4GGFA

Crystal structure of mn2+ bound calprotectin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
89
structure length
89
Chain Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antimicrobial protein
total genus 36
structure length 89
sequence length 89
chains with identical sequence K, S, U
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ggfA00
3TDUA 4DUQA 1KFXS 1R2UA 2KGBC 2JPTA 2GV5A 3RM1A 2M29A 1KFUS 3KPXA 1AVSA 3TZ1A 1ZMZA 2KAYA 2MHHA 1DF0B 2K7BA 1QLKA 2WCEA 3C1VA 1KFXL 2ZN9A 2JC2A 3AAKA 2JU0A 4M2OA 1UWOA 4NQGA 2ZNEA 2MLEC 4WRIA 1KFUL 1Y1XA 2LC5A 4AOMA 1PK0D 2LVKA 2PSRA 1KWOB 2WCFA 1YRUB 1J7PA 1S5GY 3AAJA 2PASA 3CLNA 1JF0A 1CLLA 2JZIA 2LVJA 4PHKA 4BY5A 2RGIA 2CBLA 1BR1B 1IRJA 1B1GA 2E6WA 2LVVA 2JOJA 2LHLA 4I5NB 3SJSA 2P6BB 1J7QA 1MF8B 1SR6C 1NWDA 1S5GZ 2VRGA 2ZRSA 4A4BA 1DVIA 1K9PA 1B8CA 2FJUB 2IS9A 2PVBA 1K95A 4PDZA 3FWBA 1M46A 3GK2A 1UP5A 4YBHB 1NPQA 1OE9B 2CNPA 3NSIA 3A4UB 4PE1A 5CPVA 4C0LA 1J55A 1MQ1A 1RJVA 3I5HC 3MSEB 1CLMA 2LCPA 4MVFA 1TOPA 4MZJA 1IWQA 4ZCUA 3DF0A 2TN4A 3EVVA 3BYAA 1PRWA 2L5XB 3CZTX 1NUBA 2AUCA 2LUCA 5I2QA 3DVEA 3NSKA 1LA3A 1Y1UA 1NIWA 3ICBA 3JTDB 2BCAA 2JTTA 1KSOA 1A2XA 2LLTA 2M49B 2K7CA 5I8NA 4YRUA 3I5HB 2F3YA 1SRAA 1ALWA 1XVJA 2WNDA 4TNCA 1NCXA 3VGOA 5JOLA 2JXLA 1FPWA 1N0YA 5AXIA 1CDPA 2KSPA 2ZKMX 4FTGA 3IQOA 5K89A 1GGWA 2MA2A 1J7RA 1B8LA 3PATA 2V53A 1WRZA 2LV7A 1ZFSA 2LVIA 3KEVA 1IJ6A 1NSHA 2BECA 5F6TA 3HX4A 3SG5A 2E30A 1OZSA 2LLUA 1KK8C 5J3XA 1GGZA 4AQIA 4JPZB 4MLWA 5JJGA 4DS7A 1OOJA 2G2BA 3SG3A 1X02A 1EG3A 1J1DA 3WXAA 3CGAA 2WCBA 5KU1A 2JT3A 2PRUA 1GJYA 1N65A 2LLSA 4MZKA 1KQMC 3KF9A 2HQ8A 3BQ3A 4GPLB 3WHTB 4MN0A 5ER4X 1PVAA 3LK1A 2L2EA 4QJ3B 1DT7B 1TRFA 2KGRA 2KBIA 2EGDA 1ZACA 3SG4A 2JRFA 2K61A 3EK7A 5DKQA 4XJKA 3DVJA 1KK8B 4PE7A 4YGBB 1F71A 2KI6D 3OP0A 2K2AA 1SKTA 5KSZA 1IQ3A 1LINA 3KHEA 2NCOA 2PALA 3WHUB 3CTNA 1B8RA 1U5IB 2JTZA 3EVRA 4IL1A 1SL9A 2BL0C 4HRGA 2KI6C 3I5FC 1BU3A 1DJWA 1BOCA 1KCYA 1AHRA 2B1UA 2BCBA 1LVCD 3LK0A 4XYNA 3M0WA 1YX8A 1KSMA 3OX5A 1QXPA 4PALA 1DJGA 4ETOA 3LCPC 1F55A 3EK4A 1W7IB 2LMTA 3D0YA 1OMRA 1YUUA 2KQYA 3DD4A 3EVUA 3BXKA 1SCMC 4OVNF 1MUXA 2H61A 4I5LB 3I5FB 1K96A 5DKNA 1BG1A 4GAOA 4GNKB 4MBEA 5D7FA 3IQQA 3SG6A 4USLA 2QACA 1BF5A 1TNWA 4R1EA 1PSBA 1CB1A 1YR5A 4JQ0D 3VRRA 2Y1MA 1QX2A 2JT0A 3OHMB 2BE4A 3ZWHA 1XFZO 4C0JA 1NX3A 1UHIA 2JULA 2K7OA 2ISDA 1HT9A 3EKHA 5IBWA 1W7JB 5CSJA 2JNXA 1TNPA 2L51A 1XFVO 3TS5C 3SIBA 1SCMB 1SCVA 2KNEA 5HKWA 1IGVA 4ORBB 2GGMA 2LAPA 1DF0A 5D69A 3EKJA 1S6IA 2MJWB 5AEQA 2KQ6A 1CFDA 2CCMA 5TNCA 1CFFA 1WLMA 2JT8A 1YURA 1HQVA 2HF5A 4MZLA 2A4JA 1RROA 3WNXB 1YUSA 1XA5A 1QV0A 1EG4A 2CXJA 2O60A 1QATA 1AJ5A 1A75B 5G08A 1K90D 2H2KA 1DJIA 3CWGA 4OCIA 2NXQA 2KFFA 2LMUA 2KAXA 4OV2A 4N1FA 4P5OE 3TS5B 3AKBA 1AUIB 1S1EA 3OB1B 3DVKA 3PLFB 1CDMA 1SR6B 3OB2B 2HPSA 1IQ5A 3CR2A 1NYAA 1WY9A 3TUYC 2WORA 1RWYA 4MEWA 1XFUO 3I5GC 5PALA 1WDCC 2PMYA 1G33A 3O4YA 1K9KA 4P2YB 1SY9A 1YVHA 2EC6C 1CM1A 2K8MB 2SCPA 1NX2A 4QJ4B 4NDBA 1XFWO 2G9BA 1V1FA 1Y0VH 1TNXA 1Q80A 1C7WA 1ALVA 1S26D 1YTZC 5I2OA 3ZNIA 1OZOA 2ZRTA 2DOQA 1XK4A 1BJFA 1QIWA 2D8NA 3BUWB 5HLVA 2M3WA 1JFJA 3NXAA 1H8BA 2K2FA 2EHBA 1RTP1 2JQ6A 1IG5A 3HCMA 4GGFA 2AMIA 3TUYB 4CLNA 3I5GB 3NSLA 1WDCB 3I5IC 3VRPA 1XFYO 1NX0A 2EC6B 4M2PA 4OKHA 1M63B 3CS1A 1QX5B 1DGUA 2SASA 4N1GA 1PALA 1CDLA 1YUTA 1DMOA 1TTXA 3GOFA 2AAOA 2NLNA 2BKIB 2KBMA 4UPGA 1C7VA 1AK8A 1OQPA 5CSFA 4YGEB 3SG2A 1G8IA 3F45A 2BBMA 2M1KB 2KFGA 1NX1A 5HYDA 3VROA 1BR4B 1CFPA 4CPVA 1QX7A 1LKJA 1RECA 2F8PA 3KO0A 1PSRA 1S6CA 3DVMA 2H61C 1KQMB 1TCFA 1KQVA 1CKKA 2CT9A 1OMDA 1JF2A 1XYDA 1F4QA 4F0ZB 4MRXA 1FI6A 2MAZA 3PALA 5ER5A 5B8IB 3VRQA 4NDCA 2HETA 1BMOA 1FW4A 3JVTC 1CFCA 1FF1A 4YI8A 1XFXO 3D0YB 4PE4A 3BOWA 2JNFA 3EK8A 2NZ0A 2BL0B 3QRXA 2L50A 2JWWA 3AKAA 1DJYA 2M7LA 1B7TY 1B47A 2M1UA 2LP2A 3PN7C 1CLBA 5HKYA 3NSOA 2OTGC 1JBAA 4YGCB 4HREE 4QJ5B 4DCKA 4I5KA 2HQWA 3RLZA 4A4CA 1B9AA 1GQMA 1K8UA 1S3PA 1SYMA 1V1GA 1D1OA 5CSIA 1C07A 3FIAA 1QTXA 3VRNA 2L98A 3SIAA 2R2IA 1FBVA 1TN4A 2BCXA 4DIRA 5FYXA 1NCZA 2F33A 2FCDA 1B7TZ 4WQ3A 2BBNA 4PHNA 2M8UA 3BUXB 5AANA 1A4PA 1VRKA 1J1EA 2GGZA 2COLB 2I94A 4DRWA 3FS7A 1SL7A 2KAVA 1RFJA 1UHJA 2FCEA 2MRDA 5I2LA 2I2RE 1SW8A 5DKRA 1CNPA 3PN7B 2OTGB 1RK9A 1DJHA 2JXCA 2Y4QA 1KK7Y 1LXFC 4N5XA 4GFTA 4ORAB 2K0JA 1CMGA 4YGAA 5GQQC 1MXLC 1S36A 4ORCB 2LE9B 5HKZA 1ZUZA 1E8AA 1BT6A 2MLFC 2OPOA 1BLQA 1CTRA 1N2DA 1B4CA 2M7NA 3BUNB 4I5JA 3DF0B 2F2OA 4CFRA 2L4HA 1SK6D 1JC2A 2KDHA 1M31A 1KK7Z 2NCPA 1F54A 1XK4C 4D1EA 1SNLA 3O2PA 1MXEA 2L0PA 2M97A 2ZFDA 2KI4C 1EL4A 1JSAA 2OS8C 1MHOA 4GGFC 1EJ3A 1M45A 3LLEA 3JTDC 1EH2A 1G4YR 1A29A 1WRKA 1F70A 5AERA 1DJZA 4C0KA 1A75A 4L9MA 1QLSA 2WOSA 2LNKA 1TNQA 2FOTA 1YX7A 5HLOA 1K93D 1IKUA 2M0RA 1UHNA 1F4OA 2ZNDA 2WC8A 4PCWA 4HRHA 4MRYA 1DGVA 4AQJA 1JWDA 1JUOA 1K94A 1SL8A 1IJ5A 1QJTA 1WLZA 2BKHB 2L4IA 2KI4B 2Y5IA 2M9GA 3IF7A 4HSZA 4PE0A 3TDIA 2OS8B 3O78A 1MR8A 3O6BA 1JFKA 1CDNA 2Y1NA 4NDDA 3BUMB 4OR9B 3H4SE 1S6JA 1NCYA 2KHNA 2QPTA 2MBXA 5CSNA 4M2QA 1QV1A 1K9UA 1OSAA 2I7AA 4BY4A 1AP4A 1PULA 3PM8A 2ZN8A 4YI9A 2KYFA 2LMVA 1FI5A 2LP3A 3E3RA 3OX6A 1H4BA 4WQ2A 3GK1A 4ICBA 1EXRA 1UHKA 1LA0A 1CM4A 3I5IB 4XJKB 1ODBA 1SBJA 3PSRA 1QVIY 3TDZA 1ZOTB 2Q91A 4MSPA 1TCOB 3K21A 3PFVA 2KYCA 1CMFA 5AFPA 4JWQA 1WRLA 1L2OC 1PVBA 1QASA 4GBAA 1DTLA 2Q4UA 1YRTB 3GK4X 2K7DA 1Y1AA 1DJXA 1L7ZA 3CR4X 3SG7A 3D10A 1A03A 3A8RA 1QVIZ 3FWCA 4GUKA 2LANA 4GGNA 1QS7A 1BODA 1UUSA 1F8HA 4E68A 4Q04A 2CTNA 2LM5A 3CR5X 1SMGA 2KFHA 2LUXA 4PHMA 4U8DA 1NP8A 3BOWB 4ZCVA 4CFQA 1QIVA 1M39A 3LL8B 1J7OA 1UURA 1L2OB 3BUOB 1U5IA 1SPYA 2F2PA 4CIDA 1TIZA 1K2HA 5KTYA 4YGDB 4PHJA 2F3ZA 2BE6A 1YVLA 2LHIA 1IH0A 1R6PA 1MWNA 5BPJA 1AJ4A 2O5GA 2KOTA 1Y6WA 2I18A 1UHHA 1OMVA 3JVTB 4FQOA 1XO5A 1KWOC
chains in the Genus database with same CATH superfamily
3TDUA 4DUQA 1KFXS 1R2UA 3V2LA 2KGBC 2JPTA 3L47A 2GV5A 3RM1A 2M29A 1KFUS 3KPXA 1AVSA 3TZ1A 1ZMZA 2KAYA 2MHHA 1DF0B 3R1VA 2K7BA 1QLKA 1OOFA 2WCEA 3C1VA 1KFXL 2ZN9A 3DYEA 2JC2A 3AAKA 2JU0A 4M2OA 1UWOA 3BFAA 4NQGA 2ZNEA 2MLEC 4WRIA 1KFUL 1Y1XA 2LC5A 1DQEA 2P70A 1PK0D 2LVKA 4AOMA 2PSRA 1KWOB 2WCFA 1YRUB 1J7PA 1S5GY 3AAJA 2BAPA 2PASA 3CLNA 1JF0A 1CLLA 2JZIA 2LVJA 4PHKA 4BY5A 2RGIA 2CBLA 2WCKA 1BR1B 3BJHA 4KYNA 1IRJA 1B1GA 2E6WA 2LVVA 1TWOA 2JOJA 2LHLA 4I5NB 3SJSA 2P6BB 1J7QA 1MF8B 1SR6C 1NWDA 1S5GZ 2VRGA 2ZRSA 4A4BA 5FI6A 3EG5B 1DVIA 1K9PA 1B8CA 2FJUB 2IS9A 2PVBA 2QEHA 1K95A 4PDZA 3FWBA 1M46A 3GK2A 1UP5A 4YBHB 1NPQA 1OE9B 2CNPA 2WC5A 3A4UB 3DXLA 3NSIA 4PE1A 1J55A 1MQ1A 1RJVA 5CPVA 3I5HC 3MSEB 1CLMA 2LCPA 4MVFA 1TOPA 4MZJA 1IWQA 2KPHA 4ZCUA 3DF0A 2TN4A 3EVVA 3BYAA 1PRWA 2L5XB 3CZTX 5EL2A 1NUBA 2AUCA 1Z4HA 2LUCA 3DVEA 5I2QA 3CABA 3NSKA 1LA3A 3CZ1A 3FE6A 1Y1UA 1NIWA 3ICBA 3JTDB 2BCAA 2JTTA 1KSOA 2QDIA 1A2XA 2LLTA 2M49B 2K7CA 3OBVA 5I8NA 4YRUA 3I5HB 2F3YA 1SRAA 1ALWA 1XVJA 2WNDA 4TNCA 1NCXA 3VGOA 4F7FA 5JOLA 2JXLA 1FPWA 1N0YA 5AXIA 1CDPA 2KSPA 2ZKMX 4FTGA 3IQOA 3D75A 5K89A 1GGWA 2MA2A 1J7RA 1B8LA 3PATA 2V53A 1WRZA 2LV7A 1T14A 1ZFSA 2LVIA 3KEVA 1IJ6A 1NSHA 2BECA 5F6TA 3HX4A 3SG5A 3B7AA 2E30A 1OZSA 2LLUA 1KK8C 4PT1A 1GGZA 5J3XA 4AQIA 3B6XA 4JPZB 4MLWA 5JJGA 4DS7A 1OOJA 2G2BA 3SG3A 1X02A 3O4XA 1DEKA 1EG3A 1J1DA 3NHIA 3WXAA 3CGAA 2WCBA 1GM0A 5KU1A 2JT3A 2PRUA 1GJYA 1N65A 2LLSA 4MZKA 1KQMC 3KF9A 2HQ8A 3BQ3A 4GPLB 3WHTB 4MN0A 5ER4X 1PVAA 3LK1A 2L2EA 4QJ3B 1DT7B 1TRFA 2KGRA 2KBIA 2EGDA 1ZACA 3SG4A 2JRFA 2K61A 3EK7A 5DKQA 4XJKA 3DVJA 1KK8B 3PM2A 4PE7A 4YGBB 1F71A 2KI6D 3OP0A 2K2AA 1SKTA 5KSZA 1IQ3A 1LINA 3KHEA 2NCOA 2PALA 3CZ0A 3WHUB 3CTNA 1B8RA 1U5IB 2JTZA 3EVRA 4IL1A 1SL9A 2BL0C 4HRGA 2KI6C 3I5FC 1BU3A 1DJWA 1BOCA 3K1EA 1KCYA 1AHRA 2B1UA 3L4LA 3D78A 2BCBA 1LVCD 3LK0A 3S0DA 4XYNA 1C3YA 3M0WA 1YX8A 2WCJA 2L5YA 1KSMA 3OX5A 1QXPA 5DICA 4PALA 1DJGA 4ETOA 3S0AA 3LCPC 1F55A 3EK4A 4C0LA 1W7IB 2H8VA 2LMTA 3D0YA 3RZSA 1OMRA 1TUJA 1YUUA 2KQYA 3DD4A 3EVUA 3BXKA 1SCMC 4OVNF 4OZDA 1MUXA 2H61A 4I5LB 3I5FB 1K96A 5DKNA 1BG1A 4GAOA 4GNKB 4MBEA 5D7FA 3IQQA 3SG6A 4USLA 2QACA 3N7HA 1BF5A 1TNWA 4R1EA 1PSBA 2P71A 1CB1A 1YR5A 4JQ0D 3VRRA 2Y1MA 1QX2A 2JT0A 3OHMB 2BE4A 3ZWHA 1XFZO 4C0JA 1NX3A 1UHIA 2JULA 2K7OA 2ISDA 1HT9A 3EKHA 5IBWA 1W7JB 5CSJA 2JNXA 1TNPA 2L51A 1XFVO 3TS5C 3SIBA 1SCMB 1SCVA 2KNEA 3Q8IA 1IGVA 3NHTA 4ORBB 5HKWA 2GGMA 2LAPA 1DF0A 5D69A 3EKJA 1IIOA 1S6IA 2MJWB 1OOHA 5AEQA 5HL1A 2KQ6A 1C3ZA 1CFDA 1P28A 1ORGA 2CCMA 5TNCA 1CFFA 1WLMA 2JT8A 1YURA 1HQVA 2HF5A 4MZLA 2A4JA 1RROA 3WNXB 1YUSA 1XA5A 1QV0A 1EG4A 2CXJA 2O60A 1QATA 1AJ5A 3S0BA 1A75B 5G08A 1K90D 2H2KA 1DJIA 3SS4A 1Z2CB 3CWGA 4OCIA 2NXQA 2KFFA 2LMUA 2KAXA 4OV2A 3D74A 2WCHA 3D73A 4N1FA 4P5OE 3TS5B 3AKBA 3B87A 1AUIB 1S1EA 3OB1B 3DVKA 3PLFB 2YGUA 1CDMA 1SR6B 3OB2B 2HPSA 1IQ5A 3CR2A 1NYAA 1WY9A 3TUYC 2WORA 1RWYA 4MEWA 1XFUO 3I5GC 5PALA 1WDCC 2PMYA 1G33A 3O4YA 1K9KA 4P2YB 1SY9A 1YVHA 2EC6C 1CM1A 2K8MB 2SCPA 1NX2A 4QJ4B 4NDBA 1XFWO 2G9BA 1V1FA 1Y0VH 1TNXA 1Q80A 1C7WA 1ALVA 1S26D 3FE9A 1YTZC 3NGVA 5I2OA 3ZNIA 4PE0A 1OZOA 2ZRTA 2DOQA 1XK4A 1BJFA 1QIWA 2D8NA 3BUWB 5HLVA 2M3WA 1JFJA 3NXAA 1H8BA 2K2FA 5D3OA 2EHBA 1RTP1 2JQ6A 1IG5A 3HCMA 4GGFA 2AMIA 3TUYB 4CLNA 3I5GB 3NSLA 1WDCB 3I5IC 3VRPA 1XFYO 1NX0A 2EC6B 4M2PA 4OKHA 1M63B 3CS1A 2GTEA 1QX5B 1DGUA 2SASA 4N1GA 1PALA 1CDLA 1YUTA 3UO9A 1DMOA 1TTXA 3GOFA 2AAOA 2NLNA 1DELA 2BKIB 2KBMA 4UPGA 3R1OA 4JKTA 1C7VA 1AK8A 1OQPA 5CSFA 4YGEB 3SG2A 1G8IA 3F45A 2L2CA 2BBMA 1XFRA 2KFGA 2M1KB 1NX1A 5HYDA 3VROA 1BR4B 1CFPA 4CPVA 1QX7A 1LKJA 1RECA 2F8PA 3KO0A 1PSRA 1S6CA 3DVMA 2H61C 1KQMB 1TCFA 1KQVA 1CKKA 2CT9A 1OMDA 1JF2A 1XYDA 1F4QA 4F0ZB 4MRXA 3CDNA 1FI6A 2MAZA 4FQTA 3PALA 5ER5A 5B8IB 3VRQA 4NDCA 2HETA 1BMOA 1FW4A 3JVTC 1CFCA 1FF1A 4YI8A 5FI7A 1XFXO 3D0YB 4PE4A 3BOWA 2WCLA 2JNFA 3L4AA 3EK8A 2NZ0A 2BL0B 4INXA 3QRXA 2L50A 2FJYA 3S0GA 2JWWA 3AKAA 1DJYA 1DC1A 1W9ZA 2WCMA 2M7LA 1B7TY 2KLDA 1B47A 2M1UA 2LP2A 3PN7C 3VB1A 5HKYA 3NSOA 2OTGC 1CLBA 4YGCB 4HREE 4QJ5B 4DCKA 4I5KA 1JBAA 2HQWA 3RLZA 4A4CA 1B9AA 1GQMA 1K8UA 1S3PA 1SYMA 1V1GA 1D1OA 5CSIA 1C07A 3FIAA 1QTXA 2WC6A 3VRNA 1OOGA 2L98A 3SIAA 2R2IA 1FBVA 1TN4A 2BCXA 4DIRA 2KLEA 1NCZA 2F33A 2FCDA 1B7TZ 4WQ3A 5FYXA 2BBNA 4PHNA 2M8UA 3BUXB 1OW4A 5AANA 1A4PA 1VRKA 1J1EA 2GGZA 2COLB 2I94A 3DZTA 4DRWA 3FS7A 1SL7A 2KAVA 1RFJA 1UHJA 2FCEA 3R72A 2MRDA 5I2LA 3BFBA 2I2RE 1SW8A 1SSEB 5DKRA 1CNPA 3PN7B 3SS3A 2BNXA 2OTGB 1RK9A 1DJHA 2JXCA 2Y4QA 1KK7Y 1LXFC 4N5XA 4GFTA 1QWVA 4ORAB 2K0JA 3PJIA 4YGAA 1CMGA 5GQQC 1MXLC 1S36A 4ORCB 2LE9B 5HKZA 1ZUZA 1E8AA 1BT6A 2MLFC 2OPOA 2QEBA 1CTRA 1N2DA 3D76A 1BLQA 1B4CA 2M7NA 3BUNB 4I5JA 3DF0B 2F2OA 4CFRA 2L4HA 1SK6D 1JC2A 2KDHA 1M31A 1KK7Z 2NCPA 1F54A 3SS5A 1XK4C 4D1EA 1SNLA 3O2PA 1MXEA 1LS8A 2L0PA 2M97A 2ZFDA 2KI4C 1EL4A 1JSAA 2OS8C 1MHOA 4GGFC 1EJ3A 1M45A 3LLEA 3JTDC 1EH2A 1G4YR 1A29A 1WRKA 1F70A 5AERA 1DJZA 4C0KA 1A75A 4L9MA 1QLSA 2WOSA 2LNKA 1TNQA 2FOTA 1YX7A 2PYQA 1K93D 5HLOA 2M0RA 1IKUA 1UHNA 1F4OA 2ZNDA 2WC8A 4PCWA 4HRHA 4MRYA 1DGVA 4AQJA 1JWDA 1JUOA 1K94A 1SL8A 2K60A 1IJ5A 1QJTA 1WLZA 2BKHB 2L4IA 2KI4B 2Y5IA 2M9GA 2QEOA 3IF7A 4HSZA 3TDIA 2OS8B 3O78A 1MR8A 3O6BA 1JFKA 1CDNA 2Y1NA 4NDDA 3BUMB 3OGNA 4OR9B 3H4SE 1S6JA 1NCYA 2KHNA 2QPTA 3R1PA 2MBXA 5CSNA 4M2QA 1QV1A 1K9UA 1OSAA 2ERBA 2I7AA 3DY9A 4BY4A 1AP4A 3CYZA 1TUZA 3S0EA 1PULA 3PM8A 2ZN8A 4YI9A 2KYFA 1OOIX 2LMVA 3UNWA 1FI5A 2LP3A 3E3RA 3OX6A 1H4BA 4WQ2A 3FE8A 3GK1A 3S0FA 4ICBA 1EXRA 1UHKA 1LA0A 1CM4A 3I5IB 4XJKB 1ODBA 1SBJA 3PSRA 1QVIY 3TDZA 1ZOTB 2Q91A 4MSPA 1TCOB 3BFHA 3CZ2A 3K21A 2KYCA 3PFVA 1CMFA 2JPOA 5AFPA 4JWQA 1WRLA 3D77A 1L2OC 1PVBA 1QASA 4GBAA 4INWA 1DTLA 2Q4UA 1YRTB 3GK4X 2QEVA 2K7DA 1Y1AA 1DJXA 1L7ZA 3CR4X 3SG7A 3D10A 1A03A 3A8RA 1QVIZ 3FWCA 4GUKA 2LANA 4GGNA 1QS7A 1BODA 1UUSA 1F8HA 4E68A 4JD9A 4Q04A 2CTNA 2LM5A 3CR5X 1SMGA 2KFHA 2LUXA 3B88A 4PHMA 4U8DA 2PQLA 5I94A 3B86A 1NP8A 3BOWB 4ZCVA 4CFQA 1QIVA 3IVTA 1M39A 3LL8B 4IJ7A 1UURA 1J7OA 1L2OB 3BUOB 1U5IA 1SPYA 2F2PA 4CIDA 1TIZA 1K2HA 5KTYA 4YGDB 4PHJA 5FI2A 2F3ZA 2BE6A 1YVLA 2LHIA 1IH0A 1R6PA 1MWNA 5BPJA 1AJ4A 2O5GA 3QMEA 2KOTA 1Y6WA 2I18A 1UHHA 1OMVA 3JVTB 4FQOA 1XO5A 1KWOC
chains in the Genus database with same CATH topology
3TDUA 4DUQA 1KFXS 1R2UA 2KGBC 2JPTA 2GV5A 3RM1A 2M29A 1KFUS 3KPXA 1AVSA 3TZ1A 1ZMZA 2KAYA 2MHHA 1DF0B 2K7BA 1QLKA 2WCEA 3C1VA 1KFXL 2ZN9A 2JC2A 3AAKA 2JU0A 4M2OA 1UWOA 4NQGA 2ZNEA 2MLEC 4WRIA 1KFUL 1Y1XA 2LC5A 4AOMA 1PK0D 2LVKA 2PSRA 1KWOB 2WCFA 1YRUB 1J7PA 1S5GY 3AAJA 2PASA 3CLNA 1JF0A 1CLLA 2JZIA 2LVJA 4PHKA 4BY5A 2RGIA 2CBLA 1BR1B 1IRJA 1B1GA 2E6WA 2LVVA 2JOJA 2LHLA 4I5NB 3SJSA 2P6BB 1J7QA 1MF8B 1SR6C 1NWDA 1S5GZ 2VRGA 2ZRSA 4A4BA 1DVIA 1K9PA 1B8CA 2FJUB 2IS9A 2PVBA 1K95A 4PDZA 3FWBA 1M46A 3GK2A 1UP5A 4YBHB 1NPQA 1OE9B 2CNPA 3NSIA 3A4UB 4PE1A 5CPVA 4C0LA 1J55A 1MQ1A 1RJVA 3I5HC 3MSEB 1CLMA 2LCPA 4MVFA 1TOPA 4MZJA 1IWQA 4ZCUA 3DF0A 2TN4A 3EVVA 3BYAA 1PRWA 2L5XB 3CZTX 1NUBA 2AUCA 2LUCA 5I2QA 3DVEA 3NSKA 1LA3A 1Y1UA 1NIWA 3ICBA 3JTDB 2BCAA 2JTTA 1KSOA 1A2XA 2LLTA 2M49B 2K7CA 5I8NA 4YRUA 3I5HB 2F3YA 1SRAA 1ALWA 1XVJA 2WNDA 4TNCA 1NCXA 3VGOA 5JOLA 2JXLA 1FPWA 1N0YA 5AXIA 1CDPA 2KSPA 2ZKMX 4FTGA 3IQOA 5K89A 1GGWA 2MA2A 1J7RA 1B8LA 3PATA 2V53A 1WRZA 2LV7A 1ZFSA 2LVIA 3KEVA 1IJ6A 1NSHA 2BECA 5F6TA 3HX4A 3SG5A 2E30A 1OZSA 2LLUA 1KK8C 5J3XA 1GGZA 4AQIA 4JPZB 4MLWA 5JJGA 4DS7A 1OOJA 2G2BA 3SG3A 1X02A 1EG3A 1J1DA 3WXAA 3CGAA 2WCBA 5KU1A 2JT3A 2PRUA 1GJYA 1N65A 2LLSA 4MZKA 1KQMC 3KF9A 2HQ8A 3BQ3A 4GPLB 3WHTB 4MN0A 5ER4X 1PVAA 3LK1A 2L2EA 4QJ3B 1DT7B 1TRFA 2KGRA 2KBIA 2EGDA 1ZACA 3SG4A 2JRFA 2K61A 3EK7A 5DKQA 4XJKA 3DVJA 1KK8B 4PE7A 4YGBB 1F71A 2KI6D 3OP0A 2K2AA 1SKTA 5KSZA 1IQ3A 1LINA 3KHEA 2NCOA 2PALA 3WHUB 3CTNA 1B8RA 1U5IB 2JTZA 3EVRA 4IL1A 1SL9A 2BL0C 4HRGA 2KI6C 3I5FC 1BU3A 1DJWA 1BOCA 1KCYA 1AHRA 2B1UA 2BCBA 1LVCD 3LK0A 4XYNA 3M0WA 1YX8A 1KSMA 3OX5A 1QXPA 4PALA 1DJGA 4ETOA 3LCPC 1F55A 3EK4A 1W7IB 2LMTA 3D0YA 1OMRA 1YUUA 2KQYA 3DD4A 3EVUA 3BXKA 1SCMC 4OVNF 1MUXA 2H61A 4I5LB 3I5FB 1K96A 5DKNA 1BG1A 4GAOA 4GNKB 4MBEA 5D7FA 3IQQA 3SG6A 4USLA 2QACA 1BF5A 1TNWA 4R1EA 1PSBA 1CB1A 1YR5A 4JQ0D 3VRRA 2Y1MA 1QX2A 2JT0A 3OHMB 2BE4A 3ZWHA 1XFZO 4C0JA 1NX3A 1UHIA 2JULA 2K7OA 2ISDA 1HT9A 3EKHA 5IBWA 1W7JB 5CSJA 2JNXA 1TNPA 2L51A 1XFVO 3TS5C 3SIBA 1SCMB 1SCVA 2KNEA 5HKWA 1IGVA 4ORBB 2GGMA 2LAPA 1DF0A 5D69A 3EKJA 1S6IA 2MJWB 5AEQA 2KQ6A 1CFDA 2CCMA 5TNCA 1CFFA 1WLMA 2JT8A 1YURA 1HQVA 2HF5A 4MZLA 2A4JA 1RROA 3WNXB 1YUSA 1XA5A 1QV0A 1EG4A 2CXJA 2O60A 1QATA 1AJ5A 1A75B 5G08A 1K90D 2H2KA 1DJIA 3CWGA 4OCIA 2NXQA 2KFFA 2LMUA 2KAXA 4OV2A 4N1FA 4P5OE 3TS5B 3AKBA 1AUIB 1S1EA 3OB1B 3DVKA 3PLFB 1CDMA 1SR6B 3OB2B 2HPSA 1IQ5A 3CR2A 1NYAA 1WY9A 3TUYC 2WORA 1RWYA 4MEWA 1XFUO 3I5GC 5PALA 1WDCC 2PMYA 1G33A 3O4YA 1K9KA 4P2YB 1SY9A 1YVHA 2EC6C 1CM1A 2K8MB 2SCPA 1NX2A 4QJ4B 4NDBA 1XFWO 2G9BA 1V1FA 1Y0VH 1TNXA 1Q80A 1C7WA 1ALVA 1S26D 1YTZC 5I2OA 3ZNIA 1OZOA 2ZRTA 2DOQA 1XK4A 1BJFA 1QIWA 2D8NA 3BUWB 5HLVA 2M3WA 1JFJA 3NXAA 1H8BA 2K2FA 2EHBA 1RTP1 2JQ6A 1IG5A 3HCMA 4GGFA 2AMIA 3TUYB 4CLNA 3I5GB 3NSLA 1WDCB 3I5IC 3VRPA 1XFYO 1NX0A 2EC6B 4M2PA 4OKHA 1M63B 3CS1A 1QX5B 1DGUA 2SASA 4N1GA 1PALA 1CDLA 1YUTA 1DMOA 1TTXA 3GOFA 2AAOA 2NLNA 2BKIB 2KBMA 4UPGA 1C7VA 1AK8A 1OQPA 5CSFA 4YGEB 3SG2A 1G8IA 3F45A 2BBMA 2M1KB 2KFGA 1NX1A 5HYDA 3VROA 1BR4B 1CFPA 4CPVA 1QX7A 1LKJA 1RECA 2F8PA 3KO0A 1PSRA 1S6CA 3DVMA 2H61C 1KQMB 1TCFA 1KQVA 1CKKA 2CT9A 1OMDA 1JF2A 1XYDA 1F4QA 4F0ZB 4MRXA 1FI6A 2MAZA 3PALA 5ER5A 5B8IB 3VRQA 4NDCA 2HETA 1BMOA 1FW4A 3JVTC 1CFCA 1FF1A 4YI8A 1XFXO 3D0YB 4PE4A 3BOWA 2JNFA 3EK8A 2NZ0A 2BL0B 3QRXA 2L50A 2JWWA 3AKAA 1DJYA 2M7LA 1B7TY 1B47A 2M1UA 2LP2A 3PN7C 1CLBA 5HKYA 3NSOA 2OTGC 1JBAA 4YGCB 4HREE 4QJ5B 4DCKA 4I5KA 2HQWA 3RLZA 4A4CA 1B9AA 1GQMA 1K8UA 1S3PA 1SYMA 1V1GA 1D1OA 5CSIA 1C07A 3FIAA 1QTXA 3VRNA 2L98A 3SIAA 2R2IA 1FBVA 1TN4A 2BCXA 4DIRA 5FYXA 1NCZA 2F33A 2FCDA 1B7TZ 4WQ3A 2BBNA 4PHNA 2M8UA 3BUXB 5AANA 1A4PA 1VRKA 1J1EA 2GGZA 2COLB 2I94A 4DRWA 3FS7A 1SL7A 2KAVA 1RFJA 1UHJA 2FCEA 2MRDA 5I2LA 2I2RE 1SW8A 5DKRA 1CNPA 3PN7B 2OTGB 1RK9A 1DJHA 2JXCA 2Y4QA 1KK7Y 1LXFC 4N5XA 4GFTA 4ORAB 2K0JA 1CMGA 4YGAA 5GQQC 1MXLC 1S36A 4ORCB 2LE9B 5HKZA 1ZUZA 1E8AA 1BT6A 2MLFC 2OPOA 1BLQA 1CTRA 1N2DA 1B4CA 2M7NA 3BUNB 4I5JA 3DF0B 2F2OA 4CFRA 2L4HA 1SK6D 1JC2A 2KDHA 1M31A 1KK7Z 2NCPA 1F54A 1XK4C 4D1EA 1SNLA 3O2PA 1MXEA 2L0PA 2M97A 2ZFDA 2KI4C 1EL4A 1JSAA 2OS8C 1MHOA 4GGFC 1EJ3A 1M45A 3LLEA 3JTDC 1EH2A 1G4YR 1A29A 1WRKA 1F70A 5AERA 1DJZA 4C0KA 1A75A 4L9MA 1QLSA 2WOSA 2LNKA 1TNQA 2FOTA 1YX7A 5HLOA 1K93D 1IKUA 2M0RA 1UHNA 1F4OA 2ZNDA 2WC8A 4PCWA 4HRHA 4MRYA 1DGVA 4AQJA 1JWDA 1JUOA 1K94A 1SL8A 1IJ5A 1QJTA 1WLZA 2BKHB 2L4IA 2KI4B 2Y5IA 2M9GA 3IF7A 4HSZA 4PE0A 3TDIA 2OS8B 3O78A 1MR8A 3O6BA 1JFKA 1CDNA 2Y1NA 4NDDA 3BUMB 4OR9B 3H4SE 1S6JA 1NCYA 2KHNA 2QPTA 2MBXA 5CSNA 4M2QA 1QV1A 1K9UA 1OSAA 2I7AA 4BY4A 1AP4A 1PULA 3PM8A 2ZN8A 4YI9A 2KYFA 2LMVA 1FI5A 2LP3A 3E3RA 3OX6A 1H4BA 4WQ2A 3GK1A 4ICBA 1EXRA 1UHKA 1LA0A 1CM4A 3I5IB 4XJKB 1ODBA 1SBJA 3PSRA 1QVIY 3TDZA 1ZOTB 2Q91A 4MSPA 1TCOB 3K21A 3PFVA 2KYCA 1CMFA 5AFPA 4JWQA 1WRLA 1L2OC 1PVBA 1QASA 4GBAA 1DTLA 2Q4UA 1YRTB 3GK4X 2K7DA 1Y1AA 1DJXA 1L7ZA 3CR4X 3SG7A 3D10A 1A03A 3A8RA 1QVIZ 3FWCA 4GUKA 2LANA 4GGNA 1QS7A 1BODA 1UUSA 1F8HA 4E68A 4Q04A 2CTNA 2LM5A 3CR5X 1SMGA 2KFHA 2LUXA 4PHMA 4U8DA 1NP8A 3BOWB 4ZCVA 4CFQA 1QIVA 1M39A 3LL8B 1J7OA 1UURA 1L2OB 3BUOB 1U5IA 1SPYA 2F2PA 4CIDA 1TIZA 1K2HA 5KTYA 4YGDB 4PHJA 2F3ZA 2BE6A 1YVLA 2LHIA 1IH0A 1R6PA 1MWNA 5BPJA 1AJ4A 2O5GA 2KOTA 1Y6WA 2I18A 1UHHA 1OMVA 3JVTB 4FQOA 1XO5A 1KWOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDU A;  4DUQ A;  1KFX S;  1R2U A;  2KGB C;  2JPT A;  2GV5 A;  3RM1 A;  2M29 A;  1KFU S;  3KPX A;  1AVS A;  3TZ1 A;  1ZMZ A;  2KAY A;  2MHH A;  1DF0 B;  2K7B A;  1QLK A;  2WCE A;  3C1V A;  1KFX L;  2ZN9 A;  2JC2 A;  3AAK A;  2JU0 A;  4M2O A;  1UWO A;  4NQG A;  2ZNE A;  2MLE C;  4WRI A;  1KFU L;  1Y1X A;  2LC5 A;  4AOM A;  1PK0 D;  2LVK A;  2PSR A;  1KWO B;  2WCF A;  1YRU B;  1J7P A;  1S5G Y;  3AAJ A;  2PAS A;  3CLN A;  1JF0 A;  1CLL A;  2JZI A;  2LVJ A;  4PHK A;  4BY5 A;  2RGI A;  2CBL A;  1BR1 B;  1IRJ A;  1B1G A;  2E6W A;  2LVV A;  2JOJ A;  2LHL A;  4I5N B;  3SJS A;  2P6B B;  1J7Q A;  1MF8 B;  1SR6 C;  1NWD A;  1S5G Z;  2VRG A;  2ZRS A;  4A4B A;  1DVI A;  1K9P A;  1B8C A;  2FJU B;  2IS9 A;  2PVB A;  1K95 A;  4PDZ A;  3FWB A;  1M46 A;  3GK2 A;  1UP5 A;  4YBH B;  1NPQ A;  1OE9 B;  2CNP A;  3NSI A;  3A4U B;  4PE1 A;  5CPV A;  4C0L A;  1J55 A;  1MQ1 A;  1RJV A;  3I5H C;  3MSE B;  1CLM A;  2LCP A;  4MVF A;  1TOP A;  4MZJ A;  1IWQ A;  4ZCU A;  3DF0 A;  2TN4 A;  3EVV A;  3BYA A;  1PRW A;  2L5X B;  3CZT X;  1NUB A;  2AUC A;  2LUC A;  5I2Q A;  3DVE A;  3NSK A;  1LA3 A;  1Y1U A;  1NIW A;  3ICB A;  3JTD B;  2BCA A;  2JTT A;  1KSO A;  1A2X A;  2LLT A;  2M49 B;  2K7C A;  5I8N A;  4YRU A;  3I5H B;  2F3Y A;  1SRA A;  1ALW A;  1XVJ A;  2WND A;  4TNC A;  1NCX A;  3VGO A;  5JOL A;  2JXL A;  1FPW A;  1N0Y A;  5AXI A;  1CDP A;  2KSP A;  2ZKM X;  4FTG A;  3IQO A;  5K89 A;  1GGW A;  2MA2 A;  1J7R A;  1B8L A;  3PAT A;  2V53 A;  1WRZ A;  2LV7 A;  1ZFS A;  2LVI A;  3KEV A;  1IJ6 A;  1NSH A;  2BEC A;  5F6T A;  3HX4 A;  3SG5 A;  2E30 A;  1OZS A;  2LLU A;  1KK8 C;  5J3X A;  1GGZ A;  4AQI A;  4JPZ B;  4MLW A;  5JJG A;  4DS7 A;  1OOJ A;  2G2B A;  3SG3 A;  1X02 A;  1EG3 A;  1J1D A;  3WXA A;  3CGA A;  2WCB A;  5KU1 A;  2JT3 A;  2PRU A;  1GJY A;  1N65 A;  2LLS A;  4MZK A;  1KQM C;  3KF9 A;  2HQ8 A;  3BQ3 A;  4GPL B;  3WHT B;  4MN0 A;  5ER4 X;  1PVA A;  3LK1 A;  2L2E A;  4QJ3 B;  1DT7 B;  1TRF A;  2KGR A;  2KBI A;  2EGD A;  1ZAC A;  3SG4 A;  2JRF A;  2K61 A;  3EK7 A;  5DKQ A;  4XJK A;  3DVJ A;  1KK8 B;  4PE7 A;  4YGB B;  1F71 A;  2KI6 D;  3OP0 A;  2K2A A;  1SKT A;  5KSZ A;  1IQ3 A;  1LIN A;  3KHE A;  2NCO A;  2PAL A;  3WHU B;  3CTN A;  1B8R A;  1U5I B;  2JTZ A;  3EVR A;  4IL1 A;  1SL9 A;  2BL0 C;  4HRG A;  2KI6 C;  3I5F C;  1BU3 A;  1DJW A;  1BOC A;  1KCY A;  1AHR A;  2B1U A;  2BCB A;  1LVC D;  3LK0 A;  4XYN A;  3M0W A;  1YX8 A;  1KSM A;  3OX5 A;  1QXP A;  4PAL A;  1DJG A;  4ETO A;  3LCP C;  1F55 A;  3EK4 A;  1W7I B;  2LMT A;  3D0Y A;  1OMR A;  1YUU A;  2KQY A;  3DD4 A;  3EVU A;  3BXK A;  1SCM C;  4OVN F;  1MUX A;  2H61 A;  4I5L B;  3I5F B;  1K96 A;  5DKN A;  1BG1 A;  4GAO A;  4GNK B;  4MBE A;  5D7F A;  3IQQ A;  3SG6 A;  4USL A;  2QAC A;  1BF5 A;  1TNW A;  4R1E A;  1PSB A;  1CB1 A;  1YR5 A;  4JQ0 D;  3VRR A;  2Y1M A;  1QX2 A;  2JT0 A;  3OHM B;  2BE4 A;  3ZWH A;  1XFZ O;  4C0J A;  1NX3 A;  1UHI A;  2JUL A;  2K7O A;  2ISD A;  1HT9 A;  3EKH A;  5IBW A;  1W7J B;  5CSJ A;  2JNX A;  1TNP A;  2L51 A;  1XFV O;  3TS5 C;  3SIB A;  1SCM B;  1SCV A;  2KNE A;  5HKW A;  1IGV A;  4ORB B;  2GGM A;  2LAP A;  1DF0 A;  5D69 A;  3EKJ A;  1S6I A;  2MJW B;  5AEQ A;  2KQ6 A;  1CFD A;  2CCM A;  5TNC A;  1CFF A;  1WLM A;  2JT8 A;  1YUR A;  1HQV A;  2HF5 A;  4MZL A;  2A4J A;  1RRO A;  3WNX B;  1YUS A;  1XA5 A;  1QV0 A;  1EG4 A;  2CXJ A;  2O60 A;  1QAT A;  1AJ5 A;  1A75 B;  5G08 A;  1K90 D;  2H2K A;  1DJI A;  3CWG A;  4OCI A;  2NXQ A;  2KFF A;  2LMU A;  2KAX A;  4OV2 A;  4N1F A;  4P5O E;  3TS5 B;  3AKB A;  1AUI B;  1S1E A;  3OB1 B;  3DVK A;  3PLF B;  1CDM A;  1SR6 B;  3OB2 B;  2HPS A;  1IQ5 A;  3CR2 A;  1NYA A;  1WY9 A;  3TUY C;  2WOR A;  1RWY A;  4MEW A;  1XFU O;  3I5G C;  5PAL A;  1WDC C;  2PMY A;  1G33 A;  3O4Y A;  1K9K A;  4P2Y B;  1SY9 A;  1YVH A;  2EC6 C;  1CM1 A;  2K8M B;  2SCP A;  1NX2 A;  4QJ4 B;  4NDB A;  1XFW O;  2G9B A;  1V1F A;  1Y0V H;  1TNX A;  1Q80 A;  1C7W A;  1ALV A;  1S26 D;  1YTZ C;  5I2O A;  3ZNI A;  1OZO A;  2ZRT A;  2DOQ A;  1XK4 A;  1BJF A;  1QIW A;  2D8N A;  3BUW B;  5HLV A;  2M3W A;  1JFJ A;  3NXA A;  1H8B A;  2K2F A;  2EHB A;  1RTP 1;  2JQ6 A;  1IG5 A;  3HCM A;  4GGF A;  2AMI A;  3TUY B;  4CLN A;  3I5G B;  3NSL A;  1WDC B;  3I5I C;  3VRP A;  1XFY O;  1NX0 A;  2EC6 B;  4M2P A;  4OKH A;  1M63 B;  3CS1 A;  1QX5 B;  1DGU A;  2SAS A;  4N1G A;  1PAL A;  1CDL A;  1YUT A;  1DMO A;  1TTX A;  3GOF A;  2AAO A;  2NLN A;  2BKI B;  2KBM A;  4UPG A;  1C7V A;  1AK8 A;  1OQP A;  5CSF A;  4YGE B;  3SG2 A;  1G8I A;  3F45 A;  2BBM A;  2M1K B;  2KFG A;  1NX1 A;  5HYD A;  3VRO A;  1BR4 B;  1CFP A;  4CPV A;  1QX7 A;  1LKJ A;  1REC A;  2F8P A;  3KO0 A;  1PSR A;  1S6C A;  3DVM A;  2H61 C;  1KQM B;  1TCF A;  1KQV A;  1CKK A;  2CT9 A;  1OMD A;  1JF2 A;  1XYD A;  1F4Q A;  4F0Z B;  4MRX A;  1FI6 A;  2MAZ A;  3PAL A;  5ER5 A;  5B8I B;  3VRQ A;  4NDC A;  2HET A;  1BMO A;  1FW4 A;  3JVT C;  1CFC A;  1FF1 A;  4YI8 A;  1XFX O;  3D0Y B;  4PE4 A;  3BOW A;  2JNF A;  3EK8 A;  2NZ0 A;  2BL0 B;  3QRX A;  2L50 A;  2JWW A;  3AKA A;  1DJY A;  2M7L A;  1B7T Y;  1B47 A;  2M1U A;  2LP2 A;  3PN7 C;  1CLB A;  5HKY A;  3NSO A;  2OTG C;  1JBA A;  4YGC B;  4HRE E;  4QJ5 B;  4DCK A;  4I5K A;  2HQW A;  3RLZ A;  4A4C A;  1B9A A;  1GQM A;  1K8U A;  1S3P A;  1SYM A;  1V1G A;  1D1O A;  5CSI A;  1C07 A;  3FIA A;  1QTX A;  3VRN A;  2L98 A;  3SIA A;  2R2I A;  1FBV A;  1TN4 A;  2BCX A;  4DIR A;  5FYX A;  1NCZ A;  2F33 A;  2FCD A;  1B7T Z;  4WQ3 A;  2BBN A;  4PHN A;  2M8U A;  3BUX B;  5AAN A;  1A4P A;  1VRK A;  1J1E A;  2GGZ A;  2COL B;  2I94 A;  4DRW A;  3FS7 A;  1SL7 A;  2KAV A;  1RFJ A;  1UHJ A;  2FCE A;  2MRD A;  5I2L A;  2I2R E;  1SW8 A;  5DKR A;  1CNP A;  3PN7 B;  2OTG B;  1RK9 A;  1DJH A;  2JXC A;  2Y4Q A;  1KK7 Y;  1LXF C;  4N5X A;  4GFT A;  4ORA B;  2K0J A;  1CMG A;  4YGA A;  5GQQ C;  1MXL C;  1S36 A;  4ORC B;  2LE9 B;  5HKZ A;  1ZUZ A;  1E8A A;  1BT6 A;  2MLF C;  2OPO A;  1BLQ A;  1CTR A;  1N2D A;  1B4C A;  2M7N A;  3BUN B;  4I5J A;  3DF0 B;  2F2O A;  4CFR A;  2L4H A;  1SK6 D;  1JC2 A;  2KDH A;  1M31 A;  1KK7 Z;  2NCP A;  1F54 A;  1XK4 C;  4D1E A;  1SNL A;  3O2P A;  1MXE A;  2L0P A;  2M97 A;  2ZFD A;  2KI4 C;  1EL4 A;  1JSA A;  2OS8 C;  1MHO A;  4GGF C;  1EJ3 A;  1M45 A;  3LLE A;  3JTD C;  1EH2 A;  1G4Y R;  1A29 A;  1WRK A;  1F70 A;  5AER A;  1DJZ A;  4C0K A;  1A75 A;  4L9M A;  1QLS A;  2WOS A;  2LNK A;  1TNQ A;  2FOT A;  1YX7 A;  5HLO A;  1K93 D;  1IKU A;  2M0R A;  1UHN A;  1F4O A;  2ZND A;  2WC8 A;  4PCW A;  4HRH A;  4MRY A;  1DGV A;  4AQJ A;  1JWD A;  1JUO A;  1K94 A;  1SL8 A;  1IJ5 A;  1QJT A;  1WLZ A;  2BKH B;  2L4I A;  2KI4 B;  2Y5I A;  2M9G A;  3IF7 A;  4HSZ A;  4PE0 A;  3TDI A;  2OS8 B;  3O78 A;  1MR8 A;  3O6B A;  1JFK A;  1CDN A;  2Y1N A;  4NDD A;  3BUM B;  4OR9 B;  3H4S E;  1S6J A;  1NCY A;  2KHN A;  2QPT A;  2MBX A;  5CSN A;  4M2Q A;  1QV1 A;  1K9U A;  1OSA A;  2I7A A;  4BY4 A;  1AP4 A;  1PUL A;  3PM8 A;  2ZN8 A;  4YI9 A;  2KYF A;  2LMV A;  1FI5 A;  2LP3 A;  3E3R A;  3OX6 A;  1H4B A;  4WQ2 A;  3GK1 A;  4ICB A;  1EXR A;  1UHK A;  1LA0 A;  1CM4 A;  3I5I B;  4XJK B;  1ODB A;  1SBJ A;  3PSR A;  1QVI Y;  3TDZ A;  1ZOT B;  2Q91 A;  4MSP A;  1TCO B;  3K21 A;  3PFV A;  2KYC A;  1CMF A;  5AFP A;  4JWQ A;  1WRL A;  1L2O C;  1PVB A;  1QAS A;  4GBA A;  1DTL A;  2Q4U A;  1YRT B;  3GK4 X;  2K7D A;  1Y1A A;  1DJX A;  1L7Z A;  3CR4 X;  3SG7 A;  3D10 A;  1A03 A;  3A8R A;  1QVI Z;  3FWC A;  4GUK A;  2LAN A;  4GGN A;  1QS7 A;  1BOD A;  1UUS A;  1F8H A;  4E68 A;  4Q04 A;  2CTN A;  2LM5 A;  3CR5 X;  1SMG A;  2KFH A;  2LUX A;  4PHM A;  4U8D A;  1NP8 A;  3BOW B;  4ZCV A;  4CFQ A;  1QIV A;  1M39 A;  3LL8 B;  1J7O A;  1UUR A;  1L2O B;  3BUO B;  1U5I A;  1SPY A;  2F2P A;  4CID A;  1TIZ A;  1K2H A;  5KTY A;  4YGD B;  4PHJ A;  2F3Z A;  2BE6 A;  1YVL A;  2LHI A;  1IH0 A;  1R6P A;  1MWN A;  5BPJ A;  1AJ4 A;  2O5G A;  2KOT A;  1Y6W A;  2I18 A;  1UHH A;  1OMV A;  3JVT B;  4FQO A;  1XO5 A;  1KWO C; 
#chains in the Genus database with same CATH topology
 3TDU A;  4DUQ A;  1KFX S;  1R2U A;  3V2L A;  2KGB C;  2JPT A;  3L47 A;  2GV5 A;  3RM1 A;  2M29 A;  1KFU S;  3KPX A;  1AVS A;  3TZ1 A;  1ZMZ A;  2KAY A;  2MHH A;  1DF0 B;  3R1V A;  2K7B A;  1QLK A;  1OOF A;  2WCE A;  3C1V A;  1KFX L;  2ZN9 A;  3DYE A;  2JC2 A;  3AAK A;  2JU0 A;  4M2O A;  1UWO A;  3BFA A;  4NQG A;  2ZNE A;  2MLE C;  4WRI A;  1KFU L;  1Y1X A;  2LC5 A;  1DQE A;  2P70 A;  1PK0 D;  2LVK A;  4AOM A;  2PSR A;  1KWO B;  2WCF A;  1YRU B;  1J7P A;  1S5G Y;  3AAJ A;  2BAP A;  2PAS A;  3CLN A;  1JF0 A;  1CLL A;  2JZI A;  2LVJ A;  4PHK A;  4BY5 A;  2RGI A;  2CBL A;  2WCK A;  1BR1 B;  3BJH A;  4KYN A;  1IRJ A;  1B1G A;  2E6W A;  2LVV A;  1TWO A;  2JOJ A;  2LHL A;  4I5N B;  3SJS A;  2P6B B;  1J7Q A;  1MF8 B;  1SR6 C;  1NWD A;  1S5G Z;  2VRG A;  2ZRS A;  4A4B A;  5FI6 A;  3EG5 B;  1DVI A;  1K9P A;  1B8C A;  2FJU B;  2IS9 A;  2PVB A;  2QEH A;  1K95 A;  4PDZ A;  3FWB A;  1M46 A;  3GK2 A;  1UP5 A;  4YBH B;  1NPQ A;  1OE9 B;  2CNP A;  2WC5 A;  3A4U B;  3DXL A;  3NSI A;  4PE1 A;  1J55 A;  1MQ1 A;  1RJV A;  5CPV A;  3I5H C;  3MSE B;  1CLM A;  2LCP A;  4MVF A;  1TOP A;  4MZJ A;  1IWQ A;  2KPH A;  4ZCU A;  3DF0 A;  2TN4 A;  3EVV A;  3BYA A;  1PRW A;  2L5X B;  3CZT X;  5EL2 A;  1NUB A;  2AUC A;  1Z4H A;  2LUC A;  3DVE A;  5I2Q A;  3CAB A;  3NSK A;  1LA3 A;  3CZ1 A;  3FE6 A;  1Y1U A;  1NIW A;  3ICB A;  3JTD B;  2BCA A;  2JTT A;  1KSO A;  2QDI A;  1A2X A;  2LLT A;  2M49 B;  2K7C A;  3OBV A;  5I8N A;  4YRU A;  3I5H B;  2F3Y A;  1SRA A;  1ALW A;  1XVJ A;  2WND A;  4TNC A;  1NCX A;  3VGO A;  4F7F A;  5JOL A;  2JXL A;  1FPW A;  1N0Y A;  5AXI A;  1CDP A;  2KSP A;  2ZKM X;  4FTG A;  3IQO A;  3D75 A;  5K89 A;  1GGW A;  2MA2 A;  1J7R A;  1B8L A;  3PAT A;  2V53 A;  1WRZ A;  2LV7 A;  1T14 A;  1ZFS A;  2LVI A;  3KEV A;  1IJ6 A;  1NSH A;  2BEC A;  5F6T A;  3HX4 A;  3SG5 A;  3B7A A;  2E30 A;  1OZS A;  2LLU A;  1KK8 C;  4PT1 A;  1GGZ A;  5J3X A;  4AQI A;  3B6X A;  4JPZ B;  4MLW A;  5JJG A;  4DS7 A;  1OOJ A;  2G2B A;  3SG3 A;  1X02 A;  3O4X A;  1DEK A;  1EG3 A;  1J1D A;  3NHI A;  3WXA A;  3CGA A;  2WCB A;  1GM0 A;  5KU1 A;  2JT3 A;  2PRU A;  1GJY A;  1N65 A;  2LLS A;  4MZK A;  1KQM C;  3KF9 A;  2HQ8 A;  3BQ3 A;  4GPL B;  3WHT B;  4MN0 A;  5ER4 X;  1PVA A;  3LK1 A;  2L2E A;  4QJ3 B;  1DT7 B;  1TRF A;  2KGR A;  2KBI A;  2EGD A;  1ZAC A;  3SG4 A;  2JRF A;  2K61 A;  3EK7 A;  5DKQ A;  4XJK A;  3DVJ A;  1KK8 B;  3PM2 A;  4PE7 A;  4YGB B;  1F71 A;  2KI6 D;  3OP0 A;  2K2A A;  1SKT A;  5KSZ A;  1IQ3 A;  1LIN A;  3KHE A;  2NCO A;  2PAL A;  3CZ0 A;  3WHU B;  3CTN A;  1B8R A;  1U5I B;  2JTZ A;  3EVR A;  4IL1 A;  1SL9 A;  2BL0 C;  4HRG A;  2KI6 C;  3I5F C;  1BU3 A;  1DJW A;  1BOC A;  3K1E A;  1KCY A;  1AHR A;  2B1U A;  3L4L A;  3D78 A;  2BCB A;  1LVC D;  3LK0 A;  3S0D A;  4XYN A;  1C3Y A;  3M0W A;  1YX8 A;  2WCJ A;  2L5Y A;  1KSM A;  3OX5 A;  1QXP A;  5DIC A;  4PAL A;  1DJG A;  4ETO A;  3S0A A;  3LCP C;  1F55 A;  3EK4 A;  4C0L A;  1W7I B;  2H8V A;  2LMT A;  3D0Y A;  3RZS A;  1OMR A;  1TUJ A;  1YUU A;  2KQY A;  3DD4 A;  3EVU A;  3BXK A;  1SCM C;  4OVN F;  4OZD A;  1MUX A;  2H61 A;  4I5L B;  3I5F B;  1K96 A;  5DKN A;  1BG1 A;  4GAO A;  4GNK B;  4MBE A;  5D7F A;  3IQQ A;  3SG6 A;  4USL A;  2QAC A;  3N7H A;  1BF5 A;  1TNW A;  4R1E A;  1PSB A;  2P71 A;  1CB1 A;  1YR5 A;  4JQ0 D;  3VRR A;  2Y1M A;  1QX2 A;  2JT0 A;  3OHM B;  2BE4 A;  3ZWH A;  1XFZ O;  4C0J A;  1NX3 A;  1UHI A;  2JUL A;  2K7O A;  2ISD A;  1HT9 A;  3EKH A;  5IBW A;  1W7J B;  5CSJ A;  2JNX A;  1TNP A;  2L51 A;  1XFV O;  3TS5 C;  3SIB A;  1SCM B;  1SCV A;  2KNE A;  3Q8I A;  1IGV A;  3NHT A;  4ORB B;  5HKW A;  2GGM A;  2LAP A;  1DF0 A;  5D69 A;  3EKJ A;  1IIO A;  1S6I A;  2MJW B;  1OOH A;  5AEQ A;  5HL1 A;  2KQ6 A;  1C3Z A;  1CFD A;  1P28 A;  1ORG A;  2CCM A;  5TNC A;  1CFF A;  1WLM A;  2JT8 A;  1YUR A;  1HQV A;  2HF5 A;  4MZL A;  2A4J A;  1RRO A;  3WNX B;  1YUS A;  1XA5 A;  1QV0 A;  1EG4 A;  2CXJ A;  2O60 A;  1QAT A;  1AJ5 A;  3S0B A;  1A75 B;  5G08 A;  1K90 D;  2H2K A;  1DJI A;  3SS4 A;  1Z2C B;  3CWG A;  4OCI A;  2NXQ A;  2KFF A;  2LMU A;  2KAX A;  4OV2 A;  3D74 A;  2WCH A;  3D73 A;  4N1F A;  4P5O E;  3TS5 B;  3AKB A;  3B87 A;  1AUI B;  1S1E A;  3OB1 B;  3DVK A;  3PLF B;  2YGU A;  1CDM A;  1SR6 B;  3OB2 B;  2HPS A;  1IQ5 A;  3CR2 A;  1NYA A;  1WY9 A;  3TUY C;  2WOR A;  1RWY A;  4MEW A;  1XFU O;  3I5G C;  5PAL A;  1WDC C;  2PMY A;  1G33 A;  3O4Y A;  1K9K A;  4P2Y B;  1SY9 A;  1YVH A;  2EC6 C;  1CM1 A;  2K8M B;  2SCP A;  1NX2 A;  4QJ4 B;  4NDB A;  1XFW O;  2G9B A;  1V1F A;  1Y0V H;  1TNX A;  1Q80 A;  1C7W A;  1ALV A;  1S26 D;  3FE9 A;  1YTZ C;  3NGV A;  5I2O A;  3ZNI A;  4PE0 A;  1OZO A;  2ZRT A;  2DOQ A;  1XK4 A;  1BJF A;  1QIW A;  2D8N A;  3BUW B;  5HLV A;  2M3W A;  1JFJ A;  3NXA A;  1H8B A;  2K2F A;  5D3O A;  2EHB A;  1RTP 1;  2JQ6 A;  1IG5 A;  3HCM A;  4GGF A;  2AMI A;  3TUY B;  4CLN A;  3I5G B;  3NSL A;  1WDC B;  3I5I C;  3VRP A;  1XFY O;  1NX0 A;  2EC6 B;  4M2P A;  4OKH A;  1M63 B;  3CS1 A;  2GTE A;  1QX5 B;  1DGU A;  2SAS A;  4N1G A;  1PAL A;  1CDL A;  1YUT A;  3UO9 A;  1DMO A;  1TTX A;  3GOF A;  2AAO A;  2NLN A;  1DEL A;  2BKI B;  2KBM A;  4UPG A;  3R1O A;  4JKT A;  1C7V A;  1AK8 A;  1OQP A;  5CSF A;  4YGE B;  3SG2 A;  1G8I A;  3F45 A;  2L2C A;  2BBM A;  1XFR A;  2KFG A;  2M1K B;  1NX1 A;  5HYD A;  3VRO A;  1BR4 B;  1CFP A;  4CPV A;  1QX7 A;  1LKJ A;  1REC A;  2F8P A;  3KO0 A;  1PSR A;  1S6C A;  3DVM A;  2H61 C;  1KQM B;  1TCF A;  1KQV A;  1CKK A;  2CT9 A;  1OMD A;  1JF2 A;  1XYD A;  1F4Q A;  4F0Z B;  4MRX A;  3CDN A;  1FI6 A;  2MAZ A;  4FQT A;  3PAL A;  5ER5 A;  5B8I B;  3VRQ A;  4NDC A;  2HET A;  1BMO A;  1FW4 A;  3JVT C;  1CFC A;  1FF1 A;  4YI8 A;  5FI7 A;  1XFX O;  3D0Y B;  4PE4 A;  3BOW A;  2WCL A;  2JNF A;  3L4A A;  3EK8 A;  2NZ0 A;  2BL0 B;  4INX A;  3QRX A;  2L50 A;  2FJY A;  3S0G A;  2JWW A;  3AKA A;  1DJY A;  1DC1 A;  1W9Z A;  2WCM A;  2M7L A;  1B7T Y;  2KLD A;  1B47 A;  2M1U A;  2LP2 A;  3PN7 C;  3VB1 A;  5HKY A;  3NSO A;  2OTG C;  1CLB A;  4YGC B;  4HRE E;  4QJ5 B;  4DCK A;  4I5K A;  1JBA A;  2HQW A;  3RLZ A;  4A4C A;  1B9A A;  1GQM A;  1K8U A;  1S3P A;  1SYM A;  1V1G A;  1D1O A;  5CSI A;  1C07 A;  3FIA A;  1QTX A;  2WC6 A;  3VRN A;  1OOG A;  2L98 A;  3SIA A;  2R2I A;  1FBV A;  1TN4 A;  2BCX A;  4DIR A;  2KLE A;  1NCZ A;  2F33 A;  2FCD A;  1B7T Z;  4WQ3 A;  5FYX A;  2BBN A;  4PHN A;  2M8U A;  3BUX B;  1OW4 A;  5AAN A;  1A4P A;  1VRK A;  1J1E A;  2GGZ A;  2COL B;  2I94 A;  3DZT A;  4DRW A;  3FS7 A;  1SL7 A;  2KAV A;  1RFJ A;  1UHJ A;  2FCE A;  3R72 A;  2MRD A;  5I2L A;  3BFB A;  2I2R E;  1SW8 A;  1SSE B;  5DKR A;  1CNP A;  3PN7 B;  3SS3 A;  2BNX A;  2OTG B;  1RK9 A;  1DJH A;  2JXC A;  2Y4Q A;  1KK7 Y;  1LXF C;  4N5X A;  4GFT A;  1QWV A;  4ORA B;  2K0J A;  3PJI A;  4YGA A;  1CMG A;  5GQQ C;  1MXL C;  1S36 A;  4ORC B;  2LE9 B;  5HKZ A;  1ZUZ A;  1E8A A;  1BT6 A;  2MLF C;  2OPO A;  2QEB A;  1CTR A;  1N2D A;  3D76 A;  1BLQ A;  1B4C A;  2M7N A;  3BUN B;  4I5J A;  3DF0 B;  2F2O A;  4CFR A;  2L4H A;  1SK6 D;  1JC2 A;  2KDH A;  1M31 A;  1KK7 Z;  2NCP A;  1F54 A;  3SS5 A;  1XK4 C;  4D1E A;  1SNL A;  3O2P A;  1MXE A;  1LS8 A;  2L0P A;  2M97 A;  2ZFD A;  2KI4 C;  1EL4 A;  1JSA A;  2OS8 C;  1MHO A;  4GGF C;  1EJ3 A;  1M45 A;  3LLE A;  3JTD C;  1EH2 A;  1G4Y R;  1A29 A;  1WRK A;  1F70 A;  5AER A;  1DJZ A;  4C0K A;  1A75 A;  4L9M A;  1QLS A;  2WOS A;  2LNK A;  1TNQ A;  2FOT A;  1YX7 A;  2PYQ A;  1K93 D;  5HLO A;  2M0R A;  1IKU A;  1UHN A;  1F4O A;  2ZND A;  2WC8 A;  4PCW A;  4HRH A;  4MRY A;  1DGV A;  4AQJ A;  1JWD A;  1JUO A;  1K94 A;  1SL8 A;  2K60 A;  1IJ5 A;  1QJT A;  1WLZ A;  2BKH B;  2L4I A;  2KI4 B;  2Y5I A;  2M9G A;  2QEO A;  3IF7 A;  4HSZ A;  3TDI A;  2OS8 B;  3O78 A;  1MR8 A;  3O6B A;  1JFK A;  1CDN A;  2Y1N A;  4NDD A;  3BUM B;  3OGN A;  4OR9 B;  3H4S E;  1S6J A;  1NCY A;  2KHN A;  2QPT A;  3R1P A;  2MBX A;  5CSN A;  4M2Q A;  1QV1 A;  1K9U A;  1OSA A;  2ERB A;  2I7A A;  3DY9 A;  4BY4 A;  1AP4 A;  3CYZ A;  1TUZ A;  3S0E A;  1PUL A;  3PM8 A;  2ZN8 A;  4YI9 A;  2KYF A;  1OOI X;  2LMV A;  3UNW A;  1FI5 A;  2LP3 A;  3E3R A;  3OX6 A;  1H4B A;  4WQ2 A;  3FE8 A;  3GK1 A;  3S0F A;  4ICB A;  1EXR A;  1UHK A;  1LA0 A;  1CM4 A;  3I5I B;  4XJK B;  1ODB A;  1SBJ A;  3PSR A;  1QVI Y;  3TDZ A;  1ZOT B;  2Q91 A;  4MSP A;  1TCO B;  3BFH A;  3CZ2 A;  3K21 A;  2KYC A;  3PFV A;  1CMF A;  2JPO A;  5AFP A;  4JWQ A;  1WRL A;  3D77 A;  1L2O C;  1PVB A;  1QAS A;  4GBA A;  4INW A;  1DTL A;  2Q4U A;  1YRT B;  3GK4 X;  2QEV A;  2K7D A;  1Y1A A;  1DJX A;  1L7Z A;  3CR4 X;  3SG7 A;  3D10 A;  1A03 A;  3A8R A;  1QVI Z;  3FWC A;  4GUK A;  2LAN A;  4GGN A;  1QS7 A;  1BOD A;  1UUS A;  1F8H A;  4E68 A;  4JD9 A;  4Q04 A;  2CTN A;  2LM5 A;  3CR5 X;  1SMG A;  2KFH A;  2LUX A;  3B88 A;  4PHM A;  4U8D A;  2PQL A;  5I94 A;  3B86 A;  1NP8 A;  3BOW B;  4ZCV A;  4CFQ A;  1QIV A;  3IVT A;  1M39 A;  3LL8 B;  4IJ7 A;  1UUR A;  1J7O A;  1L2O B;  3BUO B;  1U5I A;  1SPY A;  2F2P A;  4CID A;  1TIZ A;  1K2H A;  5KTY A;  4YGD B;  4PHJ A;  5FI2 A;  2F3Z A;  2BE6 A;  1YVL A;  2LHI A;  1IH0 A;  1R6P A;  1MWN A;  5BPJ A;  1AJ4 A;  2O5G A;  3QME A;  2KOT A;  1Y6W A;  2I18 A;  1UHH A;  1OMV A;  3JVT B;  4FQO A;  1XO5 A;  1KWO C; 
#chains in the Genus database with same CATH homology
 3TDU A;  4DUQ A;  1KFX S;  1R2U A;  2KGB C;  2JPT A;  2GV5 A;  3RM1 A;  2M29 A;  1KFU S;  3KPX A;  1AVS A;  3TZ1 A;  1ZMZ A;  2KAY A;  2MHH A;  1DF0 B;  2K7B A;  1QLK A;  2WCE A;  3C1V A;  1KFX L;  2ZN9 A;  2JC2 A;  3AAK A;  2JU0 A;  4M2O A;  1UWO A;  4NQG A;  2ZNE A;  2MLE C;  4WRI A;  1KFU L;  1Y1X A;  2LC5 A;  4AOM A;  1PK0 D;  2LVK A;  2PSR A;  1KWO B;  2WCF A;  1YRU B;  1J7P A;  1S5G Y;  3AAJ A;  2PAS A;  3CLN A;  1JF0 A;  1CLL A;  2JZI A;  2LVJ A;  4PHK A;  4BY5 A;  2RGI A;  2CBL A;  1BR1 B;  1IRJ A;  1B1G A;  2E6W A;  2LVV A;  2JOJ A;  2LHL A;  4I5N B;  3SJS A;  2P6B B;  1J7Q A;  1MF8 B;  1SR6 C;  1NWD A;  1S5G Z;  2VRG A;  2ZRS A;  4A4B A;  1DVI A;  1K9P A;  1B8C A;  2FJU B;  2IS9 A;  2PVB A;  1K95 A;  4PDZ A;  3FWB A;  1M46 A;  3GK2 A;  1UP5 A;  4YBH B;  1NPQ A;  1OE9 B;  2CNP A;  3NSI A;  3A4U B;  4PE1 A;  5CPV A;  4C0L A;  1J55 A;  1MQ1 A;  1RJV A;  3I5H C;  3MSE B;  1CLM A;  2LCP A;  4MVF A;  1TOP A;  4MZJ A;  1IWQ A;  4ZCU A;  3DF0 A;  2TN4 A;  3EVV A;  3BYA A;  1PRW A;  2L5X B;  3CZT X;  1NUB A;  2AUC A;  2LUC A;  5I2Q A;  3DVE A;  3NSK A;  1LA3 A;  1Y1U A;  1NIW A;  3ICB A;  3JTD B;  2BCA A;  2JTT A;  1KSO A;  1A2X A;  2LLT A;  2M49 B;  2K7C A;  5I8N A;  4YRU A;  3I5H B;  2F3Y A;  1SRA A;  1ALW A;  1XVJ A;  2WND A;  4TNC A;  1NCX A;  3VGO A;  5JOL A;  2JXL A;  1FPW A;  1N0Y A;  5AXI A;  1CDP A;  2KSP A;  2ZKM X;  4FTG A;  3IQO A;  5K89 A;  1GGW A;  2MA2 A;  1J7R A;  1B8L A;  3PAT A;  2V53 A;  1WRZ A;  2LV7 A;  1ZFS A;  2LVI A;  3KEV A;  1IJ6 A;  1NSH A;  2BEC A;  5F6T A;  3HX4 A;  3SG5 A;  2E30 A;  1OZS A;  2LLU A;  1KK8 C;  5J3X A;  1GGZ A;  4AQI A;  4JPZ B;  4MLW A;  5JJG A;  4DS7 A;  1OOJ A;  2G2B A;  3SG3 A;  1X02 A;  1EG3 A;  1J1D A;  3WXA A;  3CGA A;  2WCB A;  5KU1 A;  2JT3 A;  2PRU A;  1GJY A;  1N65 A;  2LLS A;  4MZK A;  1KQM C;  3KF9 A;  2HQ8 A;  3BQ3 A;  4GPL B;  3WHT B;  4MN0 A;  5ER4 X;  1PVA A;  3LK1 A;  2L2E A;  4QJ3 B;  1DT7 B;  1TRF A;  2KGR A;  2KBI A;  2EGD A;  1ZAC A;  3SG4 A;  2JRF A;  2K61 A;  3EK7 A;  5DKQ A;  4XJK A;  3DVJ A;  1KK8 B;  4PE7 A;  4YGB B;  1F71 A;  2KI6 D;  3OP0 A;  2K2A A;  1SKT A;  5KSZ A;  1IQ3 A;  1LIN A;  3KHE A;  2NCO A;  2PAL A;  3WHU B;  3CTN A;  1B8R A;  1U5I B;  2JTZ A;  3EVR A;  4IL1 A;  1SL9 A;  2BL0 C;  4HRG A;  2KI6 C;  3I5F C;  1BU3 A;  1DJW A;  1BOC A;  1KCY A;  1AHR A;  2B1U A;  2BCB A;  1LVC D;  3LK0 A;  4XYN A;  3M0W A;  1YX8 A;  1KSM A;  3OX5 A;  1QXP A;  4PAL A;  1DJG A;  4ETO A;  3LCP C;  1F55 A;  3EK4 A;  1W7I B;  2LMT A;  3D0Y A;  1OMR A;  1YUU A;  2KQY A;  3DD4 A;  3EVU A;  3BXK A;  1SCM C;  4OVN F;  1MUX A;  2H61 A;  4I5L B;  3I5F B;  1K96 A;  5DKN A;  1BG1 A;  4GAO A;  4GNK B;  4MBE A;  5D7F A;  3IQQ A;  3SG6 A;  4USL A;  2QAC A;  1BF5 A;  1TNW A;  4R1E A;  1PSB A;  1CB1 A;  1YR5 A;  4JQ0 D;  3VRR A;  2Y1M A;  1QX2 A;  2JT0 A;  3OHM B;  2BE4 A;  3ZWH A;  1XFZ O;  4C0J A;  1NX3 A;  1UHI A;  2JUL A;  2K7O A;  2ISD A;  1HT9 A;  3EKH A;  5IBW A;  1W7J B;  5CSJ A;  2JNX A;  1TNP A;  2L51 A;  1XFV O;  3TS5 C;  3SIB A;  1SCM B;  1SCV A;  2KNE A;  5HKW A;  1IGV A;  4ORB B;  2GGM A;  2LAP A;  1DF0 A;  5D69 A;  3EKJ A;  1S6I A;  2MJW B;  5AEQ A;  2KQ6 A;  1CFD A;  2CCM A;  5TNC A;  1CFF A;  1WLM A;  2JT8 A;  1YUR A;  1HQV A;  2HF5 A;  4MZL A;  2A4J A;  1RRO A;  3WNX B;  1YUS A;  1XA5 A;  1QV0 A;  1EG4 A;  2CXJ A;  2O60 A;  1QAT A;  1AJ5 A;  1A75 B;  5G08 A;  1K90 D;  2H2K A;  1DJI A;  3CWG A;  4OCI A;  2NXQ A;  2KFF A;  2LMU A;  2KAX A;  4OV2 A;  4N1F A;  4P5O E;  3TS5 B;  3AKB A;  1AUI B;  1S1E A;  3OB1 B;  3DVK A;  3PLF B;  1CDM A;  1SR6 B;  3OB2 B;  2HPS A;  1IQ5 A;  3CR2 A;  1NYA A;  1WY9 A;  3TUY C;  2WOR A;  1RWY A;  4MEW A;  1XFU O;  3I5G C;  5PAL A;  1WDC C;  2PMY A;  1G33 A;  3O4Y A;  1K9K A;  4P2Y B;  1SY9 A;  1YVH A;  2EC6 C;  1CM1 A;  2K8M B;  2SCP A;  1NX2 A;  4QJ4 B;  4NDB A;  1XFW O;  2G9B A;  1V1F A;  1Y0V H;  1TNX A;  1Q80 A;  1C7W A;  1ALV A;  1S26 D;  1YTZ C;  5I2O A;  3ZNI A;  1OZO A;  2ZRT A;  2DOQ A;  1XK4 A;  1BJF A;  1QIW A;  2D8N A;  3BUW B;  5HLV A;  2M3W A;  1JFJ A;  3NXA A;  1H8B A;  2K2F A;  2EHB A;  1RTP 1;  2JQ6 A;  1IG5 A;  3HCM A;  4GGF A;  2AMI A;  3TUY B;  4CLN A;  3I5G B;  3NSL A;  1WDC B;  3I5I C;  3VRP A;  1XFY O;  1NX0 A;  2EC6 B;  4M2P A;  4OKH A;  1M63 B;  3CS1 A;  1QX5 B;  1DGU A;  2SAS A;  4N1G A;  1PAL A;  1CDL A;  1YUT A;  1DMO A;  1TTX A;  3GOF A;  2AAO A;  2NLN A;  2BKI B;  2KBM A;  4UPG A;  1C7V A;  1AK8 A;  1OQP A;  5CSF A;  4YGE B;  3SG2 A;  1G8I A;  3F45 A;  2BBM A;  2M1K B;  2KFG A;  1NX1 A;  5HYD A;  3VRO A;  1BR4 B;  1CFP A;  4CPV A;  1QX7 A;  1LKJ A;  1REC A;  2F8P A;  3KO0 A;  1PSR A;  1S6C A;  3DVM A;  2H61 C;  1KQM B;  1TCF A;  1KQV A;  1CKK A;  2CT9 A;  1OMD A;  1JF2 A;  1XYD A;  1F4Q A;  4F0Z B;  4MRX A;  1FI6 A;  2MAZ A;  3PAL A;  5ER5 A;  5B8I B;  3VRQ A;  4NDC A;  2HET A;  1BMO A;  1FW4 A;  3JVT C;  1CFC A;  1FF1 A;  4YI8 A;  1XFX O;  3D0Y B;  4PE4 A;  3BOW A;  2JNF A;  3EK8 A;  2NZ0 A;  2BL0 B;  3QRX A;  2L50 A;  2JWW A;  3AKA A;  1DJY A;  2M7L A;  1B7T Y;  1B47 A;  2M1U A;  2LP2 A;  3PN7 C;  1CLB A;  5HKY A;  3NSO A;  2OTG C;  1JBA A;  4YGC B;  4HRE E;  4QJ5 B;  4DCK A;  4I5K A;  2HQW A;  3RLZ A;  4A4C A;  1B9A A;  1GQM A;  1K8U A;  1S3P A;  1SYM A;  1V1G A;  1D1O A;  5CSI A;  1C07 A;  3FIA A;  1QTX A;  3VRN A;  2L98 A;  3SIA A;  2R2I A;  1FBV A;  1TN4 A;  2BCX A;  4DIR A;  5FYX A;  1NCZ A;  2F33 A;  2FCD A;  1B7T Z;  4WQ3 A;  2BBN A;  4PHN A;  2M8U A;  3BUX B;  5AAN A;  1A4P A;  1VRK A;  1J1E A;  2GGZ A;  2COL B;  2I94 A;  4DRW A;  3FS7 A;  1SL7 A;  2KAV A;  1RFJ A;  1UHJ A;  2FCE A;  2MRD A;  5I2L A;  2I2R E;  1SW8 A;  5DKR A;  1CNP A;  3PN7 B;  2OTG B;  1RK9 A;  1DJH A;  2JXC A;  2Y4Q A;  1KK7 Y;  1LXF C;  4N5X A;  4GFT A;  4ORA B;  2K0J A;  1CMG A;  4YGA A;  5GQQ C;  1MXL C;  1S36 A;  4ORC B;  2LE9 B;  5HKZ A;  1ZUZ A;  1E8A A;  1BT6 A;  2MLF C;  2OPO A;  1BLQ A;  1CTR A;  1N2D A;  1B4C A;  2M7N A;  3BUN B;  4I5J A;  3DF0 B;  2F2O A;  4CFR A;  2L4H A;  1SK6 D;  1JC2 A;  2KDH A;  1M31 A;  1KK7 Z;  2NCP A;  1F54 A;  1XK4 C;  4D1E A;  1SNL A;  3O2P A;  1MXE A;  2L0P A;  2M97 A;  2ZFD A;  2KI4 C;  1EL4 A;  1JSA A;  2OS8 C;  1MHO A;  4GGF C;  1EJ3 A;  1M45 A;  3LLE A;  3JTD C;  1EH2 A;  1G4Y R;  1A29 A;  1WRK A;  1F70 A;  5AER A;  1DJZ A;  4C0K A;  1A75 A;  4L9M A;  1QLS A;  2WOS A;  2LNK A;  1TNQ A;  2FOT A;  1YX7 A;  5HLO A;  1K93 D;  1IKU A;  2M0R A;  1UHN A;  1F4O A;  2ZND A;  2WC8 A;  4PCW A;  4HRH A;  4MRY A;  1DGV A;  4AQJ A;  1JWD A;  1JUO A;  1K94 A;  1SL8 A;  1IJ5 A;  1QJT A;  1WLZ A;  2BKH B;  2L4I A;  2KI4 B;  2Y5I A;  2M9G A;  3IF7 A;  4HSZ A;  4PE0 A;  3TDI A;  2OS8 B;  3O78 A;  1MR8 A;  3O6B A;  1JFK A;  1CDN A;  2Y1N A;  4NDD A;  3BUM B;  4OR9 B;  3H4S E;  1S6J A;  1NCY A;  2KHN A;  2QPT A;  2MBX A;  5CSN A;  4M2Q A;  1QV1 A;  1K9U A;  1OSA A;  2I7A A;  4BY4 A;  1AP4 A;  1PUL A;  3PM8 A;  2ZN8 A;  4YI9 A;  2KYF A;  2LMV A;  1FI5 A;  2LP3 A;  3E3R A;  3OX6 A;  1H4B A;  4WQ2 A;  3GK1 A;  4ICB A;  1EXR A;  1UHK A;  1LA0 A;  1CM4 A;  3I5I B;  4XJK B;  1ODB A;  1SBJ A;  3PSR A;  1QVI Y;  3TDZ A;  1ZOT B;  2Q91 A;  4MSP A;  1TCO B;  3K21 A;  3PFV A;  2KYC A;  1CMF A;  5AFP A;  4JWQ A;  1WRL A;  1L2O C;  1PVB A;  1QAS A;  4GBA A;  1DTL A;  2Q4U A;  1YRT B;  3GK4 X;  2K7D A;  1Y1A A;  1DJX A;  1L7Z A;  3CR4 X;  3SG7 A;  3D10 A;  1A03 A;  3A8R A;  1QVI Z;  3FWC A;  4GUK A;  2LAN A;  4GGN A;  1QS7 A;  1BOD A;  1UUS A;  1F8H A;  4E68 A;  4Q04 A;  2CTN A;  2LM5 A;  3CR5 X;  1SMG A;  2KFH A;  2LUX A;  4PHM A;  4U8D A;  1NP8 A;  3BOW B;  4ZCV A;  4CFQ A;  1QIV A;  1M39 A;  3LL8 B;  1J7O A;  1UUR A;  1L2O B;  3BUO B;  1U5I A;  1SPY A;  2F2P A;  4CID A;  1TIZ A;  1K2H A;  5KTY A;  4YGD B;  4PHJ A;  2F3Z A;  2BE6 A;  1YVL A;  2LHI A;  1IH0 A;  1R6P A;  1MWN A;  5BPJ A;  1AJ4 A;  2O5G A;  2KOT A;  1Y6W A;  2I18 A;  1UHH A;  1OMV A;  3JVT B;  4FQO A;  1XO5 A;  1KWO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...