4C0LA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one magnesium ion and mg:gdp (mggdp-miros)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
404
structure length
404
Chain Sequence
b'ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 120
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0lA03
2TN4A 2GZHA 3KKQA 5FL3A 1TTTA 4ILEA 4QHTA 1B23P 3BERA 4TMTA 1XMVA 4QJ3B 4HLUA 2QROA 2J45A 4YI9A 4KVAA 3P1JA 1II8B 1G1MA 3E2IA 1JF0A 1HV8A 3TS5C 1V1GA 3WRYC 4DIEA 3F0TA 4F0ZB 2F3ZA 3A1WA 3C4JA 3T5DA 3A1VA 1LW7A 1IJEA 2C8VA 1GSIA 3A36A 4QXAA 2IA5A 4CGZA 5A5GA 1LV7A 3LVQE 1SCVA 1VHLA 4A8JA 5HZHA 4HSZA 3B78A 1U98A 3DVMA 4Q19A 2WORA 1SGWA 2F9MA 2CJWB 5KNCA 5LB2A 3RNLA 1COWD 1UHKA 2YNMA 1FBVA 3W9YA 3KUDA 1MRSA 2WAYA 4EPVA 2A2ZA 2WCBA 1SK6D 5B58C 3H4SE 1XJ0A 1DVIA 4BE7B 4XD7D 1GAJA 1IRJA 4LC0A 5ANRB 3AB3A 1IH0A 3EG5A 4MH0R 4B3XA 4QFMA 4YMVA 4F4CA 3DL0A 4PHTA 4FMDB 2CK3A 4JLJA 4ZCVA 1E99A 1ELOA 2R65A 4ESHA 1P9RA 5FBRB 4EIWA 1CLUA 4NCIA 1OIWA 5JWRA 1N6HA 4U7DA 4LJAA 3PUXA 2QORA 3E70C 4QM6A 1HT2E 2NZ8A 3MLEA 3X1YA 2FE4A 2IEYA 3FTQA 1NVVQ 2E87A 2I1QA 1Z08A 4B71A 5G53C 4GBMA 2KBIA 2FSHA 2WKQA 5CSNA 3EKJA 4OKSA 2SASA 2ZI6A 1NMYA 3DOFA 1AS3A 3QJYA 4NPHA 1G7SA 1EX7A 3NSOA 1RJ9B 4PQFA 2QA5A 3VU9A 4NDCA 2V1UA 2W00A 5BN3A 3M1IA 1JB1A 1G8IA 1NX2A 4Q4AB 2H17A 2Q9AA 3ETLA 3KFVA 4N0EA 2IYTA 4Q66C 3X1WA 4PHHA 3TGPA 1TCOB 1I2MA 2G3YA 1GNQA 1XB2A 2A5GA 4QJ5B 5AFPA 2BM0A 1TX4B 1KI6B 2CE7A 2IS9A 3NTUA 2VPPA 3OF5A 5FR1A 2HT1A 2ZJZA 3LL8B 2QNRA 1KMQA 3DKPA 1QG2A 4GBAA 1G20E 3I4LA 4CFQA 1QHHA 2XXAA 4MYUA 1QJTA 3EASA 1COWA 1DE0A 4EFMA 1OXSC 4HDOB 2QQ0A 5K8UA 4GZMA 1GL9B 1U99A 4I1VA 3ICBA 4LV5B 2AKAB 4ON9A 1NBMD 1XCMA 4XD7A 4QL3A 1RROA 2HXYA 2ZJ5A 2PJRA 4LY6A 2D3WA 1CJUC 2B7CA 4A82A 2O52A 1FTNA 4KI0A 4V0LA 4G5RA 4AKGA 4Q9HA 5JS8A 4RD3A 2KWIA 2BOVA 2DBYA 3LWNA 4MRVA 1ODFA 3Q5DA 1RJVA 1TEVA 3O78A 2W58A 3I5HC 4LOAA 3K0AB 4V0ME 2Z43A 4U5XA 4X8LA 2WKRA 3L0PA 5KPDA 2MLFC 3B85A 4QG7A 1BT6A 1KCYA 3TDIA 2HV8A 3QKSA 4B76A 1XPUA 2ANCA 3T1VA 4AOMA 4ZO4A 2UZIR 3KUCA 2C03A 2QTVB 4XJKA 4IHQA 2WMNB 2L5XB 4JIMA 1DJWA 2I7AA 3GFTA 1EG7A 4B75A 1E2MA 2L4IA 2WBLC 1NIJA 4FCVA 3ZS8A 3FE2A 2FJUB 4UXIA 1WRKA 3VROA 2C9OA 3WHTB 1XZQA 2M29A 1XD9A 1KFUS 4IL1A 2C99A 2G88A 3CIOA 1KHTA 4ORAB 2WV9A 3AKBA 3UMRA 3ZZTA 3TZ1A 3Q9LA 1M6NA 2L51A 1Z83A 1SBJA 2LHLA 4HAVA 1D2MA 3B1YA 4KLNA 3A1TA 4WBSA 1QHSA 2CL0X 2QTHA 1YTZC 4BFYA 4C2UA 4PZYA 4PC2A 2CCKA 1NI3A 2A9KA 2JZIA 1LF5A 4JBWA 4D2IA 2FFBA 1QX7A 3CWGA 3WYGA 5KYKA 1CEEA 3TVTA 1S5GZ 4KFSA 1R8QA 3NSIA 1NBMA 2GZDA 4FMBB 4CT4B 1S6CA 4U02A 1PVOA 2BCXA 1N0YA 1SKTA 1IQPA 4NKRA 3C15C 4P32A 2G0TA 4S35A 4BY4A 1MO5A 2WJYA 5EE9A 1JBKA 4ORBB 3VX4A 4MDFA 2GHIA 3KX2A 4MA4A 2P5SA 2CLCX 3ZVMA 1E2DA 3TE6A 4F93B 2FFQA 4HREE 3IHWA 1F3OA 5IRCD 4JVMA 1EFRD 2OBMA 2LMUA 3BS4A 2DHRA 4MKFA 2LUCA 3EVUA 4OJKA 5HCNA 1KNXA 1YX8A 2OS8B 2VSFA 4TMWA 4XWKA 4WXPA 1QXPA 3EPKA 1ZW6A 4XSHA 2OSBA 1KSJA 1IJ6A 4PHMA 4KSBA 5G08A 2KBMA 2EVWX 1QHIA 3U60B 4KO8A 1ZCAA 2C78A 1XD2A 1DJHA 2P2LA 5D3MB 1FW6A 3SG6A 3GLGE 3B1ZA 2BBWA 1T6NA 3WRXC 4DUGD 5JJKA 3VR4A 3CWQA 1XYDA 2M1UA 2M7NA 4JQ0D 4LSGA 1OJLA 3I5IB 2GEUA 1S26D 2K7DA 1JEEA 1FQJA 4M9QA 4Q01A 2D4HA 4JT4A 4GGFC 2BBTA 3ZQ6A 2D7DA 2OPOA 2VO1A 3SOPA 4HRHA 2GRJA 2NLNA 3JVUA 1LS6A 4C7OB 1GIAA 221PA 1LF0A 2AK3A 2VHCA 3TKLA 3EIHA 1XTKA 3O6BA 2K8MB 1MUXA 1N0WA 2IT1A 5FUWA 5FUXA 2H92A 1P2TA 3ZDQA 1NIPA 1U9IA 4PO1A 5IT5A 3OHMA 1G7CA 2LLTA 1KO1A 4EJSA 1AVSA 1XEFA 2E9SA 4FIDA 1XTJA 1NN1A 2M49B 5IBWA 4NBSA 1DS6A 3U7HB 5G40A 2O0KA 2A3RA 2ZS8A 2PZGA 5JWHA 4Q9LA 5J4LA 4HLDA 3V4RA 4C0HA 1KJWA 2EYQA 5KSPA 4OI0A 3R7WB 4Q4LA 4LJ6A 3RDPA 2QAGC 4BFTA 2RGIA 5KTYA 1UF9A 1YZQA 1EFRA 3IIJA 2VH5R 3DPUA 2Y8EA 1Z22A 2BM1A 1G19A 3U44A 1TNDA 4OQFA 4ZDJA 1P5ZB 5G3YA 4EQ6B 1DJXA 1B47A 1U8YA 3H4MA 3PUYA 3AF0A 3QQ5A 1E4VA 4CEHB 1U81A 1CRQA 4B2IA 3BRWD 3WHUB 2IBMA 1YRAA 1K5GA 2YYZA 1SHKA 3CW2A 3NG1A 2WZQA 4Q00A 1IN8A 2R44A 1CIPA 2CL6X 2BMDA 1S1EA 3D0YB 3UPUA 2ZSAA 3H84A 2ZETA 2FZLA 2Y5IA 5C46F 2WWYA 1JXOA 4PE0A 2GEDA 3CF2A 4DUGA 4ASUD 2GCOB 1SXJB 3IHLA 4LHVA 3IQXA 3B60A 4P31A 3QF4B 1EXRA 3QVUA 5KNDA 2NO7A 1OXTA 1UKYA 3PVSA 5KSOA 3KKNA 4R2IA 4JLNA 3TIFA 2ODBA 3CRQA 1WDCC 1BLQA 2BE4A 1MR8A 5SZIA 1IN5A 2NOAA 2C9YA 3IPXA 1E4YA 2M8UA 2OBNA 1FTSA 5FUYA 1CJMA 3PN7B 1N0VC 5FOVA 3THXB 2VHQA 4U00A 3LO5A 3KKPA 1UBFA 1VIAA 4NU0A 1WY9A 1A82A 1CULC 5K89A 3I32A 5AEQA 1IN7A 1CJVC 4AQIA 1XTSA 2BMFA 4NHOA 2DB3A 1YR8A 4KU4A 4Q9KA 4ZIRA 1DTSA 2ZVPX 3FOZA 1F4OA 1LNZA 2HF8A 4LV8B 2J0UB 3QEOA 2IS2A 5J40A 4Q7JB 1GL7A 2GF9A 2GBLC 1F60A 2J0VA 3B2EA 3QF7A 4M4SA 1R7RA 2NCPA 1W36B 2WOJA 2CLSA 4JL8A 1XF9A 3GP8A 1BS1A 2F8PA 1F2TB 4RD6A 1J7KA 1E2GA 5CDFE 1DAEA 2O8EB 2VLIA 1VYVA 1KZGB 5SZKB 1XO5A 3WYAA 1XFXO 4BLPA 4DCUA 1AK8A 2ZYUX 5L3RA 2WWIA 1V1FA 1RRGA 1KDTA 2F6RA 4LJ5A 1NY6A 4C0AC 4OHZA 4F4JA 4JLVA 1EX6A 2VP6A 4ASUA 4PHJA 4AK9A 4IOKA 4P0TA 1GWNA 4US0R 4RZ2A 4TTRA 4WAUA 1NLZA 1U2RA 1QLSA 5EJEA 2JPTA 4A2WA 4ZDIA 3CR2A 3VMFA 1KQMC 5JEEA 2HQ8A 1TQ2A 4XJXA 5EXPA 1NWDA 1ZP6A 4Q1DA 1U0JA 4BASA 4ACAA 2A78A 1OOJA 1QV0A 3BFVA 3DOEA 4YDHB 5H70A 1XXHE 2ZAOA 3P27A 5LB4A 2BCBA 3QXSA 3CKLA 1UHJA 2Z6VA 3BAFA 3KJEA 3M0EA 2LVKA 3ONWA 2J0QA 2JT0A 521PA 2V53A 2WJJA 4Q04A 4IDOA 2PT5A 1SVSA 1S1MA 2O0JA 1OMDA 2PLFA 1WXQA 1EG3A 5JSZB 1AUIB 5HKZA 1GILA 3BUXB 1OXUA 4V0OA 5E3HA 3BORA 1ZIPA 3TR5A 4TYPA 1JF2A 3C14C 2FEMA 1D9ZA 4RKFA 2IW3A 2UKDA 4A8JC 1VG9B 1KSOA 3AF3A 3IBGA 5CJ2A 1VRKA 1DF0B 3SG2A 1JECA 1KMHA 4BUJA 4OHWA 4D0GA 5KDOA 1E1QD 3L0IB 4QBFA 5HPYB 1BR4B 3CM0A 2X77A 1HE8B 421PA 1E9DA 5AJXA 2ORIA 3KJGA 2KI4C 2ZS7A 3GK1A 1SMGA 1PALA 5AWFC 2Q3FA 2WJVA 1M45A 3ZD7A 4PZZA 4MRNA 1T3LA 2GETA 2P5TB 2WVJA 3BOWA 2IK8A 2OE2A 1LINA 2EFEB 4NDDA 2OXRA 2SHKA 4NCNA 1SQ5A 4MBEA 2RHMA 5EE0A 4PC1A 1YU9A 1YVDA 2FSGA 4DDWA 4PHKA 3MRSA 5FPTA 1R0YA 1MO6A 1TPZA 2ZRJA 4XSGA 4ZPXA 2XZLA 4FINA 1A2KC 2ZE6A 1JEDA 2LP3A 3FMOB 5CIQA 3RS0A 2FPLA 4LUCA 4BZXA 5FPKA 4HAZA 1L2OB 1OFIA 2MAZA 1QV1A 2C98A 3B8HA 4LK2A 2KGBC 4PALA 1XD8A 2GJSA 2ZE8A 4QBGB 5AUQA 5DE3A 3RS2A 2KI5A 3AP2A 3JVTB 1I2DA 1BYUA 2C96A 1Q1QA 2IF0A 2VTKA 3CRVA 4F7WA 5CK5A 1NUBA 2KHNA 3QRXA 3SHFA 3KQKA 1OYYA 2ZSBA 4PC7A 1FFHA 1S6JA 2JXCA 2KAYA 2EFDB 1IJ5A 2ATVA 1FX0A 2FSIA 4LGMA 4NP6A 2P6BB 2YC2C 1B8LA 2ZUDA 4A0HA 3GJ6A 5FPSA 4AY2A 4N5XA 3TUYB 1FNMA 1ZU5A 3N70A 1G5RA 4OI4A 3BXZA 2K7CA 5DYGA 4B32A 4GP6A 4JLMA 2M0RA 4TYQA 2BHRA 2ZRNA 4DSOA 4WZ6A 2GVZC 2WIAA 1E1QA 1ZVQA 3I61A 1Z0KA 2BVNA 1ZUZA 4MEWA 2J5XA 1R8SA 1KGDA 2ZE7A 1R5BA 1SNLA 4DC9A 3K9NA 2G9NA 4HDQB 1W7AA 3IIKA 3TAUA 4D25A 2WWHA 1YZUA 1WBDA 2QENA 2Z5FA 1SRAA 3OB1B 1OT3A 5F3WB 3PUWA 3UK6A 3GLHE 1RFJA 4HB2A 3SJAA 4Q7MB 3P4XA 3SBDA 2XZOA 5JRJA 2QT1A 1G17A 5EP2A 4A4CA 4KYUA 2K2FA 1F55A 1FOEB 5DN6D 3K70B 5F6TA 2F7SA 2Q21A 3CLVA 4JVLA 2HT6A 2YKGA 2KOTA 5IF9A 1WQ1R 2FMXA 3DVJA 1TN4A 4D4JA 2QM8A 1YR7A 3Q72A 2K0JA 2A7QA 2GEVA 3FFAA 4G5OA 4DSUA 2IUTA 4NONA 2IYRA 3LNCA 1N6PA 1F6BA 1XEWY 4NCJA 1PRWA 3B82A 5GJBA 3C16C 4URUR 4M1YA 4QGGA 1CJTC 2P6NA 2J7PD 3RWMB 2LLSA 2EW1A 3GLFA 4DXAA 2OAQ1 1MO4A 2ZJ8A 4MYHA 3RABA 2ZN9A 1ZOTB 2QI9C 2AFIE 4GOXA 2IWRA 4A0FA 1CFPA 1A2BA 3BUOB 1KDRA 2XZPA 4PC3A 4JSTA 3SBEA 1OE0A 1DO0A 2D62A 2EU8A 2FFHA 2LANA 2KB0A 3EIQA 4UNPA 2YOHA 3T15A 2PBRA 1OFHA 2MSCB 2V6IA 4Z1MD 1QHHB 1CJKC 1FI6A 3LXRA 5LDDC 4MYTA 1AN0A 2ZYVX 1XEXB 2XNDD 5F98A 1JPJA 1PZNA 4URXR 2QMEA 5CLLA 4URVR 1PVBA 2E6WA 2JDID 2DY1A 2WSSD 3MGCA 1W0JD 4FW9A 3Q7PA 5CPVA 4GGFA 1F48A 1YE8A 1YQTA 3NEJA 2FFAA 3IGFA 3EZ9A 3L8ZA 1W1WA 4DCKA 3X1XA 2EC6C 2OCBA 2ZE5A 1CLBA 3U6BA 4AKHA 1HQYE 3CNNA 5DN6A 1WB9A 3BK7A 4KSCA 4DEXA 3A6PC 3AKEA 2V54A 2NPFA 3U3OA 4XJKB 4JLDA 4WIAA 4FQOA 3BUWB 2D06A 2PT7A 2QPAA 1ODBA 3FB4A 3LRPA 1WA5A 4ZDKA 821PA 2MSEB 1KJZA 1T9HA 2CT9A 4Q18A 4D26A 1ZUIA 2I4IA 2A30A 2H1LA 2J7PA 2BKHB 3SS8A 2E30A 1RTP1 2QAGA 4W5WA 2QRNA 2XTZA 4F91B 3UWKA 1FL9A 1I4DD 2NO0A 4DLUA 1PSRA 2DOQA 5UKDA 1YVLA 3WP0A 5DHFA 3B1WA 5JFGA 4YGBB 4C0LA 5TY0A 2BIFA 3QXXA 4AG5A 2G6BA 3UMSA 1ZMZA 3OIYA 3RAPR 3GPLA 3T1TA 4B73A 1S0UA 1ALWA 1M7BA 3LK1A 3TQFA 1MO3A 4CVNA 4Z1MA 2ISDA 1AS0A 1LA0A 3WNDA 1F70A 2BL0B 1KK3A 2F43A 2MMGA 2VHJA 2Q91A 2YHSA 4TQ9A 2IWHA 2XNDA 4FWIB 3THYA 1U9IC 3F5FA 4I1OA 4B3BA 4DIDA 5L8VA 2QBYA 5D7FA 4M9SA 2JDIA 4LX0A 2M97A 2C77A 2WSSA 5FTMA 1NVUQ 1NSHA 1RRCA 1W0JA 4LBVA 1Q80A 1G16A 4GMXA 4RD1A 1Q22A 1NCZA 4L9SA 1BIFA 3HYRA 4PHFA 1N65A 2MMCA 4GNKA 1DVRA 2M9GA 5C1BA 4CPVA 1GZSA 1UDWA 4OQLA 1IY0A 1YJ5A 4JYBA 4LCBA 3RLZA 1JR6A 2FA9A 1XK4C 2JULA 1IXRC 1LY1A 3KTAA 1ZD8A 4TQUS 1DMOA 3W3ZB 4A15A 2O0HA 4YGAA 2C9CA 4DWJA 1K6MA 2ZEJA 3W5JA 1X02A 3JZMA 4NE2A 2V7QD 1CP2A 3H86A 5K8IA 2BKUA 3X1DA 1IGVA 3D7MA 5C18A 5K8TA 4DB2A 1XD2B 2W0MA 3CZQA 4L15A 4NH0A 4B33A 1JJVA 4MUBA 2ZUCA 2CVHA 4AKIA 1XCGB 2GBLA 2HCBA 3EAQA 1OH8A 3AVQA 3IQWA 1KK7Y 1EESA 2I94A 5JHHB 2REOA 5FBWB 5DGXA 2KBFA 2OFOA 1K8RA 4GDFA 1DGUA 3GJ4A 3KJIA 2I3BA 2VHTA 3SJBA 5FYXA 4DIRA 2ZSDA 3I1FA 4G5GA 4QRHA 1GRRA 4B74A 3NVAA 1M46A 3BQ3A 4AYTA 4QNRA 3CUEF 3EC2A 1W4AA 1S9DA 4OK5A 3SC3A 3OHMB 3RRNA 2IYYA 1T5LA 4EJSB 4RFSA 3LBNA 4DCVA 5TARA 3CR4X 1CTQA 3I8XA 1CBUA 5DKQA 3SNHA 1A5TA 3BWDD 2OLKA 2ODWA 3UKDA 3RS7A 4GOKA 3WMGA 2W2XA 4TTQA 5P21A 1A2XA 2HJVA 2JLSA 1J2JA 1BMFD 2ZI7A 2QSZA 3ASYA 4LYFA 4PE4A 5JLJA 4CEJA 4MRXA 4M1TA 2P3SA 2D8NA 2ZPTX 1OFUX 4Q9IA 5JBQA 3U44B 1ZNYA 3GFOA 1JFJA 2HETA 1KK8C 1W4BA 2KSQA 3MD0A 1RECA 2OZEA 4A9AA 3BXKA 1CB1A 1C1YA 5EZ5A 2I2RE 5SZJA 1Z6AA 4S2EA 5A0FA 3TH5A 3JVVA 1OFTA 1S3GA 3U3RA 3BH7A 1B0UA 5HLVA 2F55A 4Q1BA 4DZZA 2ZU0C 2JNFA 4PO9A 5CITA 5H8WA 3FPAA 5FFMA 2VSXA 1BG1A 5B8IB 1KKLA 4BEBA 2ZU6A 2QP4A 4R98A 3SU8A 3D10A 3IF7A 3EARA 4JJKA 3UG7A 5ER4X 2M7LA 4JKIA 3WP1B 2QPOA 2JNXA 4OQMA 1WDTA 4GOJA 2F3TA 4AQJA 5EZ6B 1CM4A 4WA7A 2PMYA 3KKMA 4OK6A 2VQSA 2XAUA 3F45A 1A75B 2OAP1 1FI5A 2MRDA 5J4YA 5LD2B 4QHSA 3EPJA 1N5KA 3RS5A 2O5GA 4BFWA 1NNEA 5TV2A 1G21E 1O87A 2ATXA 3QY0A 4LBYA 5FBQB 4EUNA 3KXKA 4CYMA 3QUSA 4XYNA 4JBXA 1LXFC 4I5KA 1VECA 3A4LA 3I8SA 3VR1A 1JAHA 2RCNA 4ZIRB 4Z51A 2OILA 3S1AA 3W6NA 2PLRA 3JZAA 4LJ8A 4B3GA 3AUYA 3K0FA 3A58B 2FDCA 1UBEA 1BMFA 3KQNA 3QXHA 1HA3A 1OH5A 3MUFA 3GK2A 4DT1B 4A6XA 3G82C 3PALA 3SJSA 1CFCA 1V5WA 2LMVA 4IEEA 4NYMQ 2BE6A 4C0KA 4OHYA 1VIYA 1DAHA 4W5HA 4EFNA 1HY3A 2CBLA 1XPRA 5PALA 1CDNA 3T34A 3QG5A 1FNNA 1NSTA 3SIBA 1P3JA 1T8UA 4GMDA 3KQHA 1C7WA 4XH9B 1JQJC 3PG5A 6Q21A 5AK0A 1OMVA 3ZVNA 3Q7QA 3VTKA 2BCJQ 4GAOA 1CS4C 3REGA 1IY1A 1XFYO 4QJ4A 3ZVRA 3CBQA 1ZINA 2HYDA 3U4QA 4M2PA 1RC8A 2B1UA 5BPJA 3LLMA 1PJRA 2KAVA 2IXEA 1NP8A 3QVVA 5HCIA 5JHGB 2B8TA 3GLIB 1QS7A 4E22A 1Z63A 1M8PA 1IM2A 1MABA 3NH9A 1AJ5A 5L3QB 1KK0A 2TMKA 1Q3TA 4LJ7A 1OQPA 1US8A 3BD9A 5FH9A 3I5GB 1G4YR 3ZD6A 5CYOA 1QATA 3V4FA 1B7TZ 1E6CA 4OHXA 3FWCA 4O2RA 2LWIA 3UANA 1EJ3A 3SQXA 2V4ZA 3I92A 2ERYA 1RYFA 4OK3A 2JC2A 1KI4A 4R7ZA 3VKHA 1J7QA 4Q48A 2O8DA 2J0SA 1Z29A 2BBSA 4CLNA 1ZMXA 1VYTA 4O25A 2C95A 2GAAA 2G1JA 4TLDA 2DR3A 1NX0A 4ERNA 5KSZA 1LKJA 4BLSA 2WC8A 3ND9A 4MVFA 4PSAA 1MKYA 3I3SR 5BYKA 2OESA 5TB5A 3GLIE 1E2NA 1R5OA 3NBFA 3A1SA 4DDVA 1UHNA 3M0WA 1G8YA 3LD9A 2QSYA 3QOFA 3RHFA 2J59A 1PVAA 2QN6A 1KMHB 5JOLA 2WOOA 3B6EA 4DDTA 4TWZA 3NH6A 3TUZC 2PCLA 2GJKA 3K0CC 4KLZA 5AUOB 4TN1A 1BH2A 2B7BA 4PTLA 4Q47A 1K95A 4II7A 1CKKA 1AQUA 1Z2AA 4Z8YA 4A2PA 1X3SA 1AJ4A 1L7VC 3CF0A 3ICQB 1QF9A 1II9A 3CR5X 1Z6XA 3EZ2A 4D0NA 2CXXA 2FNAA 2OS8C 1D2NA 1E2QA 4LV6A 5E95A 4G1UC 1ETUA 4M9ZA 4D4MA 3BOWB 1E8AA 2BC9A 4KXFB 5FTJA 1T0JB 2QP9X 2WPDD 3U2QA 2IS1A 3AKDA 5L3SA 4JJZA 3AM1A 2BCGY 2YWFA 3U5ZB 4QM7A 3LA6A 4BLTA 5DSZA 2QU8A 3BGWA 1KIMA 4OL0A 2ODNA 4DLSA 2ZRLA 3IO5A 2OLJA 3BB4A 1IY2A 3A37A 1NJFA 4JLBA 5DIFA 1JSAA 2MA2A 4JL5A 1AGRA 4B2LA 1Z3IX 4EPTA 3NBYC 1G6OA 3I5IC 1D5CA 2ZRGA 3OEED 3QKTA 5JEDA 1TIZA 1ZUHA 2JJ2D 4LRWA 2X8AA 1QIWA 1TEXA 4HAXA 2P0EA 4L9WA 3ZLJA 4JYCA 3I5HB 1IN4A 5TVKA 3TSZA 3IO3A 1DTLA 1MQ1A 2ANBA 2IYVA 2J7KA 4HZUB 4IVQA 3CO5A 3H1TA 2ZRFA 4GZLA 2LUXA 2L50A 2G77B 3QI2A 2JA1A 4NMMA 3U3MA 2J87A 1FZQA 2GWHA 1FX0B 1TU3A 3R9IA 1YRTB 1JXMA 5KHOC 3RM1A 3EPLA 4JZKA 1CTRA 1BU3A 1GJYA 3SFVA 3C1VA 3DHWC 5HE9A 1QDEA 2LV7A 2WWGA 4FXPA 2XJ9A 4ZCMA 1L4UA 3AF1A 4OR9B 3GJ3A 3OZXA 4BGDA 3VRQA 2HYIC 3WHLA 4WXRA 1LTQA 4TSFD 4CEIA 3LBHA 3ZZUA 4TL7A 3UMFA 1U90A 3L8YA 5DHAA 1CMFA 4PSVA 1ZCBA 2XB2A 1TCFA 1C4OA 1UHIA 1ZIOA 3PLFB 1AQYA 1T3SA 4HB4A 2ZI5A 3BC1A 1ZC3A 1IXZA 4DRWA 1XRJA 2VP5A 1J55A 1YX7A 4IDHA 2GNOA 1SL8A 4NYJR 4AD8A 1DARA 3CX8A 3KF9A 4CZ2A 3R9XA 3AVWA 2WPDA 4RD4A 5KOYA 4NCKA 1JR3E 1KZ7B 1S3SA 4LPSA 4P4SA 3GLFB 4DB4A 4AG6A 2JLVA 3SR0A 1G8GA 4MGIR 1ZM4A 1N5JA 3AAKA 3SG4A 4B3FX 4LHWA 1XZPA 4EPXA 1E94E 4G5SA 1YRUB 2ZKMX 1DO2A 4C3ZA 3ICEA 3FMFA 2K61A 1HT1E 3OEEA 2PMKA 4LBZA 2JJ2A 3D31A 5JS7A 1KAGA 2GCPA 2R6FA 2GF0A 4HYYA 3TUIC 2ZUBA 4TQAA 1XVJA 1XTQA 4B6EA 1XK4A 2KDHA 1KWOC 4E68A 2J9RA 3J81k 2VL7A 1LFDB 4DSTA 1X8KA 3THWB 2WJGA 1KO4A 2GAOA 2P6UA 5HLOA 3GQBA 1SZPA 2ZR0A 5HTKA 3CLNA 4WOPA 1GNRA 2WSMA 3DMDA 2QMUA 4K81B 4ORCB 2CTNA 3K0SA 2F1IA 4DLWA 4GUKA 1R0WA 2JASA 2VRGA 2ERXA 2ZREA 3HWSA 4TSFA 4W5JA 4OKHA 1SKQA 1KK1A 3G0HA 1YUUA 2AXNA 2ZITA 4B44A 1DAMA 1KTVA 4RVCA 1KO8A 4KAXA 5CM8B 1NMZA 1Q1BA 2XTMA 3QSYA 3CZTX 4YMUA 1OZSA 1W36C 1M7GA 3AVVA 4HZIA 2C04A 2F3RA 3VR6A 5BWMA 1FMJA 2YOFA 4MZJA 3NWJA 4NYIR 2FF7A 3RRZA 4L16A 1GITA 2ZJBA 1X1RA 3EZFA 4NZYA 4URWR 2LM5A 4QOSA 1I4LD 1C7VA 2ASEA 2V55B 3H0KA 3FGNA 2RAPA 4MKIA 1E3MA 1D2EA 1QVAA 1OE9B 2AMIA 1GNPA 3DZDA 3E5HA 1BMOA 1Z0JA 2NTYC 1TQ6A 4V0KA 5EE1A 1RKBA 1G7TA 5FOXA 2NZJA 1OZOA 3EPHA 3I5FB 2IYQA 2YV5A 1UURA 3QBVA 4LYHA 1G7RA 4R2HA 2NMVA 4PPQA 5IDVA 1N2CE 5EE5B 1TUIA 3T61A 1S96A 1AKYA 1XU4A 3SYLA 2HCJB 2F33A 2C5LA 3LQRA 3W3AA 3EKHA 5M04A 4U8DA 3OE7D 2QAGB 3IQQA 3TW4A 1SXJE 4KHZA 1N6OA 2BBOA 3ADDA 3AGQA 2JLRA 3FYHA 3TR0A 4O3MA 3PATA 1GM5A 2G0NA 3KJHA 5JJLA 4YDSA 1H8HD 3KB1A 3DF0A 4JS0A 3ZH9B 2A4JA 4R1EA 2X2FA 5KUTA 3QKRB 3JTDC 5L3VA 3AGPA 4Y0VA 3AVUA 3EXAA 4PAQA 1DT7B 4DS7A 1KI7A 5EP3A 2F43B 5JJGA 3AEZA 4KFTA 5FTNA 2XX3A 4QBHA 4P5OE 4N3NA 2QT0A 2V8OA 1H8BA 1HEIA 1G3UA 4JBYA 4R9UC 2QBYB 4LZZA 4DKXA 4F4IA 1Q44A 4TNCA 1GVNB 1R2QA 2GK6A 2XOKD 1Q3HA 1RJ9A 4ZI3A 2DFKB 4BLQA 1ZRHA 4RD0A 2GV5A 4MKHA 4E09A 3HJNA 3VRNA 2JRFA 1U8AA 4RSGA 2CNPA 3MWJA 3P20A 1W48A 5KU1A 4Q4AA 2W6ID 1A7JA 1XMIA 2Q3HA 3O8RA 3C5CA 3CS1A 1ZU4A 3GCGA 2ZROA 3CRW1 3GD7A 2LHIA 4V0MA 4WW0A 5FOSA 5EUQB 4TYNA 1E32A 2F1RA 4LYAA 4JPZB 1WRLA 4OYHA 4TMKA 2JTZA 2NIPA 2EGDA 3I73A 1XMJA 3MMPA 4H1VA 5G41A 3U6KA 1WCV1 1EG4A 4KFUA 2QMHA 3PV0A 1NG1A 2H8KA 4M1WA 4YI8A 1Y3AA 3MWYW 1SY9A 3M4YA 1KAOA 3TBKA 2PVBA 3PQCA 1R0ZA 3OE7A 1YZNA 2RGGA 4YC7A 1U5IA 1GRQA 1BOFA 1UPTA 2XSZD 2JXLA 1F4QA 1XEWX 1E2JA 2PJZA 1R5NA 5TXGA 4C0QC 3W8RA 2JLWA 4LHYA 4CFRA 2ZN8A 4I5LB 4BY5A 2G1KA 3KXLA 2ZFDA 4YMTA 1L2OC 5AJZA 1Y1XA 4B47A 4HATA 3B1VA 1ZYUA 1H8HA 2R2AA 3NHBA 1UKVY 2CLDX 4AURA 3BE4A 2ZJ2A 4ZCIA 2YWEA 2WWFA 1YURA 3EWAA 3SHWA 3UG6A 2JLUA 4PFSA 4UJ5A 2K2AA 2J3EA 1G8FA 1VHTA 1F8HA 4TYWA 5JI3E 2N1BA 1XBTA 4TLEA 4X8MA 1JAIA 4XIGS 1M39A 1GL6A 1LB1B 2BEKA 2ZI3A 3DM5A 3L0SA 2J1LA 4CT5A 3U3JA 3A4UB 1CNPA 3WMFA 3ZS9A 3CB4A 3LV8A 4RFSB 2XEXA 1ONBA 1D6JA 2IYXA 1YZGA 3MWKA 3P32A 1OIVA 2F2PA 2JJ1D 2XOKA 3FMPB 3TUYC 4Q7KA 1F2UA 2PMDA 4TTPA 2KBEA 4YGEB 3UWOA 3CGAA 1FMLA 1J99A 1SKYB 2W6IA 4CEJB 1AZSC 1QVRA 1BKDR 2COLB 4YBHB 2GILA 3AF4A 3LQQA 3RS4A 4IVPA 4M2QA 1WRBA 3FWBA 1IXSB 1N5IA 4KVGA 3MFYA 3O8DA 1W2HA 2AUCA 1X8JA 1RVDA 4P3YA 4XTCS 5E7MA 3T1OA 1EXMA 1T91A 1R6BX 1A1VA 3VKGA 2RHDA 1DOAA 2R62A 5J47A 3N2IA 2Y1NA 4LYJA 1S2MA 1EWQA 1D9XA 4KBFA 1ZUNB 5DH9A 4AYXA 3T5GA 3WYFA 1MV5A 4DLVA 5JCZA 1A4PA 3U7FB 2A5YB 3DMNA 5J4VA 4A0RA 2JEOA 2LKDA 2XSZA 1EH2A 1QX2A 3GLGA 1TTXA 1SHZA 3TJZA 2XGJA 3ADCA 3C7KA 5TDHA 4A8JB 2IUUA 2LVJA 1E9CA 1W47A 2HEIA 4Q4HA 1CR1A 4CIDA 2I1VB 1Z0DA 3SG3A 1JNYA 4GPLB 2N42A 3MSXA 3VAAA 3R9WA 3K0CA 5J5CA 3CR7A 2X19A 1T5IA 4G0NA 2WMOB 2ZSFA 4L9MA 3D8BA 4BFZA 4M2OA 3LX8A 1YRBA 2KI4B 1SR6B 1ZACA 1VKJA 3QEJA 1H65A 4X8OA 1E2FA 2BKIB 1W46A 2FCEA 2ZRBA 5DO9A 1DPFA 4GFDA 3I5YA 2JJ1A 3MJHA 5FR2A 2KI6C 3AKYA 1K9UA 5AERA 2PL3A 4HB3A 5HYDA 1TAGA 3SDZA 3HX4A 4JSYA 4TMVA 3S1AB 4KITB 2LMTA 3K0FB 3AH8A 4IKEA 4M22A 5D3MA 2YJTD 2FV8A 4MDEA 2BEJA 3RS3A 1XFZO 3AP1A 2IEZA 1ZNZA 1FF1A 4MGZR 2BECA 4OCIA 4PHGA 2G9BA 4YGDB 3NXAA 3VU9B 3RVBA 4E07A 3Q5EA 1J90A 1AJEA 4QBIA 1QRAA 2OBLA 2D2EA 3LW8A 1Y63A 1NKSA 5AJWA 2Q4UA 5CSJA 5G3ZA 3SG5A 2B92A 4DLYA 1XFVO 2FPKA 3R20A 3AVOA 4MUAA 4URYR 4QJ4B 1DBSA 1S5GY 1T3HA 3U4QB 1JWDA 2QUZA 4RKEA 1Z28A 1IHUA 2ONKA 1GKUB 2ZI9A 1E2KA 2JGNA 1MABB 4UKDA 3LVRE 1QIVA 1M34E 3FDIA 1QHXA 3TDZA 1J70A 1SVOA 3L82B 4BFUA 3PJRA 2XXAB 1US8B 5BXQC 2XTNA 2VP4A 2JQ6A 4D80A 5DNYB 2VEDA 1XP8A 3QKUA 2ZRCA 4BZPA 1VG8A 1TUEA 2ZRHA 1UKEA 3VNVA 2UVQA 1WLMA 3CH4B 2ZNDA 3CH5A 1RK9A 4OVNF 1W36D 3W34A 2OTGC 2O8DB 1XMSA 4IXMA 3O47A 3PITA 3V00A 2V9PA 4OI1A 4CEHA 1JPNA 4TL6A 2H61C 3B9PA 3PIRA 1Y1AA 1QHYA 1JFKA 1SCMC 1E2EA 1P2SA 1YR6A 2Z4RA 5DLQC 5GVSA 2O8FA 2ZRSA 2EFGA 1TQDA 1E0AA 2HDNB 2WM9B 4JLKA 5IK2D 1SULA 3QKSB 3SZRA 4GP7A 4Q1FA 3NBXX 3U7GA 1N2DA 1KNQA 1BODA 3BIFA 2GKSA 2ZJAA 1XTRA 2K7OA 2GCOA 4PE7A 3EA0A 2AL7A 4BEJA 5IHPA 1UBGA 3U3KA 4C30A 2W2VA 1E0JA 3P4YA 4WZBE 4OJQA 5I2LA 2CCGA 1U0LA 1J8YF 2IC5A 5FOTA 5CDFA 4US1R 1JI0A 2QACA 3C5HA 3K09A 4IDQA 2WICA 1Q57A 2AN9A 2WJIA 1RRPA 2NZ0A 4PCWA 3PUVA 4RZUA 1Z0IA 2YVUA 3ZZ0A 2GA8A 4EAQA 5GJVC 1RE0A 2BBNA 1NF3A 1B4CA 1TL7C 2YC4C 3HPRA 2IYUA 4PQYA 2FOTA 3SIAA 5B30A 3NC1C 5AJYA 4PAMA 5L3SB 1M74A 1UM8A 4FWTA 1VDZA 4MN0A 4GRAA 1Z5ZA 3NHAA 4LWZA 2KYCA 1NLYA 5I8NA 4MKGA 2NQ2C 1ZJ6A 2E1RA 3T35A 2WIBA 3QIAA 3P26A 3SN6A 1TNWA 3ZGXA 1U94A 1HT9A 2P65A 1XCPA 2VYFA 2H7VA 3ZVLA 3DVKA 3EVRA 5BYJA 4JVSB 3F3YA 1XXHA 1NVXQ 1G6HA 1S3PA 2REXB 3QE0A 4YONB 2EC6B 2O8EA 1Y6WA 4MZKA 3PEYA 5E4FA 1UAAA 3A8RA 1B8CA 2DWOA 3SQWA 1CMGA 5JJIA 5IK2A 2R9VA 1M31A 3KO0A 1E9BA 3OIUA 1KI9A 4PAOA 1X86B 1W7IB 3E3RA 3THOA 1P62B 1Z07A 1IWQA 1GGZA 4HSEA 5EXSA 5FBVB 4G01B 2NO6A 1B8RA 2FU5C 1J1DA 2JJ8A 1W0KD 5CM9C 1NBME 2ZRIA 2BKEA 1KFXL 2PCJA 1DAFA 4ETOA 5GQQC 4D6PA 1NCXA 1KI1A 4JWQA 4QNMA 3FKQA 5I2QA 4KYIB 5KO2A 4MLWA 1QASA 3OAAD 3VRPA 1CLMA 4KJZA 2XB4A 1N25A 1NL3A 1FQKA 4OQNA 2EFHB 1UUSA 4XVUA 2DYKA 3BOSA 3DM9B 621PA 2ODEA 4P4SB 4IOJA 1N6RA 1N3BA 4GGNA 1PUIA 1K8UA 1CM1A 4ZDWA 2ZNEA 5FL7D 5EP4A 4EPWA 1E9EA 2ZIAA 2LKCA 3K8YA 3OFND 4I5JA 3FFBA 1ESNA 1GP2A 3BFKA 3WXAA 1OKKD 2CBZA 4YRUA 1XFAA 1Q1ZA 1KDOA 4H1UA 3LX5A 3QPVA 3OP0A 1X1SA 3WNCA 2YOGA 2EWWA 2OFWA 4PPNA 5LD2C 1MT0A 4TMZA 1CU1A 1Z06A 1UBCA 2ZS9A 1EGAA 4PSKA 2O8CA 1NN3A 2AWNA 5EP1A 3GEIA 3TRFA 3V9PA 5D69A 4TZ0A 4FD2A 4RZ3A 2FPMA 3FHOA 2V7QA 3RC8A 3CRMA 1P60A 2ZAMA 5J4HA 1QZXA 4PC6A 2KSPA 1IONA 1K96A 3FIAA 2W83A 2QGNA 1W0KA 5AR1A 3EC1A 2AHOA 4YMSA 1CDPA 1NVVR 2GXUA 4LPKA 2YZ2A 5AUNB 2JWWA 1S9HA 1NRJB 4MRYA 1W2GA 1P75A 4O0MA 2P67A 5AXIA 2RKOA 3OAAA 4A1FA 2SCPA 3WXMA 3AVPA 4HAYA 1GQMA 3GFPA 3AP3A 3GLHA 3IBYA 4M21A 4PXAA 4UNRA 1K2HA 3BYAA 4Q4JA 4M9XA 2CNWD 1TNXA 5H1YA 2KYFA 2MLEC 1QG4A 2QL6A 3KKOA 2L0XA 2G83A 3UIEA 4N1FA 1VG0B 5FL7A 1RFLA 3NSKA 1Y1UA 2KI6D 2BMJA 2ZANA 3OFNA 4ARZA 1B1GA 3BB3A 2OXCA 1OKKA 1E69A 1R4AA 4HLCA 4A4BA 4D4LA 1Z6GA 3FVQA 1ZD9A 1WBBA 3CPHA 3GJ0A 2F3YA 2CHQA 3K53A 4XVQA 3I5GC 3I5XA 2KGRA 4AC9A 4AIIA 3B5JA 4PQRA 3TSWA 1P6XA 1VCIA 4PANA 4YLGA 1KK8B 3AVTA 4JMPA 1W4RA 3CPJB 4XOIA 3VKWA 2F2OA 1G41A 1L4YA 4MRSA 1TOPA 4RCZA 1M2OB 2WHXA 1HYQA 3DF0B 4A92A 4MYCA 1ZNXA 2CHGA 4GPTA 4M1KA 1E79D 2PZEA 2VF7A 2PEZA 5BN4A 5EE3A 2IX3A 1NCYA 5CYPA 4JL6A 3TS5B 3DD4A 3AVXA 1G4UR 4UJ3A 5HKWA 1YUTA 2HLDD 1G33A 1P72A 2BJWA 1EFHA 2FH5B 4HAUA 1G9XA 3RC3A 4TT3D 3W90A 5HR5A 4D0LB 4G5QA 4IXNA 4P4UA 5SZHB 2F1HA 3G5UA 2CL7X 4MRRA 1OXXK 5A4JA 4EDHA 1OXVA 2GCNA 3PFIA 5DI9A 1VCNA 1JUOA 4X8HA 3IKJA 3RYTC 2LVIA 1IQ3A 3HYTA 4Y0AA 4OHVA 2J46A 4IOLA 4JLAA 4TMXA 2IL1A 3PR1A 2CNWA 5B64A 4DLZA 1F5NA 1QHGA 4CDGA 4UNQA 2O8BA 5JECA 1Q20A 2IYZA 4PX9A 4RJLA 1FP6A 3DVEA 2WKPA 3HPQA 2HXSA 1A4RA 3BFXA 3BH0A 4MGKR 4JKYA 3X1ZA 2QEQA 3ECCA 3FHCB 3SYKA 4WVFA 3WMEA 3RRMA 4C0SA 2DWQA 3GEHA 4M2LA 1U5IB 1XEXA 4TLBA 5B57C 3BUMB 2GXQA 3H2YA 3HP1A 4PE1A 3OIWA 2LE9B 2CXJA 4CRWB 4HUQA 4BFSA 1MOZA 1DEKA 5C4GB 1ZC4A 2ZRMA 1AGPA 3EK4A 1XTIA 1E96A 3DZ8A 3NSLA 3CONA 4MGYR 1E79A 2WWWA 3VRRA 4PPGA 1SVMA 2VBCA 3WBKA 4UQOA 2ONJA 3CWZA 5AUPB 2JLXA 2LC5A 2XITA 2ZRKA 4XTRA 2HLDA 2PX3A 1BF5A 3EWSA 2QGZA 1MXLC 3WNBA 4DUQA 2PSRA 4TT3A 2KQYA 3LW7A 3NKVA 4ZCUA 2AD1A 2H16A 4GL2A 1OV4A 1H4BA 3KB2A 2QPTA 1JALA 1F2UB 4JLOA 1TNPA 4D81A 3C8UA 3VNUA 1IOZA 1U8ZA 3O4YA 3N5CA 2MBXA 3IUYA 5E7IA 4NDBA 4I4LA 4ESVA 3EK7A 2IYWA 1NVWQ 2OM2A 3ASZA 1ALVA 2ZRPA 3GJXC 3RSOA 2Z4SA 3NC0C 5KSYA 4JVNA 3HR7A 3L43A 4BPBA 1G3IA 1GKIA 2GK7A 1CR2A 3VHLB 2R6DA 3W8NA 1W49A 3MCAA 2H61A 4BZQA 3QXCA 3AKCA 1M1YE 1YHNA 3IQOA 1P2VA 5DKRA 1XDBA 4MSPA 1BOCA 1VCOA 4BRWA 4US2R 3QPUA 4RD2A 4XVRA 3ZIAD 3L2OB 2JOJA 1FP7A 3CF6R 3GLGB 1HQCA 2H2KA 3AQ4A 4Q4HB 2H5EA 4P33A 2ZI4A 4QHYA 4ZV4A 1J7PA 1VG1A 3QG1A 3PCRB 4P2YB 1PLLA 1K5DA 3VR3A 5CB6A 1BR1B 1G3QA 1TQ4A 2FX3A 1M63B 2OHFA 2X1VA 1WF3A 2ZYTX 2LVVA 3KFXA 2QM7A 1NN5A 1Q1EA 2AKYA 2OV2A 1F71A 4IOMA 4DVGA 4LJYA 3A8TA 2WTUA 1Z6TA 3NDBB 1B9AA 4YGCB 2QAJA 4C0BA 4AI6A 2OEPA 1NSFA 4B2PA 4D4KA 4DLXA 1OYWA 4HB0A 1O3YA 1PK0D 1TRFA 1GGWA 4OV2A 1IBRA 4AYWA 1Z0AA 3DEFA 2L2EA 2A5JA 2YWHA 3R8CA 1Z47A 2FN4A 2ZSEA 2B6HA 4FMCF 2WJHA 2FGKA 5FI1B 2LAPA 3MSEB 5DI3A 1SW8A 2EYUA 3AF2A 2VRWA 4Q9JA 1KFXS 1MR3F 4YXWD 1K9KA 1XFUO 2RGDA 1G8PA 1K90D 1SXJC 4IW3B 3FMIA 1D8TA 3KDSE 1OSAA 1E2HA 3M6AA 2QY9A 3ND8A 3GOFA 1W44A 5TNCA 3KXIA 2I18A 4WZAE 4BLOA 5H68A 4DJTA 4DLTA 2CDNA 1RZ3A 3OEHD 1ZM9A 3OX6A 2GESA 2Q3MA 2QTFA 1W7JB 1UHHA 2F9LA 2VF8A 1SPYA 1G291 4Q1CA 2RGXA 3K09C 4USLA 1P9NA 2IUSA 1QBKC 2YWGA 5CK4A 4B6FA 3Q8XB 2R6CA 2RMKA 4IJMA 2RGNA 5CLQA 4B48A 4PR0A 3PN7C 1EFTA 1YR5A 3ZIAA 2KFFA 5JCPA 1VMAA 1AKEA 1DELA 3K21A 1G3MA 3AUXA 3NIBA 4HLQB 4FCWA 2JLYA 1KQVA 5C2JB 1CF4A 3I5FC 4MRPA 1RWYA 1MHOA 1UJ2A 2PH1A 2ZRTA 3NXSA 1GDDA 3WBJA 2BV3A 3D6TB 4YMWA 2DFLA 3AV0B 4Q21A 3TVDA 4N1GA 1Z2CA 3OB2B 3EA5A 5JWOA 4J0QA 1S1CA 2A5DA 3MJRA 2X2EA 2VP2A 1QVIZ 3E1SA 4BFXA 2PEYA 4NYJQ 2P6RA 2V3CC 2MJWB 3SYNA 4V03A 721PA 2ZM5A 2D74A 2K7BA 1AP4A 3NEYA 2Z83A 4N1AA 5AJVB 2OCAA 5EQTA 3GLFE 4QJ3A 3EX7C 2O8FB 1NJGA 4V0NA 4EPYA 1HE1C 1II8A 1QTXA 2D7CA 2LNKA 2DPXA 3TNFA 2JATA 2AK2A 2DCUA 2KJQA 4BLRA 1ZD1A 4YXWA 4MQBA 1WRZA 2HF5A 1ZM3A 3U61B 1OIXA 4FTGA 3MWLA 1KK2A 5KNBA 1DGVA 1EK0A 3CNLA 2CJWA 2NO9A 5D3QA 4UNSA 1YVHA 5DKNA 3SG7A 3OEHA 3W5IA 3T06B 4DRZA 4XWOA 1OSNA 2HUPA 4TL9A 1A75A 1KWOB 2IS6A 1ZFSA 1GKYA 1Y0VH 1KK7Z 3PM8A 1VCMA 1KOFA 2B8WA 1Q0UA 1TF7A 1MH1A 4LDJA 2BJVA 2PZFA 3LY5A 2ZTSA 5EXXA 3LLUA 1DJIA 3VHXA 4HEJA 5F9FA 4KBGA 3EVVA 3LH5A 1E2PA 3T1QA 1UP5A 3PENA 1P9WA 1NX3A 1DG3A 2Q9CA 5K8LA 2BBMA 5EXTA 1L8QA 2GJ8A 5LBIA 2AFHE 2JT3A 5FPHA 3THYB 3BJIC 1KSMA 2OCPA 5KDLA 4IVRA 1K93D 5J4KA 4A4DA 4YQFA 2ZJYA 5CSIA 2PASA 2CMKA 3ZQJA 4DT1A 1Z8FA 3BH6A 1PLJA 3A4MA 2HQWA 2NGRA 4HUTA 4NYIQ 3SI7A 3OESA 1XXHB 3NDPA 4GNKB 1XJCA 3KQUA 4I5NB 1WDCB 3CX7A 1AK2A 2FSFA 2Y1MA 2ZJOA 4M53A 4V02A 1T0HB 2BWJA 3VQTA 1G8HA 2K5UA 2VA8A 2VP0A 4C0JA 3KTAB 4TLAA 3REFA 1I4TD 3IIMA 4P4TA 4ICBA 1BYIA 4NDZA 4QJ5A 4ZKDA 1KI6A 2IF2A 3GLIA 4I81A 4LJ9A 1R6PA 3KPXA 2DWPA 1TNQA 4NCHA 5L3QA 5JZVA 1C07A 4PO8A 4URZR 1RPZA 2IS4A 4D82A 4W9MC 4WRIA 2MHHA 4C9BA 4F92B 1CDLA 2RGAA 3Q3JB 3TK1A 2EHBA 4FN5A 1P2UA 4B35A 1AA9A 3EK8A 1DJGA 4CW7A 4Q03A 4ZKEA 1J1EA 4Q7LA 3QBTA 2IHYA 3HR8A 4RFVA 3CTNA 4IFEA 1ZNWA 1CXZA 3CX6A 2R2IA 3JTDB 2ZQ5A 3ZWHA 1YR9A 2RGBA 1NKTA 3JVTC 4QGFA 2QG6A 2EWVA 4HLUC 4B34A 2V6JA 1A03A 2WOSA 4ACBA 1G5TA 3BUNB 5ER5A 1JR3D 3K0AA 1J8MF 4Q1AA 5DYIA 4ZI2A 1NIWA 1J7OA 4M1SA 1H8ED 4QC2A 8OHMA 2REBA 2Q0HA 1J7RA 5FTLA 1DAKA 3IILA 4M8NE 3QPWA 1L2TA 3VFDA 2GXSA 2GGZA 4DBLC 5BQ5A 1KDPA 1AIPA 2W0SA 1KQMB 3LK0A 2QE7D 2CE2X 3TLXA 3K1JA 2FJUA 3TUJC 3IPYA 4DDUA 3EZ7A 5BW8A 1Q21A 1IKUA 1P61B 3PFVA 1N0UA 1N5LA 1RIFA 3B7GA 3PEUA 4OBEA 3SE0A 2LP2A 4EPRA 4QKQA 1RYHA 1LA3A 2FCDA 1E9FA 4GI7A 1JQLB 2KAXA 1SR6C 1II0A 3CR8A 4TL8A 1S36A 5DISB 3VR5A 5TMPA 2M3WA 4M1MA 1Z6YA 2O8CB 1XNJA 2FGJA 1E9SA 1X6VA 2KQ6A 2AX4A 4WQ2A 5FUVA 2DFNA 1S6IA 1HH4A 2LCPA 3GJ7A 3QNUA 5FTKA 1FUUA 1E2LA 3OX5A 3FWYA 1XFWO 1PUJA 3IEVA 1N6IA 4FMDF 1E1RD 1W5SA 3K70C 4FCTA 4PDZA 2FZ4A 1B7TY 4A2QA 1KI2A 1ZM2A 1M7HA 4M1OA 5CSFA 3PUZA 1KSHA 4L8GA 3LXXA 1E9AA 3TSOA 1Z0FA 3QXJA 1SKYE 1KKMA 3BB1A 2NXQA 3GLHB 4JLPA 2O60A 2WWXA 1OMRA 1N6LA 3K9GA 4Q4JB 3HU1A 2OT3B 1JR3A 4AKEA 2CCJA 4BWYA 3W6OA 4R71A 2HF9A 2JT8A 1KSFX 1SVWA 1YZTA 2AXPA 2H57A 4HZUA 4QGAA 1N6NA 2HJGA 1H8EA 4OI2A 4KCGA 5EUMA 2WAXA 3PSRA 1OHHD 4ZCLA 1EFUA 3I72A 5B2ZA 5FPYA 5GJCA 1GUAA 2L98A 4ARZB 1GRNA 1QLKA 2GDJA 3LFUA 4EKDA 4HRGA 2Z0MA 1MWNA 1JBAA 2QE7A 2L4HA 2W2TA 4KV9A 2GGMA 2ZR9A 1OB5A 1OH7A 1R2UA 2V1XA 1SL9A 3L0OA 2J41A 4NTZA 5JRZA 1LVGA 1PULA 3TW8B 1HQVA 1DAIA 2OUKA 2EQBA 1XWIA 1KI8A 1SXJD 2QQEA 1GOTA 5HKKD 1KY2A 4EFLA 5FOWA 4C4PA 1FPMA 3ADBA 1SVLA 2Q6TA 4DEYA 1KSGA 4DHEA 4HDCA 1YKSA 5JMTA 3MAAC 3AVYA 2QP3A 2QRZA 2QZ4A 3RRYA 1G64A 1IJFA 3CZPA 1R0XA 4LHXA 2GVDC 4C7OA 1OPXA 1IG5A 1TU4A 4I1UA 4L4UA 3B9QA 4I99A 5KPJA 1E1RA 2O5VA 5CJPA 1ZAKA 2CEAA 3CPEA 1V43A 4POAA 1VYUA 4K46A 5FBLB 1HUQA 1WLZA 2D2FA 2KFGA 2JLZA 1E9RA 2LLUA 1SL7A 5JI2E 1GFIA 1TF2A 3SJCA 3TAHA 4KODA 3KHEA 1NMXA 2NO1A 3CRRA 1IQ5A 2JTTA 2M1KB 2NG1A 3GJ8A 3R8FA 3DKVA 1HTWA 1W5TA 3HU3A 4FMCB 1AM4D 3R7WA 1CR4A 3RANA 3WNXB 4LJ4A 1KO7A 4B3DA 2ECKA 2JIZD 2BDTA 3Q85A 1KYIA 1F54A 1EWRA 4EQ6A 3THWA 2AD5A 4BRUA 2O8BB 2PALA 3KQLA 2VIIA 4DCNA 1OHHA 3RWOA 3ZNIA 1SVIA 3SEAA 4IFBA 2YINC 2GZAA 2QMOA 4WQ3A 1R10A 3GEEA 3ZYCA 2OFXA 3DVLA 4BFVA 3PEWA 2CHVA 3FHTA 1FW4A 2BL0C 3GJ5A 3D0YA 1NY5A 3KEVA 3LBIA 1JJ7A 2MSDB 4E5UA 2RH5A 2ZVQX 5CIWA 1XJQA 4HUQB 1SXJA 4DLRA 2OG2A 1NPQA 5HKKA 3AKAA 1N6KA 1FPWA 1NP6A 1YUSA 1TF5A 3K0EA 2AR7A 1QHNA 2RGCA 1DJYA 3QF4A 1K9PA 1LS1A 2Y4QA 3B1XA 5GADl 4BECA 1C9KA 2BMEA 4NQGA 1CFFA 1E0KA 4UPGA 3FKSD 2N46A 5KDDA 1KFUL 3FS7A 2RGEA 1YZLA 1UEIA 3EIEA 1CR0A 2NCOA 1E98A 3SJZA 3UATA 3IDQA 3TDUA 1X8LA 4B43A 3THXA 4LBWA 4QGHA 1FUKA 4LI0A 3VGOA 2KNEA 3QENA 2PX0A 1TMKA 2RB4A 3PEVA 4Q1EA 4Q5IA 2UZ3A 2FOLA 3RLFA 3I62A 3W6PA 1W4CA 4PPFA 5HZKA 5ELXA 2WCFA 1QX5B 1Q12A 1KI3A 2EFCB 1YZKA 2J0UA 121PA 3LDAA 3VX3A 1E0SA 2XNSA 2FWRA 3K9HA 1CRPA 1L7ZA 2FG5A 2OCYC 5AANA 3O8BA 2JIZA 1AS2A 1ZM7A 2IHBA 5GVRA 5BN5A 2OTGB 1AZTA 1OLOA 2GJ9A 1PV4A 3GMTA 1K94A 3O2PA 3WY9A 3O8CA 1F2TA 4ABYA 1NG9A 3A4NA 1U0HC 1SYMA 1UADA 2IYSA 3IEUA 3UXMA 1SVKA 2IXGA 1SCMB 3QKRA 1UWOA 4LC1A 4Z54A 1OB2A 1ZBDA 3HU2A 1CLLA 3A1UA 4IEIA 4M0LA 2A5FA 1IN6A 2C2HA 2GJAA 3LAWA 4N0DA 2R6AA 1S4QA 2XJ4A 1CDMA 3PXGA 1P4SA 2L0PA 1T8TA 2ZRDA 2B21A 2RGNC 3T12A 1T4GA 5F2EA 4A6PA 5CB8A 1G3RA 4TYYA 4H9GA 4GT1A 4MZLA 2ZRAA 4EJSC 5I2OA 4D1EA 1DAGA 1NX1A 1HURA 1GG2A 5FOUA 2GXAA 1EL4A 1QVIY 3EZ6A 2JAQA 1D1OA 4RCYA 1UDXA 3X2SA 4I1SA 4DCSA 2VHUA 2R6GA 1DG1G 2ZYWX 3FKSA 4GFTA 3ZJYA 2KFHA 4CEIB 3DDCA 1IAQA 4E03A 1LVCD 3MG9A 2W6JD 3LCPC 4Z8XA 3K9LA 2OO7A 1VPLA 4HI0E 3WHKA 3KL4A 1DADA 4O2LA 2ORWA 1OF1A 2H18A 4LHZA 3RSLA 3AAJA 1G18A 4K8OA 1BO6A 1JC2A 2IYLD 4UXHA 1MRNA 2JU0A 2GTPA 4DCTA 1NYAA 4UXJA 2NPIA 4ITRC 2F1JA 1WMSA 4IRUB 4MITA 2AWOA 4Q02A 5HKYA 3CNOA 2PRUA 4HAWA 2WNDA 5DI3B 3TQCA 1WE2A 5JSZA 4UNNA 3TMKA 3D3QA 2KE5A 3N2EA 5LPNA 2ZXUA 2LCFA 2WCEA 1G5PA 1MF8B 1PLKA 3EW9A 1G4AE 1RRFA 1P7CA 4AWXA 1WP9A 4PZLA 4OQXA 2JLQA 5J3XA 4A36A 3ADKA 2VP9A 2JCSA 1DF0A 4IDNA 4L5BA 4TLCA 4A0GA 3BBPA 1NN0A 2DFTA 2ORVA 2ZR7A 1NLFA 4RY2A 3F8TA 4RZXA 1BJFA 3C41J 5F9HA 3KZ1E 3NBZC 1KO5A 1PSBA 5GJWC 1UKZA 2CK3D 4C2TA 1DJZA 4B3CA 1XX6A 1UFQA 2HPSA 1TADA 1UEJA 1ANKA 1GTVA 4TZ6A 1EFCA 1CFDA 1KJYA 3OIVA 1A29A 1RW4A 4FI3C 4JT2A 2CCMA 5HE8A 3GK4X 1E2IA 2R8RA 4G3XA 3U7EB 2AAOA 4DSNA 4CF7A 5C4MA 2CVFA 1OW3B 3HCMA 2VSOA 1AHRA 3B13B 3SFZA 2Q9BA 4IDPA 4GSYA 4XWAA 5FI0B 3K70D 1MXEA 1KY3A 2BCAA 1P73A 4W7SA 4F38A 1VTKA 1XPOA 2W6JA 3LLEA 1OH6A 2G2BA 4NL4H 1XA5A 5E7JA 3HDTA 4PHNA 3VR2A 1CKEA 2FEOA 1ESMA 4BQSA 4KFRA 1S8FA 4NYMR 3DO6A 2IXFA
chains in the Genus database with same CATH superfamily
3LIIA 4HLUA 2VPIA 2BH9A 1F6DA 1POWA 2V03A 4YFVA 5AT1A 3C7AA 1SCVA 4FHFA 1V5EA 3KSUA 1SVUA 5IKMA 2YNMA 4EPVA 3IMGA 4QFMA 1JEAA 5KQMA 3BFJA 2CK3A 2VF5X 4GSKA 1OIWA 1HZZC 4QM6A 2Y3IA 3MTAA 1EA7A 2ZI6A 5GOZA 1FJHA 1MQ9A 3VU9A 1Y5MA 5A6VA 3JQ7B 2IOFK 4Q4AB 2H17A 3JQ8B 5FWXB 4PHHA 1CETA 4MXDA 3N8HA 1QG2A 1RRMA 3L4SO 1HYGA 1Y48E 3U19A 5GONF 2XE6A 4A82A 2O52A 2YWBA 1TJ5A 1RWPA 4RMNA 1DRUA 2BKVA 4V0ME 4OX9Y 3JRWA 2WUWE 1YL5A 4E5NA 4F0JA 2CFSA 2WBLC 4ZMSA 2F3PA 3ZCPA 1BE8A 3OZRA 3UMRA 3LDHA 5D7BA 3A1TA 4MWSA 3NDJA 2FF5A 1QX7A 3KETA 4C04A 3TGLA 3A06A 2JPDA 3L4JA 4HGQA 1PVOA 1MO5A 2VT3A 4BO3A 3VTZA 3BIJA 2GHIA 3OCWA 4JGGA 4QARA 4EITA 2FPIB 1E6EA 1KSJA 4CKBA 5FBHA 4I19A 4FFPA 2KBMA 4AUNA 1QHIA 4KO8A 1NYTA 3LCVB 2EX4A 2BBWA 4KAFA 2M7NA 1OJLA 4JITA 3KLPX 4TROA 1JEEA 5KNDD 3W6UA 1A9QA 3W9UA 3O03A 2C1EA 1N0WA 3ZDQA 3IMEA 4IKPA 2NSJA 4FIDA 1G59A 4LJSA 4Q9LA 4JUFA 3I9OA 4OHMA 3HABA 5ECWA 4KPEC 3IIJA 1SIWA 3TPFA 1U8YA 4DPMA 3AF0A 2FI1A 3HM9A 1YRAA 2E6UX 3CW2A 1CC1S 1ZWKA 3I2HA 2BMDA 3UPUA 3I58A 2AG8A 4ASUD 4PSCA 1LLFA 2YCLA 1PK7A 4GPEA 5KNDA 1U0TA 4OUDA 4U2KA 4CF5A 3MBKA 5SZIA 3PWZA 1E4YA 1M9NA 4PFJA 1QFZA 4BKUA 3LO5A 5AEQA 3Q15C 4NHOA 3RU2A 4B84A 4P82A 4NC9A 4ZIRA 3O8LA 3BRSA 1WCXA 4P86A 2GF9A 2PSJA 2J0VA 3GP8A 2CLSA 1WKCA 5PNTA 2F8PA 1F2TB 3TIXB 3B12A 1F12A 3JRXA 2P0AA 1KYXA 1UXJA 3EF3A 4ASUA 3ERCA 2L42A 4D9BA 1UZNA 1QLSA 1TAQA 2JPTA 5KINB 3IMKA 3JS5A 5D6NA 4R1LA 3BN3A 4RLQA 3QY9A 5TPWB 3WGKA 4HYEA 5HKZA 2BTEA 1O08A 3IQFA 1EXNA 4U7JA 4ZMRA 2IW3A 1ZN7A 5IN4A 2OC4A 3E82A 5KYWB 2Z2KA 4CIWA 3CVUA 2AX3A 1SMGA 5AWFC 2Q3FA 1H3EA 1YI1A 1NT4A 2BFEB 2RHMA 4Y2UA 2FSGA 3FPCA 1A9YA 1M5TA 4XSGA 2LP3A 3OFVA 1AQNA 2QLJA 2WWVD 1YB7A 2H63A 3ONNA 5FNVF 1OCEA 3ZHYA 5DLYA 5CYGA 2R3SA 2Y05A 1G2QA 4TXMA 2WIAA 1FDRA 2XUIA 1ODJA 1JFRA 2ZE7A 1UMDA 4HDQB 2G82A 4G24A 3HACA 3EVDA 5CFNA 4NBNA 2HK8A 3F9IA 4L5AA 1XR3A 4KN8A 1CUYA 1WUJS 1OLXA 4MS3A 3F3SA 2K0JA 2WD7A 5GJBA 4QGGA 3RWMB 3R23A 4DXAA 4WFJA 1HNXB 2IWRA 2XZPA 1UBKS 1VSVA 1Q0SA 4XA8A 3PR3A 4QU8A 4F4UA 4X7BA 2QMEA 3VDQA 1D2CA 3SIRA 1MX5A 4NBKA 3M34A 3U62A 4RPJA 2C00A 2R47A 3CNNA 4BNJA 3RUFA 1KL7A 4JUDX 3U3OA 3E9CA 2HB6A 1VL1A 4C6TA 3ITKA 5K01A 2Z9CA 3NASA 2WSYB 1OZAA 2A0XA 2QM0A 2BKHB 1H6BA 3IPCA 1DQPA 2IPAB 1JW9B 1MW9X 4CUKA 5BUCA 2DR2A 5FPQA 4HRAA 1SBCA 4CV3A 1EINA 3H05A 2Q7XA 3ASVA 1WKVA 3ZWOA 1UBOS 3SKVA 2A4KA 3HYRA 3U5TA 1XWWA 5L6LB 1JIUA 4GF5A 1LY1A 1PW5A 2C7RA 1YFKA 3REQB 4BO8A 3T5AA 1IGVA 4NH0A 1JJVA 1LWNA 3HFGA 3AJRA 4P08A 5EEHA 2OFOA 2C29D 1YTLA 3S7ZA 4IH1A 4NARA 5DNAA 3CUEF 2C5BA 1M8JA 3TCKA 4DOMA 2GA9A 3WV5A 4YI3A 2O2SA 3WMGA 5A62A 1J2JA 2C9MA 3B1JA 4JQYA 2P3SA 1CQJB 1V7PC 1OFUX 3LGSA 3FNBA 2HETA 4OTZA 4S2EA 3TOZA 3JVVA 2IQIA 4TLLB 3GH3A 4PFQA 5GQSA 3H3FA 2NTVA 4UFNA 5DSTA 3KT6A 1OQAA 3RQSA 3QBDA 3QY0A 4OGKA 4DZRA 4OX9B 4D8VA 1X7GA 5CVEA 4JP8A 4ZEVA 3A58B 5EIFA 1UBEA 4AX8A 1XZFA 3GDWA 1VLVA 1CFCA 4OHYA 2NQTA 1ZIXA 3FCEA 1DAHA 1VIMA 5PALA 1G1AA 3T34A 5GM2A 1D07A 1NSTA 4HNUA 1K8XB 3RNOA 3RUDA 4GLLA 3LLMA 3NXKA 3J80A 1GCAA 3CUTA 3EGWA 4NJOA 2P8JA 2NUBA 3H97A 2JS7A 1FYFA 3DYBA 3ZD6A 3FWCA 2IZ6A 3R5KA 4F04A 4CLNA 5JTTA 2C95A 5B7NA 3I2FA 4TLDA 3EVZA 1LKJA 1JA0A 5IULC 5TB5A 2B36A 1UHNA 3IP5A 4I50A 2N0SA 1PVAA 2QN6A 1YUMA 2B7BA 3MCUA 1VA4A 4ZAZA 2FN3A 3NNNA 1ORDA 4UEOA 2FWJA 4JB8A 1TUBB 3LNTA 3DXXA 1QFJA 2EZTA 1OLSB 2ZRFA 3U3MA 2HQOA 1FZQA 5IFLA 3QTTA 1Y9ZA 1NV9A 2IIBA 2A1TS 4CR7A 4HPWA 2W2MA 5DHAA 3ENZA 2ZUVA 3PZBA 3MT0A 1Z88A 1D2AA 1IXZA 3KQTA 4ZI7A 3DBHB 3KYDB 4CZ2A 1ULZA 2COEA 1L7EA 4GBJA 1DJNA 4ZARA 4R2MA 3N86A 1H2WA 1Y0BA 4J0KA 4LHWA 3L8HA 1USUA 3WGLA 1A77A 5CDSA 3RYCB 2ZUBA 4TQAA 1TJ3A 3IB6A 1JZTA 2VL7A 4DSTA 2P71A 1U2QA 2QUKA 3FPJA 1LSUA 1N2CB 3TSYA 2HNBA 2ERXA 2ZREA 4OG2A 4RZIA 1EH5A 4KAXA 5CM8B 5AW8A 3ILXA 2HMAA 1WV1A 1QIFA 1E7WA 3GNQA 3NP9A 2H59A 2LZ0A 4GC5A 4EB6A 3MLAA 4EEKA 1D2EA 1QV7A 3DZDA 2IV2X 5FEMA 1TQ6A 2GO7A 5FOXA 3I9NA 2RHGB 3GEBA 4LDQA 3HBNA 1L5QA 1GM5A 2X40A 5JJLA 3KJHA 2IH2A 4PNZA 4MI9A 4XB1A 3JTDC 4E2YA 4YT8A 1LZLA 2XF8A 5F7JA 3T7EA 2MSLA 3EEBA 1TDJA 4R9UC 2ONZA 4LDRA 4F4IA 1NVKA 4XLTA 4BLQA 3H5AA 1V6CA 3MTDA 1Q0PA 4IJVA 1DMSA 2O1SA 3IA2A 3UK1A 1JKXA 4CDNA 3KSZO 2VOJA 4F6CA 1F4QA 3UV6A 2IHTA 5LKRA 3UOGA 2R2AA 2IY7A 3TOXA 2XKAA 3FMGA 4PFSA 4TYWA 3O2NA 4YCSA 4CWAA 3E3MA 4AJPA 3JWHA 1JRLA 2IYXA 1GQSA 5KEIA 1BE6A 4Y98A 5AI5A 2Y99A 1SKYB 1EK1A 5ERGB 3BKWA 1IXSB 5AOVA 4BJ6A 4GX5A 3F97A 3N2IA 1H1LB 5CA0A 1ZUNB 4D96A 1NQAO 1J97A 3V8PA 1ENPA 2VDMB 4C06A 1DWPA 2LP4Y 4UMEA 4L9MA 5IAAA 3AILA 1OUMA 1B8NA 4GFDA 3MJHA 2X15A 1M34B 4YVFA 1X92A 4MDEA 5DYNA 2BECA 1U2SA 4L6AA 1DX6A 4EX7A 4KXVA 2FMIA 5MN5A 2D2EA 4RDHA 1SHJA 4X1KA 4ZOAA 4D6XA 4DR2B 1DBSA 3DQQA 1DJLA 4BO4A 3BWBA 1QIVA 4GPZA 1RAHA 4EHNA 5FNZA 2VEDA 3OP1A 3OJXA 1H4TA 4TKMA 2ZYHA 1JPNA 5L3ZA 4EKEA 3I2IA 2O8FA 3CXRA 2D5BA 4ZOQI 3EFBA 2XQJA 3JTEA 3MIIA 1UBGA 5FD8A 4AQYB 4YMGA 3K09A 4KQMA 5TT1A 4EMSA 1DTWB 2FOTA 5B30A 1M74A 3ESQA 2XKBA 3ZGXA 2YVAA 1O2DA 4LDAA 5JXWA 3EVRA 3G2QA 2C3YA 1PFKA 4MI3A 1M31A 2H07A 1LSJA 1E9BA 4AJ1A 1J9GA 1CQXA 1B8RA 1RHJA 4DMMA 1WPRA 4MA0A 1UBHS 4E31A 4C2AA 3EY9A 1RKXA 2C94A 1UUSA 5AIBA 5F3DA 1KVTA 2ODEA 1DC3A 3V6LA 5HUQA 2DSTA 3AY0A 3CUWA 3OFND 3FYUB 1XQ1A 1ESNA 1I3NA 5A1TA 2V5UA 3OMWA 5JQGA 2PE5A 3ZDYB 1MT0A 2YJ5A 3D8UA 4BNZA 4IHJF 1DLIA 1BGVA 4RZ3A 4XARA 4JJFA 1KXZA 2QGNA 1VRVA 1WB6A 4KXYA 5AR1A 3ITEA 3FRIA 1B73A 2EKLA 2XB6A 3TN7A 4OJYA 3MTJA 3UN1A 5LMNB 3WSVA 2VJAA 5JANA 1HOXA 4N1FA 4FBGA 1M33A 4G5XA 3OFNA 1F9AA 2JPOA 3EZNA 2RH9B 3B5JA 2NSYA 1P6XA 4YLGA 3B3JA 3L84A 1HYQA 2P3OA 3SMVA 3G0BA 5FAKA 5HKWA 3L06A 1GLGA 3LKDA 4UBLA 4I9GA 2PMEA 2H9AA 3MCTA 3G5UA 4B7CA 2TECE 4R8MA 4EDHA 2EX0A 2IODA 1RWWA 1F5NA 2B3DA 3UV7A 4PX9A 4Z0NA 2EQ5A 2BFBB 3U4HA 1K3TA 1U9YA 1D7OA 2O3RA 1HT0A 3C97A 3G8DA 1E96A 1HFJA 3PC3A 3MINB 3PLAE 4TN5A 4BUZA 3HLTA 3LI2A 2X23A 2Y9MB 16PKA 2AQKA 1A1SA 1F2UB 1JSRA 1QUFA 5E7IA 3MMZA 1NAHA 3EZLA 4FM9A 3MCAA 1JKIA 1JHQA 4KJXA 1XDBA 3WQHA 2KPHA 4US2R 2HQ1A 3A7DA 2WT4A 4C5BA 1BXZA 3RTBA 4AI6A 3NDBB 4B2PA 3SPXA 3FCUB 1IBRA 3WJ2A 5IYZB 2TYSB 1MN6A 4UD6A 1JQAA 3CLSD 1ULBA 4LF7B 3H5NA 3ZW7A 5T3YA 4REQB 3FETA 4KBYA 1DOHA 1ZM9A 4MWDA 1JDTA 1U3WA 1C1DB 4JI3B 1FS4A 1VMAA 5C2JB 3GGPA 1RWYA 1E64A 1Q6ZA 5CA1A 4N1GA 3OB2B 1IIOA 5H3LA 2V3CC 1L6IA 3D5QA 5EJFA 1CLEA 1QZUA 4RVFA 5ADHA 2K7BA 5AJVB 4F06A 3GLFE 5B6PA 4GXQA 3W7VA 5EOVA 1X94A 1ZD1A 1WRZA 3EDYA 5EFOA 4NOMA 1C9NA 2AC4A 3MWLA 4EHJA 3FNQA 3WMRA 5E8JA 3NPMA 3QEMA 3U80A 1DJIA 3RFXA 3W5UA 2I62A 3QFFA 1ZA1A 3I01A 5FPHA 5BV0A 2OCPA 3N0TA 3IE1A 1Y6FA 2HQWA 1YE5A 3IEKA 2Q5QA 4X5OA 1AK2A 5D5PA 3M9WA 1TIBA 3REFA 3TD2A 2B83A 3AERB 5TS3A 1Y1TA 3KSRA 3WC4A 3MIZA 4FN5A 5I4IA 3SQNA 1A8SA 2XVXA 2ZULA 1ZNWA 1O94C 1W5AA 3BMQA 1A03A 3HGQA 1F5SA 4ZI2A 5G2OA 1IIRA 2WCKA 4WJLA 1H8ED 3BHIA 3MAJA 2W0SA 1QYIA 2QE7D 2ID4A 3W6ZA 3PEUA 3SE0A 4ESEA 4PZPA 3QLVA 5CP8A 4YV0A 2I4NA 2M3WA 2FGJA 1RRVA 4WQ2A 3GI1A 1RJDA 5LP6A 3DLBA 4Y9UA 3D59A 1M6EX 3SDBA 4I8IA 3GLHB 1BE0A 3HU1A 4W6QA 1YRQA 1UZLA 4UTPA 3NORA 1E7QA 1H8EA 4Y1EA 3PLNA 2QE7A 2V1XA 3GHHA 4DM3A 1A04A 2GVDC 4QUEA 3SKYA 2ATEA 3ELUA 4DCCA 2HJSA 5K4GA 1V43A 4RX1A 4X54A 2A5LA 2OD2A 4MEAA 2ECKA 2GAIA 1DBIA 3HN6A 2R7KA 4ND6A 4YEDA 1SVIA 5E6SB 1DC5A 3ZKWA 2QMYA 2YV3A 4M54A 4IS2A 2ZSHA 1SNYA 3H6GA 3ONEA 1K9PA 1EA5A 1E5DA 1ARZA 2O4UX 2O2DA 1IDOA 2P2ZA 3N76A 5KCZA 2CXSA 1X8LA 4DYDA 5LNK1 2G9QA 5I5GA 3W6PA 1E3IA 1J2RA 1U3CA 4G09A 1U11A 5FYDA 3V1UA 2LPMA 3K9HA 1L0BA 3R6DA 4RY0A 4WL0A 3BK2A 2Z5LA 5LM3A 2IXGA 2I03A 2A5FA 2R6AA 3ICWA 2RGNC 3KQWA 4I1SA 5CDUA 2VHUA 3L18A 1XCBA 4K3UA 2WP8J 3VBEA 2I99A 2H18A 2QTAA 4BP1A 2PRUA 3NIFB 1TM5E 5B1HA 3H9BA 5LPNA 1O57A 1C7ZA 4PAWA 3ZHCA 4ZC1A 3SX2A 4RYDA 2P2YA 3NKFA 2WWTA 1ZD4A 3CG0A 1RW4A 4JT2A 4CF7A 3HCMA 5E6RB 2SECE 3U9TA 4YT4A 3TG8A 1UMCB 1NXTA 1EUDA 3JTMA 2WV7A 1ORWA 2C4VA 2H2HA 3F8WA 4N5NA 4Y2PA 5HIMA 4M60A 3PL5A 3IX7A 3L0ZA 1LW7A 2Q5OA 1GSIA 3K4PA 1VHLA 1MX1A 5M5BA 1WHTA 3LE8A 1BDMA 4C7VA 3H4SE 2AUTA 4IR7A 2FWNA 1WUYA 4BBJA 1TQ8A 2VHXA 3KKLA 3KJXA 4YPOA 3QUCA 3GDHA 1L8LA 2HHJA 3ZY3A 2C0CA 2O50A 1C9DB 2P8SA 5CM2Z 5AVQA 2Z2YA 2Z2XA 5FLYA 1XB2A 5FV4A 4NAVA 1XZEA 5DT9A 4UTRA 4ICIA 3SSAA 1MBZA 5K3SA 2W9XA 1J23A 1ZMBA 3AJEA 4RD3A 1XRQA 1PV2A 1QB7A 2FPOA 3QI7A 2OXFA 2E4ZA 4JIMA 4IH4A 1A8UA 3WR5A 2H00A 3K73O 3BJHA 1LNQA 3HB4X 3ZZTA 4ATNA 2YDYA 3GARA 2NAPA 4JXKA 1M6NA 1CQZA 3DV0B 5JAHA 4XUCA 4D8YA 1NI3A 2A9KA 3TVTA 4KFSA 5CT8A 1OWNA 4CT4B 2C2KA 3CA8A 4BY4A 5KNBH 1LDBA 1F51E 3IHWA 2LMUA 3T38A 5K3BA 2LUCA 3UFBA 2OS8B 4TMWA 1QWVA 1BWPA 1C0PA 4G9GA 4GE3A 1I7QB 2RHJA 4BAGA 1JBEA 3ZE6A 4Q7QA 4LSGA 4Q01A 3ZQ6A 1MTZA 5TJ9A 5BRAA 1LS6A 3PI6A 4YJHA 221PA 3PGA1 3V7FA 1OX4B 1U9IA 1NWCA 4XEHA 1CE8B 2ORYA 3JZIA 3K15A 3UKJA 2LR0A 4OFWA 2A3RA 4IVNA 5J4LA 4ME6A 2UZ4A 1ILWA 1G19A 3P0RA 5CUQA 3ZU4A 2PG3A 3E15A 4LOKA 4X1YA 4I5GA 2IZ1A 2GEDA 4FOPA 2N9UA 4FJ1A 4R2IA 1SCIA 4LNHA 3Q1KA 3CRQA 3SX0A 4Y2TA 1T8SA 1DLJA 3HUEA 3PN7B 2VHQA 5D01A 2D54A 4P4GA 4POOA 3KZKA 4Q7JB 1K8ZB 1JT9A 1W36B 2NU6A 5L3RA 4UAGA 1QGYA 4IGFA 3V7NA 1VE3A 2ZIVB 5JD3A 1XVTA 4P22A 3OC0A 1XXHE 5DNWA 2XI4A 4MPDA 2ESRA 3M33A 1PR2A 2JT0A 2FAXA 4Q04A 2PLFA 4BNIA 1ORVA 3TR5A 1JF2A 3DONA 2B5OA 1GCUA 1G98A 1I3LA 2XMZA 1SHTX 4KWEA 1HE8B 2MYTA 2ORIA 4ETWA 3T0GA 4PZZA 3NTXA 1QAMA 5IASA 4U6SA 4RORA 4M8KA 4MQUA 1MAHA 1BFKA 4MICA 4MQLA 3DYEA 4HAZA 3KOMA 2B9VA 3H5RA 5TQ0A 2A4MA 2F8LA 2C96A 3DG9A 2VTKA 4Z7QB 1UJNA 2ZSBA 4PZEA 4GEKA 4LGCA 1M3SA 4LGMA 1IXYA 4FQTA 3MRXA 4G4SO 2DTDA 1JX6A 2PX8A 3MGAA 4LSWA 3P4XA 2Y4OA 3WLHA 3B3GA 5ALQA 1RBMA 2OR3A 2Q21A 3QEKA 4IP0A 1C0KA 1MFZA 3EXHA 4D4JA 1N7GA 1H2AS 3STHA 5I7VA 2EW1A 1MV8A 1Y9JA 4IUCS 5LMCA 2QI9C 3OHSX 2BLLA 1OBVA 1NUTA 2WJ3A 4QFBA 1K97A 2ZYVX 4Q1VA 1PZNA 5AHWA 4PV7A 5BSUA 4PTYA 1U2PA 4HYTA 5E6UA 4RL6A 5COQA 2VK4A 4WY2A 821PA 4DA0A 2WFLA 1KJZA 4PWYA 2JK1A 4D26A 3ULKA 2NO0A 5JS1A 4D02A 5IZCC 3B1WA 5KMGB 2R00C 5JAMA 5JR3A 3T5CA 4EHLA 5AKYA 3T1TA 2PUJA 1ALWA 4HNTA 1MO3A 1YA8A 4XDYA 4GG1A 5JNTA 2F43A 1AMOA 5FTMA 2EC5A 3X1JA 2OCIA 5C1BA 2WHPB 2FA9A 1CNMA 5F51A 1QTRA 3ZH2A 2W48A 2G04A 2I67A 2V9ZA 2ZVJA 1OPRA 5ICCA 3RD5A 5A9SA 1FXSA 2CVHA 5BT8A 5ITZA 3FFTA 3RB8A 4IJKA 5JQWA 4O8CA 2PGDA 3UMJA 3OVMA 2YVLA 2J85A 4M1TA 5JBQA 3GFOA 2CGEA 1I3OA 4NU6A 2I2RE 2HMTA 5AVTA 5HLVA 1OU0A 1VBNA 4EECA 3P2IA 3ZEIA 4C21A 2QNIA 2PQ0A 1DKLA 2QOEA 3F45A 2OAP1 5TV2A 5M34A 4G1FA 5K0CA 2GB4A 3W1VA 1P6UA 1A9PA 3ANNA 5CGZA 2BRUA 3A4LA 3TZBA 3UEOA 3DOHA 3VKFA 3KQNA 2WTBA 5IC4A 1CIVA 1V5WA 4O0LA 4YTEA 4ZQGA 2Q4RA 4PM4A 1FNNA 4GMDA 1T26A 3L8GA 3U9SA 1N36B 2ADFA 3KQHA 6Q21A 3DTYA 4GAOA 2REQB 3LLSA 4XW2A 2WSLA 5EY5B 5G1OA 1Q95A 3G49A 4E22A 1QRDA 1YB2A 5L3QB 3FB1A 1US8A 3V4FA 3KSDO 1JYEA 1ZGGA 2ERYA 2W8BB 3VKHA 2O8DA 4ARAA 2FPSA 1Z33A 1MKYA 4E7OA 3B70A 1UK7A 5E4TA 2QSYA 3B6EA 4CL2A 4II7A 2LDXA 1J0XO 3P9YA 3HVUA 3GCXA 2FUEA 4INOA 4E08A 3U2QA 1C7RA 2BCGY 4BNVA 2VT2A 5K0JA 3EF0A 3BB4A 1BQ4A 1IY2A 1Z75A 4JLBA 1G6OA 1D5CA 2OHHA 2VAMA 1PHPA 2P0EA 2QD4A 3N1UA 1DTLA 1MQ1A 2IYVA 4CM4B 2GWHA 1JXMA 3HCCA 4M7WA 1Y9AA 4OR9B 2HYIC 2I34A 4TSFD 3PUJA 1WCIA 4YP9A 3V3KA 2VP5A 4JA2A 3AVWA 4WLVA 4NCKA 5KAMA 3GL9A 3NMUF 3RUCA 4E5SA 3SBOA 1ZN8A 3BSFA 3EGIA 1ZIDA 5JS7A 4WOKA 5INTA 4RDXA 3J81k 1X8KA 2WJGA 4QQNA 1SZPA 5ISMA 4YJ2A 1I1NA 2WSMA 3PLRA 5A3VA 4UVGA 4TSFA 5K3AA 2QVYX 4FOOA 1A72A 2AEJA 4XFJA 1BQ3A 3AVVA 1FMJA 3RRZA 1WSDA 4OGWA 1M6WA 3ZK7A 1XLWA 3H0KA 1RBYA 3U13A 1XL0A 2P35A 3B2NA 4CLEA 2PX5A 3H5OA 3JASB 1AKYA 3E58A 2F33A 5K0EA 4IDGA 4WD3A 3HJCA 3WGIA 2FN7A 4H60A 3UZUA 1HRKA 1KI7A 1SOWA 2XX3A 1G3UA 1GVNB 1Q3HA 1RJ9A 1Z6ZA 2DFKB 3GUHA 4E09A 2JRFA 2JD1A 5A9RA 2HCFA 3ROPA 3M5DA 1RC1A 4C14A 2Q6KA 1GQRA 2NIPA 3I73A 4K6FA 1EQUA 2GPWA 4RH0A 3A4VA 4HWGA 4YUVA 1BOFA 2C42A 3G68A 2PJZA 8ABPA 3U1VA 4LZWA 1FDTA 1L7AA 5F78A 1YURA 5CFMA 1G8FA 3TIIA 4DRXA 4TMYA 1MJGM 4RFSB 3G5MA 3I2GA 3SQOA 1QVRA 1QPBA 5E7MA 4N0QA 2IYFA 2M6RA 1XA0A 1I0LA 3A32A 1GGVA 1S2MA 3WYFA 4DLVA 1DRJA 5AW9A 3GLTA 2BR3A 1RPNA 1S2IA 2R0QC 4G0NA 3C8DA 1LPAB 4ANFA 3RSGA 5ELLA 3RSSA 3SYRA 3RSQA 3UICA 5CXQA 3V4VB 2YV4A 4KITB 3S1AB 2AZTA 1NW6A 2OGWA 4UOZA 5F7OA 1T4DA 2YX1A 1FF1A 2HCTA 4YGDB 4UE3S 4ODIA 3OQ6A 3PDUA 2QSUA 1JG3A 2FPKA 3R20A 3JQQA 2I4TA 3VJLA 1ISHA 4DDHA 4ZVQA 2XT9A 3FCXA 3L82B 1EGQA 4ZT7A 5BSRA 3O47A 1JLMA 1E2EA 1YR6A 3HZZA 2HDNB 1QRTA 1PR1A 3UUFA 1KNQA 4AKTA 1PSZA 5A6SB 2VKTA 4DUPA 1A8HA 4C30A 1W8DA 5AKIA 2X8BA