4C0LA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one magnesium ion and mg:gdp (mggdp-miros)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
404
structure length
404
Chain Sequence
b'ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 120
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0lA03
1ALVA 1W47A 2MLEC 2ZRCA 1OLOA 1OXXK 1DELA 1IXZA 6Q21A 5BW8A 1CBUA 2FOTA 2ZREA 5GJWC 1PVOA 1QHHA 1JNYA 1T5IA 2E87A 1HY3A 3V4FA 3AVWA 1CR4A 4A1FA 5FOUA 3WY9A 5B58C 3CTNA 1GL9B 2QROA 4QGAA 4AIIA 1KZGB 2DWOA 4TQUS 3LK1A 1Q21A 3GK1A 3FKQA 5DYGA 1ZFSA 5GJCA 1UAAA 1A75A 2PSRA 1AK2A 2A2ZA 1WE2A 2ZRNA 3I61A 1DAMA 1KI8A 3REGA 1GGWA 4PPNA 3NWJA 1OYYA 1R6BX 2CCMA 4Q7JB 1JQJC 4CVNA 3B1WA 2WORA 1Z06A 2AAOA 1YRBA 2WBLC 4BFVA 3BH0A 4I5LB 5CYPA 3OB2B 4PX9A 3MWKA 4FXPA 2JC2A 1BYUA 5DE3A 2F33A 3SG3A 5TXGA 1DS6A 5F2EA 2NLNA 1W49A 3THWB 2E6WA 5CM8B 4TZ0A 221PA 1SY9A 3CWQA 4MLWA 1ZU5A 3EKHA 3WHUB 2WJVA 5DGXA 1KHTA 4QG7A 3AVXA 5G40A 1JQLB 1ETUA 2OUKA 2EWVA 4EPRA 2H16A 5ER4X 2QN6A 2RB4A 3AP3A 5FPYA 1B1GA 3OIVA 4ZDIA 3BFKA 2GXAA 1NSHA 2NXQA 3PALA 4V0MA 4OHWA 1RJ9B 1KO7A 2LWIA 5CLQA 3KJEA 4ACAA 1QVRA 3EVUA 2L5XB 1ZMXA 2QP3A 4AG6A 4GP6A 4AK9A 3GP8A 4ETOA 1OHHA 3Q5DA 3W6NA 5KDDA 1HA3A 2VHJA 1FTSA 2B6HA 3C41J 3OAAD 3O8DA 1P62B 5TY0A 3PN7C 2RGIA 5KHOC 5LD2B 1Y6WA 4HAWA 4GUKA 4PHMA 1TADA 3TR5A 4KITB 4LV8B 1E9FA 1YZLA 2NZ0A 1OB2A 3BUMB 4B3FX 1E9RA 4NPHA 2J0VA 1D2EA 2WWGA 1BO6A 3IHWA 1DJGA 1ZYUA 3H0KA 4ZCIA 1TRFA 2W00A 4HRGA 2QU8A 3BB3A 3QKSA 1KFXS 1RW4A 1X8LA 3MSXA 4D2IA 1KAOA 1ZM4A 4HREE 1FZQA 2GDJA 3CRMA 1Y1XA 1N0WA 1RRPA 1L2OC 3MCAA 2GVDC 1QHIA 2R9VA 1LA3A 2LHIA 2QP4A 3EWAA 4PQFA 4UNNA 1G64A 2MHHA 3ZLJA 3SYLA 2KAVA 3IGFA 1XD8A 4EPYA 3U5ZB 1IY2A 1ZCBA 2CL6X 4YBHB 1NMZA 4M2QA 4IVQA 3K0CA 1GAJA 3T34A 2ZYWX 3A4MA 2GHIA 2VA8A 4L9SA 4PC2A 4NL4H 2NIPA 2P2LA 3WRXC 4D82A 4YXWD 2QBYA 1MABA 3CRVA 3C14C 3MAAC 4G5QA 5EZ5A 3F3YA 4OQXA 2GBLC 5EXSA 1N3BA 2RGBA 3TR0A 4AKGA 4G5GA 4CZ2A 5HLOA 1QHXA 2IXGA 4ZCUA 3QPVA 3OF5A 3FOZA 4RKFA 2YOHA 5G41A 2IHBA 3RLZA 1E2DA 2B8WA 2ISDA 2RH5A 1WB9A 2OESA 2X8AA 2ZSAA 4HAVA 2BC9A 3CF0A 3EAQA 3SFZA 5I2OA 1SL7A 1J7KA 1E2LA 4FMDB 1W2GA 2R44A 2ZYVX 3BWDD 1G16A 4I81A 5G3YA 4R71A 2TMKA 1R2UA 4LV5B 2O60A 4LSGA 4E09A 1P2SA 4HZUA 3PATA 1NVXQ 1TN4A 1DJIA 3BFXA 5HE8A 1MR3F 5C4MA 2ATVA 3IHLA 2CL0X 3CX8A 4MKFA 3WP0A 2HEIA 4L5BA 4QJ3A 1D5CA 2JOJA 2R2IA 1CJMA 5FOXA 3LQQA 1KNXA 1DPFA 2BMJA 5CSJA 3MLEA 4RJLA 1PV4A 1OFTA 1S6IA 1FW6A 2ZANA 2A5JA 3ZH9B 1XPOA 2GCOA 1NUBA 4DBLC 2FSHA 1WDCC 1JJVA 1TPZA 1D9XA 2GXQA 3KDSE 2KFHA 1N6OA 3LBIA 4PZLA 1CRPA 3FS7A 2RAPA 1CLMA 2KOTA 1GRRA 1NF3A 2BDTA 3K09C 3QXHA 4B75A 3LD9A 3AF4A 1H4BA 3W3AA 1B7TZ 2O8FB 1AJ5A 4B2LA 4DEXA 2M1UA 1R4AA 3R20A 1SQ5A 1QASA 3SIBA 4A6PA 1YR8A 4LYAA 1KY2A 2HQWA 3RSOA 3BS4A 4GT1A 3F5FA 4URVR 5KSOA 3GLGE 1QS7A 1OH6A 2O8EB 4P33A 3TMKA 3O8BA 3DD4A 1W2HA 1UHHA 1ZM3A 2IYVA 1OJLA 2PZGA 2VO1A 1H8HA 3CH4B 2R2AA 5I2LA 2VHQA 3E70C 1ZM7A 4AURA 3C7KA 4Q4HA 4DLUA 1MV5A 1OFIA 3QVVA 4TYWA 3F0TA 1NKTA 3KO0A 2IS9A 2LCFA 1MO3A 2V1XA 4UQOA 1OXSC 4NP6A 3FGNA 3A1VA 3NC0C 521PA 4D4LA 1RTP1 1NJGA 4WQ2A 2VIIA 3AQ4A 4OI0A 3FFBA 1SKYB 1FI6A 5EE5B 2L98A 4G3XA 2ONKA 3IILA 2AWNA 4JBWA 1S5GZ 1G5RA 3CH5A 1KKLA 4BLTA 1KSOA 3ZVMA 4AQJA 3CIOA 4IKEA 4OK6A 4ARZB 2HPSA 2QMOA 3W34A 4N3NA 3ZDQA 3KQHA 2ZJOA 1PK0D 4XYNA 3L0SA 3IO3A 1SBJA 3FHTA 4LJ6A 2X2FA 2VP5A 2ECKA 2L2EA 2E9SA 1CS4C 2QE7A 3FHOA 2EGDA 4TSFD 1ODBA 4C9BA 1XCGB 1TCOB 5DHAA 3VR4A 3RS4A 3KQLA 1NSFA 4CPVA 1R0YA 2ZI4A 1ZM2A 1TNXA 4ICBA 1SHZA 2OFOA 1WP9A 3DVKA 1H65A 1AKYA 5HKYA 4TLEA 2D3WA 5GJBA 2W6ID 4HLUA 5JEEA 1RJVA 4GAOA 5CSIA 1CM1A 4MYUA 3KJGA 3EK4A 4JMPA 4JLNA 5C4GB 1W46A 4D80A 3DVMA 1K5GA 1VHTA 3TUYC 2ERYA 4BUJA 5TVKA 2JLXA 1X8JA 1E2IA 2VSOA 4LPSA 5CK5A 4M1TA 3IKJA 1E9DA 4EJSB 1CTRA 4Q1CA 3KQKA 5DO9A 1R5NA 2BCGY 4LGMA 1U9IC 1J8MF 2J7PD 2K2FA 4US1R 3R7WB 3HPRA 3U3JA 4DCNA 4KFUA 3FHCB 4BZXA 1US8A 1P2TA 3L8YA 2NO1A 3PUZA 1G18A 4LHVA 3J81k 4C0LA 1SVMA 1Q44A 2FPMA 4TTRA 1EG4A 1Q57A 4A0GA 2F3TA 2ZS7A 1N6PA 4A8JA 2W2XA 4DDUA 3GLFE 4H9GA 1A82A 4MZJA 3PV0A 2KBIA 1XFAA 4B3DA 4MDFA 4LDJA 1NP6A 5JECA 3AVTA 4HDQB 1BMFA 4G0NA 4LX0A 4RZXA 5CIWA 4YONB 1AHRA 3ZZUA 1IQ5A 3D0YB 3NSLA 3DHWC 4MRXA 4GOXA 4XD7D 3W6PA 4BEJA 1Q12A 2A5GA 1Q1EA 3X1WA 2R65A 3K0AB 3SZRA 4ORAB 1EK0A 3JZAA 1FQKA 4TMZA 2F2OA 1QJTA 4W5WA 4B76A 3PUVA 4XSGA 3THYA 1F4OA 1P6XA 5BN4A 1Z6XA 4XVRA 2FCDA 1UEJA 1JAIA 1E3MA 2IA5A 4MH0R 2VF8A 1OT3A 2PEYA 4O25A 4N1GA 2PLFA 4PTLA 3GLIE 3BIFA 3KXIA 2Q91A 3PUWA 3ZQJA 5F6TA 2OSBA 3B1VA 2XSZD 1AJ4A 4Q1DA 1XYDA 1RJ9A 3H86A 3K0FA 1U8ZA 4EFMA 2GEDA 2CTNA 3AGPA 1LY1A 2BOVA 1G8FA 3LK0A 1T3HA 3TE6A 2ZRIA 1U0LA 1OB5A 1NMYA 3U3KA 3U6KA 3AP2A 2QBYB 1TIZA 1W7IB 4EPVA 5FOSA 4NBSA 2QM7A 4YMTA 1PSBA 3HU2A 3IDQA 3QJYA 3F45A 2VPPA 2FJUB 2EFGA 4KXFB 3C16C 4RD0A 3KF9A 3EPLA 1PVAA 2YWFA 3LW8A 4JKIA 1TEXA 1KK7Z 1QIWA 4XJKB 3PLFB 1MO4A 2SHKA 4V0LA 3I5HC 1I2DA 1T91A 3ZIAA 2GZHA 3GQBA 3QXJA 4ITRC 4JLKA 4AYWA 3L0IB 2IYQA 5AUQA 3BQ3A 3ZS9A 3B8HA 5GVRA 1M2OB 1GZSA 1XXHE 1G7CA 2PLRA 2PASA 1SVIA 4NCIA 4A4BA 3LL8B 4RVCA 3EC1A 2ZTSA 3K0EA 1KMHA 3SBEA 2V54A 4KAXA 2RGNA 3B1YA 4GI7A 1AZSC 5HCIA 4IEIA 5EQTA 3W9YA 3WNBA 4EFLA 1HQVA 1HUQA 1SVSA 2FNAA 1GL6A 2NZ8A 3I5GB 4TT3A 1OKKD 2QI9C 2QL6A 3SOPA 1RPZA 1OIWA 1JAHA 3V9PA 4IW3B 2ZE5A 3ZD7A 1BT6A 1RYFA 1MRNA 3BE4A 1DOAA 1FUUA 3G5UA 2NPFA 1VG8A 1LXFC 1G3MA 5L3QA 2QA5A 3U44B 4Z8XA 1D8TA 2ERXA 2WOJA 3LDAA 2C03A 4JQ0D 3IBGA 3QXCA 1NYAA 4Q9KA 1NSTA 1E1RD 3R9WA 1E0AA 1G33A 1G7TA 1WRBA 3K1JA 2D06A 3IQOA 1F2TB 1GQMA 1HT9A 2C77A 3EG5A 1RVDA 4W5HA 2H2KA 2G2BA 4M1KA 2CVHA 5TARA 3JTDB 2WJJA 1N65A 3VX3A 2O0KA 4YGAA 1FNNA 1OFUX 3SR0A 1DJYA 1XTJA 1KDRA 5HE9A 4NDBA 4W9MC 3DM9B 2ZUCA 2MSDB 3W8RA 1RROA 4GDFA 3CR7A 3JVUA 5B30A 2O52A 3T1QA 1ZNWA 4CEHB 1OW3B 5CJPA 4MRPA 1X6VA 1FF1A 1Z6YA 4PQRA 4A0HA 5DSZA 1QVIZ 2IYLD 2HV8A 3MJHA 1UHIA 4MGYR 4FN5A 3LA6A 5H1YA 1GILA 2D74A 4L15A 1YURA 1Z0AA 3BK7A 5IHPA 4NONA 5DN6D 5F9HA 3W6OA 5CB6A 3WRYC 1YVHA 2JJ1A 4LWZA 2O8FA 5JJIA 2UKDA 3BH6A 1KO1A 2SASA 4B6EA 1KWOC 3UKDA 1P9RA 4HEJA 3PG5A 1L2TA 2KQYA 2CCJA 1HE1C 2WSMA 4HI0E 4LJAA 5B57C 4RSGA 1COWD 1GOTA 4CFRA 3MD0A 2O8EA 4AI6A 1F5NA 1UKEA 1CMFA 4FIDA 1EL4A 2CXJA 3GK2A 4LJ4A 3UK6A 2WWHA 1E98A 1NPQA 1E9EA 1BU3A 1SXJB 1XEXB 4V03A 3JVTC 1MH1A 5DNYB 1E2FA 1JF2A 2WV9A 1OOJA 5AEQA 2PBRA 2F9LA 1SR6B 2JZIA 2ZRPA 2BIFA 2QPOA 2Q0HA 2J3EA 2WPDD 2W6JA 2B21A 4Q19A 2MJWB 1XJ0A 2WWIA 2BEKA 4Z8YA 4PSAA 3QXSA 4ZCLA 4BY4A 2QMUA 5AUOB 2CL7X 2EC6B 4OI4A 1DE0A 4NYJQ 5BYJA 3SIAA 4LJYA 3OIWA 4Z1MD 4IHQA 4ARZA 3RVBA 4Q04A 4CFQA 1JC2A 1K5DA 4QBHA 4TQAA 4BFZA 5JI2E 1DBSA 2ZRFA 3OEHA 1RRFA 2IYWA 5I2QA 4OHZA 2BHRA 4ACBA 4C2UA 3A6PC 3TSWA 3IQQA 2XOKD 3LBNA 1VPLA 3TDUA 1S6JA 1ZVQA 2YWHA 4PHHA 4IOLA 2WSSD 1IJ6A 2WWYA 4BLSA 2I94A 1YE8A 4B35A 4QM7A 1YZTA 2TN4A 3NIBA 2Y8EA 2HF8A 2QRZA 2BBSA 4B3BA 4WRIA 2ZU6A 2M1KB 2LMTA 2MRDA 1ZP6A 3EZFA 4LJ8A 4JT2A 1NBMD 3SU8A 2M7NA 5AANA 2HYDA 3TS5B 1R2QA 2JQ6A 3AV0B 2PL3A 4M1WA 5K8UA 4CRWB 1G9XA 3CPJB 4H1UA 2BL0C 1TQDA 2Z4SA 1UFQA 3OESA 2F1HA 4P4TA 1B9AA 1ZNXA 4N1FA 4OK5A 4BLPA 5FBVB 3IQWA 4EJSA 4I1UA 3U61B 1AKEA 1ELOA 1F4QA 1XB2A 4R98A 1NCXA 4IDPA 3A4UB 2WCEA 1U8YA 2EYUA 2PT7A 3R7WA 4JLOA 1ZW6A 3WMGA 5AXIA 2W0MA 4FCVA 2G77B 1K8UA 2P65A 3QKSB 3U7EB 2CLCX 2PRUA 1G5TA 3K53A 5AWFC 5EE1A 1RZ3A 4V0OA 2UZ3A 5H68A 1YTZC 3NDPA 3QBTA 2GF0A 1OFHA 5SZKB 2QAGC 1E0KA 2FMXA 3QKRB 3QUSA 5FBRB 4DVGA 1UKYA 5J4LA 1P5ZB 4MBEA 1SK6D 4FMCF 3O8RA 2GZDA 4KFRA 2C99A 5SZHB 2MA2A 1YZUA 2FCEA 2QPAA 4FCTA 3D0YA 1E2EA 2V6JA 2JEOA 4WZAE 5E95A 1R5OA 2OAP1 2REOA 3K0AA 2A5DA 1K9KA 2GZAA 1B7TY 5LB4A 3T15A 1FQJA 1KFUS 1W0KA 4TLCA 4V02A 4LYHA 3RS5A 2AN9A 1QATA 3SS8A 1MO6A 1TUEA 4XIGS 1VMAA 1G7SA 4R2IA 2M0RA 1HT2E 4Q02A 2XJ9A 5PALA 3QKTA 3TRFA 1VIAA 4GOJA 3CWGA 4KVGA 3TH5A 1W36C 5KPJA 2L50A 1CFCA 1GKYA 2QGNA 3A4LA 1KZ7B 5F9FA 2LMUA 4DIEA 3ZVRA 1CKKA 1BG1A 2V4ZA 3TW8B 4JBXA 5D3QA 2XB4A 1GNPA 2AD5A 4TLBA 4HZUB 2P3SA 3FKSA 2B1UA 3KFXA 5GADl 4MA4A 3HYTA 3EARA 3EVVA 1M46A 1FW4A 3OAAA 1S2MA 1M45A 3AH8A 4EPXA 1G19A 4B73A 3U60B 1S5GY 3EPHA 3AVVA 2FJUA 3WYGA 1HQYE 2PH1A 1LB1B 2K7BA 2PZEA 4YGEB 1Z0FA 5H70A 3AVUA 1DTSA 3D6TB 4CT4B 4XJKA 2OAQ1 1E2NA 2G1KA 2FEOA 3B13B 3UIEA 3H2YA 3TK1A 2HJVA 3CB4A 4LHXA 4PAQA 4BFYA 1JXOA 1S26D 1MO5A 2OLJA 2Z83A 1W0JD 2JGNA 4ORCB 3PUXA 1JSAA 3RABA 4F4IA 1OSAA 2JAQA 3O8CA 2BJWA 4NH0A 1G7RA 1M7BA 3KZ1E 4GFDA 4CF7A 4B3GA 1I4DD 4QNRA 4M53A 4JS0A 2XEXA 1UKZA 4M2PA 3PQCA 4MDEA 2VL7A 2F3ZA 4GGFA 5JI3E 1LA0A 2VBCA 5JOLA 3QENA 1R10A 1IN4A 4YMWA 4JIMA 3IIMA 3KL4A 4MGIR 1V1GA 3DKVA 2JPTA 4RD4A 2Q21A 3CR2A 4OV2A 1R6PA 2L4IA 2VEDA 3CNNA 3TNFA 3UMRA 1S9DA 4TMKA 3VR6A 4ESVA 1O87A 4LOAA 1WCV1 1W7JB 1BS1A 2ASEA 1QHNA 1UDXA 2Q9BA 1JUOA 1XRJA 1DADA 1GRNA 3U44A 2ZN8A 1KQMC 2REBA 2XITA 3MFYA 4WVFA 1ZD8A 3B2EA 3OP0A 2ZYTX 3NHAA 1JALA 2BBWA 5DKRA 1MKYA 4IXMA 4EIWA 1LVGA 1Z2CA 1A29A 1NX2A 2VP6A 4TL7A 2Q3HA 2GXUA 5FR1A 1Z47A 2KWIA 1KK8B 1X1RA 2BWJA 2QT1A 5FH9A 3IIKA 2LP2A 3PN7B 5K89A 3RRNA 5D69A 4CIDA 4EAQA 1P61B 2VYFA 1T9HA 4TQ9A 5SZIA 5C46F 4F7WA 1ZNYA 2AUCA 4TMWA 4DRZA 3S1AB 2H61C 1EFRD 1CF4A 3U2QA 2PMKA 4P0TA 1ZCAA 4RZUA 3WBKA 2D8NA 1SVOA 4A6XA 2LVKA 2ZI7A 1S3SA 1UHJA 2OS8C 5IT5A 1CFDA 3L0OA 1PUJA 3CR5X 5A0FA 2X19A 5B2ZA 4HLDA 2OLKA 4MRYA 3EZ9A 5FI1B 1ALWA 1L2OB 1XMVA 1K94A 3B82A 3ADKA 4OJKA 5AJWA 5C18A 3PJRA 3ZWHA 2QPTA 1DMOA 4IL1A 1ODFA 3BH7A 3GJXC 1NN3A 4GMDA 4D0GA 4EKDA 4MEWA 1D2NA 2FEMA 2CBLA 2CMKA 2EU8A 1XFVO 4NQGA 1G21E 1Z29A 2VSFA 3TUJC 4IFEA 1QBKC 2NO0A 1US8B 3LRPA 3HU3A 1HT1E 1Z0KA 2CE7A 2OBLA 2IUTA 1SVKA 1K9UA 2XX3A 2B92A 1XCMA 4PDZA 1RFLA 1SXJA 1XEXA 2ZRMA 1NVWQ 4ZV4A 1LFDB 1B47A 4DT1B 2NCPA 4Q9HA 4A8JB 2BJVA 3DVLA 1RKBA 3A4NA 3PENA 2FDCA 1N25A 4CEJA 4B2PA 2JATA 2G6BA 2GAAA 1D6JA 1XD2B 3PEUA 3ZVLA 3VX4A 2JNXA 1EH2A 4URWR 1GDDA 5HKWA 1H8BA 5DYIA 2IEZA 2PT5A 3X1YA 4PSKA 4AD8A 4EUNA 3DZ8A 3P32A 4D0LB 5EXXA 3SE0A 2LLUA 2BEJA 4RFSA 2R6FA 1YZGA 3EASA 2KJQA 3THYB 3DEFA 2BCAA 1W4RA 1XBTA 1TUIA 1FNMA 2LHLA 4Q21A 1ZBDA 2HF9A 4U5XA 4B47A 1ZAKA 3DOFA 3FIAA 1UADA 2A3RA 2ZR0A 1YVLA 2E30A 2WZQA 2XTMA 3I73A 4I1VA 4M1YA 2PZFA 2OV2A 1MRSA 3UWOA 3EK8A 1AK8A 1E2PA 3M0EA 1X3SA 3HJNA 4TSFA 2ZNDA 3K0FB 1E0SA 3RS3A 1MR8A 2L0XA 4BGDA 1DAHA 2EFEB 1WDCB 1K96A 1TAGA 5L3RA 2JLWA 1RWYA 4L16A 3CWZA 3ECCA 1J7QA 4ZO4A 2FZLA 3SJZA 2Z6VA 3SDZA 1KNQA 4B2IA 2WHXA 2W6IA 1FUKA 4ZPXA 4JBYA 4P31A 4HUQB 4S2EA 5FTMA 1NVUQ 3ZZTA 2V1UA 2Z5FA 4URYR 4DLXA 2ZUDA 2XXAB 1YVDA 1E69A 4HZIA 4IJMA 2JRFA 1ZOTB 3QKUA 1OMVA 1PVBA 4PPFA 4BFWA 4AYTA 3LVRE 1CULC 5J3XA 3GLHB 1FX0A 3X1DA 2V53A 1ZC4A 1Z2AA 1KSJA 1VKJA 1LF5A 1YUUA 2OHFA 5HCNA 2DOQA 4C7OB 2FGJA 1YX7A 1Y1UA 1R0ZA 3ZYCA 1WBBA 3AVYA 2ZSFA 3W8NA 3QKRA 4DB2A 5FOVA 1B23P 2LKCA 2F1RA 3G0HA 2IL1A 3GFPA 4KSBA 2ZRSA 1QVIY 1V5WA 3FMIA 1KMHB 2M97A 4US0R 2VP0A 3ND9A 2IWHA 1DG3A 4A0RA 1LNZA 1NN5A 5DKNA 3W90A 1CDMA 3K70D 2OTGC 4OYHA 2M29A 2LLSA 1J7RA 5EP1A 2CK3D 2GNOA 4GSYA 4L9WA 2WAXA 2C96A 4QOSA 4XD7A 4TZ6A 5DISB 3ETLA 3NEJA 3WP1B 3LW7A 1QX5B 4BFXA 3A1SA 1SNLA 1OYWA 2QTHA 4A36A 1L8QA 1EJ3A 1YQTA 5L3QB 3LCPC 2CJWA 1OH8A 1N6IA 1SKYE 4MZLA 3LBHA 2KI6C 5FPSA 4MGZR 1S1EA 5CPVA 1WLMA 4I1OA 2KSPA 4NHOA 2HQ8A 4D25A 4Q4AB 2M8UA 5IDVA 1FPWA 2CHGA 1XMIA 3PFIA 4KCGA 4R7ZA 3TAHA 4AG5A 4DKXA 1PALA 5BN3A 3BOSA 3PSRA 2O0HA 1IG5A 1DARA 3RYTC 2ZI9A 2V9PA 3CW2A 1IM2A 4B34A 1JECA 1R8SA 4EPTA 1E79D 4WBSA 2J0QA 3BC1A 2JT3A 2CXXA 3VROA 1TF5A 3FWYA 4URUR 1OZSA 2KI4C 2VRGA 2NG1A 3LX5A 5JLJA 2RGXA 1JEEA 1DAFA 2XNDA 1FP7A 1PLJA 2HDNB 1A7JA 4Y0AA 4JSYA 5JJKA 3GEEA 1S1MA 3TJZA 4QBFA 4JYBA 2GAOA 4MYHA 5K8LA 3AKDA 4KI0A 4C0QC 2IYXA 3ZGXA 3CRRA 4I5JA 2ZE8A 5D3MB 1U0HC 4OQFA 4GNKB 3KQNA 3I32A 1I2MA 2QTVB 3ND8A 4FMDF 3EIQA 4MVFA 2IYZA 1X02A 1GG2A 2KBEA 4PC1A 5LB2A 3O6BA 1KMQA 2G0TA 3KUDA 3I92A 2KAYA 4PXAA 3NH9A 1N0VC 4QRHA 2JCSA 1YUSA 2GRJA 1R8QA 4M2LA 4M9XA 2NMVA 1TNPA 4DZZA 1JB1A 1U90A 2QGZA 5EE0A 3L2OB 4LHYA 3D10A 1NVVR 3I5XA 2O8CB 2OCYC 2D4HA 5KU1A 5IBWA 1OKKA 1SRAA 4NCHA 3R8FA 4D1EA 3N2IA 1QX2A 2GV5A 3QPWA 3GCGA 1YRUB 1JBAA 1QG4A 2FA9A 5AJXA 3ZQ6A 4C3ZA 4MRRA 3SG5A 2ZE7A 2HUPA 1W36D 1V1FA 3FE2A 4LBWA 2BKIB 2FWRA 1JXMA 1XD9A 2VQSA 2YNMA 2Q9CA 2ZEJA 3HYRA 3LH5A 4GPTA 5HYDA 2AD1A 2EFDB 2JLZA 2OG2A 3GJ0A 2FFBA 3EA5A 4AYXA 4BFSA 3MWJA 1TMKA 4XWOA 4V0NA 4YGDB 1K9PA 2BKUA 2CCGA 3ICBA 1TEVA 4LHZA 4FMBB 3HWSA 2LP3A 1H8ED 2JLSA 4BRUA 5HKKA 1S3GA 2C2HA 2C9CA 2MBXA 1VCOA 2ZS9A 2HXYA 4I99A 5DLQC 3B85A 1MUXA 4DSOA 4YMUA 3E5HA 1E2JA 2KGBC 1F8HA 1VCMA 4IVPA 5IK2A 4DIRA 1NLZA 4PHTA 3VU9B 1B8LA 2SCPA 3S1AA 1TQ2A 1ZIPA 1TTTA 2YV5A 4TMVA 2BV3A 3RS7A 2LVJA 1IWQA 3WXAA 1NN0A 1Z3IX 2WMOB 5AJZA 3WYFA 1G8PA 2G1JA 1C07A 1NIWA 1SMGA 1VDZA 3KB1A 2F2PA 4YI8A 1QHGA 1G291 4AY2A 2GJ9A 3I5HB 2CVFA 3HP1A 3TSOA 1XFXO 3EZ7A 3P4XA 1YR6A 4QFMA 2JLYA 2P6RA 2W58A 3CO5A 4ORBB 5DN6A 1YZKA 5E3HA 4JKYA 1BIFA 2WWXA 2MAZA 2ZRTA 4DLWA 4YMVA 4PPQA 2XZLA 1A2XA 1XWIA 4B44A 3VRPA 1NRJB 4Q03A 1U5IA 4YRUA 2A78A 1YJ5A 2AXPA 1D9ZA 2OILA 2WCFA 2FSIA 5JHGB 4TT3D 3I4LA 2LVVA 3C5CA 1CTQA 3P26A 2XZOA 2P6UA 5CB8A 5KNCA 1JWDA 4I4LA 1SCMC 1COWA 2OFWA 3DO6A 3QSYA 1TNDA 1CDNA 1G8GA 2GBLA 4JVNA 3EK7A 4DT1A 2BE6A 2LVIA 2QT0A 3JZMA 1UJ2A 2WCBA 1F2UB 1XD2A 2XAUA 3SJSA 1G8YA 1ZIOA 4M0LA 1DG1G 121PA 5FPKA 2CLDX 1S1CA 1YRTB 2EVWX 5FPHA 4DLVA 1CIPA 3I8SA 1Z0JA 1O3YA 3P1JA 1M8PA 2ZNEA 1A2BA 1KGDA 1KO8A 4PALA 5CLLA 5EUMA 1YX8A 4M1SA 1CJVC 1M1YE 2KFGA 4D26A 2K8MB 3NHBA 2QNRA 3PEVA 1KOFA 4UJ5A 5E7IA 3TQCA 4CGZA 1BYIA 2HT1A 1N6RA 3GLGB 2ZE6A 1ZUZA 5CDFA 4RY2A 1Q20A 4Z1MA 3GJ4A 2GA8A 1QDEA 5CIQA 5J47A 4RD3A 4Q9JA 1XPUA 2ZXUA 1KSMA 1B0UA 2D2EA 3FMFA 2XOKA 5KSZA 4O0MA 1MQ1A 2H5EA 4NCKA 4C0JA 3CS1A 2GK7A 1OE9B 1GL7A 4YDHB 4N1AA 1AS0A 4FINA 1KO4A 1BLQA 1NVVQ 3K09A 3CZTX 2JDID 4C0BA 1YKSA 3FFAA 4HUQA 4LJ5A 1NBMA 2LV7A 1IRJA 2WWWA 2BBOA 1E96A 1NIPA 2GXSA 2R6DA 3AGQA 3QOFA 3QF4B 3NDBB 1P9NA 2XXAA 1Q3TA 2JULA 1T8TA 5JS8A 3HU1A 3HR7A 1KWOB 5G08A 1JR6A 4BE7B 1RRCA 1JR3A 5AUPB 2NOAA 4NYJR 3GLHA 1GNRA 4Q66C 3DKPA 2ZJ5A 4JLBA 4HRHA 3HR8A 1LINA 2J45A 1HTWA 4Q9IA 2PMYA 1AP4A 3BJIC 4BLQA 3SG2A 1AS2A 1XEWX 2QTFA 4C7OA 3JVTB 1EXMA 1TX4B 3NH6A 3SG4A 2D7CA 2ZKMX 2PMDA 3RS2A 2HXSA 2YC4C 2YOFA 1JF0A 4MSPA 2IT1A 3CRW1 4DLYA 2VHCA 1W5SA 3E2IA 1DF0A 1RC8A 1OQPA 3AAJA 2QY9A 1OH5A 1GKUB 3NC1C 4UXIA 1GJYA 1XF9A 4JZKA 2VH5R 1AUIB 4YQFA 3A1TA 1KDOA 5M04A 3TSZA 2AK3A 2Y5IA 1KAGA 4OHVA 4TYYA 3LAWA 3LLUA 3PEYA 2IF0A 1C9KA 1JBKA 2G88A 3H1TA 3RDPA 2WTUA 3H4SE 4TL8A 4KO8A 2GETA 3FB4A 3N5CA 2BBNA 2V7QD 3UMSA 5CK4A 1UUSA 3SI7A 4DIDA 3U3RA 1NN1A 4DLSA 2OM2A 3AP1A 2ZI6A 5FI0B 2RHMA 3GLFB 4JPZB 2PEZA 2RHDA 2KBFA 2KE5A 2OBMA 4IOJA 4Q4AA 4Q1AA 2AHOA 1IOZA 2M49B 1N5IA 4LC0A 5FL7D 3I5IC 3NBZC 4A92A 5KYKA 3KKQA 5FTLA 2ZSBA 2J41A 5JRZA 3CUEF 4Q00A 2WIBA 2IHYA 2LUCA 2IW3A 1KO5A 4V0ME 4WAUA 3WYAA 4QGGA 3TUZC 4ERNA 4KYIB 2RGDA 2V8OA 2BL0B 4GFTA 3TDZA 1I4LD 3C8UA 1XJCA 3LXRA 2GKSA 4M9QA 4AKEA 2DPXA 1RK9A 2QP9X 1NY5A 3SJCA 4DC9A 4QHSA 2CEAA 1X1SA 3NTUA 3I5FC 1CKEA 1U9IA 1ZC3A 3Q7PA 1XDBA 1RFJA 4IDNA 1E2GA 1LF0A 4DCKA 1DVRA 2JA1A 4HB0A 5CM9C 3SJAA 2BMDA 1B8RA 1VYVA 2GGZA 1F70A 1ZM9A 4RCZA 1M39A 1L7VC 2RGAA 4MRVA 3OX6A 5D3MA 2I1VB 2QQEA 4GNKA 3Q7QA 3CM0A 2JTTA 1Z8FA 1NI3A 1UBGA 4OL0A 2R6CA 1UHNA 2JWWA 1NIJA 4PAMA 4F38A 1W0JA 1IN7A 2QAGB 2J0UA 1G4YR 3TVTA 2JU0A 1KJYA 3KJIA 3BAFA 1E0JA 4A0FA 4BLRA 2F1JA 3V4RA 2ZSDA 1Z0IA 1DAKA 1XZQA 5LDDC 3PVSA 721PA 2V55B 4FQOA 2IUSA 1FBVA 2J0SA 3TVDA 2QSYA 3AKAA 1JPJA 2O8CA 1LS1A 1TQ6A 3NXSA 2O8BA 2WOSA 4UNQA 1KK0A 4QJ5A 5JS7A 3GPLA 4G5SA 1CR2A 4CEJB 1NLYA 1W4AA 4GBAA 2KI6D 1EFUA 3C5HA 4BQSA 4HATA 4K81B 2GESA 3OEEA 2DY1A 1J1EA 3A37A 4BWYA 4PANA 1G8HA 1KI9A 1R7RA 4QL3A 2LANA 2J5XA 1W36B 4FD2A 4MKIA 3T35A 4YGCB 3NXAA 1XXHB 1WMSA 5EE9A 4RFSB 4UKDA 3K70C 3EZ2A 3SHFA 2L51A 2OZEA 4XH9B 1OZOA 1P4SA 2QUZA 3KHEA 3TZ1A 5KPDA 3CPEA 5JFGA 4F4CA 5FYXA 1DO2A 3CR4X 1Q1ZA 2GCPA 3B6EA 4JL5A 3AB3A 4KYUA 4QGHA 1BMFD 4Q48A 3THXB 1EGAA 1C4OA 3VU9A 5AERA 2YZ2A 3B9PA 2XTZA 5K8IA 3KUCA 1Z0DA 2IS1A 2AWOA 5KDLA 1YZQA 4D4KA 5KNBA 5JMTA 3OZXA 5BQ5A 1N5LA 2ZJ2A 1KKMA 2VP9A 3QVUA 4NDDA 1EFRA 2EWWA 4QHTA 1EWQA 3GJ6A 1DAIA 1XEWY 2PCLA 2Q3MA 3O4YA 4PFSA 2J9RA 1E94E 1MOZA 2CNWD 3CF2A 2FV8A 2Q9AA 2ZPTX 3UWKA 3GEIA 2FE4A 2VLIA 2MSCB 4NE2A 2EFCB 4PHKA 2KQ6A 1ZNZA 1KJWA 2KSQA 2QORA 4P5OE 1ZUIA 1XTIA 1XMSA 2BCBA 2GEUA 2V3CC 3VAAA 2NCOA 1E2MA 5K8TA 2AX4A 1P73A 1ONBA 1QRAA 3IIJA 2JIZD 3ADDA 1FX0B 3PCRB 4UXHA 3UMFA 4LUCA 1SHKA 3T61A 3H4MA 3AKYA 2P0EA 3B60A 2F7SA 4BY5A 3OIYA 2JTZA 3BUNB 5FUYA 1KK2A 4Q4JB 2ZJ8A 1IH0A 2J59A 2CE2X 3NEYA 1F2UA 3M0WA 4DLTA 2ANCA 2Z0MA 5AUNB 2FSFA 3EZ6A 5EXPA 1KQMB 1F71A 1E9AA 1XK4C 2JT8A 1LTQA 1P72A 3GJ3A 4DUGD 2JASA 1VIYA 2Y4QA 1YRAA 1N2CE 3IO5A 4PO8A 3EPJA 5F98A 2IXEA 2JLRA 1GVNB 1X86B 3CRQA 1IN6A 1NMXA 2XNSA 4FTGA 3FYHA 3A8RA 1VECA 4Z54A 2EFHB 4IVRA 3GLGA 1DAEA 4OI2A 2PVBA 1ZD1A 1FMJA 3DPUA 2CJWB 3BRWD 2HJGA 4JLVA 5DH9A 3HX4A 5EZ6B 2J46A 2DWQA 4JJZA 3Q9LA 2KHNA 3KXLA 4MYTA 1YUTA 4NCJA 2QEQA 4A15A 1BF5A 3BBPA 4DRWA 5BYKA 4M22A 1J90A 1A5TA 2DHRA 3K0SA 1ZMZA 2GJKA 2EQBA 4Z51A 5TDHA 1DAGA 1UBEA 2OS8B 2X77A 4UPGA 3UANA 1LKJA 3CBQA 1J2JA 2ZI5A 5AJVB 1Z5ZA 1K93D 3WMFA 4QGFA 3QE0A 1C7WA 3IUYA 4GL2A 2AKAB 3EKJA 3QF4A 4Q18A 4B33A 1VYUA 2UZIR 1J55A 1KI2A 4PHNA 5GQQC 1K90D 1TQ4A 4RD6A 4TLDA 3SYNA 1BMOA 2YOGA 1G20E 4MRSA 2I18A 2K61A 1MT0A 1CJUC 3U6BA 2P67A 1W4BA 1Z08A 4LYFA 1E4VA 2P6NA 4DCTA 1OXVA 1XTSA 5J4YA 1E9BA 5FOWA 2QSZA 3I62A 1N6KA 1OXUA 1U98A 2C8VA 4O3MA 1NL3A 2OO7A 4US2R 5JHHB 1F6BA 3RC3A 4PC6A 3MGCA 4Q7MB 5J4KA 1FOEB 1Q22A 1L4YA 2EYQA 1UWOA 4PE7A 4PHFA 4QXAA 1G3RA 2ZJAA 2J7KA 2Q4UA 3GFTA 4YXWA 2IC5A 5ANRB 1L7ZA 3PIRA 1DJXA 4L4UA 4PC7A 2BKHB 4NDCA 1GKIA 1E6CA 2FH5B 4ILEA 1IJ5A 1OF1A 2F9MA 4KLNA 3JVVA 4DCSA 1XP8A 4PHGA 4C0SA 5ELXA 2RMKA 3FVQA 2Q3FA 4UJ3A 3L43A 4QC2A 1KFXL 4HYYA 4NZYA 1N5JA 4B71A 5FUWA 1KIMA 5JRJA 3X2SA 3RWOA 5KDOA 1UF9A 4BZQA 1T3SA 2QENA 2I2RE 3GLFA 1RE0A 2HF5A 2RGEA 2ZSEA 2F55A 4ZI3A 1V43A 2CDNA 3DOEA 4LBYA 4DLRA 3VNUA 4WIAA 3DVEA 1AGRA 4AWXA 2ZRGA 3I3SR 3L0PA 1SVWA 1W1WA 4IOMA 2ODWA 4F4JA 1IKUA 2W6JD 2ZAOA 1R5BA 4LJ9A 4EFNA 2K7OA 3BUXB 1OV4A 2ZRHA 4IDQA 1NJFA 4Q47A 1CNPA 2YJTD 3EC2A 3K0CC 4JWQA 1OMRA 2OPOA 4R1EA 4OQLA 2DYKA 1M31A 1W44A 1AM4D 2KFFA 1KK3A 4CLNA 1D1OA 3NVAA 1QHSA 1TF7A 3GK4X 3U3OA 4K8OA 2C98A 3HCMA 2YINC 3BD9A 1XFZO 3BORA 4BLOA 3GLIA 4DDTA 4BZPA 3OEHD 5HTKA 3LQRA 1PULA 1E99A 2ZVPX 1U94A 2BBMA 4PQYA 4PZZA 1HEIA 2L0PA 4NMMA 1Z83A 2QAGA 3U3MA 4RFVA 3KKPA 2ORVA 2WKPA 3I1FA 1AVSA 3PITA 4IOKA 4OKSA 2HLDD 3VQTA 1JFKA 4HAUA 2D7DA 1IQ3A 2A30A 4Q1EA 4TL6A 1U5IB 2A4JA 4YMSA 3BFVA 4JVMA 3SHWA 2OTGB 1RRGA 2BMFA 2FPLA 4P3YA 4BRWA 2HCBA 2VHTA 5IF9A 2KYCA 3Q5EA 3AM1A 4LHWA 2JJ2D 1P9WA 2WVJA 1K8RA 3W3ZB 5AFPA 1G3QA 3CX6A 1CLLA 1DGUA 4DSUA 2WOOA 4KBFA 2RGCA 4CYMA 3DZDA 2F43B 2YYZA 3CKLA 1IJEA 1KK7Y 1E1QD 4NU0A 4JL8A 3ADCA 2PJZA 3CX7A 4I5KA 2RCNA 3C4JA 3BXKA 4RKEA 3ADBA 1KCYA 1P75A 4GBMA 2OCBA 2OXCA 4WW0A 2IX3A 1OSNA 3RAPR 1LV7A 4PAOA 1XXHA 1KQVA 3TKLA 4B48A 5B64A 3KQUA 2DFTA 1PLLA 4NYMR 4A2PA 4B32A 1SL8A 3QQ5A 3MSEB 2FU5C 3SG6A 4MUAA 4OCIA 3VRQA 1H8EA 2MLFC 2AL7A 1JJ7A 3NSOA 4GMXA 3THXA 3VR3A 4GOKA 1KI6B 1NG9A 3D8BA 1P60A 4WXPA 2FFAA 1IXSB 1CJTC 4FI3C 4NDZA 3SEAA 1F3OA 4Q5IA 4M4SA 2QACA 3RHFA 2JNFA 3RSLA 3R9XA 2KI4B 1B4CA 2BE4A 4YLGA 3VNVA 3RNLA 1N6HA 5FBWB 3V00A 1W0KD 4B3CA 5KSYA 1CR0A 1XFUO 2ZVQX 4JLDA 1NX0A 4R2HA 2DFKB 2YC2C 4Q7KA 3OHMB 2ODBA 2MMCA 4KSCA 4JL6A 1KI7A 1XTQA 4TLAA 3ZD6A 5FTJA 4QJ4A 1LVCD 3FMOB 4FW9A 4TTQA 1Z28A 2JLUA 3BOWB 4U7DA 1R0WA 1IJFA 5BN5A 4M9ZA 4OHXA 3DMNA 2GF9A 3CZPA 1EWRA 2ONJA 3SYKA 1DEKA 1CM4A 3BUWB 5BXQC 2I3BA 2J7PA 3AKEA 5DI3B 2GGMA 4K46A 2WJHA 4I5NB 1HV8A 1TNWA 2HYIC 2KYFA 3FKSD 1TU4A 1VYTA 3AVQA 3CF6R 3LO5A 3N2EA 3M1IA 4M1OA 2R6AA 1XVJA 1KK8C 3MWLA 3Q8XB 3DDCA 3QEOA 2N1BA 5KSPA 1K6MA 4Q4JA 1XX6A 4KODA 2CHQA 3WHTB 3ZZ0A 5JSZB 2GILA 4JSTA 2IYUA 3VHXA 3OFND 1ZUNB 1DF0B 3AUYA 1X8KA 3FMPB 2CBZA 2DBYA 4QNMA 2C9YA 3TBKA 3LFUA 4HDCA 2ORIA 2ANBA 3Q72A 3QPUA 3TIFA 4HLUC 1FI5A 2AFIE 1IBRA 5BPJA 3NG1A 4PE0A 2LE9B 3LXXA 5EP3A 1WLZA 1IONA 3UPUA 1BODA 1J70A 2UVQA 3CLNA 1IY1A 2F8PA 1GIAA 1OXTA 2W0SA 4ZDKA 1SL9A 3IF7A 2RGGA 3AVPA 1S9HA 3UXMA 3DM5A 4GGNA 4MZKA 2H1LA 2QMHA 4NKRA 3VR1A 2A7QA 3A8TA 4A2QA 1CP2A 4DLZA 1KI3A 1BOFA 2H61A 3VRNA 3PXGA 3RRYA 5CJ2A 4BEBA 1NCZA 1Y0VH 1Z6AA 3VR2A 2XSZA 1IHUA 3MMPA 5GJVC 2WAYA 4HB4A 2C5LA 2K7CA 2BKEA 2KNEA 3D7MA 1F48A 1TL7C 2FX3A 2GJ8A 2WWFA 3QY0A 4N0DA 4A8JC 1WXQA 5CYOA 1G41A 5CITA 1G5PA 2FG5A 3K21A 2HT6A 4FWTA 2NO7A 2NO9A 2Y1NA 3TUYB 3K9LA 4I1SA 3RANA 1NY6A 2JDIA 4C0HA 4PR0A 2WKQA 3LWNA 3QG5A 4M8NE 3C15C 5HLVA 1E9CA 1WA5A 2W2TA 4F0ZB 3T06B 4WA7A 1CFPA 3OE7D 5E4FA 4DDWA 4AKHA 1I4TD 4HLQB 1XA5A 4L9MA 4CEIA 2O5GA 1Z63A 3B7GA 5I8NA 3VKWA 5HZKA 3KKOA 4BECA 3AKBA 2LUXA 1LW7A 1NNEA 4AOMA 1FFHA 4LCBA 1Z6TA 2KI5A 4KV9A 4LC1A 2AR7A 1MHOA 1II8B 1OH7A 1SCMB 1E2QA 2F3YA 1ZU4A 4KFTA 4NYMQ 1CLBA 4KU4A 2AMIA 1GTVA 2REXB 2BM0A 2N46A 2J0UB 1XFWO 2ZAMA 2FPKA 1S8FA 3MJRA 1KI1A 5FUXA 4E22A 1AN0A 1XJQA 3FPAA 5DHFA 4G01B 3ZS8A 4BPBA 2QAJA 1DJZA 4UNSA 2MSEB 1MWNA 4WZ6A 1UDWA 4EQ6B 2ZRDA 3VRRA 2ODNA 1J7PA 1QVAA 1OIVA 2M7LA 3VGOA 1GGZA 1SKTA 4IRUB 4URZR 4ASUD 4D81A 3QIAA 1N6NA 2H57A 1YZNA 4YGBB 2O8BB 1ESMA 2FN4A 3K9NA 5C1BA 4QJ5B 5L8VA 5FTKA 4PE1A 2QQ0A 4G5RA 2DR3A 3WNDA 3T1VA 5LD2C 1AQYA 1XTKA 2ZR9A 3BYAA 1YR9A 2ZETA 2JLVA 1CRQA 3OX5A 1T0HB 1R0XA 3QNUA 3KFVA 1FP6A 4Q1FA 3B1XA 2ZRLA 2V7QA 1CLUA 2IS6A 1BR1B 3CR8A 2B7CA 1G3UA 3GEHA 1Q0UA 4PO1A 3ZNIA 3D31A 4EDHA 1E1RA 3AEZA 2I7AA 1SXJD 1T5LA 4MRNA 4UNPA 5EJEA 4JVLA 2GEVA 1S6CA 1ZD9A 1JPNA 5FBQB 1PUIA 2LKDA 4A4DA 1ANKA 2YHSA 4II7A 5FL7A 2ZUBA 2C95A 3NBFA 4ABYA 5IRCD 2K7DA 1YR7A 2DCUA 4C0AC 1CJKC 1DO0A 2GK6A 3KKMA 2LM5A 1PJRA 1TU3A 4QKQA 1FTNA 5CSFA 4DUQA 4DS7A 2O5VA 3EWSA 3EX7C 2RGNC 1QX7A 1XEFA 3AVOA 1T4GA 4OI1A 2IEYA 1QV0A 4B3XA 5LBIA 2O8DA 3CNLA 4WQ3A 4LBVA 3PUYA 1S0UA 3MG9A 1SZPA 3D3QA 4HB2A 4JT4A 1F55A 1HYQA 1XCPA 2XTNA 1XTRA 2VRWA 8OHMA 1A4PA 5G53C 2WNDA 2NZJA 3CNOA 2A5YB 1IGVA 2IYRA 1M7HA 3QG1A 1UM8A 2YWGA 1G4AE 4POAA 2R62A 1CMGA 1SYMA 1E2KA 4ZCMA 2JXCA 4URXR 2J1LA 5J4VA 3ONWA 1GSIA 3GMTA 1OHHD 4JJKA 3REFA 4ZDJA 1B8CA 1QG2A 1VRKA 3MWYW 1DTLA 1A4RA 4KVAA 1E32A 4OJQA 2X2EA 3EW9A 5E7JA 1P2VA 4BFUA 4DWJA 3TW4A 1GNQA 4DCUA 3OB1B 4DJTA 2HETA 4M21A 3ZJYA 1GM5A 1Z22A 2PX0A 1QIVA 2YVUA 1SVLA 3B78A 1KK1A 4RZ2A 2BECA 2KBMA 3TLXA 2EHBA 3O2PA 1M7GA 2VTKA 621PA 2F43A 2GTPA 2GJSA 4HSEA 2WJGA 1U8AA 4OBEA 3TGPA 3UATA 2WPDA 1G6HA 2LC5A 3RM1A 1YU9A 5UKDA 1Q3HA 3KTAB 1BH2A 1FMLA 1GP2A 3X1XA 3RRZA 4BFTA 5FOTA 3I5IB 2IWRA 2H17A 3BUOB 3KB2A 3UG6A 3W5JA 1PRWA 1Y63A 3BB4A 1KSFX 4F93B 2H92A 3B1ZA 2FFHA 3DF0B 5JJLA 3EA0A 4E07A 1NKSA 4E03A 1HE8B 2I1QA 1DT7B 1KI6A 4PC3A 3EIHA 2CCKA 3PM8A 2IF2A 4LPKA 4A2WA 1JI0A 3WHLA 4XWKA 1QXPA 5A4JA 3I5FB 1T8UA 2C04A 3N70A 3OIUA 3RWMB 3EXAA 1OE0A 2WSSA 2ZROA 3THWA 2OXRA 4WZBE 3ICQB 2VF7A 4H1VA 2P6BB 1SKQA 4C30A 2IS4A 2ZRJA 4MYCA 1OIXA 3OHMA 5KOYA 4HB3A 2GVZC 2ZM5A 4NCNA 3A1UA 1AZTA 3NBXX 4MKGA 2CNWA 4W5JA 5FR2A 3DMDA 2IBMA 2WJIA 3O47A 5E7MA 2XB2A 3BOWA 5DI9A 1TOPA 1A2KC 4D4MA 4LRWA 1XO5A 5DI3A 5JWHA 4U00A 2G9NA 3P27A 5F3WB 1HQCA 2JIZA 4XJXA 1RYHA 3O78A 3T1TA 3SNHA 3CZQA 1UURA 4OKHA 4V0KA 2ZITA 3U4QB 3VHLB 3EVRA 3MRSA 3QBVA 4ZI2A 1K2HA 1W5TA 2ZJZA 1FL9A 821PA 3MUFA 5JSZA 4JLAA 3BXZA 1U0JA 4UXJA 4ZIRB 2XNDD 5B8IB 3B5JA 3K9HA 1YR5A 1SXJE 1NX3A 3C1VA 4F91B 3K8YA 1A1VA 3BB1A 3FWBA 2P5TB 4DUGA 1E4YA 2WJYA 5JEDA 4PHJA 1C1YA 3K70B 4A4CA 3CONA 4R9UC 1G3IA 1Z6GA 3P4YA 3CLVA 4PZYA 1J7OA 4WXRA 2WICA 4TNCA 5JJGA 4EJSC 4JVSB 2IYTA 1EXRA 3CGAA 2P5SA 1ZINA 1ESNA 4TMTA 4F92B 2KDHA 2NQ2C 2FSGA 3I72A 4GZLA 3U7HB 3KPXA 5TNCA 4AQIA 3KX2A 1T6NA 5DIFA 2IUUA 2ZR7A 1PLKA 4XWAA 1VTKA 2BCJQ 4PPGA 4D0NA 1U2RA 1H8HD 1J99A 1S96A 3E1SA 3LNCA 1WDTA 1Y1AA 1QLSA 1M63B 5HKZA 2F3RA 2ZYUX 4MGKR 4E5UA 2HCJB 3T5GA 3NSKA 3NKVA 3WMEA 2D2FA 5JWRA 1CU1A 1JEDA 1ZACA 1WY9A 4RZ3A 3AKCA 4B74A 1VHLA 2FFQA 2NPIA 4PO9A 4B43A 3SQXA 4GZMA 2LCPA 4P2YB 4QBIA 2Q6TA 1KFUL 3IEVA 1IN5A 1GUAA 1K95A 1QHYA 1KDTA 2ORWA 3KEVA 1G8IA 1E2HA 1S4QA 5P21A 3DVJA 5HKKD 3GLIB 4NYIR 1W7AA 2D62A 3AF0A 3HDTA 4U02A 5H8WA 2IYSA 1II8A 2I4IA 2LMVA 2QE7D 1W48A 4HLCA 4MITA 4L8GA 2LAPA 4TTPA 3UG7A 3VMFA 3WXMA 5IK2D 4FCWA 2ZJBA 1UEIA 3SFVA 2AK2A 1MXLC 2JT0A 3IPYA 5AR1A 4CDGA 2NO6A 4JLMA 1PSRA 3LY5A 2ZRAA 5J40A 4KBGA 4TYNA 5CSNA 4XTCS 1XFYO 4Q7LA 5JCPA 4LYJA 1RIFA 2NGRA 1TF2A 1KSGA 4EQ6A 4LJ7A 5L3SB 1XU4A 4XVQA 1CDPA 4P4SB 1EFHA 4LBZA 5EE3A 1EFCA 3WHKA 2XGJA 3L82B 1E8AA 4Q4LA 1J8YF 5EUQB 3FWCA 2FZ4A 4IFBA 3ASYA 2IS2A 2F6RA 2IXFA 2OT3B 4XVUA 2F1IA 5D7FA 1DVIA 1QHHB 2OCPA 4OQMA 2COLB 4USLA 1UBFA 3GFOA 4D6PA 2QMEA 2ZRBA 4TWZA 1BJFA 1OMDA 4HAYA 3FDIA 1S36A 1MF8B 4RD2A 1CR1A 3AAKA 2DFLA 2WIAA 4JLPA 1A75B 1CDLA 3NSIA 4O2LA 1DJHA 1Q80A 1XNJA 2ZIAA 2AKYA 4XOIA 1T0JB 3X1ZA 3W5IA 1N2DA 1C7VA 3DL0A 4ZKDA 4Q1BA 1SCVA 4IDHA 1QLKA 2DWPA 2LNKA 5DKQA 2OEPA 3Q85A 5HPYB 2QZ4A 2K2AA 4GGFC 5EP4A 4G5OA 1Q1BA 4KLZA 4OK3A 1MXEA 3I5GC 3NBYC 1GRQA 4IXNA 1GFIA 2WMNB 4AC9A 3AF2A 1KY3A 2WM9B 1U99A 4B6FA 1G17A 4DEYA 1AA9A 2W83A 5BWMA 4C0KA 2JLQA 1II9A 1NG1A 1EFTA 2PX3A 1QV1A 4ZCVA 1D2MA 1VG1A 3A1WA 2W2VA 4QJ4B 5AK0A 2R6GA 2DB3A 1UKVY 4MUBA 1WRKA 4QHYA 4A9AA 2VHUA 1F60A 5FPTA 3AF1A 5KNDA 5L3VA 4DDVA 1HH4A 4GP7A 4DCVA 1WQ1R 2H7VA 2HLDA 3L8ZA 5LPNA 2NTYC 3KKNA 4MN0A 3WNCA 1KTVA 3AF3A 5JCZA 4QM6A 5TB5A 1AJEA 1FPMA 4KFSA 2ZQ5A 1IXRC 1EG7A 1TTXA 2RKOA 2VP2A 3AUXA 4TN1A 1YHNA 2Y1MA 3JTDC 3RLFA 2WC8A 4FMCB 4UNRA 2ZU0C 2H8KA 1M34E 3QRXA 3R9IA 2JJ2A 4A82A 2VP4A 1AQUA 3EIEA 1II0A 1JR3D 3LVQE 2K0JA 3B9QA 3M4YA 4E68A 1E1QA 1WBDA 2XZPA 2ZS8A 2J87A 4CW7A 3ZIAD 2BCXA 3A36A 4TYQA 3KTAA 1S3PA 1SPYA 3LV8A 5GVSA 1TCFA 1EESA 1Z07A 4N0EA 4OQNA 3GJ8A 1XPRA 1VCNA 3QI2A 3LLMA 1KYIA 4NYIQ 3VR5A 1VCIA 3ZVNA 3Q3JB 5A5GA 4HAZA 3DF0A 1M6NA 2BMEA 4TMXA 2PJRA 4YI9A 3KXKA 4DB4A 2CNPA 1NCYA 4KJZA 5KTYA 2M3WA 3HPQA 3IEUA 1M74A 2Z43A 5FTNA 4ON9A 2ODEA 4ZKEA 2FGKA 3LX8A 2FOLA 3SG7A 4PSVA 5KO2A 3U7GA 2YKGA 2CLSA 5JWOA 1MABB 3CPHA 5FUVA 4MQBA 4EPWA 3KJHA 4GPLB 4N5XA 3IPXA 3IBYA 1SXJC 3ICEA 5HR5A 1BR4B 2C9OA 1AIPA 1W4CA 2BVNA 3IQXA 4ESHA 4U8DA 2ZI3A 1P2UA 1G1MA 1U81A 2LLTA 1N0UA 1SR6C 4Q01A 4X8MA 4XSHA 4IDOA 2A5FA 3RS0A 4DSNA 5JZVA 3I5YA 2JJ8A 2BM1A 4PCWA 1GWNA 1L4UA 1IN8A 3A58B 4HUTA 1KJZA 1WRLA 1OPXA 3PFVA 3QEJA 3K9GA 2PCJA 3TUIC 4CEIB 3E3RA 1RECA 2CT9A 2EC6C 3GOFA 2FF7A 3F8TA 4J0QA 4Q9LA 4YC7A 3SJBA 1CEEA 1UHKA 4WOPA 3BGWA 4DHEA 2XJ4A 1A03A 3R8CA 4M1MA 2OBNA 1QF9A 4X8LA 5FBLB 4ZDWA 5ER5A 3SN6A 3U4QA 2E1RA 1EX6A 2VSXA 3I8XA 4OR9B 4Y0VA 5FFMA 1G4UR 1IQPA 2QM8A 3GJ5A 1PZNA 5SZJA 1T3LA 2QRNA 1BKDR 4QJ3B 1GITA 2Z4RA 4DXAA 4ZIRA 1XZPA 2X1VA 5HZHA 1P3JA 3TDIA 3EPKA 2GCNA 2KB0A 2MMGA 3OFNA 4GRAA 2GCOB 3RC8A 4X8OA 1TNQA 1J1DA 1KI4A 2ZRKA 4LZZA 2EW1A 3QXXA 3BERA 3QF7A 2JXLA 3TS5C 1Y3AA 2JJ1D 4LK2A 2ATXA 2K5UA 2R8RA 3P20A 2CK3A 1VG9B 4XTRA 2GJAA 2WKRA 2A9KA 1N5KA 5FL3A 3T1OA 2AXNA 4JYCA 3H84A 1DJWA 2L4HA 2G83A 3WBJA 1N6LA 5JBQA 4C4PA 1IAQA 1VG0B 4S35A 421PA 4D4JA 1NLFA 1ZUHA 1CXZA 1Q1QA 2M9GA 2G9BA 1AGPA 3WNXB 2B7BA 2G3YA 2V6IA 1E9SA 3SQWA 2GWHA 4OHYA 5G3ZA 4BASA 4RD1A 4DSTA 5CDFE 2PALA 3PEWA 4HSZA 3TQFA 2OCAA 5KUTA 4P4UA 1BOCA 3LLEA 1KSHA 1WRZA 2OFXA 3FTQA 1F54A 3GD7A 4JLJA 4W7SA 4C2TA 1NWDA 2ZN9A 4OVNF 4PE4A 2C78A 4P32A 1CB1A 4Q4HB 4LY6A 3THOA 3OEED 4LI0A 4O2RA 2YWEA 4RCYA 3GJ7A 4NTZA 4CT5A 5AJYA 5J5CA 2IK8A 4M2OA 2BBTA 3ASZA 3M6AA 4IEEA 1E79A 2ZFDA 4X8HA 1G6OA 2O8DB 1KDPA 1EX7A 2ZJYA 1LS6A 2N42A 2O0JA 3SBDA 1NBME 1ZJ6A 1UBCA 2OE2A 3OE7A 1F2TA 1N0YA 4LV6A 2QG6A 3SC3A 4TL9A 1JFJA 1EG3A 4HDOB 1P7CA 1QZXA 4MKHA 2CHVA 1DGVA 4HAXA 1SULA 1UPTA 1ZRHA 3PR1A 5TMPA 2H18A 4M9SA 4TYPA 4QBGB 3T12A 1UP5A 1JR3E 3VKHA 1NP8A 1SW8A 3VTKA 3U7FB 3VKGA 3GLHE 2B8TA 1CFFA 1NX1A 2KAXA 2DFNA 4AKIA 2IYYA 5EP2A 1AS3A 4YDSA 5J4HA 5EXTA 5TV2A 2KGRA 4CEHA 5C2JB 1XK4A 3G82C 4G1UC 5L3SA 4KHZA 4ASUA 3RRMA 1IY0A 2G0NA 4FWIB 4P4SA 3TAUA 1QTXA 1WF3A 1XMJA 1HURA 3T5DA 3VFDA 1SGWA 2AFHE
chains in the Genus database with same CATH superfamily
3IH5A 1OXXK 1IXZA 3WY9A 5DGCA 4H7HA 3S4YA 4DW8A 2WQZA 3I61A 2Q0SA 2GHQA 1TMOA 3TG2A 4PTYA 3OB2B 2Q1WA 1WCWA 2F33A 2V7VA 5TC4A 5JAZA 2NLNA 2E6WA 4RKQA 3ILYA 3CWQA 3SYRA 3H65A 2K2QB 4R7GA 4QPZA 1KQ3A 5IVKA 3V8RA 3ELYA 1YJXA 1TTHA 2MIIA 4P2GA 1LI4A 2J0VA 2WWGA 4RU1A 3FCYA 3HY3A 2YWBA 3FPKA 4I9UA 3MGAA 3DB2A 4MI6A 2GHIA 4OQXA 2RGBA 1KS9A 2OMKA 3H5VA 5G0VA 2HRRA 4E2XA 3QFSA 1VP3A 1S7GA 4HAVA 2ZKLA 1RM5A 1W2GA 4FB5A 1QIDA 2CL0X 4Y2SA 5FOXA 4IM7A 3JATA 4F7DA 2ZANA 1S89A 5K8VA 4Z9AA 5BSFA 1N6OA 5ARDA 4LYGA 1E5LA 4JJAA 3LUFA 4PLHA 4DEXA 5DHSA 1YR8A 2IUFA 1ZL0A 3W06A 1KMNA 1OXSC 3AY0A 1BCSA 3AQ4A 2FPPA 3FFBA 2L98A 4JBWA 1FMTA 3B52X 4ARZB 2RB5A 2Q5OA 4XYNA 3AUFA 1ZGCA 3D78A 1RYEA 2I5PO 2OFOA 5GV7A 4NMLA 1B74A 3KOUA 1K5GA 1T2EA 2VSOA 4YV0A 1E9DA 3AOEC 3HKBB 2HRBA 1V39A 5DO9A 5I9SA 3OLXA 4O02B 3HPRA 4KFUA 1RYZA 1N5OX 3M4ZA 3PFGA 3WDMA 1U4NA 5A5VA 1LZKA 3GLFE 4IJ6A 1C3XA 1A82A 1CRWG 3GGSA 3PE4A 3AVTA 3UEOA 2C31A 4MS1B 5CIWA 5CHYA 4YMIA 4XD7D 2YY6A 4ORAB 3S44A 1L5LA 4D3XA 3NCHA 4MH0R 2PEYA 1E89A 2Q91A 3H86A 3OOWA 3TE6A 4IZIA 4J3NA 4NBSA 4UTRA 3DF7A 4QJIA 2VDWA 4KTVE 1KK7Z 2DTEA 4V0LA 1NQAO 2H29A 1T91A 5DXAA 3QX9A 4JLKA 4EO7A 5LL6P 4BFCA 1W30A 4KZKA 2X9QA 1UMCB 4ZHQA 4GSLA 1P44A 4EFLA 5DBFA 4AULA 2NZ8A 1GL6A 3I5GB 1CZRA 1TJYA 3E7DA 3VSBA 5A4MS 1DOAA 2IOHA 2VUTA 2WOJA 3AR9A 5HNKA 4LRYA 1BJKA 5MGBA 1SXHA 4OEHA 1C1DA 5DSTA 2F4NA 3EYAA 4XJVA 3OUUA 2WJJA 1N78A 1XTJA 4NDBA 2MSDB 1V7PC 1MAWA 2X7JA 1QVIZ 3MJHA 1JSZA 2HV8A 1YBAA 2PS1A 2PBLA 3T0FA 1YVHA 5JJIA 2JBAA 3DHNA 3ENVA 1P9RA 3I2FA 2G9RA 1U3UA 5BV8A 4UUMA 3GAFA 1EBFA 2AFIA 4K2HA 3DXXA 4X85A 1XJ0A 2X42A 2QTBA 1NV8A 5A03A 1JA1A 1T43A 1K5DA 3TSWA 3K15A 4V3BA 1WMDA 2JFHA 3SHVA 3NIBA 1ZBQA 4FEYA 4HGYA 2LMTA 1Q6ZA 2BFEB 3SU8A 4P9NA 3B1JA 3D8UA 4P4TA 1IIOA 1VE3A 4BMSA 3FPFA 4DSAA 5ELMA 1X1AA 5L7TA 2WQ6A 1VFNA 3NDPA 1JEYA 1HM5A 1UKYA 2QMYA 2FXIA 1EM8B 4GWGA 3R7DA 3PTZA 1TKCA 1C1XA 3PCXA 1GPWB 1TMGE 1AD2A 3ZZ1A 1N8KA 3A28A 5PALA 2L50A 1X77A 2XQVA 1BG1A 5D3QA 3IP9A 2JD2A 1AO0A 2QRQA 1WLYA 2NNWB 2B78A 1HLPA 2G71A 5T4BA 4H6WA 2DBQA 2JLCA 4O2AB 1DJMA 5IJ9B 2OHIA 4V38A 2JGNA 5KHLB 4KGXA 4MDEA 1ZCFA 1J07A 4YMWA 1XZNA 2JPTA 4RD4A 1Y9ZA 2L4IA 1F51E 3KVVA 3SF8A 2OAGA 1MX3A 4U5QA 3W5VA 1UDXA 1THGA 2XITA 1ORDA 3UPDA 2HPAA 4U3JB 5KYWA 4EIWA 1H94A 4OHUA 1DMSA 2GXUA 1Z47A 5I4CA 5KNBD 1R66A 1ZNYA 4F7WA 5F3DA 3HJUA 4EHJA 3W7BA 5F9MA 2FRDC 4GKJB 3B7WA 2EIXA 4H3VA 2OLKA 4WGFA 5AJWA 2WD7B 4CG1A 5KOHB 3GFRA 1ISSA 4AJJA 5KTMA 3VTAA 2GRAA 2XX3A 4YCSA 1XEXA 5F7ZA 4CEJA 2YS7A 3L1IA 4PW0A 3JQGB 3HFGA 5EXXA 4BDSA 4UZFA 1MEOA 3R24A 1YRYE 2ZR0A 2PXCA 1SELA 2NUAB 1OT5A 1PR4A 1X3SA 2HPHA 1YRWA 5B1DA 5BUZA 2QL7A 3HVHA 1WDCB 4MJXA 1R9GA 2Z6VA 4ZPXA 1NVUQ 2Z5FA 1YVDA 4D9KA 2WQ7A 4MV5A 3LVRE 3U17A 4EVRA 2XMRA 2FX2A 2HA0A 3N3AC 4E5PA 2BFOA 3JQ7B 4N5LA 3FUVA 2AFHB 1PT9A 2OFPA 1QWVA 2PKRA 1I6KA 3S8EA 1ZXXA 4DEVA 2BKVA 1MB3A 1T35A 3QWIA 2BL4A 3GUUA 2QN7A 4UUBA 4G2TA 1EZZA 1U2EA 4F86A 1FDOA 2EJBA 4AZ0A 5JY1A 3AIKA 4EBFA 3DEKA 2UYHA 4D8TA 4HADA 5BT8A 3AKDA 1OI2A 1GG5A 5KHAA 2G0TA 4PXAA 4M9XA 1GZUA 4FS3A 1R6VA 2VJDA 2OCYC 5IBWA 3LQ4A 1F0KA 1REQA 1JXMA 5JXIA 5HYDA 2FFBA 3DFKA 3V1NA 5TQ0A 1R00A 2CCGA 2YRWA 4NV0A 3ISVA 4MR8B 4ZQGA 1JLSA 3ZY4A 1UWVA 2ZS9A 2JLBA 3B85A 3SQOA 2DR0A 2FPOA 4DBVO 3IAFA 3V33A 3WYFA 5L53A 3TJMA 3TLMA 3IEXA 4E31A 5E0KB 2OXEA 2XZLA 1XWIA 1H42A 1ZA2A 3P26A 1K98A 4MUJA 4I4LA 3ABSB 3L18A 4UUQA 2LVIA 1NVDA 4OSOA 1DG1G 4KUHA 2PUTA 3JWPA 4FLMA 2K8MB 5K0BA 4E5KA 2VNSA 2WTXA 4PBRA 1D6NA 2ZE6A 5BW5A 2YJ3A 3T1HB 1DG9A 1WXHA 1NAIA 1IQ0A 3D5TA 1IEVA 1NR7A 4O0MA 4NCKA 2GFHA 4HWTA 3QE9Y 1KO4A 2JDID 1ZDMA 2Q27A 2R6DA 3QQPA 3QVGA 3OMXA 4M99A 3R3JA 6CHYA 3W78A 5IKEA 4V0SA 4U2GA 1HDYA 2B36A 5AD1A 3RYHB 4MYSA 3HR8A 5JDIA 2HI0A 3IPCA 3WRWA 1W25A 5M29A 4QARA 1KDOA 3TSZA 4YRZA 4AG3A 3V4ZA 3N5CA 1R0LA 2W22A 3ONFA 5FI0B 1QV7A 2FQ1A 2FQQA 1QF7A 3TB4A 1A7AA 3CV3A 3TDZA 5D3KA 2VH2A 3EQ8A 1OROA 1CKEA 1QK5A 1QHEA 5H7XA 3G0BA 3U26A 4GNKA 2PQMA 3Q7QA 3CM0A 4Q39A 2R6CA 2JWWA 2INGX 1SK9A 3TVTA 1KJYA 4BLRA 1KTIA 2G8NA 5EQFA 1USVA 1LS1A 1WCYA 1KK0A 2FOIA 1JP7A 4EK9A 1UMBA 3R0VA 5EWJA 4RKYA 1C9NA 3IT2A 3DZKA 3F3KA 4RM3A 5HOQA 5CNMA 1XXHB 2WHYA 4J2HA 5GONF 4KKXB 1MC5A 2W5UA 3NT4A 4KYUA 4RHTA 1R12A 3FDFA 4RIFA 2FSPA 4F3TA 1W88A 4XAQA 4EJ6A 2BFFB 1QWSA 1OYVA 1JG4A 3I37X 4WEQA 1C81A 4E5SA 3AW9A 4NE2A 1VYHA 5AW4A 2O20A 3F8SA 3OPYA 1RI1A 2E18A 4XWWA 1GZ4A 3CZ4A 3ADDA 1ZSNA 4W5OA 1TCBA 4HY3A 1DB3A 1A7KA 4Z5XA 2MYUA 2ZJ8A 4U7PB 3M0WA 4DLTA 2ANCA 4D9FA 2IZOA 5I7FA 4FLEA 1P72A 3ZDEA 1GVNB 1X86B 1XAHA 1IN6A 1ZXLA 2E89A 3CRQA 4FYWA 4UHCA 1RI4A 3F7NA 2H85A 3O82A 4KREA 2WU4A 3HLTA 1YUTA 1Y6GA 1YAHA 3KPJA 2EQBA 3PZRA 3D74A 3HU5A 1Y4UA 3LDGA 1VM6A 4QDOA 1VYUA 4MGEA 1GU1A 1NW6A 1M5UA 1UPUA 4DCTA 5FO0A 4Y3UA 2QX9A 3D73A 2FH5B 1FY2A 2Q3FA 2QLFA 4NZYA 1SXQA 3D3WA 1L7EA 3G8AA 3HSSA 2RGEA 2M6LA 4JASB 3R9KA 1CJBA 4WIAA 2VQFB 4FUQA 3GGDA 3KQVA 3AOGA 3KXPA 2H1OA 2J3QA 3TQRA 4A3SA 3RSSA 2XTJA 2QRUA 3C0KA 3CH6A 1T6YA 5KNDD 5EG5A 2NQTA 4YAGA 2ROQA 1NTRA 4Q1EA 1FRQA 1K7EB 4R05A 1NHGA 3DVAA 3W3ZB 3CEPB 4HD8A 2N75A 1E1QD 4JOBA 2BAPA 4PYRA 1R50A 3I52A 4RLHA 4YLYA 1JR4A 2DFTA 1PLLA 1BU5A 4H31A 3D59A 3SG6A 5B4VA 3S8MA 4WXPA 3SEAA 1CJTC 3PQ3A 5EKUA 4LDQA 4C03A 4IHJA 1XFUO 4JLDA 2JHCA 2XD9A 3W05A 4BO3A 3M3PA 4ZEVA 3P45A 1NUPA 1Z28A 4U7DA 1IBCA 1XZAA 2J3LA 1AUXA 2OP1A 3L41A 4LJSA 4HJXA 4RA9A 3EA4A 3WAGA 4XIYA 3MTGA 1Y5NA 2QY6A 4YPOA 2ZW9A 1XK6A 3ESAA 4XCXA 3OFND 1V3UA 3A25A 1Y37A 2C9YA 1KIAA 1NX9A 4PE0A 5KJ6A 3R7AA 2UVQA 1NRWA 2F8PA 4EUEA 3DM5A 5CDGA 2XGSA 3OUZA 1RBQA 4GKKB 5B1EA 1SIBE 2FX3A 2GJ8A 3HM9A 4A8JC 5FKJA 3K21A 3VMMA 1NY6A 5HLVA 1RQPA 3AXSA 3JVDA 4TTVA 3VTZA 5G1PA 4WINA 3COWA 3D1JA 2N46A 5EUBA 1GKLA 4R8LA 4E7OA 2DFDA 4D81A 1GV0A 4XX1A 4XIJA 1ESMA 5BY2A 3WNDA 1AQYA 4Q82A 1YR9A 1W85A 4RADA 3OX5A 3IAM6 5FYQA 4I5EA 3O8LA 1ZO8A 2PL1A 3RSQA 1RXSA 1XKTA 2C95A 4WCFC 1ZEMA 4YJHA 1HK7A 2BEVA 3FUTA 1Z3CA 4HRYA 3T6KA 1UWCA 4FGJA 1MX5A 4FGUA 2J9GA 3UFXA 4P36A 1L4KA 4HJRA 3NOXA 4JSRA 1K27A 1O0BA 3N07A 4KQCA 4JJKA 3G23A 4KVAA 1P2VA 4KPGA 2KBMA 3N0WA 2COEA 1RM0A 1XZIA 2W4QA 5AXDA 4G5FA 1OXBB 1GDHA 4EG8A 2JH3A 5MF6A 1UZAA 1SG9A 4PC3A 3OIUA 2ZROA 4MI3A 3DBOB 4BV8A 2GVZC 2GTIA 3TGWA 3N9IA 2XCUA 5F3WB 4UBOA 5KQSA 4UXJA 1V45E 4F91B 1D1QA 2WJYA 1QAQA 2WWRA 4R9UC 1BW9A 5HUQA 1N3LA 4G9EA 5TNCA 2P2ZA 1FDRA 2R5NA 4PPGA 2AX3A 1UPCA 3E1SA 4CIBA 1VGVA 3O4XA 1D4OA 3QHQA 4C4RA 1PNQA 1Y8QB 1T2DA 3JWHA 1GUAA 4PQGA 5LQJA 4D74A 5HKKD 4ZRMA 2IDZA 2XWBF 4LGCA 2IEDA 1ECJA 3MERA 1D7AA 2NGRA 4W99A 3I9FA 4FOLA 1CDPA 5KNBH 1EFHA 4Q4LA 1K63A 4XVUA 3EZYA 4E88A 1NBWB 1BH6A 1CR1A 2E5FA 4YB8A 1Z2EA 2NU9B 5EMHA 4EHLA 3IQHX 4XOIA 1T0JB 3GUVA 3M7IA 3PHCA 1C8KA 4Q1BA 1SCVA 1OI3A 2VJCA 5C35A 2YWJA 4YJKA 1Q77A 5BWMA 3IRVA 3A1WA 5AK0A 2RHGB 4F5EA 1L5HA 5PGMA 4BVAA 4HPJB 1M0EA 3D2AA 2DZDA 3NANA 4DG9A 5CFPA 4FMCB 1JDTA 4EG1A 3K6SB 1DFGA 4EG0A 4KE8A 2AW3A 2ALJA 4HN9A 4YAOA 3EXHB 5GTDA 5AM0A 3FYSA 1BXKA 5IYZF 3BSWA 1Q6YA 2LLTA 2AJLI 1D6SA 4Z9XA 3X1MA 2F1OA 3IP5A 1B73A 4DV1B 4COOA 1GL3A 3BGWA 5TEVA 4IXDA 2W43A 4ZDWA 3EGVA 2PD6A 4J94A 3F49S 2VYNA 2Z4RA 2G36A 3VZDA 4GRAA 1R3DA 4J0CA 5JCXA 3I01M 3ZQ4A 4DXDA 3PL5A 2IELA 5FL3A 3VAZA 4S1TA 3WR5A 4YJ2F 4OYLA 1Q1QA 3RBZA 4HSZA 1BOCA 4CUZA 3FTQA 1F54A 4JLJA 4WCDA 2ZN9A 3ZGNA 1I2ZA 5AJYA 2IK8A 1CUXA 5C7LO 3VXKA 3X2FA 4LQ4A 1UP5A 2DFNA 1NX1A 4AKIA 3CWCA 5CB4F 1DXOA 3B3FA 3T9EA 4KHZA 1N5DA 3RRMA 2VDRB 4N7RA 3R5TA 5JD5A 4RF5A 3FY4A 2Q3LA 2PAFA 2GPJA 1MENA 1JHOA 4A1FA 4NMHA 3KDAA 1I1QB 3FKQA 2W37A 3ZCVA 2XPCA 4JEMA 1U2PA 2BD0A 3REGA 3RIGA 3F5DA 3B1WA 3CYFA 4YQEA 2CSUA 1Z7EA 4DM4A 3S6JA 3PGLA 3ROXA 3PJFA 1YC2A 4KXWA 2ZBVA 4JCOA 3BYZA 3Q1LA 1I9GA 1BN6A 5LSAA 2FWJA 2B20A 4CM6A 3W6NA 1HA3A 1Q2XA 3A10A 4X6LA 3JU3A 4AZTA 4PHMA 2FWMX 3V32A 3D6FA 1SXIA 3D4NA 4W1QA 1BO6A 2E37A 2C8KA 5EI5A 3HA7A 4HREE 5EL2A 4F9FA 4DNFA 3G5TA 4XD2A 2CL6X 5TPZA 3FUWA 3Q3CA 5ALVA 3O75A 2AQHA 2P2LA 2OBBA 4G5QA 2BFDB 1GEGA 2P9GA 2PUWA 4Q15A 1QHXA 2HRQA 1X1QA 2IHBA 3THSA 2X8AA 5F7OA 2GEBA 1FU8A 2PTGA 4RS4A 2BRUA 3TS1A 1U3CA 3WP0A 4L5BA 5CSJA 4WWHA 3F98A 1TPZA 3KDSE 1GRRA 1E18A 4MYRA 3QMVA 5HW0A 4B2LA 1M1NB 2P0YA 2LNDA 2V5VA 2V0NA 3QEAZ 3DB1A 2HQWA 2P68A 1V9CA 1W2HA 3V97A 4W5NA 5HF8A 2CXUA 3A1VA 4KG7A 4P5DA 4G36A 4UPEA 3KEOA 2AWNA 3A3NA 3H1GA 4BLTA 3N2ZB 5JXHA 1IZYA 4AQJA 1ZJYA 3SF0A 5FBKA 2BZSA 1LS8A 2MTBA 1TNXA 3DVKA 1JL3A 1HBJA 3HUTA 1JIJA 2GARA 3KQKA 1NPDA 1CTRA 3CVWA 3DCNA 1GG9A 2X1LA 2JGDA 5EJGA 2RHRA 3JD0A 4RZXA 1AHRA 1ZCJA 1Q12A 2XMDA 1FQKA 3G8CA 5FULA 4W5WA 1R4MA 5JZMA 4XSGA 5ALXA 1VHQA 5D85A 5ICSA 1PAUA 2CXSA 1BRTA 2IHKA 1LK7A 4N1GA 3F9RA 3BJEA 5CGQB 4L7QA 5KTOA 2GM5A 3P9KA 1Q14A 1R16A 1XL0A 4KGZA 1AHNA 1NMYA 5IC5A 3HU2A 3F45A 1NX6A 2Q5CA 4BX0A 3VSEA 4DG8A 4HO1X 3T3DA 4LJKA 4AJNA 3ZWYA 1IAVA 5IN4A 3MJ4A 4LFBB 3BQ3A 3QVLA 5I7SA 2PASA 3KL2A 3OZSA 2R11A 3H3XA 4UVGA 4ZOCA 2YFQA 2QI9C 4P38A 4IW3B 5EHXA 3HA2A 2PLAA 1UMDA 4GDMA 2C03A 1JMYA 1NSTA 2EX1A 4RTSA 3ZDCA 3V1KA 5K2OA 3NNDA 1XRNA 3I9V6 5DBEX 5HFAA 2WCHA 2ZYSA 3SS7X 2R85A 4Y6PA 3FETA 2D74A 4L15A 1YURA 5IHPA 2CNLA 4K6HA 3L07A 2KQYA 5KNDH 3T9DA 2WJWA 3MD0A 1F5NA 3C8DA 1U6KA 1BHJA 5D6NA 2R84A 1M72A 2PBRA 2ZRPA 2J3EA 2WPDD 2MJWB 1UJ5A 3CUTA 3SIAA 4G5XA 4HSGA 2YVAA 4C2UA 4B6QA 1MAUA 2WWYA 3FF4A 1YE8A 3E22B 2CHFA 2FR8A 4INPA 1L8AA 2R8ZA 3GFVA 1P4GA 5T6BA 4CM8A 3PC7A 2FG7C 4RGVA 4RE5A 2H7YA 3R7WA 2PT7A 1ODCA 2QRLA 1NAHA 3U7EB 3D6VA 1I3MA 3LCJA 4CMIB 1N5RA 3PC8A 3QTBA 4KQ1A 5JMPA 4NV3A 2WYVA 2P62A 1JEQB 3BF8A 4EFKA 3R5JA 1K9KA 5BSTA 4WMLA 3MC1A 1P2GA 1VMAA 4R1PA 5B4TA 2LMUA 3EVNA 4JBXA 4JFAA 3JAWA 4RTRA 1EJ0A 1VBFA 3ZBTA 3SD7A 2ISCA 1CY2A 3D3JA 1HE5A 2FEOA 1KVQA 1VLQA 4PZCA 3TK1A 2XQIA 1W0JD 3VC2A 3PUXA 5IXYA 2JAQA 5J2UA 3ANYB 3IA7A 4M53A 4NNJA 1R10A 4OV2A 5FAXA 4TMKA 4UQPA 2PSHA 2I4NA 2REQB 2A57A 4RZQA 2HA7A 2BBWA 2B1JA 4ATNA 3FSGD 4HYTA 3OC0A 3PN7B 4B85A 5D69A 3PB3A 4FR0A 2MWMA 2BJHA 3A9UA 4ZT6A 4CQLB 4J49A 5WRFA 4EHHA 3WBKA 4F3CA 3MQ2A 2F59A 3AEQB 4CBVA 5B2ZA 3PXUA 1G20B 3BH7A 1UP7A 2QNIA 2EU8A 1LWNA 1F8XA 3GARA 4WQMA 2LCIA 4PDZA 4A8JB 2JL1A 3OZ7A 1KZHA 2RE8A 1G60A 4TLLB 5DYIA 1MVOA 4QZVA 2CDRA 5HVNA 2LHLA 3VNAA 5DTQA 3VOBA 2OV2A 3EK8A 4HMPA 4B6RA 1C7EA 3F6EX 4J0FA 1YIDA 3ECCA 2VKTA 4B2IA 1CFZA 3KUUA 2I6XA 3I28A 1QTIA 4CDNA 5J3XA 2Q62A 1Z2AA 4YCJA 4TM7A 4RIIA 1ZKMA 4FXOA 4K2AA 4YHBA 5AW9A 1SU8A 4NR0A 4A0RA 1LNZA 5DKNA 2BFBA 2GNOA 3QU7A 1PBNA 3ETLA 3A4VA 2PD4A 2WFZA 3LBHA 3EDOA 3DMYA 2KSPA 2PR7A 2RDMA 3DBLA 4AG5A 1IM8A 2C97A 3BRSA 4ZAVA 4YRGA 2OV3A 4JYBA 4QBFA 1G0NA 1U1FA 3QUQA 5JDCA 2QTVB 1KDZA 5LB2A 1A95A 3EVCA 3N2NA 5FLEX 2NMVA 4INZA 1FXSA 4PONA 1PEYA 5KU1A 3VC7A 3BEOA 3R8FA 3N2IA 4JI1B 5AJXA 5B30A 2G9ZA 1DX9A 5IXJA 4B4KA 3GDWA 4XA8A 5G0WA 4J1TC 3NVKI 3HWSA 2C2HA 5DBIA 4F7FA 2EDAA 2P1DA 4YMUA 4FHFA 4PHTA 5BYAA 1RBMA 2YV5A 2YHBA 5AJZA 4AY2A 5B6JA 1JHMA 1F8YA 1WBJB 5CCBA 2IHZA 1BIFA 1CNFA 4PPQA 1A2XA 4L0CA 1CTQA 1EHYA 1SCMC 1CDNA 5D00A 2QT0A 2X9VA 3CLUC 3SJSA 4TOIA 5B2FA 4BQPA 4ZAZA 1KGDA 2ZIXB 1VFPA 1WM1A 4Q3KA 3ZGZA 3MTIA 5J2TB 1G6Q1 5CIQA 5JE8A 1TJ4A 2DHDA 2VF5X 4C0JA 4RJKA 1NBMA 1ND5A 3QF4B 3SVTA 1SWVA 4EM6A 5A7GA 3TNYA 4LF8B 5DGTA 3UV7A 4PXYA 3OMLA 3NH6A 1KEWA 3W8EA 1L7PA 3EBOA 5M04A 1V8ZA 5ED0A 2YQ4A 4FHEA 2WTUA 1BWRA 1TMYA 4YCNA 1HFJA 3RTEA 2RCYA 4NBNA 3ET5A 4IOJA 1I3NA 4PLYA 3COPA 4UDOA 4CKYA 4E7PA 5JRZA 3Q3GE 4C6TB 3CUEF 4MW7A 3L7DA 1JIXA 4KQEA 1C4XA 4ERNA 2DERA 1RWPA 5FBHA 4RK7A 1X1SA 3REQB 3Q7PA 1E2GA 4LWQA 1B8RA 3OX6A 2X2PA 4WJZA 2JTTA 4RH0A 2JIQA 2M6RA 1CUVA 3TLGB 2I7XA 1VJ0A 3H0CA 2FKNA 1WDLA 4X6UA 2QZZA 2HCRA 4EGSA 3SWWA 4HP8A 2X7XA 2YZ2A 4F72A 3KUCA 3K2QA 3NTLA 4KQHA 4O0LA 3L6OO 1QKKA 3EEQA 4IP0A 2Q9AA 2WT8A 4D41A 4AJEA 1ZNZA 2QN9A 1E2MA 1H5QA 1C9YA 4GVXA 3UMFA 3ZXSA 5ISMA 1GXSB 1E9AA 3I04A 1JT9A 3ZJ4A 2J5QA 3LPAA 3GLGA 1H9CA 2PVBA 1EVIA 2XWSA 1WHSB 2XB6A 3BICA 3UNXA 2KHNA 2CBXA 2DKOA 1Y3BE 4MYTA 4CKEB 4ZJUA 4P4GA 1BF5A 4IWNA 1P3Y1 1J2JA 4C5CA 1Z73A 4UU0A 3UYKA 5K6AA 5JS2A 5GQQC 1WKCA 2D00A 5AHRA 2AOUB 4YJ3F 1BMOA 4MRSA 3KYJB 3L8DA 3G9XA 1E4VA 1OXVA 1JHQA 4NAUA 4WY2A 1N6KA 1F6BA 3ABRB 3GFTA 1VQ1A 3HZOA 5ANRB 4ZT7A 3IVCA 4UAJA 3MJCA 1CHNA 1UZUA 3AHEA 2VHWA 1FMFA 1TO1E 4KAFA 4BNZA 1U4OA 3DOEA 3ZY6A 2W48A 5E6RA 3TBFA 4IIEA 2I4RA 3ZWBA 4CL0A 1TCCA 5LBUA 3LS2A 1K4KA 3HXLA 1XZGA 1OMRA 4ENPA 1QHSA 2OZLA 2GDZA 1PZFA 3N7AA 4NMMA 2ORVA 2HLDD 3LPNA 1AQJA