4C0LA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one magnesium ion and mg:gdp (mggdp-miros)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 120
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0lA03
1GM5A 1YZKA 1TUIA 2GJSA 3OEHA 1KSGA 2VBCA 2WM9B 2GF0A 4CLNA 3EIQA 3FFAA 3IQWA 1NCXA 2XOKA 1KGDA 3SNHA 1AHRA 4GAOA 3QOFA 1NX3A 2JLUA 1U8ZA 4D2IA 1HY3A 4EJSC 4AKEA 1DJYA 3EKJA 4B44A 4RZXA 3VHLB 1CLUA 1A1VA 1N0UA 1A2BA 3L0OA 1C4OA 3QXSA 3AF2A 5EXTA 3D0YA 4D81A 3FHOA 5CB8A 1OH6A 2G6BA 4KO8A 2OSBA 4EPWA 3LBHA 3LV8A 3W34A 1XTQA 2FEOA 5CPVA 1RECA 3OE7D 1YUTA 3I1FA 2W6IA 1S1EA 3SOPA 5C46F 3HU2A 1T3SA 4A15A 2W58A 3OF5A 4P32A 4PAMA 3GLFB 1COWD 4DSOA 4JLBA 1E9SA 2FZLA 1LXFC 1P9NA 3TR5A 3QKSB 4GZLA 2Y4QA 1VCMA 5H68A 3L0SA 4N1AA 4ZCIA 4DC9A 1DAGA 4IFBA 2WIAA 3TDZA 4CEHA 4NPHA 2B1UA 3CR8A 3FHTA 3DVMA 5KSZA 4UJ3A 2ORIA 2PALA 2G9NA 4B43A 1K90D 2B21A 3LBNA 5IT5A 1XX6A 1R6PA 4TZ6A 1Y63A 4IDQA 1XNJA 2YWHA 3RLZA 3QKUA 2KB0A 1Z47A 3OESA 1XO5A 5SZKB 2KDHA 1R0ZA 3I5HB 1TU3A 3HJNA 4KFRA 5IRCD 4C2UA 1EESA 1J7RA 2FCDA 1GKIA 4IOMA 2GGZA 1L7VC 3DMNA 4IRUB 2GDJA 2P2LA 2Z4SA 1WMSA 2PEZA 2ZJYA 3CR7A 1F2UA 1W5TA 3PCRB 3OEEA 1CDPA 4LC0A 5JHHB 1TRFA 5FPKA 2QTVB 1RFLA 1TF5A 3FYHA 4QHTA 2YC2C 1LS6A 3A8RA 2OM2A 1QJTA 4PXAA 1KYIA 4AY2A 4GBAA 1VPLA 2RGNA 3LX8A 1TCOB 3IILA 3CH5A 2JXCA 1CFFA 1TUEA 1E9DA 1VHLA 2IWHA 4FQOA 4QM7A 1E79D 3L0IB 1WRKA 5DN6D 5LDDC 2A5DA 3AVYA 1SL9A 4QGHA 4HB2A 1HUQA 1YX8A 5GVRA 1QIVA 3SQWA 2OLKA 1ZUHA 2M1KB 2HF8A 1EK0A 2ZJ5A 1XPOA 1QG4A 4NMMA 1S36A 1KFUL 1X02A 1PULA 1H8HA 4TT3A 1SULA 1RW4A 1FMLA 1XMJA 2J87A 5BYJA 2OO7A 1UWOA 3I73A 5C2JB 1XK4C 3M0WA 1E9EA 1S4QA 3G0HA 1XMSA 3LK0A 4D4KA 3D31A 1NIWA 1W48A 2LP2A 1JXMA 4FIDA 4JKIA 2V1XA 2YWFA 3SZRA 1SK6D 2SASA 3ZVMA 1MV5A 4FMDF 4XJKA 5EXPA 1QLKA 1GUAA 2VP4A 2A3RA 4KCGA 1KK7Z 3LFUA 3SS8A 3WRXC 3X1WA 1JJ7A 1X6VA 2ZM5A 2EC6B 3A4MA 2ANCA 3A1VA 1LA0A 5KTYA 2F1RA 3GQBA 1COWA 3PN7B 1NMYA 3DEFA 1N6IA 4LV8B 3R7WA 2RHDA 4C3ZA 1WE2A 1N6KA 2W6JA 3CIOA 4HUTA 1HH4A 4LGMA 2X77A 4QFMA 1ALVA 4RFVA 2AK2A 2AAOA 4FWIB 5LD2C 2D74A 4R2IA 4LJ4A 2VYFA 2FWRA 3NC1C 5DHFA 3ZJYA 3ZIAA 1KK0A 2ZRDA 2QT1A 4G5GA 2VTKA 1N0WA 1QHIA 4A8JC 3JZMA 1NBMD 1NN5A 5AUPB 2EFHB 3BD9A 2O8CA 1Q0UA 2DBYA 3RRMA 1Z28A 3DVLA 4E03A 2V55B 4KU4A 2GZHA 2BBTA 4HDCA 1FPWA 4RCZA 4TL9A 1HT2E 1ZFSA 4DJTA 2JJ1D 3CF0A 4LBYA 2OILA 3Q5EA 3D7MA 4HAVA 2IYSA 4NP6A 2CLSA 1XD9A 4OJKA 5KYKA 3N70A 1EWRA 4GOXA 2MMCA 3R9IA 1IN5A 2Q4UA 1D2EA 4JVNA 2ZS9A 3BE4A 4G5SA 1W0KD 3CUEF 2JULA 1ESMA 3ECCA 2L50A 1XFAA 3AKBA 3U3JA 5DIFA 1IN7A 1NX2A 1EFUA 1KSHA 4BFUA 4LBZA 1QLSA 4X8LA 3QF4A 1NMZA 1M74A 3AKYA 5EUMA 4MN0A 4NU0A 4BZQA 2FNAA 3AVPA 1K5GA 4O2RA 4TL7A 3TAHA 4NL4H 1J55A 2RGGA 4IXNA 1M7HA 5JS8A 2WVJA 2WWGA 4LPSA 3RS0A 2ZRIA 1KOFA 1X8LA 3LH5A 4OYHA 1NY6A 2A5YB 2CXJA 4WZ6A 1G18A 1R0XA 1ZM9A 2PSRA 4D1EA 4MZJA 5FL7D 1HA3A 1AA9A 4M1WA 3N5CA 5HKWA 2ZJ2A 5KNBA 1RROA 1E2IA 3EARA 4RFSB 4Q04A 4TWZA 4YRUA 2PMKA 4Q9HA 4WRIA 1OMRA 3I5GB 1AGPA 1D9ZA 1R4AA 3CONA 4OR9B 4M1TA 2PZFA 1BJFA 5CYPA 3THXA 3QKTA 4G3XA 4OBEA 1OFUX 4NYMQ 4PO1A 3GLHA 4F92B 3VX3A 5SZHB 1IKUA 1HURA 1XTKA 2A30A 1C1YA 1P73A 1QRAA 2WJHA 3L8YA 4KAXA 3ADBA 2A78A 5HE8A 5JCZA 1GQMA 2MSEB 4GP7A 1DARA 1SVMA 1Y1UA 1YR9A 5TVKA 4HB4A 1DVIA 4PZLA 3B1VA 4L15A 3PUZA 1JI0A 1W46A 3VROA 1R8QA 1ZINA 2GEUA 3E5HA 4FCTA 4C7OB 1Q1EA 2G3YA 5JS7A 1TF7A 2HT6A 4M2LA 1G4AE 2Y1MA 4I1OA 1PSBA 1C07A 2AX4A 3DL0A 1KMQA 1IBRA 4JJZA 1N6OA 3SJCA 5TDHA 1FTSA 5JI3E 3BUMB 5KO2A 4N0EA 2CNWA 2MAZA 4FW9A 4HAXA 1XCPA 2WOOA 4HAUA 4MH0R 3UKDA 2DB3A 2ZSBA 4I4LA 4MKGA 1QF9A 3G5UA 4HLUA 1BOFA 4DS7A 4AKIA 1A4PA 3NG1A 3MFYA 2JRFA 4KFTA 4CDGA 1Q57A 3QXHA 2BBSA 4BEBA 2V7QA 4ZKDA 5B8IB 4DCSA 3QY0A 3NH6A 1K95A 1Z6YA 2ASEA 3FMOB 1K8RA 2JT3A 2DFLA 2J7PA 1W0KA 3IIJA 4Q4HB 3VKHA 4DCNA 3I5FB 5JFGA 1KJZA 1PVAA 4PQRA 1KY2A 1SKYE 1E2PA 1U2RA 1F54A 2GXQA 1P9RA 2IYZA 4QKQA 4II7A 1KI7A 5KSOA 2QL6A 2O8FA 5CJ2A 4FCWA 4OHZA 2XGJA 1CS4C 1VKJA 2PCLA 3BAFA 3NTUA 4PHTA 3CZPA 2WJYA 2C78A 4JLPA 1QV0A 2BCBA 2ZI9A 4ETOA 3K53A 3O8DA 1E4YA 4Q4AB 3BRWD 4BFVA 5D3QA 1K5DA 1WCV1 1L7ZA 1SKTA 1AP4A 3LY5A 4DLTA 3WHTB 1XEWX 4WW0A 3WHUB 4LHXA 2PMDA 4M1MA 1OFIA 3PSRA 5EE9A 1E2GA 4BGDA 4I1SA 3WNCA 4OJQA 2QGNA 2FEMA 2DWOA 1ZNYA 3RS4A 1CXZA 1JEDA 421PA 4DBLC 1CMFA 3X1DA 3WHKA 1NKTA 5AEQA 1Z0AA 1G8YA 4GFDA 3GD7A 1LW7A 3KB1A 4AKHA 3K0CC 4POAA 2ZN8A 4MRRA 4ZPXA 1TNPA 3K0EA 5CJPA 3KJIA 3U3OA 5KDLA 3FPAA 4CZ2A 1OMDA 1XJCA 2F55A 2ZITA 2ERXA 1JFKA 1S9DA 4XOIA 1XA5A 3VR5A 2WJIA 2KGBC 4PFSA 2M9GA 1SNLA 5K8TA 2FOTA 4C0AC 5JZVA 3THXB 2HJVA 5AWFC 4EDHA 3VR3A 2NZJA 3VAAA 1G20E 1XK4A 3D10A 1FFHA 1CJUC 2QP4A 2JLZA 1A7JA 5EP1A 1H4BA 1T0JB 5AXIA 3MCAA 3K70B 2QE7D 2C9OA 2ODNA 4IJMA 4BLPA 4B73A 2GGMA 2OAQ1 1D9XA 2Q0HA 5ER4X 1OHHA 1TNXA 2L5XB 2B7BA 2AKYA 4Q9KA 1BMFA 4NHOA 2Q3HA 5F9FA 2ZSAA 4XVUA 1G6HA 2NG1A 1NN3A 1S1MA 4MBEA 2GJ8A 2PT5A 2Z43A 3VQTA 1KHTA 1F55A 1MUXA 4BECA 1F8HA 3GLGA 1TQ4A 2GAOA 4IVQA 4KYIB 2H61C 1KQVA 1BT6A 1U8YA 5FOVA 2W2VA 2Q6TA 5JLJA 1Z0KA 1VG8A 1FZQA 3BH0A 4R9UC 3PLFB 3TS5B 3MG9A 3RSLA 1O3YA 1XMIA 1GAJA 2C95A 3IPYA 4EQ6A 2C96A 2LANA 4A8JA 2V6JA 1NLFA 1G3IA 2O8DA 4Q4JA 2PMYA 3T1TA 3V4RA 4LBVA 4BWYA 4Y0VA 4KODA 5EZ5A 2XXAA 3RRZA 1EH2A 2OUKA 2HLDA 1IQPA 1RIFA 2FFQA 2H57A 1YUSA 4I99A 4AK9A 2JLSA 3FWYA 4ITRC 4Z1MA 2P5SA 2MLEC 5ER5A 3GK2A 2XTNA 1CM4A 1TTXA 3F45A 3O2PA 3AVQA 4Q19A 1U8AA 4G01B 2K2AA 3KQUA 3HWSA 2AKAB 1QTXA 3OX6A 3LAWA 1AKEA 4UXIA 4XTCS 4MKIA 3TZ1A 4B71A 3AVXA 4YMTA 1FNNA 3GLIE 4DB2A 1RRFA 2M1UA 1R5BA 1OQPA 2NZ8A 3W90A 4AG6A 1W36B 1QHYA 4LHZA 5FOUA 1CMGA 2O0HA 4YXWA 1E1QD 4OL0A 3DF0A 4CFRA 3K0AA 4QGFA 1OIWA 8OHMA 1S96A 4PE7A 2KI4C 1JXOA 5F98A 4OQFA 4PHKA 3AVWA 1SGWA 2GK7A 5TB5A 2IYVA 2PLFA 1PRWA 3CF6R 4I1UA 4JSTA 4WOPA 5B64A 2CHQA 3PXGA 3MLEA 2A5GA 3WYFA 4DLUA 1J70A 1P72A 3EC1A 4HLQB 1QX5B 5CM8B 2JA1A 2LNKA 2LAPA 5HR5A 1G16A 3I5YA 2QAGC 4HZUA 1DOAA 621PA 1NKSA 1TN4A 1P2UA 1CR2A 5DNYB 2GHIA 3UWOA 2A9KA 4GDFA 1UDWA 1LVGA 4M9QA 2EW1A 3CKLA 3UANA 2YNMA 6Q21A 3TSOA 1K9KA 2K0JA 1ZBDA 5HLOA 4GP6A 1MRNA 2OCPA 5E7JA 1IGVA 1NVVQ 1Q1BA 1W4AA 2AD5A 2ZANA 1SXJC 4JMPA 1B8CA 1D6JA 1R6BX 4OQMA 3K0SA 3BFXA 3QENA 1C7VA 3F5FA 4IDNA 4A0FA 1I4DD 2C03A 2ZJAA 1R8SA 2LCPA 1E2FA 3FGNA 4BEJA 2CBZA 1NG1A 4PO8A 2CMKA 3W8RA 2QU8A 5H1YA 2XX3A 1KDRA 1FOEB 2YVUA 4H1VA 2D3WA 4RD3A 2VH5R 3W8NA 5BWMA 4HDQB 1QVIY 1IN4A 3EZFA 2ZSDA 2BMEA 3HU3A 1H8ED 3CR2A 1ZUZA 4M1SA 4LYFA 2LLSA 4BUJA 3X1YA 1E2QA 2WKQA 3ZQ6A 2LHLA 4PCWA 2IXGA 3B13B 5FPYA 4FWTA 4DVGA 2A2ZA 4LJ9A 1N25A 4Q4JB 1KWOB 1OXXK 4LHYA 1F70A 1BG1A 1YVDA 2JTZA 3KKPA 1Q20A 1VMAA 2L98A 1UKVY 3KJEA 1XFWO 1RC8A 1G4YR 121PA 1XPUA 2LE9B 4RD2A 4D25A 2PZGA 4B2PA 4MQBA 2AN9A 1NJGA 1S2MA 2MBXA 2ZPTX 4GUKA 4KFUA 3VR1A 1S6JA 4QRHA 5HKKA 4QBHA 1QX2A 2JLWA 4NDDA 1EFRD 1SCVA 1Q1QA 1DT7B 1RPZA 3CNLA 4LYAA 5FUVA 3O4YA 1OYYA 1SVIA 1E9RA 4OKSA 1MF8B 2E87A 3GEHA 5AJXA 3ZVNA 2KQ6A 3SR0A 3I32A 3T1QA 3FB4A 1NLYA 1OB5A 4PZYA 1G8HA 2WSSD 3IHWA 2NO0A 5FI0B 1SHZA 1DELA 2EFGA 2I1VB 4ZI2A 1M7BA 2DOQA 2QBYB 3RSOA 1X8KA 4Q7JB 4U00A 2R6FA 1IN8A 2ZRAA 2KNEA 2Q3FA 1MABA 1H65A 2D06A 3QPVA 3KQKA 2NCOA 1N3BA 4KHZA 4YDSA 3F8TA 1OSAA 3QXXA 3EZ9A 4QJ3A 5I2QA 2PBRA 3BH7A 2ANBA 5I2LA 2ZR9A 3K0CA 5EZ6B 5FTMA 3W5JA 4ZCUA 1B23P 4B76A 1AS3A 4PR0A 3WNDA 1VCNA 1VCOA 2UZIR 1OH7A 2XXAB 1UP5A 1QHHB 3CZTX 5L3RA 2O5GA 4CT4B 1KFXS 1BLQA 5AUQA 1NMXA 2ZNDA 1BYIA 2W83A 2NOAA 3PUXA 4Q7LA 4C0BA 2TN4A 2GNOA 1OYWA 4HLDA 2REOA 1UAAA 1ZAKA 1CTQA 3E2IA 2BBOA 4B75A 4US2R 3LCPC 2L4IA 4MVFA 3KQHA 2HXYA 1SCMC 3Q7PA 4RKEA 4TMVA 4URYR 5KSYA 1S3SA 2PJRA 3GOFA 4M2OA 3LXRA 1E2KA 4YONB 4QHSA 5E7MA 2QQ0A 5TV2A 3N2IA 4JYCA 4JLMA 2R2AA 2FG5A 2IHBA 1ESNA 2VA8A 1T4GA 3W5IA 3TK1A 2ZYWX 4BRUA 2H61A 5CM9C 1DAEA 1KJYA 2J0UB 2Q21A 3RNLA 5F9HA 3E3RA 3DPUA 3BJIC 5HZHA 1E3MA 3DOFA 3ZH9B 1NX1A 1GRRA 1M7GA 1IONA 5CITA 2J3EA 3RWOA 4CYMA 4PAOA 3CWZA 2FV8A 2XNSA 3HCMA 4B47A 4YI9A 1IG5A 1G64A 3A4LA 1OE9B 4RD1A 2G88A 4DUGA 1OF1A 1NP6A 3ADDA 2G2BA 3JTDC 2CL6X 2IHYA 5H8WA 1VRKA 2LVVA 4DLZA 2IL1A 1CM1A 2K5UA 2JDIA 3HX4A 4WIAA 5IK2A 2KJQA 3SJBA 4EFNA 3AVOA 4BQSA 1ZM4A 1G6OA 4E07A 3THYA 1F3OA 1YRTB 2Q3MA 3K9NA 2HF5A 1GIAA 3IO3A 3OFNA 3QVVA 2LVIA 5CLQA 2P3SA 1RK9A 2QTFA 2QY9A 1XBTA 3KL4A 1IXSB 1Z29A 2IEYA 3TUIC 4Q9IA 4YMUA 1UUSA 2IYQA 2NO6A 2CDNA 1ZYUA 2PZEA 1KO8A 5FTJA 4A92A 3NXAA 3A36A 1KIMA 5EP2A 4K81B 3OB1B 1KK1A 4MUAA 1VG9B 3SC3A 2M7LA 3FWCA 2WCBA 2FPLA 3ADCA 2FJUA 3HYTA 3CPHA 4UKDA 3UMRA 3DOEA 3ASYA 3LX5A 2IS2A 4I1VA 3SJZA 1KKMA 4Y0AA 1LVCD 1NCZA 3MUFA 1YTZC 2QAGA 3O6BA 2GWHA 4MYTA 2ZJZA 3GJ4A 4ZDJA 3LLEA 1AKYA 1BH2A 1BR1B 1SBJA 3NBZC 2NIPA 1AIPA 3A4UB 3ZYCA 4M2QA 3FKSD 1P4SA 1G3UA 1YR6A 1A2KC 3LD9A 4RCYA 1UHNA 1WDCC 2N46A 4XH9B 5FPTA 4A2PA 1SXJA 3ICQB 3P4YA 2XZLA 1X3SA 2K7OA 5TNCA 4BLTA 2C8VA 1P61B 3ZZ0A 4B35A 5BXQC 2FDCA 1N5IA 5FUXA 4X8OA 4HB0A 1CU1A 1UBEA 3B6EA 3QI2A 1KO1A 3TNFA 1A75B 5BW8A 1GNRA 4OKHA 1AVSA 4ABYA 2FSIA 4A0GA 2R8RA 4DCVA 4HUQB 1T5LA 1J7OA 1ZU5A 2VO1A 1W2GA 3LWNA 4DT1B 2KE5A 1GZSA 3TQFA 1QVRA 1ZVQA 2WJJA 1XEFA 1OZSA 1FI6A 3GJXC 2F3RA 5J40A 3T5DA 1IQ3A 2QROA 3E1SA 1A2XA 3GFPA 3EK8A 2BMFA 1GSIA 2RKOA 2AUCA 1A03A 4UXHA 1M8PA 3U4QA 4NYJQ 1P7CA 4ZO4A 4P4SA 4TLCA 5AJYA 4JL8A 2REBA 4B3DA 4PPFA 4RJLA 3HP1A 1WLZA 2BL0C 1DAMA 1IAQA 3BK7A 4OI0A 1R2QA 3DZDA 2IEZA 4QBFA 1GVNB 2OFXA 4IHQA 1L2OC 1K9UA 3KF9A 1HV8A 4NZYA 4CEJA 4ZIRA 3FS7A 3B82A 2ZNEA 4M2PA 3ND9A 4UNNA 2HUPA 5DE3A 4ZCLA 3C1VA 4OI1A 1GG2A 2VIIA 4CGZA 1OKKD 4N5XA 3FFBA 3TSWA 4A1FA 5M04A 4OV2A 4JPZB 1PLJA 2OS8C 5CK5A 2JNXA 5DI9A 1E99A 4G0NA 4BLRA 1U0HC 1W7AA 2YYZA 2F8PA 1AZSC 1A29A 1P62B 4QG7A 4WXPA 3KKOA 2FN4A 1CRQA 1I4LD 1OXTA 1SZPA 1XJ0A 2ZRFA 5JSZB 4YGDB 2HXSA 2QPAA 2FCEA 3O8RA 1OOJA 3KTAB 4UNSA 4V0OA 4NYIQ 1S6IA 1N0VC 1DAKA 2FA9A 2IK8A 2IYRA 4TLDA 2GCOA 3PALA 4DLWA 4HRGA 1KZGB 1KZ7B 1KAGA 5DN6A 1MR8A 4JL6A 1CKKA 1W49A 2RGDA 4ASUA 3SIAA 3RVBA 4KSCA 1XP8A 4KJZA 2H2KA 1OIVA 2AFHE 4KLZA 2DFTA 4C4PA 4FMCB 4W5HA 2BHRA 2UZ3A 1NSTA 3PVSA 2BECA 4FCVA 4DSNA 2CHVA 4TLEA 3VRNA 1PVBA 4NTZA 3W3ZB 1UHKA 1UEIA 3WNBA 4BFWA 5KHOC 2MJWB 2OBNA 2WTUA 1D2NA 1LS1A 3RS5A 3AH8A 4JZKA 4DEYA 2JWWA 3FMFA 4PHFA 1VYUA 3TDUA 5PALA 4ARZA 1UHIA 2O0JA 4IDHA 2RGIA 3AUYA 3IGFA 3T1OA 3IBYA 1HT9A 3ZDQA 3NSLA 4YGBB 1V5WA 3BB1A 3MJRA 4OQNA 3CS1A 5IF9A 2L0XA 3KPXA 1JC2A 1SVWA 3LW8A 4M53A 1T3LA 4P31A 4LJ7A 5JRZA 1SL8A 3KXIA 4Q7KA 1YURA 1OXUA 2WPDD 3I8XA 2VSFA 3OHMB 1OW3B 2KYCA 2VPPA 2WZQA 4LI0A 4P0TA 1KK8C 2R2IA 1KI6A 3DO6A 3QSYA 3U4QB 2GJ9A 2IYUA 4E5UA 2IS4A 1ZACA 1P5ZB 4Q1FA 4QGGA 1G4UR 3K0FB 1PLLA 5CSIA 2AFIE 2GVZC 3IIMA 2NCPA 3L82B 4TMZA 2GXAA 1WB9A 3BXKA 1FL9A 1QHNA 3QG1A 3SU8A 3I5IB 1XCGB 4XWKA 1HQVA 4A2WA 5FFMA 1JPNA 2WMNB 2YV5A 4TTQA 4ZKEA 3TGPA 2HF9A 3U7HB 3SDZA 1T8TA 3WXMA 4XD7D 4ZCVA 1RRPA 4PALA 1XJQA 2QORA 4LJYA 2BCJQ 4G5QA 4I5JA 4DLVA 3T5GA 4UNRA 1Z6AA 2QG6A 2C9YA 1XF9A 4AG5A 4U8DA 1N0YA 3B9PA 1DTLA 5D3MA 4Q02A 2P6NA 4C0QC 2ZRHA 4PE1A 5HYDA 2K7BA 4QBGB 4E09A 2EGDA 4DXAA 1JALA 3GLIA 4HI0E 1NSFA 4MGKR 4K8OA 3TVDA 4A0RA 3T06B 5JCPA 3QIAA 1IWQA 3EWAA 1HQCA 2C98A 2VF7A 4BY5A 1IXRC 2FFBA 2JJ2D 4G5OA 1SHKA 1V1GA 2IXFA 3OE7A 2F7SA 2PX0A 2J0QA 2QEQA 2X2FA 2WIBA 3OB2B 1OXSC 1PUJA 1HTWA 1RZ3A 1FUKA 4LX0A 5KSPA 1AS0A 1EL4A 5L3QA 1KMHA 4KXFB 3D0YB 3ZZTA 4L5BA 1E0JA 2OFWA 2RGXA 3VKWA 2Z83A 3OIVA 4YMVA 1G291 5BN5A 2IYYA 3T12A 2BBNA 4B34A 1FQKA 3C5HA 2D8NA 4MYUA 2JT0A 2ONJA 5CDFE 2KAYA 1E0SA 3B1WA 4Q1BA 2XNDD 5HTKA 3NSOA 1I2MA 3BIFA 3K70D 4XSGA 1R0WA 1W47A 3MRSA 3I62A 4CEHB 2J59A 4GBMA 4GI7A 2H7VA 3EPJA 3TMKA 2GXUA 4BFSA 4DCUA 1J2JA 1DO2A 1ZNZA 4F0ZB 3EG5A 4D4JA 2QMHA 5DI3A 2BJVA 1E2NA 3NIBA 3NH9A 2GEVA 1FI5A 1SVKA 2WOSA 2ZVPX 3SYNA 3GK1A 3KKMA 4FMDB 5HPYB 5CSJA 1RKBA 2I18A 3BQ3A 1E79A 3LK1A 1ZC3A 2D2FA 2OE2A 2XSZD 2Z5FA 1MHOA 5JJGA 4GFTA 5AJZA 1F2UB 2KSQA 3O47A 3SJSA 4P2YB 2HPSA 5FH9A 1WY9A 2ZRBA 3ICBA 2SHKA 2N1BA 2QPTA 1HE1C 2D4HA 4NCNA 3WY9A 3NXSA 1UKEA 1V43A 3C8UA 3OIWA 5E7IA 3B2EA 1M45A 4F4JA 1F71A 4XTRA 3B7GA 4PZZA 3KQLA 3VGOA 1KK2A 4KYUA 4PC2A 1DBSA 1VG1A 2ECKA 3AKAA 2W0SA 721PA 2P65A 1CDNA 2LCFA 3FVQA 4N3NA 3TQCA 2LWIA 2EWWA 3HYRA 4LSGA 1SYMA 2KBIA 4LOAA 4PSVA 3NHBA 5JI2E 1CRPA 3RWMB 3QPUA 5D3MB 1FF1A 5AK0A 1YKSA 1Z6TA 1DGUA 1XPRA 5HKZA 1QHSA 3M1IA 1KK7Y 1MT0A 2CL0X 3WP0A 1OFTA 4FMBB 1YUUA 1JAIA 4RD6A 3MAAC 2JLXA 1W36D 2WCFA 3KEVA 2YC4C 3IDQA 4Q48A 4BZPA 2O8EA 4XJKB 1P60A 4QL3A 1S6CA 3DVEA 2I3BA 3OIYA 2JQ6A 1LF5A 4B2IA 4BLOA 1EGAA 1Q21A 2OTGC 4EJSA 4GT1A 3EAQA 3AAJA 2BWJA 1NBMA 2M29A 1TEXA 1W44A 3CPEA 1E96A 5FPHA 3GLFE 3R7WB 1S1CA 5EE3A 2YWGA 1FQJA 4TYNA 1FMJA 1ANKA 2BKEA 2PX3A 3GJ7A 3Q9LA 4ON9A 4TMKA 5FUWA 2B8WA 1JECA 1E1RD 3U44A 1SRAA 2JJ1A 4GOJA 1K94A 5JRJA 3BUOB 1BKDR 1LF0A 3M6AA 1JQLB 3IPXA 3LNCA 1KO5A 4DIDA 1ALWA 4PE0A 2O8CB 2WAYA 2ZRTA 3UK6A 1W0JD 3SBDA 3E70C 4BFZA 4CEIA 4JJKA 1NY5A 2HCBA 4MUBA 2JU0A 1QZXA 2C5LA 3MSXA 4AI6A 1N5JA 2BEKA 5AANA 2WORA 1FTNA 2MSDB 3A1WA 1SPYA 3CLNA 2L51A 2CEAA 3H84A 2BC9A 1E69A 1PZNA 5A4JA 3TLXA 1IJEA 4DZZA 1SKQA 3WNXB 3CO5A 2LMUA 5DISB 4WVFA 1UJ2A 1KDOA 1WRBA 2HDNB 1CDMA 1R2UA 3RLFA 1JEEA 3WHLA 4ZDIA 1G41A 4JL5A 2JIZD 4NE2A 5FL7A 3TUYB 1AQYA 3SI7A 1U0JA 4ESVA 2PL3A 3QF4B 4OK5A 3SG7A 4DLXA 3LLUA 1XXHA 3QQ5A 3BYAA 1FP6A 2REXB 5GJBA 4NDCA 4P33A 2NO7A 3VHXA 1NYAA 1DADA 1FX0A 1N6LA 5F3WB 3N2EA 1G17A 1DO0A 1F5NA 1YZLA 2J9RA 3QEOA 5EE1A 1J8MF 1HYQA 2PRUA 5D7FA 3PFIA 1KO7A 3PEUA 3JZAA 2CK3D 2LUCA 3GFOA 5FR1A 2PVBA 1K6MA 2CJWA 2IUSA 1L8QA 1B0UA 4HAZA 2D7CA 1KQMC 1CBUA 2PASA 3BWDD 1G3RA 2P6UA 5FTNA 2LUXA 1JF0A 3GCGA 2QAJA 3K9GA 3EKHA 3JVTB 4L16A 3GLHB 4C2TA 2JATA 2X2EA 1KAOA 2KFGA 1SR6C 2SCPA 1G21E 4I81A 2F3ZA 2BKHB 4UNQA 3U7FB 1E0KA 3W9YA 1ZM3A 5AJWA 3T1VA 1J8YF 4LJ6A 3BGWA 3ZNIA 5AERA 3FKQA 2YOHA 3MGCA 2CLDX 5LPNA 4A9AA 1JJVA 1EWQA 2OPOA 2ZFDA 5SZIA 4D80A 1ZMXA 3TUJC 1DS6A 5J4VA 1VECA 4EJSB 2Y1NA 4MLWA 1VG0B 3ETLA 2ZQ5A 3MSEB 2FPMA 3SHFA 2NGRA 1QHGA 1G5PA 5JMTA 4EPYA 3VX4A 1C9KA 2RGAA 2RHMA 4FXPA 4F93B 4EPTA 2O0KA 4OQLA 4TQAA 1CLLA 4XSHA 2UKDA 2VSXA 4DRZA 5HZKA 1DJHA 3R20A 2QZ4A 2E6WA 5DO9A 1E2DA 3W3AA 1MWNA 2QSYA 2E30A 5FPSA 3LA6A 4YDHB 3LDAA 2OCBA 3Q5DA 4NDBA 2AXNA 3KJGA 3QPWA 1FUUA 4PDZA 1XD2A 1CJMA 3MWYW 1Z83A 2J46A 4CEIB 4IKEA 1A4RA 2G77B 2FF7A 2PEYA 2XTZA 2MHHA 1S3PA 4ESHA 3BOWA 2JIZA 5TMPA 3NVAA 2O8FB 1YZTA 2K7DA 2NTYC 4KV9A 1TEVA 1WQ1R 3QUSA 1Z0JA 3ZS8A 1IH0A 3EK4A 3LQQA 2GRJA 1RYFA 2BCXA 3EPKA 3VNVA 2V54A 1ZM7A 3LVRE 4QJ4A 1GWNA 1B8RA 2ZYUX 3QKRA 4QJ5A 3GP8A 2VP2A 4BFTA 1RJ9A 3X1ZA 4GGFC 1B8LA 1G7TA 1FP7A 3AKCA 3DKPA 4Z51A 1UM8A 3VU9A 4MRPA 2QM8A 2DR3A 2LC5A 821PA 4BE7B 1P2VA 3UXMA 5KPJA 4GPLB 2MRDA 1FX0B 5EXSA 1UURA 1J7QA 3LRPA 3T15A 2QTHA 1EG3A 3ZWHA 2OHFA 1KI8A 2YWEA 1BMOA 2I7AA 2LLTA 3DKVA 1GL9B 1UKYA 4LZZA 2QP3A 2LMVA 4QNMA 2FFAA 3Q3JB 1JFJA 3AGQA 4GOKA 2QE7A 3I61A 4C0HA 1X1SA 1R10A 4PSKA 2IS9A 2D2EA 5TY0A 1D5CA 2GEDA 4DWJA 1IJ5A 1XEXA 4U5XA 1G3MA 5EUQB 2JC2A 4MDFA 2FFHA 4G5RA 5JJLA 2R44A 5UKDA 2HT1A 4MRSA 4R98A 1S3GA 1QBKC 1J7PA 3U60B 1KTVA 2FSGA 1P6XA 2R65A 4PC7A 3PUYA 4GL2A 1KK3A 2X1VA 3CRMA 4IVRA 2CVFA 3BFVA 4B33A 3EX7C 3PUVA 3JVVA 1P2TA 1YZQA 2ZI6A 4IEEA 3EVUA 3LBIA 2KAXA 4WAUA 1XMVA 5LBIA 3UMSA 3IUYA 3GLGB 4R7ZA 1EX7A 1E2MA 2B7CA 4URUR 4JVLA 4PX9A 1BS1A 1CLMA 1KY3A 2Z4RA 3RS2A 4WZBE 2G1JA 1R7RA 5LD2B 1IN6A 4JT2A 3I92A 2KI6D 221PA 3SIBA 1UHJA 1BYUA 2ERYA 1XYDA 2MSCB 2ZJOA 3M4YA 1FW4A 2M8UA 2JTTA 2JXLA 1OXVA 3KKNA 4DEXA 3CPJB 1YVLA 2VP0A 4A8JB 3ZVLA 1OFHA 2O8DB 2K2FA 2IS1A 1W4BA 1EXMA 1XFYO 4IOLA 4O25A 5SZJA 1QG2A 2F9LA 2K61A 1CFCA 3EC2A 3AF3A 1QDEA 4M8NE 2XB2A 1PSRA 2HCJB 4A0HA 1RJVA 5JJKA 1M2OB 1UBCA 3AF0A 3IEVA 3I5HC 1E1QA 2GJKA 4WXRA 2Q9BA 3PR1A 4N1FA 2P6RA 3HDTA 3C7KA 1R5NA 2ORWA 1DAHA 3A1SA 1JBKA 4C0LA 1TCFA 2CCKA 4JLJA 1SMGA 5J4HA 5CSNA 1NL3A 4IDPA 3X2SA 3KX2A 4QJ5B 4PPQA 1G19A 5EE5B 5DKNA 2KI5A 2WICA 3CWGA 1XFVO 3GFTA 1AZTA 2C77A 2FGJA 4PAQA 5JWRA 3DF0B 1QXPA 1AK2A 1PJRA 3AGPA 3K0AB 3RHFA 3VU9B 1TL7C 1XB2A 3AF1A 5FTLA 2QMEA 5IDVA 2VF8A 3AP2A 4A6PA 4DLYA 3NSIA 4D0GA 1XZQA 3BFKA 4NCJA 1EFHA 1OB2A 4Z8YA 3VMFA 5DH9A 3GLHE 1IOZA 4RZ2A 1F48A 2ORVA 3FE2A 3OZXA 1AQUA 2WKPA 4PC1A 3U7GA 4GPTA 1XTIA 4HZUB 3EWSA 4CVNA 1WLMA 2E9SA 2DFKB 2RGCA 4JVMA 4EFLA 3PATA 3AEZA 4Q66C 2I94A 3AUXA 1E2LA 1NG9A 1BF5A 1MRSA 4BRWA 4BLQA 2IWRA 1DG3A 2LP3A 1U5IA 1S8FA 2LKDA 3BUNB 4LJAA 1NUBA 2KBFA 4ORAB 3GEIA 2EHBA 4O2LA 2JLRA 4TQ9A 2QMOA 5E3HA 3CLVA 3CWQA 3TW4A 1IHUA 4HZIA 1M34E 4Z54A 1F4QA 4CF7A 1H8EA 3SYLA 1K8UA 5DKQA 2EC6C 1K9PA 1XTJA 3EW9A 3SG2A 3EK7A 4W5JA 1XVJA 1IY2A 3R9WA 2NXQA 5B58C 2F1JA 4TNCA 4KITB 1N5KA 2GJAA 3PN7C 4LPKA 3EPLA 3EIHA 1KFUS 1E9AA 5EXXA 2J7KA 1OH5A 1M39A 2ZRLA 4LV5B 3RYTC 2CXXA 3CM0A 1C7WA 3EIEA 1CNPA 4W5WA 1CR4A 3OIUA 3G82C 4CW7A 4EPRA 4YLGA 1Z6GA 1FPMA 4HLCA 4P4UA 2ZE6A 2XTMA 5C4MA 2ZRJA 2JPTA 3I3SR 5I8NA 1F2TA 1XEWY 2ZRCA 4DLRA 2ZI5A 2K7CA 4EPVA 2FU5C 2F1IA 1EFRA 3AV0B 5J3XA 3K1JA 1LB1B 2QPOA 4RD4A 2NMVA 1JB1A 3F3YA 3SN6A 2Z0MA 2F43A 4V02A 4TSFD 3ZGXA 1Y6WA 1QASA 1IM2A 2Z6VA 3VRQA 1H8BA 2WSSA 4JKYA 5G3YA 1SVOA 4TMTA 3U3MA 3H4MA 1WBBA 4KFSA 2C2HA 1DF0A 1NX0A 1TX4B 1UBGA 1QX7A 2BMDA 4M1KA 3QG5A 3H1TA 1QATA 3IBGA 3B1ZA 4ZDKA 4I5LB 2QGZA 1GL7A 1NP8A 3QXJA 3NBYC 3VR4A 4LK2A 5TXGA 2OG2A 1K93D 2ZUCA 4JLDA 4GGFA 1P9WA 2PLRA 3GJ6A 5F6TA 1CP2A 2QM7A 5FBRB 1JSAA 2DWQA 2GTPA 4GNKA 2NO1A 2VSOA 3PV0A 4H1UA 1KI1A 2WKRA 2ZRMA 5AUNB 1WRLA 2O5VA 4DDTA 2ZETA 3MMPA 3HR7A 1TTTA 1FW6A 1DAFA 1MABB 3T34A 4DSUA 4KVAA 4QJ3B 2GV5A 3CBQA 3GJ3A 4L9SA 4B3CA 1KI3A 1PLKA 3I5GC 1AK8A 2WV9A 3C15C 4L9MA 3AVUA 4W9MC 2H8KA 2OBMA 2ODWA 2QSZA 5B2ZA 4B3BA 1ZIOA 2VHQA 1OV4A 1NN1A 1GP2A 5I2OA 4KI0A 4O3MA 1LNZA 3JVUA 1CJKC 4QOSA 5E4FA 1UFQA 4K46A 3ZLJA 5HCIA 4M22A 3PM8A 5FBQB 1YVHA 1XWIA 3PJRA 4A4DA 1WF3A 3WMGA 1SR6B 1RVDA 4F38A 3U6KA 3GLGE 3KFVA 1BODA 2YJTD 1SW8A 3CX8A 2OZEA 4MYCA 5J4LA 1JBAA 1U90A 2RGEA 2XZOA 3PEVA 1LY1A 1GITA 2WC8A 1MR3F 2JEOA 5CSFA 3B60A 3P4XA 4F91B 3A1UA 1Z22A 4LJ8A 2H92A 2XEXA 5KUTA 3O78A 1O87A 2VP9A 2CT9A 1NVUQ 4PC6A 1UBFA 4D4MA 3OEHD 2V4ZA 4DDWA 4TN1A 3TH5A 2BM1A 4Q4LA 1CFDA 3A4NA 3MD0A 4JLKA 3EVRA 4TSFA 3W6NA 3MWKA 1M1YE 1SL7A 3KDSE 2ZI7A 4NCHA 3QKSA 3AKDA 3KFXA 5EP4A 4BFXA 4PANA 2BEJA 4AD8A 3I5FC 2BOVA 1F2TB 1Q22A 3L0PA 2Q9AA 2GVDC 3U61B 2GCNA 2ZRSA 1U94A 2BM0A 3WRYC 4TTRA 4RKFA 1GL6A 3TE6A 4AYTA 2W6ID 1EJ3A 4X8HA 4YBHB 3WBKA 2KAVA 4A36A 1TIZA 3CW2A 2BKUA 2R9VA 4JT4A 5JEEA 1DJXA 5J4KA 3H86A 3THYB 1GRQA 2M97A 5L3SB 3FMIA 4TYQA 2EFCB 3SJAA 5FBLB 4A2QA 5B57C 1YHNA 1P2SA 5HKYA 1UF9A 1NF3A 1YU9A 2A5FA 3HPRA 1Z2AA 2ZS7A 3IIKA 1OE0A 3SEAA 4JYBA 3KUCA 3KO0A 2EFDB 3ASZA 2GETA 1Q3HA 3NC0C 4DCKA 1SVLA 2FH5B 3L8ZA 1W4CA 2PCJA 2KI4B 1OT3A 2FE4A 5IHPA 1DG1G 1UHHA 1AGRA 1T9HA 2N42A 2G0NA 3EXAA 3KHEA 1IXZA 2FJUB 3QVUA 2ZS8A 3A37A 4AOMA 3OEED 2DY1A 1B7TY 1E9CA 2GXSA 2I4IA 2IA5A 4MRYA 4WQ3A 3FKSA 2D7DA 1DJWA 4WQ2A 5GQQC 1P75A 2GF9A 3BERA 3NWJA 1VYTA 3QJYA 2ZRKA 4OVNF 2QAGB 3A1TA 3H0KA 1R5OA 2VL7A 2LVJA 3C4JA 4ILEA 2B8TA 4M0LA 1I2DA 3KXKA 3CZQA 1N6HA 2HQWA 3K70C 4I5NB 4I5KA 4USLA 1KO4A 1JUOA 2RAPA 2VLIA 2WCEA 2R6AA 4WBSA 1KDPA 3RRYA 1OH8A 3BBPA 1JR3E 3T35A 1Z0IA 1SXJB 2J45A 4JLAA 4TT3D 1H8HD 4AKGA 3LLMA 1BR4B 1JNYA 1B9AA 3P26A 4UPGA 4OHXA 1GNPA 1CKEA 3BS4A 3GMTA 1NPQA 2COLB 3BUXB 2QN6A 2ZI4A 1OJLA 2P67A 1S5GY 5D69A 2D62A 3TS5C 2KFHA 1YR7A 5EE0A 1BU3A 2RMKA 4HLUC 4IVPA 3CNNA 1ZNXA 1A5TA 2J0VA 4LYHA 3KXLA 2B6HA 3H4SE 4JBYA 5CK4A 2JLVA 3ICEA 1XDBA 2V9PA 1OPXA 2EYUA 2G0TA 2F2OA 1PK0D 3FWBA 2QENA 1OKKA 2R62A 4MRVA 4QHYA 4RZ3A 4WA7A 2ZR0A 4G1UC 2W6JD 4GZMA 1YR5A 4P4SB 4DB4A 1S26D 4ICBA 4XIGS 2FSHA 2WSMA 4JQ0D 5FR2A 3Q7QA 3UATA 2ZXUA 5F2EA 3P27A 5FOSA 3ZIAD 4V0ME 4HEJA 2MA2A 4YGAA 3H2YA 2BJWA 3WYGA 4CEJB 1MO6A 4ZIRB 4KBFA 4S35A 5DYGA 4B6EA 2ZKMX 4TTPA 4GRAA 1Z6XA 4XYNA 1DMOA 4P5OE 1XFUO 1ZIPA 1CDLA 3RC8A 1D1OA 1GGWA 1SKYB 4HSEA 4KVGA 3P32A 2WWYA 5ELXA 1W36C 3CRQA 1EG4A 1X8JA 1PALA 3NEYA 3TUZC 1VCIA 2WWWA 2AWNA 2KFFA 1TADA 1KFXL 4L4UA 4TMWA 4M4SA 2XJ9A 1TNQA 3FHCB 2KBMA 4OHVA 4NONA 4XJXA 1XCMA 4DIEA 3WBJA 3SFZA 1AJ5A 2KOTA 5GVSA 3CTNA 5J47A 1CTRA 2WHXA 2GKSA 2IS6A 2GCOB 3S1AA 4MEWA 4U02A 5DSZA 4NQGA 3I5XA 2KGRA 1G33A 4RFSA 3EA5A 4PTLA 3HU1A 1MXLC 2O60A 2C04A 4LDJA 4OHYA 3M0EA 3BB4A 4JSYA 4QNRA 5K8LA 5JHGB 4Q1DA 3FDIA 1RFJA 3GK4X 1S9HA 3V00A 4DIRA 3WMEA 2L4HA 4PQFA 2IYLD 1ZOTB 2PH1A 4TYYA 3CRW1 3K9HA 3LW7A 1ZU4A 1Q3TA 2XB4A 3EZ7A 4Q01A 4AWXA 1KKLA 4MZKA 1DJZA 1ELOA 1XRJA 4B3FX 4YQFA 4HRHA 3QRXA 1ZNWA 2JASA 4C7OA 1SCMB 2WPDA 2JZIA 3DD4A 1UKZA 2QRZA 1XTRA 4Q9JA 2GZDA 3TKLA 1Y0VH 3NEJA 4OI4A 4ARZB 3RC3A 4C9BA 4MDEA 2CVHA 2DFNA 3VKGA 3KJHA 2ODBA 1G5TA 5K8IA 5BN3A 1AN0A 2O8BA 2CE2X 4OHWA 2JJ8A 1Z63A 2NPFA 2H1LA 2NPIA 4TL8A 1E4VA 4TLAA 1ZP6A 1S0UA 4LBWA 5KPDA 3TRFA 4PHHA 4B2LA 1VIAA 5KDOA 1CLBA 1II9A 2X19A 4EKDA 2HQ8A 2AL7A 2VRWA 1KWOC 3TBKA 2WWIA 5FBVB 3MWLA 1KI6B 5KDDA 4Q4HA 2WWFA 5H70A 2CNWD 1U99A 4XD7A 5G40A 3P1JA 4KLNA 3JTDB 4PPNA 3REGA 3B1XA 4M1OA 4PHGA 4URVR 1P3JA 4HSZA 1L2TA 2ZU6A 3VR6A 3R8FA 4EIWA 2V7QD 1NWDA 1Y1XA 3CF2A 1U9IC 1FNMA 1Z2CA 4HAYA 1IQ5A 3DZ8A 3THOA 4CRWB 4D6PA 3O8CA 3GPLA 4NYMR 5FL3A 4LJ5A 2J7PD 3AP3A 4Q4AA 4W7SA 4XWAA 4YMWA 2VHJA 2KSPA 2R6DA 3KUDA 2WJVA 5GJVC 4F7WA 4LY6A 1GKUB 4JIMA 4Q1CA 4IEIA 1CJTC 5AR1A 3A58B 2JJ2A 4IW3B 1MH1A 3BB3A 3UG7A 3CX6A 2F6RA 2KYFA 1CF4A 1QS7A 2OCAA 2QRNA 3GEEA 1XFZO 1YZNA 3Q8XB 1KSMA 3T61A 1E6CA 3EZ2A 2V8OA 2WOJA 3AQ4A 4IOKA 3GLIB 5JEDA 4JWQA 1TOPA 4XWOA 3EPHA 3OAAD 2WWXA 2V6IA 1U81A 4AYXA 4B74A 2ONKA 2L2EA 3NDBB 2ZIAA 4PPGA 4RZUA 3S1AB 3BC1A 1GFIA 5AUOB 3R8CA 5K8UA 2AWOA 2JT8A 2V53A 4M9ZA 1W7IB 1T0HB 2AK3A 4ZI3A 3CB4A 1AS2A 1GTVA 2VQSA 2BKIB 3V9PA 1SXJE 1NJFA 2LVKA 3REFA 4V0NA 2XNDA 2F1HA 4JBXA 1D2MA 5P21A 4JLVA 2F33A 2GILA 5FUYA 5IBWA 3ZZUA 3AVVA 1B1GA 3X1XA 1KMHB 5L3QB 1VHTA 3TR0A 4FTGA 2EU8A 2XITA 1Z8FA 1I4TD 1WDCB 2HETA 1UEJA 2ZU0C 4L9WA 1KSOA 4ORBB 1YZGA 2ZE8A 4AURA 1J1DA 2W2TA 1CULC 5HE9A 3RANA 5G41A 2CTNA 2CE7A 4PC3A 2I1QA 4Q1EA 1PUIA 2ODEA 2X8AA 4Q47A 4IXMA 1A82A 1L4UA 1E32A 1W2HA 2HYDA 4P4TA 2IF2A 1LKJA 4PSAA 4IDOA 4Q7MB 2XSZA 1OHHD 1F4OA 4BY4A 2P5TB 1KNXA 2JNFA 3O8BA 4F4CA 1JQJC 1BMFD 1TNDA 3AF4A 3LL8B 2O8BB 2ZSFA 1RRGA 5DI3B 2P0EA 3FIAA 3IQOA 4GGNA 1E94E 2IXEA 2L0PA 4D26A 2BE6A 4C30A 4XVQA 1WA5A 1F60A 3U2QA 5GADl 3ZD6A 3PFVA 1HEIA 2CCJA 2PJZA 2W00A 4V0KA 4XVRA 1MO3A 1WBDA 2ZYVX 4PQYA 2JCSA 3R9XA 3SQXA 3SG6A 5DKRA 3NBFA 5JWOA 2XZPA 1PV4A 1DAIA 2HJGA 4Q5IA 1KI2A 2BL0B 1Z5ZA 2WMOB 4RSGA 2IF0A 1EFCA 1VDZA 4EFMA 1D8TA 1L2OB 2QI9C 1OSNA 4EUNA 2ZEJA 1G8PA 3OP0A 3IO5A 1NCYA 2BE4A 1T3HA 1XTSA 4US1R 2JAQA 3SBEA 3KB2A 1ZD1A 3CX7A 1SQ5A 2JLQA 2HLDD 3LVQE 3MWJA 4MGYR 2OS8B 2FPKA 3OAAA 1NIJA 2CL7X 4LC1A 4ZV4A 2CCMA 1E2EA 1N2CE 3UMFA 4Z1MD 1Q44A 1NVXQ 4UJ5A 4RVCA 4YMSA 4MSPA 1WXQA 2RCNA 3RS7A 5G53C 4YGEB 2W0MA 4CPVA 2GBLC 4MRNA 2A4JA 2YINC 4PE4A 1II8A 4M9XA 4IL1A 4HREE 2FOLA 3SE0A 3I8SA 4LYJA 4FINA 4MITA 4C0SA 1J99A 4LRWA 1JWDA 4DUQA 4URZR 2FZ4A 2AXPA 2O8EB 3B78A 2ZUBA 1CEEA 1M31A 1G1MA 1ZUIA 1GGZA 4BASA 1E1RA 4YXWD 2IBMA 2KI6C 1HT1E 1OIXA 2BVNA 3NBXX 1N5LA 2IC5A 2NQ2C 1KCYA 4ERNA 4D0NA 4DDVA 2AHOA 1KSFX 1ONBA 2IUTA 2QQEA 2MLFC 1ZD8A 1W0JA 3QEJA 2AD1A 1RYHA 1ZUNB 1R0YA 4NKRA 1YRBA 2IYWA 5L8VA 3U44B 4O0MA 1M63B 5C18A 4NCKA 2E1RA 2YHSA 4V03A 4AYWA 3VRRA 1K2HA 1WP9A 1F6BA 2QA5A 1ZJ6A 2WAXA 4LHVA 4N0DA 3KZ1E 2KQYA 2NZ0A 5DLQC 3L2OB 521PA 5JWHA 3BH6A 3WMFA 5JECA 1YJ5A 4QXAA 1CJVC 2OXCA 4TL6A 1E2JA 4QC2A 3LO5A 1ZRHA 1YRAA 2QUZA 1QVIZ 4X8MA 1ZCBA 1UPTA 1G8GA 4HDOB 2BV3A 1JR3D 2OFOA 1W5SA 3IF7A 5CYOA 4ZCMA 4Q03A 3ZVRA 3TIFA 3RABA 1KK8B 1E9BA 4MGIR 2IX3A 4A4CA 2EWVA 2JOJA 3D3QA 2Q91A 2CK3A 1QHXA 3DM9B 2IUUA 1T5IA 1DJIA 2VHCA 4DSTA 1GOTA 1XXHB 2P6BB 3KQNA 1WRZA 4ACBA 5BN4A 3QBTA 4YC7A 1Y3AA 1U9IA 2DYKA 2ATVA 3K8YA 1JF2A 4HAWA 4PO9A 1YZUA 3FOZA 1J1EA 4Z8XA 1NVVR 2CJWB 1MOZA 5DHAA 4URWR 3WXAA 1T91A 1DGVA 1AM4D 1YQTA 5GJCA 3B9QA 2CBLA 1TMKA 4BLSA 5KNCA 1GILA 1E9FA 2QBYA 3PUWA 2NLNA 5HKKD 1N6PA 3DMDA 4YI8A 1II8B 1B47A 2JGNA 2ZRNA 5K89A 5J5CA 2EQBA 5CIWA 4BPBA 5EP3A 2LKCA 2ZRPA 4J0QA 2ZVQX 1N65A 1LA3A 1OMVA 1LFDB 2VRGA 1TF2A 3U6BA 1CR1A 2LV7A 1G7CA 2GA8A 3K09C 4L8GA 1IY1A 3HR8A 4JBWA 2WNDA 1QHHA 3QE0A 5FTKA 2V1UA 1KNQA 2DWPA 2NO9A 2RGBA 3LQRA 4A6XA 5JBQA 4R2HA 2A7QA 3DVKA 5BPJA 5KU1A 1KI9A 2FSFA 2QMUA 1Z0FA 1XFXO 2MMGA 2ZUDA 2M7NA 1E98A 3D8BA 5LB4A 4D0LB 2B92A 4FI3C 2KHNA 2PT7A 2XAUA 4AIIA 5C1BA 3AVTA 3Q85A 4GMXA 3VRPA 2GK6A 4OI2A 4Q9LA 2G83A 1KSJA 1G7RA 5AJVB 2WJGA 4B3XA 3RM1A 2KBEA 1T8UA 4NBSA 4Q18A 1RRCA 1G3QA 2Y5IA 4ZDWA 3RAPR 1JR3A 4IOJA 1NRJB 2J0UA 3VR2A 1XD2B 2DHRA 2LHIA 1G7SA 3QNUA 3A8TA 2WBLC 5FI1B 3SHWA 1HE8B 2IT1A 1KJWA 3B8HA 2DPXA 3BOWB 1VIYA 1WDTA 4AQIA 4MGZR 5B30A 3A6PC 4A82A 2EYQA 4B6FA 2BDTA 3THWA 1NN0A 2ZJBA 5FBWB 3AP1A 1ZW6A 2VP5A 3CR4X 1W7JB 2R6GA 3DHWC 3J81k 3NSKA 4QJ4B 2UVQA 3QKRB 4TYPA 4PHNA 1XD8A 1ZC4A 5TARA 4TZ0A 1RJ9B 4WZAE 5L3VA 3QBVA 1LTQA 3EASA 2ATXA 4D82A 4M21A 1G8FA 5JOLA 4RY2A 3CGAA 3I5IC 3OX5A 4N1GA 2OESA 1NI3A 3IHLA 3D6TB 1MXEA 3TDIA 3PEYA 1Y1AA 3IEUA 4KBGA 3AM1A 1QV1A 1NLZA 4NCIA 4MRXA 1LINA 1BO6A 4DUGD 5EQTA 4R71A 4A4BA 2OLJA 4Q00A 1JAHA 4V0MA 1XU4A 3WYAA 1ODBA 1CB1A 1TQ6A 1B4CA 5FOXA 2J5XA 2JDID 5IK2D 4B3GA 1SY9A 3ZD7A 3U5ZB 2ZROA 1OZOA 2QT0A 3BORA 2FGKA 4MZLA 1XEXB 2GBLA 5DGXA 1KDTA 4CFQA 1N6RA 3OFND 3FTQA 4DHEA 2GZAA 5CLLA 2OBLA 3TSZA 2ZE5A 3DVJA 2HV8A 4JVSB 1W4RA 2ZTSA 4MKHA 2F3TA 2BCGY 2OT3B 5EJEA 1NBME 1DEKA 2I2RE 4AQJA 2O52A 3IQQA 4HATA 1N2DA 5CIQA 3TAUA 3PEWA 2GAAA 5FOTA 4DRWA 1XZPA 1MO5A 3I4LA 2GCPA 1US8A 5LB2A 1L4YA 2OTGB 1V1FA 1ZCAA 3DM5A 4B32A 3SG5A 4DCTA 2AR7A 3AB3A 1CR0A 1II0A 3BXZA 3GJ0A 4Q21A 3U7EB 1IJFA 1AUIB 4OK6A 5KNDA 2YZ2A 1Q12A 1DJGA 1GKYA 2K8MB 1YE8A 2J41A 4NH0A 1Z08A 4V0LA 1E8AA 3VFDA 3ADKA 2IYTA 2OV2A 3SG4A 1MQ1A 1A75A 3CR5X 1J7KA 1IJ6A 3CH4B 3W6OA 3L43A 4UXJA 4JLOA 4QM6A 1ODFA 4U7DA 3UG6A 1YR8A 2FX3A 1ZM2A 2BBWA 3VTKA 3W6PA 3F0TA 4HUQA 4TYWA 4DT1A 1Z07A 4M9SA 1Q80A 1SXJD 5CDFA 1M46A 2KWIA 3K9LA 4P3YA 2JLYA 2YOFA 1ZMZA 2H17A 1MKYA 3BOSA 2LM5A 3EVVA 4B48A 2EVWX 2OEPA 4DDUA 1G8IA 2GESA 4AC9A 5G3ZA 4LUCA 4OQXA 4EPXA 2VEDA 1TAGA 4DKXA 1VYVA 1Q1ZA 1XXHE 2CLCX 2Q9CA 3SFVA 1U98A 5CB6A 3THWB 4D4LA 2H18A 4LCBA 5BYKA 1NNEA 1EX6A 2OAP1 2WWHA 2OCYC 2BCAA 3ZQJA 1EG7A 3I72A 3GJ5A 4S2EA 1CFPA 1X1RA 1IY0A 3TW8B 3SYKA 3RRNA 1RE0A 1G9XA 1GDDA 1TPZA 3AAKA 1AJEA 1UDXA 2RGNC 3C41J 2ZAMA 5GJWC 3QF7A 4IFEA 3UPUA 2CHGA 2QACA 2XJ4A 3C5CA 4OCIA 2YOGA 2J1LA 4TMXA 3CRVA 1JPJA 3U3KA 4R1EA 5G08A 1BOCA 2CCGA 2ZE7A 4H9GA 2V3CC 1KQMB 3HPQA 4HYYA 2FMXA 5BQ5A 3TJZA 5JSZA 2ZREA 1GJYA 3KTAA 3PITA 3B5JA 2ZR7A 5HCNA 4LV6A 1Z3IX 1U5IB 2J0SA 5C4GB 1U0LA 3NHAA 3NKVA 4E68A 2CNPA 1N6NA 1W1WA 3K09A 4E22A 2HYIC 1DE0A 2H16A 2YKGA 5JJIA 3AKEA 4Q1AA 1Z0DA 2A5JA 2G1KA 2W2XA 2C99A 4BZXA 2BBMA 3C14C 1UADA 1YX7A 1X86B 3IQXA 1IRJA 1NVWQ 1US8B 1T6NA 1B7TZ 2M3WA 1VTKA 3DDCA 4TQUS 4NYJR 1NSHA 1EFTA 4FD2A 3CRRA 1GRNA 5FOWA 5KOYA 2XOKD 1PVOA 2OXRA 2Y8EA 3NDPA 2H5EA 2F2PA 3ZS9A 4C0JA 2AMIA 2ZYTX 4ASUD 2DCUA 1Z06A 1HQYE 3GLFA 3EA0A 4JS0A 2ZI3A 5FYXA 3B1YA 4MA4A 3GJ8A 3U3RA 1QVAA 4YGCB 2RB4A 4C0KA 2ZJ8A 3SG3A 2IW3A 2VHUA 5A5GA 2LLUA 1YRUB 4NDZA 1ETUA 3RS3A 3V4FA 2R6CA 5A0FA 2VP6A 2BMJA 2RH5A 1TQ2A 4ORCB 2F43B 2HEIA 2VHTA 4US0R 3UIEA 2ZRGA 2F3YA 2IYXA 2ZAOA 3BUWB 2ZSEA 2M49B 1SVSA 3OHMA 1JR6A 5DYIA 4FN5A 1RWYA 1DF0B 3RDPA 1TU4A 4CIDA 3QXCA 4BFYA 1ZD9A 5HLVA 3FMPB 4NYIR 1S5GZ 4GSYA 1MO4A 3C16C 4HB3A 4DLSA 4F4IA 3TUYC 1CIPA 3PQCA 1TQDA 3K0FA 4FMCF 4TLBA 5ANRB 3PG5A 2BIFA 4CT5A 4RD0A 5L3SA 2EFEB 4URXR 2G9BA 4OK3A 1E0AA 1NIPA 1BIFA 3LXXA 3TVTA 4GNKB 1K96A 4EAQA 1FBVA 3B85A 4MKFA 1RTP1 3VNUA 4UNPA 2F9MA 1M6NA 4LWZA 2M0RA 3CNOA 1KI4A 1E2HA 1QIWA 1TNWA 2QP9X 3EZ6A 2ISDA 1G5RA 4ACAA 3MJHA 3P20A 1EXRA 4JLNA 4QBIA 4UQOA 5J4YA 2TMKA 1GNQA 1LV7A 5AFPA 4EQ6B 1AJ4A 3ONWA 4MYHA 4QGAA 4PHMA 3ND8A 2LMTA 3PIRA 4KSBA 3WP1B 3JVTC 2C9CA 1OLOA 3Q72A 2ZN9A 4PHJA 3PENA 3UWKA 3IKJA 2QNRA 3K21A 1DPFA 1DVRA 4LHWA 3KKQA 1J90A 5E95A 1DTSA 4M1YA 4GMDA
chains in the Genus database with same CATH superfamily
1GZ5A 1T9AA 3QQPA 1T36A 2Y05A 1U8ZA 2C2KA 3VSCA 1RHMA 3EAGA 4AY4A 1PNVA 4EPWA 3E48A 3HKEB 2W58A 1VCMA 2GN4A 1W6RA 2R6JA 5C5EA 1GZHB 1OI7A 2WFMA 4DIOA 3R5KA 1EFPB 1Q1NA 4B3TB 1HM5A 3DV9A 4PGHA 3MN1A 2ZYGA 3Q15C 2HN9A 2HF8A 2PAFA 3WDSA 4F06A 3ER8A 2B4RO 4OA8A 3TR6A 1XZNA 2L69A 5BYJA 3UJBA 3OPMA 3OZTA 3H2BA 2HMSA 4CLHA 1U8CB 3A4IA 4HQFA 3ZHTA 2Q07A 3GQBA 2O3JA 4I66A 1GQOA 4R2IA 4L0CA 3HM9A 3ENQA 2EFHB 2Y71A 2V55B 4RHUA 1DTWB 4BMOB 4LBYA 5LIPA 4E3ZA 2IITA 1R12A 3PQ5A 4ZVLA 3KP1A 5U9CA 1Y1RA 1PJSA 1Z5NA 5CIYA 3OP4A 4C04A 2RGGA 1J33A 2GEFA 4WOKA 2HMYB 2H9AA 2PSRA 2V9CA 4M1WA 1A9TA 5CVUA 2F8SA 2HO4A 1M33A 2DKNA 1SFRA 4BVHA 3A32A 4JOCA 4MQMA 5HKOA 2XMBA 1MVOA 3FROA 4PWYA 3ZX4A 2I03A 4HWPA 1W4LA 2LCQA 4NEHB 2HT6A 3NTOA 1DKRA 4LEIA 4OXKA 2R85A 4G8CA 3HB9A 1JLLB 2IE0A 2V7QA 2ACEA 3EMDA 3VKHA 4AY5A 4DCNA 1UT5A 3SCZA 1P9RA 4I08A 3K1YA 3BAFA 1E4YA 3BRWD 3AHCA 1ADYA 4N3BA 2IH2A 2PXCA 5AK5A 3DE5X 1WAMA 5AEQA 3K0CC 4MRRA 2XT9A 1Y4DE 3VR5A 1SNLA 3ENNA 4K86A 4B0PA 1FFHA 5CT5A 4MIOA 2C9OA 2GGMA 4WADA 2L5XB 1BMFA 1UZLA 4QNNA 1K7YA 4JBLA 1XSEA 2NG1A 4BECA 4NJEA 1L5ZA 4QREA 3AWDA 1BJKA 2NWQA 1E7QA 4CMEA 3IPYA 4RPLA 4AZWA 1TO1E 4FNGA 4YGYA 1WY5A 1LPBB 4C21A 2JLBA 4ITRC 3HCWA 2UV8A 4LOLA 1M2VA 2WZBA 3TZ1A 4B71A 4YMTA 1FNNA 4FOOA 2WTAA 4XQEA 1E1QD 3DTVD 2HBYA 1A71A 4HN4B 2CZQA 1PRWA 2G63A 2F48A 2FXVA 4NPCA 1R37A 4HLQB 4HDNB 4E1AA 2NACA 4M9QA 5EPOA 3BHNA 5JQGF 4OHPA 1IHOA 3O8OA 3F5FA 4PRLA 3OQIB 4H1VA 3JRNA 4HDQB 1BDHA 4WDQA 1B41A 5D51S 3X1YA 3ZQ6A 4IINA 4LJ9A 3M81A 3MW8A 3OMXA 1O54A 3KAKA 1D6NA 3K2IA 2ZPTX 5FV7A 4KFUA 2AQIA 4NDDA 1Q1QA 1ISSA 5DK6A 3ZW9A 3AHIA 1ZHOA 2A9QA 2H9YA 1M7BA 4RO0A 4P5PA 4CLRB 2W70A 2PQ6A 4OKIA 4LYGA 1U2QA 3VR4D 4R1PA 2HR1A 1J0DA 1C7RA 3FI0A 4CDNA 1Z4LA 4D46A 4EHHA 3EPRA 1EDOA 5DWQA 3PNSA 1WHSB 3TNDA 3JQ7B 2VA8A 1T4GA 4X0EA 2Q21A 3DBVO 3DPUA 2IPAB 2YXDA 4FFMA 3OU2A 7YASA 1O58A 2XNSA 4L8YA 4H6WA 4U9HS 3A4LA 4GWKA 4CR7A 2DLDA 1K2WA 4DLZA 2J30A 4NV3A 2VPWA 1U9JA 5ALDA 5IJWA 1B0ZA 2IYQA 2IKQA 1ZVVA 5EIBC 3HCPA 1TJ5A 1K88A 4TN5A 1VYHA 1KK1A 1IEVA 3I37X 1U2GA 2BGUA 4B4UA 2ECOA 4LNUB 4TGLA 3LCRA 4I1VA 1LVCD 1M8JA 4D9MA 4XYLA 3DMTC 4XGRA 1AIPA 4ED9A 1CWUA 3LD9A 2VWQA 3GN1A 4RCYA 1J07A 4KREA 1NXWA 1V9CA 1P61B 1BWRA 1QGZA 4JASB 1X1CA 4OKHA 4I50A 2QIOA 4LTMA 2N75A 2XXBA 1F4VA 4NHEA 4F85A 1MPTA 5F5LA 1NWCA 3OI7A 4PGFA 3GFPA 4FU0A 1M8PA 1XTBA 2AEEA 2GN2A 2ZIVB 4N5XA 3TSWA 4A1FA 4PZAA 1EP3B 1ODJA 2YYZA 3HH8A 2HIHA 4UOZA 3ZCPA 1QONA 3CEJA 4AS3A 1KXZA 3BF7A 4QSHA 5C7OO 4AJNA 4BL5A 4M38A 5HUHA 1VZ3A 1VGVA 4MUGA 4XX1A 5JASA 1DDOA 3PSHA 1NSTA 3IJRA 2XCOA 2MJWB 1D2NA 3RS5A 4RDHA 1YQWA 1TYAE 1O5OA 4CKEA 3EUFA 3F6CA 2HUNA 4ZU6X 4Y3UA 4Q6BA 2NSDA 2R5WA 5KYXB 5JXHA 3DE2X 1IB6A 3CV3A 2PHZA 4S0ZA 4ALLA 2D8AA 3AR9A 2H1OA 3GARA 3V6MA 1QHNA 3SU8A 5E8RA 2FZEA 4H4EA 3IR5A 2FF5A 1T8TA 2K6GA 2GAJA 1N0YA 3VR6D 1WDKA 1XQVA 2EGDA 2H4WA 5CEEA 3Q8WA 3BGIA 1WU7A 1HQCA 3OM8A 4BKOA 1MJGA 3P9IA 3BFHA 1SHKA 2FN8A 2W2PA 3A2LA 1PUJA 4PPYA 3UKOA 1FUKA 2AG0A 2ODAA 1JEJA 4Z0HO 5GZ1A 3ZBQA 4NEQA 3K4PA 4JD5A 4YJ2B 4UHFA 2C2WA 1E0SA 5D86A 3LKVA 4Y9SA 2OD2A 2CHEA 3PQ8A 2P9JA 1NYTA 3UPTA 5HPYB 1H0RA 3UAVA 5DM70 2FWPA 4P2YB 2SHKA 2D4HA 3C8UA 4A7PA 2INGX 1LS8A 3SC4A 3HJTA 721PA 1KEPA 2LCFA 3AOEA 2IW1A 3FLEA 2D8MA 4S1TA 3RWMB 1M66A 1RYBA 1LC0A 1MT0A 8AT1A 1V7CA 3GFRA 2XB9A 3KEVA 2F1OA 3IDQA 4QBTA 4XJKB 3TMAA 2JQ6A 1W25A 4FZ5A 3AI2A 2NSHA 1TCCA 2H65A 5FPHA 3FWHA 2IGTA 5FUWA 4Y2TA 1WO8A 3LNCA 3GCZA 3IMKA 3SNKA 1BXRB 4PIPA 5AM4A 2FSVC 1FTNA 4PYLA 5AKZA 3I6MA 1PS9A 3CO5A 1UJ2A 1XC7A 2QHXA 4I6GA 4G8BA 3T3OA 5MDHA 1PWZA 5DBIA 2R8BA 2RHCA 1DO0A 1YC5A 1C3OB 2DTEA 1K6MA 4MWGA 3GCGA 2BSXA 3S29A 2SCPA 4JT8A 1HNXB 5CT6A 1EINA 5LOVA 4R8RA 4JBIA 1GTJ1 5JNLA 3MSEB 1M34B 3LCMA 1C9KA 2EKQA 1CLLA 4DXDA 4HMOA 2QZ4A 2FUEA 3EXFA 2QSYA 5AOAA 5FPSA 2BZGA 4K6KA 4UTRA 1G2OA 4PDZA 2AZ4A 4IKEA 3LT2A 4ND8A 3VOSA 5CM2Z 3ZVKA 1WMEA 4B09A 1GWNA 3ILHA 3WYNA 2Y1GA 2I55A 1NULA 2YASA 3L7AA 5K2MA 3RUPA 5JYEA 1LDMA 4BO8A 3AOGA 5ILGA 4NECA 2QTHA 1RRKA 3DNFA 1E3QA 1UKYA 1PGJA 2GEDA 1G3MA 1UR5A 1PGQA 5AJHA 1DBPA 4RUKA 1YZVA 3QU2A 3PUYA 3C4VA 4KQ2A 3OJFA 4BLWA 2F8TA 1FLVA 4P92A 3GJYA 2RHJA 2D0DA 2C4HA 2EJUA 5D84A 3L01A 4JT2A 4JKTA 1UHJA 3M4YA 3CLRD 3IX7A 4YQZA 3EPPA 4YJGA 4IZIA 3H7AA 1ZGZA 3F71A 1JKJA 3DT9A 4JI2B 4UFNA 2H4XA 3J7AC 1GPMA 2R7LA 2J3DA 5EEHA 2A14A 3RUHA 4I4TF 1QU3A 2VXOA 1ULZA 4PC1A 1U3CA 4EW6A 3SM9A 2DX7A 3DE7X 4YY3B 5G1NA 2QMOA 3KDAA 1M34E 1WQ4A 3F9RA 3SG2A 3QYPA 2HU5A 5B58C 5GONA 2KHZA 3ZE1B 4YWHA 3TNYA 1CR4A 3CGGA 3VYRB 1VLHA 3TBFA 3W9SA 4AO6A 1Y4AE 2ZI5A 2Z2ZA 2PRKA 1K4YA 2FW6A 2NMVA 1JU4A 2Y99A 3Q87B 3DBHB 1MX3A 2RHTA 1H6DA 4M1KA 4YV0A 2X8JA 5AXCA 3L6DA 4YXFA 3II6X 4Z3DA 1KZHA 3TNJA 1GR0A 5EI5A 2EKDA 1Z5UA 2NO1A 5AUNB 1WRLA 1ND5A 2O5VA 5FO0A 4KQXA 3BWXA 3TTYA 3T34A 4KUEA 1HQDA 5A7FA 3GJZA 4QJ3B 5AJUA 2XVYA 4Z0TA 5IXSA 1ZFNA 3ICCA 2EAUA 5I9TA 5C31A 1U2DC 3JVUA 2ACVA 1RQ7A 3OJLA 1KP9A 5M2QA 2YJ4A 4W1QA 3U80A 1DX9A 1O87A 1D4OA 3HNRA 4Y6PA 2YYYA 5C1IA 4D4MA 3AF6A 3DJFA 2BM1A 2HD4A 3W6NA 3ROMA 3RTDA 2Q3DA 3FXAA 3KFXA 4TUYA 2HK6A 4AD8A 3NU1A 3ZU2A 2OFPA 5CA1A 4F0JA 4A36A 3FCAA 4NBNA 3Q4GA 2WU4A 2FPWA 4A2QA 1HL7A 3LT0A 2H1FA 2DQKA 4WXHA 2XD4A 1RWVA 4C7KA 5IYZF 2PCJA 5IHPA 2C1ZA 1FFAA 2ZS8A 3W6ZA 3QJYA 4ILEA 3OX3A 3KCNA 3ONFA 3LXMA 2TSYB 1KR5A 4LE2A 2RAPA 2CNBA 5KNLA 3A6ZA 1H2RS 3LLMA 1X7YB 1JNYA 2JK1A 2QN6A 3IEKA 3UWSA 1Z75A 4BMSA 4FYJA 1JG3A 1CQJA 1SKBA 5CK4A 4ZT3A 4MRVA 3OJEA 4JEUA 3Q7QA 2VDWB 3ETCA 4UMEA 5KREA 1XQWA 1JIQA 1DMOA 1PAUA 1WP4A 2C4TA 4UBMA 3LSYA 2QF7A 1X8JA 5TE9A 3D8HA 2VYVA 3UTDA 4II3A 3CGWA 3KZVA 3C98A 4XJXA 4V1CI 2IS6A 2G5GX 1G33A 4RFSA 3IKLA 4NAVA 1ZR2A 1HZJA 4D8TA 1Y82A 1MJNA 4OJTA 2AR0A 2Q27A 2FPPA 2ID8A 1Q3TA 4Q01A 4YALA 1GQYA 4Q9JA 2GZDA 5L7YA 4RF2A 2YX1A 1P1JA 1RQGA 1ZD2P 3EGVA 3WWOA 5KDOA 1II9A 5JNUA 1OFGA 2IHUA 3GUYA 3OUUA 5CUQA 4IWNA 1R4MA 4RJKA 3REGA 2XQGA 4J7UA 3KHKA 1QH1A 4G0OA 4RV9A 6REQA 1U9IC 3GPLA 3LUAA 4YI3A 3OZUA 5FBHA 2O0MA 3KUDA 1PG2A 4R2LA 1N5OX 4Q1CA 4QT4A 5LZ8A 4FEYA 3V7UA 2QRNA 1JAYA 2XYHA 3FPBA 3CLSC 2PVPA 2H1VA 3V9PA 4RHCA 3BMCB 2XITA 4GLLA 4MP3A 5AHXA 3M4JA 3PFFA 5BN5B 2NYVA 1M76A 1JJFA 3O8BA 1TNDA 3S8MA 5KC8A 2P0EA 3FIAA 4I9NA 3EF0A 4KXUA 4Q12A 5FWAA 4DQKA 3T9DA 4FLMA 3U2QA 1U7DA 1ZSYA 2IF0A 1U65A 3NBKA 5KNBH 5ES4B 4OX9Y 4Z1MD 3G5MA 5HGXA 4MV7A 4FINA 3H97A 3HL0A 3BHIA 3P9KA 5J5AA 1EVEA 3LXUX 4ERNA 1N3YA 4DQDA 2CXTA 5GINE 4UMFA 3R7LA 4YRTA 2PUBA 5GM2A 1Z4PX 5C18A 1E3LA 3OLZA 3ACDA 2QTWB 4GE3A 2WAXA 1ODTC 4AX8A 4CUJA 3SEFA 2AC4A 1X7WA 5LLTA 3H2ZA 1W5SA 5EHQA 1SEPA 1XMOB 2QZ9A 3ZJTA 4BGVA 4WEOA 4JU9A 2VHCA 1WXHA 1P2DA 2XHEA 3EZXA 4Q3NA 3ZHXA 1T24A 3ENKA 4GMGA 1NURA 1YQTA 1GU7A 5J5CA 4BPBA 1BVHA 1RQRA 2VRGA 2KPOA 1MEOA 2WNDA 4NWIA 1E7YA 2I2BA 2MMGA 4P54A 2H29A 4FHCA 4R9VA 2WJGA 4M0KA 4IOJA 2DHRA 3MTBA 3N2NA 2DUWA 1VIYA 5MGNA 4MGZR 1SB9A 2CDRA 3PDCA 3FWPA 1ZC4A 3TW8A 4WLVA 4J3JA 3UNWA 3ON5A 2O3TA 2J4CA 4KBGA 1U8XX 3NJ4A 1J2EA 5TX7A 2KX7A 2ZROA 3EIUA 1NYRA 1A8UA 2O7NA 4JQSA 5TT0A 3IMCA 3IDAA 5EJEA 5KOHA 4O1IA 2PSJA 1US8A 3C87A 1R9GA 4DCTA 3BXZA 5DX1A 5I51A 4Q3LA 4LZAA 1Q12A 1LPNA 4EKGA 3PQ2A 4O4JB 3ADKA 3CR5X 4TS1A 2O2SA 2GNPA 5CDHA 1IMJA 3V4OA 1Z07A 3RODA 4C4AA 1OUMA 2EVWX 4RU1A 4G0YA 4EPXA 1ZQ1A 4X63A 2Z8YA 4D4LA 3U4DA 1EX6A 4MS4B 5A9SB 4F5YA 2OCXA 5IT4A 3KLNA 1H42A 3V42A 5FNZA 2LDBA 5FEUA 1C0PA 2IV3A 3ZC3A 3EVEA 2C7VA 3KPWA 3I6ZA 1NOIA 3Q1KA 5HCNA 3LZ6A 4AJ1A 1WNTA 4MTLA 3ROZA 1G5FA 1AA6A 4RK1A 3RBVA 1IRJA 2FW1A 1VTKA 1W5AA 4NYJR 4URHA 1R50A 2AMIA 4R1SA 2QDKA 3TG8A 4ND1A 4ARUA 3FTFA 2LLUA 1YRUB 4AF6A 4H7EA 3RS3A 2D1SA 1TQ2A 3VNSA 2ZRGA 3E1GA 2J09A 3JQ8B 2CB0A 1DF0B 2A84A 4FT2A 1IIRA 1C4XA 3S8YA 4CT5A 1PR2A 4HNHA 4URXR 1DHTA 4MCHA 1WOMA 2CXHA 4L5JA 1E2HA 5KCMA 5J4YA 1LV7A 3C3EA 4XOUA 3WIEA 4J1QA 3YASA 4Q15A 2B1IA 2WM9B 1RXCA 2WUDA 4IX9A 2DBZA 2YHAA 1XHEA 3NNSA 4YCNA 4WBNA 3E7FA 3LV8A 4MB2A 2IEGA 3Q3GE 4A15A 4TWIA 3A3NA 4GZLA 4N1AA 5ELLA 1K90D 1JJIA 3S2EA 3U31A 3K1AA 3FYUB 4BWVA 2JAXA 1USWA 4HK4A 1AZLA 4ZHQB 4PGAA 3QU7A 1IPFA 1UBTS 1PZHA 3A9WA 5M5BA 4FQOA 1DIOB 3AETB 1HUQA 2G7ZA 2DUMA 3S0FA 1P0FA 1H3NA 2FUKA 4NMMA 1X02A 1M1NA 1XMJA 4WJZA 5A5FA 1W88A 3VC3A 1MV5A 3WLKX 4LGVA 5EXPA 4CTNA 1Z8DA 1Q84A 2NZXA 3LWDA 2GHTA 4ENUA 3WGHA 3TD9A 4CBVA 1CDOA 4QFMA 1TI7A 1O89A 1J0EA 2CD7A 2GZHA 2ACKA 3QPBA 4ZCTA 1M6VA 1U3VA 3PA6A 3Q5EA 3MIZA 1PWEA 1H22A 4Y6QA 4G5SA 4XAQA 3HCFA 4BMYA 5JANA 3ISTA 4YRPA 4Y2VA 3UK1A 1SQFA 2D13A 3OIDA 2ZRIA 2OCDA 3UHOA 4H27A 5BVGA 5LQUA 3Q3HA 1UAYA 1E1CB 4Q04A 4YRUA 4R16A 4QJIA 3CONA 4NNOA 1AGPA 4OR9B 1MEEA 1DC1A 3B52X 1I2AA 1FB5A 2YNMC 3FDZA 4J16C 3TAXA 1D4FA 2AXEA 1E2UA 4L15A 2CUTA 4A5SA 5DOZA 1IBRA 4G1MB 1N6OA 3OTGA 4HAXA 1J39A 3RFVA 4AKIA 2XYPA 3HY6A 2ASEA 1I24A 2ZIWB 1PVAA 1ZGJA 2PGJA 2I2WA 2D2XA 1ZCJA 4L75A 3LY8A 2XGJA 1VKJA 3W3AD 5KCZA 2BCBA 4Q4AB 4LA4A 4GC5A 4JXXA 2HTEA 3WNCA 4L78A 1GPKA 4HEA1 1Z0AA 3DBRB 4POAA 5LQMA 2JGFA 5H5JA 1QNFA 1TZMA 1K86A 3VDXA 3ROFA 3PGVA 1QCYA 2E4YA 1H4BA 5IUJC 1FX1A 4B3IA 4R9NA 1TNXA 1DJMA 3F47A 1JG2A 3VQTA 4N6OA 2GAOA 4JJ7A 1E5VA 2QEOA 3L4SO 3E53A 3WRWA 2BMWA 1VG8A 3ERCA 4J0GA 4ITUA 4LYDA 1G63A 4AQDA 4TSRA 3OCUA 2ETVA 3QP9A 4FBMA 3T5BA 4NMWA 1CUYA 4L2IB 2H0RA 5CRIA 2H57A 4D9HA 4EL0A 3KLMX 5E6RB 1U8AA 3OPNA 1M2WA 1SIBE 4BUZA 1QO0A 2VJAA 1TRKA 4DMMA 3GT0A 2B8EA 2O0HA 1CUZA 4CFRA 4QGFA 1VRWA 4PU0A 3HGTA 5F98A 1SGWA 3DZHA 4DM3A 3D7SA 3MLEA 1M73E 1P72A 2JFWA 2OPHA 3FTNA 1CR2A 1LBTA 4BNLA 3TEMA 1OVMA 1DCTA 3DOUA 1D6JA 1R6BX 4OQMA 3PFNA 5ALQA 1FF9A 4BEJA 4QYIA 3PZRA 4FOPA 3QV2A 2Z08A 1PJ4A 4M1SA 4XIFA 2C0CA 1X42A 3EEFA 2LLSA 1E2QA 4PTZA 3FWZA 1IC6A 3JATB 2A2ZA 3R1IA 5E38A 1OXXK 2B20A 4QYXA 5A03A 3IJPA 4KZKA 3CZ9A 4QYSA 1X8XA 2PZGA 4B2PA 3BRCA 3HGQA 1I1QB 1BXGA 4Y2RA 3T9FA 3O4YA 2PX2A 4OKSA 3T1QA 5JVDA 3IHWA 3WIUA 3D5TA 5KZMB 2X9QA 1LVHA 3DZBA 2D5AA 5CEJA 1YS4A 3LP6A 4QEZA 4PR0A 4Z4FA 2YIDA 1QHHB 4N03A 1KFXS 1BLQA 2GNOA 1UAAA 4AJJA 4DR1B 2DQYA 1BX1A 1E2KA 5JYBA 2C2OA 3WADA 5TR9A 2DEUA 3T3MB 3E3LA 2R1VB 2R8OA 3ANTA 4RPJA 3HCMA 4TTIA 4B47A 1G64A 2W4QA 3VAYA 4FJ0A 5JZSA 1ZM4A 1DLIA 2HF5A 4KQJA 4FFLA 4A27A 4YMVA 2P3SA 1AVTA 3KL4A 5LYJB 5K6AA 1GD1O 1RJEA 4LRXA 1UUSA 5AVTA 2BTEA 1ML4A 1E5LA 5EP2A 2GBGA 4M7OA 3NONA 4K9OA 4W8GA 3NXKA 1T9BA 3FPKA 4ZDJA 4OG2A 2XCTB 2BUAA 3CDNA 3TO5A 4QX6A 3EGIA 2GYYA 3Q2KA 3SC6A 4OP1A 1YTUA 1I1NA 4MQ6A 3JYHA 1VOTA 1UXKA 1N78A 3M2PA 4KO3S 2VO1A 4P22A 1IDN1 3IEIA 4ZO4A 4REOA 2REBA 4B3DA 2W5UA 1DAMA 4PSDA 1R2QA 1K9UA 3KF9A 2Z6UA 3B82A 3K20A 4OI1A 2VIIA 2HKIA 4JPZB 1PLJA 1JQKA 4BNIA 4NV0A 3SVTA 3PNVA 2XVAA 1TT5A 3EVBA 2FA9A 2IYRA 3O95A 1RE1A 2QN8A 1XP8A 4KBYA 3J7TA 4NNJA 1DBRA 1H9AA 2CHVA 3OT1B 2WTUA 4BFWA 2ZWVA 3NCHA 5IYZB 1T4MA 4RQAA 3C24A 1H2ZA 3UMYA 4LI3X 1U2PA 5FBKA 1JC2A 1SVWA 3LW8A 2O59A 2WPDD 1JJAA 3OHMB 2XUGA 4FIZA 1TFRA 2OK7A 5LCXA 3SHOA 3F3SA 2UXBB 3EGEA 1GZDA 3BJHA 3PNBA 3TGPA 2R1ZA 5ALYA 2YRXA 3VNQA 2C9YA 1S3IA 3VVMA 3ZWKA 5D3MA 2AEMA 1SQSA 4IF4A 4QBGB 4LYEA 4DXAA 2X0KA 4GW3A 5AO9A 3T06B 3FVRA 1CE8A 2A0FA 2FFBA 4HN2A 1DWPA 3D3JA 3P0RA 3M6XA 5CDFE 1Y8RB 4ML3A 3PXBA 3VH3A 1I2MA 3K70D 1R0WA 4CEHB 4MQ4A 4DCUA 1J2JA 5BSVA 4ARBA 5HZGA 3GK1A 2IBSA 5JJGA 3M89A 4ER6A 1D2AA 1RLTA 3HVJA 2ECPA 2IY7A 3GUCA 3O82A 4G89A 4DV7B 2XIQA 2FRDA 1M6YA 4LSGA 5JI2E 2G9VA 1JW9B 3QPUA 3N87A 1UJCA 1RC1A 4XQCA 5J9FA 1GKKA 2JLXA 1IHXA 3HDYA 2PNFA 3BK1A 4U7FA 3AAJA 2Z8XA 3TX2A 1PJQA 2PX3A 1ISIA 1EWYA 3IPXA 1DEHA 4WLFA 5H4HA 5U4XA 4OQPA 5E2IA 1BWPA 2BEKA 2PFSA 4QQ8A 3PHBE 1IY8A 3NOXA 1E69A 2PS3A 3DO5A 4FSDA 1RMYA 3WHLA 2JIZD 3T4UA 4DLXA 4MHOA 5EXEA 2REXB 4NDCA 2PUWA 4RMJA 9ABPA 4NVRA 1JF0A 6LDHA 3A1CA 3AR3A 2NXNA 4QFBA 2NZ2A 5BYBA 3GNLA 2YOHA 3IS3A 2YS6A 5FNVA 1W19A 3RR2A 2FQ1A 3BMNB 3HSSA 4TVBA 3T1HB 4N5MA 3VX4A 4EPTA 4ZODA 2BH2A 4XSHA 4CHTA 3HJGA 1R6AA 2HEGA 2BHSA 3QPWA 4LY9A 4QPNA 2JIZA 4GXNA 1QDUA 2O8FB 2AFRA 4RK7A 2PT9A 2GRJA 2FSPA 2X5KO 1ZM7A 4QJ4A 4EI2A 1YK0A 3AKCA 3ESRA 821PA 2WTMA 1EG3A 3OWHA 3RK0A 3AGQA 3LC0A 2QE7A 3T7AA 4C0HA 4EG4A 5BR4A 3R0JA 2C3UA 3FRHA 2F62A 4JI4B 5DGIA 3ZE7A 3IUYA 3G3EA 2XA1A 2WPNA 2H2WA 4LRTB 5LD2B 4PPNA 4J49A 1OFHA 2O8DB 5E6UB 2WIGA 1VRVA 4IOLA 4O25A 1QDEA 3FOBA 1M6HA 3UK0A 3H11B 3V9AA 1IBSA 5KWEA 4J7XA 2ZIGA 3RF6A 2N1MA 5AKGA 1QGED 4I9FA 4BTLA 3OWOA 4QJ5B 1C4KA 2DPHA 2WHPB 2G8NA 1Q7RA 2R48A 3K0AB 3AUSA 2XWJI 3O7WA 5FHRA 4A6PA 2AFIA 2FSSA 4D0GA 1CDDA 1EFHA 2PUVA 4DM4A 1AQU