4GGFA

Crystal structure of mn2+ bound calprotectin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
89
structure length
89
Chain Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antimicrobial protein
total genus 36
structure length 89
sequence length 89
chains with identical sequence K, S, U
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ggfA00
5HYDA 1XFXO 1CDPA 1B7TY 1CDMA 2OTGB 4GGNA 1IGVA 2H61A 2HETA 4OR9B 1KWOB 2HQWA 3VROA 5B8IB 3BOWB 3O4YA 4IL1A 5JOLA 2LC5A 4GNKB 3TDUA 3VRPA 1LVCD 2LUCA 2JZIA 2QPTA 4L9MA 2H61C 3OB1B 4CPVA 2BBMA 1CKKA 3TDIA 1BLQA 5D7FA 3NSOA 2L5XB 2ZKMX 3ICBA 1AP4A 3LK1A 1QV1A 1XFVO 3BQ3A 3D10A 1N0YA 1ZMZA 3CTNA 2L98A 3BUWB 4I5NB 1CNPA 3E3RA 3BOWA 1J1EA 5DKQA 4GGFA 1GJYA 1S26D 3NXAA 2JT3A 2MLEC 4YI8A 1QV0A 2BECA 4PHKA 2I2RE 2BCAA 4DS7A 1MQ1A 1QX2A 1RJVA 1EG3A 1QX5B 1YUUA 2CNPA 4WRIA 1PRWA 2NXQA 2WCFA 3DVMA 4FQOA 1PSRA 1Y1UA 1UHKA 1FF1A 3SJSA 2M8UA 1AJ4A 4GFTA 4AOMA 1A03A 1GGWA 1OMVA 2M97A 3SG4A 1QTXA 1DJIA 1J7PA 1OMDA 1XFWO 3KPXA 1TTXA 2K2FA 3IQQA 1DT7B 1WLZA 1UUSA 4C0KA 2JRFA 1MHOA 2MRDA 4WQ2A 1KCYA 2EGDA 2L51A 3EVUA 3VGOA 3PN7B 1LA0A 5ER5A 2FCEA 4M2QA 2M7LA 4M2PA 1IWQA 3O78A 4XYNA 1B4CA 1J7QA 3WNXB 3BUOB 3I5FB 1F55A 2Y1MA 1MR8A 2WCBA 4E68A 3PLFB 5AEQA 1UWOA 1FI5A 5TNCA 2GGMA 4PE4A 4GUKA 2LNKA 2JPTA 2L4IA 2MA2A 4ORCB 3FS7A 4JQ0D 5CPVA 2K2AA 4MLWA 1PSBA 1S3PA 1FI6A 2WC8A 2K0JA 3FIAA 2NCPA 4PHJA 3C1VA 1TNXA 3I5HC 2BCXA 1IJ6A 2V53A 2BE4A 2ZN9A 3NSIA 4CFQA 1KSMA 1J1DA 3SG5A 2PASA 4GBAA 3SG2A 2NZ0A 1JC2A 2AMIA 1ALVA 3PN7C 3VRQA 3GK2A 2GV5A 3AAJA 4MVFA 1LINA 1NX3A 1CLMA 1G33A 2JNFA 3I5FC 1L2OB 3GK1A 2KYCA 4MZKA 4QJ5B 4I5JA 4HRGA 2FJUB 4FTGA 1CM4A 4DCKA 2F2OA 1J7RA 1DJWA 2SASA 2I18A 2PALA 4ZCUA 1H4BA 1DF0B 4I5KA 1CTRA 3NSKA 1A2XA 4I5LB 1CDNA 1KK7Z 4MN0A 4D1EA 2CT9A 2F33A 2LHIA 4PCWA 3LK0A 3PFVA 2L4HA 1NP8A 2M0RA 4MSPA 3CGAA 2HPSA 1IKUA 2K8MB 1NIWA 2JU0A 1KK8C 1RTP1 3OB2B 3EKJA 1DJZA 1NWDA 4NDCA 1L2OC 1QVIY 1WRLA 1F54A 1NX0A 1DF0A 1SCMB 4DIRA 2A4JA 1VRKA 1QATA 1TN4A 1D1OA 1DMOA 1UHIA 1B47A 1Y6WA 1K9KA 1SW8A 3I5IB 1CLLA 2EHBA 2MBXA 4YBHB 3DVKA 3NSLA 1K94A 2KDHA 1S6CA 1QX7A 5I8NA 1S6JA 2BCBA 1RFJA 3SG7A 4PDZA 1B8RA 1NYAA 5HLVA 1DGUA 4M2OA 1EL4A 2LUXA 3JVTB 3TUYB 1NPQA 1WDCB 3RM1A 3CWGA 3I5GC 4PE1A 1ZFSA 3EKHA 1MF8B 4DRWA 2KBIA 4R1EA 1TRFA 1KFUS 3FWCA 5KU1A 2JXCA 1YRUB 2M3WA 1F70A 2Y4QA 1LXFC 2SCPA 1ALWA 2LHLA 3JTDC 3K21A 2G2BA 1M31A 1SR6C 2FCDA 5AERA 2BL0C 1V1FA 3EK4A 2WNDA 1TIZA 2M9GA 3I5IC 4N1FA 1BR4B 2LMTA 2M29A 2JTTA 4ORBB 1CFDA 1KQMB 1XFYO 2KFHA 1TCFA 2PMYA 3DVEA 3SIBA 2OTGC 4A4BA 1GQMA 2BKHB 2LCPA 1KWOC 1JUOA 2JULA 2PVBA 3KHEA 4GGFC 1W7IB 2F3YA 1EJ3A 1KFXL 2OPOA 1J7OA 1MXEA 1AJ5A 3O2PA 4NDDA 4PE0A 5CSIA 1V1GA 2KFFA 2KYFA 4QJ3B 4HREE 1B1GA 3CR2A 4DUQA 1M46A 1M39A 3O6BA 1SL7A 1JFKA 2KSPA 4U8DA 2O5GA 2OS8B 4YGEB 1NX2A 2KAVA 3BXKA 5AXIA 3SG3A 1EH2A 4OKHA 2KQYA 1C7WA 1K9PA 3RLZA 4N1GA 2LANA 4BY5A 3A4UB 1S5GZ 1LKJA 2E6WA 5JJGA 3BUMB 4GPLB 1DGVA 3AKAA 4PHMA 1ZACA 2ZFDA 4QJ4B 1B8LA 2LV7A 1CFFA 1GGZA 3HCMA 3H4SE 3CR5X 5HLOA 1YVLA 4MEWA 1MWNA 5HKWA 2CTNA 4C0LA 5HKYA 1K2HA 1XFZO 2QACA 1XA5A 1WY9A 2MJWB 2KBMA 1ZOTB 4MZLA 2ZRTA 2LVJA 2LLTA 1XYDA 2Q4UA 3KO0A 1U5IB 2E30A 3GK4X 3OP0A 3VRNA 1YR5A 2D8NA 2JT0A 1FW4A 2LE9B 4MBEA 5F6TA 1EXRA 1NX1A 1YUTA 4JPZB 1DVIA 2F8PA 1AVSA 3SG6A 1BU3A 2KGBC 4TNCA 4ORAB 1OZSA 2KI6C 2RGIA 5CSJA 3EK8A 5FYXA 1PVBA 2HQ8A 3OX6A 1AHRA 2I7AA 2COLB 1K9UA 1U5IA 3BUNB 1YX8A 5I2LA 1K95A 1A29A 1JF0A 1L7ZA 4ZCVA 4MRYA 1XK4A 1DTLA 4CLNA 5GQQC 1CM1A 2NCOA 4GAOA 1QLSA 4ICBA 4PHNA 1XO5A 3D0YA 1Y0VH 1YRTB 2KI6D 2WOSA 5ER4X 5AANA 5KTYA 1R6PA 2IS9A 1IG5A 1PVAA 1SMGA 2LAPA 4HSZA 2LM5A 1ODBA 2MLFC 3TDZA 1LA3A 3SIAA 1F4QA 1OQPA 4YGCB 1WRZA 2Y1NA 5K89A 2JNXA 1KQVA 2AUCA 3ZNIA 3LLEA 1N2DA 5J3XA 3AAKA 1JBAA 1B9AA 1EG4A 2FOTA 1K90D 2LLSA 4CFRA 4OV2A 1NCZA 1G8IA 5AFPA 2KOTA 3M0WA 2NLNA 2KQ6A 1QLKA 3FWBA 1OSAA 3OX5A 1JSAA 4AQJA 2K7OA 3OHMB 1SNLA 3DD4A 2MAZA 5I2OA 1SBJA 4MRXA 1BOCA 1X02A 2LVIA 3GOFA 3PM8A 2K7DA 4OVNF 3EK7A 2MHHA 1A75B 1NUBA 5HKZA 4OCIA 2KGRA 1MUXA 1UHNA 3KF9A 4USLA 4YGAA 2R2IA 3LCPC 1SCMC 2LMVA 2L2EA 4YI9A 3TS5B 1SL9A 5D69A 2KHNA 1OZOA 2PSRA 2H2KA 3ZWHA 1NCYA 5I2QA 1RECA 1YVHA 4WQ3A 2ZNEA 1XFUO 2M7NA 1G4YR 1UHJA 2LMUA 4N5XA 4BY4A 4F0ZB 1AK8A 1A75A 1S1EA 5CSFA 1IRJA 1IQ5A 4Q04A 1PALA 3CS1A 3JVTC 3TUYC 1WDCC 2K7BA 1BJFA 1KSOA 1UP5A 1NCXA 5DKRA 4UPGA 1KK7Y 2JXLA 3PALA 2GGZA 4YGDB 2ZRSA 2JOJA 1QXPA 1M63B 2KAXA 1ZUZA 4ETOA 2LP3A 1CDLA 3TS5C 1SYMA 3A8RA 1YURA 4P5OE 1CFPA 2BE6A 4MZJA 3PSRA 2HF5A 2KI4B 2JQ6A 1KQMC 1C07A 4YGBB 1M45A 5CSNA 1F8HA 2Y5IA 2F3ZA 3KEVA 1DJXA 3MSEB 3WHUB 1QVIZ 1SY9A 2ZNDA 5G08A 2JWWA 2KNEA 3I5HB 1XVJA 1W7JB 1QIWA 1S6IA 3BYAA 2BKIB 1IQ3A 1OOJA 1C7VA 1JFJA 4NQGA 2K7CA 2EC6B 1TOPA 1B8CA 1QS7A 1Q80A 2B1UA 1SCVA 4HRHA 1MXLC 1B7TZ 2CCMA 5PALA 3BUXB 2OS8C 4A4CA 2K61A 2WCEA 2WORA 3CLNA 1WRKA 2I94A 5IBWA 1SK6D 3CR4X 2M49B 1SPYA 2KI4C 1BMOA 1BT6A 1UHHA 1JF2A 1KFXS 4CIDA 3D0YB 1TNWA 3IQOA 4JWQA 1BODA 2PRUA 2L0PA 3AKBA 1QASA 1RROA 2G9BA 2M1KB 1JWDA 3HX4A 3DVJA 3CZTX 4NDBA 1PULA 1SRAA 3VRRA 1K96A 2LVKA 5DKNA 1N65A 2TN4A 3QRXA 1SL8A 3PATA 1TNQA 1DJGA 2EC6C 2VRGA 2LVVA 1UURA 3IF7A 1KK8B 4AQIA 1DJHA 4PE7A 1F71A 3DF0B 2JT8A 1OMRA 2KAYA 1CB1A 2P6BB 1TNPA 1IH0A 1FBVA 1QIVA 1RWYA 1XK4C 2JTZA 4P2YB 1KFUL 1YX7A 1BG1A 1HT9A 4XJKB 1CMFA 4YRUA 1Y1AA 1IJ5A 2BBNA 1E8AA 4PALA 3TZ1A 1DJYA 2Q91A 3EVVA 1K8UA 1BR1B 4C0JA 1AUIB 1Y1XA 1YUSA 2LLUA 1BF5A 2LP2A 1FPWA 3DF0A 3WXAA 1YTZC 1A4PA 1RK9A 1HQVA 1TCOB 1CFCA 1K93D 1S36A 2L50A 3I5GB 2KFGA 1CLBA 2CXJA 3EVRA 1S5GY 2JC2A 2O60A 1R2UA 4XJKA 2DOQA 1QJTA 2ZN8A 3WHTB 5KSZA 1WLMA 5BPJA 3LL8B 2ISDA 1NSHA 3F45A 1OE9B 3JTDB 2AAOA 1H8BA 1J55A 1SR6B 2M1UA 2BL0B 1CMGA 2F2PA 1PK0D 1SKTA 2CBLA 1F4OA
chains in the Genus database with same CATH superfamily
5HYDA 1XFXO 1CDPA 1B7TY 3B88A 1CDMA 2OTGB 4GGNA 1IGVA 2H61A 2HETA 4OR9B 1KWOB 2HQWA 3VROA 3SS4A 5B8IB 3BOWB 3O4YA 4IL1A 5JOLA 2LC5A 4GNKB 3TDUA 3VRPA 1LVCD 2LUCA 2JZIA 2QPTA 3DYEA 4L9MA 2H61C 3OB1B 4CPVA 2BBMA 1CKKA 3TDIA 1BLQA 5D7FA 3NSOA 2L5XB 2ZKMX 3ICBA 1AP4A 3LK1A 3S0BA 1QV1A 1XFVO 3BQ3A 3D10A 1N0YA 2QEVA 3UNWA 1ZMZA 3CTNA 2L98A 3BUWB 4I5NB 1CNPA 3E3RA 3DXLA 3B87A 3BOWA 1J1EA 5DKQA 4GGFA 3SS5A 1GJYA 1S26D 3NXAA 2JT3A 2MLEC 4YI8A 1QV0A 2BECA 4PHKA 2I2RE 2BCAA 4DS7A 1MQ1A 1QX2A 1RJVA 1EG3A 1QX5B 1YUUA 2CNPA 4WRIA 1PRWA 2NXQA 2P70A 2WCFA 3DVMA 4FQOA 1PSRA 1Y1UA 1UHKA 3CDNA 1FF1A 3SJSA 2M8UA 1AJ4A 3R72A 3R1OA 4GFTA 4AOMA 1A03A 1OMVA 2M97A 1GGWA 2QEBA 3SG4A 1QTXA 1DJIA 1J7PA 1OMDA 1XFWO 3KPXA 1TTXA 2K2FA 3N7HA 3IQQA 3DY9A 1DT7B 1WLZA 1UUSA 4C0KA 2JRFA 1MHOA 2MRDA 4WQ2A 1DC1A 1KCYA 2EGDA 2L51A 3EVUA 3VGOA 3L47A 1LA0A 3PN7B 2FCEA 4M2QA 5ER5A 4M2PA 1IWQA 3O78A 4XYNA 1B4CA 1J7QA 3WNXB 3BUOB 3I5FB 1F55A 2Y1MA 3D74A 3D76A 1MR8A 2WCBA 4E68A 3PLFB 5AEQA 1UWOA 2WCKA 3IVTA 1FI5A 5TNCA 3L4LA 2GGMA 2FJYA 4PE4A 4GUKA 2LNKA 2JPTA 2L4IA 2MA2A 4ORCB 3CZ1A 3FS7A 4JQ0D 1OOFA 5CPVA 2K2AA 4MLWA 1PSBA 1S3PA 1FI6A 2WC8A 2K0JA 3FIAA 2NCPA 4PHJA 3C1VA 1TNXA 3I5HC 2YGUA 2BCXA 1IJ6A 2V53A 2BE4A 2ZN9A 3NSIA 4CFQA 1KSMA 1J1DA 3SG5A 2PASA 4GBAA 3SG2A 2NZ0A 1JC2A 2AMIA 2QEOA 1ALVA 3PN7C 3VRQA 3GK2A 2GV5A 3AAJA 4MVFA 1LINA 1NX3A 3EG5B 1CLMA 1G33A 2JNFA 3I5FC 1L2OB 3GK1A 2KYCA 4MZKA 4QJ5B 5D3OA 4I5JA 4HRGA 2FJUB 2KPHA 4FTGA 1CM4A 4DCKA 2F2OA 1J7RA 1DJWA 2SASA 2I18A 2PALA 4OZDA 4ZCUA 1T14A 1H4BA 1DF0B 1LS8A 4I5KA 1CTRA 3NSKA 1A2XA 2WCLA 4I5LB 1CDNA 1KK7Z 4MN0A 4D1EA 2CT9A 2F33A 2LHIA 4PCWA 3LK0A 3PFVA 1IIOA 2L4HA 1NP8A 2M0RA 4MSPA 3CGAA 2HPSA 1IKUA 2K8MB 1NIWA 2JU0A 1KK8C 1RTP1 2KLEA 3EKJA 3OB2B 1DJZA 1NWDA 4NDCA 1L2OC 1QVIY 1WRLA 1F54A 1NX0A 1DF0A 3Q8IA 1SCMB 4DIRA 4INWA 2A4JA 1VRKA 5EL2A 1QATA 1TN4A 1D1OA 1DMOA 1UHIA 2P71A 1B47A 1Y6WA 1K9KA 1SW8A 3I5IB 1CLLA 2EHBA 2MBXA 4YBHB 3DVKA 3NSLA 1K94A 2KDHA 1S6CA 1QX7A 5I8NA 1S6JA 2BCBA 1RFJA 3SG7A 4PDZA 1B8RA 1DQEA 1NYAA 1OOIX 1DGUA 1OW4A 5HLVA 4M2OA 1EL4A 2LUXA 2K60A 3JVTB 3TUYB 1NPQA 1WDCB 3RM1A 3CWGA 3I5GC 4PE1A 1ZFSA 3EKHA 1MF8B 4DRWA 2KBIA 4R1EA 1TRFA 1KFUS 3FWCA 5KU1A 2JXCA 1YRUB 2M3WA 1F70A 2Y4QA 1LXFC 2SCPA 5FI2A 1ALWA 4IJ7A 2LHLA 3JTDC 3K21A 2G2BA 1M31A 1SR6C 2FCDA 2WC5A 5AERA 2BL0C 1V1FA 3EK4A 2WNDA 1TIZA 2M9GA 3I5IC 4N1FA 3NHIA 1BR4B 2LMTA 2M29A 2JTTA 4ORBB 1CFDA 1KQMB 1XFYO 2KFHA 1TCFA 2PMYA 3DVEA 3SIBA 2OTGC 4A4BA 1GQMA 2BKHB 2LCPA 2BNXA 1KWOC 1JUOA 2JULA 2PVBA 3KHEA 4GGFC 1W7IB 2F3YA 1EJ3A 1KFXL 1SSEB 2OPOA 1J7OA 1MXEA 1AJ5A 3B7AA 3O2PA 4NDDA 4PE0A 3L4AA 3D75A 5CSIA 1V1GA 2KFFA 2KYFA 4QJ3B 4HREE 1B1GA 3CR2A 4DUQA 3PJIA 2M7LA 1M46A 1M39A 3O6BA 1SL7A 1JFKA 2KSPA 4U8DA 2O5GA 2OS8B 4YGEB 1NX2A 2KAVA 3BXKA 5AXIA 3UO9A 3SG3A 1ORGA 4OKHA 1EH2A 2KQYA 1C7WA 1K9PA 2PYQA 3RLZA 4N1GA 1GM0A 2LANA 2H8VA 4BY5A 3A4UB 1S5GZ 1LKJA 2E6WA 1QWVA 3BUMB 3CZ0A 4GPLB 5JJGA 1DGVA 3AKAA 4PHMA 1TUJA 1ZACA 2WCJA 2ZFDA 4QJ4B 1B8LA 2LV7A 1CFFA 1GGZA 3HCMA 3H4SE 3CR5X 5HLOA 1YVLA 4MEWA 1MWNA 5HKWA 2CTNA 3NHTA 4C0LA 5HKYA 1XFZO 1K2HA 2QACA 1XA5A 1WY9A 2MJWB 2KBMA 1ZOTB 4MZLA 2ZRTA 2LVJA 2LLTA 1XYDA 2Q4UA 3S0FA 3KO0A 1U5IB 2E30A 3GK4X 3OP0A 3R1VA 3VRNA 2WCMA 3RZSA 1C3YA 1YR5A 2D8NA 2JT0A 1FW4A 2LE9B 4MBEA 1DELA 2QEHA 5F6TA 1EXRA 1NX1A 1YUTA 4JPZB 1DVIA 2F8PA 4JKTA 1AVSA 3SG6A 1BU3A 2KGBC 3VB1A 4TNCA 4ORAB 1OZSA 2KI6C 3NGVA 2RGIA 5CSJA 3EK8A 5FYXA 1PVBA 2HQ8A 3BFAA 3OX6A 1AHRA 2I7AA 2COLB 1K9UA 3S0DA 3CABA 1U5IA 3BUNB 1YX8A 5I2LA 1K95A 3B6XA 1A29A 1JF0A 1L7ZA 4ZCVA 4MRYA 1XK4A 1DTLA 3SS3A 4CLNA 5GQQC 1CM1A 2NCOA 4GAOA 1QLSA 4ICBA 4PHNA 4F7FA 1XO5A 3D0YA 1Y0VH 1YRTB 2KI6D 2WOSA 5ER4X 5AANA 5KTYA 1R6PA 2IS9A 1IG5A 1PVAA 1SMGA 2LAPA 4HSZA 2LM5A 5HL1A 1ODBA 2MLFC 3OGNA 3TDZA 1LA3A 3CZ2A 3SIAA 1TUZA 1F4QA 1OQPA 4YGCB 1WRZA 2Y1NA 5K89A 1DEKA 2JNXA 1KQVA 2AUCA 3ZNIA 3LLEA 1N2DA 5J3XA 3AAKA 1JBAA 3OBVA 1B9AA 1EG4A 2FOTA 4PT1A 1K90D 2LLSA 4CFRA 4OV2A 1NCZA 1G8IA 5AFPA 2KOTA 3M0WA 2NLNA 2KQ6A 1QLKA 3FWBA 1OSAA 3OX5A 1JSAA 4AQJA 2K7OA 3OHMB 1SNLA 3DD4A 2MAZA 5I2OA 1SBJA 4MRXA 1BOCA 1X02A 2LVIA 3GOFA 3PM8A 2K7DA 4OVNF 3EK7A 2MHHA 1A75B 1NUBA 5HKZA 2L5YA 2KGRA 4OCIA 1MUXA 1UHNA 3KF9A 2L2CA 4USLA 4YGAA 2R2IA 3LCPC 1SCMC 2LMVA 2L2EA 5FI6A 4YI9A 3TS5B 1SL9A 5D69A 3V2LA 5I94A 2KHNA 1OZOA 2PSRA 2H2KA 3ZWHA 1C3ZA 4FQTA 1NCYA 5I2QA 3PM2A 1RECA 1YVHA 4WQ3A 3O4XA 2ZNEA 1XFUO 2M7NA 1G4YR 1UHJA 2KLDA 2LMUA 4N5XA 4BY4A 1OOGA 4F0ZB 1AK8A 3DZTA 1A75A 1S1EA 1Z4HA 5CSFA 1IRJA 1IQ5A 3K1EA 4Q04A 1PALA 3CS1A 3JVTC 3TUYC 1WDCC 2K7BA 1BJFA 2JPOA 1KSOA 1UP5A 1NCXA 5DKRA 4UPGA 2PQLA 1KK7Y 2JXLA 3PALA 2GGZA 4YGDB 2ZRSA 2JOJA 1QXPA 1M63B 1Z2CB 1ZUZA 2KAXA 4ETOA 2LP3A 1CDLA 3TS5C 1SYMA 3A8RA 1YURA 4P5OE 1CFPA 2BE6A 4KYNA 4MZJA 5FI7A 3PSRA 2HF5A 2KI4B 2JQ6A 3BJHA 1KQMC 2QDIA 1C07A 4YGBB 1M45A 5CSNA 1F8HA 2Y5IA 2F3ZA 3KEVA 1DJXA 3MSEB 3WHUB 1QVIZ 1SY9A 2ZNDA 5G08A 2JWWA 2KNEA 3I5HB 1XFRA 1W7JB 1QIWA 1S6IA 1XVJA 3BYAA 2BKIB 3D78A 1OOJA 1IQ3A 1C7VA 1JFJA 4NQGA 3BFBA 2K7CA 2EC6B 1TOPA 1B8CA 2WCHA 1QS7A 1Q80A 2B1UA 1SCVA 4HRHA 1MXLC 1B7TZ 2CCMA 5PALA 1OOHA 3BUXB 2OS8C 4A4CA 3FE8A 1P28A 2K61A 2WCEA 3S0GA 2WORA 3CLNA 1WRKA 2I94A 5IBWA 1SK6D 2ERBA 3CR4X 2M49B 1SPYA 2KI4C 1BMOA 1BT6A 1UHHA 3CYZA 1JF2A 1KFXS 4CIDA 3D0YB 1TNWA 3IQOA 4JWQA 3FE6A 1BODA 2PRUA 2L0PA 3AKBA 1QASA 1RROA 2G9BA 2M1KB 3FE9A 3HX4A 1JWDA 3DVJA 3CZTX 4NDBA 1PULA 1SRAA 3VRRA 1K96A 2LVKA 5DKNA 1N65A 2TN4A 3QRXA 1SL8A 3PATA 1TNQA 1DJGA 2EC6C 2VRGA 2LVVA 1UURA 2GTEA 3IF7A 1KK8B 4AQIA 1DJHA 4PE7A 1F71A 3DF0B 3R1PA 2JT8A 3D73A 1OMRA 2KAYA 1CB1A 2P6BB 1TNPA 1IH0A 1FBVA 1QIVA 1RWYA 1XK4C 2JTZA 4P2YB 1KFUL 1YX7A 5DICA 1BG1A 1HT9A 4XJKB 1CMFA 4YRUA 1Y1AA 1IJ5A 2BBNA 1E8AA 4PALA 3TZ1A 1DJYA 3S0EA 2BAPA 2Q91A 3EVVA 1K8UA 1BR1B 4C0JA 1AUIB 1Y1XA 1YUSA 1W9ZA 2LLUA 1BF5A 2LP2A 4JD9A 1FPWA 3DF0A 1TWOA 3WXAA 3BFHA 1YTZC 1A4PA 1RK9A 1HQVA 1TCOB 3B86A 1K93D 1CFCA 1S36A 2L50A 3I5GB 2KFGA 1CLBA 2CXJA 3EVRA 1S5GY 2JC2A 2O60A 1R2UA 4XJKA 2DOQA 1QJTA 2ZN8A 4INXA 3WHTB 5KSZA 1WLMA 5BPJA 3LL8B 2ISDA 1NSHA 2WC6A 3F45A 1OE9B 3JTDB 3QMEA 3S0AA 3D77A 2AAOA 1H8BA 1J55A 1SR6B 2M1UA 2BL0B 1CMGA 2F2PA 1PK0D 1SKTA 2CBLA 1F4OA
chains in the Genus database with same CATH topology
5HYDA 1XFXO 1CDPA 1B7TY 1CDMA 2OTGB 4GGNA 1IGVA 2H61A 2HETA 4OR9B 1KWOB 2HQWA 3VROA 5B8IB 3BOWB 3O4YA 4IL1A 5JOLA 2LC5A 4GNKB 3TDUA 3VRPA 1LVCD 2LUCA 2JZIA 2QPTA 4L9MA 2H61C 3OB1B 4CPVA 2BBMA 1CKKA 3TDIA 1BLQA 5D7FA 3NSOA 2L5XB 2ZKMX 3ICBA 1AP4A 3LK1A 1QV1A 1XFVO 3BQ3A 3D10A 1N0YA 1ZMZA 3CTNA 2L98A 3BUWB 4I5NB 1CNPA 3E3RA 3BOWA 1J1EA 5DKQA 4GGFA 1GJYA 1S26D 3NXAA 2JT3A 2MLEC 4YI8A 1QV0A 2BECA 4PHKA 2I2RE 2BCAA 4DS7A 1MQ1A 1QX2A 1RJVA 1EG3A 1QX5B 1YUUA 2CNPA 4WRIA 1PRWA 2NXQA 2WCFA 3DVMA 4FQOA 1PSRA 1Y1UA 1UHKA 1FF1A 3SJSA 2M8UA 1AJ4A 4GFTA 4AOMA 1A03A 1GGWA 1OMVA 2M97A 3SG4A 1QTXA 1DJIA 1J7PA 1OMDA 1XFWO 3KPXA 1TTXA 2K2FA 3IQQA 1DT7B 1WLZA 1UUSA 4C0KA 2JRFA 1MHOA 2MRDA 4WQ2A 1KCYA 2EGDA 2L51A 3EVUA 3VGOA 3PN7B 1LA0A 5ER5A 2FCEA 4M2QA 2M7LA 4M2PA 1IWQA 3O78A 4XYNA 1B4CA 1J7QA 3WNXB 3BUOB 3I5FB 1F55A 2Y1MA 1MR8A 2WCBA 4E68A 3PLFB 5AEQA 1UWOA 1FI5A 5TNCA 2GGMA 4PE4A 4GUKA 2LNKA 2JPTA 2L4IA 2MA2A 4ORCB 3FS7A 4JQ0D 5CPVA 2K2AA 4MLWA 1PSBA 1S3PA 1FI6A 2WC8A 2K0JA 3FIAA 2NCPA 4PHJA 3C1VA 1TNXA 3I5HC 2BCXA 1IJ6A 2V53A 2BE4A 2ZN9A 3NSIA 4CFQA 1KSMA 1J1DA 3SG5A 2PASA 4GBAA 3SG2A 2NZ0A 1JC2A 2AMIA 1ALVA 3PN7C 3VRQA 3GK2A 2GV5A 3AAJA 4MVFA 1LINA 1NX3A 1CLMA 1G33A 2JNFA 3I5FC 1L2OB 3GK1A 2KYCA 4MZKA 4QJ5B 4I5JA 4HRGA 2FJUB 4FTGA 1CM4A 4DCKA 2F2OA 1J7RA 1DJWA 2SASA 2I18A 2PALA 4ZCUA 1H4BA 1DF0B 4I5KA 1CTRA 3NSKA 1A2XA 4I5LB 1CDNA 1KK7Z 4MN0A 4D1EA 2CT9A 2F33A 2LHIA 4PCWA 3LK0A 3PFVA 2L4HA 1NP8A 2M0RA 4MSPA 3CGAA 2HPSA 1IKUA 2K8MB 1NIWA 2JU0A 1KK8C 1RTP1 3OB2B 3EKJA 1DJZA 1NWDA 4NDCA 1L2OC 1QVIY 1WRLA 1F54A 1NX0A 1DF0A 1SCMB 4DIRA 2A4JA 1VRKA 1QATA 1TN4A 1D1OA 1DMOA 1UHIA 1B47A 1Y6WA 1K9KA 1SW8A 3I5IB 1CLLA 2EHBA 2MBXA 4YBHB 3DVKA 3NSLA 1K94A 2KDHA 1S6CA 1QX7A 5I8NA 1S6JA 2BCBA 1RFJA 3SG7A 4PDZA 1B8RA 1NYAA 5HLVA 1DGUA 4M2OA 1EL4A 2LUXA 3JVTB 3TUYB 1NPQA 1WDCB 3RM1A 3CWGA 3I5GC 4PE1A 1ZFSA 3EKHA 1MF8B 4DRWA 2KBIA 4R1EA 1TRFA 1KFUS 3FWCA 5KU1A 2JXCA 1YRUB 2M3WA 1F70A 2Y4QA 1LXFC 2SCPA 1ALWA 2LHLA 3JTDC 3K21A 2G2BA 1M31A 1SR6C 2FCDA 5AERA 2BL0C 1V1FA 3EK4A 2WNDA 1TIZA 2M9GA 3I5IC 4N1FA 1BR4B 2LMTA 2M29A 2JTTA 4ORBB 1CFDA 1KQMB 1XFYO 2KFHA 1TCFA 2PMYA 3DVEA 3SIBA 2OTGC 4A4BA 1GQMA 2BKHB 2LCPA 1KWOC 1JUOA 2JULA 2PVBA 3KHEA 4GGFC 1W7IB 2F3YA 1EJ3A 1KFXL 2OPOA 1J7OA 1MXEA 1AJ5A 3O2PA 4NDDA 4PE0A 5CSIA 1V1GA 2KFFA 2KYFA 4QJ3B 4HREE 1B1GA 3CR2A 4DUQA 1M46A 1M39A 3O6BA 1SL7A 1JFKA 2KSPA 4U8DA 2O5GA 2OS8B 4YGEB 1NX2A 2KAVA 3BXKA 5AXIA 3SG3A 1EH2A 4OKHA 2KQYA 1C7WA 1K9PA 3RLZA 4N1GA 2LANA 4BY5A 3A4UB 1S5GZ 1LKJA 2E6WA 5JJGA 3BUMB 4GPLB 1DGVA 3AKAA 4PHMA 1ZACA 2ZFDA 4QJ4B 1B8LA 2LV7A 1CFFA 1GGZA 3HCMA 3H4SE 3CR5X 5HLOA 1YVLA 4MEWA 1MWNA 5HKWA 2CTNA 4C0LA 5HKYA 1K2HA 1XFZO 2QACA 1XA5A 1WY9A 2MJWB 2KBMA 1ZOTB 4MZLA 2ZRTA 2LVJA 2LLTA 1XYDA 2Q4UA 3KO0A 1U5IB 2E30A 3GK4X 3OP0A 3VRNA 1YR5A 2D8NA 2JT0A 1FW4A 2LE9B 4MBEA 5F6TA 1EXRA 1NX1A 1YUTA 4JPZB 1DVIA 2F8PA 1AVSA 3SG6A 1BU3A 2KGBC 4TNCA 4ORAB 1OZSA 2KI6C 2RGIA 5CSJA 3EK8A 5FYXA 1PVBA 2HQ8A 3OX6A 1AHRA 2I7AA 2COLB 1K9UA 1U5IA 3BUNB 1YX8A 5I2LA 1K95A 1A29A 1JF0A 1L7ZA 4ZCVA 4MRYA 1XK4A 1DTLA 4CLNA 5GQQC 1CM1A 2NCOA 4GAOA 1QLSA 4ICBA 4PHNA 1XO5A 3D0YA 1Y0VH 1YRTB 2KI6D 2WOSA 5ER4X 5AANA 5KTYA 1R6PA 2IS9A 1IG5A 1PVAA 1SMGA 2LAPA 4HSZA 2LM5A 1ODBA 2MLFC 3TDZA 1LA3A 3SIAA 1F4QA 1OQPA 4YGCB 1WRZA 2Y1NA 5K89A 2JNXA 1KQVA 2AUCA 3ZNIA 3LLEA 1N2DA 5J3XA 3AAKA 1JBAA 1B9AA 1EG4A 2FOTA 1K90D 2LLSA 4CFRA 4OV2A 1NCZA 1G8IA 5AFPA 2KOTA 3M0WA 2NLNA 2KQ6A 1QLKA 3FWBA 1OSAA 3OX5A 1JSAA 4AQJA 2K7OA 3OHMB 1SNLA 3DD4A 2MAZA 5I2OA 1SBJA 4MRXA 1BOCA 1X02A 2LVIA 3GOFA 3PM8A 2K7DA 4OVNF 3EK7A 2MHHA 1A75B 1NUBA 5HKZA 4OCIA 2KGRA 1MUXA 1UHNA 3KF9A 4USLA 4YGAA 2R2IA 3LCPC 1SCMC 2LMVA 2L2EA 4YI9A 3TS5B 1SL9A 5D69A 2KHNA 1OZOA 2PSRA 2H2KA 3ZWHA 1NCYA 5I2QA 1RECA 1YVHA 4WQ3A 2ZNEA 1XFUO 2M7NA 1G4YR 1UHJA 2LMUA 4N5XA 4BY4A 4F0ZB 1AK8A 1A75A 1S1EA 5CSFA 1IRJA 1IQ5A 4Q04A 1PALA 3CS1A 3JVTC 3TUYC 1WDCC 2K7BA 1BJFA 1KSOA 1UP5A 1NCXA 5DKRA 4UPGA 1KK7Y 2JXLA 3PALA 2GGZA 4YGDB 2ZRSA 2JOJA 1QXPA 1M63B 2KAXA 1ZUZA 4ETOA 2LP3A 1CDLA 3TS5C 1SYMA 3A8RA 1YURA 4P5OE 1CFPA 2BE6A 4MZJA 3PSRA 2HF5A 2KI4B 2JQ6A 1KQMC 1C07A 4YGBB 1M45A 5CSNA 1F8HA 2Y5IA 2F3ZA 3KEVA 1DJXA 3MSEB 3WHUB 1QVIZ 1SY9A 2ZNDA 5G08A 2JWWA 2KNEA 3I5HB 1XVJA 1W7JB 1QIWA 1S6IA 3BYAA 2BKIB 1IQ3A 1OOJA 1C7VA 1JFJA 4NQGA 2K7CA 2EC6B 1TOPA 1B8CA 1QS7A 1Q80A 2B1UA 1SCVA 4HRHA 1MXLC 1B7TZ 2CCMA 5PALA 3BUXB 2OS8C 4A4CA 2K61A 2WCEA 2WORA 3CLNA 1WRKA 2I94A 5IBWA 1SK6D 3CR4X 2M49B 1SPYA 2KI4C 1BMOA 1BT6A 1UHHA 1JF2A 1KFXS 4CIDA 3D0YB 1TNWA 3IQOA 4JWQA 1BODA 2PRUA 2L0PA 3AKBA 1QASA 1RROA 2G9BA 2M1KB 1JWDA 3HX4A 3DVJA 3CZTX 4NDBA 1PULA 1SRAA 3VRRA 1K96A 2LVKA 5DKNA 1N65A 2TN4A 3QRXA 1SL8A 3PATA 1TNQA 1DJGA 2EC6C 2VRGA 2LVVA 1UURA 3IF7A 1KK8B 4AQIA 1DJHA 4PE7A 1F71A 3DF0B 2JT8A 1OMRA 2KAYA 1CB1A 2P6BB 1TNPA 1IH0A 1FBVA 1QIVA 1RWYA 1XK4C 2JTZA 4P2YB 1KFUL 1YX7A 1BG1A 1HT9A 4XJKB 1CMFA 4YRUA 1Y1AA 1IJ5A 2BBNA 1E8AA 4PALA 3TZ1A 1DJYA 2Q91A 3EVVA 1K8UA 1BR1B 4C0JA 1AUIB 1Y1XA 1YUSA 2LLUA 1BF5A 2LP2A 1FPWA 3DF0A 3WXAA 1YTZC 1A4PA 1RK9A 1HQVA 1TCOB 1CFCA 1K93D 1S36A 2L50A 3I5GB 2KFGA 1CLBA 2CXJA 3EVRA 1S5GY 2JC2A 2O60A 1R2UA 4XJKA 2DOQA 1QJTA 2ZN8A 3WHTB 5KSZA 1WLMA 5BPJA 3LL8B 2ISDA 1NSHA 3F45A 1OE9B 3JTDB 2AAOA 1H8BA 1J55A 1SR6B 2M1UA 2BL0B 1CMGA 2F2PA 1PK0D 1SKTA 2CBLA 1F4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HYD A;  1XFX O;  1CDP A;  1B7T Y;  1CDM A;  2OTG B;  4GGN A;  1IGV A;  2H61 A;  2HET A;  4OR9 B;  1KWO B;  2HQW A;  3VRO A;  5B8I B;  3BOW B;  3O4Y A;  4IL1 A;  5JOL A;  2LC5 A;  4GNK B;  3TDU A;  3VRP A;  1LVC D;  2LUC A;  2JZI A;  2QPT A;  4L9M A;  2H61 C;  3OB1 B;  4CPV A;  2BBM A;  1CKK A;  3TDI A;  1BLQ A;  5D7F A;  3NSO A;  2L5X B;  2ZKM X;  3ICB A;  1AP4 A;  3LK1 A;  1QV1 A;  1XFV O;  3BQ3 A;  3D10 A;  1N0Y A;  1ZMZ A;  3CTN A;  2L98 A;  3BUW B;  4I5N B;  1CNP A;  3E3R A;  3BOW A;  1J1E A;  5DKQ A;  4GGF A;  1GJY A;  1S26 D;  3NXA A;  2JT3 A;  2MLE C;  4YI8 A;  1QV0 A;  2BEC A;  4PHK A;  2I2R E;  2BCA A;  4DS7 A;  1MQ1 A;  1QX2 A;  1RJV A;  1EG3 A;  1QX5 B;  1YUU A;  2CNP A;  4WRI A;  1PRW A;  2NXQ A;  2WCF A;  3DVM A;  4FQO A;  1PSR A;  1Y1U A;  1UHK A;  1FF1 A;  3SJS A;  2M8U A;  1AJ4 A;  4GFT A;  4AOM A;  1A03 A;  1GGW A;  1OMV A;  2M97 A;  3SG4 A;  1QTX A;  1DJI A;  1J7P A;  1OMD A;  1XFW O;  3KPX A;  1TTX A;  2K2F A;  3IQQ A;  1DT7 B;  1WLZ A;  1UUS A;  4C0K A;  2JRF A;  1MHO A;  2MRD A;  4WQ2 A;  1KCY A;  2EGD A;  2L51 A;  3EVU A;  3VGO A;  3PN7 B;  1LA0 A;  5ER5 A;  2FCE A;  4M2Q A;  2M7L A;  4M2P A;  1IWQ A;  3O78 A;  4XYN A;  1B4C A;  1J7Q A;  3WNX B;  3BUO B;  3I5F B;  1F55 A;  2Y1M A;  1MR8 A;  2WCB A;  4E68 A;  3PLF B;  5AEQ A;  1UWO A;  1FI5 A;  5TNC A;  2GGM A;  4PE4 A;  4GUK A;  2LNK A;  2JPT A;  2L4I A;  2MA2 A;  4ORC B;  3FS7 A;  4JQ0 D;  5CPV A;  2K2A A;  4MLW A;  1PSB A;  1S3P A;  1FI6 A;  2WC8 A;  2K0J A;  3FIA A;  2NCP A;  4PHJ A;  3C1V A;  1TNX A;  3I5H C;  2BCX A;  1IJ6 A;  2V53 A;  2BE4 A;  2ZN9 A;  3NSI A;  4CFQ A;  1KSM A;  1J1D A;  3SG5 A;  2PAS A;  4GBA A;  3SG2 A;  2NZ0 A;  1JC2 A;  2AMI A;  1ALV A;  3PN7 C;  3VRQ A;  3GK2 A;  2GV5 A;  3AAJ A;  4MVF A;  1LIN A;  1NX3 A;  1CLM A;  1G33 A;  2JNF A;  3I5F C;  1L2O B;  3GK1 A;  2KYC A;  4MZK A;  4QJ5 B;  4I5J A;  4HRG A;  2FJU B;  4FTG A;  1CM4 A;  4DCK A;  2F2O A;  1J7R A;  1DJW A;  2SAS A;  2I18 A;  2PAL A;  4ZCU A;  1H4B A;  1DF0 B;  4I5K A;  1CTR A;  3NSK A;  1A2X A;  4I5L B;  1CDN A;  1KK7 Z;  4MN0 A;  4D1E A;  2CT9 A;  2F33 A;  2LHI A;  4PCW A;  3LK0 A;  3PFV A;  2L4H A;  1NP8 A;  2M0R A;  4MSP A;  3CGA A;  2HPS A;  1IKU A;  2K8M B;  1NIW A;  2JU0 A;  1KK8 C;  1RTP 1;  3OB2 B;  3EKJ A;  1DJZ A;  1NWD A;  4NDC A;  1L2O C;  1QVI Y;  1WRL A;  1F54 A;  1NX0 A;  1DF0 A;  1SCM B;  4DIR A;  2A4J A;  1VRK A;  1QAT A;  1TN4 A;  1D1O A;  1DMO A;  1UHI A;  1B47 A;  1Y6W A;  1K9K A;  1SW8 A;  3I5I B;  1CLL A;  2EHB A;  2MBX A;  4YBH B;  3DVK A;  3NSL A;  1K94 A;  2KDH A;  1S6C A;  1QX7 A;  5I8N A;  1S6J A;  2BCB A;  1RFJ A;  3SG7 A;  4PDZ A;  1B8R A;  1NYA A;  5HLV A;  1DGU A;  4M2O A;  1EL4 A;  2LUX A;  3JVT B;  3TUY B;  1NPQ A;  1WDC B;  3RM1 A;  3CWG A;  3I5G C;  4PE1 A;  1ZFS A;  3EKH A;  1MF8 B;  4DRW A;  2KBI A;  4R1E A;  1TRF A;  1KFU S;  3FWC A;  5KU1 A;  2JXC A;  1YRU B;  2M3W A;  1F70 A;  2Y4Q A;  1LXF C;  2SCP A;  1ALW A;  2LHL A;  3JTD C;  3K21 A;  2G2B A;  1M31 A;  1SR6 C;  2FCD A;  5AER A;  2BL0 C;  1V1F A;  3EK4 A;  2WND A;  1TIZ A;  2M9G A;  3I5I C;  4N1F A;  1BR4 B;  2LMT A;  2M29 A;  2JTT A;  4ORB B;  1CFD A;  1KQM B;  1XFY O;  2KFH A;  1TCF A;  2PMY A;  3DVE A;  3SIB A;  2OTG C;  4A4B A;  1GQM A;  2BKH B;  2LCP A;  1KWO C;  1JUO A;  2JUL A;  2PVB A;  3KHE A;  4GGF C;  1W7I B;  2F3Y A;  1EJ3 A;  1KFX L;  2OPO A;  1J7O A;  1MXE A;  1AJ5 A;  3O2P A;  4NDD A;  4PE0 A;  5CSI A;  1V1G A;  2KFF A;  2KYF A;  4QJ3 B;  4HRE E;  1B1G A;  3CR2 A;  4DUQ A;  1M46 A;  1M39 A;  3O6B A;  1SL7 A;  1JFK A;  2KSP A;  4U8D A;  2O5G A;  2OS8 B;  4YGE B;  1NX2 A;  2KAV A;  3BXK A;  5AXI A;  3SG3 A;  1EH2 A;  4OKH A;  2KQY A;  1C7W A;  1K9P A;  3RLZ A;  4N1G A;  2LAN A;  4BY5 A;  3A4U B;  1S5G Z;  1LKJ A;  2E6W A;  5JJG A;  3BUM B;  4GPL B;  1DGV A;  3AKA A;  4PHM A;  1ZAC A;  2ZFD A;  4QJ4 B;  1B8L A;  2LV7 A;  1CFF A;  1GGZ A;  3HCM A;  3H4S E;  3CR5 X;  5HLO A;  1YVL A;  4MEW A;  1MWN A;  5HKW A;  2CTN A;  4C0L A;  5HKY A;  1K2H A;  1XFZ O;  2QAC A;  1XA5 A;  1WY9 A;  2MJW B;  2KBM A;  1ZOT B;  4MZL A;  2ZRT A;  2LVJ A;  2LLT A;  1XYD A;  2Q4U A;  3KO0 A;  1U5I B;  2E30 A;  3GK4 X;  3OP0 A;  3VRN A;  1YR5 A;  2D8N A;  2JT0 A;  1FW4 A;  2LE9 B;  4MBE A;  5F6T A;  1EXR A;  1NX1 A;  1YUT A;  4JPZ B;  1DVI A;  2F8P A;  1AVS A;  3SG6 A;  1BU3 A;  2KGB C;  4TNC A;  4ORA B;  1OZS A;  2KI6 C;  2RGI A;  5CSJ A;  3EK8 A;  5FYX A;  1PVB A;  2HQ8 A;  3OX6 A;  1AHR A;  2I7A A;  2COL B;  1K9U A;  1U5I A;  3BUN B;  1YX8 A;  5I2L A;  1K95 A;  1A29 A;  1JF0 A;  1L7Z A;  4ZCV A;  4MRY A;  1XK4 A;  1DTL A;  4CLN A;  5GQQ C;  1CM1 A;  2NCO A;  4GAO A;  1QLS A;  4ICB A;  4PHN A;  1XO5 A;  3D0Y A;  1Y0V H;  1YRT B;  2KI6 D;  2WOS A;  5ER4 X;  5AAN A;  5KTY A;  1R6P A;  2IS9 A;  1IG5 A;  1PVA A;  1SMG A;  2LAP A;  4HSZ A;  2LM5 A;  1ODB A;  2MLF C;  3TDZ A;  1LA3 A;  3SIA A;  1F4Q A;  1OQP A;  4YGC B;  1WRZ A;  2Y1N A;  5K89 A;  2JNX A;  1KQV A;  2AUC A;  3ZNI A;  3LLE A;  1N2D A;  5J3X A;  3AAK A;  1JBA A;  1B9A A;  1EG4 A;  2FOT A;  1K90 D;  2LLS A;  4CFR A;  4OV2 A;  1NCZ A;  1G8I A;  5AFP A;  2KOT A;  3M0W A;  2NLN A;  2KQ6 A;  1QLK A;  3FWB A;  1OSA A;  3OX5 A;  1JSA A;  4AQJ A;  2K7O A;  3OHM B;  1SNL A;  3DD4 A;  2MAZ A;  5I2O A;  1SBJ A;  4MRX A;  1BOC A;  1X02 A;  2LVI A;  3GOF A;  3PM8 A;  2K7D A;  4OVN F;  3EK7 A;  2MHH A;  1A75 B;  1NUB A;  5HKZ A;  4OCI A;  2KGR A;  1MUX A;  1UHN A;  3KF9 A;  4USL A;  4YGA A;  2R2I A;  3LCP C;  1SCM C;  2LMV A;  2L2E A;  4YI9 A;  3TS5 B;  1SL9 A;  5D69 A;  2KHN A;  1OZO A;  2PSR A;  2H2K A;  3ZWH A;  1NCY A;  5I2Q A;  1REC A;  1YVH A;  4WQ3 A;  2ZNE A;  1XFU O;  2M7N A;  1G4Y R;  1UHJ A;  2LMU A;  4N5X A;  4BY4 A;  4F0Z B;  1AK8 A;  1A75 A;  1S1E A;  5CSF A;  1IRJ A;  1IQ5 A;  4Q04 A;  1PAL A;  3CS1 A;  3JVT C;  3TUY C;  1WDC C;  2K7B A;  1BJF A;  1KSO A;  1UP5 A;  1NCX A;  5DKR A;  4UPG A;  1KK7 Y;  2JXL A;  3PAL A;  2GGZ A;  4YGD B;  2ZRS A;  2JOJ A;  1QXP A;  1M63 B;  2KAX A;  1ZUZ A;  4ETO A;  2LP3 A;  1CDL A;  3TS5 C;  1SYM A;  3A8R A;  1YUR A;  4P5O E;  1CFP A;  2BE6 A;  4MZJ A;  3PSR A;  2HF5 A;  2KI4 B;  2JQ6 A;  1KQM C;  1C07 A;  4YGB B;  1M45 A;  5CSN A;  1F8H A;  2Y5I A;  2F3Z A;  3KEV A;  1DJX A;  3MSE B;  3WHU B;  1QVI Z;  1SY9 A;  2ZND A;  5G08 A;  2JWW A;  2KNE A;  3I5H B;  1XVJ A;  1W7J B;  1QIW A;  1S6I A;  3BYA A;  2BKI B;  1IQ3 A;  1OOJ A;  1C7V A;  1JFJ A;  4NQG A;  2K7C A;  2EC6 B;  1TOP A;  1B8C A;  1QS7 A;  1Q80 A;  2B1U A;  1SCV A;  4HRH A;  1MXL C;  1B7T Z;  2CCM A;  5PAL A;  3BUX B;  2OS8 C;  4A4C A;  2K61 A;  2WCE A;  2WOR A;  3CLN A;  1WRK A;  2I94 A;  5IBW A;  1SK6 D;  3CR4 X;  2M49 B;  1SPY A;  2KI4 C;  1BMO A;  1BT6 A;  1UHH A;  1JF2 A;  1KFX S;  4CID A;  3D0Y B;  1TNW A;  3IQO A;  4JWQ A;  1BOD A;  2PRU A;  2L0P A;  3AKB A;  1QAS A;  1RRO A;  2G9B A;  2M1K B;  1JWD A;  3HX4 A;  3DVJ A;  3CZT X;  4NDB A;  1PUL A;  1SRA A;  3VRR A;  1K96 A;  2LVK A;  5DKN A;  1N65 A;  2TN4 A;  3QRX A;  1SL8 A;  3PAT A;  1TNQ A;  1DJG A;  2EC6 C;  2VRG A;  2LVV A;  1UUR A;  3IF7 A;  1KK8 B;  4AQI A;  1DJH A;  4PE7 A;  1F71 A;  3DF0 B;  2JT8 A;  1OMR A;  2KAY A;  1CB1 A;  2P6B B;  1TNP A;  1IH0 A;  1FBV A;  1QIV A;  1RWY A;  1XK4 C;  2JTZ A;  4P2Y B;  1KFU L;  1YX7 A;  1BG1 A;  1HT9 A;  4XJK B;  1CMF A;  4YRU A;  1Y1A A;  1IJ5 A;  2BBN A;  1E8A A;  4PAL A;  3TZ1 A;  1DJY A;  2Q91 A;  3EVV A;  1K8U A;  1BR1 B;  4C0J A;  1AUI B;  1Y1X A;  1YUS A;  2LLU A;  1BF5 A;  2LP2 A;  1FPW A;  3DF0 A;  3WXA A;  1YTZ C;  1A4P A;  1RK9 A;  1HQV A;  1TCO B;  1CFC A;  1K93 D;  1S36 A;  2L50 A;  3I5G B;  2KFG A;  1CLB A;  2CXJ A;  3EVR A;  1S5G Y;  2JC2 A;  2O60 A;  1R2U A;  4XJK A;  2DOQ A;  1QJT A;  2ZN8 A;  3WHT B;  5KSZ A;  1WLM A;  5BPJ A;  3LL8 B;  2ISD A;  1NSH A;  3F45 A;  1OE9 B;  3JTD B;  2AAO A;  1H8B A;  1J55 A;  1SR6 B;  2M1U A;  2BL0 B;  1CMG A;  2F2P A;  1PK0 D;  1SKT A;  2CBL A;  1F4O A; 
#chains in the Genus database with same CATH topology
 5HYD A;  1XFX O;  1CDP A;  1B7T Y;  3B88 A;  1CDM A;  2OTG B;  4GGN A;  1IGV A;  2H61 A;  2HET A;  4OR9 B;  1KWO B;  2HQW A;  3VRO A;  3SS4 A;  5B8I B;  3BOW B;  3O4Y A;  4IL1 A;  5JOL A;  2LC5 A;  4GNK B;  3TDU A;  3VRP A;  1LVC D;  2LUC A;  2JZI A;  2QPT A;  3DYE A;  4L9M A;  2H61 C;  3OB1 B;  4CPV A;  2BBM A;  1CKK A;  3TDI A;  1BLQ A;  5D7F A;  3NSO A;  2L5X B;  2ZKM X;  3ICB A;  1AP4 A;  3LK1 A;  3S0B A;  1QV1 A;  1XFV O;  3BQ3 A;  3D10 A;  1N0Y A;  2QEV A;  3UNW A;  1ZMZ A;  3CTN A;  2L98 A;  3BUW B;  4I5N B;  1CNP A;  3E3R A;  3DXL A;  3B87 A;  3BOW A;  1J1E A;  5DKQ A;  4GGF A;  3SS5 A;  1GJY A;  1S26 D;  3NXA A;  2JT3 A;  2MLE C;  4YI8 A;  1QV0 A;  2BEC A;  4PHK A;  2I2R E;  2BCA A;  4DS7 A;  1MQ1 A;  1QX2 A;  1RJV A;  1EG3 A;  1QX5 B;  1YUU A;  2CNP A;  4WRI A;  1PRW A;  2NXQ A;  2P70 A;  2WCF A;  3DVM A;  4FQO A;  1PSR A;  1Y1U A;  1UHK A;  3CDN A;  1FF1 A;  3SJS A;  2M8U A;  1AJ4 A;  3R72 A;  3R1O A;  4GFT A;  4AOM A;  1A03 A;  1OMV A;  2M97 A;  1GGW A;  2QEB A;  3SG4 A;  1QTX A;  1DJI A;  1J7P A;  1OMD A;  1XFW O;  3KPX A;  1TTX A;  2K2F A;  3N7H A;  3IQQ A;  3DY9 A;  1DT7 B;  1WLZ A;  1UUS A;  4C0K A;  2JRF A;  1MHO A;  2MRD A;  4WQ2 A;  1DC1 A;  1KCY A;  2EGD A;  2L51 A;  3EVU A;  3VGO A;  3L47 A;  1LA0 A;  3PN7 B;  2FCE A;  4M2Q A;  5ER5 A;  4M2P A;  1IWQ A;  3O78 A;  4XYN A;  1B4C A;  1J7Q A;  3WNX B;  3BUO B;  3I5F B;  1F55 A;  2Y1M A;  3D74 A;  3D76 A;  1MR8 A;  2WCB A;  4E68 A;  3PLF B;  5AEQ A;  1UWO A;  2WCK A;  3IVT A;  1FI5 A;  5TNC A;  3L4L A;  2GGM A;  2FJY A;  4PE4 A;  4GUK A;  2LNK A;  2JPT A;  2L4I A;  2MA2 A;  4ORC B;  3CZ1 A;  3FS7 A;  4JQ0 D;  1OOF A;  5CPV A;  2K2A A;  4MLW A;  1PSB A;  1S3P A;  1FI6 A;  2WC8 A;  2K0J A;  3FIA A;  2NCP A;  4PHJ A;  3C1V A;  1TNX A;  3I5H C;  2YGU A;  2BCX A;  1IJ6 A;  2V53 A;  2BE4 A;  2ZN9 A;  3NSI A;  4CFQ A;  1KSM A;  1J1D A;  3SG5 A;  2PAS A;  4GBA A;  3SG2 A;  2NZ0 A;  1JC2 A;  2AMI A;  2QEO A;  1ALV A;  3PN7 C;  3VRQ A;  3GK2 A;  2GV5 A;  3AAJ A;  4MVF A;  1LIN A;  1NX3 A;  3EG5 B;  1CLM A;  1G33 A;  2JNF A;  3I5F C;  1L2O B;  3GK1 A;  2KYC A;  4MZK A;  4QJ5 B;  5D3O A;  4I5J A;  4HRG A;  2FJU B;  2KPH A;  4FTG A;  1CM4 A;  4DCK A;  2F2O A;  1J7R A;  1DJW A;  2SAS A;  2I18 A;  2PAL A;  4OZD A;  4ZCU A;  1T14 A;  1H4B A;  1DF0 B;  1LS8 A;  4I5K A;  1CTR A;  3NSK A;  1A2X A;  2WCL A;  4I5L B;  1CDN A;  1KK7 Z;  4MN0 A;  4D1E A;  2CT9 A;  2F33 A;  2LHI A;  4PCW A;  3LK0 A;  3PFV A;  1IIO A;  2L4H A;  1NP8 A;  2M0R A;  4MSP A;  3CGA A;  2HPS A;  1IKU A;  2K8M B;  1NIW A;  2JU0 A;  1KK8 C;  1RTP 1;  2KLE A;  3EKJ A;  3OB2 B;  1DJZ A;  1NWD A;  4NDC A;  1L2O C;  1QVI Y;  1WRL A;  1F54 A;  1NX0 A;  1DF0 A;  3Q8I A;  1SCM B;  4DIR A;  4INW A;  2A4J A;  1VRK A;  5EL2 A;  1QAT A;  1TN4 A;  1D1O A;  1DMO A;  1UHI A;  2P71 A;  1B47 A;  1Y6W A;  1K9K A;  1SW8 A;  3I5I B;  1CLL A;  2EHB A;  2MBX A;  4YBH B;  3DVK A;  3NSL A;  1K94 A;  2KDH A;  1S6C A;  1QX7 A;  5I8N A;  1S6J A;  2BCB A;  1RFJ A;  3SG7 A;  4PDZ A;  1B8R A;  1DQE A;  1NYA A;  1OOI X;  1DGU A;  1OW4 A;  5HLV A;  4M2O A;  1EL4 A;  2LUX A;  2K60 A;  3JVT B;  3TUY B;  1NPQ A;  1WDC B;  3RM1 A;  3CWG A;  3I5G C;  4PE1 A;  1ZFS A;  3EKH A;  1MF8 B;  4DRW A;  2KBI A;  4R1E A;  1TRF A;  1KFU S;  3FWC A;  5KU1 A;  2JXC A;  1YRU B;  2M3W A;  1F70 A;  2Y4Q A;  1LXF C;  2SCP A;  5FI2 A;  1ALW A;  4IJ7 A;  2LHL A;  3JTD C;  3K21 A;  2G2B A;  1M31 A;  1SR6 C;  2FCD A;  2WC5 A;  5AER A;  2BL0 C;  1V1F A;  3EK4 A;  2WND A;  1TIZ A;  2M9G A;  3I5I C;  4N1F A;  3NHI A;  1BR4 B;  2LMT A;  2M29 A;  2JTT A;  4ORB B;  1CFD A;  1KQM B;  1XFY O;  2KFH A;  1TCF A;  2PMY A;  3DVE A;  3SIB A;  2OTG C;  4A4B A;  1GQM A;  2BKH B;  2LCP A;  2BNX A;  1KWO C;  1JUO A;  2JUL A;  2PVB A;  3KHE A;  4GGF C;  1W7I B;  2F3Y A;  1EJ3 A;  1KFX L;  1SSE B;  2OPO A;  1J7O A;  1MXE A;  1AJ5 A;  3B7A A;  3O2P A;  4NDD A;  4PE0 A;  3L4A A;  3D75 A;  5CSI A;  1V1G A;  2KFF A;  2KYF A;  4QJ3 B;  4HRE E;  1B1G A;  3CR2 A;  4DUQ A;  3PJI A;  2M7L A;  1M46 A;  1M39 A;  3O6B A;  1SL7 A;  1JFK A;  2KSP A;  4U8D A;  2O5G A;  2OS8 B;  4YGE B;  1NX2 A;  2KAV A;  3BXK A;  5AXI A;  3UO9 A;  3SG3 A;  1ORG A;  4OKH A;  1EH2 A;  2KQY A;  1C7W A;  1K9P A;  2PYQ A;  3RLZ A;  4N1G A;  1GM0 A;  2LAN A;  2H8V A;  4BY5 A;  3A4U B;  1S5G Z;  1LKJ A;  2E6W A;  1QWV A;  3BUM B;  3CZ0 A;  4GPL B;  5JJG A;  1DGV A;  3AKA A;  4PHM A;  1TUJ A;  1ZAC A;  2WCJ A;  2ZFD A;  4QJ4 B;  1B8L A;  2LV7 A;  1CFF A;  1GGZ A;  3HCM A;  3H4S E;  3CR5 X;  5HLO A;  1YVL A;  4MEW A;  1MWN A;  5HKW A;  2CTN A;  3NHT A;  4C0L A;  5HKY A;  1XFZ O;  1K2H A;  2QAC A;  1XA5 A;  1WY9 A;  2MJW B;  2KBM A;  1ZOT B;  4MZL A;  2ZRT A;  2LVJ A;  2LLT A;  1XYD A;  2Q4U A;  3S0F A;  3KO0 A;  1U5I B;  2E30 A;  3GK4 X;  3OP0 A;  3R1V A;  3VRN A;  2WCM A;  3RZS A;  1C3Y A;  1YR5 A;  2D8N A;  2JT0 A;  1FW4 A;  2LE9 B;  4MBE A;  1DEL A;  2QEH A;  5F6T A;  1EXR A;  1NX1 A;  1YUT A;  4JPZ B;  1DVI A;  2F8P A;  4JKT A;  1AVS A;  3SG6 A;  1BU3 A;  2KGB C;  3VB1 A;  4TNC A;  4ORA B;  1OZS A;  2KI6 C;  3NGV A;  2RGI A;  5CSJ A;  3EK8 A;  5FYX A;  1PVB A;  2HQ8 A;  3BFA A;  3OX6 A;  1AHR A;  2I7A A;  2COL B;  1K9U A;  3S0D A;  3CAB A;  1U5I A;  3BUN B;  1YX8 A;  5I2L A;  1K95 A;  3B6X A;  1A29 A;  1JF0 A;  1L7Z A;  4ZCV A;  4MRY A;  1XK4 A;  1DTL A;  3SS3 A;  4CLN A;  5GQQ C;  1CM1 A;  2NCO A;  4GAO A;  1QLS A;  4ICB A;  4PHN A;  4F7F A;  1XO5 A;  3D0Y A;  1Y0V H;  1YRT B;  2KI6 D;  2WOS A;  5ER4 X;  5AAN A;  5KTY A;  1R6P A;  2IS9 A;  1IG5 A;  1PVA A;  1SMG A;  2LAP A;  4HSZ A;  2LM5 A;  5HL1 A;  1ODB A;  2MLF C;  3OGN A;  3TDZ A;  1LA3 A;  3CZ2 A;  3SIA A;  1TUZ A;  1F4Q A;  1OQP A;  4YGC B;  1WRZ A;  2Y1N A;  5K89 A;  1DEK A;  2JNX A;  1KQV A;  2AUC A;  3ZNI A;  3LLE A;  1N2D A;  5J3X A;  3AAK A;  1JBA A;  3OBV A;  1B9A A;  1EG4 A;  2FOT A;  4PT1 A;  1K90 D;  2LLS A;  4CFR A;  4OV2 A;  1NCZ A;  1G8I A;  5AFP A;  2KOT A;  3M0W A;  2NLN A;  2KQ6 A;  1QLK A;  3FWB A;  1OSA A;  3OX5 A;  1JSA A;  4AQJ A;  2K7O A;  3OHM B;  1SNL A;  3DD4 A;  2MAZ A;  5I2O A;  1SBJ A;  4MRX A;  1BOC A;  1X02 A;  2LVI A;  3GOF A;  3PM8 A;  2K7D A;  4OVN F;  3EK7 A;  2MHH A;  1A75 B;  1NUB A;  5HKZ A;  2L5Y A;  2KGR A;  4OCI A;  1MUX A;  1UHN A;  3KF9 A;  2L2C A;  4USL A;  4YGA A;  2R2I A;  3LCP C;  1SCM C;  2LMV A;  2L2E A;  5FI6 A;  4YI9 A;  3TS5 B;  1SL9 A;  5D69 A;  3V2L A;  5I94 A;  2KHN A;  1OZO A;  2PSR A;  2H2K A;  3ZWH A;  1C3Z A;  4FQT A;  1NCY A;  5I2Q A;  3PM2 A;  1REC A;  1YVH A;  4WQ3 A;  3O4X A;  2ZNE A;  1XFU O;  2M7N A;  1G4Y R;  1UHJ A;  2KLD A;  2LMU A;  4N5X A;  4BY4 A;  1OOG A;  4F0Z B;  1AK8 A;  3DZT A;  1A75 A;  1S1E A;  1Z4H A;  5CSF A;  1IRJ A;  1IQ5 A;  3K1E A;  4Q04 A;  1PAL A;  3CS1 A;  3JVT C;  3TUY C;  1WDC C;  2K7B A;  1BJF A;  2JPO A;  1KSO A;  1UP5 A;  1NCX A;  5DKR A;  4UPG A;  2PQL A;  1KK7 Y;  2JXL A;  3PAL A;  2GGZ A;  4YGD B;  2ZRS A;  2JOJ A;  1QXP A;  1M63 B;  1Z2C B;  1ZUZ A;  2KAX A;  4ETO A;  2LP3 A;  1CDL A;  3TS5 C;  1SYM A;  3A8R A;  1YUR A;  4P5O E;  1CFP A;  2BE6 A;  4KYN A;  4MZJ A;  5FI7 A;  3PSR A;  2HF5 A;  2KI4 B;  2JQ6 A;  3BJH A;  1KQM C;  2QDI A;  1C07 A;  4YGB B;  1M45 A;  5CSN A;  1F8H A;  2Y5I A;  2F3Z A;  3KEV A;  1DJX A;  3MSE B;  3WHU B;  1QVI Z;  1SY9 A;  2ZND A;  5G08 A;  2JWW A;  2KNE A;  3I5H B;  1XFR A;  1W7J B;  1QIW A;  1S6I A;  1XVJ A;  3BYA A;  2BKI B;  3D78 A;  1OOJ A;  1IQ3 A;  1C7V A;  1JFJ A;  4NQG A;  3BFB A;  2K7C A;  2EC6 B;  1TOP A;  1B8C A;  2WCH A;  1QS7 A;  1Q80 A;  2B1U A;  1SCV A;  4HRH A;  1MXL C;  1B7T Z;  2CCM A;  5PAL A;  1OOH A;  3BUX B;  2OS8 C;  4A4C A;  3FE8 A;  1P28 A;  2K61 A;  2WCE A;  3S0G A;  2WOR A;  3CLN A;  1WRK A;  2I94 A;  5IBW A;  1SK6 D;  2ERB A;  3CR4 X;  2M49 B;  1SPY A;  2KI4 C;  1BMO A;  1BT6 A;  1UHH A;  3CYZ A;  1JF2 A;  1KFX S;  4CID A;  3D0Y B;  1TNW A;  3IQO A;  4JWQ A;  3FE6 A;  1BOD A;  2PRU A;  2L0P A;  3AKB A;  1QAS A;  1RRO A;  2G9B A;  2M1K B;  3FE9 A;  3HX4 A;  1JWD A;  3DVJ A;  3CZT X;  4NDB A;  1PUL A;  1SRA A;  3VRR A;  1K96 A;  2LVK A;  5DKN A;  1N65 A;  2TN4 A;  3QRX A;  1SL8 A;  3PAT A;  1TNQ A;  1DJG A;  2EC6 C;  2VRG A;  2LVV A;  1UUR A;  2GTE A;  3IF7 A;  1KK8 B;  4AQI A;  1DJH A;  4PE7 A;  1F71 A;  3DF0 B;  3R1P A;  2JT8 A;  3D73 A;  1OMR A;  2KAY A;  1CB1 A;  2P6B B;  1TNP A;  1IH0 A;  1FBV A;  1QIV A;  1RWY A;  1XK4 C;  2JTZ A;  4P2Y B;  1KFU L;  1YX7 A;  5DIC A;  1BG1 A;  1HT9 A;  4XJK B;  1CMF A;  4YRU A;  1Y1A A;  1IJ5 A;  2BBN A;  1E8A A;  4PAL A;  3TZ1 A;  1DJY A;  3S0E A;  2BAP A;  2Q91 A;  3EVV A;  1K8U A;  1BR1 B;  4C0J A;  1AUI B;  1Y1X A;  1YUS A;  1W9Z A;  2LLU A;  1BF5 A;  2LP2 A;  4JD9 A;  1FPW A;  3DF0 A;  1TWO A;  3WXA A;  3BFH A;  1YTZ C;  1A4P A;  1RK9 A;  1HQV A;  1TCO B;  3B86 A;  1K93 D;  1CFC A;  1S36 A;  2L50 A;  3I5G B;  2KFG A;  1CLB A;  2CXJ A;  3EVR A;  1S5G Y;  2JC2 A;  2O60 A;  1R2U A;  4XJK A;  2DOQ A;  1QJT A;  2ZN8 A;  4INX A;  3WHT B;  5KSZ A;  1WLM A;  5BPJ A;  3LL8 B;  2ISD A;  1NSH A;  2WC6 A;  3F45 A;  1OE9 B;  3JTD B;  3QME A;  3S0A A;  3D77 A;  2AAO A;  1H8B A;  1J55 A;  1SR6 B;  2M1U A;  2BL0 B;  1CMG A;  2F2P A;  1PK0 D;  1SKT A;  2CBL A;  1F4O A; 
#chains in the Genus database with same CATH homology
 5HYD A;  1XFX O;  1CDP A;  1B7T Y;  1CDM A;  2OTG B;  4GGN A;  1IGV A;  2H61 A;  2HET A;  4OR9 B;  1KWO B;  2HQW A;  3VRO A;  5B8I B;  3BOW B;  3O4Y A;  4IL1 A;  5JOL A;  2LC5 A;  4GNK B;  3TDU A;  3VRP A;  1LVC D;  2LUC A;  2JZI A;  2QPT A;  4L9M A;  2H61 C;  3OB1 B;  4CPV A;  2BBM A;  1CKK A;  3TDI A;  1BLQ A;  5D7F A;  3NSO A;  2L5X B;  2ZKM X;  3ICB A;  1AP4 A;  3LK1 A;  1QV1 A;  1XFV O;  3BQ3 A;  3D10 A;  1N0Y A;  1ZMZ A;  3CTN A;  2L98 A;  3BUW B;  4I5N B;  1CNP A;  3E3R A;  3BOW A;  1J1E A;  5DKQ A;  4GGF A;  1GJY A;  1S26 D;  3NXA A;  2JT3 A;  2MLE C;  4YI8 A;  1QV0 A;  2BEC A;  4PHK A;  2I2R E;  2BCA A;  4DS7 A;  1MQ1 A;  1QX2 A;  1RJV A;  1EG3 A;  1QX5 B;  1YUU A;  2CNP A;  4WRI A;  1PRW A;  2NXQ A;  2WCF A;  3DVM A;  4FQO A;  1PSR A;  1Y1U A;  1UHK A;  1FF1 A;  3SJS A;  2M8U A;  1AJ4 A;  4GFT A;  4AOM A;  1A03 A;  1GGW A;  1OMV A;  2M97 A;  3SG4 A;  1QTX A;  1DJI A;  1J7P A;  1OMD A;  1XFW O;  3KPX A;  1TTX A;  2K2F A;  3IQQ A;  1DT7 B;  1WLZ A;  1UUS A;  4C0K A;  2JRF A;  1MHO A;  2MRD A;  4WQ2 A;  1KCY A;  2EGD A;  2L51 A;  3EVU A;  3VGO A;  3PN7 B;  1LA0 A;  5ER5 A;  2FCE A;  4M2Q A;  2M7L A;  4M2P A;  1IWQ A;  3O78 A;  4XYN A;  1B4C A;  1J7Q A;  3WNX B;  3BUO B;  3I5F B;  1F55 A;  2Y1M A;  1MR8 A;  2WCB A;  4E68 A;  3PLF B;  5AEQ A;  1UWO A;  1FI5 A;  5TNC A;  2GGM A;  4PE4 A;  4GUK A;  2LNK A;  2JPT A;  2L4I A;  2MA2 A;  4ORC B;  3FS7 A;  4JQ0 D;  5CPV A;  2K2A A;  4MLW A;  1PSB A;  1S3P A;  1FI6 A;  2WC8 A;  2K0J A;  3FIA A;  2NCP A;  4PHJ A;  3C1V A;  1TNX A;  3I5H C;  2BCX A;  1IJ6 A;  2V53 A;  2BE4 A;  2ZN9 A;  3NSI A;  4CFQ A;  1KSM A;  1J1D A;  3SG5 A;  2PAS A;  4GBA A;  3SG2 A;  2NZ0 A;  1JC2 A;  2AMI A;  1ALV A;  3PN7 C;  3VRQ A;  3GK2 A;  2GV5 A;  3AAJ A;  4MVF A;  1LIN A;  1NX3 A;  1CLM A;  1G33 A;  2JNF A;  3I5F C;  1L2O B;  3GK1 A;  2KYC A;  4MZK A;  4QJ5 B;  4I5J A;  4HRG A;  2FJU B;  4FTG A;  1CM4 A;  4DCK A;  2F2O A;  1J7R A;  1DJW A;  2SAS A;  2I18 A;  2PAL A;  4ZCU A;  1H4B A;  1DF0 B;  4I5K A;  1CTR A;  3NSK A;  1A2X A;  4I5L B;  1CDN A;  1KK7 Z;  4MN0 A;  4D1E A;  2CT9 A;  2F33 A;  2LHI A;  4PCW A;  3LK0 A;  3PFV A;  2L4H A;  1NP8 A;  2M0R A;  4MSP A;  3CGA A;  2HPS A;  1IKU A;  2K8M B;  1NIW A;  2JU0 A;  1KK8 C;  1RTP 1;  3OB2 B;  3EKJ A;  1DJZ A;  1NWD A;  4NDC A;  1L2O C;  1QVI Y;  1WRL A;  1F54 A;  1NX0 A;  1DF0 A;  1SCM B;  4DIR A;  2A4J A;  1VRK A;  1QAT A;  1TN4 A;  1D1O A;  1DMO A;  1UHI A;  1B47 A;  1Y6W A;  1K9K A;  1SW8 A;  3I5I B;  1CLL A;  2EHB A;  2MBX A;  4YBH B;  3DVK A;  3NSL A;  1K94 A;  2KDH A;  1S6C A;  1QX7 A;  5I8N A;  1S6J A;  2BCB A;  1RFJ A;  3SG7 A;  4PDZ A;  1B8R A;  1NYA A;  5HLV A;  1DGU A;  4M2O A;  1EL4 A;  2LUX A;  3JVT B;  3TUY B;  1NPQ A;  1WDC B;  3RM1 A;  3CWG A;  3I5G C;  4PE1 A;  1ZFS A;  3EKH A;  1MF8 B;  4DRW A;  2KBI A;  4R1E A;  1TRF A;  1KFU S;  3FWC A;  5KU1 A;  2JXC A;  1YRU B;  2M3W A;  1F70 A;  2Y4Q A;  1LXF C;  2SCP A;  1ALW A;  2LHL A;  3JTD C;  3K21 A;  2G2B A;  1M31 A;  1SR6 C;  2FCD A;  5AER A;  2BL0 C;  1V1F A;  3EK4 A;  2WND A;  1TIZ A;  2M9G A;  3I5I C;  4N1F A;  1BR4 B;  2LMT A;  2M29 A;  2JTT A;  4ORB B;  1CFD A;  1KQM B;  1XFY O;  2KFH A;  1TCF A;  2PMY A;  3DVE A;  3SIB A;  2OTG C;  4A4B A;  1GQM A;  2BKH B;  2LCP A;  1KWO C;  1JUO A;  2JUL A;  2PVB A;  3KHE A;  4GGF C;  1W7I B;  2F3Y A;  1EJ3 A;  1KFX L;  2OPO A;  1J7O A;  1MXE A;  1AJ5 A;  3O2P A;  4NDD A;  4PE0 A;  5CSI A;  1V1G A;  2KFF A;  2KYF A;  4QJ3 B;  4HRE E;  1B1G A;  3CR2 A;  4DUQ A;  1M46 A;  1M39 A;  3O6B A;  1SL7 A;  1JFK A;  2KSP A;  4U8D A;  2O5G A;  2OS8 B;  4YGE B;  1NX2 A;  2KAV A;  3BXK A;  5AXI A;  3SG3 A;  1EH2 A;  4OKH A;  2KQY A;  1C7W A;  1K9P A;  3RLZ A;  4N1G A;  2LAN A;  4BY5 A;  3A4U B;  1S5G Z;  1LKJ A;  2E6W A;  5JJG A;  3BUM B;  4GPL B;  1DGV A;  3AKA A;  4PHM A;  1ZAC A;  2ZFD A;  4QJ4 B;  1B8L A;  2LV7 A;  1CFF A;  1GGZ A;  3HCM A;  3H4S E;  3CR5 X;  5HLO A;  1YVL A;  4MEW A;  1MWN A;  5HKW A;  2CTN A;  4C0L A;  5HKY A;  1K2H A;  1XFZ O;  2QAC A;  1XA5 A;  1WY9 A;  2MJW B;  2KBM A;  1ZOT B;  4MZL A;  2ZRT A;  2LVJ A;  2LLT A;  1XYD A;  2Q4U A;  3KO0 A;  1U5I B;  2E30 A;  3GK4 X;  3OP0 A;  3VRN A;  1YR5 A;  2D8N A;  2JT0 A;  1FW4 A;  2LE9 B;  4MBE A;  5F6T A;  1EXR A;  1NX1 A;  1YUT A;  4JPZ B;  1DVI A;  2F8P A;  1AVS A;  3SG6 A;  1BU3 A;  2KGB C;  4TNC A;  4ORA B;  1OZS A;  2KI6 C;  2RGI A;  5CSJ A;  3EK8 A;  5FYX A;  1PVB A;  2HQ8 A;  3OX6 A;  1AHR A;  2I7A A;  2COL B;  1K9U A;  1U5I A;  3BUN B;  1YX8 A;  5I2L A;  1K95 A;  1A29 A;  1JF0 A;  1L7Z A;  4ZCV A;  4MRY A;  1XK4 A;  1DTL A;  4CLN A;  5GQQ C;  1CM1 A;  2NCO A;  4GAO A;  1QLS A;  4ICB A;  4PHN A;  1XO5 A;  3D0Y A;  1Y0V H;  1YRT B;  2KI6 D;  2WOS A;  5ER4 X;  5AAN A;  5KTY A;  1R6P A;  2IS9 A;  1IG5 A;  1PVA A;  1SMG A;  2LAP A;  4HSZ A;  2LM5 A;  1ODB A;  2MLF C;  3TDZ A;  1LA3 A;  3SIA A;  1F4Q A;  1OQP A;  4YGC B;  1WRZ A;  2Y1N A;  5K89 A;  2JNX A;  1KQV A;  2AUC A;  3ZNI A;  3LLE A;  1N2D A;  5J3X A;  3AAK A;  1JBA A;  1B9A A;  1EG4 A;  2FOT A;  1K90 D;  2LLS A;  4CFR A;  4OV2 A;  1NCZ A;  1G8I A;  5AFP A;  2KOT A;  3M0W A;  2NLN A;  2KQ6 A;  1QLK A;  3FWB A;  1OSA A;  3OX5 A;  1JSA A;  4AQJ A;  2K7O A;  3OHM B;  1SNL A;  3DD4 A;  2MAZ A;  5I2O A;  1SBJ A;  4MRX A;  1BOC A;  1X02 A;  2LVI A;  3GOF A;  3PM8 A;  2K7D A;  4OVN F;  3EK7 A;  2MHH A;  1A75 B;  1NUB A;  5HKZ A;  4OCI A;  2KGR A;  1MUX A;  1UHN A;  3KF9 A;  4USL A;  4YGA A;  2R2I A;  3LCP C;  1SCM C;  2LMV A;  2L2E A;  4YI9 A;  3TS5 B;  1SL9 A;  5D69 A;  2KHN A;  1OZO A;  2PSR A;  2H2K A;  3ZWH A;  1NCY A;  5I2Q A;  1REC A;  1YVH A;  4WQ3 A;  2ZNE A;  1XFU O;  2M7N A;  1G4Y R;  1UHJ A;  2LMU A;  4N5X A;  4BY4 A;  4F0Z B;  1AK8 A;  1A75 A;  1S1E A;  5CSF A;  1IRJ A;  1IQ5 A;  4Q04 A;  1PAL A;  3CS1 A;  3JVT C;  3TUY C;  1WDC C;  2K7B A;  1BJF A;  1KSO A;  1UP5 A;  1NCX A;  5DKR A;  4UPG A;  1KK7 Y;  2JXL A;  3PAL A;  2GGZ A;  4YGD B;  2ZRS A;  2JOJ A;  1QXP A;  1M63 B;  2KAX A;  1ZUZ A;  4ETO A;  2LP3 A;  1CDL A;  3TS5 C;  1SYM A;  3A8R A;  1YUR A;  4P5O E;  1CFP A;  2BE6 A;  4MZJ A;  3PSR A;  2HF5 A;  2KI4 B;  2JQ6 A;  1KQM C;  1C07 A;  4YGB B;  1M45 A;  5CSN A;  1F8H A;  2Y5I A;  2F3Z A;  3KEV A;  1DJX A;  3MSE B;  3WHU B;  1QVI Z;  1SY9 A;  2ZND A;  5G08 A;  2JWW A;  2KNE A;  3I5H B;  1XVJ A;  1W7J B;  1QIW A;  1S6I A;  3BYA A;  2BKI B;  1IQ3 A;  1OOJ A;  1C7V A;  1JFJ A;  4NQG A;  2K7C A;  2EC6 B;  1TOP A;  1B8C A;  1QS7 A;  1Q80 A;  2B1U A;  1SCV A;  4HRH A;  1MXL C;  1B7T Z;  2CCM A;  5PAL A;  3BUX B;  2OS8 C;  4A4C A;  2K61 A;  2WCE A;  2WOR A;  3CLN A;  1WRK A;  2I94 A;  5IBW A;  1SK6 D;  3CR4 X;  2M49 B;  1SPY A;  2KI4 C;  1BMO A;  1BT6 A;  1UHH A;  1JF2 A;  1KFX S;  4CID A;  3D0Y B;  1TNW A;  3IQO A;  4JWQ A;  1BOD A;  2PRU A;  2L0P A;  3AKB A;  1QAS A;  1RRO A;  2G9B A;  2M1K B;  1JWD A;  3HX4 A;  3DVJ A;  3CZT X;  4NDB A;  1PUL A;  1SRA A;  3VRR A;  1K96 A;  2LVK A;  5DKN A;  1N65 A;  2TN4 A;  3QRX A;  1SL8 A;  3PAT A;  1TNQ A;  1DJG A;  2EC6 C;  2VRG A;  2LVV A;  1UUR A;  3IF7 A;  1KK8 B;  4AQI A;  1DJH A;  4PE7 A;  1F71 A;  3DF0 B;  2JT8 A;  1OMR A;  2KAY A;  1CB1 A;  2P6B B;  1TNP A;  1IH0 A;  1FBV A;  1QIV A;  1RWY A;  1XK4 C;  2JTZ A;  4P2Y B;  1KFU L;  1YX7 A;  1BG1 A;  1HT9 A;  4XJK B;  1CMF A;  4YRU A;  1Y1A A;  1IJ5 A;  2BBN A;  1E8A A;  4PAL A;  3TZ1 A;  1DJY A;  2Q91 A;  3EVV A;  1K8U A;  1BR1 B;  4C0J A;  1AUI B;  1Y1X A;  1YUS A;  2LLU A;  1BF5 A;  2LP2 A;  1FPW A;  3DF0 A;  3WXA A;  1YTZ C;  1A4P A;  1RK9 A;  1HQV A;  1TCO B;  1CFC A;  1K93 D;  1S36 A;  2L50 A;  3I5G B;  2KFG A;  1CLB A;  2CXJ A;  3EVR A;  1S5G Y;  2JC2 A;  2O60 A;  1R2U A;  4XJK A;  2DOQ A;  1QJT A;  2ZN8 A;  3WHT B;  5KSZ A;  1WLM A;  5BPJ A;  3LL8 B;  2ISD A;  1NSH A;  3F45 A;  1OE9 B;  3JTD B;  2AAO A;  1H8B A;  1J55 A;  1SR6 B;  2M1U A;  2BL0 B;  1CMG A;  2F2P A;  1PK0 D;  1SKT A;  2CBL A;  1F4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...