4GGFA

Crystal structure of mn2+ bound calprotectin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
89
structure length
89
Chain Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Protein S100-A8
publication title Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 89
sequence length 89
chains with identical sequence K, S, U
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ggfA00
2FCEA 2F3ZA 2M97A 2MBXA 4CIDA 1SR6B 1G4YR 2G2BA 1DT7B 4YI9A 3IF7A 2LC5A 2JU0A 1S5GY 4ICBA 1YX7A 4YRUA 1SCMB 3LL8B 4FQOA 3VRPA 1KK7Z 2LVKA 4YGDB 4OR9B 2LHLA 4M2QA 2K0JA 1CLLA 1LVCD 2LLTA 3O2PA 4PHKA 2JTZA 2KI4B 1K90D 3DVMA 5DKQA 3DF0A 1BU3A 2EC6B 3DVJA 1RWYA 4OKHA 1XFVO 4PDZA 5CSFA 1BODA 2KFFA 1G8IA 3PFVA 1K96A 1YRUB 1DJYA 4FTGA 4PE0A 1JSAA 1NPQA 5G08A 2Q4UA 2BCBA 3PATA 2M0RA 3KPXA 1B4CA 2FJUB 1WRLA 3BYAA 1K94A 1C07A 2HPSA 3FIAA 1S5GZ 2MLFC 4D1EA 4P5OE 2L98A 2A4JA 4ETOA 1UHNA 3DF0B 2K7BA 2F3YA 2KDHA 3VGOA 3C1VA 4I5NB 1RECA 3CGAA 3TDUA 2PMYA 2OTGC 1M39A 1AJ5A 1C7WA 1CB1A 2FOTA 2BL0C 2KAVA 4QJ3B 3JVTB 1Y1UA 1B7TY 2LMVA 1KCYA 4OCIA 4A4BA 1AVSA 3SG3A 1TOPA 1PRWA 5AEQA 4R1EA 1J7QA 3BUNB 4I5JA 4YGCB 2KBMA 5JOLA 2OS8C 3LLEA 2LE9B 1M46A 3SG7A 1WRZA 2JT0A 4MZJA 2QACA 3OX5A 1CFPA 1AHRA 2PALA 1QIVA 2KSPA 1DGVA 2LAPA 4ZCVA 2M1UA 4GNKB 2LANA 4UPGA 3A4UB 2KBIA 1J1DA 4BY5A 2CT9A 3NSLA 3GK1A 3PALA 1CM1A 1XVJA 2JNXA 1AJ4A 1QTXA 3BOWA 1FI5A 2M8UA 2M29A 2M7NA 4GPLB 1NSHA 1M45A 2ZNDA 1ZFSA 4HRGA 1FF1A 1TRFA 1NX2A 1A03A 1U5IA 3I5GB 1OSAA 3O4YA 1J7RA 1DJXA 4GBAA 1SY9A 1UHKA 1EJ3A 2MAZA 1B7TZ 1SR6C 2CBLA 4DS7A 1DJZA 3FS7A 4ORAB 1Y0VH 1CNPA 2GV5A 2KI6C 1MQ1A 1N65A 3OX6A 1YR5A 2KAYA 1SCMC 5K89A 1A4PA 1XFWO 1DVIA 2PRUA 2GGZA 1SL9A 4NDDA 5JJGA 2Y1NA 3PM8A 2QPTA 2H2KA 3RM1A 1GGZA 1XFYO 2K2FA 3KEVA 1BOCA 1F70A 2EC6C 1IJ5A 3BOWB 2Y4QA 1XK4C 2PVBA 3GK4X 4MZKA 3AAKA 4JQ0D 2LNKA 3O78A 4YGEB 4CFQA 3EVUA 1K95A 5F6TA 4CLNA 1L2OB 4MN0A 1B1GA 4F0ZB 1QLKA 1QXPA 2CCMA 3BQ3A 4XYNA 1Y1XA 2NXQA 2JT8A 1CDNA 3VRRA 3DVEA 1FI6A 2BKHB 3BUOB 4ORCB 2WCBA 5I2LA 2KGRA 4PHJA 3O6BA 1UUSA 1CTRA 1NWDA 1JC2A 2ZRTA 2P6BB 2LV7A 2JOJA 1TCOB 2M49B 4PE4A 1UHJA 4YBHB 1YVHA 3PSRA 2AMIA 5IBWA 2M3WA 1W7JB 5BPJA 2LMUA 4A4CA 4N1FA 1N2DA 1F55A 1BLQA 1BG1A 3VRNA 1SL8A 1K2HA 1HT9A 3I5FB 2F8PA 4MEWA 3LK1A 1IKUA 1ZACA 5D7FA 5TNCA 1F8HA 3CR4X 1PULA 1AK8A 1IH0A 4DRWA 2K7CA 2L51A 1NCZA 1H4BA 1FPWA 1F54A 3PLFB 2H61A 4MSPA 2IS9A 1QS7A 1KSMA 3ZNIA 1RK9A 1SMGA 2BBMA 4MRYA 1L7ZA 2MRDA 2MJWB 4N1GA 4ORBB 3EVRA 2JXCA 2EHBA 1OMRA 2K7DA 4I5LB 2JT3A 1C7VA 2R2IA 4YGBB 4DIRA 5KU1A 3DD4A 2CXJA 3D0YA 3OB2B 3K21A 5I2QA 5CSIA 1UHHA 2JWWA 3I5GC 3EKJA 4I5KA 4MZLA 1OZSA 2MHHA 3BXKA 1KFXS 3CR5X 1KFXL 1KQMB 1PSBA 1QJTA 2F2PA 4HRHA 1WRKA 1BJFA 4GAOA 4BY4A 4CPVA 2ZN8A 1SKTA 3CS1A 2GGMA 2VRGA 3SG4A 2SCPA 2ZN9A 2NCOA 2HQWA 4MVFA 3FWCA 1TCFA 1SNLA 2LUCA 4MRXA 5KTYA 1NX0A 3CWGA 3VROA 1NUBA 2NZ0A 1B47A 1CDLA 2LVIA 2MLEC 5D69A 2JPTA 1QX5B 3D0YB 3EK7A 1R2UA 2LLUA 2LVVA 1MXLC 5ER5A 2RGIA 4GFTA 1L2OC 2LP2A 3NSKA 3OP0A 1A75B 1JFJA 2TN4A 2BBNA 5DKRA 1ALWA 2LLSA 1QX2A 4M2OA 5FYXA 4M2PA 1S6CA 1SBJA 2KFHA 2LP3A 1JF0A 3OB1B 2ZKMX 1WY9A 2K61A 4NDCA 3LK0A 2F33A 1G33A 2NCPA 4L9MA 1JFKA 3TDZA 1F4OA 2JZIA 1M63B 1RROA 4HSZA 4N5XA 4AQJA 1QLSA 2L0PA 3GK2A 2AAOA 1JWDA 2WNDA 3BUXB 1QASA 1UWOA 4PE1A 2LUXA 2JTTA 5CSNA 2K7OA 1IQ5A 1ALVA 4WQ2A 1B8LA 2JRFA 1S26D 2KI4C 4USLA 1IG5A 1JUOA 2G9BA 1A29A 1MR8A 3SG5A 1EH2A 3JTDB 1KFUS 2BE6A 3VRQA 1E8AA 1KFUL 4XJKA 3NXAA 3I5HB 1QX7A 1J55A 1SCVA 1MXEA 3I5FC 2WOSA 3HCMA 1PK0D 4IL1A 1TN4A 3EKHA 2M7LA 3RLZA 2LCPA 1DGUA 1TNPA 1IQ3A 1IRJA 4GGFA 1OOJA 2BECA 4MLWA 5AERA 5B8IB 1YUSA 3EK8A 5KSZA 1J1EA 1BMOA 1KK7Y 1IWQA 3H4SE 4Q04A 4U8DA 3WNXB 3CR2A 3EK4A 1Q80A 1J7OA 4P2YB 4C0JA 1NP8A 4PE7A 1DMOA 1KSOA 3CLNA 1YUTA 2KNEA 3CZTX 1OZOA 1QATA 2WORA 5CPVA 4DUQA 3SIAA 4ZCUA 1S36A 2MA2A 5HKYA 2E30A 4XJKB 1MUXA 1K9PA 4OV2A 3NSIA 1OMVA 2CNPA 3ZWHA 1LINA 3GOFA 4YI8A 1CFDA 5GQQC 3TS5B 1UHIA 1DF0A 1KQMC 3CTNA 3JVTC 1W7IB 2OPOA 4PHMA 5AFPA 1JBAA 2WC8A 2KYCA 2KQYA 1J7PA 2JC2A 5ER4X 2COLB 1CFCA 1OE9B 1QVIY 1TNXA 1GJYA 2H61C 1XFZO 5HYDA 2L5XB 2Q91A 3KF9A 2KHNA 1YRTB 2KGBC 1B8RA 2JQ6A 4PALA 5I8NA 1CDMA 1D1OA 1Y1AA 1SL7A 2AUCA 1CDPA 1M31A 1BR4B 2KAXA 4WRIA 2I2RE 3QRXA 2CTNA 5PALA 3BUMB 1UURA 3PN7B 4WQ3A 2Y5IA 1OQPA 1XO5A 2ZNEA 3WHTB 1KWOB 2WCEA 2EGDA 1VRKA 1XYDA 2D8NA 2L4HA 1DF0B 1F71A 1KK8B 2K2AA 3AKAA 1BR1B 4YGAA 4CFRA 1S3PA 1CKKA 1V1GA 4PCWA 1DJGA 4QJ4B 2JULA 3TUYB 2M9GA 4GUKA 1K9UA 4JPZB 1QV1A 2KQ6A 4C0KA 1A75A 1DJWA 1GQMA 2F2OA 1K93D 1V1FA 3ICBA 3SG2A 3I5IB 2HQ8A 3WHUB 1DJHA 1NCYA 1WDCB 1TNWA 1MF8B 2I94A 2PSRA 2SASA 3D10A 3HX4A 2BKIB 1QVIZ 2E6WA 2V53A 1NIWA 1IGVA 1NX1A 1WLMA 3AKBA 1ZOTB 3E3RA 1NYAA 1YVLA 4NDBA 2ISDA 1K8UA 2L2EA 2BCXA 4TNCA 1A2XA 1LKJA 1RTP1 5DKNA 1CM4A 1PVAA 1QV0A 1F4QA 3JTDC 5AXIA 1QIWA 3I5HC 2JNFA 1RFJA 4JWQA 1PSRA 1MHOA 1EG4A 2NLNA 1UP5A 3IQOA 5AANA 1DJIA 1YX8A 5HLOA 5J3XA 2ZRSA 4HREE 2B1UA 1TNQA 1EG3A 1CMFA 2Y1MA 1LA3A 1RJVA 3KO0A 1Y6WA 2HF5A 2ZFDA 1N0YA 1B9AA 2BE4A 1BF5A 5CSJA 2O60A 4DCKA 4GGNA 2L50A 3OHMB 1CMGA 3MSEB 3SG6A 4NQGA 1SK6D 5HKWA 1AUIB 1B8CA 2BCAA 1X02A 2JXLA 1YUUA 3F45A 1YURA 2LMTA 4E68A 1TTXA 2K8MB 1FW4A 1TIZA 2LHIA 3EVVA 3TS5C 2HETA 2FCDA 5HKZA 2I7AA 2KFGA 1WLZA 4PHNA 2KOTA 2OTGB 4GGFC 1LA0A 4C0LA 1FBVA 3TDIA 1CLMA 1ODBA 2BL0B 2I18A 3M0WA 3WXAA 2WCFA 1R6PA 3KHEA 3A8RA 1K9KA 2KYFA 3NSOA 1GGWA 3SIBA 1PVBA 1NX3A 1ZUZA 3FWBA 4QJ5B 4MBEA 1S6IA 5HLVA 2PASA 1PALA 3BUWB 3LCPC 1S1EA 1KQVA 1DTLA 2DOQA 2OS8B 1BT6A 1ZMZA 1OMDA 1XFUO 4AQIA 2LM5A 1XA5A 1MWNA 5I2OA 3PN7C 4AOMA 1XFXO 1KWOC 3TZ1A 1JF2A 1HQVA 1IJ6A 1KK8C 1S6JA 1SRAA 1EL4A 1U5IB 2L4IA 3DVKA 3SJSA 3AAJA 1NCXA 3TUYC 1H8BA 1AP4A 2M1KB 2O5GA 1SW8A 1XK4A 1CLBA 1SPYA 3IQQA 2KI6D 3I5IC 1LXFC 1YTZC 1CFFA 1SYMA 1WDCC 4OVNF 1EXRA 2LVJA
chains in the Genus database with same CATH superfamily
2FCEA 3RZSA 2F3ZA 2M97A 1XFRA 2MBXA 4CIDA 3S0AA 1SR6B 1G4YR 2G2BA 1DT7B 4YI9A 1OOGA 3IF7A 2LC5A 2JU0A 1S5GY 4ICBA 1YX7A 3B86A 4YRUA 3FE6A 1SCMB 3LL8B 4FQOA 3VRPA 3SS5A 1KK7Z 2LVKA 3BFAA 4OR9B 2WCJA 2LHLA 4M2QA 4YGDB 2K0JA 1CLLA 1LVCD 2LLTA 3O2PA 3SS3A 4PHKA 2JTZA 2KI4B 1K90D 3DVMA 5DKQA 3DF0A 1BU3A 2EC6B 3DVJA 3DY9A 1RWYA 3NHIA 4OKHA 1XFVO 4PDZA 5CSFA 1BODA 2KFFA 1G8IA 3PFVA 1K96A 1YRUB 1DJYA 4FTGA 4PE0A 1JSAA 3UO9A 1NPQA 5G08A 2Q4UA 2BCBA 3PATA 2M0RA 3KPXA 3OBVA 2FJUB 2JPOA 1WRLA 1B4CA 3BYAA 1K94A 1C07A 2HPSA 3FIAA 1S5GZ 2MLFC 4D1EA 4P5OE 2L98A 2A4JA 4ETOA 4JKTA 2KLEA 3FE9A 1UHNA 3DF0B 2K7BA 2F3YA 2KDHA 3VGOA 3D78A 3C1VA 4I5NB 1RECA 3CGAA 3S0EA 3TDUA 2PMYA 2OTGC 1M39A 3DYEA 1AJ5A 1C7WA 1CB1A 2FOTA 2BL0C 2KAVA 4QJ3B 3JVTB 1P28A 2WCMA 1Y1UA 3D73A 1B7TY 2LMVA 4FQTA 1KCYA 4OCIA 4A4BA 1AVSA 3SG3A 1TOPA 1PRWA 2QEOA 5AEQA 4R1EA 1J7QA 3BUNB 4I5JA 4YGCB 2KBMA 5JOLA 2OS8C 3LLEA 2LE9B 1M46A 3SG7A 1WRZA 2JT0A 4MZJA 2QACA 2K60A 3OX5A 1CFPA 1AHRA 2PALA 1QIVA 2KSPA 1DGVA 2LAPA 4ZCVA 4JD9A 2M1UA 4GNKB 2LANA 4UPGA 3A4UB 2KBIA 1J1DA 4BY5A 2CT9A 3NSLA 3GK1A 3PALA 1CM1A 1XVJA 2JNXA 1AJ4A 3L47A 1QTXA 3BOWA 1FI5A 2M8UA 2M29A 1SSEB 2M7NA 2QEBA 4GPLB 1NSHA 1M45A 2ZNDA 1ZFSA 4HRGA 1FF1A 1OOFA 1NX2A 1TRFA 1A03A 1U5IA 3I5GB 1OSAA 3O4YA 1J7RA 1DJXA 4GBAA 1SY9A 1UHKA 1EJ3A 2MAZA 1B7TZ 1SR6C 3B7AA 2CBLA 4F7FA 4DS7A 1DJZA 3FS7A 4ORAB 1Y0VH 1CNPA 2GV5A 2KI6C 1MQ1A 1N65A 3OX6A 1YR5A 2KAYA 1SCMC 5K89A 1A4PA 1XFWO 1DVIA 3OGNA 2PRUA 2GGZA 1SL9A 4NDDA 5JJGA 2Y1NA 2BAPA 2QPTA 2H2KA 3PM8A 3RM1A 1GGZA 1XFYO 2K2FA 3KEVA 1BOCA 1F70A 2EC6C 1IJ5A 3BOWB 2Y4QA 1XK4C 2PVBA 5D3OA 3GK4X 4MZKA 3AAKA 4JQ0D 2LNKA 3O78A 4YGEB 4CFQA 3EVUA 2L5YA 1K95A 5F6TA 4CLNA 1L2OB 4MN0A 1B1GA 4F0ZB 1QLKA 1QXPA 2CCMA 3BQ3A 4XYNA 1Y1XA 2NXQA 2JT8A 1CDNA 3VRRA 3DVEA 1FI6A 2BKHB 3BUOB 3R72A 4ORCB 2WCBA 2QEVA 5I2LA 2KGRA 4PHJA 3O6BA 1UUSA 3PJIA 1CTRA 1NWDA 3QMEA 1JC2A 2ZRTA 2P6BB 2LV7A 2WCLA 2JOJA 1TCOB 2M49B 4PE4A 1DEKA 1LS8A 1UHJA 4YBHB 1DC1A 1YVHA 3PSRA 2AMIA 5IBWA 2M3WA 1W7JB 3D74A 5BPJA 2LMUA 4A4CA 4N1FA 1N2DA 1F55A 1BLQA 1BG1A 3VRNA 1SL8A 1K2HA 1HT9A 3I5FB 2F8PA 4MEWA 3DXLA 3LK1A 1IKUA 1ZACA 5D7FA 5TNCA 1F8HA 3CR4X 1PULA 1AK8A 1IH0A 4DRWA 2K7CA 2L51A 1NCZA 2WCHA 1FPWA 1H4BA 1F54A 3PLFB 2H61A 3R1OA 4MSPA 2WCKA 2IS9A 1QS7A 1KSMA 3ZNIA 1RK9A 1SMGA 2BBMA 3D76A 1L7ZA 2MRDA 2MJWB 3CDNA 4MRYA 3EVRA 2JXCA 4ORBB 2EHBA 1OMRA 2K7DA 4I5LB 2JT3A 1C7VA 2R2IA 4YGBB 4DIRA 5KU1A 3DD4A 2CXJA 3D0YA 3OB2B 3K21A 5I2QA 5CSIA 1UHHA 2JWWA 2QDIA 3I5GC 3EKJA 4I5KA 4MZLA 3UNWA 1OOIX 1OZSA 2MHHA 3BXKA 1KFXS 3CR5X 1KFXL 1KQMB 1PSBA 1QJTA 2F2PA 4HRHA 1WRKA 1BJFA 4GAOA 4BY4A 4CPVA 2ZN8A 1SKTA 1OOHA 3CS1A 1QWVA 2GGMA 2VRGA 3SG4A 2SCPA 2ZN9A 2NCOA 2HQWA 4MVFA 3FWCA 1TCFA 1SNLA 2LUCA 3FE8A 5I94A 2BNXA 4MRXA 5KTYA 1NX0A 3CWGA 3VROA 1NUBA 2NZ0A 1B47A 1CDLA 2LVIA 2MLEC 5D69A 2JPTA 1QX5B 3D0YB 5FI6A 3EK7A 1R2UA 3B6XA 2KLDA 2LLUA 2LVVA 4INXA 1MXLC 5ER5A 2RGIA 4GFTA 1L2OC 2LP2A 1TWOA 3NSKA 1A75B 3CZ0A 3OP0A 2TN4A 1JFJA 5DICA 2BBNA 5DKRA 1ALWA 2LLSA 1QX2A 4M2OA 5FYXA 4M2PA 1S6CA 1SBJA 2KFHA 2LP3A 1JF0A 3OB1B 2ZKMX 1WY9A 2ERBA 2K61A 3L4LA 4NDCA 3LK0A 2F33A 1G33A 2NCPA 4L9MA 1JFKA 3TDZA 1F4OA 2JZIA 3IVTA 1M63B 1RROA 4HSZA 4N5XA 4AQJA 1QLSA 2L0PA 3GK2A 4INWA 2AAOA 1JWDA 2WNDA 3BUXB 1QASA 3K1EA 1UWOA 4PE1A 2LUXA 2JTTA 5CSNA 1W9ZA 2K7OA 1IQ5A 1ALVA 3CYZA 4WQ2A 1B8LA 2JRFA 1S26D 2KI4C 4USLA 1IG5A 1JUOA 2G9BA 5FI7A 1A29A 1MR8A 3SG5A 1EH2A 1C3YA 3JTDB 1KFUS 2BE6A 3VRQA 1E8AA 1KFUL 4XJKA 3NXAA 3I5HB 1QX7A 1J55A 1TUJA 1SCVA 1MXEA 3I5FC 2WOSA 3HCMA 2PYQA 1PK0D 4IL1A 1TN4A 1DELA 3EKHA 2M7LA 2P70A 3RLZA 2LCPA 1DGUA 1TNPA 1OW4A 1IRJA 4GGFA 1OOJA 2BECA 4MLWA 5AERA 1IQ3A 5B8IB 1YUSA 3EK8A 5KSZA 1J1EA 4IJ7A 1BMOA 1KK7Y 1IWQA 3H4SE 4Q04A 4U8DA 3WNXB 1GM0A 3CR2A 3EK4A 1Q80A 1J7OA 4P2YB 4C0JA 1NP8A 4PE7A 1DMOA 1KSOA 3CLNA 1YUTA 2KNEA 3CZTX 1OZOA 1QATA 2WORA 1TUZA 5CPVA 3S0GA 3SIAA 4DUQA 4ZCUA 1S36A 2MA2A 5HKYA 2E30A 2QEHA 4XJKB 1MUXA 3S0DA 1K9PA 4OV2A 3NSIA 1OMVA 2CNPA 3ZWHA 1LINA 3GOFA 4N1GA 1CFDA 4YI8A 5GQQC 1Z2CB 3TS5B 1UHIA 1DF0A 1KQMC 3CTNA 3JVTC 1W7IB 2OPOA 2WC6A 3PM2A 4PHMA 5AFPA 1JBAA 2WC8A 2KYCA 2KQYA 3DZTA 1J7PA 2JC2A 5ER4X 2COLB 3BJHA 1OE9B 1QVIY 1TNXA 1GJYA 2H61C 1CFCA 1XFZO 1C3ZA 5HYDA 2L5XB 2Q91A 3KF9A 2KHNA 1YRTB 2KGBC 3B88A 1B8RA 2JQ6A 4PALA 5I8NA 1CDMA 1D1OA 1Y1AA 1SL7A 2AUCA 3BFHA 1CDPA 1M31A 1BR4B 1DQEA 2KAXA 4WRIA 2I2RE 1T14A 3QRXA 2CTNA 5PALA 3BUMB 1UURA 3PN7B 4WQ3A 2Y5IA 1OQPA 1XO5A 2ZNEA 3WHTB 1KWOB 2WCEA 2EGDA 1VRKA 1XYDA 2D8NA 2L4HA 1DF0B 1F71A 1KK8B 2K2AA 3AKAA 1BR1B 4YGAA 4CFRA 1S3PA 3BFBA 1V1GA 4PCWA 1CKKA 1DJGA 4QJ4B 2JULA 3TUYB 2M9GA 4GUKA 1K9UA 4JPZB 1QV1A 2KQ6A 4C0KA 1A75A 1DJWA 1GQMA 2F2OA 1K93D 1V1FA 3ICBA 3SG2A 3I5IB 3VB1A 2HQ8A 3NHTA 3WHUB 1DJHA 1NCYA 5HL1A 4PT1A 1WDCB 1TNWA 1MF8B 2I94A 2PSRA 2SASA 3D10A 3HX4A 4OZDA 2BKIB 1QVIZ 2PQLA 2E6WA 2V53A 1NIWA 1IGVA 1NX1A 1WLMA 3AKBA 3CABA 1ZOTB 3E3RA 1NYAA 1YVLA 4NDBA 2ISDA 3D77A 1K8UA 2L2EA 2BCXA 4TNCA 1A2XA 1LKJA 1RTP1 3N7HA 1CM4A 1PVAA 1QV0A 5DKNA 1F4QA 3JTDC 3NGVA 5AXIA 1QIWA 3I5HC 2JNFA 1RFJA 4JWQA 1PSRA 1MHOA 1EG4A 2NLNA 1UP5A 3IQOA 5AANA 1DJIA 1YX8A 3O4XA 5HLOA 5J3XA 2ZRSA 4HREE 2B1UA 1TNQA 1EG3A 2YGUA 1CMFA 2Y1MA 1LA3A 1RJVA 2L2CA 5FI2A 3KO0A 3S0BA 1Y6WA 2HF5A 2ZFDA 1N0YA 1B9AA 2BE4A 1BF5A 3EG5B 5CSJA 2O60A 2P71A 4DCKA 4GGNA 2L50A 3OHMB 1CMGA 3MSEB 3SG6A 4NQGA 1SK6D 5HKWA 1AUIB 1B8CA 2BCAA 1X02A 2JXLA 1YUUA 3F45A 1YURA 2LMTA 4E68A 1TTXA 3D75A 2K8MB 1FW4A 1TIZA 2LHIA 3EVVA 3TS5C 2HETA 2FCDA 5HKZA 2I7AA 2KFGA 4KYNA 1WLZA 4PHNA 2KOTA 2OTGB 3SS4A 4GGFC 1LA0A 4C0LA 1IIOA 1FBVA 3TDIA 3S0FA 1CLMA 3R1VA 1ODBA 2BL0B 2I18A 3R1PA 3M0WA 3WXAA 2H8VA 2WCFA 1R6PA 3KHEA 3A8RA 1K9KA 3V2LA 2GTEA 2KYFA 3NSOA 3SIBA 1GGWA 1PVBA 2KPHA 1NX3A 1ZUZA 3CZ1A 3FWBA 4QJ5B 4MBEA 1S6IA 5HLVA 2PASA 1PALA 3BUWB 3LCPC 1S1EA 1KQVA 1DTLA 1ORGA 2DOQA 1BT6A 1ZMZA 2OS8B 1OMDA 1XFUO 2FJYA 4AQIA 2LM5A 1XA5A 1MWNA 3CZ2A 3PN7C 5I2OA 4AOMA 1Z4HA 1XFXO 1KWOC 3Q8IA 1JF2A 3TZ1A 1HQVA 1IJ6A 1KK8C 1S6JA 1SRAA 1EL4A 1U5IB 2L4IA 3DVKA 5EL2A 3SJSA 3AAJA 2WC5A 1NCXA 3TUYC 3L4AA 1AP4A 2M1KB 2O5GA 1SW8A 1H8BA 1XK4A 1CLBA 1SPYA 3IQQA 2KI6D 3I5IC 1LXFC 1YTZC 1CFFA 1SYMA 1WDCC 4OVNF 1EXRA 2LVJA 3B87A
chains in the Genus database with same CATH topology
2FCEA 2F3ZA 2M97A 2MBXA 4CIDA 1SR6B 1G4YR 2G2BA 1DT7B 4YI9A 3IF7A 2LC5A 2JU0A 1S5GY 4ICBA 1YX7A 4YRUA 1SCMB 3LL8B 4FQOA 3VRPA 1KK7Z 2LVKA 4YGDB 4OR9B 2LHLA 4M2QA 2K0JA 1CLLA 1LVCD 2LLTA 3O2PA 4PHKA 2JTZA 2KI4B 1K90D 3DVMA 5DKQA 3DF0A 1BU3A 2EC6B 3DVJA 1RWYA 4OKHA 1XFVO 4PDZA 5CSFA 1BODA 2KFFA 1G8IA 3PFVA 1K96A 1YRUB 1DJYA 4FTGA 4PE0A 1JSAA 1NPQA 5G08A 2Q4UA 2BCBA 3PATA 2M0RA 3KPXA 1B4CA 2FJUB 1WRLA 3BYAA 1K94A 1C07A 2HPSA 3FIAA 1S5GZ 2MLFC 4D1EA 4P5OE 2L98A 2A4JA 4ETOA 1UHNA 3DF0B 2K7BA 2F3YA 2KDHA 3VGOA 3C1VA 4I5NB 1RECA 3CGAA 3TDUA 2PMYA 2OTGC 1M39A 1AJ5A 1C7WA 1CB1A 2FOTA 2BL0C 2KAVA 4QJ3B 3JVTB 1Y1UA 1B7TY 2LMVA 1KCYA 4OCIA 4A4BA 1AVSA 3SG3A 1TOPA 1PRWA 5AEQA 4R1EA 1J7QA 3BUNB 4I5JA 4YGCB 2KBMA 5JOLA 2OS8C 3LLEA 2LE9B 1M46A 3SG7A 1WRZA 2JT0A 4MZJA 2QACA 3OX5A 1CFPA 1AHRA 2PALA 1QIVA 2KSPA 1DGVA 2LAPA 4ZCVA 2M1UA 4GNKB 2LANA 4UPGA 3A4UB 2KBIA 1J1DA 4BY5A 2CT9A 3NSLA 3GK1A 3PALA 1CM1A 1XVJA 2JNXA 1AJ4A 1QTXA 3BOWA 1FI5A 2M8UA 2M29A 2M7NA 4GPLB 1NSHA 1M45A 2ZNDA 1ZFSA 4HRGA 1FF1A 1TRFA 1NX2A 1A03A 1U5IA 3I5GB 1OSAA 3O4YA 1J7RA 1DJXA 4GBAA 1SY9A 1UHKA 1EJ3A 2MAZA 1B7TZ 1SR6C 2CBLA 4DS7A 1DJZA 3FS7A 4ORAB 1Y0VH 1CNPA 2GV5A 2KI6C 1MQ1A 1N65A 3OX6A 1YR5A 2KAYA 1SCMC 5K89A 1A4PA 1XFWO 1DVIA 2PRUA 2GGZA 1SL9A 4NDDA 5JJGA 2Y1NA 3PM8A 2QPTA 2H2KA 3RM1A 1GGZA 1XFYO 2K2FA 3KEVA 1BOCA 1F70A 2EC6C 1IJ5A 3BOWB 2Y4QA 1XK4C 2PVBA 3GK4X 4MZKA 3AAKA 4JQ0D 2LNKA 3O78A 4YGEB 4CFQA 3EVUA 1K95A 5F6TA 4CLNA 1L2OB 4MN0A 1B1GA 4F0ZB 1QLKA 1QXPA 2CCMA 3BQ3A 4XYNA 1Y1XA 2NXQA 2JT8A 1CDNA 3VRRA 3DVEA 1FI6A 2BKHB 3BUOB 4ORCB 2WCBA 5I2LA 2KGRA 4PHJA 3O6BA 1UUSA 1CTRA 1NWDA 1JC2A 2ZRTA 2P6BB 2LV7A 2JOJA 1TCOB 2M49B 4PE4A 1UHJA 4YBHB 1YVHA 3PSRA 2AMIA 5IBWA 2M3WA 1W7JB 5BPJA 2LMUA 4A4CA 4N1FA 1N2DA 1F55A 1BLQA 1BG1A 3VRNA 1SL8A 1K2HA 1HT9A 3I5FB 2F8PA 4MEWA 3LK1A 1IKUA 1ZACA 5D7FA 5TNCA 1F8HA 3CR4X 1PULA 1AK8A 1IH0A 4DRWA 2K7CA 2L51A 1NCZA 1H4BA 1FPWA 1F54A 3PLFB 2H61A 4MSPA 2IS9A 1QS7A 1KSMA 3ZNIA 1RK9A 1SMGA 2BBMA 4MRYA 1L7ZA 2MRDA 2MJWB 4N1GA 4ORBB 3EVRA 2JXCA 2EHBA 1OMRA 2K7DA 4I5LB 2JT3A 1C7VA 2R2IA 4YGBB 4DIRA 5KU1A 3DD4A 2CXJA 3D0YA 3OB2B 3K21A 5I2QA 5CSIA 1UHHA 2JWWA 3I5GC 3EKJA 4I5KA 4MZLA 1OZSA 2MHHA 3BXKA 1KFXS 3CR5X 1KFXL 1KQMB 1PSBA 1QJTA 2F2PA 4HRHA 1WRKA 1BJFA 4GAOA 4BY4A 4CPVA 2ZN8A 1SKTA 3CS1A 2GGMA 2VRGA 3SG4A 2SCPA 2ZN9A 2NCOA 2HQWA 4MVFA 3FWCA 1TCFA 1SNLA 2LUCA 4MRXA 5KTYA 1NX0A 3CWGA 3VROA 1NUBA 2NZ0A 1B47A 1CDLA 2LVIA 2MLEC 5D69A 2JPTA 1QX5B 3D0YB 3EK7A 1R2UA 2LLUA 2LVVA 1MXLC 5ER5A 2RGIA 4GFTA 1L2OC 2LP2A 3NSKA 3OP0A 1A75B 1JFJA 2TN4A 2BBNA 5DKRA 1ALWA 2LLSA 1QX2A 4M2OA 5FYXA 4M2PA 1S6CA 1SBJA 2KFHA 2LP3A 1JF0A 3OB1B 2ZKMX 1WY9A 2K61A 4NDCA 3LK0A 2F33A 1G33A 2NCPA 4L9MA 1JFKA 3TDZA 1F4OA 2JZIA 1M63B 1RROA 4HSZA 4N5XA 4AQJA 1QLSA 2L0PA 3GK2A 2AAOA 1JWDA 2WNDA 3BUXB 1QASA 1UWOA 4PE1A 2LUXA 2JTTA 5CSNA 2K7OA 1IQ5A 1ALVA 4WQ2A 1B8LA 2JRFA 1S26D 2KI4C 4USLA 1IG5A 1JUOA 2G9BA 1A29A 1MR8A 3SG5A 1EH2A 3JTDB 1KFUS 2BE6A 3VRQA 1E8AA 1KFUL 4XJKA 3NXAA 3I5HB 1QX7A 1J55A 1SCVA 1MXEA 3I5FC 2WOSA 3HCMA 1PK0D 4IL1A 1TN4A 3EKHA 2M7LA 3RLZA 2LCPA 1DGUA 1TNPA 1IQ3A 1IRJA 4GGFA 1OOJA 2BECA 4MLWA 5AERA 5B8IB 1YUSA 3EK8A 5KSZA 1J1EA 1BMOA 1KK7Y 1IWQA 3H4SE 4Q04A 4U8DA 3WNXB 3CR2A 3EK4A 1Q80A 1J7OA 4P2YB 4C0JA 1NP8A 4PE7A 1DMOA 1KSOA 3CLNA 1YUTA 2KNEA 3CZTX 1OZOA 1QATA 2WORA 5CPVA 4DUQA 3SIAA 4ZCUA 1S36A 2MA2A 5HKYA 2E30A 4XJKB 1MUXA 1K9PA 4OV2A 3NSIA 1OMVA 2CNPA 3ZWHA 1LINA 3GOFA 4YI8A 1CFDA 5GQQC 3TS5B 1UHIA 1DF0A 1KQMC 3CTNA 3JVTC 1W7IB 2OPOA 4PHMA 5AFPA 1JBAA 2WC8A 2KYCA 2KQYA 1J7PA 2JC2A 5ER4X 2COLB 1CFCA 1OE9B 1QVIY 1TNXA 1GJYA 2H61C 1XFZO 5HYDA 2L5XB 2Q91A 3KF9A 2KHNA 1YRTB 2KGBC 1B8RA 2JQ6A 4PALA 5I8NA 1CDMA 1D1OA 1Y1AA 1SL7A 2AUCA 1CDPA 1M31A 1BR4B 2KAXA 4WRIA 2I2RE 3QRXA 2CTNA 5PALA 3BUMB 1UURA 3PN7B 4WQ3A 2Y5IA 1OQPA 1XO5A 2ZNEA 3WHTB 1KWOB 2WCEA 2EGDA 1VRKA 1XYDA 2D8NA 2L4HA 1DF0B 1F71A 1KK8B 2K2AA 3AKAA 1BR1B 4YGAA 4CFRA 1S3PA 1CKKA 1V1GA 4PCWA 1DJGA 4QJ4B 2JULA 3TUYB 2M9GA 4GUKA 1K9UA 4JPZB 1QV1A 2KQ6A 4C0KA 1A75A 1DJWA 1GQMA 2F2OA 1K93D 1V1FA 3ICBA 3SG2A 3I5IB 2HQ8A 3WHUB 1DJHA 1NCYA 1WDCB 1TNWA 1MF8B 2I94A 2PSRA 2SASA 3D10A 3HX4A 2BKIB 1QVIZ 2E6WA 2V53A 1NIWA 1IGVA 1NX1A 1WLMA 3AKBA 1ZOTB 3E3RA 1NYAA 1YVLA 4NDBA 2ISDA 1K8UA 2L2EA 2BCXA 4TNCA 1A2XA 1LKJA 1RTP1 5DKNA 1CM4A 1PVAA 1QV0A 1F4QA 3JTDC 5AXIA 1QIWA 3I5HC 2JNFA 1RFJA 4JWQA 1PSRA 1MHOA 1EG4A 2NLNA 1UP5A 3IQOA 5AANA 1DJIA 1YX8A 5HLOA 5J3XA 2ZRSA 4HREE 2B1UA 1TNQA 1EG3A 1CMFA 2Y1MA 1LA3A 1RJVA 3KO0A 1Y6WA 2HF5A 2ZFDA 1N0YA 1B9AA 2BE4A 1BF5A 5CSJA 2O60A 4DCKA 4GGNA 2L50A 3OHMB 1CMGA 3MSEB 3SG6A 4NQGA 1SK6D 5HKWA 1AUIB 1B8CA 2BCAA 1X02A 2JXLA 1YUUA 3F45A 1YURA 2LMTA 4E68A 1TTXA 2K8MB 1FW4A 1TIZA 2LHIA 3EVVA 3TS5C 2HETA 2FCDA 5HKZA 2I7AA 2KFGA 1WLZA 4PHNA 2KOTA 2OTGB 4GGFC 1LA0A 4C0LA 1FBVA 3TDIA 1CLMA 1ODBA 2BL0B 2I18A 3M0WA 3WXAA 2WCFA 1R6PA 3KHEA 3A8RA 1K9KA 2KYFA 3NSOA 1GGWA 3SIBA 1PVBA 1NX3A 1ZUZA 3FWBA 4QJ5B 4MBEA 1S6IA 5HLVA 2PASA 1PALA 3BUWB 3LCPC 1S1EA 1KQVA 1DTLA 2DOQA 2OS8B 1BT6A 1ZMZA 1OMDA 1XFUO 4AQIA 2LM5A 1XA5A 1MWNA 5I2OA 3PN7C 4AOMA 1XFXO 1KWOC 3TZ1A 1JF2A 1HQVA 1IJ6A 1KK8C 1S6JA 1SRAA 1EL4A 1U5IB 2L4IA 3DVKA 3SJSA 3AAJA 1NCXA 3TUYC 1H8BA 1AP4A 2M1KB 2O5GA 1SW8A 1XK4A 1CLBA 1SPYA 3IQQA 2KI6D 3I5IC 1LXFC 1YTZC 1CFFA 1SYMA 1WDCC 4OVNF 1EXRA 2LVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCE A;  2F3Z A;  2M97 A;  2MBX A;  4CID A;  1SR6 B;  1G4Y R;  2G2B A;  1DT7 B;  4YI9 A;  3IF7 A;  2LC5 A;  2JU0 A;  1S5G Y;  4ICB A;  1YX7 A;  4YRU A;  1SCM B;  3LL8 B;  4FQO A;  3VRP A;  1KK7 Z;  2LVK A;  4YGD B;  4OR9 B;  2LHL A;  4M2Q A;  2K0J A;  1CLL A;  1LVC D;  2LLT A;  3O2P A;  4PHK A;  2JTZ A;  2KI4 B;  1K90 D;  3DVM A;  5DKQ A;  3DF0 A;  1BU3 A;  2EC6 B;  3DVJ A;  1RWY A;  4OKH A;  1XFV O;  4PDZ A;  5CSF A;  1BOD A;  2KFF A;  1G8I A;  3PFV A;  1K96 A;  1YRU B;  1DJY A;  4FTG A;  4PE0 A;  1JSA A;  1NPQ A;  5G08 A;  2Q4U A;  2BCB A;  3PAT A;  2M0R A;  3KPX A;  1B4C A;  2FJU B;  1WRL A;  3BYA A;  1K94 A;  1C07 A;  2HPS A;  3FIA A;  1S5G Z;  2MLF C;  4D1E A;  4P5O E;  2L98 A;  2A4J A;  4ETO A;  1UHN A;  3DF0 B;  2K7B A;  2F3Y A;  2KDH A;  3VGO A;  3C1V A;  4I5N B;  1REC A;  3CGA A;  3TDU A;  2PMY A;  2OTG C;  1M39 A;  1AJ5 A;  1C7W A;  1CB1 A;  2FOT A;  2BL0 C;  2KAV A;  4QJ3 B;  3JVT B;  1Y1U A;  1B7T Y;  2LMV A;  1KCY A;  4OCI A;  4A4B A;  1AVS A;  3SG3 A;  1TOP A;  1PRW A;  5AEQ A;  4R1E A;  1J7Q A;  3BUN B;  4I5J A;  4YGC B;  2KBM A;  5JOL A;  2OS8 C;  3LLE A;  2LE9 B;  1M46 A;  3SG7 A;  1WRZ A;  2JT0 A;  4MZJ A;  2QAC A;  3OX5 A;  1CFP A;  1AHR A;  2PAL A;  1QIV A;  2KSP A;  1DGV A;  2LAP A;  4ZCV A;  2M1U A;  4GNK B;  2LAN A;  4UPG A;  3A4U B;  2KBI A;  1J1D A;  4BY5 A;  2CT9 A;  3NSL A;  3GK1 A;  3PAL A;  1CM1 A;  1XVJ A;  2JNX A;  1AJ4 A;  1QTX A;  3BOW A;  1FI5 A;  2M8U A;  2M29 A;  2M7N A;  4GPL B;  1NSH A;  1M45 A;  2ZND A;  1ZFS A;  4HRG A;  1FF1 A;  1TRF A;  1NX2 A;  1A03 A;  1U5I A;  3I5G B;  1OSA A;  3O4Y A;  1J7R A;  1DJX A;  4GBA A;  1SY9 A;  1UHK A;  1EJ3 A;  2MAZ A;  1B7T Z;  1SR6 C;  2CBL A;  4DS7 A;  1DJZ A;  3FS7 A;  4ORA B;  1Y0V H;  1CNP A;  2GV5 A;  2KI6 C;  1MQ1 A;  1N65 A;  3OX6 A;  1YR5 A;  2KAY A;  1SCM C;  5K89 A;  1A4P A;  1XFW O;  1DVI A;  2PRU A;  2GGZ A;  1SL9 A;  4NDD A;  5JJG A;  2Y1N A;  3PM8 A;  2QPT A;  2H2K A;  3RM1 A;  1GGZ A;  1XFY O;  2K2F A;  3KEV A;  1BOC A;  1F70 A;  2EC6 C;  1IJ5 A;  3BOW B;  2Y4Q A;  1XK4 C;  2PVB A;  3GK4 X;  4MZK A;  3AAK A;  4JQ0 D;  2LNK A;  3O78 A;  4YGE B;  4CFQ A;  3EVU A;  1K95 A;  5F6T A;  4CLN A;  1L2O B;  4MN0 A;  1B1G A;  4F0Z B;  1QLK A;  1QXP A;  2CCM A;  3BQ3 A;  4XYN A;  1Y1X A;  2NXQ A;  2JT8 A;  1CDN A;  3VRR A;  3DVE A;  1FI6 A;  2BKH B;  3BUO B;  4ORC B;  2WCB A;  5I2L A;  2KGR A;  4PHJ A;  3O6B A;  1UUS A;  1CTR A;  1NWD A;  1JC2 A;  2ZRT A;  2P6B B;  2LV7 A;  2JOJ A;  1TCO B;  2M49 B;  4PE4 A;  1UHJ A;  4YBH B;  1YVH A;  3PSR A;  2AMI A;  5IBW A;  2M3W A;  1W7J B;  5BPJ A;  2LMU A;  4A4C A;  4N1F A;  1N2D A;  1F55 A;  1BLQ A;  1BG1 A;  3VRN A;  1SL8 A;  1K2H A;  1HT9 A;  3I5F B;  2F8P A;  4MEW A;  3LK1 A;  1IKU A;  1ZAC A;  5D7F A;  5TNC A;  1F8H A;  3CR4 X;  1PUL A;  1AK8 A;  1IH0 A;  4DRW A;  2K7C A;  2L51 A;  1NCZ A;  1H4B A;  1FPW A;  1F54 A;  3PLF B;  2H61 A;  4MSP A;  2IS9 A;  1QS7 A;  1KSM A;  3ZNI A;  1RK9 A;  1SMG A;  2BBM A;  4MRY A;  1L7Z A;  2MRD A;  2MJW B;  4N1G A;  4ORB B;  3EVR A;  2JXC A;  2EHB A;  1OMR A;  2K7D A;  4I5L B;  2JT3 A;  1C7V A;  2R2I A;  4YGB B;  4DIR A;  5KU1 A;  3DD4 A;  2CXJ A;  3D0Y A;  3OB2 B;  3K21 A;  5I2Q A;  5CSI A;  1UHH A;  2JWW A;  3I5G C;  3EKJ A;  4I5K A;  4MZL A;  1OZS A;  2MHH A;  3BXK A;  1KFX S;  3CR5 X;  1KFX L;  1KQM B;  1PSB A;  1QJT A;  2F2P A;  4HRH A;  1WRK A;  1BJF A;  4GAO A;  4BY4 A;  4CPV A;  2ZN8 A;  1SKT A;  3CS1 A;  2GGM A;  2VRG A;  3SG4 A;  2SCP A;  2ZN9 A;  2NCO A;  2HQW A;  4MVF A;  3FWC A;  1TCF A;  1SNL A;  2LUC A;  4MRX A;  5KTY A;  1NX0 A;  3CWG A;  3VRO A;  1NUB A;  2NZ0 A;  1B47 A;  1CDL A;  2LVI A;  2MLE C;  5D69 A;  2JPT A;  1QX5 B;  3D0Y B;  3EK7 A;  1R2U A;  2LLU A;  2LVV A;  1MXL C;  5ER5 A;  2RGI A;  4GFT A;  1L2O C;  2LP2 A;  3NSK A;  3OP0 A;  1A75 B;  1JFJ A;  2TN4 A;  2BBN A;  5DKR A;  1ALW A;  2LLS A;  1QX2 A;  4M2O A;  5FYX A;  4M2P A;  1S6C A;  1SBJ A;  2KFH A;  2LP3 A;  1JF0 A;  3OB1 B;  2ZKM X;  1WY9 A;  2K61 A;  4NDC A;  3LK0 A;  2F33 A;  1G33 A;  2NCP A;  4L9M A;  1JFK A;  3TDZ A;  1F4O A;  2JZI A;  1M63 B;  1RRO A;  4HSZ A;  4N5X A;  4AQJ A;  1QLS A;  2L0P A;  3GK2 A;  2AAO A;  1JWD A;  2WND A;  3BUX B;  1QAS A;  1UWO A;  4PE1 A;  2LUX A;  2JTT A;  5CSN A;  2K7O A;  1IQ5 A;  1ALV A;  4WQ2 A;  1B8L A;  2JRF A;  1S26 D;  2KI4 C;  4USL A;  1IG5 A;  1JUO A;  2G9B A;  1A29 A;  1MR8 A;  3SG5 A;  1EH2 A;  3JTD B;  1KFU S;  2BE6 A;  3VRQ A;  1E8A A;  1KFU L;  4XJK A;  3NXA A;  3I5H B;  1QX7 A;  1J55 A;  1SCV A;  1MXE A;  3I5F C;  2WOS A;  3HCM A;  1PK0 D;  4IL1 A;  1TN4 A;  3EKH A;  2M7L A;  3RLZ A;  2LCP A;  1DGU A;  1TNP A;  1IQ3 A;  1IRJ A;  4GGF A;  1OOJ A;  2BEC A;  4MLW A;  5AER A;  5B8I B;  1YUS A;  3EK8 A;  5KSZ A;  1J1E A;  1BMO A;  1KK7 Y;  1IWQ A;  3H4S E;  4Q04 A;  4U8D A;  3WNX B;  3CR2 A;  3EK4 A;  1Q80 A;  1J7O A;  4P2Y B;  4C0J A;  1NP8 A;  4PE7 A;  1DMO A;  1KSO A;  3CLN A;  1YUT A;  2KNE A;  3CZT X;  1OZO A;  1QAT A;  2WOR A;  5CPV A;  4DUQ A;  3SIA A;  4ZCU A;  1S36 A;  2MA2 A;  5HKY A;  2E30 A;  4XJK B;  1MUX A;  1K9P A;  4OV2 A;  3NSI A;  1OMV A;  2CNP A;  3ZWH A;  1LIN A;  3GOF A;  4YI8 A;  1CFD A;  5GQQ C;  3TS5 B;  1UHI A;  1DF0 A;  1KQM C;  3CTN A;  3JVT C;  1W7I B;  2OPO A;  4PHM A;  5AFP A;  1JBA A;  2WC8 A;  2KYC A;  2KQY A;  1J7P A;  2JC2 A;  5ER4 X;  2COL B;  1CFC A;  1OE9 B;  1QVI Y;  1TNX A;  1GJY A;  2H61 C;  1XFZ O;  5HYD A;  2L5X B;  2Q91 A;  3KF9 A;  2KHN A;  1YRT B;  2KGB C;  1B8R A;  2JQ6 A;  4PAL A;  5I8N A;  1CDM A;  1D1O A;  1Y1A A;  1SL7 A;  2AUC A;  1CDP A;  1M31 A;  1BR4 B;  2KAX A;  4WRI A;  2I2R E;  3QRX A;  2CTN A;  5PAL A;  3BUM B;  1UUR A;  3PN7 B;  4WQ3 A;  2Y5I A;  1OQP A;  1XO5 A;  2ZNE A;  3WHT B;  1KWO B;  2WCE A;  2EGD A;  1VRK A;  1XYD A;  2D8N A;  2L4H A;  1DF0 B;  1F71 A;  1KK8 B;  2K2A A;  3AKA A;  1BR1 B;  4YGA A;  4CFR A;  1S3P A;  1CKK A;  1V1G A;  4PCW A;  1DJG A;  4QJ4 B;  2JUL A;  3TUY B;  2M9G A;  4GUK A;  1K9U A;  4JPZ B;  1QV1 A;  2KQ6 A;  4C0K A;  1A75 A;  1DJW A;  1GQM A;  2F2O A;  1K93 D;  1V1F A;  3ICB A;  3SG2 A;  3I5I B;  2HQ8 A;  3WHU B;  1DJH A;  1NCY A;  1WDC B;  1TNW A;  1MF8 B;  2I94 A;  2PSR A;  2SAS A;  3D10 A;  3HX4 A;  2BKI B;  1QVI Z;  2E6W A;  2V53 A;  1NIW A;  1IGV A;  1NX1 A;  1WLM A;  3AKB A;  1ZOT B;  3E3R A;  1NYA A;  1YVL A;  4NDB A;  2ISD A;  1K8U A;  2L2E A;  2BCX A;  4TNC A;  1A2X A;  1LKJ A;  1RTP 1;  5DKN A;  1CM4 A;  1PVA A;  1QV0 A;  1F4Q A;  3JTD C;  5AXI A;  1QIW A;  3I5H C;  2JNF A;  1RFJ A;  4JWQ A;  1PSR A;  1MHO A;  1EG4 A;  2NLN A;  1UP5 A;  3IQO A;  5AAN A;  1DJI A;  1YX8 A;  5HLO A;  5J3X A;  2ZRS A;  4HRE E;  2B1U A;  1TNQ A;  1EG3 A;  1CMF A;  2Y1M A;  1LA3 A;  1RJV A;  3KO0 A;  1Y6W A;  2HF5 A;  2ZFD A;  1N0Y A;  1B9A A;  2BE4 A;  1BF5 A;  5CSJ A;  2O60 A;  4DCK A;  4GGN A;  2L50 A;  3OHM B;  1CMG A;  3MSE B;  3SG6 A;  4NQG A;  1SK6 D;  5HKW A;  1AUI B;  1B8C A;  2BCA A;  1X02 A;  2JXL A;  1YUU A;  3F45 A;  1YUR A;  2LMT A;  4E68 A;  1TTX A;  2K8M B;  1FW4 A;  1TIZ A;  2LHI A;  3EVV A;  3TS5 C;  2HET A;  2FCD A;  5HKZ A;  2I7A A;  2KFG A;  1WLZ A;  4PHN A;  2KOT A;  2OTG B;  4GGF C;  1LA0 A;  4C0L A;  1FBV A;  3TDI A;  1CLM A;  1ODB A;  2BL0 B;  2I18 A;  3M0W A;  3WXA A;  2WCF A;  1R6P A;  3KHE A;  3A8R A;  1K9K A;  2KYF A;  3NSO A;  1GGW A;  3SIB A;  1PVB A;  1NX3 A;  1ZUZ A;  3FWB A;  4QJ5 B;  4MBE A;  1S6I A;  5HLV A;  2PAS A;  1PAL A;  3BUW B;  3LCP C;  1S1E A;  1KQV A;  1DTL A;  2DOQ A;  2OS8 B;  1BT6 A;  1ZMZ A;  1OMD A;  1XFU O;  4AQI A;  2LM5 A;  1XA5 A;  1MWN A;  5I2O A;  3PN7 C;  4AOM A;  1XFX O;  1KWO C;  3TZ1 A;  1JF2 A;  1HQV A;  1IJ6 A;  1KK8 C;  1S6J A;  1SRA A;  1EL4 A;  1U5I B;  2L4I A;  3DVK A;  3SJS A;  3AAJ A;  1NCX A;  3TUY C;  1H8B A;  1AP4 A;  2M1K B;  2O5G A;  1SW8 A;  1XK4 A;  1CLB A;  1SPY A;  3IQQ A;  2KI6 D;  3I5I C;  1LXF C;  1YTZ C;  1CFF A;  1SYM A;  1WDC C;  4OVN F;  1EXR A;  2LVJ A; 
#chains in the Genus database with same CATH topology
 2FCE A;  3RZS A;  2F3Z A;  2M97 A;  1XFR A;  2MBX A;  4CID A;  3S0A A;  1SR6 B;  1G4Y R;  2G2B A;  1DT7 B;  4YI9 A;  1OOG A;  3IF7 A;  2LC5 A;  2JU0 A;  1S5G Y;  4ICB A;  1YX7 A;  3B86 A;  4YRU A;  3FE6 A;  1SCM B;  3LL8 B;  4FQO A;  3VRP A;  3SS5 A;  1KK7 Z;  2LVK A;  3BFA A;  4OR9 B;  2WCJ A;  2LHL A;  4M2Q A;  4YGD B;  2K0J A;  1CLL A;  1LVC D;  2LLT A;  3O2P A;  3SS3 A;  4PHK A;  2JTZ A;  2KI4 B;  1K90 D;  3DVM A;  5DKQ A;  3DF0 A;  1BU3 A;  2EC6 B;  3DVJ A;  3DY9 A;  1RWY A;  3NHI A;  4OKH A;  1XFV O;  4PDZ A;  5CSF A;  1BOD A;  2KFF A;  1G8I A;  3PFV A;  1K96 A;  1YRU B;  1DJY A;  4FTG A;  4PE0 A;  1JSA A;  3UO9 A;  1NPQ A;  5G08 A;  2Q4U A;  2BCB A;  3PAT A;  2M0R A;  3KPX A;  3OBV A;  2FJU B;  2JPO A;  1WRL A;  1B4C A;  3BYA A;  1K94 A;  1C07 A;  2HPS A;  3FIA A;  1S5G Z;  2MLF C;  4D1E A;  4P5O E;  2L98 A;  2A4J A;  4ETO A;  4JKT A;  2KLE A;  3FE9 A;  1UHN A;  3DF0 B;  2K7B A;  2F3Y A;  2KDH A;  3VGO A;  3D78 A;  3C1V A;  4I5N B;  1REC A;  3CGA A;  3S0E A;  3TDU A;  2PMY A;  2OTG C;  1M39 A;  3DYE A;  1AJ5 A;  1C7W A;  1CB1 A;  2FOT A;  2BL0 C;  2KAV A;  4QJ3 B;  3JVT B;  1P28 A;  2WCM A;  1Y1U A;  3D73 A;  1B7T Y;  2LMV A;  4FQT A;  1KCY A;  4OCI A;  4A4B A;  1AVS A;  3SG3 A;  1TOP A;  1PRW A;  2QEO A;  5AEQ A;  4R1E A;  1J7Q A;  3BUN B;  4I5J A;  4YGC B;  2KBM A;  5JOL A;  2OS8 C;  3LLE A;  2LE9 B;  1M46 A;  3SG7 A;  1WRZ A;  2JT0 A;  4MZJ A;  2QAC A;  2K60 A;  3OX5 A;  1CFP A;  1AHR A;  2PAL A;  1QIV A;  2KSP A;  1DGV A;  2LAP A;  4ZCV A;  4JD9 A;  2M1U A;  4GNK B;  2LAN A;  4UPG A;  3A4U B;  2KBI A;  1J1D A;  4BY5 A;  2CT9 A;  3NSL A;  3GK1 A;  3PAL A;  1CM1 A;  1XVJ A;  2JNX A;  1AJ4 A;  3L47 A;  1QTX A;  3BOW A;  1FI5 A;  2M8U A;  2M29 A;  1SSE B;  2M7N A;  2QEB A;  4GPL B;  1NSH A;  1M45 A;  2ZND A;  1ZFS A;  4HRG A;  1FF1 A;  1OOF A;  1NX2 A;  1TRF A;  1A03 A;  1U5I A;  3I5G B;  1OSA A;  3O4Y A;  1J7R A;  1DJX A;  4GBA A;  1SY9 A;  1UHK A;  1EJ3 A;  2MAZ A;  1B7T Z;  1SR6 C;  3B7A A;  2CBL A;  4F7F A;  4DS7 A;  1DJZ A;  3FS7 A;  4ORA B;  1Y0V H;  1CNP A;  2GV5 A;  2KI6 C;  1MQ1 A;  1N65 A;  3OX6 A;  1YR5 A;  2KAY A;  1SCM C;  5K89 A;  1A4P A;  1XFW O;  1DVI A;  3OGN A;  2PRU A;  2GGZ A;  1SL9 A;  4NDD A;  5JJG A;  2Y1N A;  2BAP A;  2QPT A;  2H2K A;  3PM8 A;  3RM1 A;  1GGZ A;  1XFY O;  2K2F A;  3KEV A;  1BOC A;  1F70 A;  2EC6 C;  1IJ5 A;  3BOW B;  2Y4Q A;  1XK4 C;  2PVB A;  5D3O A;  3GK4 X;  4MZK A;  3AAK A;  4JQ0 D;  2LNK A;  3O78 A;  4YGE B;  4CFQ A;  3EVU A;  2L5Y A;  1K95 A;  5F6T A;  4CLN A;  1L2O B;  4MN0 A;  1B1G A;  4F0Z B;  1QLK A;  1QXP A;  2CCM A;  3BQ3 A;  4XYN A;  1Y1X A;  2NXQ A;  2JT8 A;  1CDN A;  3VRR A;  3DVE A;  1FI6 A;  2BKH B;  3BUO B;  3R72 A;  4ORC B;  2WCB A;  2QEV A;  5I2L A;  2KGR A;  4PHJ A;  3O6B A;  1UUS A;  3PJI A;  1CTR A;  1NWD A;  3QME A;  1JC2 A;  2ZRT A;  2P6B B;  2LV7 A;  2WCL A;  2JOJ A;  1TCO B;  2M49 B;  4PE4 A;  1DEK A;  1LS8 A;  1UHJ A;  4YBH B;  1DC1 A;  1YVH A;  3PSR A;  2AMI A;  5IBW A;  2M3W A;  1W7J B;  3D74 A;  5BPJ A;  2LMU A;  4A4C A;  4N1F A;  1N2D A;  1F55 A;  1BLQ A;  1BG1 A;  3VRN A;  1SL8 A;  1K2H A;  1HT9 A;  3I5F B;  2F8P A;  4MEW A;  3DXL A;  3LK1 A;  1IKU A;  1ZAC A;  5D7F A;  5TNC A;  1F8H A;  3CR4 X;  1PUL A;  1AK8 A;  1IH0 A;  4DRW A;  2K7C A;  2L51 A;  1NCZ A;  2WCH A;  1FPW A;  1H4B A;  1F54 A;  3PLF B;  2H61 A;  3R1O A;  4MSP A;  2WCK A;  2IS9 A;  1QS7 A;  1KSM A;  3ZNI A;  1RK9 A;  1SMG A;  2BBM A;  3D76 A;  1L7Z A;  2MRD A;  2MJW B;  3CDN A;  4MRY A;  3EVR A;  2JXC A;  4ORB B;  2EHB A;  1OMR A;  2K7D A;  4I5L B;  2JT3 A;  1C7V A;  2R2I A;  4YGB B;  4DIR A;  5KU1 A;  3DD4 A;  2CXJ A;  3D0Y A;  3OB2 B;  3K21 A;  5I2Q A;  5CSI A;  1UHH A;  2JWW A;  2QDI A;  3I5G C;  3EKJ A;  4I5K A;  4MZL A;  3UNW A;  1OOI X;  1OZS A;  2MHH A;  3BXK A;  1KFX S;  3CR5 X;  1KFX L;  1KQM B;  1PSB A;  1QJT A;  2F2P A;  4HRH A;  1WRK A;  1BJF A;  4GAO A;  4BY4 A;  4CPV A;  2ZN8 A;  1SKT A;  1OOH A;  3CS1 A;  1QWV A;  2GGM A;  2VRG A;  3SG4 A;  2SCP A;  2ZN9 A;  2NCO A;  2HQW A;  4MVF A;  3FWC A;  1TCF A;  1SNL A;  2LUC A;  3FE8 A;  5I94 A;  2BNX A;  4MRX A;  5KTY A;  1NX0 A;  3CWG A;  3VRO A;  1NUB A;  2NZ0 A;  1B47 A;  1CDL A;  2LVI A;  2MLE C;  5D69 A;  2JPT A;  1QX5 B;  3D0Y B;  5FI6 A;  3EK7 A;  1R2U A;  3B6X A;  2KLD A;  2LLU A;  2LVV A;  4INX A;  1MXL C;  5ER5 A;  2RGI A;  4GFT A;  1L2O C;  2LP2 A;  1TWO A;  3NSK A;  1A75 B;  3CZ0 A;  3OP0 A;  2TN4 A;  1JFJ A;  5DIC A;  2BBN A;  5DKR A;  1ALW A;  2LLS A;  1QX2 A;  4M2O A;  5FYX A;  4M2P A;  1S6C A;  1SBJ A;  2KFH A;  2LP3 A;  1JF0 A;  3OB1 B;  2ZKM X;  1WY9 A;  2ERB A;  2K61 A;  3L4L A;  4NDC A;  3LK0 A;  2F33 A;  1G33 A;  2NCP A;  4L9M A;  1JFK A;  3TDZ A;  1F4O A;  2JZI A;  3IVT A;  1M63 B;  1RRO A;  4HSZ A;  4N5X A;  4AQJ A;  1QLS A;  2L0P A;  3GK2 A;  4INW A;  2AAO A;  1JWD A;  2WND A;  3BUX B;  1QAS A;  3K1E A;  1UWO A;  4PE1 A;  2LUX A;  2JTT A;  5CSN A;  1W9Z A;  2K7O A;  1IQ5 A;  1ALV A;  3CYZ A;  4WQ2 A;  1B8L A;  2JRF A;  1S26 D;  2KI4 C;  4USL A;  1IG5 A;  1JUO A;  2G9B A;  5FI7 A;  1A29 A;  1MR8 A;  3SG5 A;  1EH2 A;  1C3Y A;  3JTD B;  1KFU S;  2BE6 A;  3VRQ A;  1E8A A;  1KFU L;  4XJK A;  3NXA A;  3I5H B;  1QX7 A;  1J55 A;  1TUJ A;  1SCV A;  1MXE A;  3I5F C;  2WOS A;  3HCM A;  2PYQ A;  1PK0 D;  4IL1 A;  1TN4 A;  1DEL A;  3EKH A;  2M7L A;  2P70 A;  3RLZ A;  2LCP A;  1DGU A;  1TNP A;  1OW4 A;  1IRJ A;  4GGF A;  1OOJ A;  2BEC A;  4MLW A;  5AER A;  1IQ3 A;  5B8I B;  1YUS A;  3EK8 A;  5KSZ A;  1J1E A;  4IJ7 A;  1BMO A;  1KK7 Y;  1IWQ A;  3H4S E;  4Q04 A;  4U8D A;  3WNX B;  1GM0 A;  3CR2 A;  3EK4 A;  1Q80 A;  1J7O A;  4P2Y B;  4C0J A;  1NP8 A;  4PE7 A;  1DMO A;  1KSO A;  3CLN A;  1YUT A;  2KNE A;  3CZT X;  1OZO A;  1QAT A;  2WOR A;  1TUZ A;  5CPV A;  3S0G A;  3SIA A;  4DUQ A;  4ZCU A;  1S36 A;  2MA2 A;  5HKY A;  2E30 A;  2QEH A;  4XJK B;  1MUX A;  3S0D A;  1K9P A;  4OV2 A;  3NSI A;  1OMV A;  2CNP A;  3ZWH A;  1LIN A;  3GOF A;  4N1G A;  1CFD A;  4YI8 A;  5GQQ C;  1Z2C B;  3TS5 B;  1UHI A;  1DF0 A;  1KQM C;  3CTN A;  3JVT C;  1W7I B;  2OPO A;  2WC6 A;  3PM2 A;  4PHM A;  5AFP A;  1JBA A;  2WC8 A;  2KYC A;  2KQY A;  3DZT A;  1J7P A;  2JC2 A;  5ER4 X;  2COL B;  3BJH A;  1OE9 B;  1QVI Y;  1TNX A;  1GJY A;  2H61 C;  1CFC A;  1XFZ O;  1C3Z A;  5HYD A;  2L5X B;  2Q91 A;  3KF9 A;  2KHN A;  1YRT B;  2KGB C;  3B88 A;  1B8R A;  2JQ6 A;  4PAL A;  5I8N A;  1CDM A;  1D1O A;  1Y1A A;  1SL7 A;  2AUC A;  3BFH A;  1CDP A;  1M31 A;  1BR4 B;  1DQE A;  2KAX A;  4WRI A;  2I2R E;  1T14 A;  3QRX A;  2CTN A;  5PAL A;  3BUM B;  1UUR A;  3PN7 B;  4WQ3 A;  2Y5I A;  1OQP A;  1XO5 A;  2ZNE A;  3WHT B;  1KWO B;  2WCE A;  2EGD A;  1VRK A;  1XYD A;  2D8N A;  2L4H A;  1DF0 B;  1F71 A;  1KK8 B;  2K2A A;  3AKA A;  1BR1 B;  4YGA A;  4CFR A;  1S3P A;  3BFB A;  1V1G A;  4PCW A;  1CKK A;  1DJG A;  4QJ4 B;  2JUL A;  3TUY B;  2M9G A;  4GUK A;  1K9U A;  4JPZ B;  1QV1 A;  2KQ6 A;  4C0K A;  1A75 A;  1DJW A;  1GQM A;  2F2O A;  1K93 D;  1V1F A;  3ICB A;  3SG2 A;  3I5I B;  3VB1 A;  2HQ8 A;  3NHT A;  3WHU B;  1DJH A;  1NCY A;  5HL1 A;  4PT1 A;  1WDC B;  1TNW A;  1MF8 B;  2I94 A;  2PSR A;  2SAS A;  3D10 A;  3HX4 A;  4OZD A;  2BKI B;  1QVI Z;  2PQL A;  2E6W A;  2V53 A;  1NIW A;  1IGV A;  1NX1 A;  1WLM A;  3AKB A;  3CAB A;  1ZOT B;  3E3R A;  1NYA A;  1YVL A;  4NDB A;  2ISD A;  3D77 A;  1K8U A;  2L2E A;  2BCX A;  4TNC A;  1A2X A;  1LKJ A;  1RTP 1;  3N7H A;  1CM4 A;  1PVA A;  1QV0 A;  5DKN A;  1F4Q A;  3JTD C;  3NGV A;  5AXI A;  1QIW A;  3I5H C;  2JNF A;  1RFJ A;  4JWQ A;  1PSR A;  1MHO A;  1EG4 A;  2NLN A;  1UP5 A;  3IQO A;  5AAN A;  1DJI A;  1YX8 A;  3O4X A;  5HLO A;  5J3X A;  2ZRS A;  4HRE E;  2B1U A;  1TNQ A;  1EG3 A;  2YGU A;  1CMF A;  2Y1M A;  1LA3 A;  1RJV A;  2L2C A;  5FI2 A;  3KO0 A;  3S0B A;  1Y6W A;  2HF5 A;  2ZFD A;  1N0Y A;  1B9A A;  2BE4 A;  1BF5 A;  3EG5 B;  5CSJ A;  2O60 A;  2P71 A;  4DCK A;  4GGN A;  2L50 A;  3OHM B;  1CMG A;  3MSE B;  3SG6 A;  4NQG A;  1SK6 D;  5HKW A;  1AUI B;  1B8C A;  2BCA A;  1X02 A;  2JXL A;  1YUU A;  3F45 A;  1YUR A;  2LMT A;  4E68 A;  1TTX A;  3D75 A;  2K8M B;  1FW4 A;  1TIZ A;  2LHI A;  3EVV A;  3TS5 C;  2HET A;  2FCD A;  5HKZ A;  2I7A A;  2KFG A;  4KYN A;  1WLZ A;  4PHN A;  2KOT A;  2OTG B;  3SS4 A;  4GGF C;  1LA0 A;  4C0L A;  1IIO A;  1FBV A;  3TDI A;  3S0F A;  1CLM A;  3R1V A;  1ODB A;  2BL0 B;  2I18 A;  3R1P A;  3M0W A;  3WXA A;  2H8V A;  2WCF A;  1R6P A;  3KHE A;  3A8R A;  1K9K A;  3V2L A;  2GTE A;  2KYF A;  3NSO A;  3SIB A;  1GGW A;  1PVB A;  2KPH A;  1NX3 A;  1ZUZ A;  3CZ1 A;  3FWB A;  4QJ5 B;  4MBE A;  1S6I A;  5HLV A;  2PAS A;  1PAL A;  3BUW B;  3LCP C;  1S1E A;  1KQV A;  1DTL A;  1ORG A;  2DOQ A;  1BT6 A;  1ZMZ A;  2OS8 B;  1OMD A;  1XFU O;  2FJY A;  4AQI A;  2LM5 A;  1XA5 A;  1MWN A;  3CZ2 A;  3PN7 C;  5I2O A;  4AOM A;  1Z4H A;  1XFX O;  1KWO C;  3Q8I A;  1JF2 A;  3TZ1 A;  1HQV A;  1IJ6 A;  1KK8 C;  1S6J A;  1SRA A;  1EL4 A;  1U5I B;  2L4I A;  3DVK A;  5EL2 A;  3SJS A;  3AAJ A;  2WC5 A;  1NCX A;  3TUY C;  3L4A A;  1AP4 A;  2M1K B;  2O5G A;  1SW8 A;  1H8B A;  1XK4 A;  1CLB A;  1SPY A;  3IQQ A;  2KI6 D;  3I5I C;  1LXF C;  1YTZ C;  1CFF A;  1SYM A;  1WDC C;  4OVN F;  1EXR A;  2LVJ A;  3B87 A; 
#chains in the Genus database with same CATH homology
 2FCE A;  2F3Z A;  2M97 A;  2MBX A;  4CID A;  1SR6 B;  1G4Y R;  2G2B A;  1DT7 B;  4YI9 A;  3IF7 A;  2LC5 A;  2JU0 A;  1S5G Y;  4ICB A;  1YX7 A;  4YRU A;  1SCM B;  3LL8 B;  4FQO A;  3VRP A;  1KK7 Z;  2LVK A;  4YGD B;  4OR9 B;  2LHL A;  4M2Q A;  2K0J A;  1CLL A;  1LVC D;  2LLT A;  3O2P A;  4PHK A;  2JTZ A;  2KI4 B;  1K90 D;  3DVM A;  5DKQ A;  3DF0 A;  1BU3 A;  2EC6 B;  3DVJ A;  1RWY A;  4OKH A;  1XFV O;  4PDZ A;  5CSF A;  1BOD A;  2KFF A;  1G8I A;  3PFV A;  1K96 A;  1YRU B;  1DJY A;  4FTG A;  4PE0 A;  1JSA A;  1NPQ A;  5G08 A;  2Q4U A;  2BCB A;  3PAT A;  2M0R A;  3KPX A;  1B4C A;  2FJU B;  1WRL A;  3BYA A;  1K94 A;  1C07 A;  2HPS A;  3FIA A;  1S5G Z;  2MLF C;  4D1E A;  4P5O E;  2L98 A;  2A4J A;  4ETO A;  1UHN A;  3DF0 B;  2K7B A;  2F3Y A;  2KDH A;  3VGO A;  3C1V A;  4I5N B;  1REC A;  3CGA A;  3TDU A;  2PMY A;  2OTG C;  1M39 A;  1AJ5 A;  1C7W A;  1CB1 A;  2FOT A;  2BL0 C;  2KAV A;  4QJ3 B;  3JVT B;  1Y1U A;  1B7T Y;  2LMV A;  1KCY A;  4OCI A;  4A4B A;  1AVS A;  3SG3 A;  1TOP A;  1PRW A;  5AEQ A;  4R1E A;  1J7Q A;  3BUN B;  4I5J A;  4YGC B;  2KBM A;  5JOL A;  2OS8 C;  3LLE A;  2LE9 B;  1M46 A;  3SG7 A;  1WRZ A;  2JT0 A;  4MZJ A;  2QAC A;  3OX5 A;  1CFP A;  1AHR A;  2PAL A;  1QIV A;  2KSP A;  1DGV A;  2LAP A;  4ZCV A;  2M1U A;  4GNK B;  2LAN A;  4UPG A;  3A4U B;  2KBI A;  1J1D A;  4BY5 A;  2CT9 A;  3NSL A;  3GK1 A;  3PAL A;  1CM1 A;  1XVJ A;  2JNX A;  1AJ4 A;  1QTX A;  3BOW A;  1FI5 A;  2M8U A;  2M29 A;  2M7N A;  4GPL B;  1NSH A;  1M45 A;  2ZND A;  1ZFS A;  4HRG A;  1FF1 A;  1TRF A;  1NX2 A;  1A03 A;  1U5I A;  3I5G B;  1OSA A;  3O4Y A;  1J7R A;  1DJX A;  4GBA A;  1SY9 A;  1UHK A;  1EJ3 A;  2MAZ A;  1B7T Z;  1SR6 C;  2CBL A;  4DS7 A;  1DJZ A;  3FS7 A;  4ORA B;  1Y0V H;  1CNP A;  2GV5 A;  2KI6 C;  1MQ1 A;  1N65 A;  3OX6 A;  1YR5 A;  2KAY A;  1SCM C;  5K89 A;  1A4P A;  1XFW O;  1DVI A;  2PRU A;  2GGZ A;  1SL9 A;  4NDD A;  5JJG A;  2Y1N A;  3PM8 A;  2QPT A;  2H2K A;  3RM1 A;  1GGZ A;  1XFY O;  2K2F A;  3KEV A;  1BOC A;  1F70 A;  2EC6 C;  1IJ5 A;  3BOW B;  2Y4Q A;  1XK4 C;  2PVB A;  3GK4 X;  4MZK A;  3AAK A;  4JQ0 D;  2LNK A;  3O78 A;  4YGE B;  4CFQ A;  3EVU A;  1K95 A;  5F6T A;  4CLN A;  1L2O B;  4MN0 A;  1B1G A;  4F0Z B;  1QLK A;  1QXP A;  2CCM A;  3BQ3 A;  4XYN A;  1Y1X A;  2NXQ A;  2JT8 A;  1CDN A;  3VRR A;  3DVE A;  1FI6 A;  2BKH B;  3BUO B;  4ORC B;  2WCB A;  5I2L A;  2KGR A;  4PHJ A;  3O6B A;  1UUS A;  1CTR A;  1NWD A;  1JC2 A;  2ZRT A;  2P6B B;  2LV7 A;  2JOJ A;  1TCO B;  2M49 B;  4PE4 A;  1UHJ A;  4YBH B;  1YVH A;  3PSR A;  2AMI A;  5IBW A;  2M3W A;  1W7J B;  5BPJ A;  2LMU A;  4A4C A;  4N1F A;  1N2D A;  1F55 A;  1BLQ A;  1BG1 A;  3VRN A;  1SL8 A;  1K2H A;  1HT9 A;  3I5F B;  2F8P A;  4MEW A;  3LK1 A;  1IKU A;  1ZAC A;  5D7F A;  5TNC A;  1F8H A;  3CR4 X;  1PUL A;  1AK8 A;  1IH0 A;  4DRW A;  2K7C A;  2L51 A;  1NCZ A;  1H4B A;  1FPW A;  1F54 A;  3PLF B;  2H61 A;  4MSP A;  2IS9 A;  1QS7 A;  1KSM A;  3ZNI A;  1RK9 A;  1SMG A;  2BBM A;  4MRY A;  1L7Z A;  2MRD A;  2MJW B;  4N1G A;  4ORB B;  3EVR A;  2JXC A;  2EHB A;  1OMR A;  2K7D A;  4I5L B;  2JT3 A;  1C7V A;  2R2I A;  4YGB B;  4DIR A;  5KU1 A;  3DD4 A;  2CXJ A;  3D0Y A;  3OB2 B;  3K21 A;  5I2Q A;  5CSI A;  1UHH A;  2JWW A;  3I5G C;  3EKJ A;  4I5K A;  4MZL A;  1OZS A;  2MHH A;  3BXK A;  1KFX S;  3CR5 X;  1KFX L;  1KQM B;  1PSB A;  1QJT A;  2F2P A;  4HRH A;  1WRK A;  1BJF A;  4GAO A;  4BY4 A;  4CPV A;  2ZN8 A;  1SKT A;  3CS1 A;  2GGM A;  2VRG A;  3SG4 A;  2SCP A;  2ZN9 A;  2NCO A;  2HQW A;  4MVF A;  3FWC A;  1TCF A;  1SNL A;  2LUC A;  4MRX A;  5KTY A;  1NX0 A;  3CWG A;  3VRO A;  1NUB A;  2NZ0 A;  1B47 A;  1CDL A;  2LVI A;  2MLE C;  5D69 A;  2JPT A;  1QX5 B;  3D0Y B;  3EK7 A;  1R2U A;  2LLU A;  2LVV A;  1MXL C;  5ER5 A;  2RGI A;  4GFT A;  1L2O C;  2LP2 A;  3NSK A;  3OP0 A;  1A75 B;  1JFJ A;  2TN4 A;  2BBN A;  5DKR A;  1ALW A;  2LLS A;  1QX2 A;  4M2O A;  5FYX A;  4M2P A;  1S6C A;  1SBJ A;  2KFH A;  2LP3 A;  1JF0 A;  3OB1 B;  2ZKM X;  1WY9 A;  2K61 A;  4NDC A;  3LK0 A;  2F33 A;  1G33 A;  2NCP A;  4L9M A;  1JFK A;  3TDZ A;  1F4O A;  2JZI A;  1M63 B;  1RRO A;  4HSZ A;  4N5X A;  4AQJ A;  1QLS A;  2L0P A;  3GK2 A;  2AAO A;  1JWD A;  2WND A;  3BUX B;  1QAS A;  1UWO A;  4PE1 A;  2LUX A;  2JTT A;  5CSN A;  2K7O A;  1IQ5 A;  1ALV A;  4WQ2 A;  1B8L A;  2JRF A;  1S26 D;  2KI4 C;  4USL A;  1IG5 A;  1JUO A;  2G9B A;  1A29 A;  1MR8 A;  3SG5 A;  1EH2 A;  3JTD B;  1KFU S;  2BE6 A;  3VRQ A;  1E8A A;  1KFU L;  4XJK A;  3NXA A;  3I5H B;  1QX7 A;  1J55 A;  1SCV A;  1MXE A;  3I5F C;  2WOS A;  3HCM A;  1PK0 D;  4IL1 A;  1TN4 A;  3EKH A;  2M7L A;  3RLZ A;  2LCP A;  1DGU A;  1TNP A;  1IQ3 A;  1IRJ A;  4GGF A;  1OOJ A;  2BEC A;  4MLW A;  5AER A;  5B8I B;  1YUS A;  3EK8 A;  5KSZ A;  1J1E A;  1BMO A;  1KK7 Y;  1IWQ A;  3H4S E;  4Q04 A;  4U8D A;  3WNX B;  3CR2 A;  3EK4 A;  1Q80 A;  1J7O A;  4P2Y B;  4C0J A;  1NP8 A;  4PE7 A;  1DMO A;  1KSO A;  3CLN A;  1YUT A;  2KNE A;  3CZT X;  1OZO A;  1QAT A;  2WOR A;  5CPV A;  4DUQ A;  3SIA A;  4ZCU A;  1S36 A;  2MA2 A;  5HKY A;  2E30 A;  4XJK B;  1MUX A;  1K9P A;  4OV2 A;  3NSI A;  1OMV A;  2CNP A;  3ZWH A;  1LIN A;  3GOF A;  4YI8 A;  1CFD A;  5GQQ C;  3TS5 B;  1UHI A;  1DF0 A;  1KQM C;  3CTN A;  3JVT C;  1W7I B;  2OPO A;  4PHM A;  5AFP A;  1JBA A;  2WC8 A;  2KYC A;  2KQY A;  1J7P A;  2JC2 A;  5ER4 X;  2COL B;  1CFC A;  1OE9 B;  1QVI Y;  1TNX A;  1GJY A;  2H61 C;  1XFZ O;  5HYD A;  2L5X B;  2Q91 A;  3KF9 A;  2KHN A;  1YRT B;  2KGB C;  1B8R A;  2JQ6 A;  4PAL A;  5I8N A;  1CDM A;  1D1O A;  1Y1A A;  1SL7 A;  2AUC A;  1CDP A;  1M31 A;  1BR4 B;  2KAX A;  4WRI A;  2I2R E;  3QRX A;  2CTN A;  5PAL A;  3BUM B;  1UUR A;  3PN7 B;  4WQ3 A;  2Y5I A;  1OQP A;  1XO5 A;  2ZNE A;  3WHT B;  1KWO B;  2WCE A;  2EGD A;  1VRK A;  1XYD A;  2D8N A;  2L4H A;  1DF0 B;  1F71 A;  1KK8 B;  2K2A A;  3AKA A;  1BR1 B;  4YGA A;  4CFR A;  1S3P A;  1CKK A;  1V1G A;  4PCW A;  1DJG A;  4QJ4 B;  2JUL A;  3TUY B;  2M9G A;  4GUK A;  1K9U A;  4JPZ B;  1QV1 A;  2KQ6 A;  4C0K A;  1A75 A;  1DJW A;  1GQM A;  2F2O A;  1K93 D;  1V1F A;  3ICB A;  3SG2 A;  3I5I B;  2HQ8 A;  3WHU B;  1DJH A;  1NCY A;  1WDC B;  1TNW A;  1MF8 B;  2I94 A;  2PSR A;  2SAS A;  3D10 A;  3HX4 A;  2BKI B;  1QVI Z;  2E6W A;  2V53 A;  1NIW A;  1IGV A;  1NX1 A;  1WLM A;  3AKB A;  1ZOT B;  3E3R A;  1NYA A;  1YVL A;  4NDB A;  2ISD A;  1K8U A;  2L2E A;  2BCX A;  4TNC A;  1A2X A;  1LKJ A;  1RTP 1;  5DKN A;  1CM4 A;  1PVA A;  1QV0 A;  1F4Q A;  3JTD C;  5AXI A;  1QIW A;  3I5H C;  2JNF A;  1RFJ A;  4JWQ A;  1PSR A;  1MHO A;  1EG4 A;  2NLN A;  1UP5 A;  3IQO A;  5AAN A;  1DJI A;  1YX8 A;  5HLO A;  5J3X A;  2ZRS A;  4HRE E;  2B1U A;  1TNQ A;  1EG3 A;  1CMF A;  2Y1M A;  1LA3 A;  1RJV A;  3KO0 A;  1Y6W A;  2HF5 A;  2ZFD A;  1N0Y A;  1B9A A;  2BE4 A;  1BF5 A;  5CSJ A;  2O60 A;  4DCK A;  4GGN A;  2L50 A;  3OHM B;  1CMG A;  3MSE B;  3SG6 A;  4NQG A;  1SK6 D;  5HKW A;  1AUI B;  1B8C A;  2BCA A;  1X02 A;  2JXL A;  1YUU A;  3F45 A;  1YUR A;  2LMT A;  4E68 A;  1TTX A;  2K8M B;  1FW4 A;  1TIZ A;  2LHI A;  3EVV A;  3TS5 C;  2HET A;  2FCD A;  5HKZ A;  2I7A A;  2KFG A;  1WLZ A;  4PHN A;  2KOT A;  2OTG B;  4GGF C;  1LA0 A;  4C0L A;  1FBV A;  3TDI A;  1CLM A;  1ODB A;  2BL0 B;  2I18 A;  3M0W A;  3WXA A;  2WCF A;  1R6P A;  3KHE A;  3A8R A;  1K9K A;  2KYF A;  3NSO A;  1GGW A;  3SIB A;  1PVB A;  1NX3 A;  1ZUZ A;  3FWB A;  4QJ5 B;  4MBE A;  1S6I A;  5HLV A;  2PAS A;  1PAL A;  3BUW B;  3LCP C;  1S1E A;  1KQV A;  1DTL A;  2DOQ A;  2OS8 B;  1BT6 A;  1ZMZ A;  1OMD A;  1XFU O;  4AQI A;  2LM5 A;  1XA5 A;  1MWN A;  5I2O A;  3PN7 C;  4AOM A;  1XFX O;  1KWO C;  3TZ1 A;  1JF2 A;  1HQV A;  1IJ6 A;  1KK8 C;  1S6J A;  1SRA A;  1EL4 A;  1U5I B;  2L4I A;  3DVK A;  3SJS A;  3AAJ A;  1NCX A;  3TUY C;  1H8B A;  1AP4 A;  2M1K B;  2O5G A;  1SW8 A;  1XK4 A;  1CLB A;  1SPY A;  3IQQ A;  2KI6 D;  3I5I C;  1LXF C;  1YTZ C;  1CFF A;  1SYM A;  1WDC C;  4OVN F;  1EXR A;  2LVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...