGA 2BNXA 1LA3A 1QX2A 3I5GB 1IGVA 4L9MA 4MLWA 5EL2A 3SJSA 4E68A 5HKZA 3CR4X 1RJVA 1Y1UA 3GK2A 1EXRA 1A4PA 4MZLA 4YGEB 1JUOA 2WCBA 2I7AA 1KCYA 1YVHA 4PHMA 2ZNDA 4PE1A 1FPWA 2G2BA 1OW4A 5AANA 1KK8C 2JT3A 5HKYA 2L50A 2KNEA 1TNXA 2EC6C 4CFRA 1DTLA 2OTGB 5CPVA 2NCOA 1Z2CB 3A8RA 2WNDA 1G8IA 5AEQA 2LUXA 1CDNA 1JFKA 1RROA 3SIBA 3IF7A 1B8RA 2LLSA 1YX8A 2KI6D 3VRRA 1AJ5A 1QX5B 3VGOA 1F71A 2CXJA 3B6XA 4PE7A 1FI6A 1BLQA 1S5GY 5FI6A 2VRGA 2G9BA 3BXKA 3LK1A 3I5FB 3OP0A 2HETA 1YTZC 1WY9A 2WCHA 3WHUB 4YGBB 1B1GA 2P71A 1SW8A 1QV0A 2H2KA 2KLEA 2OPOA 1M63B 2HF5A 1Y0VH 3FWBA 2RGIA 3BUXB 3FS7A 4I5JA 4INWA 3CGAA 3DF0A 2LP3A 5D3OA 1F54A 2LC5A 1A03A 2LP2A 3BFAA 4GPLB 4I5LB 4QJ4B 1LKJA 4USLA 5HLVA 4I5KA 1IQ3A 1UURA 3OX6A 1AK8A 1QJTA 5K89A 1SBJA 1BG1A 2QEBA 3FWCA 4NQGA 3I5IC 2BE6A 2QPTA 3DVMA 4DIRA 4NDBA 3EK8A 2SASA 1K93D 1DJZA 5KU1A 3S0AA 2PALA 3Q8IA 1EG4A 3V2LA 1TOPA 2CNPA 2LMUA 4ORAB 1QVIZ 3H4SE 2WC5A 3DF0B 1SNLA 2SCPA 4GUKA 1S6JA 1W7JB 1FBVA 2K7DA 4HSZA 4YBHB 2E6WA 5HKWA 1CNPA 5I2QA 2O5GA 2JTTA 5FI2A 1OOHA 4ZCVA 4M2QA 2M7LA 3WNXB 2KDHA 3LL8B 1L2OC 1TUZA 1RECA 2V53A 1MXEA 1FW4A 4OCIA 1SRAA 1PVAA 2Y1MA 3AKBA 3D75A 2ISDA 1CLMA 4IL1A 4QJ3B 1PULA 2FJUB 2E30A 4OR9B 3SG6A 3SS4A 1RTP1 1DELA 2BAPA 1QIVA 1WRLA 1ALWA 1Y1AA 3VRPA 2AMIA 1BODA 2F3YA 1SCVA 1AHRA 3IQOA 4MBEA 3VB1A 3EK4A 2HQ8A 3D78A 3TDZA 2K8MB 3F45A 1NX2A 1JBAA 1NUBA 1W9ZA 1FI5A 1SCMC 3ZNIA 4JD9A 1K90D 3L47A 1KFUS 3KO0A 2BECA 3DVEA 3O2PA 2PRUA 3PSRA 1J1DA 2R2IA 2ZRSA 3B87A 1Y6WA 2M1KB 2WCKA 3AKAA 1H4BA 5DKRA 4CLNA 1OMRA 3NSKA 1QIWA 1AUIB 2WCLA 3PM2A 4P5OE 1KQVA 1K9KA 3JTDC 1YRTB 2K2AA 3DVKA 5D69A 2H8VA 4C0KA 1QV1A 1E8AA 3C1VA 3S0BA 1D1OA 2K60A 4NDDA 3GOFA 2LUCA 1IQ5A 4YGDB 4JKTA 1YRUB 1XYDA 2JQ6A 2WCEA 2KQ6A 3CYZA 3IQQA 5CSFA 3WXAA 2LMVA 3TDIA 2CCMA 3OGNA 1A29A 1NCXA 1B7TZ 1M46A 1OE9B 3NHIA 5PALA 1XVJA 1S36A 1TNQA 3O6BA 5J3XA 2ZKMX 4MVFA 3OX5A 2LVKA 2KBIA 3D76A 2Y1NA 3FE9A 1SCMB 1OZOA 3EKJA 1CM1A 2JT0A 1NX1A 2ZN8A 2H61C 2M49B 1KFUL 2DOQA 2LANA 1N2DA 2LMTA 3RLZA 1LXFC 2LLUA 2Y4QA 1DF0A 1NIWA 1YUTA 4WRIA 1SL7A 1V1GA 1IJ6A 1SK6D 2JXLA 2L4IA 1AVSA 5KTYA 3R1OA 3S0GA 4JQ0D 1WDCB 1IKUA 4A4CA 2KYCA 1KSMA 3NSIA 1ODBA 1YURA 4UPGA 1TUJA 2EHBA 3CZ1A 3JTDB 5DICA 3S0DA 3PALA 1QASA 4I5NB 4M2PA 2M9GA 2BCBA 1YVLA 2JPOA 3FE6A 2Q4UA 3D0YA 1S1EA 3CABA 1G33A 1K95A 2WC6A 4WQ2A 1OOIX 2H61A 5G08A 1C07A 4PHJA 2I94A 4A4BA 2BL0B 4XYNA 2L5XB 3L4LA 1BOCA 2AAOA 2KSPA 3ZWHA 1CFDA 1IH0A 2OS8C 2PSRA 1F8HA 1B4CA 5DKQA 2CT9A 1S6IA 2JT8A 2EGDA 1ALVA 2GGZA 2LNKA 2WORA 3PJIA 4OZDA 2NZ0A 3JVTC 2WCJA 4GAOA 4XJKA 1DJGA 1TCOB 3CZ0A 3SG5A 5AFPA 2JU0A 1DGUA 4DUQA 1K9UA 4JPZB 1WLMA 2F2PA 1KK8B 3SS3A 3I5HC 2KAXA 3LCPC 1CDLA 1IWQA 1R6PA 2EC6B 1QTXA 3HCMA 5B8IB 4FTGA 2KOTA 3SG4A 3NSOA 2GV5A 1OSAA 3R1VA 1EJ3A 1PRWA 2NXQA 3CZTX 4TNCA 1NYAA 5HLOA 2KFGA 3QRXA 2WCMA 2LCPA 1QS7A 4YI9A 1IJ5A 1BR4B 1W7IB 1XFRA 2M3WA 3KF9A 1TN4A 1SY9A 3DXLA 4MEWA 1XA5A 1SL8A 4U8DA 3BUWB 1CFPA 3CS1A 4GGNA 1YUSA 5JOLA 2JWWA 4YI8A 1MHOA 2M0RA
chains in the Genus database with same CATH topology
1SSEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSE B; 
#chains in the Genus database with same CATH topology
 5I94 A;  1MR8 A;  1QLK A;  1DQE A;  1XFX O;  1EL4 A;  1M45 A;  2BE4 A;  1UHK A;  3O4X A;  2K2F A;  4MN0 A;  2KHN A;  3K1E A;  1DC1 A;  4GGF A;  4PHN A;  4ZCU A;  1IIO A;  3TUY C;  4FQT A;  1B8C A;  3BOW A;  1KWO C;  1QX7 A;  1S5G Z;  1SR6 C;  1TRF A;  2LVJ A;  3SG7 A;  3WHT B;  4PT1 A;  3PN7 C;  1KQM C;  3TDU A;  1QXP A;  5I8N A;  2IS9 A;  4ICB A;  2PQL A;  2ZFD A;  2CBL A;  1Z4H A;  3GK1 A;  4FQO A;  1KFX S;  1J7P A;  1F4Q A;  1TNP A;  3I5I B;  3JVT B;  4JWQ A;  3UNW A;  1CDM A;  2MLE C;  3EK7 A;  2KGB C;  2B1U A;  5DKN A;  1PK0 D;  3I5H B;  4YGC B;  3E3R A;  1P28 A;  1QAT A;  2FJY A;  3BOW B;  3I5G C;  4DCK A;  3NXA A;  5KSZ A;  3NHT A;  1ZMZ A;  3VRN A;  2M29 A;  3SS5 A;  1KSO A;  1LVC D;  1WRK A;  5ER5 A;  3B88 A;  2QEH A;  1JSA A;  1J55 A;  2BBM A;  2COL B;  2P70 A;  3CZ2 A;  1TCF A;  4PHK A;  2PVB A;  5JJG A;  1UHJ A;  1L2O B;  1XO5 A;  2HPS A;  1JWD A;  2KGR A;  5FYX A;  2MLF C;  3BYA A;  1AJ4 A;  3CTN A;  1BU3 A;  2GTE A;  5I2O A;  1BJF A;  2WCF A;  3TZ1 A;  2PYQ A;  5I2L A;  3SIA A;  3D10 A;  4CFQ A;  3TUY B;  1TTX A;  2ERB A;  3BFH A;  1KWO B;  1SR6 B;  3O4Y A;  4GFT A;  2L5Y A;  2L2E A;  2K7O A;  3PN7 B;  2LVI A;  1XK4 A;  3D73 A;  3PAT A;  3AAJ A;  1EG3 A;  2K7C A;  1K8U A;  1VRK A;  1ZFS A;  4P2Y B;  2KAV A;  4INX A;  3VRO A;  1B9A A;  1NP8 A;  1BMO A;  2JNF A;  2M7N A;  4C0L A;  1TWO A;  1CLL A;  1SSE B;  2KI4 C;  1BR1 B;  1UUS A;  1K2H A;  2JRF A;  1CFC A;  1SMG A;  4PDZ A;  1CM4 A;  1CLB A;  4N5X A;  1A2X A;  1CB1 A;  4GBA A;  1SL9 A;  2LAP A;  4HRG A;  4ETO A;  4D1E A;  1LS8 A;  1CTR A;  2CTN A;  2HQW A;  1Q80 A;  2M8U A;  1M31 A;  2Y5I A;  1J1E A;  1NSH A;  1XFY O;  1QVI Y;  2NCP A;  2M97 A;  3RZS A;  2NLN A;  2WOS A;  3R72 A;  3LLE A;  1HT9 A;  2TN4 A;  3D77 A;  1B47 A;  2KQY A;  1DF0 B;  4HRH A;  1L7Z A;  2MRD A;  3S0E A;  4ORB B;  2BCA A;  1LA0 A;  2WC8 A;  1V1F A;  1F4O A;  1C7V A;  2KPH A;  1OZS A;  3OB2 B;  3R1P A;  2M1U A;  4PE4 A;  1K96 A;  3PM8 A;  1UP5 A;  1TNW A;  2LM5 A;  2FCE A;  3UO9 A;  1S3P A;  3FE8 A;  4GNK B;  4N1F A;  2BKI B;  2D8N A;  1CFF A;  1ORG A;  1GGW A;  2I18 A;  1SPY A;  3PLF B;  2JZI A;  5AER A;  3VRQ A;  1S26 D;  2MBX A;  2MHH A;  4M2O A;  5FI7 A;  1PSB A;  1J7R A;  2QEO A;  4PCW A;  3FIA A;  1Y1X A;  2KFF A;  3D0Y B;  1NCY A;  3BUM B;  1CDP A;  3DZT A;  3KEV A;  4YGA A;  4AQI A;  3KPX A;  1UWO A;  2BBN A;  1K9P A;  1GGZ A;  2FOT A;  2K61 A;  3CLN A;  3EVV A;  4N1G A;  4CID A;  1MF8 B;  3DVJ A;  3EVR A;  1DGV A;  2LE9 B;  2KI4 B;  4NDC A;  1R2U A;  1DJH A;  2JTZ A;  4GGF C;  5BPJ A;  1JFJ A;  1MUX A;  1OQP A;  3OBV A;  4QJ5 B;  1F55 A;  1XFZ O;  1OMD A;  1YX7 A;  2LVV A;  2P6B B;  1DEK A;  2PAS A;  2JC2 A;  1C3Z A;  2BCX A;  3CR2 A;  3SG2 A;  2ZNE A;  4IJ7 A;  1RWY A;  1DJX A;  1LIN A;  3OHM B;  4PE0 A;  1N0Y A;  3EKH A;  3RM1 A;  3SG3 A;  1EH2 A;  2F2O A;  2QDI A;  3TS5 C;  1A75 A;  1J7Q A;  1J7O A;  3BFB A;  5D7F A;  1DJI A;  1FF1 A;  3EVU A;  3CR5 X;  4Q04 A;  4XJK B;  4BY5 A;  2JOJ A;  4KYN A;  4ORC B;  1PVB A;  2I2R E;  2KFH A;  1KK7 Y;  1DVI A;  3N7H A;  3B86 A;  5CSI A;  2ZRT A;  1GQM A;  3DD4 A;  1U5I A;  5CSJ A;  3S0F A;  2AUC A;  1QLS A;  2F8P A;  3EG5 B;  1F70 A;  2LLT A;  2JNX A;  2O60 A;  1G4Y R;  1NX3 A;  2Q91 A;  3MSE B;  1JC2 A;  4DS7 A;  1GM0 A;  2L51 A;  1MQ1 A;  1QWV A;  1A75 B;  2OS8 B;  3BUN B;  1C3Y A;  3QME A;  1RFJ A;  2L2C A;  1OOF A;  3BQ3 A;  1B7T Y;  4MRX A;  1PAL A;  2JXC A;  1ZOT B;  4AQJ A;  2KI6 C;  4OVN F;  1CKK A;  1NWD A;  2PMY A;  2YGU A;  4F0Z B;  3DYE A;  1XFU O;  2FCD A;  3A4U B;  1NCZ A;  1SYM A;  1RK9 A;  4WQ3 A;  1U5I B;  2JUL A;  2L4H A;  1ZUZ A;  4MSP A;  1DT7 B;  1UHH A;  5HL1 A;  3NSL A;  1JF2 A;  3LK0 A;  1M39 A;  1DJW A;  2LHL A;  1UHI A;  5HYD A;  2L98 A;  4MZK A;  1IRJ A;  1HQV A;  1OOG A;  1DJY A;  1XK4 C;  2KYF A;  4C0J A;  5GQQ C;  4YRU A;  3M0W A;  1SKT A;  5AXI A;  3TS5 B;  3CWG A;  4BY4 A;  3PFV A;  5IBW A;  3B7A A;  3BJH A;  3D74 A;  3L4A A;  1TIZ A;  1B8L A;  4CPV A;  5CSN A;  1S6C A;  1BT6 A;  3K21 A;  2JPT A;  2BKH B;  3CDN A;  2MAZ A;  2KBM A;  3OB1 B;  1K94 A;  2OTG C;  3DY9 A;  3AAK A;  5F6T A;  1NX0 A;  5ER4 X;  1IG5 A;  3ICB A;  1OMV A;  1MWN A;  1WDC C;  1WRZ A;  1X02 A;  2K7B A;  3HX4 A;  4OKH A;  4R1E A;  2F33 A;  1ZAC A;  1YR5 A;  3GK4 X;  3O78 A;  1XFW O;  3BUO B;  3IVT A;  1JF0 A;  4MRY A;  2K0J A;  4MZJ A;  1N65 A;  2GGM A;  1YUU A;  2A4J A;  2KAY A;  2QEV A;  4AOM A;  1KK7 Z;  3KHE A;  1OOJ A;  1KQM B;  5TNC A;  1AP4 A;  1CMF A;  1KFX L;  2ZN9 A;  3I5F C;  1MXL C;  4HRE E;  1C7W A;  2LV7 A;  1BF5 A;  2LHI A;  4OV2 A;  1NPQ A;  4DRW A;  1XFV O;  1UHN A;  2KLD A;  2MA2 A;  1GJY A;  2MJW B;  2F3Z A;  4F7F A;  2BL0 C;  2L0P A;  1WLZ A;  2QAC A;  1T14 A;  1H8B A;  1DMO A;  3NGV A;  4PAL A;  1PSR A;  1CMG A;  2BNX A;  1LA3 A;  1QX2 A;  3I5G B;  1IGV A;  4L9M A;  4MLW A;  5EL2 A;  3SJS A;  4E68 A;  5HKZ A;  3CR4 X;  1RJV A;  1Y1U A;  3GK2 A;  1EXR A;  1A4P A;  4MZL A;  4YGE B;  1JUO A;  2WCB A;  2I7A A;  1KCY A;  1YVH A;  4PHM A;  2ZND A;  4PE1 A;  1FPW A;  2G2B A;  1OW4 A;  5AAN A;  1KK8 C;  2JT3 A;  5HKY A;  2L50 A;  2KNE A;  1TNX A;  2EC6 C;  4CFR A;  1DTL A;  2OTG B;  5CPV A;  2NCO A;  1Z2C B;  3A8R A;  2WND A;  1G8I A;  5AEQ A;  2LUX A;  1CDN A;  1JFK A;  1RRO A;  3SIB A;  3IF7 A;  1B8R A;  2LLS A;  1YX8 A;  2KI6 D;  3VRR A;  1AJ5 A;  1QX5 B;  3VGO A;  1F71 A;  2CXJ A;  3B6X A;  4PE7 A;  1FI6 A;  1BLQ A;  1S5G Y;  5FI6 A;  2VRG A;  2G9B A;  3BXK A;  3LK1 A;  3I5F B;  3OP0 A;  2HET A;  1YTZ C;  1WY9 A;  2WCH A;  3WHU B;  4YGB B;  1B1G A;  2P71 A;  1SW8 A;  1QV0 A;  2H2K A;  2KLE A;  2OPO A;  1M63 B;  2HF5 A;  1Y0V H;  3FWB A;  2RGI A;  3BUX B;  3FS7 A;  4I5J A;  4INW A;  3CGA A;  3DF0 A;  2LP3 A;  5D3O A;  1F54 A;  2LC5 A;  1A03 A;  2LP2 A;  3BFA A;  4GPL B;  4I5L B;  4QJ4 B;  1LKJ A;  4USL A;  5HLV A;  4I5K A;  1IQ3 A;  1UUR A;  3OX6 A;  1AK8 A;  1QJT A;  5K89 A;  1SBJ A;  1BG1 A;  2QEB A;  3FWC A;  4NQG A;  3I5I C;  2BE6 A;  2QPT A;  3DVM A;  4DIR A;  4NDB A;  3EK8 A;  2SAS A;  1K93 D;  1DJZ A;  5KU1 A;  3S0A A;  2PAL A;  3Q8I A;  1EG4 A;  3V2L A;  1TOP A;  2CNP A;  2LMU A;  4ORA B;  1QVI Z;  3H4S E;  2WC5 A;  3DF0 B;  1SNL A;  2SCP A;  4GUK A;  1S6J A;  1W7J B;  1FBV A;  2K7D A;  4HSZ A;  4YBH B;  2E6W A;  5HKW A;  1CNP A;  5I2Q A;  2O5G A;  2JTT A;  5FI2 A;  1OOH A;  4ZCV A;  4M2Q A;  2M7L A;  3WNX B;  2KDH A;  3LL8 B;  1L2O C;  1TUZ A;  1REC A;  2V53 A;  1MXE A;  1FW4 A;  4OCI A;  1SRA A;  1PVA A;  2Y1M A;  3AKB A;  3D75 A;  2ISD A;  1CLM A;  4IL1 A;  4QJ3 B;  1PUL A;  2FJU B;  2E30 A;  4OR9 B;  3SG6 A;  3SS4 A;  1RTP 1;  1DEL A;  2BAP A;  1QIV A;  1WRL A;  1ALW A;  1Y1A A;  3VRP A;  2AMI A;  1BOD A;  2F3Y A;  1SCV A;  1AHR A;  3IQO A;  4MBE A;  3VB1 A;  3EK4 A;  2HQ8 A;  3D78 A;  3TDZ A;  2K8M B;  3F45 A;  1NX2 A;  1JBA A;  1NUB A;  1W9Z A;  1FI5 A;  1SCM C;  3ZNI A;  4JD9 A;  1K90 D;  3L47 A;  1KFU S;  3KO0 A;  2BEC A;  3DVE A;  3O2P A;  2PRU A;  3PSR A;  1J1D A;  2R2I A;  2ZRS A;  3B87 A;  1Y6W A;  2M1K B;  2WCK A;  3AKA A;  1H4B A;  5DKR A;  4CLN A;  1OMR A;  3NSK A;  1QIW A;  1AUI B;  2WCL A;  3PM2 A;  4P5O E;  1KQV A;  1K9K A;  3JTD C;  1YRT B;  2K2A A;  3DVK A;  5D69 A;  2H8V A;  4C0K A;  1QV1 A;  1E8A A;  3C1V A;  3S0B A;  1D1O A;  2K60 A;  4NDD A;  3GOF A;  2LUC A;  1IQ5 A;  4YGD B;  4JKT A;  1YRU B;  1XYD A;  2JQ6 A;  2WCE A;  2KQ6 A;  3CYZ A;  3IQQ A;  5CSF A;  3WXA A;  2LMV A;  3TDI A;  2CCM A;  3OGN A;  1A29 A;  1NCX A;  1B7T Z;  1M46 A;  1OE9 B;  3NHI A;  5PAL A;  1XVJ A;  1S36 A;  1TNQ A;  3O6B A;  5J3X A;  2ZKM X;  4MVF A;  3OX5 A;  2LVK A;  2KBI A;  3D76 A;  2Y1N A;  3FE9 A;  1SCM B;  1OZO A;  3EKJ A;  1CM1 A;  2JT0 A;  1NX1 A;  2ZN8 A;  2H61 C;  2M49 B;  1KFU L;  2DOQ A;  2LAN A;  1N2D A;  2LMT A;  3RLZ A;  1LXF C;  2LLU A;  2Y4Q A;  1DF0 A;  1NIW A;  1YUT A;  4WRI A;  1SL7 A;  1V1G A;  1IJ6 A;  1SK6 D;  2JXL A;  2L4I A;  1AVS A;  5KTY A;  3R1O A;  3S0G A;  4JQ0 D;  1WDC B;  1IKU A;  4A4C A;  2KYC A;  1KSM A;  3NSI A;  1ODB A;  1YUR A;  4UPG A;  1TUJ A;  2EHB A;  3CZ1 A;  3JTD B;  5DIC A;  3S0D A;  3PAL A;  1QAS A;  4I5N B;  4M2P A;  2M9G A;  2BCB A;  1YVL A;  2JPO A;  3FE6 A;  2Q4U A;  3D0Y A;  1S1E A;  3CAB A;  1G33 A;  1K95 A;  2WC6 A;  4WQ2 A;  1OOI X;  2H61 A;  5G08 A;  1C07 A;  4PHJ A;  2I94 A;  4A4B A;  2BL0 B;  4XYN A;  2L5X B;  3L4L A;  1BOC A;  2AAO A;  2KSP A;  3ZWH A;  1CFD A;  1IH0 A;  2OS8 C;  2PSR A;  1F8H A;  1B4C A;  5DKQ A;  2CT9 A;  1S6I A;  2JT8 A;  2EGD A;  1ALV A;  2GGZ A;  2LNK A;  2WOR A;  3PJI A;  4OZD A;  2NZ0 A;  3JVT C;  2WCJ A;  4GAO A;  4XJK A;  1DJG A;  1TCO B;  3CZ0 A;  3SG5 A;  5AFP A;  2JU0 A;  1DGU A;  4DUQ A;  1K9U A;  4JPZ B;  1WLM A;  2F2P A;  1KK8 B;  3SS3 A;  3I5H C;  2KAX A;  3LCP C;  1CDL A;  1IWQ A;  1R6P A;  2EC6 B;  1QTX A;  3HCM A;  5B8I B;  4FTG A;  2KOT A;  3SG4 A;  3NSO A;  2GV5 A;  1OSA A;  3R1V A;  1EJ3 A;  1PRW A;  2NXQ A;  3CZT X;  4TNC A;  1NYA A;  5HLO A;  2KFG A;  3QRX A;  2WCM A;  2LCP A;  1QS7 A;  4YI9 A;  1IJ5 A;  1BR4 B;  1W7I B;  1XFR A;  2M3W A;  3KF9 A;  1TN4 A;  1SY9 A;  3DXL A;  4MEW A;  1XA5 A;  1SL8 A;  4U8D A;  3BUW B;  1CFP A;  3CS1 A;  4GGN A;  1YUS A;  5JOL A;  2JWW A;  4YI8 A;  1MHO A;  2M0R A; 
#chains in the Genus database with same CATH homology
 1SSE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...