3FS7A

Crystal structure of gallus gallus beta-parvalbumin (avian thymic hormone)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVEEFQSLVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Parvalbumin, thymic
publication title Structure of avian thymic hormone, a high-affinity avian beta-parvalbumin, in the Ca2+-free and Ca2+-bound states.
pubmed doi rcsb
source organism Gallus gallus
total genus 41
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3fs7A00
3DVJA 1BODA 5HKWA 1NYAA 2LE9B 2VRGA 1CDNA 1YX7A 1FBVA 4ICBA 4YGAA 2JRFA 2F8PA 1AJ5A 2LUCA 4XJKB 4PCWA 3VRRA 4YGBB 1GJYA 1CLBA 1L2OB 2LVKA 2WCEA 4MRXA 3IF7A 4YGCB 2HQ8A 2KBMA 4OV2A 3PN7C 2LHIA 1TNWA 3C1VA 3EK7A 3JVTB 1S5GZ 1EL4A 5G08A 2JZIA 1PSRA 4PHKA 1YR5A 4C0LA 4GNKB 2JNXA 4ZCVA 4GPLB 1YUTA 2L5XB 4CIDA 3H4SE 2PSRA 1BR1B 2LP3A 2WCBA 3D10A 2JC2A 1PRWA 1UHHA 2LP2A 1B8LA 1QIVA 2GGZA 1KCYA 4JWQA 1SMGA 1MHOA 4Q04A 4BY4A 1X02A 1BJFA 2OTGC 1J7QA 1MXEA 2MLEC 3SG3A 4M2QA 1IQ3A 1DJGA 2COLB 2LVJA 3TDIA 1WLMA 4MZLA 4NQGA 1PSBA 1KQMC 1TRFA 3EK4A 1PVBA 2Y4QA 1PULA 3CGAA 2LLSA 1G4YR 2QPTA 1M45A 4GBAA 1C07A 1UHJA 2KSPA 4PHMA 1NX0A 2TN4A 1CMGA 2LLTA 3PSRA 2KYCA 4YGEB 3EVVA 1SL8A 3FWBA 1CFFA 1NIWA 1XFVO 2FCDA 2MA2A 2FJUB 2Q4UA 2NCOA 4GGNA 2WOSA 1YVHA 2HQWA 1CMFA 5J3XA 1KK8B 1SCVA 4HREE 2KYFA 2NCPA 3PLFB 1FW4A 3LL8B 1DJWA 1K8UA 3SG6A 1QX5B 1MR8A 4MBEA 4GAOA 1AHRA 1LINA 1EXRA 5HYDA 1J1DA 1ZACA 2LVVA 1F8HA 1QLSA 1UHNA 5DKNA 1XFUO 2ZN8A 4I5NB 1IQ5A 1MQ1A 4GFTA 3LLEA 3VRPA 2JXLA 5DKQA 2LMUA 5F6TA 5HKYA 4WRIA 3CS1A 3MSEB 5JOLA 1C7WA 1SKTA 3GK2A 3OX6A 2ISDA 1KWOB 3SJSA 1ZOTB 4MSPA 3DF0A 4PE7A 3EKHA 3O4YA 5ER5A 1B7TY 4FTGA 2ZKMX 1K9KA 1NCYA 2LV7A 5CSIA 1A03A 1RWYA 1DJZA 1KSMA 2Q91A 2I7AA 2CNPA 2LLUA 1LA3A 1LKJA 1TOPA 4DRWA 3ZWHA 4F0ZB 4OVNF 4A4BA 2A4JA 3BQ3A 1DJIA 2L4HA 4C0KA 3I5FC 2F2PA 3OP0A 4IL1A 2CXJA 3DVEA 2M7LA 2JNFA 1FF1A 2BCXA 4BY5A 3PATA 1IJ6A 1A75A 2E30A 3JTDB 5CSFA 2L2EA 4GGFC 3KO0A 2CBLA 4PALA 2ZNEA 2NZ0A 1B7TZ 2BL0B 3BUWB 2LNKA 2KAYA 3PALA 1DT7B 1YVLA 3D0YB 1MXLC 3CLNA 2OS8B 1J1EA 5CSNA 5AXIA 1B8RA 1YTZC 5I2OA 1SW8A 3OHMB 1GQMA 1AK8A 4MLWA 5AFPA 4AOMA 1HT9A 5KTYA 1SR6C 1TTXA 1BF5A 2IS9A 3TZ1A 1HQVA 1UP5A 2HF5A 3BOWB 1C7VA 1F4OA 3M0WA 2ZRTA 1AJ4A 2PRUA 1G33A 5KSZA 1JWDA 1BG1A 1KFXS 3E3RA 3AKBA 1DJHA 2L0PA 1OMRA 2OPOA 2G9BA 3QRXA 4PE1A 5HKZA 1XFXO 2M0RA 2O5GA 1F54A 4PHJA 3BUXB 4OKHA 1A29A 2LM5A 5HLOA 1BT6A 1UHIA 5AERA 5AEQA 2BE6A 1K95A 2E6WA 3CR2A 1S3PA 1AP4A 3LCPC 4DUQA 1J7OA 4QJ5B 4DS7A 1BMOA 3ICBA 4JQ0D 3AAJA 4ETOA 2KQ6A 1NX2A 1K96A 3OB1B 5FYXA 1RTP1 1JF2A 2JTZA 1Y1XA 1OE9B 1CFDA 1JUOA 3O2PA 2EHBA 2BBNA 5D69A 4CFQA 3I5HC 3BYAA 1KK7Z 4ORCB 5B8IB 5I8NA 1RJVA 2LANA 1QLKA 1NX1A 2KI4B 2BECA 4GGFA 3HX4A 4DCKA 1XFWO 2M1KB 4N5XA 1IH0A 1PALA 1OMVA 1VRKA 2LHLA 1IRJA 2K2AA 3TUYB 1YUSA 1QS7A 1F70A 3TS5B 1DF0A 4WQ3A 1BLQA 2MAZA 1JFKA 2NXQA 3OX5A 1CDMA 2P6BB 3EVRA 4E68A 3NSIA 1K94A 1A4PA 1L2OC 2KQYA 4ORBB 5GQQC 1NSHA 3GOFA 2D8NA 4M2PA 2V53A 1ZUZA 4R1EA 1EJ3A 1R2UA 4CLNA 3F45A 1J7PA 1JF0A 3JVTC 4CFRA 3IQQA 4CPVA 2F3ZA 3WHTB 5KU1A 1F55A 4I5JA 2KI6D 1TNPA 1YUUA 3SIBA 2EC6B 3OB2B 1XVJA 1V1FA 1XK4C 1YRUB 3I5IB 1QIWA 3CWGA 4AQIA 1R6PA 1CLLA 2M9GA 1GGZA 1EH2A 3WNXB 2L51A 4U8DA 5TNCA 4XYNA 2PVBA 1UHKA 3CZTX 1NP8A 2KDHA 1DMOA 5K89A 3DD4A 1QV0A 2AAOA 1OSAA 1Y6WA 1SBJA 2LMTA 2K8MB 1WY9A 3A4UB 1M63B 4NDDA 2MLFC 3VRQA 1U5IB 1ZMZA 3WHUB 1M39A 1Y1UA 2RGIA 2HPSA 1SPYA 1JBAA 4P2YB 2K0JA 3GK1A 2LCPA 2PMYA 1JFJA 2MRDA 2F33A 3AAKA 3I5GB 4MEWA 1KK8C 1QX7A 2I18A 2BE4A 1OZSA 1SCMB 4NDBA 4P5OE 3RLZA 4I5KA 2MBXA 2KFHA 2PASA 1SYMA 2BKIB 2LVIA 2CTNA 3FWCA 2BCBA 3HCMA 1CDPA 4XJKA 1OQPA 1SY9A 2JU0A 1WDCB 4M2OA 2QACA 1QASA 1DVIA 4C0JA 1MWNA 2R2IA 3DVKA 3DVMA 4YI8A 2JWWA 1B8CA 1B1GA 1LXFC 1KWOC 1Y0VH 1QV1A 1K90D 2M3WA 1K2HA 1K9UA 1ODBA 3BUNB 1EG3A 3KEVA 2M97A 2F3YA 3KHEA 4PE4A 4YRUA 1FI6A 2O60A 2JULA 3PN7B 1XK4A 4HSZA 2KAXA 3SG5A 4YBHB 1KFXL 4MN0A 1DGVA 4USLA 3DF0B 1RECA 2Y1MA 1H4BA 1SRAA 2KFFA 3IQOA 1QVIZ 4I5LB 1L7ZA 1K9PA 4HRHA 5CPVA 2L98A 1KK7Y 3CTNA 4FQOA 1QTXA 2M1UA 2M29A 2GV5A 2L4IA 1NWDA 2PALA 1PK0D 1CFCA 1YX8A 2SASA 2KOTA 2OTGB 5PALA 1QX2A 1XFZO 3JTDC 5HLVA 1EG4A 3NSKA 1NCZA 3VGOA 2H61C 2JXCA 1SL9A 2KNEA 4OCIA 3FS7A 2BL0C 2DOQA 1KQMB 1A75B 2JT8A 4ZCUA 1KSOA 1M31A 1ZFSA 2EGDA 1AUIB 1E8AA 2Y5IA 1WRLA 1BU3A 1ALWA 1LVCD 2GGMA 2KFGA 2KI6C 2OS8C 1F71A 1QATA 1SL7A 3K21A 1W7IB 3CR4X 3A8RA 1IJ5A 1H8BA 3SG2A 3KF9A 2BCAA 4JPZB 4NDCA 2I94A 2M7NA 2ZRSA 4MZKA 1ALVA 1CNPA 1J7RA 1M46A 3BXKA 1G8IA 3NSOA 1Y1AA 4TNCA 1CM1A 1S6CA 1TCFA 4YI9A 2B1UA 2JOJA 4AQJA 1CTRA 2CT9A 4UPGA 1UWOA 1U5IA 4ORAB 2AUCA 1N65A 3O78A 3GK4X 1AVSA 1IGVA 1SK6D 2KGRA 1TCOB 2AMIA 5JJGA 1YRTB 1DGUA 2M8UA 1F4QA 1CB1A 2Y1NA 5I2LA 1S6IA 5DKRA 1WLZA 4PE0A 1CLMA 3VROA 1JC2A 1NPQA 1LA0A 1KQVA 2K2FA 2KI4C 2MJWB 2WCFA 4QJ4B 1N2DA 2K7BA 1TNQA 2LUXA 3I5FB 1B9AA 4N1FA 1WRKA 2BBMA 2H61A 2G2BA 1RROA 4HRGA 3TUYC 3TS5C 3AKAA 4YGDB 1XA5A 1A2XA 3EK8A 4MZJA 4WQ2A 5IBWA 1CKKA 2KHNA 2K61A 1TIZA 3D0YA 1K93D 5ER4X 1FI5A 1DJXA 2JTTA 1IKUA 1JSAA 1QJTA 2K7CA 2MHHA 3KPXA 4L9MA 4OR9B 1MUXA 4DIRA 5I2QA 3NSLA 4QJ3B 1S36A 2I2RE 1DF0B 1XFYO 2H2KA 3EKJA 3VRNA 1FPWA 1CDLA 3FIAA 2HETA 2FOTA 3BOWA 1NX3A 2LMVA 2EC6C 2KGBC 3LK1A 1W7JB 2K7DA 1OOJA 2LAPA 3I5IC 2FCEA 3O6BA 1KFUL 5BPJA 1RFJA 1OMDA 2CCMA 3EVUA 1TN4A 1S6JA 1QVIY 2LC5A 1SR6B 3TDUA 1CM4A 4N1GA 1DTLA 4PHNA 1DJYA 2ZNDA 1KFUS 4D1EA 3CR5X 2M49B 2JT0A 3WXAA 2L50A 3TDZA 3RM1A 1NUBA 3BUOB 2ZFDA 1BOCA 1V1GA 1NCXA 1CFPA 1J55A 2SCPA 1B4CA 1SNLA 5AANA 1UUSA 1GGWA 5D7FA 1PVAA 3NXAA 4MVFA 2WNDA 1N0YA 1S1EA 3SIAA 1S26D 2JT3A 1MF8B 1Q80A 3SG4A 3BUMB 3PM8A 1XYDA 3I5GC 1IWQA 1TNXA 4A4CA 1XO5A 3LK0A 1OZOA 1SCMC 5CSJA 1B47A 2F2OA 3SG7A 2JQ6A 1RK9A 2ZN9A 3ZNIA 4MRYA 2NLNA 1IG5A 1UURA 2KAVA 1S5GY 3PFVA 3I5HB 2JPTA 2WC8A 4GUKA 1D1OA 1WRZA 1QXPA 2BKHB 2KBIA 2WORA 1BR4B 2K7OA 4PDZA 1WDCC 1YURA
chains in the Genus database with same CATH superfamily
3DVJA 3CZ1A 1BODA 5HKWA 1NYAA 2LE9B 2VRGA 1CDNA 2KLEA 1YX7A 1FBVA 4ICBA 4YGAA 2BNXA 2JRFA 2F8PA 1AJ5A 2LUCA 2QEOA 4PCWA 4XJKB 2H8VA 3VRRA 4YGBB 1DQEA 1GJYA 1OOFA 1L2OB 2LVKA 2WCEA 4MRXA 1CLBA 3IF7A 4YGCB 4INXA 2HQ8A 2KBMA 2P71A 4OV2A 3PN7C 2LHIA 1TNWA 3C1VA 3IVTA 3B88A 3EK7A 2KLDA 3JVTB 1S5GZ 1EL4A 5G08A 2JZIA 1PSRA 4PHKA 3BFAA 3PM2A 1YR5A 4C0LA 4GNKB 2JNXA 4ZCVA 3S0GA 4GPLB 1YUTA 2L5XB 4CIDA 3H4SE 2PSRA 2QEHA 1TWOA 1BR1B 2LP3A 2WCBA 3D10A 2JC2A 1PRWA 1UHHA 2LP2A 1ORGA 1B8LA 1QIVA 2GGZA 3UO9A 1KCYA 4JWQA 1SMGA 1MHOA 4Q04A 4BY4A 1X02A 1BJFA 2OTGC 1J7QA 1MXEA 2MLEC 3SG3A 3CZ0A 4M2QA 1DJGA 1IQ3A 2COLB 2LVJA 3R1VA 3TDIA 1WLMA 4MZLA 4NQGA 1PSBA 1KQMC 1TRFA 3EK4A 1PVBA 2Y4QA 1PULA 3CGAA 2LLSA 1G4YR 2QPTA 1M45A 4GBAA 1C07A 1UHJA 2KSPA 4PHMA 1NX0A 2TN4A 1CMGA 2LLTA 3PSRA 2KYCA 4YGEB 3EVVA 1SL8A 3FWBA 1CFFA 1NIWA 1XFVO 2FCDA 2MA2A 2FJUB 2Q4UA 2NCOA 4GGNA 2WOSA 1YVHA 2HQWA 1CMFA 5J3XA 1KK8B 1SCVA 5HL1A 4HREE 2KYFA 2NCPA 3PLFB 1FW4A 3LL8B 1DJWA 1K8UA 3SG6A 1QX5B 1MR8A 4MBEA 4GAOA 1AHRA 1LINA 1EXRA 5HYDA 1J1DA 1ZACA 2LVVA 1F8HA 1QWVA 1QLSA 2WCKA 1UHNA 5DKNA 1XFUO 2ZN8A 4I5NB 1IQ5A 1MQ1A 4GFTA 3LLEA 5DICA 3VRPA 2JXLA 5DKQA 3V2LA 2LMUA 3OBVA 5F6TA 5HKYA 4WRIA 3CS1A 3MSEB 5JOLA 1C7WA 1SKTA 3GK2A 3OX6A 3D75A 2ISDA 1KWOB 3SJSA 1ZOTB 4MSPA 3DF0A 4PE7A 3EKHA 3O4YA 5ER5A 1B7TY 4FTGA 2ZKMX 1K9KA 1NCYA 2K60A 2LV7A 5CSIA 3S0BA 1RWYA 2L5YA 1DJZA 1A03A 1KSMA 2Q91A 2I7AA 2CNPA 2LLUA 1LA3A 1LKJA 1TOPA 4DRWA 3ZWHA 4F0ZB 4OVNF 4A4BA 2A4JA 3BQ3A 1DJIA 2L4HA 4C0KA 3I5FC 2F2PA 3OP0A 4IL1A 2CXJA 3DVEA 2M7LA 2JNFA 1FF1A 2BCXA 4BY5A 3PATA 1IJ6A 1A75A 2E30A 3JTDB 5CSFA 2L2EA 4GGFC 3KO0A 2CBLA 4PALA 2ZNEA 2NZ0A 1B7TZ 2BL0B 3BUWB 2LNKA 2KAYA 3PALA 1DT7B 1GM0A 1YVLA 3D0YB 1MXLC 3CLNA 2OS8B 1J1EA 2BAPA 5CSNA 1B8RA 1YTZC 5AXIA 1SW8A 3OHMB 1GQMA 3VB1A 5I2OA 1AK8A 4MLWA 3R1PA 5AFPA 4AOMA 2QEBA 1HT9A 5KTYA 1SR6C 1TTXA 5EL2A 2IS9A 3TZ1A 1HQVA 1BF5A 1UP5A 2HF5A 3B87A 3BOWB 1C7VA 1F4OA 3M0WA 2ZRTA 1AJ4A 2PRUA 1G33A 5KSZA 1JWDA 1BG1A 1KFXS 3E3RA 1IIOA 3AKBA 1DJHA 2L0PA 1OMRA 2OPOA 2G9BA 3QRXA 3R72A 4PE1A 5HKZA 1XFXO 2M0RA 2O5GA 3S0AA 1F54A 3BJHA 4PHJA 3BUXB 4OKHA 4IJ7A 1A29A 2LM5A 5HLOA 1BT6A 4JD9A 1UHIA 3SS5A 5AEQA 5AERA 2BE6A 1K95A 2E6WA 3CR2A 1S3PA 1AP4A 5D3OA 3LCPC 4DUQA 1C3ZA 1J7OA 4QJ5B 4DS7A 1BMOA 3ICBA 4JQ0D 3AAJA 4ETOA 2KQ6A 1NX2A 1K96A 3OB1B 5FYXA 1RTP1 1JF2A 3S0EA 2JTZA 1Y1XA 1OE9B 2WCMA 1CFDA 1JUOA 3O2PA 2EHBA 2BBNA 5D69A 4CFQA 1Z2CB 3I5HC 3BYAA 1KK7Z 4ORCB 5B8IB 3L47A 1RJVA 2LANA 4FQTA 1QLKA 5I8NA 1NX1A 2KI4B 2BECA 4GGFA 3CDNA 3HX4A 4DCKA 1XFWO 2M1KB 1SSEB 4N5XA 1IH0A 1PALA 1OMVA 1VRKA 2LHLA 1IRJA 2K2AA 3TUYB 3K1EA 3RZSA 1YUSA 1QS7A 3D73A 3TS5B 1DF0A 1F70A 4WQ3A 1BLQA 2MAZA 1JFKA 2NXQA 3OX5A 3L4LA 1CDMA 2P6BB 3EVRA 4E68A 3NSIA 1K94A 1A4PA 1L2OC 2KQYA 4ORBB 5GQQC 1NSHA 3GOFA 2ERBA 2D8NA 4M2PA 2V53A 1ZUZA 4R1EA 1EJ3A 1R2UA 4CLNA 3F45A 1J7PA 1JF0A 3JVTC 4CFRA 3IQQA 3SS3A 4CPVA 2F3ZA 3N7HA 3WHTB 5KU1A 1F55A 4I5JA 2KI6D 1TNPA 1YUUA 3SIBA 2EC6B 3OB2B 3FE9A 1XVJA 1V1FA 1XK4C 1YRUB 2WCHA 3I5IB 1QIWA 3CWGA 4AQIA 1R6PA 1CLLA 3O4XA 2M9GA 1GGZA 1EH2A 1XFRA 3WNXB 2L51A 4U8DA 5TNCA 4XYNA 2PVBA 1UHKA 3CZTX 1NP8A 2KDHA 1DMOA 5K89A 3DD4A 1QV0A 2AAOA 1OSAA 1Y6WA 1SBJA 2LMTA 2K8MB 1WY9A 3S0DA 3A4UB 1M63B 4NDDA 2MLFC 3VRQA 3L4AA 1U5IB 1ZMZA 3WHUB 1M39A 1Y1UA 1TUZA 2RGIA 2HPSA 1SPYA 1JBAA 4P2YB 4F7FA 4OZDA 2K0JA 3GK1A 3B6XA 2LCPA 2PMYA 1JFJA 2YGUA 3Q8IA 2MRDA 2F33A 3AAKA 3I5GB 4MEWA 1KK8C 1QX7A 2I18A 2BE4A 1OZSA 1SCMB 1TUJA 4NDBA 4P5OE 3RLZA 4I5KA 2MBXA 2KFHA 2PASA 1SYMA 2BKIB 2LVIA 2CTNA 3FWCA 2BCBA 3HCMA 1CDPA 4XJKA 1OQPA 1SY9A 2JU0A 1WDCB 4M2OA 2QACA 3D77A 1QASA 2L2CA 4PT1A 1DVIA 4C0JA 1MWNA 2R2IA 3DVKA 3DVMA 4YI8A 2JWWA 3BFHA 1B8CA 1B1GA 1LXFC 1KWOC 1Y0VH 1QV1A 2WC5A 1K90D 2M3WA 1K2HA 2P70A 1K9UA 1ODBA 3BUNB 1EG3A 2JPOA 2M97A 2F3YA 2WC6A 3KEVA 3KHEA 4PE4A 4YRUA 2O60A 1FI6A 2JULA 3PJIA 1XK4A 3PN7B 2KAXA 4HSZA 3SG5A 4YBHB 2QEVA 1KFXL 4MN0A 1DGVA 4USLA 3DF0B 1RECA 2Y1MA 1H4BA 1SRAA 2KFFA 3IQOA 1QVIZ 4I5LB 3D78A 1L7ZA 1K9PA 1DEKA 4HRHA 2L98A 1KK7Y 5CPVA 5FI6A 3CTNA 4FQOA 3NHTA 1QTXA 2M1UA 2M29A 2GV5A 2L4IA 1NWDA 2PALA 1PK0D 1CFCA 3CZ2A 1YX8A 2SASA 2KOTA 2OTGB 5PALA 1QX2A 1XFZO 3JTDC 5HLVA 1EG4A 3NSKA 1NCZA 3VGOA 3OGNA 2H61C 2JXCA 1SL9A 2KNEA 4OCIA 3FS7A 2BL0C 2DOQA 1KQMB 1A75B 2JT8A 5FI7A 4ZCUA 1KSOA 1M31A 1ZFSA 2EGDA 1AUIB 1E8AA 2Y5IA 1WRLA 1BU3A 1ALWA 1LVCD 2GGMA 2KFGA 2KI6C 2OS8C 1F71A 1QATA 1SL7A 3K21A 3R1OA 1C3YA 1W7IB 3CR4X 3A8RA 1IJ5A 3DZTA 1H8BA 3SG2A 3KF9A 2BCAA 3EG5B 4JPZB 4NDCA 2I94A 2M7NA 2ZRSA 4MZKA 1ALVA 3FE6A 1CNPA 1J7RA 1M46A 3BXKA 1G8IA 3NSOA 1Y1AA 4TNCA 1CM1A 1S6CA 1TCFA 4YI9A 3B7AA 2B1UA 2JOJA 3D74A 4AQJA 2PYQA 1CTRA 2CT9A 4UPGA 1UWOA 1U5IA 4ORAB 1Z4HA 2AUCA 1N65A 3O78A 3GK4X 1AVSA 3BFBA 1IGVA 1SK6D 3NGVA 2KGRA 1TCOB 1P28A 2AMIA 4INWA 5JJGA 1YRTB 1DGUA 2M8UA 1F4QA 1CB1A 2Y1NA 5I2LA 1DELA 1S6IA 5DKRA 1WLZA 4PE0A 1CLMA 3VROA 1JC2A 1NPQA 2GTEA 1LA0A 2FJYA 1KQVA 2K2FA 2KI4C 2MJWB 2WCFA 2KPHA 4QJ4B 1N2DA 2K7BA 1TNQA 2LUXA 3I5FB 1B9AA 4N1FA 1WRKA 3DXLA 1W9ZA 2BBMA 2H61A 2G2BA 2QDIA 1RROA 4HRGA 3TUYC 3TS5C 3AKAA 4YGDB 1XA5A 1A2XA 3EK8A 4MZJA 4WQ2A 5IBWA 1CKKA 2KHNA 2K61A 1TIZA 3D0YA 1K93D 5ER4X 1FI5A 1DJXA 2JTTA 1IKUA 1JSAA 1QJTA 2K7CA 2MHHA 3KPXA 4L9MA 4OR9B 1MUXA 4DIRA 5I2QA 3NSLA 4QJ3B 1S36A 2I2RE 1DF0B 1XFYO 2H2KA 3EKJA 3SS4A 3VRNA 1FPWA 1CDLA 3FIAA 2HETA 2FOTA 3BOWA 1NX3A 2LMVA 2EC6C 2KGBC 3LK1A 1W7JB 3D76A 2K7DA 1OOJA 2LAPA 3I5IC 2FCEA 2PQLA 1KFUL 3O6BA 1RFJA 5BPJA 1OMDA 2CCMA 3B86A 3EVUA 1TN4A 1S6JA 1QVIY 2LC5A 1SR6B 3TDUA 1CM4A 4N1GA 1DTLA 3UNWA 4PHNA 3QMEA 1DJYA 5I94A 2ZNDA 1OOIX 1KFUS 4D1EA 3CR5X 2M49B 2JT0A 3WXAA 2L50A 3TDZA 3RM1A 1NUBA 3BUOB 2ZFDA 1BOCA 5FI2A 1V1GA 1NCXA 1CFPA 3CYZA 1OW4A 1J55A 2SCPA 1B4CA 1OOGA 1SNLA 1UUSA 3DY9A 5AANA 1GGWA 5D7FA 1PVAA 3NXAA 4MVFA 2WNDA 1N0YA 1S1EA 3SIAA 1S26D 1LS8A 2JT3A 1MF8B 2WCJA 3NHIA 1Q80A 3SG4A 3S0FA 3BUMB 3CABA 3DYEA 3PM8A 1XYDA 4JKTA 3I5GC 1IWQA 1TNXA 4A4CA 1XO5A 3FE8A 3LK0A 1OZOA 1DC1A 1SCMC 5CSJA 1B47A 2F2OA 1T14A 2WCLA 3SG7A 2JQ6A 1OOHA 1RK9A 2ZN9A 3ZNIA 4MRYA 2NLNA 1IG5A 1UURA 2KAVA 4KYNA 1S5GY 3PFVA 3I5HB 2JPTA 2WC8A 4GUKA 1D1OA 1WRZA 1QXPA 2BKHB 2KBIA 2WORA 1BR4B 2K7OA 4PDZA 1WDCC 1YURA
chains in the Genus database with same CATH topology
3DVJA 1BODA 5HKWA 1NYAA 2LE9B 2VRGA 1CDNA 1YX7A 1FBVA 4ICBA 4YGAA 2JRFA 2F8PA 1AJ5A 2LUCA 4XJKB 4PCWA 3VRRA 4YGBB 1GJYA 1CLBA 1L2OB 2LVKA 2WCEA 4MRXA 3IF7A 4YGCB 2HQ8A 2KBMA 4OV2A 3PN7C 2LHIA 1TNWA 3C1VA 3EK7A 3JVTB 1S5GZ 1EL4A 5G08A 2JZIA 1PSRA 4PHKA 1YR5A 4C0LA 4GNKB 2JNXA 4ZCVA 4GPLB 1YUTA 2L5XB 4CIDA 3H4SE 2PSRA 1BR1B 2LP3A 2WCBA 3D10A 2JC2A 1PRWA 1UHHA 2LP2A 1B8LA 1QIVA 2GGZA 1KCYA 4JWQA 1SMGA 1MHOA 4Q04A 4BY4A 1X02A 1BJFA 2OTGC 1J7QA 1MXEA 2MLEC 3SG3A 4M2QA 1IQ3A 1DJGA 2COLB 2LVJA 3TDIA 1WLMA 4MZLA 4NQGA 1PSBA 1KQMC 1TRFA 3EK4A 1PVBA 2Y4QA 1PULA 3CGAA 2LLSA 1G4YR 2QPTA 1M45A 4GBAA 1C07A 1UHJA 2KSPA 4PHMA 1NX0A 2TN4A 1CMGA 2LLTA 3PSRA 2KYCA 4YGEB 3EVVA 1SL8A 3FWBA 1CFFA 1NIWA 1XFVO 2FCDA 2MA2A 2FJUB 2Q4UA 2NCOA 4GGNA 2WOSA 1YVHA 2HQWA 1CMFA 5J3XA 1KK8B 1SCVA 4HREE 2KYFA 2NCPA 3PLFB 1FW4A 3LL8B 1DJWA 1K8UA 3SG6A 1QX5B 1MR8A 4MBEA 4GAOA 1AHRA 1LINA 1EXRA 5HYDA 1J1DA 1ZACA 2LVVA 1F8HA 1QLSA 1UHNA 5DKNA 1XFUO 2ZN8A 4I5NB 1IQ5A 1MQ1A 4GFTA 3LLEA 3VRPA 2JXLA 5DKQA 2LMUA 5F6TA 5HKYA 4WRIA 3CS1A 3MSEB 5JOLA 1C7WA 1SKTA 3GK2A 3OX6A 2ISDA 1KWOB 3SJSA 1ZOTB 4MSPA 3DF0A 4PE7A 3EKHA 3O4YA 5ER5A 1B7TY 4FTGA 2ZKMX 1K9KA 1NCYA 2LV7A 5CSIA 1A03A 1RWYA 1DJZA 1KSMA 2Q91A 2I7AA 2CNPA 2LLUA 1LA3A 1LKJA 1TOPA 4DRWA 3ZWHA 4F0ZB 4OVNF 4A4BA 2A4JA 3BQ3A 1DJIA 2L4HA 4C0KA 3I5FC 2F2PA 3OP0A 4IL1A 2CXJA 3DVEA 2M7LA 2JNFA 1FF1A 2BCXA 4BY5A 3PATA 1IJ6A 1A75A 2E30A 3JTDB 5CSFA 2L2EA 4GGFC 3KO0A 2CBLA 4PALA 2ZNEA 2NZ0A 1B7TZ 2BL0B 3BUWB 2LNKA 2KAYA 3PALA 1DT7B 1YVLA 3D0YB 1MXLC 3CLNA 2OS8B 1J1EA 5CSNA 5AXIA 1B8RA 1YTZC 5I2OA 1SW8A 3OHMB 1GQMA 1AK8A 4MLWA 5AFPA 4AOMA 1HT9A 5KTYA 1SR6C 1TTXA 1BF5A 2IS9A 3TZ1A 1HQVA 1UP5A 2HF5A 3BOWB 1C7VA 1F4OA 3M0WA 2ZRTA 1AJ4A 2PRUA 1G33A 5KSZA 1JWDA 1BG1A 1KFXS 3E3RA 3AKBA 1DJHA 2L0PA 1OMRA 2OPOA 2G9BA 3QRXA 4PE1A 5HKZA 1XFXO 2M0RA 2O5GA 1F54A 4PHJA 3BUXB 4OKHA 1A29A 2LM5A 5HLOA 1BT6A 1UHIA 5AERA 5AEQA 2BE6A 1K95A 2E6WA 3CR2A 1S3PA 1AP4A 3LCPC 4DUQA 1J7OA 4QJ5B 4DS7A 1BMOA 3ICBA 4JQ0D 3AAJA 4ETOA 2KQ6A 1NX2A 1K96A 3OB1B 5FYXA 1RTP1 1JF2A 2JTZA 1Y1XA 1OE9B 1CFDA 1JUOA 3O2PA 2EHBA 2BBNA 5D69A 4CFQA 3I5HC 3BYAA 1KK7Z 4ORCB 5B8IB 5I8NA 1RJVA 2LANA 1QLKA 1NX1A 2KI4B 2BECA 4GGFA 3HX4A 4DCKA 1XFWO 2M1KB 4N5XA 1IH0A 1PALA 1OMVA 1VRKA 2LHLA 1IRJA 2K2AA 3TUYB 1YUSA 1QS7A 1F70A 3TS5B 1DF0A 4WQ3A 1BLQA 2MAZA 1JFKA 2NXQA 3OX5A 1CDMA 2P6BB 3EVRA 4E68A 3NSIA 1K94A 1A4PA 1L2OC 2KQYA 4ORBB 5GQQC 1NSHA 3GOFA 2D8NA 4M2PA 2V53A 1ZUZA 4R1EA 1EJ3A 1R2UA 4CLNA 3F45A 1J7PA 1JF0A 3JVTC 4CFRA 3IQQA 4CPVA 2F3ZA 3WHTB 5KU1A 1F55A 4I5JA 2KI6D 1TNPA 1YUUA 3SIBA 2EC6B 3OB2B 1XVJA 1V1FA 1XK4C 1YRUB 3I5IB 1QIWA 3CWGA 4AQIA 1R6PA 1CLLA 2M9GA 1GGZA 1EH2A 3WNXB 2L51A 4U8DA 5TNCA 4XYNA 2PVBA 1UHKA 3CZTX 1NP8A 2KDHA 1DMOA 5K89A 3DD4A 1QV0A 2AAOA 1OSAA 1Y6WA 1SBJA 2LMTA 2K8MB 1WY9A 3A4UB 1M63B 4NDDA 2MLFC 3VRQA 1U5IB 1ZMZA 3WHUB 1M39A 1Y1UA 2RGIA 2HPSA 1SPYA 1JBAA 4P2YB 2K0JA 3GK1A 2LCPA 2PMYA 1JFJA 2MRDA 2F33A 3AAKA 3I5GB 4MEWA 1KK8C 1QX7A 2I18A 2BE4A 1OZSA 1SCMB 4NDBA 4P5OE 3RLZA 4I5KA 2MBXA 2KFHA 2PASA 1SYMA 2BKIB 2LVIA 2CTNA 3FWCA 2BCBA 3HCMA 1CDPA 4XJKA 1OQPA 1SY9A 2JU0A 1WDCB 4M2OA 2QACA 1QASA 1DVIA 4C0JA 1MWNA 2R2IA 3DVKA 3DVMA 4YI8A 2JWWA 1B8CA 1B1GA 1LXFC 1KWOC 1Y0VH 1QV1A 1K90D 2M3WA 1K2HA 1K9UA 1ODBA 3BUNB 1EG3A 3KEVA 2M97A 2F3YA 3KHEA 4PE4A 4YRUA 1FI6A 2O60A 2JULA 3PN7B 1XK4A 4HSZA 2KAXA 3SG5A 4YBHB 1KFXL 4MN0A 1DGVA 4USLA 3DF0B 1RECA 2Y1MA 1H4BA 1SRAA 2KFFA 3IQOA 1QVIZ 4I5LB 1L7ZA 1K9PA 4HRHA 5CPVA 2L98A 1KK7Y 3CTNA 4FQOA 1QTXA 2M1UA 2M29A 2GV5A 2L4IA 1NWDA 2PALA 1PK0D 1CFCA 1YX8A 2SASA 2KOTA 2OTGB 5PALA 1QX2A 1XFZO 3JTDC 5HLVA 1EG4A 3NSKA 1NCZA 3VGOA 2H61C 2JXCA 1SL9A 2KNEA 4OCIA 3FS7A 2BL0C 2DOQA 1KQMB 1A75B 2JT8A 4ZCUA 1KSOA 1M31A 1ZFSA 2EGDA 1AUIB 1E8AA 2Y5IA 1WRLA 1BU3A 1ALWA 1LVCD 2GGMA 2KFGA 2KI6C 2OS8C 1F71A 1QATA 1SL7A 3K21A 1W7IB 3CR4X 3A8RA 1IJ5A 1H8BA 3SG2A 3KF9A 2BCAA 4JPZB 4NDCA 2I94A 2M7NA 2ZRSA 4MZKA 1ALVA 1CNPA 1J7RA 1M46A 3BXKA 1G8IA 3NSOA 1Y1AA 4TNCA 1CM1A 1S6CA 1TCFA 4YI9A 2B1UA 2JOJA 4AQJA 1CTRA 2CT9A 4UPGA 1UWOA 1U5IA 4ORAB 2AUCA 1N65A 3O78A 3GK4X 1AVSA 1IGVA 1SK6D 2KGRA 1TCOB 2AMIA 5JJGA 1YRTB 1DGUA 2M8UA 1F4QA 1CB1A 2Y1NA 5I2LA 1S6IA 5DKRA 1WLZA 4PE0A 1CLMA 3VROA 1JC2A 1NPQA 1LA0A 1KQVA 2K2FA 2KI4C 2MJWB 2WCFA 4QJ4B 1N2DA 2K7BA 1TNQA 2LUXA 3I5FB 1B9AA 4N1FA 1WRKA 2BBMA 2H61A 2G2BA 1RROA 4HRGA 3TUYC 3TS5C 3AKAA 4YGDB 1XA5A 1A2XA 3EK8A 4MZJA 4WQ2A 5IBWA 1CKKA 2KHNA 2K61A 1TIZA 3D0YA 1K93D 5ER4X 1FI5A 1DJXA 2JTTA 1IKUA 1JSAA 1QJTA 2K7CA 2MHHA 3KPXA 4L9MA 4OR9B 1MUXA 4DIRA 5I2QA 3NSLA 4QJ3B 1S36A 2I2RE 1DF0B 1XFYO 2H2KA 3EKJA 3VRNA 1FPWA 1CDLA 3FIAA 2HETA 2FOTA 3BOWA 1NX3A 2LMVA 2EC6C 2KGBC 3LK1A 1W7JB 2K7DA 1OOJA 2LAPA 3I5IC 2FCEA 3O6BA 1KFUL 5BPJA 1RFJA 1OMDA 2CCMA 3EVUA 1TN4A 1S6JA 1QVIY 2LC5A 1SR6B 3TDUA 1CM4A 4N1GA 1DTLA 4PHNA 1DJYA 2ZNDA 1KFUS 4D1EA 3CR5X 2M49B 2JT0A 3WXAA 2L50A 3TDZA 3RM1A 1NUBA 3BUOB 2ZFDA 1BOCA 1V1GA 1NCXA 1CFPA 1J55A 2SCPA 1B4CA 1SNLA 5AANA 1UUSA 1GGWA 5D7FA 1PVAA 3NXAA 4MVFA 2WNDA 1N0YA 1S1EA 3SIAA 1S26D 2JT3A 1MF8B 1Q80A 3SG4A 3BUMB 3PM8A 1XYDA 3I5GC 1IWQA 1TNXA 4A4CA 1XO5A 3LK0A 1OZOA 1SCMC 5CSJA 1B47A 2F2OA 3SG7A 2JQ6A 1RK9A 2ZN9A 3ZNIA 4MRYA 2NLNA 1IG5A 1UURA 2KAVA 1S5GY 3PFVA 3I5HB 2JPTA 2WC8A 4GUKA 1D1OA 1WRZA 1QXPA 2BKHB 2KBIA 2WORA 1BR4B 2K7OA 4PDZA 1WDCC 1YURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVJ A;  1BOD A;  5HKW A;  1NYA A;  2LE9 B;  2VRG A;  1CDN A;  1YX7 A;  1FBV A;  4ICB A;  4YGA A;  2JRF A;  2F8P A;  1AJ5 A;  2LUC A;  4XJK B;  4PCW A;  3VRR A;  4YGB B;  1GJY A;  1CLB A;  1L2O B;  2LVK A;  2WCE A;  4MRX A;  3IF7 A;  4YGC B;  2HQ8 A;  2KBM A;  4OV2 A;  3PN7 C;  2LHI A;  1TNW A;  3C1V A;  3EK7 A;  3JVT B;  1S5G Z;  1EL4 A;  5G08 A;  2JZI A;  1PSR A;  4PHK A;  1YR5 A;  4C0L A;  4GNK B;  2JNX A;  4ZCV A;  4GPL B;  1YUT A;  2L5X B;  4CID A;  3H4S E;  2PSR A;  1BR1 B;  2LP3 A;  2WCB A;  3D10 A;  2JC2 A;  1PRW A;  1UHH A;  2LP2 A;  1B8L A;  1QIV A;  2GGZ A;  1KCY A;  4JWQ A;  1SMG A;  1MHO A;  4Q04 A;  4BY4 A;  1X02 A;  1BJF A;  2OTG C;  1J7Q A;  1MXE A;  2MLE C;  3SG3 A;  4M2Q A;  1IQ3 A;  1DJG A;  2COL B;  2LVJ A;  3TDI A;  1WLM A;  4MZL A;  4NQG A;  1PSB A;  1KQM C;  1TRF A;  3EK4 A;  1PVB A;  2Y4Q A;  1PUL A;  3CGA A;  2LLS A;  1G4Y R;  2QPT A;  1M45 A;  4GBA A;  1C07 A;  1UHJ A;  2KSP A;  4PHM A;  1NX0 A;  2TN4 A;  1CMG A;  2LLT A;  3PSR A;  2KYC A;  4YGE B;  3EVV A;  1SL8 A;  3FWB A;  1CFF A;  1NIW A;  1XFV O;  2FCD A;  2MA2 A;  2FJU B;  2Q4U A;  2NCO A;  4GGN A;  2WOS A;  1YVH A;  2HQW A;  1CMF A;  5J3X A;  1KK8 B;  1SCV A;  4HRE E;  2KYF A;  2NCP A;  3PLF B;  1FW4 A;  3LL8 B;  1DJW A;  1K8U A;  3SG6 A;  1QX5 B;  1MR8 A;  4MBE A;  4GAO A;  1AHR A;  1LIN A;  1EXR A;  5HYD A;  1J1D A;  1ZAC A;  2LVV A;  1F8H A;  1QLS A;  1UHN A;  5DKN A;  1XFU O;  2ZN8 A;  4I5N B;  1IQ5 A;  1MQ1 A;  4GFT A;  3LLE A;  3VRP A;  2JXL A;  5DKQ A;  2LMU A;  5F6T A;  5HKY A;  4WRI A;  3CS1 A;  3MSE B;  5JOL A;  1C7W A;  1SKT A;  3GK2 A;  3OX6 A;  2ISD A;  1KWO B;  3SJS A;  1ZOT B;  4MSP A;  3DF0 A;  4PE7 A;  3EKH A;  3O4Y A;  5ER5 A;  1B7T Y;  4FTG A;  2ZKM X;  1K9K A;  1NCY A;  2LV7 A;  5CSI A;  1A03 A;  1RWY A;  1DJZ A;  1KSM A;  2Q91 A;  2I7A A;  2CNP A;  2LLU A;  1LA3 A;  1LKJ A;  1TOP A;  4DRW A;  3ZWH A;  4F0Z B;  4OVN F;  4A4B A;  2A4J A;  3BQ3 A;  1DJI A;  2L4H A;  4C0K A;  3I5F C;  2F2P A;  3OP0 A;  4IL1 A;  2CXJ A;  3DVE A;  2M7L A;  2JNF A;  1FF1 A;  2BCX A;  4BY5 A;  3PAT A;  1IJ6 A;  1A75 A;  2E30 A;  3JTD B;  5CSF A;  2L2E A;  4GGF C;  3KO0 A;  2CBL A;  4PAL A;  2ZNE A;  2NZ0 A;  1B7T Z;  2BL0 B;  3BUW B;  2LNK A;  2KAY A;  3PAL A;  1DT7 B;  1YVL A;  3D0Y B;  1MXL C;  3CLN A;  2OS8 B;  1J1E A;  5CSN A;  5AXI A;  1B8R A;  1YTZ C;  5I2O A;  1SW8 A;  3OHM B;  1GQM A;  1AK8 A;  4MLW A;  5AFP A;  4AOM A;  1HT9 A;  5KTY A;  1SR6 C;  1TTX A;  1BF5 A;  2IS9 A;  3TZ1 A;  1HQV A;  1UP5 A;  2HF5 A;  3BOW B;  1C7V A;  1F4O A;  3M0W A;  2ZRT A;  1AJ4 A;  2PRU A;  1G33 A;  5KSZ A;  1JWD A;  1BG1 A;  1KFX S;  3E3R A;  3AKB A;  1DJH A;  2L0P A;  1OMR A;  2OPO A;  2G9B A;  3QRX A;  4PE1 A;  5HKZ A;  1XFX O;  2M0R A;  2O5G A;  1F54 A;  4PHJ A;  3BUX B;  4OKH A;  1A29 A;  2LM5 A;  5HLO A;  1BT6 A;  1UHI A;  5AER A;  5AEQ A;  2BE6 A;  1K95 A;  2E6W A;  3CR2 A;  1S3P A;  1AP4 A;  3LCP C;  4DUQ A;  1J7O A;  4QJ5 B;  4DS7 A;  1BMO A;  3ICB A;  4JQ0 D;  3AAJ A;  4ETO A;  2KQ6 A;  1NX2 A;  1K96 A;  3OB1 B;  5FYX A;  1RTP 1;  1JF2 A;  2JTZ A;  1Y1X A;  1OE9 B;  1CFD A;  1JUO A;  3O2P A;  2EHB A;  2BBN A;  5D69 A;  4CFQ A;  3I5H C;  3BYA A;  1KK7 Z;  4ORC B;  5B8I B;  5I8N A;  1RJV A;  2LAN A;  1QLK A;  1NX1 A;  2KI4 B;  2BEC A;  4GGF A;  3HX4 A;  4DCK A;  1XFW O;  2M1K B;  4N5X A;  1IH0 A;  1PAL A;  1OMV A;  1VRK A;  2LHL A;  1IRJ A;  2K2A A;  3TUY B;  1YUS A;  1QS7 A;  1F70 A;  3TS5 B;  1DF0 A;  4WQ3 A;  1BLQ A;  2MAZ A;  1JFK A;  2NXQ A;  3OX5 A;  1CDM A;  2P6B B;  3EVR A;  4E68 A;  3NSI A;  1K94 A;  1A4P A;  1L2O C;  2KQY A;  4ORB B;  5GQQ C;  1NSH A;  3GOF A;  2D8N A;  4M2P A;  2V53 A;  1ZUZ A;  4R1E A;  1EJ3 A;  1R2U A;  4CLN A;  3F45 A;  1J7P A;  1JF0 A;  3JVT C;  4CFR A;  3IQQ A;  4CPV A;  2F3Z A;  3WHT B;  5KU1 A;  1F55 A;  4I5J A;  2KI6 D;  1TNP A;  1YUU A;  3SIB A;  2EC6 B;  3OB2 B;  1XVJ A;  1V1F A;  1XK4 C;  1YRU B;  3I5I B;  1QIW A;  3CWG A;  4AQI A;  1R6P A;  1CLL A;  2M9G A;  1GGZ A;  1EH2 A;  3WNX B;  2L51 A;  4U8D A;  5TNC A;  4XYN A;  2PVB A;  1UHK A;  3CZT X;  1NP8 A;  2KDH A;  1DMO A;  5K89 A;  3DD4 A;  1QV0 A;  2AAO A;  1OSA A;  1Y6W A;  1SBJ A;  2LMT A;  2K8M B;  1WY9 A;  3A4U B;  1M63 B;  4NDD A;  2MLF C;  3VRQ A;  1U5I B;  1ZMZ A;  3WHU B;  1M39 A;  1Y1U A;  2RGI A;  2HPS A;  1SPY A;  1JBA A;  4P2Y B;  2K0J A;  3GK1 A;  2LCP A;  2PMY A;  1JFJ A;  2MRD A;  2F33 A;  3AAK A;  3I5G B;  4MEW A;  1KK8 C;  1QX7 A;  2I18 A;  2BE4 A;  1OZS A;  1SCM B;  4NDB A;  4P5O E;  3RLZ A;  4I5K A;  2MBX A;  2KFH A;  2PAS A;  1SYM A;  2BKI B;  2LVI A;  2CTN A;  3FWC A;  2BCB A;  3HCM A;  1CDP A;  4XJK A;  1OQP A;  1SY9 A;  2JU0 A;  1WDC B;  4M2O A;  2QAC A;  1QAS A;  1DVI A;  4C0J A;  1MWN A;  2R2I A;  3DVK A;  3DVM A;  4YI8 A;  2JWW A;  1B8C A;  1B1G A;  1LXF C;  1KWO C;  1Y0V H;  1QV1 A;  1K90 D;  2M3W A;  1K2H A;  1K9U A;  1ODB A;  3BUN B;  1EG3 A;  3KEV A;  2M97 A;  2F3Y A;  3KHE A;  4PE4 A;  4YRU A;  1FI6 A;  2O60 A;  2JUL A;  3PN7 B;  1XK4 A;  4HSZ A;  2KAX A;  3SG5 A;  4YBH B;  1KFX L;  4MN0 A;  1DGV A;  4USL A;  3DF0 B;  1REC A;  2Y1M A;  1H4B A;  1SRA A;  2KFF A;  3IQO A;  1QVI Z;  4I5L B;  1L7Z A;  1K9P A;  4HRH A;  5CPV A;  2L98 A;  1KK7 Y;  3CTN A;  4FQO A;  1QTX A;  2M1U A;  2M29 A;  2GV5 A;  2L4I A;  1NWD A;  2PAL A;  1PK0 D;  1CFC A;  1YX8 A;  2SAS A;  2KOT A;  2OTG B;  5PAL A;  1QX2 A;  1XFZ O;  3JTD C;  5HLV A;  1EG4 A;  3NSK A;  1NCZ A;  3VGO A;  2H61 C;  2JXC A;  1SL9 A;  2KNE A;  4OCI A;  3FS7 A;  2BL0 C;  2DOQ A;  1KQM B;  1A75 B;  2JT8 A;  4ZCU A;  1KSO A;  1M31 A;  1ZFS A;  2EGD A;  1AUI B;  1E8A A;  2Y5I A;  1WRL A;  1BU3 A;  1ALW A;  1LVC D;  2GGM A;  2KFG A;  2KI6 C;  2OS8 C;  1F71 A;  1QAT A;  1SL7 A;  3K21 A;  1W7I B;  3CR4 X;  3A8R A;  1IJ5 A;  1H8B A;  3SG2 A;  3KF9 A;  2BCA A;  4JPZ B;  4NDC A;  2I94 A;  2M7N A;  2ZRS A;  4MZK A;  1ALV A;  1CNP A;  1J7R A;  1M46 A;  3BXK A;  1G8I A;  3NSO A;  1Y1A A;  4TNC A;  1CM1 A;  1S6C A;  1TCF A;  4YI9 A;  2B1U A;  2JOJ A;  4AQJ A;  1CTR A;  2CT9 A;  4UPG A;  1UWO A;  1U5I A;  4ORA B;  2AUC A;  1N65 A;  3O78 A;  3GK4 X;  1AVS A;  1IGV A;  1SK6 D;  2KGR A;  1TCO B;  2AMI A;  5JJG A;  1YRT B;  1DGU A;  2M8U A;  1F4Q A;  1CB1 A;  2Y1N A;  5I2L A;  1S6I A;  5DKR A;  1WLZ A;  4PE0 A;  1CLM A;  3VRO A;  1JC2 A;  1NPQ A;  1LA0 A;  1KQV A;  2K2F A;  2KI4 C;  2MJW B;  2WCF A;  4QJ4 B;  1N2D A;  2K7B A;  1TNQ A;  2LUX A;  3I5F B;  1B9A A;  4N1F A;  1WRK A;  2BBM A;  2H61 A;  2G2B A;  1RRO A;  4HRG A;  3TUY C;  3TS5 C;  3AKA A;  4YGD B;  1XA5 A;  1A2X A;  3EK8 A;  4MZJ A;  4WQ2 A;  5IBW A;  1CKK A;  2KHN A;  2K61 A;  1TIZ A;  3D0Y A;  1K93 D;  5ER4 X;  1FI5 A;  1DJX A;  2JTT A;  1IKU A;  1JSA A;  1QJT A;  2K7C A;  2MHH A;  3KPX A;  4L9M A;  4OR9 B;  1MUX A;  4DIR A;  5I2Q A;  3NSL A;  4QJ3 B;  1S36 A;  2I2R E;  1DF0 B;  1XFY O;  2H2K A;  3EKJ A;  3VRN A;  1FPW A;  1CDL A;  3FIA A;  2HET A;  2FOT A;  3BOW A;  1NX3 A;  2LMV A;  2EC6 C;  2KGB C;  3LK1 A;  1W7J B;  2K7D A;  1OOJ A;  2LAP A;  3I5I C;  2FCE A;  3O6B A;  1KFU L;  5BPJ A;  1RFJ A;  1OMD A;  2CCM A;  3EVU A;  1TN4 A;  1S6J A;  1QVI Y;  2LC5 A;  1SR6 B;  3TDU A;  1CM4 A;  4N1G A;  1DTL A;  4PHN A;  1DJY A;  2ZND A;  1KFU S;  4D1E A;  3CR5 X;  2M49 B;  2JT0 A;  3WXA A;  2L50 A;  3TDZ A;  3RM1 A;  1NUB A;  3BUO B;  2ZFD A;  1BOC A;  1V1G A;  1NCX A;  1CFP A;  1J55 A;  2SCP A;  1B4C A;  1SNL A;  5AAN A;  1UUS A;  1GGW A;  5D7F A;  1PVA A;  3NXA A;  4MVF A;  2WND A;  1N0Y A;  1S1E A;  3SIA A;  1S26 D;  2JT3 A;  1MF8 B;  1Q80 A;  3SG4 A;  3BUM B;  3PM8 A;  1XYD A;  3I5G C;  1IWQ A;  1TNX A;  4A4C A;  1XO5 A;  3LK0 A;  1OZO A;  1SCM C;  5CSJ A;  1B47 A;  2F2O A;  3SG7 A;  2JQ6 A;  1RK9 A;  2ZN9 A;  3ZNI A;  4MRY A;  2NLN A;  1IG5 A;  1UUR A;  2KAV A;  1S5G Y;  3PFV A;  3I5H B;  2JPT A;  2WC8 A;  4GUK A;  1D1O A;  1WRZ A;  1QXP A;  2BKH B;  2KBI A;  2WOR A;  1BR4 B;  2K7O A;  4PDZ A;  1WDC C;  1YUR A; 
#chains in the Genus database with same CATH topology
 3DVJ A;  3CZ1 A;  1BOD A;  5HKW A;  1NYA A;  2LE9 B;  2VRG A;  1CDN A;  2KLE A;  1YX7 A;  1FBV A;  4ICB A;  4YGA A;  2BNX A;  2JRF A;  2F8P A;  1AJ5 A;  2LUC A;  2QEO A;  4PCW A;  4XJK B;  2H8V A;  3VRR A;  4YGB B;  1DQE A;  1GJY A;  1OOF A;  1L2O B;  2LVK A;  2WCE A;  4MRX A;  1CLB A;  3IF7 A;  4YGC B;  4INX A;  2HQ8 A;  2KBM A;  2P71 A;  4OV2 A;  3PN7 C;  2LHI A;  1TNW A;  3C1V A;  3IVT A;  3B88 A;  3EK7 A;  2KLD A;  3JVT B;  1S5G Z;  1EL4 A;  5G08 A;  2JZI A;  1PSR A;  4PHK A;  3BFA A;  3PM2 A;  1YR5 A;  4C0L A;  4GNK B;  2JNX A;  4ZCV A;  3S0G A;  4GPL B;  1YUT A;  2L5X B;  4CID A;  3H4S E;  2PSR A;  2QEH A;  1TWO A;  1BR1 B;  2LP3 A;  2WCB A;  3D10 A;  2JC2 A;  1PRW A;  1UHH A;  2LP2 A;  1ORG A;  1B8L A;  1QIV A;  2GGZ A;  3UO9 A;  1KCY A;  4JWQ A;  1SMG A;  1MHO A;  4Q04 A;  4BY4 A;  1X02 A;  1BJF A;  2OTG C;  1J7Q A;  1MXE A;  2MLE C;  3SG3 A;  3CZ0 A;  4M2Q A;  1DJG A;  1IQ3 A;  2COL B;  2LVJ A;  3R1V A;  3TDI A;  1WLM A;  4MZL A;  4NQG A;  1PSB A;  1KQM C;  1TRF A;  3EK4 A;  1PVB A;  2Y4Q A;  1PUL A;  3CGA A;  2LLS A;  1G4Y R;  2QPT A;  1M45 A;  4GBA A;  1C07 A;  1UHJ A;  2KSP A;  4PHM A;  1NX0 A;  2TN4 A;  1CMG A;  2LLT A;  3PSR A;  2KYC A;  4YGE B;  3EVV A;  1SL8 A;  3FWB A;  1CFF A;  1NIW A;  1XFV O;  2FCD A;  2MA2 A;  2FJU B;  2Q4U A;  2NCO A;  4GGN A;  2WOS A;  1YVH A;  2HQW A;  1CMF A;  5J3X A;  1KK8 B;  1SCV A;  5HL1 A;  4HRE E;  2KYF A;  2NCP A;  3PLF B;  1FW4 A;  3LL8 B;  1DJW A;  1K8U A;  3SG6 A;  1QX5 B;  1MR8 A;  4MBE A;  4GAO A;  1AHR A;  1LIN A;  1EXR A;  5HYD A;  1J1D A;  1ZAC A;  2LVV A;  1F8H A;  1QWV A;  1QLS A;  2WCK A;  1UHN A;  5DKN A;  1XFU O;  2ZN8 A;  4I5N B;  1IQ5 A;  1MQ1 A;  4GFT A;  3LLE A;  5DIC A;  3VRP A;  2JXL A;  5DKQ A;  3V2L A;  2LMU A;  3OBV A;  5F6T A;  5HKY A;  4WRI A;  3CS1 A;  3MSE B;  5JOL A;  1C7W A;  1SKT A;  3GK2 A;  3OX6 A;  3D75 A;  2ISD A;  1KWO B;  3SJS A;  1ZOT B;  4MSP A;  3DF0 A;  4PE7 A;  3EKH A;  3O4Y A;  5ER5 A;  1B7T Y;  4FTG A;  2ZKM X;  1K9K A;  1NCY A;  2K60 A;  2LV7 A;  5CSI A;  3S0B A;  1RWY A;  2L5Y A;  1DJZ A;  1A03 A;  1KSM A;  2Q91 A;  2I7A A;  2CNP A;  2LLU A;  1LA3 A;  1LKJ A;  1TOP A;  4DRW A;  3ZWH A;  4F0Z B;  4OVN F;  4A4B A;  2A4J A;  3BQ3 A;  1DJI A;  2L4H A;  4C0K A;  3I5F C;  2F2P A;  3OP0 A;  4IL1 A;  2CXJ A;  3DVE A;  2M7L A;  2JNF A;  1FF1 A;  2BCX A;  4BY5 A;  3PAT A;  1IJ6 A;  1A75 A;  2E30 A;  3JTD B;  5CSF A;  2L2E A;  4GGF C;  3KO0 A;  2CBL A;  4PAL A;  2ZNE A;  2NZ0 A;  1B7T Z;  2BL0 B;  3BUW B;  2LNK A;  2KAY A;  3PAL A;  1DT7 B;  1GM0 A;  1YVL A;  3D0Y B;  1MXL C;  3CLN A;  2OS8 B;  1J1E A;  2BAP A;  5CSN A;  1B8R A;  1YTZ C;  5AXI A;  1SW8 A;  3OHM B;  1GQM A;  3VB1 A;  5I2O A;  1AK8 A;  4MLW A;  3R1P A;  5AFP A;  4AOM A;  2QEB A;  1HT9 A;  5KTY A;  1SR6 C;  1TTX A;  5EL2 A;  2IS9 A;  3TZ1 A;  1HQV A;  1BF5 A;  1UP5 A;  2HF5 A;  3B87 A;  3BOW B;  1C7V A;  1F4O A;  3M0W A;  2ZRT A;  1AJ4 A;  2PRU A;  1G33 A;  5KSZ A;  1JWD A;  1BG1 A;  1KFX S;  3E3R A;  1IIO A;  3AKB A;  1DJH A;  2L0P A;  1OMR A;  2OPO A;  2G9B A;  3QRX A;  3R72 A;  4PE1 A;  5HKZ A;  1XFX O;  2M0R A;  2O5G A;  3S0A A;  1F54 A;  3BJH A;  4PHJ A;  3BUX B;  4OKH A;  4IJ7 A;  1A29 A;  2LM5 A;  5HLO A;  1BT6 A;  4JD9 A;  1UHI A;  3SS5 A;  5AEQ A;  5AER A;  2BE6 A;  1K95 A;  2E6W A;  3CR2 A;  1S3P A;  1AP4 A;  5D3O A;  3LCP C;  4DUQ A;  1C3Z A;  1J7O A;  4QJ5 B;  4DS7 A;  1BMO A;  3ICB A;  4JQ0 D;  3AAJ A;  4ETO A;  2KQ6 A;  1NX2 A;  1K96 A;  3OB1 B;  5FYX A;  1RTP 1;  1JF2 A;  3S0E A;  2JTZ A;  1Y1X A;  1OE9 B;  2WCM A;  1CFD A;  1JUO A;  3O2P A;  2EHB A;  2BBN A;  5D69 A;  4CFQ A;  1Z2C B;  3I5H C;  3BYA A;  1KK7 Z;  4ORC B;  5B8I B;  3L47 A;  1RJV A;  2LAN A;  4FQT A;  1QLK A;  5I8N A;  1NX1 A;  2KI4 B;  2BEC A;  4GGF A;  3CDN A;  3HX4 A;  4DCK A;  1XFW O;  2M1K B;  1SSE B;  4N5X A;  1IH0 A;  1PAL A;  1OMV A;  1VRK A;  2LHL A;  1IRJ A;  2K2A A;  3TUY B;  3K1E A;  3RZS A;  1YUS A;  1QS7 A;  3D73 A;  3TS5 B;  1DF0 A;  1F70 A;  4WQ3 A;  1BLQ A;  2MAZ A;  1JFK A;  2NXQ A;  3OX5 A;  3L4L A;  1CDM A;  2P6B B;  3EVR A;  4E68 A;  3NSI A;  1K94 A;  1A4P A;  1L2O C;  2KQY A;  4ORB B;  5GQQ C;  1NSH A;  3GOF A;  2ERB A;  2D8N A;  4M2P A;  2V53 A;  1ZUZ A;  4R1E A;  1EJ3 A;  1R2U A;  4CLN A;  3F45 A;  1J7P A;  1JF0 A;  3JVT C;  4CFR A;  3IQQ A;  3SS3 A;  4CPV A;  2F3Z A;  3N7H A;  3WHT B;  5KU1 A;  1F55 A;  4I5J A;  2KI6 D;  1TNP A;  1YUU A;  3SIB A;  2EC6 B;  3OB2 B;  3FE9 A;  1XVJ A;  1V1F A;  1XK4 C;  1YRU B;  2WCH A;  3I5I B;  1QIW A;  3CWG A;  4AQI A;  1R6P A;  1CLL A;  3O4X A;  2M9G A;  1GGZ A;  1EH2 A;  1XFR A;  3WNX B;  2L51 A;  4U8D A;  5TNC A;  4XYN A;  2PVB A;  1UHK A;  3CZT X;  1NP8 A;  2KDH A;  1DMO A;  5K89 A;  3DD4 A;  1QV0 A;  2AAO A;  1OSA A;  1Y6W A;  1SBJ A;  2LMT A;  2K8M B;  1WY9 A;  3S0D A;  3A4U B;  1M63 B;  4NDD A;  2MLF C;  3VRQ A;  3L4A A;  1U5I B;  1ZMZ A;  3WHU B;  1M39 A;  1Y1U A;  1TUZ A;  2RGI A;  2HPS A;  1SPY A;  1JBA A;  4P2Y B;  4F7F A;  4OZD A;  2K0J A;  3GK1 A;  3B6X A;  2LCP A;  2PMY A;  1JFJ A;  2YGU A;  3Q8I A;  2MRD A;  2F33 A;  3AAK A;  3I5G B;  4MEW A;  1KK8 C;  1QX7 A;  2I18 A;  2BE4 A;  1OZS A;  1SCM B;  1TUJ A;  4NDB A;  4P5O E;  3RLZ A;  4I5K A;  2MBX A;  2KFH A;  2PAS A;  1SYM A;  2BKI B;  2LVI A;  2CTN A;  3FWC A;  2BCB A;  3HCM A;  1CDP A;  4XJK A;  1OQP A;  1SY9 A;  2JU0 A;  1WDC B;  4M2O A;  2QAC A;  3D77 A;  1QAS A;  2L2C A;  4PT1 A;  1DVI A;  4C0J A;  1MWN A;  2R2I A;  3DVK A;  3DVM A;  4YI8 A;  2JWW A;  3BFH A;  1B8C A;  1B1G A;  1LXF C;  1KWO C;  1Y0V H;  1QV1 A;  2WC5 A;  1K90 D;  2M3W A;  1K2H A;  2P70 A;  1K9U A;  1ODB A;  3BUN B;  1EG3 A;  2JPO A;  2M97 A;  2F3Y A;  2WC6 A;  3KEV A;  3KHE A;  4PE4 A;  4YRU A;  2O60 A;  1FI6 A;  2JUL A;  3PJI A;  1XK4 A;  3PN7 B;  2KAX A;  4HSZ A;  3SG5 A;  4YBH B;  2QEV A;  1KFX L;  4MN0 A;  1DGV A;  4USL A;  3DF0 B;  1REC A;  2Y1M A;  1H4B A;  1SRA A;  2KFF A;  3IQO A;  1QVI Z;  4I5L B;  3D78 A;  1L7Z A;  1K9P A;  1DEK A;  4HRH A;  2L98 A;  1KK7 Y;  5CPV A;  5FI6 A;  3CTN A;  4FQO A;  3NHT A;  1QTX A;  2M1U A;  2M29 A;  2GV5 A;  2L4I A;  1NWD A;  2PAL A;  1PK0 D;  1CFC A;  3CZ2 A;  1YX8 A;  2SAS A;  2KOT A;  2OTG B;  5PAL A;  1QX2 A;  1XFZ O;  3JTD C;  5HLV A;  1EG4 A;  3NSK A;  1NCZ A;  3VGO A;  3OGN A;  2H61 C;  2JXC A;  1SL9 A;  2KNE A;  4OCI A;  3FS7 A;  2BL0 C;  2DOQ A;  1KQM B;  1A75 B;  2JT8 A;  5FI7 A;  4ZCU A;  1KSO A;  1M31 A;  1ZFS A;  2EGD A;  1AUI B;  1E8A A;  2Y5I A;  1WRL A;  1BU3 A;  1ALW A;  1LVC D;  2GGM A;  2KFG A;  2KI6 C;  2OS8 C;  1F71 A;  1QAT A;  1SL7 A;  3K21 A;  3R1O A;  1C3Y A;  1W7I B;  3CR4 X;  3A8R A;  1IJ5 A;  3DZT A;  1H8B A;  3SG2 A;  3KF9 A;  2BCA A;  3EG5 B;  4JPZ B;  4NDC A;  2I94 A;  2M7N A;  2ZRS A;  4MZK A;  1ALV A;  3FE6 A;  1CNP A;  1J7R A;  1M46 A;  3BXK A;  1G8I A;  3NSO A;  1Y1A A;  4TNC A;  1CM1 A;  1S6C A;  1TCF A;  4YI9 A;  3B7A A;  2B1U A;  2JOJ A;  3D74 A;  4AQJ A;  2PYQ A;  1CTR A;  2CT9 A;  4UPG A;  1UWO A;  1U5I A;  4ORA B;  1Z4H A;  2AUC A;  1N65 A;  3O78 A;  3GK4 X;  1AVS A;  3BFB A;  1IGV A;  1SK6 D;  3NGV A;  2KGR A;  1TCO B;  1P28 A;  2AMI A;  4INW A;  5JJG A;  1YRT B;  1DGU A;  2M8U A;  1F4Q A;  1CB1 A;  2Y1N A;  5I2L A;  1DEL A;  1S6I A;  5DKR A;  1WLZ A;  4PE0 A;  1CLM A;  3VRO A;  1JC2 A;  1NPQ A;  2GTE A;  1LA0 A;  2FJY A;  1KQV A;  2K2F A;  2KI4 C;  2MJW B;  2WCF A;  2KPH A;  4QJ4 B;  1N2D A;  2K7B A;  1TNQ A;  2LUX A;  3I5F B;  1B9A A;  4N1F A;  1WRK A;  3DXL A;  1W9Z A;  2BBM A;  2H61 A;  2G2B A;  2QDI A;  1RRO A;  4HRG A;  3TUY C;  3TS5 C;  3AKA A;  4YGD B;  1XA5 A;  1A2X A;  3EK8 A;  4MZJ A;  4WQ2 A;  5IBW A;  1CKK A;  2KHN A;  2K61 A;  1TIZ A;  3D0Y A;  1K93 D;  5ER4 X;  1FI5 A;  1DJX A;  2JTT A;  1IKU A;  1JSA A;  1QJT A;  2K7C A;  2MHH A;  3KPX A;  4L9M A;  4OR9 B;  1MUX A;  4DIR A;  5I2Q A;  3NSL A;  4QJ3 B;  1S36 A;  2I2R E;  1DF0 B;  1XFY O;  2H2K A;  3EKJ A;  3SS4 A;  3VRN A;  1FPW A;  1CDL A;  3FIA A;  2HET A;  2FOT A;  3BOW A;  1NX3 A;  2LMV A;  2EC6 C;  2KGB C;  3LK1 A;  1W7J B;  3D76 A;  2K7D A;  1OOJ A;  2LAP A;  3I5I C;  2FCE A;  2PQL A;  1KFU L;  3O6B A;  1RFJ A;  5BPJ A;  1OMD A;  2CCM A;  3B86 A;  3EVU A;  1TN4 A;  1S6J A;  1QVI Y;  2LC5 A;  1SR6 B;  3TDU A;  1CM4 A;  4N1G A;  1DTL A;  3UNW A;  4PHN A;  3QME A;  1DJY A;  5I94 A;  2ZND A;  1OOI X;  1KFU S;  4D1E A;  3CR5 X;  2M49 B;  2JT0 A;  3WXA A;  2L50 A;  3TDZ A;  3RM1 A;  1NUB A;  3BUO B;  2ZFD A;  1BOC A;  5FI2 A;  1V1G A;  1NCX A;  1CFP A;  3CYZ A;  1OW4 A;  1J55 A;  2SCP A;  1B4C A;  1OOG A;  1SNL A;  1UUS A;  3DY9 A;  5AAN A;  1GGW A;  5D7F A;  1PVA A;  3NXA A;  4MVF A;  2WND A;  1N0Y A;  1S1E A;  3SIA A;  1S26 D;  1LS8 A;  2JT3 A;  1MF8 B;  2WCJ A;  3NHI A;  1Q80 A;  3SG4 A;  3S0F A;  3BUM B;  3CAB A;  3DYE A;  3PM8 A;  1XYD A;  4JKT A;  3I5G C;  1IWQ A;  1TNX A;  4A4C A;  1XO5 A;  3FE8 A;  3LK0 A;  1OZO A;  1DC1 A;  1SCM C;  5CSJ A;  1B47 A;  2F2O A;  1T14 A;  2WCL A;  3SG7 A;  2JQ6 A;  1OOH A;  1RK9 A;  2ZN9 A;  3ZNI A;  4MRY A;  2NLN A;  1IG5 A;  1UUR A;  2KAV A;  4KYN A;  1S5G Y;  3PFV A;  3I5H B;  2JPT A;  2WC8 A;  4GUK A;  1D1O A;  1WRZ A;  1QXP A;  2BKH B;  2KBI A;  2WOR A;  1BR4 B;  2K7O A;  4PDZ A;  1WDC C;  1YUR A; 
#chains in the Genus database with same CATH homology
 3DVJ A;  1BOD A;  5HKW A;  1NYA A;  2LE9 B;  2VRG A;  1CDN A;  1YX7 A;  1FBV A;  4ICB A;  4YGA A;  2JRF A;  2F8P A;  1AJ5 A;  2LUC A;  4XJK B;  4PCW A;  3VRR A;  4YGB B;  1GJY A;  1CLB A;  1L2O B;  2LVK A;  2WCE A;  4MRX A;  3IF7 A;  4YGC B;  2HQ8 A;  2KBM A;  4OV2 A;  3PN7 C;  2LHI A;  1TNW A;  3C1V A;  3EK7 A;  3JVT B;  1S5G Z;  1EL4 A;  5G08 A;  2JZI A;  1PSR A;  4PHK A;  1YR5 A;  4C0L A;  4GNK B;  2JNX A;  4ZCV A;  4GPL B;  1YUT A;  2L5X B;  4CID A;  3H4S E;  2PSR A;  1BR1 B;  2LP3 A;  2WCB A;  3D10 A;  2JC2 A;  1PRW A;  1UHH A;  2LP2 A;  1B8L A;  1QIV A;  2GGZ A;  1KCY A;  4JWQ A;  1SMG A;  1MHO A;  4Q04 A;  4BY4 A;  1X02 A;  1BJF A;  2OTG C;  1J7Q A;  1MXE A;  2MLE C;  3SG3 A;  4M2Q A;  1IQ3 A;  1DJG A;  2COL B;  2LVJ A;  3TDI A;  1WLM A;  4MZL A;  4NQG A;  1PSB A;  1KQM C;  1TRF A;  3EK4 A;  1PVB A;  2Y4Q A;  1PUL A;  3CGA A;  2LLS A;  1G4Y R;  2QPT A;  1M45 A;  4GBA A;  1C07 A;  1UHJ A;  2KSP A;  4PHM A;  1NX0 A;  2TN4 A;  1CMG A;  2LLT A;  3PSR A;  2KYC A;  4YGE B;  3EVV A;  1SL8 A;  3FWB A;  1CFF A;  1NIW A;  1XFV O;  2FCD A;  2MA2 A;  2FJU B;  2Q4U A;  2NCO A;  4GGN A;  2WOS A;  1YVH A;  2HQW A;  1CMF A;  5J3X A;  1KK8 B;  1SCV A;  4HRE E;  2KYF A;  2NCP A;  3PLF B;  1FW4 A;  3LL8 B;  1DJW A;  1K8U A;  3SG6 A;  1QX5 B;  1MR8 A;  4MBE A;  4GAO A;  1AHR A;  1LIN A;  1EXR A;  5HYD A;  1J1D A;  1ZAC A;  2LVV A;  1F8H A;  1QLS A;  1UHN A;  5DKN A;  1XFU O;  2ZN8 A;  4I5N B;  1IQ5 A;  1MQ1 A;  4GFT A;  3LLE A;  3VRP A;  2JXL A;  5DKQ A;  2LMU A;  5F6T A;  5HKY A;  4WRI A;  3CS1 A;  3MSE B;  5JOL A;  1C7W A;  1SKT A;  3GK2 A;  3OX6 A;  2ISD A;  1KWO B;  3SJS A;  1ZOT B;  4MSP A;  3DF0 A;  4PE7 A;  3EKH A;  3O4Y A;  5ER5 A;  1B7T Y;  4FTG A;  2ZKM X;  1K9K A;  1NCY A;  2LV7 A;  5CSI A;  1A03 A;  1RWY A;  1DJZ A;  1KSM A;  2Q91 A;  2I7A A;  2CNP A;  2LLU A;  1LA3 A;  1LKJ A;  1TOP A;  4DRW A;  3ZWH A;  4F0Z B;  4OVN F;  4A4B A;  2A4J A;  3BQ3 A;  1DJI A;  2L4H A;  4C0K A;  3I5F C;  2F2P A;  3OP0 A;  4IL1 A;  2CXJ A;  3DVE A;  2M7L A;  2JNF A;  1FF1 A;  2BCX A;  4BY5 A;  3PAT A;  1IJ6 A;  1A75 A;  2E30 A;  3JTD B;  5CSF A;  2L2E A;  4GGF C;  3KO0 A;  2CBL A;  4PAL A;  2ZNE A;  2NZ0 A;  1B7T Z;  2BL0 B;  3BUW B;  2LNK A;  2KAY A;  3PAL A;  1DT7 B;  1YVL A;  3D0Y B;  1MXL C;  3CLN A;  2OS8 B;  1J1E A;  5CSN A;  5AXI A;  1B8R A;  1YTZ C;  5I2O A;  1SW8 A;  3OHM B;  1GQM A;  1AK8 A;  4MLW A;  5AFP A;  4AOM A;  1HT9 A;  5KTY A;  1SR6 C;  1TTX A;  1BF5 A;  2IS9 A;  3TZ1 A;  1HQV A;  1UP5 A;  2HF5 A;  3BOW B;  1C7V A;  1F4O A;  3M0W A;  2ZRT A;  1AJ4 A;  2PRU A;  1G33 A;  5KSZ A;  1JWD A;  1BG1 A;  1KFX S;  3E3R A;  3AKB A;  1DJH A;  2L0P A;  1OMR A;  2OPO A;  2G9B A;  3QRX A;  4PE1 A;  5HKZ A;  1XFX O;  2M0R A;  2O5G A;  1F54 A;  4PHJ A;  3BUX B;  4OKH A;  1A29 A;  2LM5 A;  5HLO A;  1BT6 A;  1UHI A;  5AER A;  5AEQ A;  2BE6 A;  1K95 A;  2E6W A;  3CR2 A;  1S3P A;  1AP4 A;  3LCP C;  4DUQ A;  1J7O A;  4QJ5 B;  4DS7 A;  1BMO A;  3ICB A;  4JQ0 D;  3AAJ A;  4ETO A;  2KQ6 A;  1NX2 A;  1K96 A;  3OB1 B;  5FYX A;  1RTP 1;  1JF2 A;  2JTZ A;  1Y1X A;  1OE9 B;  1CFD A;  1JUO A;  3O2P A;  2EHB A;  2BBN A;  5D69 A;  4CFQ A;  3I5H C;  3BYA A;  1KK7 Z;  4ORC B;  5B8I B;  5I8N A;  1RJV A;  2LAN A;  1QLK A;  1NX1 A;  2KI4 B;  2BEC A;  4GGF A;  3HX4 A;  4DCK A;  1XFW O;  2M1K B;  4N5X A;  1IH0 A;  1PAL A;  1OMV A;  1VRK A;  2LHL A;  1IRJ A;  2K2A A;  3TUY B;  1YUS A;  1QS7 A;  1F70 A;  3TS5 B;  1DF0 A;  4WQ3 A;  1BLQ A;  2MAZ A;  1JFK A;  2NXQ A;  3OX5 A;  1CDM A;  2P6B B;  3EVR A;  4E68 A;  3NSI A;  1K94 A;  1A4P A;  1L2O C;  2KQY A;  4ORB B;  5GQQ C;  1NSH A;  3GOF A;  2D8N A;  4M2P A;  2V53 A;  1ZUZ A;  4R1E A;  1EJ3 A;  1R2U A;  4CLN A;  3F45 A;  1J7P A;  1JF0 A;  3JVT C;  4CFR A;  3IQQ A;  4CPV A;  2F3Z A;  3WHT B;  5KU1 A;  1F55 A;  4I5J A;  2KI6 D;  1TNP A;  1YUU A;  3SIB A;  2EC6 B;  3OB2 B;  1XVJ A;  1V1F A;  1XK4 C;  1YRU B;  3I5I B;  1QIW A;  3CWG A;  4AQI A;  1R6P A;  1CLL A;  2M9G A;  1GGZ A;  1EH2 A;  3WNX B;  2L51 A;  4U8D A;  5TNC A;  4XYN A;  2PVB A;  1UHK A;  3CZT X;  1NP8 A;  2KDH A;  1DMO A;  5K89 A;  3DD4 A;  1QV0 A;  2AAO A;  1OSA A;  1Y6W A;  1SBJ A;  2LMT A;  2K8M B;  1WY9 A;  3A4U B;  1M63 B;  4NDD A;  2MLF C;  3VRQ A;  1U5I B;  1ZMZ A;  3WHU B;  1M39 A;  1Y1U A;  2RGI A;  2HPS A;  1SPY A;  1JBA A;  4P2Y B;  2K0J A;  3GK1 A;  2LCP A;  2PMY A;  1JFJ A;  2MRD A;  2F33 A;  3AAK A;  3I5G B;  4MEW A;  1KK8 C;  1QX7 A;  2I18 A;  2BE4 A;  1OZS A;  1SCM B;  4NDB A;  4P5O E;  3RLZ A;  4I5K A;  2MBX A;  2KFH A;  2PAS A;  1SYM A;  2BKI B;  2LVI A;  2CTN A;  3FWC A;  2BCB A;  3HCM A;  1CDP A;  4XJK A;  1OQP A;  1SY9 A;  2JU0 A;  1WDC B;  4M2O A;  2QAC A;  1QAS A;  1DVI A;  4C0J A;  1MWN A;  2R2I A;  3DVK A;  3DVM A;  4YI8 A;  2JWW A;  1B8C A;  1B1G A;  1LXF C;  1KWO C;  1Y0V H;  1QV1 A;  1K90 D;  2M3W A;  1K2H A;  1K9U A;  1ODB A;  3BUN B;  1EG3 A;  3KEV A;  2M97 A;  2F3Y A;  3KHE A;  4PE4 A;  4YRU A;  1FI6 A;  2O60 A;  2JUL A;  3PN7 B;  1XK4 A;  4HSZ A;  2KAX A;  3SG5 A;  4YBH B;  1KFX L;  4MN0 A;  1DGV A;  4USL A;  3DF0 B;  1REC A;  2Y1M A;  1H4B A;  1SRA A;  2KFF A;  3IQO A;  1QVI Z;  4I5L B;  1L7Z A;  1K9P A;  4HRH A;  5CPV A;  2L98 A;  1KK7 Y;  3CTN A;  4FQO A;  1QTX A;  2M1U A;  2M29 A;  2GV5 A;  2L4I A;  1NWD A;  2PAL A;  1PK0 D;  1CFC A;  1YX8 A;  2SAS A;  2KOT A;  2OTG B;  5PAL A;  1QX2 A;  1XFZ O;  3JTD C;  5HLV A;  1EG4 A;  3NSK A;  1NCZ A;  3VGO A;  2H61 C;  2JXC A;  1SL9 A;  2KNE A;  4OCI A;  3FS7 A;  2BL0 C;  2DOQ A;  1KQM B;  1A75 B;  2JT8 A;  4ZCU A;  1KSO A;  1M31 A;  1ZFS A;  2EGD A;  1AUI B;  1E8A A;  2Y5I A;  1WRL A;  1BU3 A;  1ALW A;  1LVC D;  2GGM A;  2KFG A;  2KI6 C;  2OS8 C;  1F71 A;  1QAT A;  1SL7 A;  3K21 A;  1W7I B;  3CR4 X;  3A8R A;  1IJ5 A;  1H8B A;  3SG2 A;  3KF9 A;  2BCA A;  4JPZ B;  4NDC A;  2I94 A;  2M7N A;  2ZRS A;  4MZK A;  1ALV A;  1CNP A;  1J7R A;  1M46 A;  3BXK A;  1G8I A;  3NSO A;  1Y1A A;  4TNC A;  1CM1 A;  1S6C A;  1TCF A;  4YI9 A;  2B1U A;  2JOJ A;  4AQJ A;  1CTR A;  2CT9 A;  4UPG A;  1UWO A;  1U5I A;  4ORA B;  2AUC A;  1N65 A;  3O78 A;  3GK4 X;  1AVS A;  1IGV A;  1SK6 D;  2KGR A;  1TCO B;  2AMI A;  5JJG A;  1YRT B;  1DGU A;  2M8U A;  1F4Q A;  1CB1 A;  2Y1N A;  5I2L A;  1S6I A;  5DKR A;  1WLZ A;  4PE0 A;  1CLM A;  3VRO A;  1JC2 A;  1NPQ A;  1LA0 A;  1KQV A;  2K2F A;  2KI4 C;  2MJW B;  2WCF A;  4QJ4 B;  1N2D A;  2K7B A;  1TNQ A;  2LUX A;  3I5F B;  1B9A A;  4N1F A;  1WRK A;  2BBM A;  2H61 A;  2G2B A;  1RRO A;  4HRG A;  3TUY C;  3TS5 C;  3AKA A;  4YGD B;  1XA5 A;  1A2X A;  3EK8 A;  4MZJ A;  4WQ2 A;  5IBW A;  1CKK A;  2KHN A;  2K61 A;  1TIZ A;  3D0Y A;  1K93 D;  5ER4 X;  1FI5 A;  1DJX A;  2JTT A;  1IKU A;  1JSA A;  1QJT A;  2K7C A;  2MHH A;  3KPX A;  4L9M A;  4OR9 B;  1MUX A;  4DIR A;  5I2Q A;  3NSL A;  4QJ3 B;  1S36 A;  2I2R E;  1DF0 B;  1XFY O;  2H2K A;  3EKJ A;  3VRN A;  1FPW A;  1CDL A;  3FIA A;  2HET A;  2FOT A;  3BOW A;  1NX3 A;  2LMV A;  2EC6 C;  2KGB C;  3LK1 A;  1W7J B;  2K7D A;  1OOJ A;  2LAP A;  3I5I C;  2FCE A;  3O6B A;  1KFU L;  5BPJ A;  1RFJ A;  1OMD A;  2CCM A;  3EVU A;  1TN4 A;  1S6J A;  1QVI Y;  2LC5 A;  1SR6 B;  3TDU A;  1CM4 A;  4N1G A;  1DTL A;  4PHN A;  1DJY A;  2ZND A;  1KFU S;  4D1E A;  3CR5 X;  2M49 B;  2JT0 A;  3WXA A;  2L50 A;  3TDZ A;  3RM1 A;  1NUB A;  3BUO B;  2ZFD A;  1BOC A;  1V1G A;  1NCX A;  1CFP A;  1J55 A;  2SCP A;  1B4C A;  1SNL A;  5AAN A;  1UUS A;  1GGW A;  5D7F A;  1PVA A;  3NXA A;  4MVF A;  2WND A;  1N0Y A;  1S1E A;  3SIA A;  1S26 D;  2JT3 A;  1MF8 B;  1Q80 A;  3SG4 A;  3BUM B;  3PM8 A;  1XYD A;  3I5G C;  1IWQ A;  1TNX A;  4A4C A;  1XO5 A;  3LK0 A;  1OZO A;  1SCM C;  5CSJ A;  1B47 A;  2F2O A;  3SG7 A;  2JQ6 A;  1RK9 A;  2ZN9 A;  3ZNI A;  4MRY A;  2NLN A;  1IG5 A;  1UUR A;  2KAV A;  1S5G Y;  3PFV A;  3I5H B;  2JPT A;  2WC8 A;  4GUK A;  1D1O A;  1WRZ A;  1QXP A;  2BKH B;  2KBI A;  2WOR A;  1BR4 B;  2K7O A;  4PDZ A;  1WDC C;  1YUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...