1J55A

The crystal structure of ca+-bound human s100p determined at 2.0a resolution by x-ray
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
88
Chain Sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100P PROTEIN
publication title The Crystal Structure at 2A Resolution of the Ca2+-binding Protein S100P
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 88
sequence length 94
ec nomenclature
pdb deposition date 2002-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j55A00
2LVJA 5AXIA 4QJ3B 3BOWA 4HREE 3ICBA 5AEQA 1B7TZ 2MBXA 1DJXA 4L9MA 1ALWA 3AAJA 1YURA 2OS8B 2L2EA 1CTRA 3VRQA 1KSOA 1A75B 2M8UA 3IQQA 2LVIA 4PCWA 4GFTA 1JSAA 5CSNA 1JWDA 3VGOA 2HQ8A 1FBVA 2JRFA 1S36A 1DMOA 4HRHA 2ZRSA 4M2QA 1BOCA 1CLBA 1U5IB 2LUCA 2MA2A 1KQMB 3A8RA 1IRJA 2K7OA 1X02A 3TUYC 4AQIA 1OZOA 4ORBB 3HCMA 4ORCB 2M7LA 4FTGA 3PSRA 3I5GB 4QJ5B 1QXPA 4DCKA 2JZIA 4JPZB 3I5HB 5JOLA 1CLMA 5JJGA 3FIAA 4BY4A 1YUUA 1OE9B 2L4HA 1NYAA 4YRUA 1TNQA 2H61A 3MSEB 1CDNA 3BUOB 5CSFA 2FCEA 1JFKA 1IJ6A 1QTXA 2ZNDA 4AQJA 1JUOA 3SG7A 3JTDC 1AHRA 2P6BB 1ODBA 2OTGC 2M97A 2FJUB 4GGFA 3DF0A 1BODA 1S6JA 3H4SE 3CR5X 1F71A 1B47A 2MJWB 2L51A 4JQ0D 1DJYA 4YGCB 2EGDA 1M63B 1SCMC 4MZJA 4YGEB 2M3WA 1QJTA 1XK4A 2QACA 3BYAA 1QX5B 2KHNA 1K90D 4TNCA 2PMYA 1KK8C 4GGNA 1ZMZA 2BCBA 1DGVA 2BE6A 5PALA 2F33A 1AJ5A 2K2AA 1PSBA 2LHLA 4PALA 1WDCB 1H8BA 1WRKA 1N0YA 2SASA 3CLNA 1IG5A 3D10A 1S26D 3DVEA 2A4JA 1XFZO 3BQ3A 4MZLA 3CGAA 4USLA 1OQPA 2WNDA 1F4QA 4NDBA 1AP4A 2JQ6A 4Q04A 3TDZA 3VRRA 1QASA 4YGDB 1IH0A 1S5GY 2L4IA 2M0RA 1RTP1 2L0PA 1WLZA 1XVJA 3SG3A 3KO0A 1DVIA 4PE4A 2TN4A 1QLKA 1CFCA 2G9BA 1DJGA 1DTLA 2KQ6A 1JF2A 3EVVA 1JBAA 1NUBA 1GQMA 1KFXS 1NCXA 1PSRA 2HPSA 2PASA 4NQGA 4GPLB 1TOPA 2BL0C 2MLEC 3M0WA 3SG4A 1J1EA 1NWDA 2NLNA 3LL8B 2BE4A 2EC6B 2V53A 2JT3A 4M2OA 1CMGA 1UURA 1GGZA 1NP8A 5IBWA 1TIZA 2PVBA 4GAOA 1M46A 2BCXA 3O2PA 2OS8C 1OZSA 2KAVA 3PN7B 3I5FB 3K21A 3ZWHA 2L98A 5K89A 1QIWA 4NDCA 1J1DA 1V1FA 1M31A 4I5NB 3EKHA 3NSLA 3BOWB 1LA3A 4ZCVA 1RJVA 1KSMA 3HX4A 1UP5A 2AMIA 2O5GA 4DIRA 1KQMC 1UWOA 2KSPA 2LNKA 2BBMA 3BUMB 3GK1A 1K96A 2KBIA 1A4PA 4I5JA 1MR8A 1SR6B 3I5GC 1WY9A 2MAZA 4XJKA 1BLQA 2K7BA 1YX8A 3I5HC 1WRZA 4PHNA 1LKJA 2WOSA 5I8NA 3PALA 2K7CA 1B7TY 3AKBA 1OMDA 2JULA 3VRPA 3VRNA 1IGVA 1KFXL 1OOJA 4HRGA 2KI4B 1CNPA 1NX0A 1VRKA 1NSHA 1RROA 1TCFA 1NCZA 1YUTA 4MSPA 1PVBA 3NSIA 2D8NA 1C07A 3PFVA 1MUXA 2JXCA 1UUSA 3E3RA 2I18A 1J7RA 2LUXA 2WORA 5KU1A 1EJ3A 2PRUA 2LAPA 1CMFA 2HF5A 2CT9A 2GGZA 4C0KA 1H4BA 2I94A 3OB2B 1LXFC 2ISDA 2B1UA 2FOTA 3DF0B 1L2OB 1KCYA 2KBMA 3IF7A 1D1OA 1S6IA 3DD4A 1NIWA 1WDCC 2M9GA 3JVTB 3BUXB 4CPVA 1YX7A 2JU0A 4D1EA 2E30A 4E68A 3KHEA 1YRUB 1MWNA 4AOMA 1DGUA 1IQ5A 2K61A 1DF0A 2LLTA 2QPTA 2KI6D 2M7NA 3WNXB 5ER4X 2KGRA 4U8DA 2ZN8A 2ZRTA 1A03A 1GGWA 2LHIA 2Y1NA 1TNXA 3AKAA 1SL8A 1BMOA 4GNKB 2DOQA 3LK1A 3DVJA 1LVCD 2KYCA 5CPVA 5TNCA 3NXAA 3LCPC 4MZKA 2E6WA 2F2OA 5I2OA 4UPGA 1G33A 2K0JA 2LE9B 1TTXA 4P2YB 1KK7Y 4FQOA 2EC6C 1QATA 4YI9A 1IKUA 4PE7A 5CSJA 4N1GA 1F4OA 2M1UA 1GJYA 5HKWA 1CDMA 1K95A 4OKHA 4N5XA 4PHJA 1F70A 4YBHB 2CNPA 1ALVA 3TDIA 1WRLA 1Y1AA 2JTZA 1KWOB 2EHBA 2BECA 1OMRA 2HETA 3PN7C 3I5FC 1BT6A 1SNLA 2MHHA 3O6BA 4A4CA 5D69A 3TS5B 2COLB 2JT0A 2LP2A 5ER5A 1FI5A 3D0YA 2NCOA 4PHKA 2F8PA 1TRFA 2Q91A 2M1KB 4MN0A 2FCDA 4R1EA 4CIDA 2JXLA 3RLZA 3OHMB 3PM8A 1EG4A 5CSIA 2GGMA 5I2QA 3EK7A 1L7ZA 1QX2A 3CR4X 3EK8A 1QIVA 2F3ZA 3BUWB 1S5GZ 2JWWA 2WCBA 4DS7A 1SKTA 1SR6C 3DVKA 4PE0A 1YUSA 1B1GA 1JFJA 1SL7A 1NPQA 4DUQA 1J7QA 4ZCUA 1QVIZ 2CXJA 3NSOA 1YVHA 3GOFA 3ZNIA 1CDPA 1NX1A 1XFXO 3OB1B 1CKKA 1YTZC 2KNEA 1YRTB 1SK6D 2KI4C 4HSZA 4OCIA 3WHTB 5B8IB 1ZFSA 1B8LA 4WQ2A 2LM5A 5HKZA 1MHOA 3A4UB 4YI8A 4XJKB 1UHHA 3FWCA 1W7IB 1S6CA 2NCPA 3PLFB 2LVKA 1AUIB 2H61C 4OVNF 1YR5A 3VROA 3I5IB 1PVAA 1JF0A 1KQVA 1AK8A 1W7JB 1TCOB 1PALA 2RGIA 1XA5A 4GGFC 1Y1XA 2WC8A 1L2OC 4YGAA 1Y0VH 4A4BA 1B8RA 2KFHA 3KF9A 1AVSA 4PHMA 3SIAA 1CB1A 1MXLC 2BKIB 2LMTA 5DKRA 5FYXA 5J3XA 1XFYO 4MRXA 3SG6A 3OX6A 3WHUB 1XK4C 3DVMA 5AFPA 2I2RE 2MLFC 2JPTA 2KFGA 1UHJA 2F2PA 1F55A 2NXQA 1XFUO 3CZTX 2L5XB 5HLOA 3F45A 1J7PA 1SPYA 2PALA 1BU3A 3FWBA 1K9UA 5HKYA 3SG5A 2G2BA 5D7FA 1G4YR 5G08A 4MVFA 5KSZA 4MBEA 1Y1UA 1EG3A 1N2DA 2LMVA 2LLSA 3KEVA 1DF0B 1SCVA 1A2XA 5AERA 1C7VA 1CM1A 4ICBA 1CM4A 4JWQA 2M29A 1M39A 3KPXA 2JNFA 1DJHA 2LLUA 1B4CA 1OMVA 1CFFA 2LMUA 4IL1A 2F3YA 3NSKA 1PRWA 1UHIA 1QS7A 5DKQA 2IS9A 1LINA 1MF8B 4CFRA 2Q4UA 2JNXA 1F8HA 2LANA 1QLSA 1IWQA 1A75A 1KWOC 4ETOA 1CLLA 1ZUZA 4NDDA 1UHKA 3TS5C 1RECA 1UHNA 3SJSA 3C1VA 1Y6WA 2LP3A 4MEWA 4CFQA 1CFDA 1KFUS 1U5IA 5KTYA 1CFPA 2WCEA 4CLNA 4OV2A 1AJ4A 1XYDA 1HQVA 1FF1A 2CTNA 3BXKA 1BG1A 3AAKA 1TN4A 1B9AA 3RM1A 1SW8A 4N1FA 1SY9A 1WLMA 1QX7A 2KI6C 2KAYA 2HQWA 1K2HA 1N65A 2JC2A 2LVVA 3D0YB 4C0JA 2ZN9A 2KDHA 3PATA 3CS1A 2GV5A 3IQOA 2JOJA 2AAOA 1FW4A 3TUYB 4C0LA 1NX2A 3LLEA 3LK0A 2KYFA 1DJIA 1OSAA 1YVLA 2KGBC 3EK4A 3O78A 2KFFA 1IQ3A 1B8CA 2WCFA 2BBNA 1PK0D 1KK7Z 5HYDA 2M49B 1PULA 3EVUA 4MRYA 2K7DA 5I2LA 1DT7B 1RK9A 1NCYA 5DKNA 1FPWA 3JTDB 2I7AA 1IJ5A 1TNPA 4F0ZB 2JTTA 2BCAA 2OTGB 1DJWA 2Y1MA 4MLWA 1MXEA 3CTNA 3I5IC 1CDLA 1RFJA 1RWYA 1DJZA 4PDZA 2LCPA 4GUKA 2NZ0A 1G8IA 1EXRA 2O60A 2CBLA 4WRIA 1SCMB 1QVIY 3EKJA 1BR4B 1SRAA 2L50A 1EH2A 1KFUL 1NX3A 1BF5A 4OR9B 4BY5A 1K9PA 2Y5IA 1XO5A 1KK8B 1R6PA 4I5LB 2BKHB 1ZOTB 1C7WA 2H2KA 3O4YA 1SBJA 2OPOA 2K2FA 2Y4QA 3EVRA 2ZNEA 3CR2A 4ORAB 1J7OA 2KQYA 1TNWA 4WQ3A 5BPJA 1R2UA 3TZ1A 4P5OE 1QV1A 5GQQC 1S1EA 4XYNA 3GK2A 3SIBA 3TDUA 5F6TA 1BJFA 1SYMA 3SG2A 3OP0A 1HT9A 4PE1A 2JT8A 1XFVO 1E8AA 1K93D 2ZKMX 2SCPA 3QRXA 4I5KA 1LA0A 1XFWO 3WXAA 4M2PA 5HLVA 1F54A 3OX5A 1K94A 1K9KA 2LC5A 1JC2A 3BUNB 2K8MB 1S3PA 4GBAA 3FS7A 1SMGA 1K8UA 3JVTC 1V1GA 1MQ1A 1SL9A 2PSRA 2ZFDA 3CWGA 1QV0A 2LV7A 2MRDA 2R2IA 5AANA 1A29A 2BL0B 1Q80A 1M45A 1EL4A 1BR1B 1ZACA 4YGBB 4DRWA 1J55A 2AUCA 2KOTA 2VRGA 4QJ4B 1FI6A 2KAXA 2CCMA 3GK4X
chains in the Genus database with same CATH superfamily
2LVJA 5AXIA 4QJ3B 3BOWA 4HREE 3ICBA 5AEQA 1B7TZ 2FJYA 2MBXA 1DJXA 4L9MA 1ALWA 3AAJA 3UNWA 1YURA 2OS8B 2WCKA 2L2EA 1CTRA 3VRQA 1KSOA 1A75B 2M8UA 3IQQA 2LVIA 4PCWA 4GFTA 1JSAA 5CSNA 1JWDA 3VGOA 2HQ8A 1FBVA 2JRFA 1S36A 1DMOA 4HRHA 2ZRSA 4M2QA 1BOCA 1CLBA 3RZSA 1U5IB 2LUCA 2KLDA 2MA2A 1KQMB 3A8RA 1IRJA 2K7OA 1X02A 3TUYC 3UO9A 1OZOA 4AQIA 4ORBB 3HCMA 4ORCB 2M7LA 4FTGA 3PSRA 3I5GB 4QJ5B 1QXPA 3IVTA 4DCKA 2JZIA 3O4XA 3I5HB 4JPZB 1CLMA 5JOLA 5JJGA 3FIAA 4BY4A 1YUUA 1OE9B 2L4HA 1NYAA 5FI7A 4YRUA 1TNQA 2H61A 3MSEB 1CDNA 3BUOB 5CSFA 2FCEA 1JFKA 1IJ6A 1QTXA 2ZNDA 4AQJA 1JUOA 3SG7A 3JTDC 1AHRA 2P6BB 1ODBA 2OTGC 2M97A 3PJIA 2FJUB 4GGFA 3DF0A 1BODA 1S6JA 3H4SE 3CR5X 1F71A 1B47A 2MJWB 2L51A 4JQ0D 1DJYA 4YGCB 2EGDA 1M63B 1SCMC 3EG5B 4MZJA 4YGEB 3D73A 2M3WA 1QJTA 3R72A 1XK4A 2QACA 3BYAA 1QX5B 2KHNA 1K90D 4TNCA 3BFBA 3L47A 2PMYA 1KK8C 4GGNA 1LS8A 1ZMZA 3S0BA 2BCBA 1DGVA 2BE6A 5PALA 3S0EA 2F33A 1AJ5A 2K2AA 1PSBA 2LHLA 4PALA 1WDCB 1H8BA 1WRKA 1N0YA 1Z4HA 2SASA 1IG5A 3CLNA 1S26D 3D10A 2A4JA 1XFZO 3BQ3A 3DVEA 3CGAA 4USLA 2ERBA 3BFAA 1OQPA 2WNDA 1F4QA 4NDBA 1AP4A 2JQ6A 4Q04A 3TDZA 3VRRA 1QASA 3SS3A 3L4LA 4YGDB 1DEKA 1IH0A 1S5GY 2L4IA 2M0RA 1RTP1 2L0PA 3R1OA 1WLZA 1XVJA 3SG3A 3KO0A 1DVIA 1GM0A 4PE4A 2TN4A 1QLKA 1CFCA 2G9BA 1DJGA 1DTLA 2KQ6A 1JF2A 3Q8IA 3EVVA 1JBAA 1NUBA 1GQMA 1KFXS 1NCXA 3CDNA 3D76A 1TUZA 1PSRA 2H8VA 2PQLA 2HPSA 2PASA 4NQGA 4GPLB 1TOPA 2BL0C 2MLEC 3M0WA 3SG4A 2WCLA 1J1EA 3FE8A 1NWDA 2WCJA 2NLNA 3LL8B 2BE4A 2EC6B 2V53A 2JT3A 4M2OA 1CMGA 2KPHA 1UURA 1GGZA 1NP8A 5IBWA 1TIZA 2PVBA 1TWOA 4GAOA 1M46A 2BCXA 3O2PA 4JD9A 4KYNA 2OS8C 3DZTA 1OZSA 2KAVA 3PN7B 3S0GA 3I5FB 3K21A 3ZWHA 2L98A 5K89A 1QIWA 4NDCA 1J1DA 1V1FA 1M31A 4I5NB 3EKHA 4CFQA 3NSLA 3BOWB 1LA3A 4ZCVA 1RJVA 3S0AA 1KSMA 3HX4A 1P28A 1UP5A 2AMIA 2O5GA 3ZNIA 4DIRA 1KQMC 1UWOA 2KSPA 2LNKA 2BBMA 3BUMB 3GK1A 5HL1A 1K96A 2KBIA 1A4PA 1OOIX 1MR8A 4I5JA 1SR6B 1XFRA 2BAPA 1WY9A 3I5GC 2MAZA 4XJKA 1BLQA 2K7BA 1YX8A 3I5HC 1WRZA 4PHNA 1LKJA 1C7VA 2WOSA 2P71A 5I8NA 3PALA 2K7CA 1B7TY 3AKBA 3PM2A 1OMDA 2JULA 3VRPA 3VRNA 1IGVA 1KFXL 1OOJA 4HRGA 2KI4B 1CNPA 1NX0A 1VRKA 1NSHA 1RROA 1TCFA 1NCZA 1YUTA 4MSPA 1PVBA 3NSIA 2D8NA 1C07A 1C3ZA 3PFVA 1MUXA 2JXCA 1UUSA 2QEBA 3E3RA 2I18A 1J7RA 2LUXA 2WORA 5KU1A 3SS4A 1EJ3A 2PRUA 2LAPA 1CMFA 2HF5A 2CT9A 2GGZA 4C0KA 1H4BA 2I94A 3OB2B 1OOHA 2QEVA 1LXFC 2ISDA 2B1UA 2FOTA 3DF0B 1L2OB 1OOGA 1KCYA 3BJHA 2KBMA 3IF7A 1D1OA 1S6IA 3K1EA 3DD4A 1NIWA 1WDCC 2M9GA 3JVTB 3BUXB 4OZDA 1YX7A 4CPVA 2JU0A 1T14A 4D1EA 2E30A 4E68A 3KHEA 1YRUB 1MWNA 4AOMA 1DGUA 1IQ5A 2K61A 1DF0A 2LLTA 2QPTA 2KI6D 2M7NA 3WNXB 5ER4X 2KGRA 4U8DA 2ZN8A 2ZRTA 1A03A 1GGWA 2LHIA 2Y1NA 1TNXA 3AKAA 3CZ1A 1SL8A 1BMOA 4GNKB 2DOQA 3LK1A 3DVJA 1LVCD 2KYCA 4FQTA 5CPVA 5TNCA 3NXAA 3LCPC 4MZKA 2E6WA 2F2OA 5I2OA 3DYEA 4UPGA 1G33A 2K0JA 2LE9B 1TTXA 4P2YB 1KK7Y 5FI6A 4FQOA 2EC6C 1QATA 4YI9A 1IKUA 4PE7A 2P70A 5CSJA 2BNXA 4N1GA 1F4OA 2M1UA 1GJYA 5HKWA 1CDMA 3NHTA 1K95A 4OKHA 4N5XA 4PHJA 1F70A 4YBHB 2CNPA 1ALVA 3TDIA 1TUJA 1WRLA 1W9ZA 1Y1AA 2JTZA 1KWOB 2EHBA 3FE6A 3S0DA 2BECA 1OMRA 2HETA 3PN7C 3I5FC 3V2LA 1BT6A 1SNLA 4IJ7A 2MHHA 3O6BA 4A4CA 5D69A 3TS5B 2COLB 2JT0A 2LP2A 5ER5A 1FI5A 3D74A 3D0YA 2NCOA 4PHKA 1Z2CB 2F8PA 1TRFA 2Q91A 2M1KB 4MN0A 2FCDA 4R1EA 4CIDA 2JXLA 5D3OA 3OHMB 3PM8A 1EG4A 5CSIA 2GGMA 5DICA 3RLZA 5I2QA 3EK7A 1L7ZA 1QX2A 2QEOA 3CR4X 1QIVA 2F3ZA 3BUWB 3EK8A 1S5GZ 2JWWA 2WCBA 4DS7A 1SKTA 1SR6C 3DVKA 4PE0A 1YUSA 1B1GA 1JFJA 1SL7A 1NPQA 4DUQA 1J7QA 4ZCUA 1QVIZ 2CXJA 3NSOA 1YVHA 3GOFA 3OBVA 1CDPA 1NX1A 1ORGA 1XFXO 3OB1B 1YTZC 1CKKA 2GTEA 2KNEA 1YRTB 2WC5A 1SK6D 2KI4C 4HSZA 4OCIA 5EL2A 3WHTB 5B8IB 1ZFSA 1B8LA 4WQ2A 3SS5A 2LM5A 5HKZA 1MHOA 3A4UB 4YI8A 3CYZA 4XJKB 1UHHA 5FI2A 3FWCA 1W7IB 1S6CA 2NCPA 3PLFB 2LVKA 1AUIB 2H61C 4OVNF 1YR5A 3OGNA 3VROA 4F7FA 3NHIA 3I5IB 1PVAA 1JF0A 5I94A 1KQVA 2WCHA 1AK8A 1W7JB 1TCOB 1PALA 2RGIA 1XA5A 4GGFC 1Y1XA 2WC8A 1L2OC 4YGAA 1Y0VH 4A4BA 1B8RA 2KFHA 3KF9A 1AVSA 4PHMA 3SIAA 1CB1A 1MXLC 2BKIB 2LMTA 3FE9A 5DKRA 5FYXA 5J3XA 1XFYO 4MRXA 3SG6A 3OX6A 1QWVA 3WHUB 1XK4C 3DVMA 5AFPA 2I2RE 2MLFC 2JPTA 2KFGA 1UHJA 2F2PA 2YGUA 1F55A 2NXQA 3S0FA 1XFUO 3CZTX 2L5XB 5HLOA 3F45A 2WC6A 1SPYA 2PALA 1BU3A 3B87A 1K9UA 3FWBA 5HKYA 1J7PA 3SG5A 2G2BA 3N7HA 3CZ0A 5D7FA 1G4YR 5G08A 4MVFA 5KSZA 4MBEA 1Y1UA 1EG3A 1N2DA 2LMVA 2LLSA 3KEVA 1DF0B 1SCVA 1A2XA 2WCMA 3R1PA 1CM1A 1OOFA 5AERA 1C3YA 4ICBA 1CM4A 4JWQA 3D77A 1IIOA 2M29A 1M39A 3KPXA 3QMEA 2JNFA 1DJHA 2LLUA 1B4CA 1OMVA 1CFFA 2LMUA 4IL1A 2F3YA 3NSKA 1PRWA 1UHIA 1QS7A 5DKQA 2IS9A 1LINA 1MF8B 4CFRA 2Q4UA 2JNXA 1F8HA 2K60A 1QLSA 1IWQA 2LANA 1A75A 3DY9A 1KWOC 3NGVA 4ETOA 1CLLA 1ZUZA 4NDDA 1UHKA 3B6XA 3TS5C 1RECA 1UHNA 3SJSA 3C1VA 1Y6WA 2LP3A 4INXA 4MEWA 1CFDA 1KFUS 1U5IA 5KTYA 1CFPA 2WCEA 4CLNA 4OV2A 1AJ4A 3BFHA 1DELA 1XYDA 1HQVA 1FF1A 2CTNA 3BXKA 3CABA 2QEHA 1BG1A 3AAKA 1TN4A 1B9AA 3RM1A 1SW8A 3B86A 4N1FA 3VB1A 1SY9A 1WLMA 1QX7A 2KI6C 2KAYA 2HQWA 1DQEA 1N65A 2JC2A 2LVVA 3D0YB 1K2HA 4C0JA 2ZN9A 2KDHA 3PATA 3CS1A 2GV5A 3IQOA 2JOJA 2AAOA 1FW4A 3TUYB 4C0LA 1NX2A 3LLEA 3LK0A 2KYFA 1DJIA 1OSAA 1YVLA 2KGBC 3EK4A 3R1VA 4MZLA 3O78A 4JKTA 2KFFA 1IQ3A 1B8CA 2WCFA 2BBNA 3CZ2A 1PK0D 3L4AA 1OW4A 1KK7Z 3D75A 5HYDA 2M49B 2JPOA 1PULA 3EVUA 4MRYA 2K7DA 5I2LA 1DT7B 1RK9A 1NCYA 5DKNA 2QDIA 1FPWA 3JTDB 2I7AA 4PT1A 1IJ5A 1TNPA 4F0ZB 2JTTA 2BCAA 1DC1A 2OTGB 1DJWA 2Y1MA 4MLWA 1MXEA 3CTNA 3I5IC 1CDLA 1RFJA 1RWYA 1DJZA 4PDZA 2LCPA 4GUKA 2NZ0A 3DXLA 1G8IA 1EXRA 2O60A 2CBLA 2L2CA 4WRIA 1SCMB 1QVIY 3EKJA 1BR4B 1SRAA 2L50A 1EH2A 1KFUL 1NX3A 1BF5A 2KLEA 4OR9B 4BY5A 1K9PA 2Y5IA 1XO5A 1KK8B 1R6PA 4I5LB 2BKHB 1ZOTB 1C7WA 2H2KA 3B7AA 3O4YA 2PYQA 1SBJA 2OPOA 2K2FA 2Y4QA 3EVRA 2ZNEA 3CR2A 4ORAB 3D78A 1J7OA 2KQYA 1TNWA 4WQ3A 5BPJA 1R2UA 3TZ1A 4P5OE 1QV1A 5GQQC 1S1EA 4XYNA 3GK2A 3SIBA 3TDUA 5F6TA 1BJFA 1SYMA 3SG2A 3OP0A 1HT9A 4PE1A 2JT8A 1XFVO 1E8AA 1K93D 2ZKMX 2SCPA 3QRXA 4I5KA 1LA0A 1XFWO 3WXAA 4M2PA 5HLVA 1F54A 3OX5A 1K94A 1K9KA 2LC5A 1JC2A 3BUNB 2K8MB 1S3PA 4GBAA 3FS7A 1SMGA 1K8UA 2L5YA 3JVTC 1V1GA 1MQ1A 1SL9A 2PSRA 2ZFDA 3CWGA 1QV0A 2LV7A 2MRDA 2R2IA 5AANA 1A29A 2BL0B 1Q80A 1M45A 1SSEB 3B88A 1EL4A 1BR1B 1ZACA 4YGBB 4DRWA 1J55A 2AUCA 2KOTA 2VRGA 4QJ4B 1FI6A 4INWA 2KAXA 2CCMA 3GK4X
chains in the Genus database with same CATH topology
2LVJA 5AXIA 4QJ3B 3BOWA 4HREE 3ICBA 5AEQA 1B7TZ 2MBXA 1DJXA 4L9MA 1ALWA 3AAJA 1YURA 2OS8B 2L2EA 1CTRA 3VRQA 1KSOA 1A75B 2M8UA 3IQQA 2LVIA 4PCWA 4GFTA 1JSAA 5CSNA 1JWDA 3VGOA 2HQ8A 1FBVA 2JRFA 1S36A 1DMOA 4HRHA 2ZRSA 4M2QA 1BOCA 1CLBA 1U5IB 2LUCA 2MA2A 1KQMB 3A8RA 1IRJA 2K7OA 1X02A 3TUYC 4AQIA 1OZOA 4ORBB 3HCMA 4ORCB 2M7LA 4FTGA 3PSRA 3I5GB 4QJ5B 1QXPA 4DCKA 2JZIA 4JPZB 3I5HB 5JOLA 1CLMA 5JJGA 3FIAA 4BY4A 1YUUA 1OE9B 2L4HA 1NYAA 4YRUA 1TNQA 2H61A 3MSEB 1CDNA 3BUOB 5CSFA 2FCEA 1JFKA 1IJ6A 1QTXA 2ZNDA 4AQJA 1JUOA 3SG7A 3JTDC 1AHRA 2P6BB 1ODBA 2OTGC 2M97A 2FJUB 4GGFA 3DF0A 1BODA 1S6JA 3H4SE 3CR5X 1F71A 1B47A 2MJWB 2L51A 4JQ0D 1DJYA 4YGCB 2EGDA 1M63B 1SCMC 4MZJA 4YGEB 2M3WA 1QJTA 1XK4A 2QACA 3BYAA 1QX5B 2KHNA 1K90D 4TNCA 2PMYA 1KK8C 4GGNA 1ZMZA 2BCBA 1DGVA 2BE6A 5PALA 2F33A 1AJ5A 2K2AA 1PSBA 2LHLA 4PALA 1WDCB 1H8BA 1WRKA 1N0YA 2SASA 3CLNA 1IG5A 3D10A 1S26D 3DVEA 2A4JA 1XFZO 3BQ3A 4MZLA 3CGAA 4USLA 1OQPA 2WNDA 1F4QA 4NDBA 1AP4A 2JQ6A 4Q04A 3TDZA 3VRRA 1QASA 4YGDB 1IH0A 1S5GY 2L4IA 2M0RA 1RTP1 2L0PA 1WLZA 1XVJA 3SG3A 3KO0A 1DVIA 4PE4A 2TN4A 1QLKA 1CFCA 2G9BA 1DJGA 1DTLA 2KQ6A 1JF2A 3EVVA 1JBAA 1NUBA 1GQMA 1KFXS 1NCXA 1PSRA 2HPSA 2PASA 4NQGA 4GPLB 1TOPA 2BL0C 2MLEC 3M0WA 3SG4A 1J1EA 1NWDA 2NLNA 3LL8B 2BE4A 2EC6B 2V53A 2JT3A 4M2OA 1CMGA 1UURA 1GGZA 1NP8A 5IBWA 1TIZA 2PVBA 4GAOA 1M46A 2BCXA 3O2PA 2OS8C 1OZSA 2KAVA 3PN7B 3I5FB 3K21A 3ZWHA 2L98A 5K89A 1QIWA 4NDCA 1J1DA 1V1FA 1M31A 4I5NB 3EKHA 3NSLA 3BOWB 1LA3A 4ZCVA 1RJVA 1KSMA 3HX4A 1UP5A 2AMIA 2O5GA 4DIRA 1KQMC 1UWOA 2KSPA 2LNKA 2BBMA 3BUMB 3GK1A 1K96A 2KBIA 1A4PA 4I5JA 1MR8A 1SR6B 3I5GC 1WY9A 2MAZA 4XJKA 1BLQA 2K7BA 1YX8A 3I5HC 1WRZA 4PHNA 1LKJA 2WOSA 5I8NA 3PALA 2K7CA 1B7TY 3AKBA 1OMDA 2JULA 3VRPA 3VRNA 1IGVA 1KFXL 1OOJA 4HRGA 2KI4B 1CNPA 1NX0A 1VRKA 1NSHA 1RROA 1TCFA 1NCZA 1YUTA 4MSPA 1PVBA 3NSIA 2D8NA 1C07A 3PFVA 1MUXA 2JXCA 1UUSA 3E3RA 2I18A 1J7RA 2LUXA 2WORA 5KU1A 1EJ3A 2PRUA 2LAPA 1CMFA 2HF5A 2CT9A 2GGZA 4C0KA 1H4BA 2I94A 3OB2B 1LXFC 2ISDA 2B1UA 2FOTA 3DF0B 1L2OB 1KCYA 2KBMA 3IF7A 1D1OA 1S6IA 3DD4A 1NIWA 1WDCC 2M9GA 3JVTB 3BUXB 4CPVA 1YX7A 2JU0A 4D1EA 2E30A 4E68A 3KHEA 1YRUB 1MWNA 4AOMA 1DGUA 1IQ5A 2K61A 1DF0A 2LLTA 2QPTA 2KI6D 2M7NA 3WNXB 5ER4X 2KGRA 4U8DA 2ZN8A 2ZRTA 1A03A 1GGWA 2LHIA 2Y1NA 1TNXA 3AKAA 1SL8A 1BMOA 4GNKB 2DOQA 3LK1A 3DVJA 1LVCD 2KYCA 5CPVA 5TNCA 3NXAA 3LCPC 4MZKA 2E6WA 2F2OA 5I2OA 4UPGA 1G33A 2K0JA 2LE9B 1TTXA 4P2YB 1KK7Y 4FQOA 2EC6C 1QATA 4YI9A 1IKUA 4PE7A 5CSJA 4N1GA 1F4OA 2M1UA 1GJYA 5HKWA 1CDMA 1K95A 4OKHA 4N5XA 4PHJA 1F70A 4YBHB 2CNPA 1ALVA 3TDIA 1WRLA 1Y1AA 2JTZA 1KWOB 2EHBA 2BECA 1OMRA 2HETA 3PN7C 3I5FC 1BT6A 1SNLA 2MHHA 3O6BA 4A4CA 5D69A 3TS5B 2COLB 2JT0A 2LP2A 5ER5A 1FI5A 3D0YA 2NCOA 4PHKA 2F8PA 1TRFA 2Q91A 2M1KB 4MN0A 2FCDA 4R1EA 4CIDA 2JXLA 3RLZA 3OHMB 3PM8A 1EG4A 5CSIA 2GGMA 5I2QA 3EK7A 1L7ZA 1QX2A 3CR4X 3EK8A 1QIVA 2F3ZA 3BUWB 1S5GZ 2JWWA 2WCBA 4DS7A 1SKTA 1SR6C 3DVKA 4PE0A 1YUSA 1B1GA 1JFJA 1SL7A 1NPQA 4DUQA 1J7QA 4ZCUA 1QVIZ 2CXJA 3NSOA 1YVHA 3GOFA 3ZNIA 1CDPA 1NX1A 1XFXO 3OB1B 1CKKA 1YTZC 2KNEA 1YRTB 1SK6D 2KI4C 4HSZA 4OCIA 3WHTB 5B8IB 1ZFSA 1B8LA 4WQ2A 2LM5A 5HKZA 1MHOA 3A4UB 4YI8A 4XJKB 1UHHA 3FWCA 1W7IB 1S6CA 2NCPA 3PLFB 2LVKA 1AUIB 2H61C 4OVNF 1YR5A 3VROA 3I5IB 1PVAA 1JF0A 1KQVA 1AK8A 1W7JB 1TCOB 1PALA 2RGIA 1XA5A 4GGFC 1Y1XA 2WC8A 1L2OC 4YGAA 1Y0VH 4A4BA 1B8RA 2KFHA 3KF9A 1AVSA 4PHMA 3SIAA 1CB1A 1MXLC 2BKIB 2LMTA 5DKRA 5FYXA 5J3XA 1XFYO 4MRXA 3SG6A 3OX6A 3WHUB 1XK4C 3DVMA 5AFPA 2I2RE 2MLFC 2JPTA 2KFGA 1UHJA 2F2PA 1F55A 2NXQA 1XFUO 3CZTX 2L5XB 5HLOA 3F45A 1J7PA 1SPYA 2PALA 1BU3A 3FWBA 1K9UA 5HKYA 3SG5A 2G2BA 5D7FA 1G4YR 5G08A 4MVFA 5KSZA 4MBEA 1Y1UA 1EG3A 1N2DA 2LMVA 2LLSA 3KEVA 1DF0B 1SCVA 1A2XA 5AERA 1C7VA 1CM1A 4ICBA 1CM4A 4JWQA 2M29A 1M39A 3KPXA 2JNFA 1DJHA 2LLUA 1B4CA 1OMVA 1CFFA 2LMUA 4IL1A 2F3YA 3NSKA 1PRWA 1UHIA 1QS7A 5DKQA 2IS9A 1LINA 1MF8B 4CFRA 2Q4UA 2JNXA 1F8HA 2LANA 1QLSA 1IWQA 1A75A 1KWOC 4ETOA 1CLLA 1ZUZA 4NDDA 1UHKA 3TS5C 1RECA 1UHNA 3SJSA 3C1VA 1Y6WA 2LP3A 4MEWA 4CFQA 1CFDA 1KFUS 1U5IA 5KTYA 1CFPA 2WCEA 4CLNA 4OV2A 1AJ4A 1XYDA 1HQVA 1FF1A 2CTNA 3BXKA 1BG1A 3AAKA 1TN4A 1B9AA 3RM1A 1SW8A 4N1FA 1SY9A 1WLMA 1QX7A 2KI6C 2KAYA 2HQWA 1K2HA 1N65A 2JC2A 2LVVA 3D0YB 4C0JA 2ZN9A 2KDHA 3PATA 3CS1A 2GV5A 3IQOA 2JOJA 2AAOA 1FW4A 3TUYB 4C0LA 1NX2A 3LLEA 3LK0A 2KYFA 1DJIA 1OSAA 1YVLA 2KGBC 3EK4A 3O78A 2KFFA 1IQ3A 1B8CA 2WCFA 2BBNA 1PK0D 1KK7Z 5HYDA 2M49B 1PULA 3EVUA 4MRYA 2K7DA 5I2LA 1DT7B 1RK9A 1NCYA 5DKNA 1FPWA 3JTDB 2I7AA 1IJ5A 1TNPA 4F0ZB 2JTTA 2BCAA 2OTGB 1DJWA 2Y1MA 4MLWA 1MXEA 3CTNA 3I5IC 1CDLA 1RFJA 1RWYA 1DJZA 4PDZA 2LCPA 4GUKA 2NZ0A 1G8IA 1EXRA 2O60A 2CBLA 4WRIA 1SCMB 1QVIY 3EKJA 1BR4B 1SRAA 2L50A 1EH2A 1KFUL 1NX3A 1BF5A 4OR9B 4BY5A 1K9PA 2Y5IA 1XO5A 1KK8B 1R6PA 4I5LB 2BKHB 1ZOTB 1C7WA 2H2KA 3O4YA 1SBJA 2OPOA 2K2FA 2Y4QA 3EVRA 2ZNEA 3CR2A 4ORAB 1J7OA 2KQYA 1TNWA 4WQ3A 5BPJA 1R2UA 3TZ1A 4P5OE 1QV1A 5GQQC 1S1EA 4XYNA 3GK2A 3SIBA 3TDUA 5F6TA 1BJFA 1SYMA 3SG2A 3OP0A 1HT9A 4PE1A 2JT8A 1XFVO 1E8AA 1K93D 2ZKMX 2SCPA 3QRXA 4I5KA 1LA0A 1XFWO 3WXAA 4M2PA 5HLVA 1F54A 3OX5A 1K94A 1K9KA 2LC5A 1JC2A 3BUNB 2K8MB 1S3PA 4GBAA 3FS7A 1SMGA 1K8UA 3JVTC 1V1GA 1MQ1A 1SL9A 2PSRA 2ZFDA 3CWGA 1QV0A 2LV7A 2MRDA 2R2IA 5AANA 1A29A 2BL0B 1Q80A 1M45A 1EL4A 1BR1B 1ZACA 4YGBB 4DRWA 1J55A 2AUCA 2KOTA 2VRGA 4QJ4B 1FI6A 2KAXA 2CCMA 3GK4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVJ A;  5AXI A;  4QJ3 B;  3BOW A;  4HRE E;  3ICB A;  5AEQ A;  1B7T Z;  2MBX A;  1DJX A;  4L9M A;  1ALW A;  3AAJ A;  1YUR A;  2OS8 B;  2L2E A;  1CTR A;  3VRQ A;  1KSO A;  1A75 B;  2M8U A;  3IQQ A;  2LVI A;  4PCW A;  4GFT A;  1JSA A;  5CSN A;  1JWD A;  3VGO A;  2HQ8 A;  1FBV A;  2JRF A;  1S36 A;  1DMO A;  4HRH A;  2ZRS A;  4M2Q A;  1BOC A;  1CLB A;  1U5I B;  2LUC A;  2MA2 A;  1KQM B;  3A8R A;  1IRJ A;  2K7O A;  1X02 A;  3TUY C;  4AQI A;  1OZO A;  4ORB B;  3HCM A;  4ORC B;  2M7L A;  4FTG A;  3PSR A;  3I5G B;  4QJ5 B;  1QXP A;  4DCK A;  2JZI A;  4JPZ B;  3I5H B;  5JOL A;  1CLM A;  5JJG A;  3FIA A;  4BY4 A;  1YUU A;  1OE9 B;  2L4H A;  1NYA A;  4YRU A;  1TNQ A;  2H61 A;  3MSE B;  1CDN A;  3BUO B;  5CSF A;  2FCE A;  1JFK A;  1IJ6 A;  1QTX A;  2ZND A;  4AQJ A;  1JUO A;  3SG7 A;  3JTD C;  1AHR A;  2P6B B;  1ODB A;  2OTG C;  2M97 A;  2FJU B;  4GGF A;  3DF0 A;  1BOD A;  1S6J A;  3H4S E;  3CR5 X;  1F71 A;  1B47 A;  2MJW B;  2L51 A;  4JQ0 D;  1DJY A;  4YGC B;  2EGD A;  1M63 B;  1SCM C;  4MZJ A;  4YGE B;  2M3W A;  1QJT A;  1XK4 A;  2QAC A;  3BYA A;  1QX5 B;  2KHN A;  1K90 D;  4TNC A;  2PMY A;  1KK8 C;  4GGN A;  1ZMZ A;  2BCB A;  1DGV A;  2BE6 A;  5PAL A;  2F33 A;  1AJ5 A;  2K2A A;  1PSB A;  2LHL A;  4PAL A;  1WDC B;  1H8B A;  1WRK A;  1N0Y A;  2SAS A;  3CLN A;  1IG5 A;  3D10 A;  1S26 D;  3DVE A;  2A4J A;  1XFZ O;  3BQ3 A;  4MZL A;  3CGA A;  4USL A;  1OQP A;  2WND A;  1F4Q A;  4NDB A;  1AP4 A;  2JQ6 A;  4Q04 A;  3TDZ A;  3VRR A;  1QAS A;  4YGD B;  1IH0 A;  1S5G Y;  2L4I A;  2M0R A;  1RTP 1;  2L0P A;  1WLZ A;  1XVJ A;  3SG3 A;  3KO0 A;  1DVI A;  4PE4 A;  2TN4 A;  1QLK A;  1CFC A;  2G9B A;  1DJG A;  1DTL A;  2KQ6 A;  1JF2 A;  3EVV A;  1JBA A;  1NUB A;  1GQM A;  1KFX S;  1NCX A;  1PSR A;  2HPS A;  2PAS A;  4NQG A;  4GPL B;  1TOP A;  2BL0 C;  2MLE C;  3M0W A;  3SG4 A;  1J1E A;  1NWD A;  2NLN A;  3LL8 B;  2BE4 A;  2EC6 B;  2V53 A;  2JT3 A;  4M2O A;  1CMG A;  1UUR A;  1GGZ A;  1NP8 A;  5IBW A;  1TIZ A;  2PVB A;  4GAO A;  1M46 A;  2BCX A;  3O2P A;  2OS8 C;  1OZS A;  2KAV A;  3PN7 B;  3I5F B;  3K21 A;  3ZWH A;  2L98 A;  5K89 A;  1QIW A;  4NDC A;  1J1D A;  1V1F A;  1M31 A;  4I5N B;  3EKH A;  3NSL A;  3BOW B;  1LA3 A;  4ZCV A;  1RJV A;  1KSM A;  3HX4 A;  1UP5 A;  2AMI A;  2O5G A;  4DIR A;  1KQM C;  1UWO A;  2KSP A;  2LNK A;  2BBM A;  3BUM B;  3GK1 A;  1K96 A;  2KBI A;  1A4P A;  4I5J A;  1MR8 A;  1SR6 B;  3I5G C;  1WY9 A;  2MAZ A;  4XJK A;  1BLQ A;  2K7B A;  1YX8 A;  3I5H C;  1WRZ A;  4PHN A;  1LKJ A;  2WOS A;  5I8N A;  3PAL A;  2K7C A;  1B7T Y;  3AKB A;  1OMD A;  2JUL A;  3VRP A;  3VRN A;  1IGV A;  1KFX L;  1OOJ A;  4HRG A;  2KI4 B;  1CNP A;  1NX0 A;  1VRK A;  1NSH A;  1RRO A;  1TCF A;  1NCZ A;  1YUT A;  4MSP A;  1PVB A;  3NSI A;  2D8N A;  1C07 A;  3PFV A;  1MUX A;  2JXC A;  1UUS A;  3E3R A;  2I18 A;  1J7R A;  2LUX A;  2WOR A;  5KU1 A;  1EJ3 A;  2PRU A;  2LAP A;  1CMF A;  2HF5 A;  2CT9 A;  2GGZ A;  4C0K A;  1H4B A;  2I94 A;  3OB2 B;  1LXF C;  2ISD A;  2B1U A;  2FOT A;  3DF0 B;  1L2O B;  1KCY A;  2KBM A;  3IF7 A;  1D1O A;  1S6I A;  3DD4 A;  1NIW A;  1WDC C;  2M9G A;  3JVT B;  3BUX B;  4CPV A;  1YX7 A;  2JU0 A;  4D1E A;  2E30 A;  4E68 A;  3KHE A;  1YRU B;  1MWN A;  4AOM A;  1DGU A;  1IQ5 A;  2K61 A;  1DF0 A;  2LLT A;  2QPT A;  2KI6 D;  2M7N A;  3WNX B;  5ER4 X;  2KGR A;  4U8D A;  2ZN8 A;  2ZRT A;  1A03 A;  1GGW A;  2LHI A;  2Y1N A;  1TNX A;  3AKA A;  1SL8 A;  1BMO A;  4GNK B;  2DOQ A;  3LK1 A;  3DVJ A;  1LVC D;  2KYC A;  5CPV A;  5TNC A;  3NXA A;  3LCP C;  4MZK A;  2E6W A;  2F2O A;  5I2O A;  4UPG A;  1G33 A;  2K0J A;  2LE9 B;  1TTX A;  4P2Y B;  1KK7 Y;  4FQO A;  2EC6 C;  1QAT A;  4YI9 A;  1IKU A;  4PE7 A;  5CSJ A;  4N1G A;  1F4O A;  2M1U A;  1GJY A;  5HKW A;  1CDM A;  1K95 A;  4OKH A;  4N5X A;  4PHJ A;  1F70 A;  4YBH B;  2CNP A;  1ALV A;  3TDI A;  1WRL A;  1Y1A A;  2JTZ A;  1KWO B;  2EHB A;  2BEC A;  1OMR A;  2HET A;  3PN7 C;  3I5F C;  1BT6 A;  1SNL A;  2MHH A;  3O6B A;  4A4C A;  5D69 A;  3TS5 B;  2COL B;  2JT0 A;  2LP2 A;  5ER5 A;  1FI5 A;  3D0Y A;  2NCO A;  4PHK A;  2F8P A;  1TRF A;  2Q91 A;  2M1K B;  4MN0 A;  2FCD A;  4R1E A;  4CID A;  2JXL A;  3RLZ A;  3OHM B;  3PM8 A;  1EG4 A;  5CSI A;  2GGM A;  5I2Q A;  3EK7 A;  1L7Z A;  1QX2 A;  3CR4 X;  3EK8 A;  1QIV A;  2F3Z A;  3BUW B;  1S5G Z;  2JWW A;  2WCB A;  4DS7 A;  1SKT A;  1SR6 C;  3DVK A;  4PE0 A;  1YUS A;  1B1G A;  1JFJ A;  1SL7 A;  1NPQ A;  4DUQ A;  1J7Q A;  4ZCU A;  1QVI Z;  2CXJ A;  3NSO A;  1YVH A;  3GOF A;  3ZNI A;  1CDP A;  1NX1 A;  1XFX O;  3OB1 B;  1CKK A;  1YTZ C;  2KNE A;  1YRT B;  1SK6 D;  2KI4 C;  4HSZ A;  4OCI A;  3WHT B;  5B8I B;  1ZFS A;  1B8L A;  4WQ2 A;  2LM5 A;  5HKZ A;  1MHO A;  3A4U B;  4YI8 A;  4XJK B;  1UHH A;  3FWC A;  1W7I B;  1S6C A;  2NCP A;  3PLF B;  2LVK A;  1AUI B;  2H61 C;  4OVN F;  1YR5 A;  3VRO A;  3I5I B;  1PVA A;  1JF0 A;  1KQV A;  1AK8 A;  1W7J B;  1TCO B;  1PAL A;  2RGI A;  1XA5 A;  4GGF C;  1Y1X A;  2WC8 A;  1L2O C;  4YGA A;  1Y0V H;  4A4B A;  1B8R A;  2KFH A;  3KF9 A;  1AVS A;  4PHM A;  3SIA A;  1CB1 A;  1MXL C;  2BKI B;  2LMT A;  5DKR A;  5FYX A;  5J3X A;  1XFY O;  4MRX A;  3SG6 A;  3OX6 A;  3WHU B;  1XK4 C;  3DVM A;  5AFP A;  2I2R E;  2MLF C;  2JPT A;  2KFG A;  1UHJ A;  2F2P A;  1F55 A;  2NXQ A;  1XFU O;  3CZT X;  2L5X B;  5HLO A;  3F45 A;  1J7P A;  1SPY A;  2PAL A;  1BU3 A;  3FWB A;  1K9U A;  5HKY A;  3SG5 A;  2G2B A;  5D7F A;  1G4Y R;  5G08 A;  4MVF A;  5KSZ A;  4MBE A;  1Y1U A;  1EG3 A;  1N2D A;  2LMV A;  2LLS A;  3KEV A;  1DF0 B;  1SCV A;  1A2X A;  5AER A;  1C7V A;  1CM1 A;  4ICB A;  1CM4 A;  4JWQ A;  2M29 A;  1M39 A;  3KPX A;  2JNF A;  1DJH A;  2LLU A;  1B4C A;  1OMV A;  1CFF A;  2LMU A;  4IL1 A;  2F3Y A;  3NSK A;  1PRW A;  1UHI A;  1QS7 A;  5DKQ A;  2IS9 A;  1LIN A;  1MF8 B;  4CFR A;  2Q4U A;  2JNX A;  1F8H A;  2LAN A;  1QLS A;  1IWQ A;  1A75 A;  1KWO C;  4ETO A;  1CLL A;  1ZUZ A;  4NDD A;  1UHK A;  3TS5 C;  1REC A;  1UHN A;  3SJS A;  3C1V A;  1Y6W A;  2LP3 A;  4MEW A;  4CFQ A;  1CFD A;  1KFU S;  1U5I A;  5KTY A;  1CFP A;  2WCE A;  4CLN A;  4OV2 A;  1AJ4 A;  1XYD A;  1HQV A;  1FF1 A;  2CTN A;  3BXK A;  1BG1 A;  3AAK A;  1TN4 A;  1B9A A;  3RM1 A;  1SW8 A;  4N1F A;  1SY9 A;  1WLM A;  1QX7 A;  2KI6 C;  2KAY A;  2HQW A;  1K2H A;  1N65 A;  2JC2 A;  2LVV A;  3D0Y B;  4C0J A;  2ZN9 A;  2KDH A;  3PAT A;  3CS1 A;  2GV5 A;  3IQO A;  2JOJ A;  2AAO A;  1FW4 A;  3TUY B;  4C0L A;  1NX2 A;  3LLE A;  3LK0 A;  2KYF A;  1DJI A;  1OSA A;  1YVL A;  2KGB C;  3EK4 A;  3O78 A;  2KFF A;  1IQ3 A;  1B8C A;  2WCF A;  2BBN A;  1PK0 D;  1KK7 Z;  5HYD A;  2M49 B;  1PUL A;  3EVU A;  4MRY A;  2K7D A;  5I2L A;  1DT7 B;  1RK9 A;  1NCY A;  5DKN A;  1FPW A;  3JTD B;  2I7A A;  1IJ5 A;  1TNP A;  4F0Z B;  2JTT A;  2BCA A;  2OTG B;  1DJW A;  2Y1M A;  4MLW A;  1MXE A;  3CTN A;  3I5I C;  1CDL A;  1RFJ A;  1RWY A;  1DJZ A;  4PDZ A;  2LCP A;  4GUK A;  2NZ0 A;  1G8I A;  1EXR A;  2O60 A;  2CBL A;  4WRI A;  1SCM B;  1QVI Y;  3EKJ A;  1BR4 B;  1SRA A;  2L50 A;  1EH2 A;  1KFU L;  1NX3 A;  1BF5 A;  4OR9 B;  4BY5 A;  1K9P A;  2Y5I A;  1XO5 A;  1KK8 B;  1R6P A;  4I5L B;  2BKH B;  1ZOT B;  1C7W A;  2H2K A;  3O4Y A;  1SBJ A;  2OPO A;  2K2F A;  2Y4Q A;  3EVR A;  2ZNE A;  3CR2 A;  4ORA B;  1J7O A;  2KQY A;  1TNW A;  4WQ3 A;  5BPJ A;  1R2U A;  3TZ1 A;  4P5O E;  1QV1 A;  5GQQ C;  1S1E A;  4XYN A;  3GK2 A;  3SIB A;  3TDU A;  5F6T A;  1BJF A;  1SYM A;  3SG2 A;  3OP0 A;  1HT9 A;  4PE1 A;  2JT8 A;  1XFV O;  1E8A A;  1K93 D;  2ZKM X;  2SCP A;  3QRX A;  4I5K A;  1LA0 A;  1XFW O;  3WXA A;  4M2P A;  5HLV A;  1F54 A;  3OX5 A;  1K94 A;  1K9K A;  2LC5 A;  1JC2 A;  3BUN B;  2K8M B;  1S3P A;  4GBA A;  3FS7 A;  1SMG A;  1K8U A;  3JVT C;  1V1G A;  1MQ1 A;  1SL9 A;  2PSR A;  2ZFD A;  3CWG A;  1QV0 A;  2LV7 A;  2MRD A;  2R2I A;  5AAN A;  1A29 A;  2BL0 B;  1Q80 A;  1M45 A;  1EL4 A;  1BR1 B;  1ZAC A;  4YGB B;  4DRW A;  1J55 A;  2AUC A;  2KOT A;  2VRG A;  4QJ4 B;  1FI6 A;  2KAX A;  2CCM A;  3GK4 X; 
#chains in the Genus database with same CATH topology
 2LVJ A;  5AXI A;  4QJ3 B;  3BOW A;  4HRE E;  3ICB A;  5AEQ A;  1B7T Z;  2FJY A;  2MBX A;  1DJX A;  4L9M A;  1ALW A;  3AAJ A;  3UNW A;  1YUR A;  2OS8 B;  2WCK A;  2L2E A;  1CTR A;  3VRQ A;  1KSO A;  1A75 B;  2M8U A;  3IQQ A;  2LVI A;  4PCW A;  4GFT A;  1JSA A;  5CSN A;  1JWD A;  3VGO A;  2HQ8 A;  1FBV A;  2JRF A;  1S36 A;  1DMO A;  4HRH A;  2ZRS A;  4M2Q A;  1BOC A;  1CLB A;  3RZS A;  1U5I B;  2LUC A;  2KLD A;  2MA2 A;  1KQM B;  3A8R A;  1IRJ A;  2K7O A;  1X02 A;  3TUY C;  3UO9 A;  1OZO A;  4AQI A;  4ORB B;  3HCM A;  4ORC B;  2M7L A;  4FTG A;  3PSR A;  3I5G B;  4QJ5 B;  1QXP A;  3IVT A;  4DCK A;  2JZI A;  3O4X A;  3I5H B;  4JPZ B;  1CLM A;  5JOL A;  5JJG A;  3FIA A;  4BY4 A;  1YUU A;  1OE9 B;  2L4H A;  1NYA A;  5FI7 A;  4YRU A;  1TNQ A;  2H61 A;  3MSE B;  1CDN A;  3BUO B;  5CSF A;  2FCE A;  1JFK A;  1IJ6 A;  1QTX A;  2ZND A;  4AQJ A;  1JUO A;  3SG7 A;  3JTD C;  1AHR A;  2P6B B;  1ODB A;  2OTG C;  2M97 A;  3PJI A;  2FJU B;  4GGF A;  3DF0 A;  1BOD A;  1S6J A;  3H4S E;  3CR5 X;  1F71 A;  1B47 A;  2MJW B;  2L51 A;  4JQ0 D;  1DJY A;  4YGC B;  2EGD A;  1M63 B;  1SCM C;  3EG5 B;  4MZJ A;  4YGE B;  3D73 A;  2M3W A;  1QJT A;  3R72 A;  1XK4 A;  2QAC A;  3BYA A;  1QX5 B;  2KHN A;  1K90 D;  4TNC A;  3BFB A;  3L47 A;  2PMY A;  1KK8 C;  4GGN A;  1LS8 A;  1ZMZ A;  3S0B A;  2BCB A;  1DGV A;  2BE6 A;  5PAL A;  3S0E A;  2F33 A;  1AJ5 A;  2K2A A;  1PSB A;  2LHL A;  4PAL A;  1WDC B;  1H8B A;  1WRK A;  1N0Y A;  1Z4H A;  2SAS A;  1IG5 A;  3CLN A;  1S26 D;  3D10 A;  2A4J A;  1XFZ O;  3BQ3 A;  3DVE A;  3CGA A;  4USL A;  2ERB A;  3BFA A;  1OQP A;  2WND A;  1F4Q A;  4NDB A;  1AP4 A;  2JQ6 A;  4Q04 A;  3TDZ A;  3VRR A;  1QAS A;  3SS3 A;  3L4L A;  4YGD B;  1DEK A;  1IH0 A;  1S5G Y;  2L4I A;  2M0R A;  1RTP 1;  2L0P A;  3R1O A;  1WLZ A;  1XVJ A;  3SG3 A;  3KO0 A;  1DVI A;  1GM0 A;  4PE4 A;  2TN4 A;  1QLK A;  1CFC A;  2G9B A;  1DJG A;  1DTL A;  2KQ6 A;  1JF2 A;  3Q8I A;  3EVV A;  1JBA A;  1NUB A;  1GQM A;  1KFX S;  1NCX A;  3CDN A;  3D76 A;  1TUZ A;  1PSR A;  2H8V A;  2PQL A;  2HPS A;  2PAS A;  4NQG A;  4GPL B;  1TOP A;  2BL0 C;  2MLE C;  3M0W A;  3SG4 A;  2WCL A;  1J1E A;  3FE8 A;  1NWD A;  2WCJ A;  2NLN A;  3LL8 B;  2BE4 A;  2EC6 B;  2V53 A;  2JT3 A;  4M2O A;  1CMG A;  2KPH A;  1UUR A;  1GGZ A;  1NP8 A;  5IBW A;  1TIZ A;  2PVB A;  1TWO A;  4GAO A;  1M46 A;  2BCX A;  3O2P A;  4JD9 A;  4KYN A;  2OS8 C;  3DZT A;  1OZS A;  2KAV A;  3PN7 B;  3S0G A;  3I5F B;  3K21 A;  3ZWH A;  2L98 A;  5K89 A;  1QIW A;  4NDC A;  1J1D A;  1V1F A;  1M31 A;  4I5N B;  3EKH A;  4CFQ A;  3NSL A;  3BOW B;  1LA3 A;  4ZCV A;  1RJV A;  3S0A A;  1KSM A;  3HX4 A;  1P28 A;  1UP5 A;  2AMI A;  2O5G A;  3ZNI A;  4DIR A;  1KQM C;  1UWO A;  2KSP A;  2LNK A;  2BBM A;  3BUM B;  3GK1 A;  5HL1 A;  1K96 A;  2KBI A;  1A4P A;  1OOI X;  1MR8 A;  4I5J A;  1SR6 B;  1XFR A;  2BAP A;  1WY9 A;  3I5G C;  2MAZ A;  4XJK A;  1BLQ A;  2K7B A;  1YX8 A;  3I5H C;  1WRZ A;  4PHN A;  1LKJ A;  1C7V A;  2WOS A;  2P71 A;  5I8N A;  3PAL A;  2K7C A;  1B7T Y;  3AKB A;  3PM2 A;  1OMD A;  2JUL A;  3VRP A;  3VRN A;  1IGV A;  1KFX L;  1OOJ A;  4HRG A;  2KI4 B;  1CNP A;  1NX0 A;  1VRK A;  1NSH A;  1RRO A;  1TCF A;  1NCZ A;  1YUT A;  4MSP A;  1PVB A;  3NSI A;  2D8N A;  1C07 A;  1C3Z A;  3PFV A;  1MUX A;  2JXC A;  1UUS A;  2QEB A;  3E3R A;  2I18 A;  1J7R A;  2LUX A;  2WOR A;  5KU1 A;  3SS4 A;  1EJ3 A;  2PRU A;  2LAP A;  1CMF A;  2HF5 A;  2CT9 A;  2GGZ A;  4C0K A;  1H4B A;  2I94 A;  3OB2 B;  1OOH A;  2QEV A;  1LXF C;  2ISD A;  2B1U A;  2FOT A;  3DF0 B;  1L2O B;  1OOG A;  1KCY A;  3BJH A;  2KBM A;  3IF7 A;  1D1O A;  1S6I A;  3K1E A;  3DD4 A;  1NIW A;  1WDC C;  2M9G A;  3JVT B;  3BUX B;  4OZD A;  1YX7 A;  4CPV A;  2JU0 A;  1T14 A;  4D1E A;  2E30 A;  4E68 A;  3KHE A;  1YRU B;  1MWN A;  4AOM A;  1DGU A;  1IQ5 A;  2K61 A;  1DF0 A;  2LLT A;  2QPT A;  2KI6 D;  2M7N A;  3WNX B;  5ER4 X;  2KGR A;  4U8D A;  2ZN8 A;  2ZRT A;  1A03 A;  1GGW A;  2LHI A;  2Y1N A;  1TNX A;  3AKA A;  3CZ1 A;  1SL8 A;  1BMO A;  4GNK B;  2DOQ A;  3LK1 A;  3DVJ A;  1LVC D;  2KYC A;  4FQT A;  5CPV A;  5TNC A;  3NXA A;  3LCP C;  4MZK A;  2E6W A;  2F2O A;  5I2O A;  3DYE A;  4UPG A;  1G33 A;  2K0J A;  2LE9 B;  1TTX A;  4P2Y B;  1KK7 Y;  5FI6 A;  4FQO A;  2EC6 C;  1QAT A;  4YI9 A;  1IKU A;  4PE7 A;  2P70 A;  5CSJ A;  2BNX A;  4N1G A;  1F4O A;  2M1U A;  1GJY A;  5HKW A;  1CDM A;  3NHT A;  1K95 A;  4OKH A;  4N5X A;  4PHJ A;  1F70 A;  4YBH B;  2CNP A;  1ALV A;  3TDI A;  1TUJ A;  1WRL A;  1W9Z A;  1Y1A A;  2JTZ A;  1KWO B;  2EHB A;  3FE6 A;  3S0D A;  2BEC A;  1OMR A;  2HET A;  3PN7 C;  3I5F C;  3V2L A;  1BT6 A;  1SNL A;  4IJ7 A;  2MHH A;  3O6B A;  4A4C A;  5D69 A;  3TS5 B;  2COL B;  2JT0 A;  2LP2 A;  5ER5 A;  1FI5 A;  3D74 A;  3D0Y A;  2NCO A;  4PHK A;  1Z2C B;  2F8P A;  1TRF A;  2Q91 A;  2M1K B;  4MN0 A;  2FCD A;  4R1E A;  4CID A;  2JXL A;  5D3O A;  3OHM B;  3PM8 A;  1EG4 A;  5CSI A;  2GGM A;  5DIC A;  3RLZ A;  5I2Q A;  3EK7 A;  1L7Z A;  1QX2 A;  2QEO A;  3CR4 X;  1QIV A;  2F3Z A;  3BUW B;  3EK8 A;  1S5G Z;  2JWW A;  2WCB A;  4DS7 A;  1SKT A;  1SR6 C;  3DVK A;  4PE0 A;  1YUS A;  1B1G A;  1JFJ A;  1SL7 A;  1NPQ A;  4DUQ A;  1J7Q A;  4ZCU A;  1QVI Z;  2CXJ A;  3NSO A;  1YVH A;  3GOF A;  3OBV A;  1CDP A;  1NX1 A;  1ORG A;  1XFX O;  3OB1 B;  1YTZ C;  1CKK A;  2GTE A;  2KNE A;  1YRT B;  2WC5 A;  1SK6 D;  2KI4 C;  4HSZ A;  4OCI A;  5EL2 A;  3WHT B;  5B8I B;  1ZFS A;  1B8L A;  4WQ2 A;  3SS5 A;  2LM5 A;  5HKZ A;  1MHO A;  3A4U B;  4YI8 A;  3CYZ A;  4XJK B;  1UHH A;  5FI2 A;  3FWC A;  1W7I B;  1S6C A;  2NCP A;  3PLF B;  2LVK A;  1AUI B;  2H61 C;  4OVN F;  1YR5 A;  3OGN A;  3VRO A;  4F7F A;  3NHI A;  3I5I B;  1PVA A;  1JF0 A;  5I94 A;  1KQV A;  2WCH A;  1AK8 A;  1W7J B;  1TCO B;  1PAL A;  2RGI A;  1XA5 A;  4GGF C;  1Y1X A;  2WC8 A;  1L2O C;  4YGA A;  1Y0V H;  4A4B A;  1B8R A;  2KFH A;  3KF9 A;  1AVS A;  4PHM A;  3SIA A;  1CB1 A;  1MXL C;  2BKI B;  2LMT A;  3FE9 A;  5DKR A;  5FYX A;  5J3X A;  1XFY O;  4MRX A;  3SG6 A;  3OX6 A;  1QWV A;  3WHU B;  1XK4 C;  3DVM A;  5AFP A;  2I2R E;  2MLF C;  2JPT A;  2KFG A;  1UHJ A;  2F2P A;  2YGU A;  1F55 A;  2NXQ A;  3S0F A;  1XFU O;  3CZT X;  2L5X B;  5HLO A;  3F45 A;  2WC6 A;  1SPY A;  2PAL A;  1BU3 A;  3B87 A;  1K9U A;  3FWB A;  5HKY A;  1J7P A;  3SG5 A;  2G2B A;  3N7H A;  3CZ0 A;  5D7F A;  1G4Y R;  5G08 A;  4MVF A;  5KSZ A;  4MBE A;  1Y1U A;  1EG3 A;  1N2D A;  2LMV A;  2LLS A;  3KEV A;  1DF0 B;  1SCV A;  1A2X A;  2WCM A;  3R1P A;  1CM1 A;  1OOF A;  5AER A;  1C3Y A;  4ICB A;  1CM4 A;  4JWQ A;  3D77 A;  1IIO A;  2M29 A;  1M39 A;  3KPX A;  3QME A;  2JNF A;  1DJH A;  2LLU A;  1B4C A;  1OMV A;  1CFF A;  2LMU A;  4IL1 A;  2F3Y A;  3NSK A;  1PRW A;  1UHI A;  1QS7 A;  5DKQ A;  2IS9 A;  1LIN A;  1MF8 B;  4CFR A;  2Q4U A;  2JNX A;  1F8H A;  2K60 A;  1QLS A;  1IWQ A;  2LAN A;  1A75 A;  3DY9 A;  1KWO C;  3NGV A;  4ETO A;  1CLL A;  1ZUZ A;  4NDD A;  1UHK A;  3B6X A;  3TS5 C;  1REC A;  1UHN A;  3SJS A;  3C1V A;  1Y6W A;  2LP3 A;  4INX A;  4MEW A;  1CFD A;  1KFU S;  1U5I A;  5KTY A;  1CFP A;  2WCE A;  4CLN A;  4OV2 A;  1AJ4 A;  3BFH A;  1DEL A;  1XYD A;  1HQV A;  1FF1 A;  2CTN A;  3BXK A;  3CAB A;  2QEH A;  1BG1 A;  3AAK A;  1TN4 A;  1B9A A;  3RM1 A;  1SW8 A;  3B86 A;  4N1F A;  3VB1 A;  1SY9 A;  1WLM A;  1QX7 A;  2KI6 C;  2KAY A;  2HQW A;  1DQE A;  1N65 A;  2JC2 A;  2LVV A;  3D0Y B;  1K2H A;  4C0J A;  2ZN9 A;  2KDH A;  3PAT A;  3CS1 A;  2GV5 A;  3IQO A;  2JOJ A;  2AAO A;  1FW4 A;  3TUY B;  4C0L A;  1NX2 A;  3LLE A;  3LK0 A;  2KYF A;  1DJI A;  1OSA A;  1YVL A;  2KGB C;  3EK4 A;  3R1V A;  4MZL A;  3O78 A;  4JKT A;  2KFF A;  1IQ3 A;  1B8C A;  2WCF A;  2BBN A;  3CZ2 A;  1PK0 D;  3L4A A;  1OW4 A;  1KK7 Z;  3D75 A;  5HYD A;  2M49 B;  2JPO A;  1PUL A;  3EVU A;  4MRY A;  2K7D A;  5I2L A;  1DT7 B;  1RK9 A;  1NCY A;  5DKN A;  2QDI A;  1FPW A;  3JTD B;  2I7A A;  4PT1 A;  1IJ5 A;  1TNP A;  4F0Z B;  2JTT A;  2BCA A;  1DC1 A;  2OTG B;  1DJW A;  2Y1M A;  4MLW A;  1MXE A;  3CTN A;  3I5I C;  1CDL A;  1RFJ A;  1RWY A;  1DJZ A;  4PDZ A;  2LCP A;  4GUK A;  2NZ0 A;  3DXL A;  1G8I A;  1EXR A;  2O60 A;  2CBL A;  2L2C A;  4WRI A;  1SCM B;  1QVI Y;  3EKJ A;  1BR4 B;  1SRA A;  2L50 A;  1EH2 A;  1KFU L;  1NX3 A;  1BF5 A;  2KLE A;  4OR9 B;  4BY5 A;  1K9P A;  2Y5I A;  1XO5 A;  1KK8 B;  1R6P A;  4I5L B;  2BKH B;  1ZOT B;  1C7W A;  2H2K A;  3B7A A;  3O4Y A;  2PYQ A;  1SBJ A;  2OPO A;  2K2F A;  2Y4Q A;  3EVR A;  2ZNE A;  3CR2 A;  4ORA B;  3D78 A;  1J7O A;  2KQY A;  1TNW A;  4WQ3 A;  5BPJ A;  1R2U A;  3TZ1 A;  4P5O E;  1QV1 A;  5GQQ C;  1S1E A;  4XYN A;  3GK2 A;  3SIB A;  3TDU A;  5F6T A;  1BJF A;  1SYM A;  3SG2 A;  3OP0 A;  1HT9 A;  4PE1 A;  2JT8 A;  1XFV O;  1E8A A;  1K93 D;  2ZKM X;  2SCP A;  3QRX A;  4I5K A;  1LA0 A;  1XFW O;  3WXA A;  4M2P A;  5HLV A;  1F54 A;  3OX5 A;  1K94 A;  1K9K A;  2LC5 A;  1JC2 A;  3BUN B;  2K8M B;  1S3P A;  4GBA A;  3FS7 A;  1SMG A;  1K8U A;  2L5Y A;  3JVT C;  1V1G A;  1MQ1 A;  1SL9 A;  2PSR A;  2ZFD A;  3CWG A;  1QV0 A;  2LV7 A;  2MRD A;  2R2I A;  5AAN A;  1A29 A;  2BL0 B;  1Q80 A;  1M45 A;  1SSE B;  3B88 A;  1EL4 A;  1BR1 B;  1ZAC A;  4YGB B;  4DRW A;  1J55 A;  2AUC A;  2KOT A;  2VRG A;  4QJ4 B;  1FI6 A;  4INW A;  2KAX A;  2CCM A;  3GK4 X; 
#chains in the Genus database with same CATH homology
 2LVJ A;  5AXI A;  4QJ3 B;  3BOW A;  4HRE E;  3ICB A;  5AEQ A;  1B7T Z;  2MBX A;  1DJX A;  4L9M A;  1ALW A;  3AAJ A;  1YUR A;  2OS8 B;  2L2E A;  1CTR A;  3VRQ A;  1KSO A;  1A75 B;  2M8U A;  3IQQ A;  2LVI A;  4PCW A;  4GFT A;  1JSA A;  5CSN A;  1JWD A;  3VGO A;  2HQ8 A;  1FBV A;  2JRF A;  1S36 A;  1DMO A;  4HRH A;  2ZRS A;  4M2Q A;  1BOC A;  1CLB A;  1U5I B;  2LUC A;  2MA2 A;  1KQM B;  3A8R A;  1IRJ A;  2K7O A;  1X02 A;  3TUY C;  4AQI A;  1OZO A;  4ORB B;  3HCM A;  4ORC B;  2M7L A;  4FTG A;  3PSR A;  3I5G B;  4QJ5 B;  1QXP A;  4DCK A;  2JZI A;  4JPZ B;  3I5H B;  5JOL A;  1CLM A;  5JJG A;  3FIA A;  4BY4 A;  1YUU A;  1OE9 B;  2L4H A;  1NYA A;  4YRU A;  1TNQ A;  2H61 A;  3MSE B;  1CDN A;  3BUO B;  5CSF A;  2FCE A;  1JFK A;  1IJ6 A;  1QTX A;  2ZND A;  4AQJ A;  1JUO A;  3SG7 A;  3JTD C;  1AHR A;  2P6B B;  1ODB A;  2OTG C;  2M97 A;  2FJU B;  4GGF A;  3DF0 A;  1BOD A;  1S6J A;  3H4S E;  3CR5 X;  1F71 A;  1B47 A;  2MJW B;  2L51 A;  4JQ0 D;  1DJY A;  4YGC B;  2EGD A;  1M63 B;  1SCM C;  4MZJ A;  4YGE B;  2M3W A;  1QJT A;  1XK4 A;  2QAC A;  3BYA A;  1QX5 B;  2KHN A;  1K90 D;  4TNC A;  2PMY A;  1KK8 C;  4GGN A;  1ZMZ A;  2BCB A;  1DGV A;  2BE6 A;  5PAL A;  2F33 A;  1AJ5 A;  2K2A A;  1PSB A;  2LHL A;  4PAL A;  1WDC B;  1H8B A;  1WRK A;  1N0Y A;  2SAS A;  3CLN A;  1IG5 A;  3D10 A;  1S26 D;  3DVE A;  2A4J A;  1XFZ O;  3BQ3 A;  4MZL A;  3CGA A;  4USL A;  1OQP A;  2WND A;  1F4Q A;  4NDB A;  1AP4 A;  2JQ6 A;  4Q04 A;  3TDZ A;  3VRR A;  1QAS A;  4YGD B;  1IH0 A;  1S5G Y;  2L4I A;  2M0R A;  1RTP 1;  2L0P A;  1WLZ A;  1XVJ A;  3SG3 A;  3KO0 A;  1DVI A;  4PE4 A;  2TN4 A;  1QLK A;  1CFC A;  2G9B A;  1DJG A;  1DTL A;  2KQ6 A;  1JF2 A;  3EVV A;  1JBA A;  1NUB A;  1GQM A;  1KFX S;  1NCX A;  1PSR A;  2HPS A;  2PAS A;  4NQG A;  4GPL B;  1TOP A;  2BL0 C;  2MLE C;  3M0W A;  3SG4 A;  1J1E A;  1NWD A;  2NLN A;  3LL8 B;  2BE4 A;  2EC6 B;  2V53 A;  2JT3 A;  4M2O A;  1CMG A;  1UUR A;  1GGZ A;  1NP8 A;  5IBW A;  1TIZ A;  2PVB A;  4GAO A;  1M46 A;  2BCX A;  3O2P A;  2OS8 C;  1OZS A;  2KAV A;  3PN7 B;  3I5F B;  3K21 A;  3ZWH A;  2L98 A;  5K89 A;  1QIW A;  4NDC A;  1J1D A;  1V1F A;  1M31 A;  4I5N B;  3EKH A;  3NSL A;  3BOW B;  1LA3 A;  4ZCV A;  1RJV A;  1KSM A;  3HX4 A;  1UP5 A;  2AMI A;  2O5G A;  4DIR A;  1KQM C;  1UWO A;  2KSP A;  2LNK A;  2BBM A;  3BUM B;  3GK1 A;  1K96 A;  2KBI A;  1A4P A;  4I5J A;  1MR8 A;  1SR6 B;  3I5G C;  1WY9 A;  2MAZ A;  4XJK A;  1BLQ A;  2K7B A;  1YX8 A;  3I5H C;  1WRZ A;  4PHN A;  1LKJ A;  2WOS A;  5I8N A;  3PAL A;  2K7C A;  1B7T Y;  3AKB A;  1OMD A;  2JUL A;  3VRP A;  3VRN A;  1IGV A;  1KFX L;  1OOJ A;  4HRG A;  2KI4 B;  1CNP A;  1NX0 A;  1VRK A;  1NSH A;  1RRO A;  1TCF A;  1NCZ A;  1YUT A;  4MSP A;  1PVB A;  3NSI A;  2D8N A;  1C07 A;  3PFV A;  1MUX A;  2JXC A;  1UUS A;  3E3R A;  2I18 A;  1J7R A;  2LUX A;  2WOR A;  5KU1 A;  1EJ3 A;  2PRU A;  2LAP A;  1CMF A;  2HF5 A;  2CT9 A;  2GGZ A;  4C0K A;  1H4B A;  2I94 A;  3OB2 B;  1LXF C;  2ISD A;  2B1U A;  2FOT A;  3DF0 B;  1L2O B;  1KCY A;  2KBM A;  3IF7 A;  1D1O A;  1S6I A;  3DD4 A;  1NIW A;  1WDC C;  2M9G A;  3JVT B;  3BUX B;  4CPV A;  1YX7 A;  2JU0 A;  4D1E A;  2E30 A;  4E68 A;  3KHE A;  1YRU B;  1MWN A;  4AOM A;  1DGU A;  1IQ5 A;  2K61 A;  1DF0 A;  2LLT A;  2QPT A;  2KI6 D;  2M7N A;  3WNX B;  5ER4 X;  2KGR A;  4U8D A;  2ZN8 A;  2ZRT A;  1A03 A;  1GGW A;  2LHI A;  2Y1N A;  1TNX A;  3AKA A;  1SL8 A;  1BMO A;  4GNK B;  2DOQ A;  3LK1 A;  3DVJ A;  1LVC D;  2KYC A;  5CPV A;  5TNC A;  3NXA A;  3LCP C;  4MZK A;  2E6W A;  2F2O A;  5I2O A;  4UPG A;  1G33 A;  2K0J A;  2LE9 B;  1TTX A;  4P2Y B;  1KK7 Y;  4FQO A;  2EC6 C;  1QAT A;  4YI9 A;  1IKU A;  4PE7 A;  5CSJ A;  4N1G A;  1F4O A;  2M1U A;  1GJY A;  5HKW A;  1CDM A;  1K95 A;  4OKH A;  4N5X A;  4PHJ A;  1F70 A;  4YBH B;  2CNP A;  1ALV A;  3TDI A;  1WRL A;  1Y1A A;  2JTZ A;  1KWO B;  2EHB A;  2BEC A;  1OMR A;  2HET A;  3PN7 C;  3I5F C;  1BT6 A;  1SNL A;  2MHH A;  3O6B A;  4A4C A;  5D69 A;  3TS5 B;  2COL B;  2JT0 A;  2LP2 A;  5ER5 A;  1FI5 A;  3D0Y A;  2NCO A;  4PHK A;  2F8P A;  1TRF A;  2Q91 A;  2M1K B;  4MN0 A;  2FCD A;  4R1E A;  4CID A;  2JXL A;  3RLZ A;  3OHM B;  3PM8 A;  1EG4 A;  5CSI A;  2GGM A;  5I2Q A;  3EK7 A;  1L7Z A;  1QX2 A;  3CR4 X;  3EK8 A;  1QIV A;  2F3Z A;  3BUW B;  1S5G Z;  2JWW A;  2WCB A;  4DS7 A;  1SKT A;  1SR6 C;  3DVK A;  4PE0 A;  1YUS A;  1B1G A;  1JFJ A;  1SL7 A;  1NPQ A;  4DUQ A;  1J7Q A;  4ZCU A;  1QVI Z;  2CXJ A;  3NSO A;  1YVH A;  3GOF A;  3ZNI A;  1CDP A;  1NX1 A;  1XFX O;  3OB1 B;  1CKK A;  1YTZ C;  2KNE A;  1YRT B;  1SK6 D;  2KI4 C;  4HSZ A;  4OCI A;  3WHT B;  5B8I B;  1ZFS A;  1B8L A;  4WQ2 A;  2LM5 A;  5HKZ A;  1MHO A;  3A4U B;  4YI8 A;  4XJK B;  1UHH A;  3FWC A;  1W7I B;  1S6C A;  2NCP A;  3PLF B;  2LVK A;  1AUI B;  2H61 C;  4OVN F;  1YR5 A;  3VRO A;  3I5I B;  1PVA A;  1JF0 A;  1KQV A;  1AK8 A;  1W7J B;  1TCO B;  1PAL A;  2RGI A;  1XA5 A;  4GGF C;  1Y1X A;  2WC8 A;  1L2O C;  4YGA A;  1Y0V H;  4A4B A;  1B8R A;  2KFH A;  3KF9 A;  1AVS A;  4PHM A;  3SIA A;  1CB1 A;  1MXL C;  2BKI B;  2LMT A;  5DKR A;  5FYX A;  5J3X A;  1XFY O;  4MRX A;  3SG6 A;  3OX6 A;  3WHU B;  1XK4 C;  3DVM A;  5AFP A;  2I2R E;  2MLF C;  2JPT A;  2KFG A;  1UHJ A;  2F2P A;  1F55 A;  2NXQ A;  1XFU O;  3CZT X;  2L5X B;  5HLO A;  3F45 A;  1J7P A;  1SPY A;  2PAL A;  1BU3 A;  3FWB A;  1K9U A;  5HKY A;  3SG5 A;  2G2B A;  5D7F A;  1G4Y R;  5G08 A;  4MVF A;  5KSZ A;  4MBE A;  1Y1U A;  1EG3 A;  1N2D A;  2LMV A;  2LLS A;  3KEV A;  1DF0 B;  1SCV A;  1A2X A;  5AER A;  1C7V A;  1CM1 A;  4ICB A;  1CM4 A;  4JWQ A;  2M29 A;  1M39 A;  3KPX A;  2JNF A;  1DJH A;  2LLU A;  1B4C A;  1OMV A;  1CFF A;  2LMU A;  4IL1 A;  2F3Y A;  3NSK A;  1PRW A;  1UHI A;  1QS7 A;  5DKQ A;  2IS9 A;  1LIN A;  1MF8 B;  4CFR A;  2Q4U A;  2JNX A;  1F8H A;  2LAN A;  1QLS A;  1IWQ A;  1A75 A;  1KWO C;  4ETO A;  1CLL A;  1ZUZ A;  4NDD A;  1UHK A;  3TS5 C;  1REC A;  1UHN A;  3SJS A;  3C1V A;  1Y6W A;  2LP3 A;  4MEW A;  4CFQ A;  1CFD A;  1KFU S;  1U5I A;  5KTY A;  1CFP A;  2WCE A;  4CLN A;  4OV2 A;  1AJ4 A;  1XYD A;  1HQV A;  1FF1 A;  2CTN A;  3BXK A;  1BG1 A;  3AAK A;  1TN4 A;  1B9A A;  3RM1 A;  1SW8 A;  4N1F A;  1SY9 A;  1WLM A;  1QX7 A;  2KI6 C;  2KAY A;  2HQW A;  1K2H A;  1N65 A;  2JC2 A;  2LVV A;  3D0Y B;  4C0J A;  2ZN9 A;  2KDH A;  3PAT A;  3CS1 A;  2GV5 A;  3IQO A;  2JOJ A;  2AAO A;  1FW4 A;  3TUY B;  4C0L A;  1NX2 A;  3LLE A;  3LK0 A;  2KYF A;  1DJI A;  1OSA A;  1YVL A;  2KGB C;  3EK4 A;  3O78 A;  2KFF A;  1IQ3 A;  1B8C A;  2WCF A;  2BBN A;  1PK0 D;  1KK7 Z;  5HYD A;  2M49 B;  1PUL A;  3EVU A;  4MRY A;  2K7D A;  5I2L A;  1DT7 B;  1RK9 A;  1NCY A;  5DKN A;  1FPW A;  3JTD B;  2I7A A;  1IJ5 A;  1TNP A;  4F0Z B;  2JTT A;  2BCA A;  2OTG B;  1DJW A;  2Y1M A;  4MLW A;  1MXE A;  3CTN A;  3I5I C;  1CDL A;  1RFJ A;  1RWY A;  1DJZ A;  4PDZ A;  2LCP A;  4GUK A;  2NZ0 A;  1G8I A;  1EXR A;  2O60 A;  2CBL A;  4WRI A;  1SCM B;  1QVI Y;  3EKJ A;  1BR4 B;  1SRA A;  2L50 A;  1EH2 A;  1KFU L;  1NX3 A;  1BF5 A;  4OR9 B;  4BY5 A;  1K9P A;  2Y5I A;  1XO5 A;  1KK8 B;  1R6P A;  4I5L B;  2BKH B;  1ZOT B;  1C7W A;  2H2K A;  3O4Y A;  1SBJ A;  2OPO A;  2K2F A;  2Y4Q A;  3EVR A;  2ZNE A;  3CR2 A;  4ORA B;  1J7O A;  2KQY A;  1TNW A;  4WQ3 A;  5BPJ A;  1R2U A;  3TZ1 A;  4P5O E;  1QV1 A;  5GQQ C;  1S1E A;  4XYN A;  3GK2 A;  3SIB A;  3TDU A;  5F6T A;  1BJF A;  1SYM A;  3SG2 A;  3OP0 A;  1HT9 A;  4PE1 A;  2JT8 A;  1XFV O;  1E8A A;  1K93 D;  2ZKM X;  2SCP A;  3QRX A;  4I5K A;  1LA0 A;  1XFW O;  3WXA A;  4M2P A;  5HLV A;  1F54 A;  3OX5 A;  1K94 A;  1K9K A;  2LC5 A;  1JC2 A;  3BUN B;  2K8M B;  1S3P A;  4GBA A;  3FS7 A;  1SMG A;  1K8U A;  3JVT C;  1V1G A;  1MQ1 A;  1SL9 A;  2PSR A;  2ZFD A;  3CWG A;  1QV0 A;  2LV7 A;  2MRD A;  2R2I A;  5AAN A;  1A29 A;  2BL0 B;  1Q80 A;  1M45 A;  1EL4 A;  1BR1 B;  1ZAC A;  4YGB B;  4DRW A;  1J55 A;  2AUC A;  2KOT A;  2VRG A;  4QJ4 B;  1FI6 A;  2KAX A;  2CCM A;  3GK4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...