3FS7A

Crystal structure of gallus gallus beta-parvalbumin (avian thymic hormone)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
AITDILSAKDIESALSSCQAADSFNYKSFFSTVGLSSKTPDQIKKVFGILDQDKSGFIEEEELQLFLKNFSSSARVLTSAETKAFLAAGDTDGDGKIGVEEFQSLVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin, thymic
publication title Structure of avian thymic hormone, a high-affinity avian beta-parvalbumin, in the Ca2+-free and Ca2+-bound states.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal binding protein
total genus 41
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3fs7A00
2GV5A 3FS7A 2JXLA 3WNXB 2LP3A 3BUNB 2LVIA 1OMRA 4JPZB 2BECA 1K9PA 3KEVA 1SR6B 3SIBA 1F54A 2LANA 1SRAA 1B7TY 1CDMA 1IG5A 2KNEA 1CLBA 1K93D 3CTNA 1LKJA 1ZMZA 2SASA 3H4SE 3PM8A 1QS7A 2K2AA 2BE4A 2LP2A 2MLEC 3EVRA 1QIWA 2JWWA 3VRQA 1SMGA 1NPQA 2ZFDA 1UHJA 1K2HA 3CS1A 1CTRA 2HQ8A 3JVTC 1TNXA 2CTNA 4WQ2A 3SJSA 2LV7A 2A4JA 2CBLA 3M0WA 1NX0A 1B4CA 1B9AA 3I5IC 1B7TZ 4PE1A 4FQOA 1NX1A 1WDCC 3DVJA 1BODA 3LCPC 3JVTB 1XA5A 2ZN9A 5ER4X 5HYDA 3I5IB 2L98A 4I5NB 1WDCB 1TN4A 1CDPA 1DTLA 1G8IA 1QV1A 1YX7A 2JT0A 2OPOA 1Y1XA 3O6BA 3C1VA 2F33A 2ZNDA 3PN7C 3ICBA 4OKHA 5BPJA 4MBEA 4PHKA 4CFQA 4NDBA 1FPWA 2EGDA 1NX2A 3PATA 1YVLA 4MLWA 3HX4A 1AUIB 2F3YA 1NIWA 4CFRA 4WQ3A 1YUSA 1SKTA 3PN7B 1LA0A 2Y4QA 4DS7A 1WLZA 1ZACA 1NYAA 2OS8C 3BUMB 1DF0B 3BUOB 2BCXA 2KOTA 1Y1AA 1CNPA 2LNKA 3BUXB 1QLKA 2MRDA 2HF5A 1SCMC 2I94A 1KSMA 2O5GA 1BLQA 1QVIZ 1H8BA 2JU0A 3ZWHA 2EC6C 1FI5A 1JF2A 1J7OA 2E6WA 2OS8B 1TNQA 1WRLA 1XYDA 1LA3A 3DVKA 2KBMA 2NZ0A 1FF1A 3CZTX 4MRXA 4N1FA 1R2UA 5I2LA 2CXJA 4U8DA 1SCMB 2JOJA 1QX7A 1DGUA 1ODBA 4D1EA 1TTXA 5HKYA 5K89A 2EC6B 4A4CA 5HLVA 1DT7B 2H61C 1SL8A 1MQ1A 3CLNA 1CFCA 1Q80A 5AXIA 1S6JA 4MZJA 4ORBB 2NXQA 3OX6A 1LINA 4MSPA 2LHIA 1X02A 3FIAA 1QIVA 1OSAA 4YGAA 3SG2A 3DF0B 1YX8A 2L0PA 2L51A 2FCDA 3O2PA 2L50A 3FWBA 4MN0A 1PALA 1J55A 5AEQA 3SG5A 4OVNF 1IJ5A 1BMOA 4MRYA 4GNKB 3DF0A 4I5JA 1KK8C 2PVBA 1UHNA 2I2RE 2KFHA 2H61A 1U5IB 1YRTB 2GGZA 3LL8B 1UURA 2LMTA 3D10A 3EVUA 3JTDC 1IJ6A 1B8CA 1AHRA 3BYAA 2KAVA 4FTGA 1RROA 1XFYO 2SCPA 1YR5A 2BCAA 2OTGC 1U5IA 1QX5B 1KK8B 1XVJA 1YTZC 1D1OA 4DIRA 1CFPA 1KQVA 3NSIA 2E30A 3JTDB 2M7LA 3CGAA 1K95A 3CWGA 1EG4A 1S26D 2IS9A 2L2EA 2LLUA 3QRXA 4CPVA 1L2OC 1MWNA 2OTGB 3OX5A 2VRGA 1XFVO 1FBVA 1SCVA 4GUKA 1C07A 3TDIA 5DKRA 4A4BA 4QJ3B 2JNFA 2KI6D 1GQMA 5CSIA 3OP0A 4HRGA 4Q04A 5B8IB 2I18A 3I5FC 1JFJA 4PHNA 1V1GA 3A4UB 1L2OB 1CMGA 5G08A 4AQJA 2Y5IA 1CM1A 2KYFA 5J3XA 1XFUO 5HKZA 1PSBA 2LVJA 1M31A 2I7AA 3IQQA 5AANA 2JNXA 4GGFC 1TCFA 3O4YA 5CSFA 3I5FB 1N65A 1EG3A 1A2XA 1QJTA 1CB1A 2JTZA 1KFXS 1F55A 2JT3A 1H4BA 2BE6A 4I5KA 3ZNIA 3F45A 1K8UA 2TN4A 1V1FA 3SG6A 2AUCA 4BY5A 1YUUA 1BF5A 4XYNA 1WRKA 1PVAA 4AQIA 2KBIA 2CNPA 1EJ3A 4OR9B 2JQ6A 1UHKA 1QV0A 2KQYA 3NSOA 4PHMA 2CT9A 4GGFA 1ZOTB 1OZSA 2Q91A 2KFGA 3KHEA 1GGZA 2KQ6A 3GOFA 4R1EA 2KGBC 1Y1UA 5I2OA 3E3RA 3HCMA 1QVIY 1QATA 1WLMA 4YGEB 1J1EA 2MLFC 3WHUB 3KPXA 1Y6WA 4JQ0D 3VRNA 2M1KB 3NSLA 4M2PA 4M2QA 5JJGA 5ER5A 3NSKA 1RFJA 3FWCA 2ZNEA 4OCIA 2KDHA 4F0ZB 2LC5A 1DJWA 5IBWA 2CCMA 2LCPA 2WC8A 1S3PA 4HREE 2D8NA 5JOLA 2LMUA 1JFKA 1MF8B 1DJZA 3DVEA 3OB1B 5F6TA 1AVSA 2K2FA 4GFTA 1WY9A 1VRKA 1BG1A 3CR5X 2AAOA 4NDCA 1KWOC 2WCFA 4PDZA 2QACA 2PALA 1FW4A 2RGIA 3PLFB 1UWOA 3RM1A 1F8HA 3AAJA 2PASA 3EK8A 1FI6A 2MBXA 4P2YB 4C0KA 1MUXA 5CSJA 1CMFA 4MZLA 1J7PA 4YGCB 1YURA 2BL0C 1KWOB 2K61A 1CDNA 1K94A 1BR1B 1SW8A 5PALA 1B8LA 4ZCVA 2BBMA 2FCEA 1BOCA 3D0YA 2HQWA 4YGDB 2NCPA 4TNCA 1YVHA 3WXAA 1PVBA 2M97A 3EKJA 4MZKA 2Y1MA 4P5OE 3CR2A 1JWDA 4WRIA 1M63B 1ZFSA 4ICBA 2BL0B 1DJIA 2KI4C 4ZCUA 1KK7Y 3SG7A 3TS5C 4MVFA 1AP4A 2L4IA 3BQ3A 1IQ3A 2R2IA 1R6PA 3LLEA 3OB2B 2COLB 1LVCD 1A75B 1ALVA 2K7OA 4GPLB 1AJ4A 2GGMA 3IQOA 2B1UA 1Y0VH 2KI4B 4JWQA 3TS5B 1IKUA 4HSZA 3RLZA 3WHTB 1A75A 1KK7Z 3PSRA 2LUXA 2M1UA 4ETOA 1F4OA 1HQVA 5CPVA 5I2QA 2JZIA 3O78A 5HLOA 1M45A 3DD4A 2QPTA 3TDZA 4HRHA 4PCWA 1OMVA 2LHLA 1A03A 2AMIA 1DJGA 3TZ1A 1QASA 2JT8A 4PHJA 1CFDA 1AJ5A 2F3ZA 2F2OA 2ISDA 3VRPA 1NWDA 4IL1A 5CSNA 2KAYA 1JUOA 3AKAA 3KF9A 1SPYA 1A29A 1UHIA 1PK0D 1ZUZA 3PFVA 4NQGA 1PRWA 4PE0A 2MHHA 2LM5A 1IRJA 1QXPA 2LUCA 4DCKA 2WCBA 1DJYA 5KSZA 2K7CA 1ALWA 1QLSA 2Y1NA 2HETA 1F4QA 1GJYA 2K7DA 3VGOA 4AOMA 3GK4X 1RJVA 2KFFA 2KGRA 4C0LA 1PSRA 1NX3A 5AERA 3AKBA 1OOJA 1KFUL 1IQ5A 2FJUB 1S6CA 4C0JA 1TRFA 3LK0A 4CIDA 2M0RA 2ZKMX 3I5HC 2KI6C 1IH0A 3BUWB 4NDDA 1MHOA 1M39A 1JF0A 2NCOA 3TUYC 1KSOA 3GK2A 3MSEB 1W7IB 2WOSA 1XFWO 2ZRTA 1B47A 1IGVA 2K8MB 4USLA 3SG4A 1F70A 1UHHA 2BCBA 1HT9A 2NLNA 1K96A 1B1GA 5KTYA 2FOTA 2KYCA 5I8NA 1NSHA 1IWQA 1J7QA 3I5HB 1NUBA 1QX2A 1J7RA 2MA2A 2DOQA 1S5GY 3VRRA 2PRUA 3AAKA 3TUYB 1UP5A 1XFZO 2G9BA 2P6BB 5DKNA 1BU3A 1DJXA 1L7ZA 2LAPA 3EVVA 4CLNA 2L4HA 1CLMA 1NCXA 3A8RA 2M29A 1M46A 1S36A 4GAOA 1C7VA 1SY9A 4DRWA 1DVIA 4DUQA 2LLSA 4N5XA 1OQPA 3OHMB 4XJKB 2BBNA 1BJFA 2M3WA 1LXFC 1RK9A 3SG3A 2WORA 1XK4C 4PE4A 4YRUA 1SYMA 4YI8A 4OV2A 5GQQC 1S5GZ 3NXAA 1K9KA 2EHBA 3K21A 4XJKA 2G2BA 1CM4A 3PALA 1JBAA 1EH2A 1SL9A 1K9UA 3BOWB 2K0JA 3VROA 1SK6D 1CDLA 1B8RA 1KFXL 2ZRSA 1RTP1 1SNLA 1K90D 3D0YB 1N2DA 2JPTA 2V53A 1A4PA 1TNPA 5AFPA 1RWYA 3BOWA 4GBAA 2KAXA 4I5LB 2F8PA 2PSRA 1DF0A 1XK4A 2O60A 1EL4A 2H2KA 2M8UA 1EXRA 1RECA 3EKHA 3LK1A 3CR4X 4MEWA 5DKQA 1S6IA 3I5GC 3EK7A 1XO5A 2L5XB 1TOPA 1S1EA 2LLTA 2LVKA 1YRUB 4GGNA 2ZN8A 2MAZA 2PMYA 4QJ4B 1OMDA 1OZOA 4UPGA 1TNWA 3EK4A 1MR8A 1WRZA 1AK8A 3I5GB 4YI9A 1NP8A 3BXKA 4PALA 1J1DA 1SBJA 2BKIB 2M7NA 2LMVA 2LVVA 1TCOB 1TIZA 3SIAA 1F71A 2KSPA 2M49B 4L9MA 1UUSA 1XFXO 4QJ5B 1DJHA 1SL7A 2Q4UA 4BY4A 1KFUS 1W7JB 1KQMC 1KCYA 1JC2A 1CLLA 1CKKA 3GK1A 5HKWA 2K7BA 1N0YA 1OE9B 2JRFA 2JULA 5FYXA 5KU1A 4YBHB 1MXEA 1NCYA 3IF7A 4N1GA 1NCZA 2LE9B 4PE7A 3TDUA 1JSAA 4ORAB 4E68A 5D7FA 2M9GA 2F2PA 1MXLC 3KO0A 1KQMB 2HPSA 2MJWB 1QTXA 1BR4B 2KHNA 4M2OA 1GGWA 2JTTA 1E8AA 3DVMA 1YUTA 2WNDA 1CFFA 2BKHB 1G33A 1PULA 2WCEA 1G4YR 1SR6C 5TNCA 1BT6A 1DGVA 1C7WA 4YGBB 1DMOA 2JC2A 2JXCA 5D69A 4ORCB
chains in the Genus database with same CATH superfamily
2GV5A 2QEOA 2JXLA 3FS7A 3WNXB 2LP3A 3BUNB 2LVIA 1OMRA 1OW4A 2BECA 1K9PA 3CYZA 1SR6B 3KEVA 4JPZB 2BNXA 3SIBA 3RZSA 1F54A 2LANA 1SRAA 1B7TY 1CDMA 1IG5A 2KNEA 1CLBA 1K93D 3CTNA 1LKJA 1ZMZA 2SASA 3H4SE 2PQLA 1QS7A 2K2AA 2BE4A 2LP2A 2MLEC 3EVRA 3PM8A 1QIWA 1QWVA 2JWWA 3VRQA 1SMGA 1NPQA 2ZFDA 1UHJA 1K2HA 3CS1A 1CTRA 2HQ8A 3JVTC 3S0BA 1TNXA 2CTNA 4WQ2A 3SJSA 5FI6A 2LV7A 2A4JA 2CBLA 2FJYA 1NX0A 3M0WA 1B4CA 1B9AA 3I5IC 1B7TZ 4PE1A 4FQOA 1NX1A 1WDCC 2P70A 3DVJA 3O6BA 1BODA 3FE9A 3LCPC 3JVTB 1XA5A 2ZN9A 5ER4X 3OGNA 5HYDA 1C3YA 3I5IB 2L98A 4I5NB 1WDCB 1TN4A 1CDPA 1DTLA 1G8IA 1QV1A 1YX7A 2JT0A 2L2CA 1T14A 1Y1XA 2OPOA 3BJHA 1TUJA 3C1VA 2F33A 2ZNDA 3DYEA 3ICBA 3EG5B 3PN7C 4OKHA 5BPJA 4MBEA 4PHKA 4CFQA 4NDBA 1FPWA 2EGDA 1NX2A 3PATA 2WCMA 1YVLA 4MLWA 3HX4A 1AUIB 2F3YA 1NIWA 4CFRA 4WQ3A 1YUSA 1SKTA 1C3ZA 1LA0A 2Y4QA 3PN7B 4DS7A 1WLZA 1ZACA 1NYAA 2OS8C 3BUMB 1DF0B 3BUOB 2BCXA 2KOTA 1Y1AA 1CNPA 2LNKA 3BUXB 1LS8A 1QLKA 2MRDA 2HF5A 1SCMC 2I94A 1KSMA 2O5GA 3O4XA 1BLQA 1QVIZ 3FE6A 1H8BA 2JU0A 3ZWHA 2EC6C 1FI5A 1JF2A 1J7OA 2E6WA 2OS8B 1TNQA 1WRLA 1XYDA 1LA3A 3DVKA 2KBMA 2NZ0A 1FF1A 3CZTX 2L5YA 4MRXA 4N1FA 1R2UA 5I2LA 2CXJA 4U8DA 1SCMB 2JOJA 3D77A 1QX7A 1DGUA 1ODBA 4D1EA 1TTXA 5HKYA 5K89A 2EC6B 2QDIA 4A4CA 5HLVA 1DC1A 1DT7B 2H61C 1SL8A 1MQ1A 3CLNA 1CFCA 1Q80A 5AXIA 1S6JA 4MZJA 4ORBB 2NXQA 3OX6A 1LINA 4MSPA 3UNWA 2LHIA 1X02A 3FIAA 1QIVA 2P71A 1OSAA 4YGAA 3SG2A 2WCJA 3DF0B 4FQTA 1YX8A 2L0PA 2L51A 2FCDA 3O2PA 2L50A 3FWBA 4MN0A 1PALA 1J55A 5AEQA 3SG5A 4OVNF 1IJ5A 1BMOA 4MRYA 4PT1A 4GNKB 3DF0A 4I5JA 1KK8C 2PVBA 1UHNA 2I2RE 2KFHA 3D73A 2H61A 1U5IB 1YRTB 2GGZA 3LL8B 1UURA 2LMTA 1OOFA 3D10A 3EVUA 3JTDC 1IJ6A 1B8CA 1AHRA 3BYAA 2KAVA 4FTGA 1RROA 1XFYO 2SCPA 1YR5A 2BCAA 2OTGC 1U5IA 1QX5B 1KK8B 1XVJA 1YTZC 1D1OA 3K1EA 4DIRA 5EL2A 1GM0A 3DXLA 1CFPA 1KQVA 3NSIA 1ORGA 2E30A 3JTDB 2M7LA 3CGAA 1OOIX 1K95A 3CWGA 2KLDA 1EG4A 1S26D 2IS9A 2L2EA 2LLUA 3FE8A 3QRXA 1L2OC 4CPVA 1MWNA 2OTGB 3OX5A 2VRGA 1XFVO 3S0GA 1FBVA 1SCVA 4GUKA 1C07A 3CDNA 3TDIA 5DKRA 4A4BA 4QJ3B 2JNFA 2KI6D 3N7HA 1GQMA 5CSIA 3OP0A 4HRGA 4Q04A 5D3OA 2I18A 3I5FC 5B8IB 4PHNA 3IVTA 1JFJA 1V1GA 3A4UB 1L2OB 2WCHA 1CMGA 5G08A 4AQJA 2Y5IA 1CM1A 2KYFA 5J3XA 1XFUO 5HKZA 1PSBA 1SSEB 2LVJA 1M31A 2I7AA 3IQQA 5AANA 2JNXA 4GGFC 1TCFA 1OOHA 3O4YA 5CSFA 3I5FB 1N65A 1EG3A 1A2XA 1QJTA 1CB1A 2JTZA 1KFXS 1F55A 2JT3A 1H4BA 1DQEA 2BE6A 4I5KA 3ZNIA 3F45A 1K8UA 2TN4A 3L4AA 1V1FA 3SG6A 2AUCA 4BY5A 1YUUA 1BF5A 4XYNA 4INXA 1WRKA 1PVAA 1Z2CB 4AQIA 2KBIA 2CNPA 1EJ3A 4OR9B 2JQ6A 1UHKA 1QV0A 2KQYA 3NSOA 4PHMA 2CT9A 2WCLA 4GGFA 1ZOTB 1OZSA 2JPOA 2Q91A 2KFGA 3KHEA 1GGZA 2KQ6A 3GOFA 4R1EA 3B86A 3PJIA 2KGBC 1Y1UA 5I2OA 1XFRA 3E3RA 3HCMA 1QVIY 1QATA 1WLMA 4YGEB 1J1EA 4JKTA 2MLFC 3WHUB 3KPXA 1Y6WA 3R1VA 4JQ0D 3VRNA 2M1KB 3NSLA 4M2PA 4M2QA 5JJGA 5ER5A 3NSKA 1RFJA 2QEHA 3FWCA 2ZNEA 4OCIA 2KDHA 3CZ2A 4F0ZB 2LC5A 3D74A 1DJWA 5IBWA 2CCMA 2LCPA 2WC8A 1S3PA 4HREE 2D8NA 5FI2A 5JOLA 2LMUA 1JFKA 1MF8B 1DJZA 3DVEA 3OB1B 5F6TA 1AVSA 2K2FA 4GFTA 1WY9A 1VRKA 1BG1A 3CR5X 2AAOA 4NDCA 1KWOC 2WCFA 4PDZA 2QACA 2PALA 1FW4A 3SS4A 3R1OA 2RGIA 3PLFB 1UWOA 3RM1A 1F8HA 3AAJA 2PASA 3EK8A 1FI6A 2MBXA 4P2YB 4C0KA 1MUXA 5CSJA 3S0AA 1CMFA 4MZLA 1J7PA 4YGCB 1YURA 2BL0C 2YGUA 1KWOB 2K61A 1CDNA 1K94A 1BR1B 1SW8A 5PALA 5HL1A 1B8LA 4ZCVA 3BFHA 2BBMA 1W9ZA 2FCEA 3B6XA 2HQWA 3D0YA 4YGDB 1BOCA 2NCPA 4TNCA 1YVHA 3WXAA 1PVBA 3QMEA 2M97A 3EKJA 4MZKA 2Y1MA 3D76A 4P5OE 3CR2A 1JWDA 4WRIA 1M63B 1ZFSA 4ICBA 2BL0B 3Q8IA 1DJIA 2KI4C 4ZCUA 5FI7A 1KK7Y 3SG7A 3TS5C 4F7FA 4MVFA 3UO9A 3NGVA 1AP4A 2L4IA 3BQ3A 1IQ3A 2R2IA 1R6PA 3LLEA 3OB2B 2COLB 1LVCD 4KYNA 1A75B 1ALVA 2K7OA 4GPLB 1AJ4A 2GGMA 3IQOA 1Y0VH 2B1UA 2PYQA 2KI4B 4JWQA 3TS5B 1IKUA 4HSZA 2KLEA 3RLZA 3WHTB 1A75A 1KK7Z 3PSRA 2LUXA 2M1UA 4ETOA 1F4OA 1HQVA 5CPVA 5I2QA 2JZIA 3O78A 5HLOA 1M45A 3DD4A 2QPTA 3TDZA 3R72A 4HRHA 4PCWA 1OMVA 2LHLA 3D75A 1A03A 2AMIA 1DJGA 3TZ1A 1QASA 2JT8A 4PHJA 1CFDA 1AJ5A 2F3ZA 2F2OA 2ISDA 3VRPA 1NWDA 4IL1A 5CSNA 2KAYA 1JUOA 3AKAA 3KF9A 1SPYA 1A29A 1UHIA 1PK0D 1ZUZA 3PFVA 4NQGA 3V2LA 1PRWA 4PE0A 2MHHA 2LM5A 1IRJA 3DZTA 1QXPA 2LUCA 2WC5A 4DCKA 3NHTA 2WCBA 1DJYA 5KSZA 2H8VA 1P28A 2K7CA 1IIOA 1ALWA 1QLSA 2Y1NA 2HETA 1F4QA 1GJYA 2K7DA 3VGOA 4AOMA 3GK4X 3B87A 1Z4HA 2QEVA 3R1PA 1RJVA 2KFFA 2KGRA 4C0LA 1PSRA 1NX3A 5AERA 3AKBA 1OOJA 1KFUL 1IQ5A 2FJUB 1S6CA 4C0JA 1TRFA 5DICA 3LK0A 4CIDA 2M0RA 2ZKMX 3I5HC 2KI6C 1IH0A 3BUWB 4NDDA 1MHOA 1M39A 1JF0A 2NCOA 3OBVA 3TUYC 1KSOA 3GK2A 3MSEB 1W7IB 2WOSA 1XFWO 2ZRTA 1B47A 1IGVA 2K8MB 4USLA 3SG4A 1F70A 2WC6A 1UHHA 2BCBA 1HT9A 2NLNA 1K96A 1DELA 1B1GA 5KTYA 2FOTA 2KYCA 5I94A 5I8NA 1NSHA 1IWQA 1J7QA 3I5HB 1NUBA 2GTEA 1QX2A 1J7RA 3BFAA 2MA2A 2DOQA 3CZ1A 1S5GY 3VRRA 2PRUA 3AAKA 3S0DA 1UP5A 1XFZO 3TUYB 2G9BA 2P6BB 5DKNA 1BU3A 1DJXA 1L7ZA 2LAPA 3EVVA 4CLNA 2L4HA 1CLMA 1NCXA 2BAPA 2M29A 3A8RA 1M46A 1S36A 1TWOA 4GAOA 1C7VA 1SY9A 4DRWA 1DVIA 4DUQA 1OOGA 2LLSA 4N5XA 1OQPA 3OHMB 4XJKB 2BBNA 3CZ0A 1BJFA 2M3WA 1LXFC 1RK9A 3SG3A 2WORA 1XK4C 4PE4A 4YRUA 1SYMA 4YI8A 4OV2A 5GQQC 1S5GZ 3NXAA 1K9KA 2EHBA 3K21A 4XJKA 2G2BA 1CM4A 3PALA 1JBAA 1EH2A 1SL9A 1K9UA 3BOWB 3SS5A 2K0JA 4OZDA 3VROA 1SK6D 1CDLA 3D78A 3NHIA 1B8RA 1KFXL 2ZRSA 1RTP1 1SNLA 3B7AA 1K90D 3D0YB 1N2DA 2JPTA 3BFBA 2V53A 1A4PA 1TNPA 4IJ7A 5AFPA 1RWYA 3BOWA 3PM2A 4GBAA 2KAXA 4I5LB 2F8PA 2PSRA 1DF0A 2QEBA 1XK4A 2O60A 1EL4A 2H2KA 3VB1A 2M8UA 1EXRA 1RECA 3EKHA 3LK1A 3CR4X 4MEWA 5DKQA 1S6IA 3I5GC 3EK7A 1XO5A 2L5XB 1TOPA 1S1EA 3L4LA 2LLTA 2LVKA 1YRUB 4GGNA 2ZN8A 2MAZA 2PMYA 4QJ4B 1OMDA 1OZOA 4UPGA 2K60A 1TNWA 3EK4A 1MR8A 1WRZA 1AK8A 3I5GB 4YI9A 1NP8A 4INWA 3BXKA 1DEKA 4PALA 1J1DA 1SBJA 2BKIB 1TUZA 2M7NA 3S0FA 2LMVA 2LVVA 1TCOB 1TIZA 3SIAA 1F71A 2KSPA 4JD9A 2M49B 4L9MA 1UUSA 1XFXO 4QJ5B 1DJHA 1SL7A 2Q4UA 4BY4A 1KFUS 1W7JB 1KQMC 1KCYA 1JC2A 3S0EA 1CLLA 3SS3A 3DY9A 3GK1A 5HKWA 1CKKA 2K7BA 1N0YA 1OE9B 2JRFA 2JULA 5FYXA 2WCKA 5KU1A 4YBHB 1MXEA 1NCYA 3IF7A 2KPHA 1NCZA 2ERBA 4N1GA 2LE9B 4PE7A 3TDUA 1JSAA 4ORAB 4E68A 5D7FA 2M9GA 2F2PA 1MXLC 3KO0A 1KQMB 2HPSA 2MJWB 1QTXA 1BR4B 2KHNA 4M2OA 1GGWA 2JTTA 1E8AA 3DVMA 1YUTA 2WNDA 1CFFA 2BKHB 1G33A 1PULA 2WCEA 1G4YR 1SR6C 5TNCA 1BT6A 3CABA 1DGVA 1C7WA 3L47A 4YGBB 1DMOA 2JC2A 2JXCA 5D69A 3B88A 4ORCB
chains in the Genus database with same CATH topology
2GV5A 3FS7A 2JXLA 3WNXB 2LP3A 3BUNB 2LVIA 1OMRA 4JPZB 2BECA 1K9PA 3KEVA 1SR6B 3SIBA 1F54A 2LANA 1SRAA 1B7TY 1CDMA 1IG5A 2KNEA 1CLBA 1K93D 3CTNA 1LKJA 1ZMZA 2SASA 3H4SE 3PM8A 1QS7A 2K2AA 2BE4A 2LP2A 2MLEC 3EVRA 1QIWA 2JWWA 3VRQA 1SMGA 1NPQA 2ZFDA 1UHJA 1K2HA 3CS1A 1CTRA 2HQ8A 3JVTC 1TNXA 2CTNA 4WQ2A 3SJSA 2LV7A 2A4JA 2CBLA 3M0WA 1NX0A 1B4CA 1B9AA 3I5IC 1B7TZ 4PE1A 4FQOA 1NX1A 1WDCC 3DVJA 1BODA 3LCPC 3JVTB 1XA5A 2ZN9A 5ER4X 5HYDA 3I5IB 2L98A 4I5NB 1WDCB 1TN4A 1CDPA 1DTLA 1G8IA 1QV1A 1YX7A 2JT0A 2OPOA 1Y1XA 3O6BA 3C1VA 2F33A 2ZNDA 3PN7C 3ICBA 4OKHA 5BPJA 4MBEA 4PHKA 4CFQA 4NDBA 1FPWA 2EGDA 1NX2A 3PATA 1YVLA 4MLWA 3HX4A 1AUIB 2F3YA 1NIWA 4CFRA 4WQ3A 1YUSA 1SKTA 3PN7B 1LA0A 2Y4QA 4DS7A 1WLZA 1ZACA 1NYAA 2OS8C 3BUMB 1DF0B 3BUOB 2BCXA 2KOTA 1Y1AA 1CNPA 2LNKA 3BUXB 1QLKA 2MRDA 2HF5A 1SCMC 2I94A 1KSMA 2O5GA 1BLQA 1QVIZ 1H8BA 2JU0A 3ZWHA 2EC6C 1FI5A 1JF2A 1J7OA 2E6WA 2OS8B 1TNQA 1WRLA 1XYDA 1LA3A 3DVKA 2KBMA 2NZ0A 1FF1A 3CZTX 4MRXA 4N1FA 1R2UA 5I2LA 2CXJA 4U8DA 1SCMB 2JOJA 1QX7A 1DGUA 1ODBA 4D1EA 1TTXA 5HKYA 5K89A 2EC6B 4A4CA 5HLVA 1DT7B 2H61C 1SL8A 1MQ1A 3CLNA 1CFCA 1Q80A 5AXIA 1S6JA 4MZJA 4ORBB 2NXQA 3OX6A 1LINA 4MSPA 2LHIA 1X02A 3FIAA 1QIVA 1OSAA 4YGAA 3SG2A 3DF0B 1YX8A 2L0PA 2L51A 2FCDA 3O2PA 2L50A 3FWBA 4MN0A 1PALA 1J55A 5AEQA 3SG5A 4OVNF 1IJ5A 1BMOA 4MRYA 4GNKB 3DF0A 4I5JA 1KK8C 2PVBA 1UHNA 2I2RE 2KFHA 2H61A 1U5IB 1YRTB 2GGZA 3LL8B 1UURA 2LMTA 3D10A 3EVUA 3JTDC 1IJ6A 1B8CA 1AHRA 3BYAA 2KAVA 4FTGA 1RROA 1XFYO 2SCPA 1YR5A 2BCAA 2OTGC 1U5IA 1QX5B 1KK8B 1XVJA 1YTZC 1D1OA 4DIRA 1CFPA 1KQVA 3NSIA 2E30A 3JTDB 2M7LA 3CGAA 1K95A 3CWGA 1EG4A 1S26D 2IS9A 2L2EA 2LLUA 3QRXA 4CPVA 1L2OC 1MWNA 2OTGB 3OX5A 2VRGA 1XFVO 1FBVA 1SCVA 4GUKA 1C07A 3TDIA 5DKRA 4A4BA 4QJ3B 2JNFA 2KI6D 1GQMA 5CSIA 3OP0A 4HRGA 4Q04A 5B8IB 2I18A 3I5FC 1JFJA 4PHNA 1V1GA 3A4UB 1L2OB 1CMGA 5G08A 4AQJA 2Y5IA 1CM1A 2KYFA 5J3XA 1XFUO 5HKZA 1PSBA 2LVJA 1M31A 2I7AA 3IQQA 5AANA 2JNXA 4GGFC 1TCFA 3O4YA 5CSFA 3I5FB 1N65A 1EG3A 1A2XA 1QJTA 1CB1A 2JTZA 1KFXS 1F55A 2JT3A 1H4BA 2BE6A 4I5KA 3ZNIA 3F45A 1K8UA 2TN4A 1V1FA 3SG6A 2AUCA 4BY5A 1YUUA 1BF5A 4XYNA 1WRKA 1PVAA 4AQIA 2KBIA 2CNPA 1EJ3A 4OR9B 2JQ6A 1UHKA 1QV0A 2KQYA 3NSOA 4PHMA 2CT9A 4GGFA 1ZOTB 1OZSA 2Q91A 2KFGA 3KHEA 1GGZA 2KQ6A 3GOFA 4R1EA 2KGBC 1Y1UA 5I2OA 3E3RA 3HCMA 1QVIY 1QATA 1WLMA 4YGEB 1J1EA 2MLFC 3WHUB 3KPXA 1Y6WA 4JQ0D 3VRNA 2M1KB 3NSLA 4M2PA 4M2QA 5JJGA 5ER5A 3NSKA 1RFJA 3FWCA 2ZNEA 4OCIA 2KDHA 4F0ZB 2LC5A 1DJWA 5IBWA 2CCMA 2LCPA 2WC8A 1S3PA 4HREE 2D8NA 5JOLA 2LMUA 1JFKA 1MF8B 1DJZA 3DVEA 3OB1B 5F6TA 1AVSA 2K2FA 4GFTA 1WY9A 1VRKA 1BG1A 3CR5X 2AAOA 4NDCA 1KWOC 2WCFA 4PDZA 2QACA 2PALA 1FW4A 2RGIA 3PLFB 1UWOA 3RM1A 1F8HA 3AAJA 2PASA 3EK8A 1FI6A 2MBXA 4P2YB 4C0KA 1MUXA 5CSJA 1CMFA 4MZLA 1J7PA 4YGCB 1YURA 2BL0C 1KWOB 2K61A 1CDNA 1K94A 1BR1B 1SW8A 5PALA 1B8LA 4ZCVA 2BBMA 2FCEA 1BOCA 3D0YA 2HQWA 4YGDB 2NCPA 4TNCA 1YVHA 3WXAA 1PVBA 2M97A 3EKJA 4MZKA 2Y1MA 4P5OE 3CR2A 1JWDA 4WRIA 1M63B 1ZFSA 4ICBA 2BL0B 1DJIA 2KI4C 4ZCUA 1KK7Y 3SG7A 3TS5C 4MVFA 1AP4A 2L4IA 3BQ3A 1IQ3A 2R2IA 1R6PA 3LLEA 3OB2B 2COLB 1LVCD 1A75B 1ALVA 2K7OA 4GPLB 1AJ4A 2GGMA 3IQOA 2B1UA 1Y0VH 2KI4B 4JWQA 3TS5B 1IKUA 4HSZA 3RLZA 3WHTB 1A75A 1KK7Z 3PSRA 2LUXA 2M1UA 4ETOA 1F4OA 1HQVA 5CPVA 5I2QA 2JZIA 3O78A 5HLOA 1M45A 3DD4A 2QPTA 3TDZA 4HRHA 4PCWA 1OMVA 2LHLA 1A03A 2AMIA 1DJGA 3TZ1A 1QASA 2JT8A 4PHJA 1CFDA 1AJ5A 2F3ZA 2F2OA 2ISDA 3VRPA 1NWDA 4IL1A 5CSNA 2KAYA 1JUOA 3AKAA 3KF9A 1SPYA 1A29A 1UHIA 1PK0D 1ZUZA 3PFVA 4NQGA 1PRWA 4PE0A 2MHHA 2LM5A 1IRJA 1QXPA 2LUCA 4DCKA 2WCBA 1DJYA 5KSZA 2K7CA 1ALWA 1QLSA 2Y1NA 2HETA 1F4QA 1GJYA 2K7DA 3VGOA 4AOMA 3GK4X 1RJVA 2KFFA 2KGRA 4C0LA 1PSRA 1NX3A 5AERA 3AKBA 1OOJA 1KFUL 1IQ5A 2FJUB 1S6CA 4C0JA 1TRFA 3LK0A 4CIDA 2M0RA 2ZKMX 3I5HC 2KI6C 1IH0A 3BUWB 4NDDA 1MHOA 1M39A 1JF0A 2NCOA 3TUYC 1KSOA 3GK2A 3MSEB 1W7IB 2WOSA 1XFWO 2ZRTA 1B47A 1IGVA 2K8MB 4USLA 3SG4A 1F70A 1UHHA 2BCBA 1HT9A 2NLNA 1K96A 1B1GA 5KTYA 2FOTA 2KYCA 5I8NA 1NSHA 1IWQA 1J7QA 3I5HB 1NUBA 1QX2A 1J7RA 2MA2A 2DOQA 1S5GY 3VRRA 2PRUA 3AAKA 3TUYB 1UP5A 1XFZO 2G9BA 2P6BB 5DKNA 1BU3A 1DJXA 1L7ZA 2LAPA 3EVVA 4CLNA 2L4HA 1CLMA 1NCXA 3A8RA 2M29A 1M46A 1S36A 4GAOA 1C7VA 1SY9A 4DRWA 1DVIA 4DUQA 2LLSA 4N5XA 1OQPA 3OHMB 4XJKB 2BBNA 1BJFA 2M3WA 1LXFC 1RK9A 3SG3A 2WORA 1XK4C 4PE4A 4YRUA 1SYMA 4YI8A 4OV2A 5GQQC 1S5GZ 3NXAA 1K9KA 2EHBA 3K21A 4XJKA 2G2BA 1CM4A 3PALA 1JBAA 1EH2A 1SL9A 1K9UA 3BOWB 2K0JA 3VROA 1SK6D 1CDLA 1B8RA 1KFXL 2ZRSA 1RTP1 1SNLA 1K90D 3D0YB 1N2DA 2JPTA 2V53A 1A4PA 1TNPA 5AFPA 1RWYA 3BOWA 4GBAA 2KAXA 4I5LB 2F8PA 2PSRA 1DF0A 1XK4A 2O60A 1EL4A 2H2KA 2M8UA 1EXRA 1RECA 3EKHA 3LK1A 3CR4X 4MEWA 5DKQA 1S6IA 3I5GC 3EK7A 1XO5A 2L5XB 1TOPA 1S1EA 2LLTA 2LVKA 1YRUB 4GGNA 2ZN8A 2MAZA 2PMYA 4QJ4B 1OMDA 1OZOA 4UPGA 1TNWA 3EK4A 1MR8A 1WRZA 1AK8A 3I5GB 4YI9A 1NP8A 3BXKA 4PALA 1J1DA 1SBJA 2BKIB 2M7NA 2LMVA 2LVVA 1TCOB 1TIZA 3SIAA 1F71A 2KSPA 2M49B 4L9MA 1UUSA 1XFXO 4QJ5B 1DJHA 1SL7A 2Q4UA 4BY4A 1KFUS 1W7JB 1KQMC 1KCYA 1JC2A 1CLLA 1CKKA 3GK1A 5HKWA 2K7BA 1N0YA 1OE9B 2JRFA 2JULA 5FYXA 5KU1A 4YBHB 1MXEA 1NCYA 3IF7A 4N1GA 1NCZA 2LE9B 4PE7A 3TDUA 1JSAA 4ORAB 4E68A 5D7FA 2M9GA 2F2PA 1MXLC 3KO0A 1KQMB 2HPSA 2MJWB 1QTXA 1BR4B 2KHNA 4M2OA 1GGWA 2JTTA 1E8AA 3DVMA 1YUTA 2WNDA 1CFFA 2BKHB 1G33A 1PULA 2WCEA 1G4YR 1SR6C 5TNCA 1BT6A 1DGVA 1C7WA 4YGBB 1DMOA 2JC2A 2JXCA 5D69A 4ORCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GV5 A;  3FS7 A;  2JXL A;  3WNX B;  2LP3 A;  3BUN B;  2LVI A;  1OMR A;  4JPZ B;  2BEC A;  1K9P A;  3KEV A;  1SR6 B;  3SIB A;  1F54 A;  2LAN A;  1SRA A;  1B7T Y;  1CDM A;  1IG5 A;  2KNE A;  1CLB A;  1K93 D;  3CTN A;  1LKJ A;  1ZMZ A;  2SAS A;  3H4S E;  3PM8 A;  1QS7 A;  2K2A A;  2BE4 A;  2LP2 A;  2MLE C;  3EVR A;  1QIW A;  2JWW A;  3VRQ A;  1SMG A;  1NPQ A;  2ZFD A;  1UHJ A;  1K2H A;  3CS1 A;  1CTR A;  2HQ8 A;  3JVT C;  1TNX A;  2CTN A;  4WQ2 A;  3SJS A;  2LV7 A;  2A4J A;  2CBL A;  3M0W A;  1NX0 A;  1B4C A;  1B9A A;  3I5I C;  1B7T Z;  4PE1 A;  4FQO A;  1NX1 A;  1WDC C;  3DVJ A;  1BOD A;  3LCP C;  3JVT B;  1XA5 A;  2ZN9 A;  5ER4 X;  5HYD A;  3I5I B;  2L98 A;  4I5N B;  1WDC B;  1TN4 A;  1CDP A;  1DTL A;  1G8I A;  1QV1 A;  1YX7 A;  2JT0 A;  2OPO A;  1Y1X A;  3O6B A;  3C1V A;  2F33 A;  2ZND A;  3PN7 C;  3ICB A;  4OKH A;  5BPJ A;  4MBE A;  4PHK A;  4CFQ A;  4NDB A;  1FPW A;  2EGD A;  1NX2 A;  3PAT A;  1YVL A;  4MLW A;  3HX4 A;  1AUI B;  2F3Y A;  1NIW A;  4CFR A;  4WQ3 A;  1YUS A;  1SKT A;  3PN7 B;  1LA0 A;  2Y4Q A;  4DS7 A;  1WLZ A;  1ZAC A;  1NYA A;  2OS8 C;  3BUM B;  1DF0 B;  3BUO B;  2BCX A;  2KOT A;  1Y1A A;  1CNP A;  2LNK A;  3BUX B;  1QLK A;  2MRD A;  2HF5 A;  1SCM C;  2I94 A;  1KSM A;  2O5G A;  1BLQ A;  1QVI Z;  1H8B A;  2JU0 A;  3ZWH A;  2EC6 C;  1FI5 A;  1JF2 A;  1J7O A;  2E6W A;  2OS8 B;  1TNQ A;  1WRL A;  1XYD A;  1LA3 A;  3DVK A;  2KBM A;  2NZ0 A;  1FF1 A;  3CZT X;  4MRX A;  4N1F A;  1R2U A;  5I2L A;  2CXJ A;  4U8D A;  1SCM B;  2JOJ A;  1QX7 A;  1DGU A;  1ODB A;  4D1E A;  1TTX A;  5HKY A;  5K89 A;  2EC6 B;  4A4C A;  5HLV A;  1DT7 B;  2H61 C;  1SL8 A;  1MQ1 A;  3CLN A;  1CFC A;  1Q80 A;  5AXI A;  1S6J A;  4MZJ A;  4ORB B;  2NXQ A;  3OX6 A;  1LIN A;  4MSP A;  2LHI A;  1X02 A;  3FIA A;  1QIV A;  1OSA A;  4YGA A;  3SG2 A;  3DF0 B;  1YX8 A;  2L0P A;  2L51 A;  2FCD A;  3O2P A;  2L50 A;  3FWB A;  4MN0 A;  1PAL A;  1J55 A;  5AEQ A;  3SG5 A;  4OVN F;  1IJ5 A;  1BMO A;  4MRY A;  4GNK B;  3DF0 A;  4I5J A;  1KK8 C;  2PVB A;  1UHN A;  2I2R E;  2KFH A;  2H61 A;  1U5I B;  1YRT B;  2GGZ A;  3LL8 B;  1UUR A;  2LMT A;  3D10 A;  3EVU A;  3JTD C;  1IJ6 A;  1B8C A;  1AHR A;  3BYA A;  2KAV A;  4FTG A;  1RRO A;  1XFY O;  2SCP A;  1YR5 A;  2BCA A;  2OTG C;  1U5I A;  1QX5 B;  1KK8 B;  1XVJ A;  1YTZ C;  1D1O A;  4DIR A;  1CFP A;  1KQV A;  3NSI A;  2E30 A;  3JTD B;  2M7L A;  3CGA A;  1K95 A;  3CWG A;  1EG4 A;  1S26 D;  2IS9 A;  2L2E A;  2LLU A;  3QRX A;  4CPV A;  1L2O C;  1MWN A;  2OTG B;  3OX5 A;  2VRG A;  1XFV O;  1FBV A;  1SCV A;  4GUK A;  1C07 A;  3TDI A;  5DKR A;  4A4B A;  4QJ3 B;  2JNF A;  2KI6 D;  1GQM A;  5CSI A;  3OP0 A;  4HRG A;  4Q04 A;  5B8I B;  2I18 A;  3I5F C;  1JFJ A;  4PHN A;  1V1G A;  3A4U B;  1L2O B;  1CMG A;  5G08 A;  4AQJ A;  2Y5I A;  1CM1 A;  2KYF A;  5J3X A;  1XFU O;  5HKZ A;  1PSB A;  2LVJ A;  1M31 A;  2I7A A;  3IQQ A;  5AAN A;  2JNX A;  4GGF C;  1TCF A;  3O4Y A;  5CSF A;  3I5F B;  1N65 A;  1EG3 A;  1A2X A;  1QJT A;  1CB1 A;  2JTZ A;  1KFX S;  1F55 A;  2JT3 A;  1H4B A;  2BE6 A;  4I5K A;  3ZNI A;  3F45 A;  1K8U A;  2TN4 A;  1V1F A;  3SG6 A;  2AUC A;  4BY5 A;  1YUU A;  1BF5 A;  4XYN A;  1WRK A;  1PVA A;  4AQI A;  2KBI A;  2CNP A;  1EJ3 A;  4OR9 B;  2JQ6 A;  1UHK A;  1QV0 A;  2KQY A;  3NSO A;  4PHM A;  2CT9 A;  4GGF A;  1ZOT B;  1OZS A;  2Q91 A;  2KFG A;  3KHE A;  1GGZ A;  2KQ6 A;  3GOF A;  4R1E A;  2KGB C;  1Y1U A;  5I2O A;  3E3R A;  3HCM A;  1QVI Y;  1QAT A;  1WLM A;  4YGE B;  1J1E A;  2MLF C;  3WHU B;  3KPX A;  1Y6W A;  4JQ0 D;  3VRN A;  2M1K B;  3NSL A;  4M2P A;  4M2Q A;  5JJG A;  5ER5 A;  3NSK A;  1RFJ A;  3FWC A;  2ZNE A;  4OCI A;  2KDH A;  4F0Z B;  2LC5 A;  1DJW A;  5IBW A;  2CCM A;  2LCP A;  2WC8 A;  1S3P A;  4HRE E;  2D8N A;  5JOL A;  2LMU A;  1JFK A;  1MF8 B;  1DJZ A;  3DVE A;  3OB1 B;  5F6T A;  1AVS A;  2K2F A;  4GFT A;  1WY9 A;  1VRK A;  1BG1 A;  3CR5 X;  2AAO A;  4NDC A;  1KWO C;  2WCF A;  4PDZ A;  2QAC A;  2PAL A;  1FW4 A;  2RGI A;  3PLF B;  1UWO A;  3RM1 A;  1F8H A;  3AAJ A;  2PAS A;  3EK8 A;  1FI6 A;  2MBX A;  4P2Y B;  4C0K A;  1MUX A;  5CSJ A;  1CMF A;  4MZL A;  1J7P A;  4YGC B;  1YUR A;  2BL0 C;  1KWO B;  2K61 A;  1CDN A;  1K94 A;  1BR1 B;  1SW8 A;  5PAL A;  1B8L A;  4ZCV A;  2BBM A;  2FCE A;  1BOC A;  3D0Y A;  2HQW A;  4YGD B;  2NCP A;  4TNC A;  1YVH A;  3WXA A;  1PVB A;  2M97 A;  3EKJ A;  4MZK A;  2Y1M A;  4P5O E;  3CR2 A;  1JWD A;  4WRI A;  1M63 B;  1ZFS A;  4ICB A;  2BL0 B;  1DJI A;  2KI4 C;  4ZCU A;  1KK7 Y;  3SG7 A;  3TS5 C;  4MVF A;  1AP4 A;  2L4I A;  3BQ3 A;  1IQ3 A;  2R2I A;  1R6P A;  3LLE A;  3OB2 B;  2COL B;  1LVC D;  1A75 B;  1ALV A;  2K7O A;  4GPL B;  1AJ4 A;  2GGM A;  3IQO A;  2B1U A;  1Y0V H;  2KI4 B;  4JWQ A;  3TS5 B;  1IKU A;  4HSZ A;  3RLZ A;  3WHT B;  1A75 A;  1KK7 Z;  3PSR A;  2LUX A;  2M1U A;  4ETO A;  1F4O A;  1HQV A;  5CPV A;  5I2Q A;  2JZI A;  3O78 A;  5HLO A;  1M45 A;  3DD4 A;  2QPT A;  3TDZ A;  4HRH A;  4PCW A;  1OMV A;  2LHL A;  1A03 A;  2AMI A;  1DJG A;  3TZ1 A;  1QAS A;  2JT8 A;  4PHJ A;  1CFD A;  1AJ5 A;  2F3Z A;  2F2O A;  2ISD A;  3VRP A;  1NWD A;  4IL1 A;  5CSN A;  2KAY A;  1JUO A;  3AKA A;  3KF9 A;  1SPY A;  1A29 A;  1UHI A;  1PK0 D;  1ZUZ A;  3PFV A;  4NQG A;  1PRW A;  4PE0 A;  2MHH A;  2LM5 A;  1IRJ A;  1QXP A;  2LUC A;  4DCK A;  2WCB A;  1DJY A;  5KSZ A;  2K7C A;  1ALW A;  1QLS A;  2Y1N A;  2HET A;  1F4Q A;  1GJY A;  2K7D A;  3VGO A;  4AOM A;  3GK4 X;  1RJV A;  2KFF A;  2KGR A;  4C0L A;  1PSR A;  1NX3 A;  5AER A;  3AKB A;  1OOJ A;  1KFU L;  1IQ5 A;  2FJU B;  1S6C A;  4C0J A;  1TRF A;  3LK0 A;  4CID A;  2M0R A;  2ZKM X;  3I5H C;  2KI6 C;  1IH0 A;  3BUW B;  4NDD A;  1MHO A;  1M39 A;  1JF0 A;  2NCO A;  3TUY C;  1KSO A;  3GK2 A;  3MSE B;  1W7I B;  2WOS A;  1XFW O;  2ZRT A;  1B47 A;  1IGV A;  2K8M B;  4USL A;  3SG4 A;  1F70 A;  1UHH A;  2BCB A;  1HT9 A;  2NLN A;  1K96 A;  1B1G A;  5KTY A;  2FOT A;  2KYC A;  5I8N A;  1NSH A;  1IWQ A;  1J7Q A;  3I5H B;  1NUB A;  1QX2 A;  1J7R A;  2MA2 A;  2DOQ A;  1S5G Y;  3VRR A;  2PRU A;  3AAK A;  3TUY B;  1UP5 A;  1XFZ O;  2G9B A;  2P6B B;  5DKN A;  1BU3 A;  1DJX A;  1L7Z A;  2LAP A;  3EVV A;  4CLN A;  2L4H A;  1CLM A;  1NCX A;  3A8R A;  2M29 A;  1M46 A;  1S36 A;  4GAO A;  1C7V A;  1SY9 A;  4DRW A;  1DVI A;  4DUQ A;  2LLS A;  4N5X A;  1OQP A;  3OHM B;  4XJK B;  2BBN A;  1BJF A;  2M3W A;  1LXF C;  1RK9 A;  3SG3 A;  2WOR A;  1XK4 C;  4PE4 A;  4YRU A;  1SYM A;  4YI8 A;  4OV2 A;  5GQQ C;  1S5G Z;  3NXA A;  1K9K A;  2EHB A;  3K21 A;  4XJK A;  2G2B A;  1CM4 A;  3PAL A;  1JBA A;  1EH2 A;  1SL9 A;  1K9U A;  3BOW B;  2K0J A;  3VRO A;  1SK6 D;  1CDL A;  1B8R A;  1KFX L;  2ZRS A;  1RTP 1;  1SNL A;  1K90 D;  3D0Y B;  1N2D A;  2JPT A;  2V53 A;  1A4P A;  1TNP A;  5AFP A;  1RWY A;  3BOW A;  4GBA A;  2KAX A;  4I5L B;  2F8P A;  2PSR A;  1DF0 A;  1XK4 A;  2O60 A;  1EL4 A;  2H2K A;  2M8U A;  1EXR A;  1REC A;  3EKH A;  3LK1 A;  3CR4 X;  4MEW A;  5DKQ A;  1S6I A;  3I5G C;  3EK7 A;  1XO5 A;  2L5X B;  1TOP A;  1S1E A;  2LLT A;  2LVK A;  1YRU B;  4GGN A;  2ZN8 A;  2MAZ A;  2PMY A;  4QJ4 B;  1OMD A;  1OZO A;  4UPG A;  1TNW A;  3EK4 A;  1MR8 A;  1WRZ A;  1AK8 A;  3I5G B;  4YI9 A;  1NP8 A;  3BXK A;  4PAL A;  1J1D A;  1SBJ A;  2BKI B;  2M7N A;  2LMV A;  2LVV A;  1TCO B;  1TIZ A;  3SIA A;  1F71 A;  2KSP A;  2M49 B;  4L9M A;  1UUS A;  1XFX O;  4QJ5 B;  1DJH A;  1SL7 A;  2Q4U A;  4BY4 A;  1KFU S;  1W7J B;  1KQM C;  1KCY A;  1JC2 A;  1CLL A;  1CKK A;  3GK1 A;  5HKW A;  2K7B A;  1N0Y A;  1OE9 B;  2JRF A;  2JUL A;  5FYX A;  5KU1 A;  4YBH B;  1MXE A;  1NCY A;  3IF7 A;  4N1G A;  1NCZ A;  2LE9 B;  4PE7 A;  3TDU A;  1JSA A;  4ORA B;  4E68 A;  5D7F A;  2M9G A;  2F2P A;  1MXL C;  3KO0 A;  1KQM B;  2HPS A;  2MJW B;  1QTX A;  1BR4 B;  2KHN A;  4M2O A;  1GGW A;  2JTT A;  1E8A A;  3DVM A;  1YUT A;  2WND A;  1CFF A;  2BKH B;  1G33 A;  1PUL A;  2WCE A;  1G4Y R;  1SR6 C;  5TNC A;  1BT6 A;  1DGV A;  1C7W A;  4YGB B;  1DMO A;  2JC2 A;  2JXC A;  5D69 A;  4ORC B; 
#chains in the Genus database with same CATH topology
 2GV5 A;  2QEO A;  2JXL A;  3FS7 A;  3WNX B;  2LP3 A;  3BUN B;  2LVI A;  1OMR A;  1OW4 A;  2BEC A;  1K9P A;  3CYZ A;  1SR6 B;  3KEV A;  4JPZ B;  2BNX A;  3SIB A;  3RZS A;  1F54 A;  2LAN A;  1SRA A;  1B7T Y;  1CDM A;  1IG5 A;  2KNE A;  1CLB A;  1K93 D;  3CTN A;  1LKJ A;  1ZMZ A;  2SAS A;  3H4S E;  2PQL A;  1QS7 A;  2K2A A;  2BE4 A;  2LP2 A;  2MLE C;  3EVR A;  3PM8 A;  1QIW A;  1QWV A;  2JWW A;  3VRQ A;  1SMG A;  1NPQ A;  2ZFD A;  1UHJ A;  1K2H A;  3CS1 A;  1CTR A;  2HQ8 A;  3JVT C;  3S0B A;  1TNX A;  2CTN A;  4WQ2 A;  3SJS A;  5FI6 A;  2LV7 A;  2A4J A;  2CBL A;  2FJY A;  1NX0 A;  3M0W A;  1B4C A;  1B9A A;  3I5I C;  1B7T Z;  4PE1 A;  4FQO A;  1NX1 A;  1WDC C;  2P70 A;  3DVJ A;  3O6B A;  1BOD A;  3FE9 A;  3LCP C;  3JVT B;  1XA5 A;  2ZN9 A;  5ER4 X;  3OGN A;  5HYD A;  1C3Y A;  3I5I B;  2L98 A;  4I5N B;  1WDC B;  1TN4 A;  1CDP A;  1DTL A;  1G8I A;  1QV1 A;  1YX7 A;  2JT0 A;  2L2C A;  1T14 A;  1Y1X A;  2OPO A;  3BJH A;  1TUJ A;  3C1V A;  2F33 A;  2ZND A;  3DYE A;  3ICB A;  3EG5 B;  3PN7 C;  4OKH A;  5BPJ A;  4MBE A;  4PHK A;  4CFQ A;  4NDB A;  1FPW A;  2EGD A;  1NX2 A;  3PAT A;  2WCM A;  1YVL A;  4MLW A;  3HX4 A;  1AUI B;  2F3Y A;  1NIW A;  4CFR A;  4WQ3 A;  1YUS A;  1SKT A;  1C3Z A;  1LA0 A;  2Y4Q A;  3PN7 B;  4DS7 A;  1WLZ A;  1ZAC A;  1NYA A;  2OS8 C;  3BUM B;  1DF0 B;  3BUO B;  2BCX A;  2KOT A;  1Y1A A;  1CNP A;  2LNK A;  3BUX B;  1LS8 A;  1QLK A;  2MRD A;  2HF5 A;  1SCM C;  2I94 A;  1KSM A;  2O5G A;  3O4X A;  1BLQ A;  1QVI Z;  3FE6 A;  1H8B A;  2JU0 A;  3ZWH A;  2EC6 C;  1FI5 A;  1JF2 A;  1J7O A;  2E6W A;  2OS8 B;  1TNQ A;  1WRL A;  1XYD A;  1LA3 A;  3DVK A;  2KBM A;  2NZ0 A;  1FF1 A;  3CZT X;  2L5Y A;  4MRX A;  4N1F A;  1R2U A;  5I2L A;  2CXJ A;  4U8D A;  1SCM B;  2JOJ A;  3D77 A;  1QX7 A;  1DGU A;  1ODB A;  4D1E A;  1TTX A;  5HKY A;  5K89 A;  2EC6 B;  2QDI A;  4A4C A;  5HLV A;  1DC1 A;  1DT7 B;  2H61 C;  1SL8 A;  1MQ1 A;  3CLN A;  1CFC A;  1Q80 A;  5AXI A;  1S6J A;  4MZJ A;  4ORB B;  2NXQ A;  3OX6 A;  1LIN A;  4MSP A;  3UNW A;  2LHI A;  1X02 A;  3FIA A;  1QIV A;  2P71 A;  1OSA A;  4YGA A;  3SG2 A;  2WCJ A;  3DF0 B;  4FQT A;  1YX8 A;  2L0P A;  2L51 A;  2FCD A;  3O2P A;  2L50 A;  3FWB A;  4MN0 A;  1PAL A;  1J55 A;  5AEQ A;  3SG5 A;  4OVN F;  1IJ5 A;  1BMO A;  4MRY A;  4PT1 A;  4GNK B;  3DF0 A;  4I5J A;  1KK8 C;  2PVB A;  1UHN A;  2I2R E;  2KFH A;  3D73 A;  2H61 A;  1U5I B;  1YRT B;  2GGZ A;  3LL8 B;  1UUR A;  2LMT A;  1OOF A;  3D10 A;  3EVU A;  3JTD C;  1IJ6 A;  1B8C A;  1AHR A;  3BYA A;  2KAV A;  4FTG A;  1RRO A;  1XFY O;  2SCP A;  1YR5 A;  2BCA A;  2OTG C;  1U5I A;  1QX5 B;  1KK8 B;  1XVJ A;  1YTZ C;  1D1O A;  3K1E A;  4DIR A;  5EL2 A;  1GM0 A;  3DXL A;  1CFP A;  1KQV A;  3NSI A;  1ORG A;  2E30 A;  3JTD B;  2M7L A;  3CGA A;  1OOI X;  1K95 A;  3CWG A;  2KLD A;  1EG4 A;  1S26 D;  2IS9 A;  2L2E A;  2LLU A;  3FE8 A;  3QRX A;  1L2O C;  4CPV A;  1MWN A;  2OTG B;  3OX5 A;  2VRG A;  1XFV O;  3S0G A;  1FBV A;  1SCV A;  4GUK A;  1C07 A;  3CDN A;  3TDI A;  5DKR A;  4A4B A;  4QJ3 B;  2JNF A;  2KI6 D;  3N7H A;  1GQM A;  5CSI A;  3OP0 A;  4HRG A;  4Q04 A;  5D3O A;  2I18 A;  3I5F C;  5B8I B;  4PHN A;  3IVT A;  1JFJ A;  1V1G A;  3A4U B;  1L2O B;  2WCH A;  1CMG A;  5G08 A;  4AQJ A;  2Y5I A;  1CM1 A;  2KYF A;  5J3X A;  1XFU O;  5HKZ A;  1PSB A;  1SSE B;  2LVJ A;  1M31 A;  2I7A A;  3IQQ A;  5AAN A;  2JNX A;  4GGF C;  1TCF A;  1OOH A;  3O4Y A;  5CSF A;  3I5F B;  1N65 A;  1EG3 A;  1A2X A;  1QJT A;  1CB1 A;  2JTZ A;  1KFX S;  1F55 A;  2JT3 A;  1H4B A;  1DQE A;  2BE6 A;  4I5K A;  3ZNI A;  3F45 A;  1K8U A;  2TN4 A;  3L4A A;  1V1F A;  3SG6 A;  2AUC A;  4BY5 A;  1YUU A;  1BF5 A;  4XYN A;  4INX A;  1WRK A;  1PVA A;  1Z2C B;  4AQI A;  2KBI A;  2CNP A;  1EJ3 A;  4OR9 B;  2JQ6 A;  1UHK A;  1QV0 A;  2KQY A;  3NSO A;  4PHM A;  2CT9 A;  2WCL A;  4GGF A;  1ZOT B;  1OZS A;  2JPO A;  2Q91 A;  2KFG A;  3KHE A;  1GGZ A;  2KQ6 A;  3GOF A;  4R1E A;  3B86 A;  3PJI A;  2KGB C;  1Y1U A;  5I2O A;  1XFR A;  3E3R A;  3HCM A;  1QVI Y;  1QAT A;  1WLM A;  4YGE B;  1J1E A;  4JKT A;  2MLF C;  3WHU B;  3KPX A;  1Y6W A;  3R1V A;  4JQ0 D;  3VRN A;  2M1K B;  3NSL A;  4M2P A;  4M2Q A;  5JJG A;  5ER5 A;  3NSK A;  1RFJ A;  2QEH A;  3FWC A;  2ZNE A;  4OCI A;  2KDH A;  3CZ2 A;  4F0Z B;  2LC5 A;  3D74 A;  1DJW A;  5IBW A;  2CCM A;  2LCP A;  2WC8 A;  1S3P A;  4HRE E;  2D8N A;  5FI2 A;  5JOL A;  2LMU A;  1JFK A;  1MF8 B;  1DJZ A;  3DVE A;  3OB1 B;  5F6T A;  1AVS A;  2K2F A;  4GFT A;  1WY9 A;  1VRK A;  1BG1 A;  3CR5 X;  2AAO A;  4NDC A;  1KWO C;  2WCF A;  4PDZ A;  2QAC A;  2PAL A;  1FW4 A;  3SS4 A;  3R1O A;  2RGI A;  3PLF B;  1UWO A;  3RM1 A;  1F8H A;  3AAJ A;  2PAS A;  3EK8 A;  1FI6 A;  2MBX A;  4P2Y B;  4C0K A;  1MUX A;  5CSJ A;  3S0A A;  1CMF A;  4MZL A;  1J7P A;  4YGC B;  1YUR A;  2BL0 C;  2YGU A;  1KWO B;  2K61 A;  1CDN A;  1K94 A;  1BR1 B;  1SW8 A;  5PAL A;  5HL1 A;  1B8L A;  4ZCV A;  3BFH A;  2BBM A;  1W9Z A;  2FCE A;  3B6X A;  2HQW A;  3D0Y A;  4YGD B;  1BOC A;  2NCP A;  4TNC A;  1YVH A;  3WXA A;  1PVB A;  3QME A;  2M97 A;  3EKJ A;  4MZK A;  2Y1M A;  3D76 A;  4P5O E;  3CR2 A;  1JWD A;  4WRI A;  1M63 B;  1ZFS A;  4ICB A;  2BL0 B;  3Q8I A;  1DJI A;  2KI4 C;  4ZCU A;  5FI7 A;  1KK7 Y;  3SG7 A;  3TS5 C;  4F7F A;  4MVF A;  3UO9 A;  3NGV A;  1AP4 A;  2L4I A;  3BQ3 A;  1IQ3 A;  2R2I A;  1R6P A;  3LLE A;  3OB2 B;  2COL B;  1LVC D;  4KYN A;  1A75 B;  1ALV A;  2K7O A;  4GPL B;  1AJ4 A;  2GGM A;  3IQO A;  1Y0V H;  2B1U A;  2PYQ A;  2KI4 B;  4JWQ A;  3TS5 B;  1IKU A;  4HSZ A;  2KLE A;  3RLZ A;  3WHT B;  1A75 A;  1KK7 Z;  3PSR A;  2LUX A;  2M1U A;  4ETO A;  1F4O A;  1HQV A;  5CPV A;  5I2Q A;  2JZI A;  3O78 A;  5HLO A;  1M45 A;  3DD4 A;  2QPT A;  3TDZ A;  3R72 A;  4HRH A;  4PCW A;  1OMV A;  2LHL A;  3D75 A;  1A03 A;  2AMI A;  1DJG A;  3TZ1 A;  1QAS A;  2JT8 A;  4PHJ A;  1CFD A;  1AJ5 A;  2F3Z A;  2F2O A;  2ISD A;  3VRP A;  1NWD A;  4IL1 A;  5CSN A;  2KAY A;  1JUO A;  3AKA A;  3KF9 A;  1SPY A;  1A29 A;  1UHI A;  1PK0 D;  1ZUZ A;  3PFV A;  4NQG A;  3V2L A;  1PRW A;  4PE0 A;  2MHH A;  2LM5 A;  1IRJ A;  3DZT A;  1QXP A;  2LUC A;  2WC5 A;  4DCK A;  3NHT A;  2WCB A;  1DJY A;  5KSZ A;  2H8V A;  1P28 A;  2K7C A;  1IIO A;  1ALW A;  1QLS A;  2Y1N A;  2HET A;  1F4Q A;  1GJY A;  2K7D A;  3VGO A;  4AOM A;  3GK4 X;  3B87 A;  1Z4H A;  2QEV A;  3R1P A;  1RJV A;  2KFF A;  2KGR A;  4C0L A;  1PSR A;  1NX3 A;  5AER A;  3AKB A;  1OOJ A;  1KFU L;  1IQ5 A;  2FJU B;  1S6C A;  4C0J A;  1TRF A;  5DIC A;  3LK0 A;  4CID A;  2M0R A;  2ZKM X;  3I5H C;  2KI6 C;  1IH0 A;  3BUW B;  4NDD A;  1MHO A;  1M39 A;  1JF0 A;  2NCO A;  3OBV A;  3TUY C;  1KSO A;  3GK2 A;  3MSE B;  1W7I B;  2WOS A;  1XFW O;  2ZRT A;  1B47 A;  1IGV A;  2K8M B;  4USL A;  3SG4 A;  1F70 A;  2WC6 A;  1UHH A;  2BCB A;  1HT9 A;  2NLN A;  1K96 A;  1DEL A;  1B1G A;  5KTY A;  2FOT A;  2KYC A;  5I94 A;  5I8N A;  1NSH A;  1IWQ A;  1J7Q A;  3I5H B;  1NUB A;  2GTE A;  1QX2 A;  1J7R A;  3BFA A;  2MA2 A;  2DOQ A;  3CZ1 A;  1S5G Y;  3VRR A;  2PRU A;  3AAK A;  3S0D A;  1UP5 A;  1XFZ O;  3TUY B;  2G9B A;  2P6B B;  5DKN A;  1BU3 A;  1DJX A;  1L7Z A;  2LAP A;  3EVV A;  4CLN A;  2L4H A;  1CLM A;  1NCX A;  2BAP A;  2M29 A;  3A8R A;  1M46 A;  1S36 A;  1TWO A;  4GAO A;  1C7V A;  1SY9 A;  4DRW A;  1DVI A;  4DUQ A;  1OOG A;  2LLS A;  4N5X A;  1OQP A;  3OHM B;  4XJK B;  2BBN A;  3CZ0 A;  1BJF A;  2M3W A;  1LXF C;  1RK9 A;  3SG3 A;  2WOR A;  1XK4 C;  4PE4 A;  4YRU A;  1SYM A;  4YI8 A;  4OV2 A;  5GQQ C;  1S5G Z;  3NXA A;  1K9K A;  2EHB A;  3K21 A;  4XJK A;  2G2B A;  1CM4 A;  3PAL A;  1JBA A;  1EH2 A;  1SL9 A;  1K9U A;  3BOW B;  3SS5 A;  2K0J A;  4OZD A;  3VRO A;  1SK6 D;  1CDL A;  3D78 A;  3NHI A;  1B8R A;  1KFX L;  2ZRS A;  1RTP 1;  1SNL A;  3B7A A;  1K90 D;  3D0Y B;  1N2D A;  2JPT A;  3BFB A;  2V53 A;  1A4P A;  1TNP A;  4IJ7 A;  5AFP A;  1RWY A;  3BOW A;  3PM2 A;  4GBA A;  2KAX A;  4I5L B;  2F8P A;  2PSR A;  1DF0 A;  2QEB A;  1XK4 A;  2O60 A;  1EL4 A;  2H2K A;  3VB1 A;  2M8U A;  1EXR A;  1REC A;  3EKH A;  3LK1 A;  3CR4 X;  4MEW A;  5DKQ A;  1S6I A;  3I5G C;  3EK7 A;  1XO5 A;  2L5X B;  1TOP A;  1S1E A;  3L4L A;  2LLT A;  2LVK A;  1YRU B;  4GGN A;  2ZN8 A;  2MAZ A;  2PMY A;  4QJ4 B;  1OMD A;  1OZO A;  4UPG A;  2K60 A;  1TNW A;  3EK4 A;  1MR8 A;  1WRZ A;  1AK8 A;  3I5G B;  4YI9 A;  1NP8 A;  4INW A;  3BXK A;  1DEK A;  4PAL A;  1J1D A;  1SBJ A;  2BKI B;  1TUZ A;  2M7N A;  3S0F A;  2LMV A;  2LVV A;  1TCO B;  1TIZ A;  3SIA A;  1F71 A;  2KSP A;  4JD9 A;  2M49 B;  4L9M A;  1UUS A;  1XFX O;  4QJ5 B;  1DJH A;  1SL7 A;  2Q4U A;  4BY4 A;  1KFU S;  1W7J B;  1KQM C;  1KCY A;  1JC2 A;  3S0E A;  1CLL A;  3SS3 A;  3DY9 A;  3GK1 A;  5HKW A;  1CKK A;  2K7B A;  1N0Y A;  1OE9 B;  2JRF A;  2JUL A;  5FYX A;  2WCK A;  5KU1 A;  4YBH B;  1MXE A;  1NCY A;  3IF7 A;  2KPH A;  1NCZ A;  2ERB A;  4N1G A;  2LE9 B;  4PE7 A;  3TDU A;  1JSA A;  4ORA B;  4E68 A;  5D7F A;  2M9G A;  2F2P A;  1MXL C;  3KO0 A;  1KQM B;  2HPS A;  2MJW B;  1QTX A;  1BR4 B;  2KHN A;  4M2O A;  1GGW A;  2JTT A;  1E8A A;  3DVM A;  1YUT A;  2WND A;  1CFF A;  2BKH B;  1G33 A;  1PUL A;  2WCE A;  1G4Y R;  1SR6 C;  5TNC A;  1BT6 A;  3CAB A;  1DGV A;  1C7W A;  3L47 A;  4YGB B;  1DMO A;  2JC2 A;  2JXC A;  5D69 A;  3B88 A;  4ORC B; 
#chains in the Genus database with same CATH homology
 2GV5 A;  3FS7 A;  2JXL A;  3WNX B;  2LP3 A;  3BUN B;  2LVI A;  1OMR A;  4JPZ B;  2BEC A;  1K9P A;  3KEV A;  1SR6 B;  3SIB A;  1F54 A;  2LAN A;  1SRA A;  1B7T Y;  1CDM A;  1IG5 A;  2KNE A;  1CLB A;  1K93 D;  3CTN A;  1LKJ A;  1ZMZ A;  2SAS A;  3H4S E;  3PM8 A;  1QS7 A;  2K2A A;  2BE4 A;  2LP2 A;  2MLE C;  3EVR A;  1QIW A;  2JWW A;  3VRQ A;  1SMG A;  1NPQ A;  2ZFD A;  1UHJ A;  1K2H A;  3CS1 A;  1CTR A;  2HQ8 A;  3JVT C;  1TNX A;  2CTN A;  4WQ2 A;  3SJS A;  2LV7 A;  2A4J A;  2CBL A;  3M0W A;  1NX0 A;  1B4C A;  1B9A A;  3I5I C;  1B7T Z;  4PE1 A;  4FQO A;  1NX1 A;  1WDC C;  3DVJ A;  1BOD A;  3LCP C;  3JVT B;  1XA5 A;  2ZN9 A;  5ER4 X;  5HYD A;  3I5I B;  2L98 A;  4I5N B;  1WDC B;  1TN4 A;  1CDP A;  1DTL A;  1G8I A;  1QV1 A;  1YX7 A;  2JT0 A;  2OPO A;  1Y1X A;  3O6B A;  3C1V A;  2F33 A;  2ZND A;  3PN7 C;  3ICB A;  4OKH A;  5BPJ A;  4MBE A;  4PHK A;  4CFQ A;  4NDB A;  1FPW A;  2EGD A;  1NX2 A;  3PAT A;  1YVL A;  4MLW A;  3HX4 A;  1AUI B;  2F3Y A;  1NIW A;  4CFR A;  4WQ3 A;  1YUS A;  1SKT A;  3PN7 B;  1LA0 A;  2Y4Q A;  4DS7 A;  1WLZ A;  1ZAC A;  1NYA A;  2OS8 C;  3BUM B;  1DF0 B;  3BUO B;  2BCX A;  2KOT A;  1Y1A A;  1CNP A;  2LNK A;  3BUX B;  1QLK A;  2MRD A;  2HF5 A;  1SCM C;  2I94 A;  1KSM A;  2O5G A;  1BLQ A;  1QVI Z;  1H8B A;  2JU0 A;  3ZWH A;  2EC6 C;  1FI5 A;  1JF2 A;  1J7O A;  2E6W A;  2OS8 B;  1TNQ A;  1WRL A;  1XYD A;  1LA3 A;  3DVK A;  2KBM A;  2NZ0 A;  1FF1 A;  3CZT X;  4MRX A;  4N1F A;  1R2U A;  5I2L A;  2CXJ A;  4U8D A;  1SCM B;  2JOJ A;  1QX7 A;  1DGU A;  1ODB A;  4D1E A;  1TTX A;  5HKY A;  5K89 A;  2EC6 B;  4A4C A;  5HLV A;  1DT7 B;  2H61 C;  1SL8 A;  1MQ1 A;  3CLN A;  1CFC A;  1Q80 A;  5AXI A;  1S6J A;  4MZJ A;  4ORB B;  2NXQ A;  3OX6 A;  1LIN A;  4MSP A;  2LHI A;  1X02 A;  3FIA A;  1QIV A;  1OSA A;  4YGA A;  3SG2 A;  3DF0 B;  1YX8 A;  2L0P A;  2L51 A;  2FCD A;  3O2P A;  2L50 A;  3FWB A;  4MN0 A;  1PAL A;  1J55 A;  5AEQ A;  3SG5 A;  4OVN F;  1IJ5 A;  1BMO A;  4MRY A;  4GNK B;  3DF0 A;  4I5J A;  1KK8 C;  2PVB A;  1UHN A;  2I2R E;  2KFH A;  2H61 A;  1U5I B;  1YRT B;  2GGZ A;  3LL8 B;  1UUR A;  2LMT A;  3D10 A;  3EVU A;  3JTD C;  1IJ6 A;  1B8C A;  1AHR A;  3BYA A;  2KAV A;  4FTG A;  1RRO A;  1XFY O;  2SCP A;  1YR5 A;  2BCA A;  2OTG C;  1U5I A;  1QX5 B;  1KK8 B;  1XVJ A;  1YTZ C;  1D1O A;  4DIR A;  1CFP A;  1KQV A;  3NSI A;  2E30 A;  3JTD B;  2M7L A;  3CGA A;  1K95 A;  3CWG A;  1EG4 A;  1S26 D;  2IS9 A;  2L2E A;  2LLU A;  3QRX A;  4CPV A;  1L2O C;  1MWN A;  2OTG B;  3OX5 A;  2VRG A;  1XFV O;  1FBV A;  1SCV A;  4GUK A;  1C07 A;  3TDI A;  5DKR A;  4A4B A;  4QJ3 B;  2JNF A;  2KI6 D;  1GQM A;  5CSI A;  3OP0 A;  4HRG A;  4Q04 A;  5B8I B;  2I18 A;  3I5F C;  1JFJ A;  4PHN A;  1V1G A;  3A4U B;  1L2O B;  1CMG A;  5G08 A;  4AQJ A;  2Y5I A;  1CM1 A;  2KYF A;  5J3X A;  1XFU O;  5HKZ A;  1PSB A;  2LVJ A;  1M31 A;  2I7A A;  3IQQ A;  5AAN A;  2JNX A;  4GGF C;  1TCF A;  3O4Y A;  5CSF A;  3I5F B;  1N65 A;  1EG3 A;  1A2X A;  1QJT A;  1CB1 A;  2JTZ A;  1KFX S;  1F55 A;  2JT3 A;  1H4B A;  2BE6 A;  4I5K A;  3ZNI A;  3F45 A;  1K8U A;  2TN4 A;  1V1F A;  3SG6 A;  2AUC A;  4BY5 A;  1YUU A;  1BF5 A;  4XYN A;  1WRK A;  1PVA A;  4AQI A;  2KBI A;  2CNP A;  1EJ3 A;  4OR9 B;  2JQ6 A;  1UHK A;  1QV0 A;  2KQY A;  3NSO A;  4PHM A;  2CT9 A;  4GGF A;  1ZOT B;  1OZS A;  2Q91 A;  2KFG A;  3KHE A;  1GGZ A;  2KQ6 A;  3GOF A;  4R1E A;  2KGB C;  1Y1U A;  5I2O A;  3E3R A;  3HCM A;  1QVI Y;  1QAT A;  1WLM A;  4YGE B;  1J1E A;  2MLF C;  3WHU B;  3KPX A;  1Y6W A;  4JQ0 D;  3VRN A;  2M1K B;  3NSL A;  4M2P A;  4M2Q A;  5JJG A;  5ER5 A;  3NSK A;  1RFJ A;  3FWC A;  2ZNE A;  4OCI A;  2KDH A;  4F0Z B;  2LC5 A;  1DJW A;  5IBW A;  2CCM A;  2LCP A;  2WC8 A;  1S3P A;  4HRE E;  2D8N A;  5JOL A;  2LMU A;  1JFK A;  1MF8 B;  1DJZ A;  3DVE A;  3OB1 B;  5F6T A;  1AVS A;  2K2F A;  4GFT A;  1WY9 A;  1VRK A;  1BG1 A;  3CR5 X;  2AAO A;  4NDC A;  1KWO C;  2WCF A;  4PDZ A;  2QAC A;  2PAL A;  1FW4 A;  2RGI A;  3PLF B;  1UWO A;  3RM1 A;  1F8H A;  3AAJ A;  2PAS A;  3EK8 A;  1FI6 A;  2MBX A;  4P2Y B;  4C0K A;  1MUX A;  5CSJ A;  1CMF A;  4MZL A;  1J7P A;  4YGC B;  1YUR A;  2BL0 C;  1KWO B;  2K61 A;  1CDN A;  1K94 A;  1BR1 B;  1SW8 A;  5PAL A;  1B8L A;  4ZCV A;  2BBM A;  2FCE A;  1BOC A;  3D0Y A;  2HQW A;  4YGD B;  2NCP A;  4TNC A;  1YVH A;  3WXA A;  1PVB A;  2M97 A;  3EKJ A;  4MZK A;  2Y1M A;  4P5O E;  3CR2 A;  1JWD A;  4WRI A;  1M63 B;  1ZFS A;  4ICB A;  2BL0 B;  1DJI A;  2KI4 C;  4ZCU A;  1KK7 Y;  3SG7 A;  3TS5 C;  4MVF A;  1AP4 A;  2L4I A;  3BQ3 A;  1IQ3 A;  2R2I A;  1R6P A;  3LLE A;  3OB2 B;  2COL B;  1LVC D;  1A75 B;  1ALV A;  2K7O A;  4GPL B;  1AJ4 A;  2GGM A;  3IQO A;  2B1U A;  1Y0V H;  2KI4 B;  4JWQ A;  3TS5 B;  1IKU A;  4HSZ A;  3RLZ A;  3WHT B;  1A75 A;  1KK7 Z;  3PSR A;  2LUX A;  2M1U A;  4ETO A;  1F4O A;  1HQV A;  5CPV A;  5I2Q A;  2JZI A;  3O78 A;  5HLO A;  1M45 A;  3DD4 A;  2QPT A;  3TDZ A;  4HRH A;  4PCW A;  1OMV A;  2LHL A;  1A03 A;  2AMI A;  1DJG A;  3TZ1 A;  1QAS A;  2JT8 A;  4PHJ A;  1CFD A;  1AJ5 A;  2F3Z A;  2F2O A;  2ISD A;  3VRP A;  1NWD A;  4IL1 A;  5CSN A;  2KAY A;  1JUO A;  3AKA A;  3KF9 A;  1SPY A;  1A29 A;  1UHI A;  1PK0 D;  1ZUZ A;  3PFV A;  4NQG A;  1PRW A;  4PE0 A;  2MHH A;  2LM5 A;  1IRJ A;  1QXP A;  2LUC A;  4DCK A;  2WCB A;  1DJY A;  5KSZ A;  2K7C A;  1ALW A;  1QLS A;  2Y1N A;  2HET A;  1F4Q A;  1GJY A;  2K7D A;  3VGO A;  4AOM A;  3GK4 X;  1RJV A;  2KFF A;  2KGR A;  4C0L A;  1PSR A;  1NX3 A;  5AER A;  3AKB A;  1OOJ A;  1KFU L;  1IQ5 A;  2FJU B;  1S6C A;  4C0J A;  1TRF A;  3LK0 A;  4CID A;  2M0R A;  2ZKM X;  3I5H C;  2KI6 C;  1IH0 A;  3BUW B;  4NDD A;  1MHO A;  1M39 A;  1JF0 A;  2NCO A;  3TUY C;  1KSO A;  3GK2 A;  3MSE B;  1W7I B;  2WOS A;  1XFW O;  2ZRT A;  1B47 A;  1IGV A;  2K8M B;  4USL A;  3SG4 A;  1F70 A;  1UHH A;  2BCB A;  1HT9 A;  2NLN A;  1K96 A;  1B1G A;  5KTY A;  2FOT A;  2KYC A;  5I8N A;  1NSH A;  1IWQ A;  1J7Q A;  3I5H B;  1NUB A;  1QX2 A;  1J7R A;  2MA2 A;  2DOQ A;  1S5G Y;  3VRR A;  2PRU A;  3AAK A;  3TUY B;  1UP5 A;  1XFZ O;  2G9B A;  2P6B B;  5DKN A;  1BU3 A;  1DJX A;  1L7Z A;  2LAP A;  3EVV A;  4CLN A;  2L4H A;  1CLM A;  1NCX A;  3A8R A;  2M29 A;  1M46 A;  1S36 A;  4GAO A;  1C7V A;  1SY9 A;  4DRW A;  1DVI A;  4DUQ A;  2LLS A;  4N5X A;  1OQP A;  3OHM B;  4XJK B;  2BBN A;  1BJF A;  2M3W A;  1LXF C;  1RK9 A;  3SG3 A;  2WOR A;  1XK4 C;  4PE4 A;  4YRU A;  1SYM A;  4YI8 A;  4OV2 A;  5GQQ C;  1S5G Z;  3NXA A;  1K9K A;  2EHB A;  3K21 A;  4XJK A;  2G2B A;  1CM4 A;  3PAL A;  1JBA A;  1EH2 A;  1SL9 A;  1K9U A;  3BOW B;  2K0J A;  3VRO A;  1SK6 D;  1CDL A;  1B8R A;  1KFX L;  2ZRS A;  1RTP 1;  1SNL A;  1K90 D;  3D0Y B;  1N2D A;  2JPT A;  2V53 A;  1A4P A;  1TNP A;  5AFP A;  1RWY A;  3BOW A;  4GBA A;  2KAX A;  4I5L B;  2F8P A;  2PSR A;  1DF0 A;  1XK4 A;  2O60 A;  1EL4 A;  2H2K A;  2M8U A;  1EXR A;  1REC A;  3EKH A;  3LK1 A;  3CR4 X;  4MEW A;  5DKQ A;  1S6I A;  3I5G C;  3EK7 A;  1XO5 A;  2L5X B;  1TOP A;  1S1E A;  2LLT A;  2LVK A;  1YRU B;  4GGN A;  2ZN8 A;  2MAZ A;  2PMY A;  4QJ4 B;  1OMD A;  1OZO A;  4UPG A;  1TNW A;  3EK4 A;  1MR8 A;  1WRZ A;  1AK8 A;  3I5G B;  4YI9 A;  1NP8 A;  3BXK A;  4PAL A;  1J1D A;  1SBJ A;  2BKI B;  2M7N A;  2LMV A;  2LVV A;  1TCO B;  1TIZ A;  3SIA A;  1F71 A;  2KSP A;  2M49 B;  4L9M A;  1UUS A;  1XFX O;  4QJ5 B;  1DJH A;  1SL7 A;  2Q4U A;  4BY4 A;  1KFU S;  1W7J B;  1KQM C;  1KCY A;  1JC2 A;  1CLL A;  1CKK A;  3GK1 A;  5HKW A;  2K7B A;  1N0Y A;  1OE9 B;  2JRF A;  2JUL A;  5FYX A;  5KU1 A;  4YBH B;  1MXE A;  1NCY A;  3IF7 A;  4N1G A;  1NCZ A;  2LE9 B;  4PE7 A;  3TDU A;  1JSA A;  4ORA B;  4E68 A;  5D7F A;  2M9G A;  2F2P A;  1MXL C;  3KO0 A;  1KQM B;  2HPS A;  2MJW B;  1QTX A;  1BR4 B;  2KHN A;  4M2O A;  1GGW A;  2JTT A;  1E8A A;  3DVM A;  1YUT A;  2WND A;  1CFF A;  2BKH B;  1G33 A;  1PUL A;  2WCE A;  1G4Y R;  1SR6 C;  5TNC A;  1BT6 A;  1DGV A;  1C7W A;  4YGB B;  1DMO A;  2JC2 A;  2JXC A;  5D69 A;  4ORC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...