1J55A

The crystal structure of ca+-bound human s100p determined at 2.0a resolution by x-ray
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
88
Chain Sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure at 2A Resolution of the Ca2+-binding Protein S100P
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords S-100P PROTEIN
total genus 30
structure length 88
sequence length 94
ec nomenclature
pdb deposition date 2002-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j55A00
4MZJA 3QRXA 1ZACA 5D69A 3I5GB 4NDCA 1F55A 1Y6WA 2Y1MA 1LVCD 3EKJA 4JQ0D 3VRRA 1TTXA 2KFGA 3DVKA 5AFPA 2COLB 1XFUO 1XVJA 2LVIA 1EG3A 2KAXA 1JWDA 2DOQA 1BLQA 4I5LB 1JUOA 4PHNA 2Y5IA 2HETA 2GGZA 2H61A 4USLA 2WCFA 3VRPA 5CSIA 1GJYA 2JULA 3LK1A 5AANA 4FQOA 2CT9A 2HPSA 1JFKA 3PLFB 4E68A 1H4BA 1OMVA 2F8PA 2ZFDA 2G2BA 4OCIA 5AEQA 2IS9A 2WNDA 1E8AA 4GPLB 1KK7Z 1KQMB 1TNWA 2LVVA 5FYXA 2KAVA 1D1OA 5G08A 1MHOA 1SMGA 1OZOA 1M46A 1TIZA 1KFUL 1SW8A 2KQYA 3OB1B 2KOTA 1LKJA 4N5XA 1F71A 1K9PA 2K7BA 1K95A 5B8IB 1BF5A 2ZNDA 2BECA 1AP4A 5I8NA 5AXIA 3LLEA 1BOCA 5JJGA 1H8BA 3FWBA 1G8IA 2I94A 2KGBC 2OTGB 3A8RA 3BUWB 2KI6C 4ICBA 4DUQA 1F54A 1MXLC 3DF0B 4MN0A 3SIAA 5I2LA 1J7RA 1QXPA 3TUYB 1QASA 3TDIA 2BCBA 1DF0A 3CR5X 2BBNA 1K96A 2GV5A 1KK8C 1WRKA 1SR6B 5DKQA 1A03A 3BYAA 3CGAA 1UHKA 3PM8A 4WRIA 1FPWA 1FF1A 2JWWA 1K93D 3D0YA 4MZLA 1NSHA 2L98A 5DKRA 2E30A 3NSKA 1AJ5A 1XFYO 3DF0A 3IF7A 1JF0A 1S3PA 2BE4A 3I5FC 1N0YA 1NX3A 2ZRTA 4CIDA 1A2XA 1DMOA 2BL0B 2NCOA 4PE1A 3VRNA 3CR2A 1AJ4A 3HX4A 1JF2A 4HRHA 4MEWA 1ALVA 4MSPA 4MZKA 1CFCA 2B1UA 3SG3A 2L0PA 1KSOA 2EC6B 2LLSA 1IWQA 1WRZA 2ZKMX 3PALA 1OMDA 1CKKA 1SL7A 2F3YA 5CSNA 2D8NA 4YBHB 1S5GZ 2K0JA 2LLUA 1YUTA 4QJ5B 2JC2A 4PE4A 4PDZA 4A4BA 2L4IA 4P2YB 1S6CA 1QLKA 5HYDA 1W7IB 2LANA 1TNPA 1TRFA 1S36A 2LUXA 2M1KB 1QX2A 1XA5A 1EL4A 1GGWA 1KQVA 2LAPA 2CCMA 4GUKA 4IL1A 1V1FA 1MXEA 1Y1UA 3BUMB 2F3ZA 1UHHA 3FWCA 2FCDA 3EVVA 1B7TY 2KNEA 4C0JA 4GNKB 1UHNA 1KWOC 1MUXA 2KDHA 4PE0A 5HKWA 2HQ8A 3LK0A 4AQJA 2H2KA 2LP3A 1UWOA 4GGFA 1XYDA 1YRTB 5JOLA 2JPTA 1VRKA 3OX5A 1WRLA 2JTZA 1NX0A 3AKAA 4CPVA 1DJHA 2BCXA 4CFQA 2L4HA 1SCMC 1IRJA 2KBMA 1W7JB 2M0RA 3EVRA 4M2QA 2L51A 1S6IA 1CFPA 1YUUA 1M45A 1HQVA 1RJVA 1X02A 3I5FB 1SY9A 5I2OA 1YVHA 2JQ6A 4QJ3B 4XYNA 1NX2A 1CDLA 3GOFA 4YGEB 1B8LA 1XFWO 2CNPA 1J7QA 1NCZA 1GGZA 2KHNA 3BUOB 1WDCC 4C0KA 1QIWA 3I5HC 1B8RA 1SPYA 1A75B 1U5IA 4M2PA 3EKHA 1KFXL 1DJGA 2M3WA 1LA3A 2LMVA 3D10A 4HREE 1IG5A 2JXLA 1K9UA 4AOMA 1NPQA 1CNPA 3OX6A 3WHUB 2M97A 2K7DA 2JU0A 3M0WA 1Y0VH 2MBXA 3VGOA 2BKHB 2MAZA 1XFXO 2M49B 3JVTC 2JXCA 2WOSA 3AAJA 1OZSA 1QV1A 4YI9A 1BU3A 3BUXB 1NCYA 1B7TZ 1NUBA 1SKTA 4L9MA 1F4QA 4GBAA 5J3XA 3PATA 1QV0A 1QVIZ 1K9KA 3KEVA 1HT9A 4OKHA 1EG4A 2WCEA 2M9GA 3A4UB 5K89A 2LLTA 2HF5A 3MSEB 1N2DA 1IGVA 4GAOA 4YRUA 5DKNA 1FI6A 5BPJA 1DJZA 2FCEA 2K8MB 4I5NB 1A75A 1CDPA 1UHJA 2A4JA 1K2HA 2PASA 3EK7A 4DIRA 2JOJA 4BY5A 1ZFSA 1KFUS 3I5HB 1KCYA 2EGDA 1LXFC 1RTP1 4JWQA 3TDUA 4DCKA 2K7OA 1BG1A 4M2OA 3VRQA 1IH0A 1DTLA 4PALA 1SRAA 1SYMA 1B1GA 1YRUB 3KPXA 3TDZA 3DVMA 5AERA 3NXAA 2K7CA 5CSJA 3BQ3A 1YR5A 3FS7A 4PCWA 1RFJA 2PMYA 3AAKA 5KSZA 4YGDB 5ER5A 1KSMA 1IJ6A 1Y1AA 4BY4A 2MJWB 3C1VA 1TNXA 2KI4B 3ICBA 1EJ3A 1XFZO 1CTRA 2JT3A 1CDMA 3GK2A 4ORBB 4F0ZB 2JT8A 2OS8C 1L2OB 3I5IB 2PRUA 1YX8A 3NSIA 4GFTA 1NIWA 3LCPC 4PHKA 4MLWA 2I18A 4A4CA 5IBWA 2NZ0A 1PSBA 1QTXA 2I2RE 2WORA 2EC6C 2OS8B 1KWOB 4XJKA 2MLEC 3IQOA 2MRDA 1WDCB 3E3RA 2Q91A 3BXKA 2KI4C 2PVBA 4DRWA 2JNXA 1YX7A 2M1UA 1BMOA 3SG7A 1PK0D 3EK8A 2LUCA 1BR1B 2M8UA 1PULA 1ODBA 1RECA 3SG6A 1PVAA 2WCBA 3BUNB 2JNFA 4YGAA 1DVIA 1V1GA 3CLNA 2MA2A 3OHMB 1MWNA 2GGMA 2Y4QA 3NSLA 1MR8A 4N1GA 3TZ1A 4WQ2A 2L50A 2V53A 4DS7A 1IQ5A 4ZCUA 1DJWA 1ZUZA 1B9AA 4WQ3A 1CFDA 3FIAA 1KFXS 1OSAA 1QATA 1ZMZA 2AMIA 3RM1A 4R1EA 2MLFC 1RWYA 2CBLA 1IQ3A 4FTGA 4AQIA 2K2AA 4I5KA 1PALA 1B4CA 2PALA 5KU1A 5I2QA 1FW4A 2LM5A 2EHBA 2OTGC 4ORCB 1TNQA 1U5IB 1CLLA 2F2OA 1JSAA 1QX5B 2WC8A 2RGIA 1A4PA 4GGNA 2SCPA 3AKBA 4Q04A 1EXRA 2NXQA 3JTDB 1OMRA 2O5GA 2ZNEA 1DJXA 4N1FA 2L5XB 1K8UA 1DJIA 5HLOA 2KBIA 4I5JA 3JVTB 1J55A 1SR6C 4HRGA 1SCVA 2H61C 1ALWA 4U8DA 1S5GY 3RLZA 2BKIB 2LHIA 5CSFA 1LA0A 5ER4X 1A29A 1TCOB 2LE9B 3KF9A 2Q4UA 1WLMA 5GQQC 3BOWB 2JTTA 4PHJA 1C7VA 2K2FA 1F4OA 1L2OC 1RK9A 1R6PA 1J7OA 1TN4A 2L2EA 2NLNA 3ZWHA 1TCFA 2LNKA 1SBJA 1OOJA 5CPVA 3LL8B 2M7LA 3DVJA 1OE9B 1CDNA 4YGBB 4HSZA 1K94A 1XFVO 4UPGA 1ZOTB 4OR9B 5F6TA 1JBAA 1G4YR 5HKYA 2FJUB 2O60A 2Y1NA 1YTZC 2PSRA 1SL9A 1DJYA 1J7PA 1BODA 1FI5A 2HQWA 3SIBA 1PVBA 4P5OE 4ZCVA 3O6BA 2NCPA 1JC2A 4CLNA 3SG5A 3BOWA 2ISDA 3NSOA 1SCMB 1EH2A 2LVJA 2P6BB 2VRGA 5HKZA 1YURA 1R2UA 2KSPA 1KK8B 1NCXA 2KQ6A 1AK8A 2LMUA 2F2PA 2BBMA 2ZRSA 1CFFA 1M39A 3SG2A 4MBEA 1IKUA 1BJFA 2JT0A 1KQMC 3H4SE 1DGVA 3SG4A 3CR4X 3TUYC 3CZTX 1K90D 1B47A 1IJ5A 1N65A 3KO0A 3DVEA 2AUCA 3O2PA 3CTNA 3SJSA 1TOPA 1CM1A 2BE6A 3JTDC 1QVIY 1AUIB 1DT7B 2KYFA 4CFRA 5HLVA 3KHEA 2ZN8A 1S6JA 2LC5A 5KTYA 1QX7A 1UURA 2LVKA 2FOTA 2KFHA 2F33A 1MF8B 1WY9A 1OQPA 1WLZA 1QLSA 4ETOA 1L7ZA 2KYCA 2KGRA 1M31A 4QJ4B 1C07A 3GK4X 2K61A 1AHRA 3WNXB 1F70A 1SNLA 2QPTA 1AVSA 1QJTA 1BT6A 1M63B 1J1EA 1KK7Y 3O78A 3EVUA 3I5IC 3D0YB 3PSRA 2LV7A 4JPZB 4YI8A 1CLMA 3TS5B 2M7NA 1YVLA 1CMFA 1DF0B 1NP8A 4XJKB 4YGCB 5D7FA 2BL0C 1NX1A 3WHTB 2KAYA 1UP5A 4TNCA 1B8CA 3PN7C 5TNCA 3IQQA 2LHLA 1XO5A 2LP2A 1RROA 1NWDA 1S26D 3PN7B 3WXAA 3GK1A 1FBVA 4MVFA 4PHMA 3PFVA 1MQ1A 2KFFA 1S1EA 2R2IA 4GGFC 3TS5C 4NQGA 1DGUA 1BR4B 1Y1XA 3I5GC 1YUSA 1CLBA 4ORAB 2E6WA 3K21A 4OV2A 2JRFA 1XK4C 3VROA 4C0LA 2LMTA 1LINA 4NDDA 2BCAA 1UHIA 2CXJA 2I7AA 2MHHA 1SK6D 2OPOA 3EK4A 1QIVA 4MRYA 2QACA 2LCPA 2AAOA 5PALA 2JZIA 3DD4A 1UUSA 2G9BA 2KI6D 1C7WA 1QS7A 1PSRA 1CM4A 3CWGA 3OP0A 1CB1A 1F8HA 1JFJA 2SASA 1PRWA 1CMGA 4PE7A 1GQMA 4MRXA 4NDBA 3OB2B 1NYAA 1Q80A 3ZNIA 1J1DA 2ZN9A 4OVNF 1XK4A 3CS1A 1G33A 2TN4A 3F45A 3HCMA 4D1EA 1SL8A 2CTNA 3O4YA 2M29A
chains in the Genus database with same CATH superfamily
4MZJA 3QRXA 1ZACA 5D69A 3I5GB 4NDCA 1F55A 1Y6WA 2Y1MA 1LVCD 3EKJA 3NHIA 4JQ0D 3VRRA 5EL2A 1TTXA 2KFGA 3DVKA 1SSEB 5AFPA 2COLB 1XFUO 1XVJA 2LVIA 1EG3A 2KAXA 1JWDA 2DOQA 1BLQA 4I5LB 1XFRA 2PQLA 3V2LA 2WCKA 1JUOA 4PHNA 2Y5IA 2HETA 2GGZA 2H61A 4INXA 2WCFA 4USLA 3VRPA 5CSIA 1GJYA 2JULA 3LK1A 5AANA 4FQOA 2CT9A 2HPSA 1JFKA 2L5YA 3PLFB 4E68A 1H4BA 1OMVA 2F8PA 2ZFDA 2G2BA 4OCIA 5AEQA 2IS9A 2WNDA 1E8AA 4GPLB 1KK7Z 1KQMB 1TNWA 2LVVA 5FYXA 3UNWA 1DC1A 2KAVA 1D1OA 2WC6A 5G08A 1MHOA 1SMGA 1OZOA 1M46A 1TIZA 1KFUL 1SW8A 2KQYA 3OB1B 2KOTA 1LKJA 4N5XA 1F71A 1K9PA 3DZTA 2QEHA 2K7BA 1K95A 5B8IB 1BF5A 4OZDA 2ZNDA 3D74A 2BECA 1AP4A 5I8NA 5AXIA 3LLEA 1BOCA 5JJGA 3S0EA 1TUZA 1H8BA 3FWBA 2KLDA 1G8IA 2I94A 2KGBC 2OTGB 3A8RA 3BUWB 2KI6C 4ICBA 4DUQA 1F54A 1MXLC 3DF0B 4MN0A 3CYZA 3SIAA 5I2LA 1J7RA 1QXPA 5FI2A 3TUYB 1QASA 3TDIA 1DELA 1OOHA 2BCBA 2KLEA 1DEKA 1DF0A 3CR5X 2BBNA 3FE8A 2WCHA 1K96A 3PJIA 2GV5A 1KK8C 1WRKA 1SR6B 5DKQA 1A03A 3BYAA 3CGAA 3CZ2A 1UHKA 3PM8A 4WRIA 1QWVA 1FPWA 1FF1A 2JWWA 1K93D 3D0YA 4MZLA 1NSHA 2L98A 5DKRA 3S0FA 1Z4HA 2E30A 3S0BA 3NSKA 3S0AA 1AJ5A 1XFYO 3DF0A 3IF7A 1JF0A 1S3PA 2BE4A 3I5FC 1N0YA 1NX3A 2ZRTA 4CIDA 1A2XA 1DMOA 2BL0B 2NCOA 4PE1A 3VRNA 3FE6A 3CR2A 1AJ4A 3HX4A 1JF2A 4HRHA 4MEWA 1ALVA 4MSPA 4MZKA 1CFCA 2B1UA 3SG3A 2L0PA 1KSOA 2EC6B 2LLSA 1IWQA 1WRZA 2ZKMX 3PALA 1LS8A 1OMDA 4FQTA 1CKKA 1SL7A 2F3YA 5CSNA 2D8NA 4YBHB 1S5GZ 2K0JA 2LLUA 1YUTA 3PM2A 4QJ5B 2JC2A 4PE4A 4PDZA 4A4BA 3D75A 2L4IA 4P2YB 1S6CA 3FE9A 1QLKA 5HYDA 1OOIX 1W7IB 2LANA 1TNPA 1OW4A 1TRFA 1S36A 2LUXA 2M1KB 1QX2A 1XA5A 1EL4A 3L4LA 1GGWA 1KQVA 2LAPA 2CCMA 4GUKA 4IL1A 1V1FA 1MXEA 1Y1UA 3BUMB 2F3ZA 1UHHA 3FWCA 3VB1A 2FCDA 3L47A 3EVVA 1B7TY 2KNEA 4C0JA 4GNKB 3BJHA 1UHNA 1KWOC 1MUXA 2KDHA 4PE0A 5HKWA 2HQ8A 3LK0A 4AQJA 2FJYA 2H2KA 2QDIA 2LP3A 1UWOA 4GGFA 1XYDA 1YRTB 5JOLA 2JPTA 1VRKA 3OX5A 1WRLA 2JTZA 1NX0A 3AKAA 4CPVA 1DJHA 2BCXA 4CFQA 2L4HA 1SCMC 1IRJA 2KBMA 1W7JB 2M0RA 3EVRA 4M2QA 2L51A 1S6IA 1CFPA 1YUUA 1M45A 1HQVA 1RJVA 1X02A 3B88A 1SY9A 3I5FB 1YVHA 2JQ6A 4QJ3B 4XYNA 1NX2A 1CDLA 3GOFA 4YGEB 1B8LA 1XFWO 2CNPA 1J7QA 1NCZA 3BFBA 1GGZA 2KHNA 3BUOB 5DICA 1WDCC 4C0KA 1QIWA 3I5HC 1B8RA 1SPYA 1A75B 1U5IA 4M2PA 3RZSA 3EKHA 1KFXL 1DJGA 2M3WA 1LA3A 1ORGA 2JPOA 2LMVA 3D10A 4HREE 1IG5A 1TUJA 1K9UA 2JXLA 1NPQA 2L2CA 3OX6A 3WHUB 4AOMA 1CNPA 2M97A 2K7DA 2JU0A 3M0WA 1Y0VH 2MBXA 3VGOA 2BKHB 2MAZA 1XFXO 2M49B 3JVTC 2JXCA 2WOSA 1C3ZA 3AAJA 1W9ZA 1OZSA 1QV1A 4YI9A 1BU3A 3BUXB 1NCYA 1B7TZ 1NUBA 1SKTA 4L9MA 1F4QA 4GBAA 5I94A 5J3XA 2WCJA 1QV0A 3PATA 3CDNA 1QVIZ 1K9KA 3KEVA 1HT9A 4OKHA 1EG4A 2WCEA 2M9GA 3A4UB 5K89A 2LLTA 2HF5A 3MSEB 1N2DA 1IGVA 4GAOA 4INWA 5DKNA 4YRUA 1FI6A 5BPJA 1DJZA 2FCEA 2K8MB 4I5NB 1A75A 2ERBA 1CDPA 1UHJA 2A4JA 1C7VA 1K2HA 2PASA 3EK7A 4DIRA 2JOJA 4BY5A 1ZFSA 1KFUS 3I5HB 1KCYA 2EGDA 1LXFC 1RTP1 4JWQA 3TDUA 4DCKA 2K7OA 1BG1A 4M2OA 3VRQA 1IH0A 1DTLA 4PALA 1SRAA 1SYMA 1B1GA 1YRUB 3KPXA 3TDZA 3DVMA 5AERA 3NXAA 2K7CA 5CSJA 3BQ3A 1YR5A 3FS7A 4PCWA 1RFJA 3UO9A 2PMYA 3AAKA 5KSZA 4PT1A 4YGDB 3O4XA 1KSMA 1IJ6A 5ER5A 1Y1AA 4BY4A 2MJWB 3C1VA 1TNXA 2KI4B 3ICBA 1EJ3A 1XFZO 1CTRA 2JT3A 1CDMA 3EG5B 3GK2A 4ORBB 4F0ZB 3D76A 2JT8A 2OS8C 1L2OB 3I5IB 2PRUA 1YX8A 3NSIA 4GFTA 1NIWA 3LCPC 4PHKA 4MLWA 2I18A 4A4CA 5IBWA 2NZ0A 1PSBA 1QTXA 2I2RE 2WORA 2EC6C 2OS8B 1KWOB 4XJKA 2MLEC 3IQOA 2MRDA 1WDCB 3E3RA 2Q91A 3BXKA 3DXLA 2KI4C 1IIOA 2PVBA 4DRWA 2JNXA 2WCLA 3DY9A 1YX7A 2M1UA 1BMOA 3SG7A 1PK0D 3D78A 3EK8A 2LUCA 3Q8IA 1BR1B 2M8UA 1PULA 1ODBA 1RECA 3SG6A 1PVAA 2WCBA 3BUNB 2JNFA 4YGAA 1DVIA 3S0DA 1V1GA 3CLNA 2MA2A 3OHMB 1MWNA 2GGMA 2Y4QA 3NSLA 1MR8A 4N1GA 3TZ1A 2YGUA 4WQ2A 2L50A 2K60A 2V53A 4DS7A 1IQ5A 4ZCUA 1DJWA 1ZUZA 1B9AA 4WQ3A 1CFDA 3FIAA 1KFXS 1OSAA 1QATA 1ZMZA 2AMIA 2KPHA 4JKTA 3RM1A 4R1EA 3S0GA 2MLFC 1RWYA 2CBLA 3B7AA 1IQ3A 4FTGA 4AQIA 2K2AA 3SS3A 4I5KA 1PALA 1B4CA 2PALA 5KU1A 5I2QA 3B87A 1FW4A 2LM5A 2EHBA 2OTGC 2P70A 4ORCB 1TNQA 1U5IB 2WC5A 1CLLA 2F2OA 1JSAA 1QX5B 2WC8A 2RGIA 1A4PA 4GGNA 2SCPA 3AKBA 3SS5A 4Q04A 1EXRA 2H8VA 2NXQA 1OMRA 2O5GA 2ZNEA 3JTDB 1DJXA 4N1FA 2L5XB 1K8UA 1DJIA 5HLOA 2KBIA 4I5JA 3CZ0A 3JVTB 1J55A 1SR6C 4HRGA 1SCVA 2H61C 1ALWA 4U8DA 1S5GY 3RLZA 2BKIB 2LHIA 2BNXA 5CSFA 1LA0A 5ER4X 1A29A 1TCOB 2LE9B 3KF9A 2Q4UA 1WLMA 5GQQC 3BOWB 2JTTA 4PHJA 5HL1A 2K2FA 1F4OA 1L2OC 1RK9A 1R6PA 1J7OA 1TN4A 2L2EA 2NLNA 3ZWHA 1TCFA 2LNKA 1SBJA 3BFAA 1OOJA 5CPVA 3LL8B 2M7LA 3DVJA 1OE9B 1CDNA 2QEOA 4YGBB 4HSZA 3NGVA 1K94A 1XFVO 4UPGA 1ZOTB 4OR9B 5F6TA 1JBAA 1G4YR 5HKYA 2FJUB 2O60A 2Y1NA 1YTZC 3R1OA 2PSRA 1SL9A 1DJYA 3B86A 1J7PA 1BODA 1FI5A 2HQWA 3SIBA 1PVBA 4P5OE 4ZCVA 3O6BA 2NCPA 2QEVA 4CLNA 3SG5A 1JC2A 3BOWA 2ISDA 3NSOA 1SCMB 1EH2A 2LVJA 2P6BB 2VRGA 5HKZA 1YURA 1R2UA 3OGNA 2KSPA 1KK8B 1NCXA 2KQ6A 1AK8A 2LMUA 2F2PA 2BBMA 2ZRSA 1CFFA 1M39A 3SG2A 4MBEA 1IKUA 1BJFA 2JT0A 1KQMC 3H4SE 2P71A 1DGVA 3SG4A 3CR4X 3TUYC 3CZTX 1K90D 1B47A 1IJ5A 1N65A 2QEBA 1Z2CB 3KO0A 3L4AA 3QMEA 1C3YA 3DVEA 3K1EA 2AUCA 3CABA 3O2PA 3CTNA 4KYNA 3SJSA 1TOPA 1CM1A 2BE6A 3JTDC 1QVIY 1AUIB 1DT7B 2KYFA 4CFRA 5HLVA 3KHEA 3SS4A 2ZN8A 1S6JA 2LC5A 5KTYA 3R1PA 1QX7A 1UURA 2LVKA 2FOTA 2KFHA 2F33A 2WCMA 1MF8B 1WY9A 1OQPA 1WLZA 1QLSA 4ETOA 1GM0A 1L7ZA 2KYCA 2KGRA 1M31A 5D3OA 4QJ4B 1C07A 3GK4X 3N7HA 2K61A 3D77A 1AHRA 3WNXB 1F70A 1SNLA 2QPTA 3IVTA 1AVSA 1QJTA 1BT6A 1M63B 4F7FA 1TWOA 1J1EA 1KK7Y 3O78A 3EVUA 3I5IC 1OOGA 2GTEA 3D0YB 1P28A 3PSRA 2LV7A 4JPZB 4YI8A 1CLMA 3TS5B 2M7NA 1YVLA 1CMFA 1DF0B 1NP8A 4XJKB 3D73A 3BFHA 4YGCB 5D7FA 2BL0C 1NX1A 3CZ1A 3NHTA 2KAYA 1UP5A 4TNCA 1B8CA 3WHTB 3PN7C 5TNCA 3IQQA 2LHLA 1XO5A 2LP2A 1RROA 3OBVA 1NWDA 1S26D 3PN7B 3R1VA 3WXAA 3GK1A 1T14A 1FBVA 4MVFA 4PHMA 3PFVA 3R72A 1MQ1A 5FI7A 2KFFA 1S1EA 2R2IA 4GGFC 3TS5C 4NQGA 1DGUA 1BR4B 1Y1XA 3DYEA 3I5GC 4JD9A 1YUSA 4IJ7A 4ORAB 1CLBA 2E6WA 3K21A 4OV2A 2JRFA 1XK4C 2BAPA 3VROA 2LMTA 2PYQA 4C0LA 1DQEA 1LINA 4NDDA 5FI6A 2BCAA 1UHIA 2CXJA 2I7AA 2MHHA 1SK6D 2OPOA 3EK4A 1QIVA 4MRYA 2QACA 2LCPA 2AAOA 5PALA 2JZIA 1OOFA 3DD4A 1UUSA 2G9BA 2KI6D 1C7WA 1QS7A 1PSRA 1CM4A 3CWGA 3OP0A 5I2OA 1CB1A 1JFJA 1F8HA 2SASA 1PRWA 1CMGA 4PE7A 1GQMA 4MRXA 4NDBA 3OB2B 1NYAA 1Q80A 3ZNIA 3B6XA 1J1DA 2ZN9A 4OVNF 1XK4A 3CS1A 1G33A 2TN4A 3F45A 3HCMA 4D1EA 1SL8A 2CTNA 3O4YA 2M29A
chains in the Genus database with same CATH topology
4MZJA 3QRXA 1ZACA 5D69A 3I5GB 4NDCA 1F55A 1Y6WA 2Y1MA 1LVCD 3EKJA 4JQ0D 3VRRA 1TTXA 2KFGA 3DVKA 5AFPA 2COLB 1XFUO 1XVJA 2LVIA 1EG3A 2KAXA 1JWDA 2DOQA 1BLQA 4I5LB 1JUOA 4PHNA 2Y5IA 2HETA 2GGZA 2H61A 4USLA 2WCFA 3VRPA 5CSIA 1GJYA 2JULA 3LK1A 5AANA 4FQOA 2CT9A 2HPSA 1JFKA 3PLFB 4E68A 1H4BA 1OMVA 2F8PA 2ZFDA 2G2BA 4OCIA 5AEQA 2IS9A 2WNDA 1E8AA 4GPLB 1KK7Z 1KQMB 1TNWA 2LVVA 5FYXA 2KAVA 1D1OA 5G08A 1MHOA 1SMGA 1OZOA 1M46A 1TIZA 1KFUL 1SW8A 2KQYA 3OB1B 2KOTA 1LKJA 4N5XA 1F71A 1K9PA 2K7BA 1K95A 5B8IB 1BF5A 2ZNDA 2BECA 1AP4A 5I8NA 5AXIA 3LLEA 1BOCA 5JJGA 1H8BA 3FWBA 1G8IA 2I94A 2KGBC 2OTGB 3A8RA 3BUWB 2KI6C 4ICBA 4DUQA 1F54A 1MXLC 3DF0B 4MN0A 3SIAA 5I2LA 1J7RA 1QXPA 3TUYB 1QASA 3TDIA 2BCBA 1DF0A 3CR5X 2BBNA 1K96A 2GV5A 1KK8C 1WRKA 1SR6B 5DKQA 1A03A 3BYAA 3CGAA 1UHKA 3PM8A 4WRIA 1FPWA 1FF1A 2JWWA 1K93D 3D0YA 4MZLA 1NSHA 2L98A 5DKRA 2E30A 3NSKA 1AJ5A 1XFYO 3DF0A 3IF7A 1JF0A 1S3PA 2BE4A 3I5FC 1N0YA 1NX3A 2ZRTA 4CIDA 1A2XA 1DMOA 2BL0B 2NCOA 4PE1A 3VRNA 3CR2A 1AJ4A 3HX4A 1JF2A 4HRHA 4MEWA 1ALVA 4MSPA 4MZKA 1CFCA 2B1UA 3SG3A 2L0PA 1KSOA 2EC6B 2LLSA 1IWQA 1WRZA 2ZKMX 3PALA 1OMDA 1CKKA 1SL7A 2F3YA 5CSNA 2D8NA 4YBHB 1S5GZ 2K0JA 2LLUA 1YUTA 4QJ5B 2JC2A 4PE4A 4PDZA 4A4BA 2L4IA 4P2YB 1S6CA 1QLKA 5HYDA 1W7IB 2LANA 1TNPA 1TRFA 1S36A 2LUXA 2M1KB 1QX2A 1XA5A 1EL4A 1GGWA 1KQVA 2LAPA 2CCMA 4GUKA 4IL1A 1V1FA 1MXEA 1Y1UA 3BUMB 2F3ZA 1UHHA 3FWCA 2FCDA 3EVVA 1B7TY 2KNEA 4C0JA 4GNKB 1UHNA 1KWOC 1MUXA 2KDHA 4PE0A 5HKWA 2HQ8A 3LK0A 4AQJA 2H2KA 2LP3A 1UWOA 4GGFA 1XYDA 1YRTB 5JOLA 2JPTA 1VRKA 3OX5A 1WRLA 2JTZA 1NX0A 3AKAA 4CPVA 1DJHA 2BCXA 4CFQA 2L4HA 1SCMC 1IRJA 2KBMA 1W7JB 2M0RA 3EVRA 4M2QA 2L51A 1S6IA 1CFPA 1YUUA 1M45A 1HQVA 1RJVA 1X02A 3I5FB 1SY9A 5I2OA 1YVHA 2JQ6A 4QJ3B 4XYNA 1NX2A 1CDLA 3GOFA 4YGEB 1B8LA 1XFWO 2CNPA 1J7QA 1NCZA 1GGZA 2KHNA 3BUOB 1WDCC 4C0KA 1QIWA 3I5HC 1B8RA 1SPYA 1A75B 1U5IA 4M2PA 3EKHA 1KFXL 1DJGA 2M3WA 1LA3A 2LMVA 3D10A 4HREE 1IG5A 2JXLA 1K9UA 4AOMA 1NPQA 1CNPA 3OX6A 3WHUB 2M97A 2K7DA 2JU0A 3M0WA 1Y0VH 2MBXA 3VGOA 2BKHB 2MAZA 1XFXO 2M49B 3JVTC 2JXCA 2WOSA 3AAJA 1OZSA 1QV1A 4YI9A 1BU3A 3BUXB 1NCYA 1B7TZ 1NUBA 1SKTA 4L9MA 1F4QA 4GBAA 5J3XA 3PATA 1QV0A 1QVIZ 1K9KA 3KEVA 1HT9A 4OKHA 1EG4A 2WCEA 2M9GA 3A4UB 5K89A 2LLTA 2HF5A 3MSEB 1N2DA 1IGVA 4GAOA 4YRUA 5DKNA 1FI6A 5BPJA 1DJZA 2FCEA 2K8MB 4I5NB 1A75A 1CDPA 1UHJA 2A4JA 1K2HA 2PASA 3EK7A 4DIRA 2JOJA 4BY5A 1ZFSA 1KFUS 3I5HB 1KCYA 2EGDA 1LXFC 1RTP1 4JWQA 3TDUA 4DCKA 2K7OA 1BG1A 4M2OA 3VRQA 1IH0A 1DTLA 4PALA 1SRAA 1SYMA 1B1GA 1YRUB 3KPXA 3TDZA 3DVMA 5AERA 3NXAA 2K7CA 5CSJA 3BQ3A 1YR5A 3FS7A 4PCWA 1RFJA 2PMYA 3AAKA 5KSZA 4YGDB 5ER5A 1KSMA 1IJ6A 1Y1AA 4BY4A 2MJWB 3C1VA 1TNXA 2KI4B 3ICBA 1EJ3A 1XFZO 1CTRA 2JT3A 1CDMA 3GK2A 4ORBB 4F0ZB 2JT8A 2OS8C 1L2OB 3I5IB 2PRUA 1YX8A 3NSIA 4GFTA 1NIWA 3LCPC 4PHKA 4MLWA 2I18A 4A4CA 5IBWA 2NZ0A 1PSBA 1QTXA 2I2RE 2WORA 2EC6C 2OS8B 1KWOB 4XJKA 2MLEC 3IQOA 2MRDA 1WDCB 3E3RA 2Q91A 3BXKA 2KI4C 2PVBA 4DRWA 2JNXA 1YX7A 2M1UA 1BMOA 3SG7A 1PK0D 3EK8A 2LUCA 1BR1B 2M8UA 1PULA 1ODBA 1RECA 3SG6A 1PVAA 2WCBA 3BUNB 2JNFA 4YGAA 1DVIA 1V1GA 3CLNA 2MA2A 3OHMB 1MWNA 2GGMA 2Y4QA 3NSLA 1MR8A 4N1GA 3TZ1A 4WQ2A 2L50A 2V53A 4DS7A 1IQ5A 4ZCUA 1DJWA 1ZUZA 1B9AA 4WQ3A 1CFDA 3FIAA 1KFXS 1OSAA 1QATA 1ZMZA 2AMIA 3RM1A 4R1EA 2MLFC 1RWYA 2CBLA 1IQ3A 4FTGA 4AQIA 2K2AA 4I5KA 1PALA 1B4CA 2PALA 5KU1A 5I2QA 1FW4A 2LM5A 2EHBA 2OTGC 4ORCB 1TNQA 1U5IB 1CLLA 2F2OA 1JSAA 1QX5B 2WC8A 2RGIA 1A4PA 4GGNA 2SCPA 3AKBA 4Q04A 1EXRA 2NXQA 3JTDB 1OMRA 2O5GA 2ZNEA 1DJXA 4N1FA 2L5XB 1K8UA 1DJIA 5HLOA 2KBIA 4I5JA 3JVTB 1J55A 1SR6C 4HRGA 1SCVA 2H61C 1ALWA 4U8DA 1S5GY 3RLZA 2BKIB 2LHIA 5CSFA 1LA0A 5ER4X 1A29A 1TCOB 2LE9B 3KF9A 2Q4UA 1WLMA 5GQQC 3BOWB 2JTTA 4PHJA 1C7VA 2K2FA 1F4OA 1L2OC 1RK9A 1R6PA 1J7OA 1TN4A 2L2EA 2NLNA 3ZWHA 1TCFA 2LNKA 1SBJA 1OOJA 5CPVA 3LL8B 2M7LA 3DVJA 1OE9B 1CDNA 4YGBB 4HSZA 1K94A 1XFVO 4UPGA 1ZOTB 4OR9B 5F6TA 1JBAA 1G4YR 5HKYA 2FJUB 2O60A 2Y1NA 1YTZC 2PSRA 1SL9A 1DJYA 1J7PA 1BODA 1FI5A 2HQWA 3SIBA 1PVBA 4P5OE 4ZCVA 3O6BA 2NCPA 1JC2A 4CLNA 3SG5A 3BOWA 2ISDA 3NSOA 1SCMB 1EH2A 2LVJA 2P6BB 2VRGA 5HKZA 1YURA 1R2UA 2KSPA 1KK8B 1NCXA 2KQ6A 1AK8A 2LMUA 2F2PA 2BBMA 2ZRSA 1CFFA 1M39A 3SG2A 4MBEA 1IKUA 1BJFA 2JT0A 1KQMC 3H4SE 1DGVA 3SG4A 3CR4X 3TUYC 3CZTX 1K90D 1B47A 1IJ5A 1N65A 3KO0A 3DVEA 2AUCA 3O2PA 3CTNA 3SJSA 1TOPA 1CM1A 2BE6A 3JTDC 1QVIY 1AUIB 1DT7B 2KYFA 4CFRA 5HLVA 3KHEA 2ZN8A 1S6JA 2LC5A 5KTYA 1QX7A 1UURA 2LVKA 2FOTA 2KFHA 2F33A 1MF8B 1WY9A 1OQPA 1WLZA 1QLSA 4ETOA 1L7ZA 2KYCA 2KGRA 1M31A 4QJ4B 1C07A 3GK4X 2K61A 1AHRA 3WNXB 1F70A 1SNLA 2QPTA 1AVSA 1QJTA 1BT6A 1M63B 1J1EA 1KK7Y 3O78A 3EVUA 3I5IC 3D0YB 3PSRA 2LV7A 4JPZB 4YI8A 1CLMA 3TS5B 2M7NA 1YVLA 1CMFA 1DF0B 1NP8A 4XJKB 4YGCB 5D7FA 2BL0C 1NX1A 3WHTB 2KAYA 1UP5A 4TNCA 1B8CA 3PN7C 5TNCA 3IQQA 2LHLA 1XO5A 2LP2A 1RROA 1NWDA 1S26D 3PN7B 3WXAA 3GK1A 1FBVA 4MVFA 4PHMA 3PFVA 1MQ1A 2KFFA 1S1EA 2R2IA 4GGFC 3TS5C 4NQGA 1DGUA 1BR4B 1Y1XA 3I5GC 1YUSA 1CLBA 4ORAB 2E6WA 3K21A 4OV2A 2JRFA 1XK4C 3VROA 4C0LA 2LMTA 1LINA 4NDDA 2BCAA 1UHIA 2CXJA 2I7AA 2MHHA 1SK6D 2OPOA 3EK4A 1QIVA 4MRYA 2QACA 2LCPA 2AAOA 5PALA 2JZIA 3DD4A 1UUSA 2G9BA 2KI6D 1C7WA 1QS7A 1PSRA 1CM4A 3CWGA 3OP0A 1CB1A 1F8HA 1JFJA 2SASA 1PRWA 1CMGA 4PE7A 1GQMA 4MRXA 4NDBA 3OB2B 1NYAA 1Q80A 3ZNIA 1J1DA 2ZN9A 4OVNF 1XK4A 3CS1A 1G33A 2TN4A 3F45A 3HCMA 4D1EA 1SL8A 2CTNA 3O4YA 2M29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZJ A;  3QRX A;  1ZAC A;  5D69 A;  3I5G B;  4NDC A;  1F55 A;  1Y6W A;  2Y1M A;  1LVC D;  3EKJ A;  4JQ0 D;  3VRR A;  1TTX A;  2KFG A;  3DVK A;  5AFP A;  2COL B;  1XFU O;  1XVJ A;  2LVI A;  1EG3 A;  2KAX A;  1JWD A;  2DOQ A;  1BLQ A;  4I5L B;  1JUO A;  4PHN A;  2Y5I A;  2HET A;  2GGZ A;  2H61 A;  4USL A;  2WCF A;  3VRP A;  5CSI A;  1GJY A;  2JUL A;  3LK1 A;  5AAN A;  4FQO A;  2CT9 A;  2HPS A;  1JFK A;  3PLF B;  4E68 A;  1H4B A;  1OMV A;  2F8P A;  2ZFD A;  2G2B A;  4OCI A;  5AEQ A;  2IS9 A;  2WND A;  1E8A A;  4GPL B;  1KK7 Z;  1KQM B;  1TNW A;  2LVV A;  5FYX A;  2KAV A;  1D1O A;  5G08 A;  1MHO A;  1SMG A;  1OZO A;  1M46 A;  1TIZ A;  1KFU L;  1SW8 A;  2KQY A;  3OB1 B;  2KOT A;  1LKJ A;  4N5X A;  1F71 A;  1K9P A;  2K7B A;  1K95 A;  5B8I B;  1BF5 A;  2ZND A;  2BEC A;  1AP4 A;  5I8N A;  5AXI A;  3LLE A;  1BOC A;  5JJG A;  1H8B A;  3FWB A;  1G8I A;  2I94 A;  2KGB C;  2OTG B;  3A8R A;  3BUW B;  2KI6 C;  4ICB A;  4DUQ A;  1F54 A;  1MXL C;  3DF0 B;  4MN0 A;  3SIA A;  5I2L A;  1J7R A;  1QXP A;  3TUY B;  1QAS A;  3TDI A;  2BCB A;  1DF0 A;  3CR5 X;  2BBN A;  1K96 A;  2GV5 A;  1KK8 C;  1WRK A;  1SR6 B;  5DKQ A;  1A03 A;  3BYA A;  3CGA A;  1UHK A;  3PM8 A;  4WRI A;  1FPW A;  1FF1 A;  2JWW A;  1K93 D;  3D0Y A;  4MZL A;  1NSH A;  2L98 A;  5DKR A;  2E30 A;  3NSK A;  1AJ5 A;  1XFY O;  3DF0 A;  3IF7 A;  1JF0 A;  1S3P A;  2BE4 A;  3I5F C;  1N0Y A;  1NX3 A;  2ZRT A;  4CID A;  1A2X A;  1DMO A;  2BL0 B;  2NCO A;  4PE1 A;  3VRN A;  3CR2 A;  1AJ4 A;  3HX4 A;  1JF2 A;  4HRH A;  4MEW A;  1ALV A;  4MSP A;  4MZK A;  1CFC A;  2B1U A;  3SG3 A;  2L0P A;  1KSO A;  2EC6 B;  2LLS A;  1IWQ A;  1WRZ A;  2ZKM X;  3PAL A;  1OMD A;  1CKK A;  1SL7 A;  2F3Y A;  5CSN A;  2D8N A;  4YBH B;  1S5G Z;  2K0J A;  2LLU A;  1YUT A;  4QJ5 B;  2JC2 A;  4PE4 A;  4PDZ A;  4A4B A;  2L4I A;  4P2Y B;  1S6C A;  1QLK A;  5HYD A;  1W7I B;  2LAN A;  1TNP A;  1TRF A;  1S36 A;  2LUX A;  2M1K B;  1QX2 A;  1XA5 A;  1EL4 A;  1GGW A;  1KQV A;  2LAP A;  2CCM A;  4GUK A;  4IL1 A;  1V1F A;  1MXE A;  1Y1U A;  3BUM B;  2F3Z A;  1UHH A;  3FWC A;  2FCD A;  3EVV A;  1B7T Y;  2KNE A;  4C0J A;  4GNK B;  1UHN A;  1KWO C;  1MUX A;  2KDH A;  4PE0 A;  5HKW A;  2HQ8 A;  3LK0 A;  4AQJ A;  2H2K A;  2LP3 A;  1UWO A;  4GGF A;  1XYD A;  1YRT B;  5JOL A;  2JPT A;  1VRK A;  3OX5 A;  1WRL A;  2JTZ A;  1NX0 A;  3AKA A;  4CPV A;  1DJH A;  2BCX A;  4CFQ A;  2L4H A;  1SCM C;  1IRJ A;  2KBM A;  1W7J B;  2M0R A;  3EVR A;  4M2Q A;  2L51 A;  1S6I A;  1CFP A;  1YUU A;  1M45 A;  1HQV A;  1RJV A;  1X02 A;  3I5F B;  1SY9 A;  5I2O A;  1YVH A;  2JQ6 A;  4QJ3 B;  4XYN A;  1NX2 A;  1CDL A;  3GOF A;  4YGE B;  1B8L A;  1XFW O;  2CNP A;  1J7Q A;  1NCZ A;  1GGZ A;  2KHN A;  3BUO B;  1WDC C;  4C0K A;  1QIW A;  3I5H C;  1B8R A;  1SPY A;  1A75 B;  1U5I A;  4M2P A;  3EKH A;  1KFX L;  1DJG A;  2M3W A;  1LA3 A;  2LMV A;  3D10 A;  4HRE E;  1IG5 A;  2JXL A;  1K9U A;  4AOM A;  1NPQ A;  1CNP A;  3OX6 A;  3WHU B;  2M97 A;  2K7D A;  2JU0 A;  3M0W A;  1Y0V H;  2MBX A;  3VGO A;  2BKH B;  2MAZ A;  1XFX O;  2M49 B;  3JVT C;  2JXC A;  2WOS A;  3AAJ A;  1OZS A;  1QV1 A;  4YI9 A;  1BU3 A;  3BUX B;  1NCY A;  1B7T Z;  1NUB A;  1SKT A;  4L9M A;  1F4Q A;  4GBA A;  5J3X A;  3PAT A;  1QV0 A;  1QVI Z;  1K9K A;  3KEV A;  1HT9 A;  4OKH A;  1EG4 A;  2WCE A;  2M9G A;  3A4U B;  5K89 A;  2LLT A;  2HF5 A;  3MSE B;  1N2D A;  1IGV A;  4GAO A;  4YRU A;  5DKN A;  1FI6 A;  5BPJ A;  1DJZ A;  2FCE A;  2K8M B;  4I5N B;  1A75 A;  1CDP A;  1UHJ A;  2A4J A;  1K2H A;  2PAS A;  3EK7 A;  4DIR A;  2JOJ A;  4BY5 A;  1ZFS A;  1KFU S;  3I5H B;  1KCY A;  2EGD A;  1LXF C;  1RTP 1;  4JWQ A;  3TDU A;  4DCK A;  2K7O A;  1BG1 A;  4M2O A;  3VRQ A;  1IH0 A;  1DTL A;  4PAL A;  1SRA A;  1SYM A;  1B1G A;  1YRU B;  3KPX A;  3TDZ A;  3DVM A;  5AER A;  3NXA A;  2K7C A;  5CSJ A;  3BQ3 A;  1YR5 A;  3FS7 A;  4PCW A;  1RFJ A;  2PMY A;  3AAK A;  5KSZ A;  4YGD B;  5ER5 A;  1KSM A;  1IJ6 A;  1Y1A A;  4BY4 A;  2MJW B;  3C1V A;  1TNX A;  2KI4 B;  3ICB A;  1EJ3 A;  1XFZ O;  1CTR A;  2JT3 A;  1CDM A;  3GK2 A;  4ORB B;  4F0Z B;  2JT8 A;  2OS8 C;  1L2O B;  3I5I B;  2PRU A;  1YX8 A;  3NSI A;  4GFT A;  1NIW A;  3LCP C;  4PHK A;  4MLW A;  2I18 A;  4A4C A;  5IBW A;  2NZ0 A;  1PSB A;  1QTX A;  2I2R E;  2WOR A;  2EC6 C;  2OS8 B;  1KWO B;  4XJK A;  2MLE C;  3IQO A;  2MRD A;  1WDC B;  3E3R A;  2Q91 A;  3BXK A;  2KI4 C;  2PVB A;  4DRW A;  2JNX A;  1YX7 A;  2M1U A;  1BMO A;  3SG7 A;  1PK0 D;  3EK8 A;  2LUC A;  1BR1 B;  2M8U A;  1PUL A;  1ODB A;  1REC A;  3SG6 A;  1PVA A;  2WCB A;  3BUN B;  2JNF A;  4YGA A;  1DVI A;  1V1G A;  3CLN A;  2MA2 A;  3OHM B;  1MWN A;  2GGM A;  2Y4Q A;  3NSL A;  1MR8 A;  4N1G A;  3TZ1 A;  4WQ2 A;  2L50 A;  2V53 A;  4DS7 A;  1IQ5 A;  4ZCU A;  1DJW A;  1ZUZ A;  1B9A A;  4WQ3 A;  1CFD A;  3FIA A;  1KFX S;  1OSA A;  1QAT A;  1ZMZ A;  2AMI A;  3RM1 A;  4R1E A;  2MLF C;  1RWY A;  2CBL A;  1IQ3 A;  4FTG A;  4AQI A;  2K2A A;  4I5K A;  1PAL A;  1B4C A;  2PAL A;  5KU1 A;  5I2Q A;  1FW4 A;  2LM5 A;  2EHB A;  2OTG C;  4ORC B;  1TNQ A;  1U5I B;  1CLL A;  2F2O A;  1JSA A;  1QX5 B;  2WC8 A;  2RGI A;  1A4P A;  4GGN A;  2SCP A;  3AKB A;  4Q04 A;  1EXR A;  2NXQ A;  3JTD B;  1OMR A;  2O5G A;  2ZNE A;  1DJX A;  4N1F A;  2L5X B;  1K8U A;  1DJI A;  5HLO A;  2KBI A;  4I5J A;  3JVT B;  1J55 A;  1SR6 C;  4HRG A;  1SCV A;  2H61 C;  1ALW A;  4U8D A;  1S5G Y;  3RLZ A;  2BKI B;  2LHI A;  5CSF A;  1LA0 A;  5ER4 X;  1A29 A;  1TCO B;  2LE9 B;  3KF9 A;  2Q4U A;  1WLM A;  5GQQ C;  3BOW B;  2JTT A;  4PHJ A;  1C7V A;  2K2F A;  1F4O A;  1L2O C;  1RK9 A;  1R6P A;  1J7O A;  1TN4 A;  2L2E A;  2NLN A;  3ZWH A;  1TCF A;  2LNK A;  1SBJ A;  1OOJ A;  5CPV A;  3LL8 B;  2M7L A;  3DVJ A;  1OE9 B;  1CDN A;  4YGB B;  4HSZ A;  1K94 A;  1XFV O;  4UPG A;  1ZOT B;  4OR9 B;  5F6T A;  1JBA A;  1G4Y R;  5HKY A;  2FJU B;  2O60 A;  2Y1N A;  1YTZ C;  2PSR A;  1SL9 A;  1DJY A;  1J7P A;  1BOD A;  1FI5 A;  2HQW A;  3SIB A;  1PVB A;  4P5O E;  4ZCV A;  3O6B A;  2NCP A;  1JC2 A;  4CLN A;  3SG5 A;  3BOW A;  2ISD A;  3NSO A;  1SCM B;  1EH2 A;  2LVJ A;  2P6B B;  2VRG A;  5HKZ A;  1YUR A;  1R2U A;  2KSP A;  1KK8 B;  1NCX A;  2KQ6 A;  1AK8 A;  2LMU A;  2F2P A;  2BBM A;  2ZRS A;  1CFF A;  1M39 A;  3SG2 A;  4MBE A;  1IKU A;  1BJF A;  2JT0 A;  1KQM C;  3H4S E;  1DGV A;  3SG4 A;  3CR4 X;  3TUY C;  3CZT X;  1K90 D;  1B47 A;  1IJ5 A;  1N65 A;  3KO0 A;  3DVE A;  2AUC A;  3O2P A;  3CTN A;  3SJS A;  1TOP A;  1CM1 A;  2BE6 A;  3JTD C;  1QVI Y;  1AUI B;  1DT7 B;  2KYF A;  4CFR A;  5HLV A;  3KHE A;  2ZN8 A;  1S6J A;  2LC5 A;  5KTY A;  1QX7 A;  1UUR A;  2LVK A;  2FOT A;  2KFH A;  2F33 A;  1MF8 B;  1WY9 A;  1OQP A;  1WLZ A;  1QLS A;  4ETO A;  1L7Z A;  2KYC A;  2KGR A;  1M31 A;  4QJ4 B;  1C07 A;  3GK4 X;  2K61 A;  1AHR A;  3WNX B;  1F70 A;  1SNL A;  2QPT A;  1AVS A;  1QJT A;  1BT6 A;  1M63 B;  1J1E A;  1KK7 Y;  3O78 A;  3EVU A;  3I5I C;  3D0Y B;  3PSR A;  2LV7 A;  4JPZ B;  4YI8 A;  1CLM A;  3TS5 B;  2M7N A;  1YVL A;  1CMF A;  1DF0 B;  1NP8 A;  4XJK B;  4YGC B;  5D7F A;  2BL0 C;  1NX1 A;  3WHT B;  2KAY A;  1UP5 A;  4TNC A;  1B8C A;  3PN7 C;  5TNC A;  3IQQ A;  2LHL A;  1XO5 A;  2LP2 A;  1RRO A;  1NWD A;  1S26 D;  3PN7 B;  3WXA A;  3GK1 A;  1FBV A;  4MVF A;  4PHM A;  3PFV A;  1MQ1 A;  2KFF A;  1S1E A;  2R2I A;  4GGF C;  3TS5 C;  4NQG A;  1DGU A;  1BR4 B;  1Y1X A;  3I5G C;  1YUS A;  1CLB A;  4ORA B;  2E6W A;  3K21 A;  4OV2 A;  2JRF A;  1XK4 C;  3VRO A;  4C0L A;  2LMT A;  1LIN A;  4NDD A;  2BCA A;  1UHI A;  2CXJ A;  2I7A A;  2MHH A;  1SK6 D;  2OPO A;  3EK4 A;  1QIV A;  4MRY A;  2QAC A;  2LCP A;  2AAO A;  5PAL A;  2JZI A;  3DD4 A;  1UUS A;  2G9B A;  2KI6 D;  1C7W A;  1QS7 A;  1PSR A;  1CM4 A;  3CWG A;  3OP0 A;  1CB1 A;  1F8H A;  1JFJ A;  2SAS A;  1PRW A;  1CMG A;  4PE7 A;  1GQM A;  4MRX A;  4NDB A;  3OB2 B;  1NYA A;  1Q80 A;  3ZNI A;  1J1D A;  2ZN9 A;  4OVN F;  1XK4 A;  3CS1 A;  1G33 A;  2TN4 A;  3F45 A;  3HCM A;  4D1E A;  1SL8 A;  2CTN A;  3O4Y A;  2M29 A; 
#chains in the Genus database with same CATH topology
 4MZJ A;  3QRX A;  1ZAC A;  5D69 A;  3I5G B;  4NDC A;  1F55 A;  1Y6W A;  2Y1M A;  1LVC D;  3EKJ A;  3NHI A;  4JQ0 D;  3VRR A;  5EL2 A;  1TTX A;  2KFG A;  3DVK A;  1SSE B;  5AFP A;  2COL B;  1XFU O;  1XVJ A;  2LVI A;  1EG3 A;  2KAX A;  1JWD A;  2DOQ A;  1BLQ A;  4I5L B;  1XFR A;  2PQL A;  3V2L A;  2WCK A;  1JUO A;  4PHN A;  2Y5I A;  2HET A;  2GGZ A;  2H61 A;  4INX A;  2WCF A;  4USL A;  3VRP A;  5CSI A;  1GJY A;  2JUL A;  3LK1 A;  5AAN A;  4FQO A;  2CT9 A;  2HPS A;  1JFK A;  2L5Y A;  3PLF B;  4E68 A;  1H4B A;  1OMV A;  2F8P A;  2ZFD A;  2G2B A;  4OCI A;  5AEQ A;  2IS9 A;  2WND A;  1E8A A;  4GPL B;  1KK7 Z;  1KQM B;  1TNW A;  2LVV A;  5FYX A;  3UNW A;  1DC1 A;  2KAV A;  1D1O A;  2WC6 A;  5G08 A;  1MHO A;  1SMG A;  1OZO A;  1M46 A;  1TIZ A;  1KFU L;  1SW8 A;  2KQY A;  3OB1 B;  2KOT A;  1LKJ A;  4N5X A;  1F71 A;  1K9P A;  3DZT A;  2QEH A;  2K7B A;  1K95 A;  5B8I B;  1BF5 A;  4OZD A;  2ZND A;  3D74 A;  2BEC A;  1AP4 A;  5I8N A;  5AXI A;  3LLE A;  1BOC A;  5JJG A;  3S0E A;  1TUZ A;  1H8B A;  3FWB A;  2KLD A;  1G8I A;  2I94 A;  2KGB C;  2OTG B;  3A8R A;  3BUW B;  2KI6 C;  4ICB A;  4DUQ A;  1F54 A;  1MXL C;  3DF0 B;  4MN0 A;  3CYZ A;  3SIA A;  5I2L A;  1J7R A;  1QXP A;  5FI2 A;  3TUY B;  1QAS A;  3TDI A;  1DEL A;  1OOH A;  2BCB A;  2KLE A;  1DEK A;  1DF0 A;  3CR5 X;  2BBN A;  3FE8 A;  2WCH A;  1K96 A;  3PJI A;  2GV5 A;  1KK8 C;  1WRK A;  1SR6 B;  5DKQ A;  1A03 A;  3BYA A;  3CGA A;  3CZ2 A;  1UHK A;  3PM8 A;  4WRI A;  1QWV A;  1FPW A;  1FF1 A;  2JWW A;  1K93 D;  3D0Y A;  4MZL A;  1NSH A;  2L98 A;  5DKR A;  3S0F A;  1Z4H A;  2E30 A;  3S0B A;  3NSK A;  3S0A A;  1AJ5 A;  1XFY O;  3DF0 A;  3IF7 A;  1JF0 A;  1S3P A;  2BE4 A;  3I5F C;  1N0Y A;  1NX3 A;  2ZRT A;  4CID A;  1A2X A;  1DMO A;  2BL0 B;  2NCO A;  4PE1 A;  3VRN A;  3FE6 A;  3CR2 A;  1AJ4 A;  3HX4 A;  1JF2 A;  4HRH A;  4MEW A;  1ALV A;  4MSP A;  4MZK A;  1CFC A;  2B1U A;  3SG3 A;  2L0P A;  1KSO A;  2EC6 B;  2LLS A;  1IWQ A;  1WRZ A;  2ZKM X;  3PAL A;  1LS8 A;  1OMD A;  4FQT A;  1CKK A;  1SL7 A;  2F3Y A;  5CSN A;  2D8N A;  4YBH B;  1S5G Z;  2K0J A;  2LLU A;  1YUT A;  3PM2 A;  4QJ5 B;  2JC2 A;  4PE4 A;  4PDZ A;  4A4B A;  3D75 A;  2L4I A;  4P2Y B;  1S6C A;  3FE9 A;  1QLK A;  5HYD A;  1OOI X;  1W7I B;  2LAN A;  1TNP A;  1OW4 A;  1TRF A;  1S36 A;  2LUX A;  2M1K B;  1QX2 A;  1XA5 A;  1EL4 A;  3L4L A;  1GGW A;  1KQV A;  2LAP A;  2CCM A;  4GUK A;  4IL1 A;  1V1F A;  1MXE A;  1Y1U A;  3BUM B;  2F3Z A;  1UHH A;  3FWC A;  3VB1 A;  2FCD A;  3L47 A;  3EVV A;  1B7T Y;  2KNE A;  4C0J A;  4GNK B;  3BJH A;  1UHN A;  1KWO C;  1MUX A;  2KDH A;  4PE0 A;  5HKW A;  2HQ8 A;  3LK0 A;  4AQJ A;  2FJY A;  2H2K A;  2QDI A;  2LP3 A;  1UWO A;  4GGF A;  1XYD A;  1YRT B;  5JOL A;  2JPT A;  1VRK A;  3OX5 A;  1WRL A;  2JTZ A;  1NX0 A;  3AKA A;  4CPV A;  1DJH A;  2BCX A;  4CFQ A;  2L4H A;  1SCM C;  1IRJ A;  2KBM A;  1W7J B;  2M0R A;  3EVR A;  4M2Q A;  2L51 A;  1S6I A;  1CFP A;  1YUU A;  1M45 A;  1HQV A;  1RJV A;  1X02 A;  3B88 A;  1SY9 A;  3I5F B;  1YVH A;  2JQ6 A;  4QJ3 B;  4XYN A;  1NX2 A;  1CDL A;  3GOF A;  4YGE B;  1B8L A;  1XFW O;  2CNP A;  1J7Q A;  1NCZ A;  3BFB A;  1GGZ A;  2KHN A;  3BUO B;  5DIC A;  1WDC C;  4C0K A;  1QIW A;  3I5H C;  1B8R A;  1SPY A;  1A75 B;  1U5I A;  4M2P A;  3RZS A;  3EKH A;  1KFX L;  1DJG A;  2M3W A;  1LA3 A;  1ORG A;  2JPO A;  2LMV A;  3D10 A;  4HRE E;  1IG5 A;  1TUJ A;  1K9U A;  2JXL A;  1NPQ A;  2L2C A;  3OX6 A;  3WHU B;  4AOM A;  1CNP A;  2M97 A;  2K7D A;  2JU0 A;  3M0W A;  1Y0V H;  2MBX A;  3VGO A;  2BKH B;  2MAZ A;  1XFX O;  2M49 B;  3JVT C;  2JXC A;  2WOS A;  1C3Z A;  3AAJ A;  1W9Z A;  1OZS A;  1QV1 A;  4YI9 A;  1BU3 A;  3BUX B;  1NCY A;  1B7T Z;  1NUB A;  1SKT A;  4L9M A;  1F4Q A;  4GBA A;  5I94 A;  5J3X A;  2WCJ A;  1QV0 A;  3PAT A;  3CDN A;  1QVI Z;  1K9K A;  3KEV A;  1HT9 A;  4OKH A;  1EG4 A;  2WCE A;  2M9G A;  3A4U B;  5K89 A;  2LLT A;  2HF5 A;  3MSE B;  1N2D A;  1IGV A;  4GAO A;  4INW A;  5DKN A;  4YRU A;  1FI6 A;  5BPJ A;  1DJZ A;  2FCE A;  2K8M B;  4I5N B;  1A75 A;  2ERB A;  1CDP A;  1UHJ A;  2A4J A;  1C7V A;  1K2H A;  2PAS A;  3EK7 A;  4DIR A;  2JOJ A;  4BY5 A;  1ZFS A;  1KFU S;  3I5H B;  1KCY A;  2EGD A;  1LXF C;  1RTP 1;  4JWQ A;  3TDU A;  4DCK A;  2K7O A;  1BG1 A;  4M2O A;  3VRQ A;  1IH0 A;  1DTL A;  4PAL A;  1SRA A;  1SYM A;  1B1G A;  1YRU B;  3KPX A;  3TDZ A;  3DVM A;  5AER A;  3NXA A;  2K7C A;  5CSJ A;  3BQ3 A;  1YR5 A;  3FS7 A;  4PCW A;  1RFJ A;  3UO9 A;  2PMY A;  3AAK A;  5KSZ A;  4PT1 A;  4YGD B;  3O4X A;  1KSM A;  1IJ6 A;  5ER5 A;  1Y1A A;  4BY4 A;  2MJW B;  3C1V A;  1TNX A;  2KI4 B;  3ICB A;  1EJ3 A;  1XFZ O;  1CTR A;  2JT3 A;  1CDM A;  3EG5 B;  3GK2 A;  4ORB B;  4F0Z B;  3D76 A;  2JT8 A;  2OS8 C;  1L2O B;  3I5I B;  2PRU A;  1YX8 A;  3NSI A;  4GFT A;  1NIW A;  3LCP C;  4PHK A;  4MLW A;  2I18 A;  4A4C A;  5IBW A;  2NZ0 A;  1PSB A;  1QTX A;  2I2R E;  2WOR A;  2EC6 C;  2OS8 B;  1KWO B;  4XJK A;  2MLE C;  3IQO A;  2MRD A;  1WDC B;  3E3R A;  2Q91 A;  3BXK A;  3DXL A;  2KI4 C;  1IIO A;  2PVB A;  4DRW A;  2JNX A;  2WCL A;  3DY9 A;  1YX7 A;  2M1U A;  1BMO A;  3SG7 A;  1PK0 D;  3D78 A;  3EK8 A;  2LUC A;  3Q8I A;  1BR1 B;  2M8U A;  1PUL A;  1ODB A;  1REC A;  3SG6 A;  1PVA A;  2WCB A;  3BUN B;  2JNF A;  4YGA A;  1DVI A;  3S0D A;  1V1G A;  3CLN A;  2MA2 A;  3OHM B;  1MWN A;  2GGM A;  2Y4Q A;  3NSL A;  1MR8 A;  4N1G A;  3TZ1 A;  2YGU A;  4WQ2 A;  2L50 A;  2K60 A;  2V53 A;  4DS7 A;  1IQ5 A;  4ZCU A;  1DJW A;  1ZUZ A;  1B9A A;  4WQ3 A;  1CFD A;  3FIA A;  1KFX S;  1OSA A;  1QAT A;  1ZMZ A;  2AMI A;  2KPH A;  4JKT A;  3RM1 A;  4R1E A;  3S0G A;  2MLF C;  1RWY A;  2CBL A;  3B7A A;  1IQ3 A;  4FTG A;  4AQI A;  2K2A A;  3SS3 A;  4I5K A;  1PAL A;  1B4C A;  2PAL A;  5KU1 A;  5I2Q A;  3B87 A;  1FW4 A;  2LM5 A;  2EHB A;  2OTG C;  2P70 A;  4ORC B;  1TNQ A;  1U5I B;  2WC5 A;  1CLL A;  2F2O A;  1JSA A;  1QX5 B;  2WC8 A;  2RGI A;  1A4P A;  4GGN A;  2SCP A;  3AKB A;  3SS5 A;  4Q04 A;  1EXR A;  2H8V A;  2NXQ A;  1OMR A;  2O5G A;  2ZNE A;  3JTD B;  1DJX A;  4N1F A;  2L5X B;  1K8U A;  1DJI A;  5HLO A;  2KBI A;  4I5J A;  3CZ0 A;  3JVT B;  1J55 A;  1SR6 C;  4HRG A;  1SCV A;  2H61 C;  1ALW A;  4U8D A;  1S5G Y;  3RLZ A;  2BKI B;  2LHI A;  2BNX A;  5CSF A;  1LA0 A;  5ER4 X;  1A29 A;  1TCO B;  2LE9 B;  3KF9 A;  2Q4U A;  1WLM A;  5GQQ C;  3BOW B;  2JTT A;  4PHJ A;  5HL1 A;  2K2F A;  1F4O A;  1L2O C;  1RK9 A;  1R6P A;  1J7O A;  1TN4 A;  2L2E A;  2NLN A;  3ZWH A;  1TCF A;  2LNK A;  1SBJ A;  3BFA A;  1OOJ A;  5CPV A;  3LL8 B;  2M7L A;  3DVJ A;  1OE9 B;  1CDN A;  2QEO A;  4YGB B;  4HSZ A;  3NGV A;  1K94 A;  1XFV O;  4UPG A;  1ZOT B;  4OR9 B;  5F6T A;  1JBA A;  1G4Y R;  5HKY A;  2FJU B;  2O60 A;  2Y1N A;  1YTZ C;  3R1O A;  2PSR A;  1SL9 A;  1DJY A;  3B86 A;  1J7P A;  1BOD A;  1FI5 A;  2HQW A;  3SIB A;  1PVB A;  4P5O E;  4ZCV A;  3O6B A;  2NCP A;  2QEV A;  4CLN A;  3SG5 A;  1JC2 A;  3BOW A;  2ISD A;  3NSO A;  1SCM B;  1EH2 A;  2LVJ A;  2P6B B;  2VRG A;  5HKZ A;  1YUR A;  1R2U A;  3OGN A;  2KSP A;  1KK8 B;  1NCX A;  2KQ6 A;  1AK8 A;  2LMU A;  2F2P A;  2BBM A;  2ZRS A;  1CFF A;  1M39 A;  3SG2 A;  4MBE A;  1IKU A;  1BJF A;  2JT0 A;  1KQM C;  3H4S E;  2P71 A;  1DGV A;  3SG4 A;  3CR4 X;  3TUY C;  3CZT X;  1K90 D;  1B47 A;  1IJ5 A;  1N65 A;  2QEB A;  1Z2C B;  3KO0 A;  3L4A A;  3QME A;  1C3Y A;  3DVE A;  3K1E A;  2AUC A;  3CAB A;  3O2P A;  3CTN A;  4KYN A;  3SJS A;  1TOP A;  1CM1 A;  2BE6 A;  3JTD C;  1QVI Y;  1AUI B;  1DT7 B;  2KYF A;  4CFR A;  5HLV A;  3KHE A;  3SS4 A;  2ZN8 A;  1S6J A;  2LC5 A;  5KTY A;  3R1P A;  1QX7 A;  1UUR A;  2LVK A;  2FOT A;  2KFH A;  2F33 A;  2WCM A;  1MF8 B;  1WY9 A;  1OQP A;  1WLZ A;  1QLS A;  4ETO A;  1GM0 A;  1L7Z A;  2KYC A;  2KGR A;  1M31 A;  5D3O A;  4QJ4 B;  1C07 A;  3GK4 X;  3N7H A;  2K61 A;  3D77 A;  1AHR A;  3WNX B;  1F70 A;  1SNL A;  2QPT A;  3IVT A;  1AVS A;  1QJT A;  1BT6 A;  1M63 B;  4F7F A;  1TWO A;  1J1E A;  1KK7 Y;  3O78 A;  3EVU A;  3I5I C;  1OOG A;  2GTE A;  3D0Y B;  1P28 A;  3PSR A;  2LV7 A;  4JPZ B;  4YI8 A;  1CLM A;  3TS5 B;  2M7N A;  1YVL A;  1CMF A;  1DF0 B;  1NP8 A;  4XJK B;  3D73 A;  3BFH A;  4YGC B;  5D7F A;  2BL0 C;  1NX1 A;  3CZ1 A;  3NHT A;  2KAY A;  1UP5 A;  4TNC A;  1B8C A;  3WHT B;  3PN7 C;  5TNC A;  3IQQ A;  2LHL A;  1XO5 A;  2LP2 A;  1RRO A;  3OBV A;  1NWD A;  1S26 D;  3PN7 B;  3R1V A;  3WXA A;  3GK1 A;  1T14 A;  1FBV A;  4MVF A;  4PHM A;  3PFV A;  3R72 A;  1MQ1 A;  5FI7 A;  2KFF A;  1S1E A;  2R2I A;  4GGF C;  3TS5 C;  4NQG A;  1DGU A;  1BR4 B;  1Y1X A;  3DYE A;  3I5G C;  4JD9 A;  1YUS A;  4IJ7 A;  4ORA B;  1CLB A;  2E6W A;  3K21 A;  4OV2 A;  2JRF A;  1XK4 C;  2BAP A;  3VRO A;  2LMT A;  2PYQ A;  4C0L A;  1DQE A;  1LIN A;  4NDD A;  5FI6 A;  2BCA A;  1UHI A;  2CXJ A;  2I7A A;  2MHH A;  1SK6 D;  2OPO A;  3EK4 A;  1QIV A;  4MRY A;  2QAC A;  2LCP A;  2AAO A;  5PAL A;  2JZI A;  1OOF A;  3DD4 A;  1UUS A;  2G9B A;  2KI6 D;  1C7W A;  1QS7 A;  1PSR A;  1CM4 A;  3CWG A;  3OP0 A;  5I2O A;  1CB1 A;  1JFJ A;  1F8H A;  2SAS A;  1PRW A;  1CMG A;  4PE7 A;  1GQM A;  4MRX A;  4NDB A;  3OB2 B;  1NYA A;  1Q80 A;  3ZNI A;  3B6X A;  1J1D A;  2ZN9 A;  4OVN F;  1XK4 A;  3CS1 A;  1G33 A;  2TN4 A;  3F45 A;  3HCM A;  4D1E A;  1SL8 A;  2CTN A;  3O4Y A;  2M29 A; 
#chains in the Genus database with same CATH homology
 4MZJ A;  3QRX A;  1ZAC A;  5D69 A;  3I5G B;  4NDC A;  1F55 A;  1Y6W A;  2Y1M A;  1LVC D;  3EKJ A;  4JQ0 D;  3VRR A;  1TTX A;  2KFG A;  3DVK A;  5AFP A;  2COL B;  1XFU O;  1XVJ A;  2LVI A;  1EG3 A;  2KAX A;  1JWD A;  2DOQ A;  1BLQ A;  4I5L B;  1JUO A;  4PHN A;  2Y5I A;  2HET A;  2GGZ A;  2H61 A;  4USL A;  2WCF A;  3VRP A;  5CSI A;  1GJY A;  2JUL A;  3LK1 A;  5AAN A;  4FQO A;  2CT9 A;  2HPS A;  1JFK A;  3PLF B;  4E68 A;  1H4B A;  1OMV A;  2F8P A;  2ZFD A;  2G2B A;  4OCI A;  5AEQ A;  2IS9 A;  2WND A;  1E8A A;  4GPL B;  1KK7 Z;  1KQM B;  1TNW A;  2LVV A;  5FYX A;  2KAV A;  1D1O A;  5G08 A;  1MHO A;  1SMG A;  1OZO A;  1M46 A;  1TIZ A;  1KFU L;  1SW8 A;  2KQY A;  3OB1 B;  2KOT A;  1LKJ A;  4N5X A;  1F71 A;  1K9P A;  2K7B A;  1K95 A;  5B8I B;  1BF5 A;  2ZND A;  2BEC A;  1AP4 A;  5I8N A;  5AXI A;  3LLE A;  1BOC A;  5JJG A;  1H8B A;  3FWB A;  1G8I A;  2I94 A;  2KGB C;  2OTG B;  3A8R A;  3BUW B;  2KI6 C;  4ICB A;  4DUQ A;  1F54 A;  1MXL C;  3DF0 B;  4MN0 A;  3SIA A;  5I2L A;  1J7R A;  1QXP A;  3TUY B;  1QAS A;  3TDI A;  2BCB A;  1DF0 A;  3CR5 X;  2BBN A;  1K96 A;  2GV5 A;  1KK8 C;  1WRK A;  1SR6 B;  5DKQ A;  1A03 A;  3BYA A;  3CGA A;  1UHK A;  3PM8 A;  4WRI A;  1FPW A;  1FF1 A;  2JWW A;  1K93 D;  3D0Y A;  4MZL A;  1NSH A;  2L98 A;  5DKR A;  2E30 A;  3NSK A;  1AJ5 A;  1XFY O;  3DF0 A;  3IF7 A;  1JF0 A;  1S3P A;  2BE4 A;  3I5F C;  1N0Y A;  1NX3 A;  2ZRT A;  4CID A;  1A2X A;  1DMO A;  2BL0 B;  2NCO A;  4PE1 A;  3VRN A;  3CR2 A;  1AJ4 A;  3HX4 A;  1JF2 A;  4HRH A;  4MEW A;  1ALV A;  4MSP A;  4MZK A;  1CFC A;  2B1U A;  3SG3 A;  2L0P A;  1KSO A;  2EC6 B;  2LLS A;  1IWQ A;  1WRZ A;  2ZKM X;  3PAL A;  1OMD A;  1CKK A;  1SL7 A;  2F3Y A;  5CSN A;  2D8N A;  4YBH B;  1S5G Z;  2K0J A;  2LLU A;  1YUT A;  4QJ5 B;  2JC2 A;  4PE4 A;  4PDZ A;  4A4B A;  2L4I A;  4P2Y B;  1S6C A;  1QLK A;  5HYD A;  1W7I B;  2LAN A;  1TNP A;  1TRF A;  1S36 A;  2LUX A;  2M1K B;  1QX2 A;  1XA5 A;  1EL4 A;  1GGW A;  1KQV A;  2LAP A;  2CCM A;  4GUK A;  4IL1 A;  1V1F A;  1MXE A;  1Y1U A;  3BUM B;  2F3Z A;  1UHH A;  3FWC A;  2FCD A;  3EVV A;  1B7T Y;  2KNE A;  4C0J A;  4GNK B;  1UHN A;  1KWO C;  1MUX A;  2KDH A;  4PE0 A;  5HKW A;  2HQ8 A;  3LK0 A;  4AQJ A;  2H2K A;  2LP3 A;  1UWO A;  4GGF A;  1XYD A;  1YRT B;  5JOL A;  2JPT A;  1VRK A;  3OX5 A;  1WRL A;  2JTZ A;  1NX0 A;  3AKA A;  4CPV A;  1DJH A;  2BCX A;  4CFQ A;  2L4H A;  1SCM C;  1IRJ A;  2KBM A;  1W7J B;  2M0R A;  3EVR A;  4M2Q A;  2L51 A;  1S6I A;  1CFP A;  1YUU A;  1M45 A;  1HQV A;  1RJV A;  1X02 A;  3I5F B;  1SY9 A;  5I2O A;  1YVH A;  2JQ6 A;  4QJ3 B;  4XYN A;  1NX2 A;  1CDL A;  3GOF A;  4YGE B;  1B8L A;  1XFW O;  2CNP A;  1J7Q A;  1NCZ A;  1GGZ A;  2KHN A;  3BUO B;  1WDC C;  4C0K A;  1QIW A;  3I5H C;  1B8R A;  1SPY A;  1A75 B;  1U5I A;  4M2P A;  3EKH A;  1KFX L;  1DJG A;  2M3W A;  1LA3 A;  2LMV A;  3D10 A;  4HRE E;  1IG5 A;  2JXL A;  1K9U A;  4AOM A;  1NPQ A;  1CNP A;  3OX6 A;  3WHU B;  2M97 A;  2K7D A;  2JU0 A;  3M0W A;  1Y0V H;  2MBX A;  3VGO A;  2BKH B;  2MAZ A;  1XFX O;  2M49 B;  3JVT C;  2JXC A;  2WOS A;  3AAJ A;  1OZS A;  1QV1 A;  4YI9 A;  1BU3 A;  3BUX B;  1NCY A;  1B7T Z;  1NUB A;  1SKT A;  4L9M A;  1F4Q A;  4GBA A;  5J3X A;  3PAT A;  1QV0 A;  1QVI Z;  1K9K A;  3KEV A;  1HT9 A;  4OKH A;  1EG4 A;  2WCE A;  2M9G A;  3A4U B;  5K89 A;  2LLT A;  2HF5 A;  3MSE B;  1N2D A;  1IGV A;  4GAO A;  4YRU A;  5DKN A;  1FI6 A;  5BPJ A;  1DJZ A;  2FCE A;  2K8M B;  4I5N B;  1A75 A;  1CDP A;  1UHJ A;  2A4J A;  1K2H A;  2PAS A;  3EK7 A;  4DIR A;  2JOJ A;  4BY5 A;  1ZFS A;  1KFU S;  3I5H B;  1KCY A;  2EGD A;  1LXF C;  1RTP 1;  4JWQ A;  3TDU A;  4DCK A;  2K7O A;  1BG1 A;  4M2O A;  3VRQ A;  1IH0 A;  1DTL A;  4PAL A;  1SRA A;  1SYM A;  1B1G A;  1YRU B;  3KPX A;  3TDZ A;  3DVM A;  5AER A;  3NXA A;  2K7C A;  5CSJ A;  3BQ3 A;  1YR5 A;  3FS7 A;  4PCW A;  1RFJ A;  2PMY A;  3AAK A;  5KSZ A;  4YGD B;  5ER5 A;  1KSM A;  1IJ6 A;  1Y1A A;  4BY4 A;  2MJW B;  3C1V A;  1TNX A;  2KI4 B;  3ICB A;  1EJ3 A;  1XFZ O;  1CTR A;  2JT3 A;  1CDM A;  3GK2 A;  4ORB B;  4F0Z B;  2JT8 A;  2OS8 C;  1L2O B;  3I5I B;  2PRU A;  1YX8 A;  3NSI A;  4GFT A;  1NIW A;  3LCP C;  4PHK A;  4MLW A;  2I18 A;  4A4C A;  5IBW A;  2NZ0 A;  1PSB A;  1QTX A;  2I2R E;  2WOR A;  2EC6 C;  2OS8 B;  1KWO B;  4XJK A;  2MLE C;  3IQO A;  2MRD A;  1WDC B;  3E3R A;  2Q91 A;  3BXK A;  2KI4 C;  2PVB A;  4DRW A;  2JNX A;  1YX7 A;  2M1U A;  1BMO A;  3SG7 A;  1PK0 D;  3EK8 A;  2LUC A;  1BR1 B;  2M8U A;  1PUL A;  1ODB A;  1REC A;  3SG6 A;  1PVA A;  2WCB A;  3BUN B;  2JNF A;  4YGA A;  1DVI A;  1V1G A;  3CLN A;  2MA2 A;  3OHM B;  1MWN A;  2GGM A;  2Y4Q A;  3NSL A;  1MR8 A;  4N1G A;  3TZ1 A;  4WQ2 A;  2L50 A;  2V53 A;  4DS7 A;  1IQ5 A;  4ZCU A;  1DJW A;  1ZUZ A;  1B9A A;  4WQ3 A;  1CFD A;  3FIA A;  1KFX S;  1OSA A;  1QAT A;  1ZMZ A;  2AMI A;  3RM1 A;  4R1E A;  2MLF C;  1RWY A;  2CBL A;  1IQ3 A;  4FTG A;  4AQI A;  2K2A A;  4I5K A;  1PAL A;  1B4C A;  2PAL A;  5KU1 A;  5I2Q A;  1FW4 A;  2LM5 A;  2EHB A;  2OTG C;  4ORC B;  1TNQ A;  1U5I B;  1CLL A;  2F2O A;  1JSA A;  1QX5 B;  2WC8 A;  2RGI A;  1A4P A;  4GGN A;  2SCP A;  3AKB A;  4Q04 A;  1EXR A;  2NXQ A;  3JTD B;  1OMR A;  2O5G A;  2ZNE A;  1DJX A;  4N1F A;  2L5X B;  1K8U A;  1DJI A;  5HLO A;  2KBI A;  4I5J A;  3JVT B;  1J55 A;  1SR6 C;  4HRG A;  1SCV A;  2H61 C;  1ALW A;  4U8D A;  1S5G Y;  3RLZ A;  2BKI B;  2LHI A;  5CSF A;  1LA0 A;  5ER4 X;  1A29 A;  1TCO B;  2LE9 B;  3KF9 A;  2Q4U A;  1WLM A;  5GQQ C;  3BOW B;  2JTT A;  4PHJ A;  1C7V A;  2K2F A;  1F4O A;  1L2O C;  1RK9 A;  1R6P A;  1J7O A;  1TN4 A;  2L2E A;  2NLN A;  3ZWH A;  1TCF A;  2LNK A;  1SBJ A;  1OOJ A;  5CPV A;  3LL8 B;  2M7L A;  3DVJ A;  1OE9 B;  1CDN A;  4YGB B;  4HSZ A;  1K94 A;  1XFV O;  4UPG A;  1ZOT B;  4OR9 B;  5F6T A;  1JBA A;  1G4Y R;  5HKY A;  2FJU B;  2O60 A;  2Y1N A;  1YTZ C;  2PSR A;  1SL9 A;  1DJY A;  1J7P A;  1BOD A;  1FI5 A;  2HQW A;  3SIB A;  1PVB A;  4P5O E;  4ZCV A;  3O6B A;  2NCP A;  1JC2 A;  4CLN A;  3SG5 A;  3BOW A;  2ISD A;  3NSO A;  1SCM B;  1EH2 A;  2LVJ A;  2P6B B;  2VRG A;  5HKZ A;  1YUR A;  1R2U A;  2KSP A;  1KK8 B;  1NCX A;  2KQ6 A;  1AK8 A;  2LMU A;  2F2P A;  2BBM A;  2ZRS A;  1CFF A;  1M39 A;  3SG2 A;  4MBE A;  1IKU A;  1BJF A;  2JT0 A;  1KQM C;  3H4S E;  1DGV A;  3SG4 A;  3CR4 X;  3TUY C;  3CZT X;  1K90 D;  1B47 A;  1IJ5 A;  1N65 A;  3KO0 A;  3DVE A;  2AUC A;  3O2P A;  3CTN A;  3SJS A;  1TOP A;  1CM1 A;  2BE6 A;  3JTD C;  1QVI Y;  1AUI B;  1DT7 B;  2KYF A;  4CFR A;  5HLV A;  3KHE A;  2ZN8 A;  1S6J A;  2LC5 A;  5KTY A;  1QX7 A;  1UUR A;  2LVK A;  2FOT A;  2KFH A;  2F33 A;  1MF8 B;  1WY9 A;  1OQP A;  1WLZ A;  1QLS A;  4ETO A;  1L7Z A;  2KYC A;  2KGR A;  1M31 A;  4QJ4 B;  1C07 A;  3GK4 X;  2K61 A;  1AHR A;  3WNX B;  1F70 A;  1SNL A;  2QPT A;  1AVS A;  1QJT A;  1BT6 A;  1M63 B;  1J1E A;  1KK7 Y;  3O78 A;  3EVU A;  3I5I C;  3D0Y B;  3PSR A;  2LV7 A;  4JPZ B;  4YI8 A;  1CLM A;  3TS5 B;  2M7N A;  1YVL A;  1CMF A;  1DF0 B;  1NP8 A;  4XJK B;  4YGC B;  5D7F A;  2BL0 C;  1NX1 A;  3WHT B;  2KAY A;  1UP5 A;  4TNC A;  1B8C A;  3PN7 C;  5TNC A;  3IQQ A;  2LHL A;  1XO5 A;  2LP2 A;  1RRO A;  1NWD A;  1S26 D;  3PN7 B;  3WXA A;  3GK1 A;  1FBV A;  4MVF A;  4PHM A;  3PFV A;  1MQ1 A;  2KFF A;  1S1E A;  2R2I A;  4GGF C;  3TS5 C;  4NQG A;  1DGU A;  1BR4 B;  1Y1X A;  3I5G C;  1YUS A;  1CLB A;  4ORA B;  2E6W A;  3K21 A;  4OV2 A;  2JRF A;  1XK4 C;  3VRO A;  4C0L A;  2LMT A;  1LIN A;  4NDD A;  2BCA A;  1UHI A;  2CXJ A;  2I7A A;  2MHH A;  1SK6 D;  2OPO A;  3EK4 A;  1QIV A;  4MRY A;  2QAC A;  2LCP A;  2AAO A;  5PAL A;  2JZI A;  3DD4 A;  1UUS A;  2G9B A;  2KI6 D;  1C7W A;  1QS7 A;  1PSR A;  1CM4 A;  3CWG A;  3OP0 A;  1CB1 A;  1F8H A;  1JFJ A;  2SAS A;  1PRW A;  1CMG A;  4PE7 A;  1GQM A;  4MRX A;  4NDB A;  3OB2 B;  1NYA A;  1Q80 A;  3ZNI A;  1J1D A;  2ZN9 A;  4OVN F;  1XK4 A;  3CS1 A;  1G33 A;  2TN4 A;  3F45 A;  3HCM A;  4D1E A;  1SL8 A;  2CTN A;  3O4Y A;  2M29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...