4C0LA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one magnesium ion and mg:gdp (mggdp-miros)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 120
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0lA03
4AKGA 3AF0A 4Q1FA 3G5UA 4TL9A 1UJ2A 2RCNA 4F7WA 3THWB 1NIPA 1M6NA 3QXJA 1CMGA 2JA1A 2C95A 1RZ3A 4JSYA 4URZR 5IRCD 4YONB 2IK8A 2O8FB 4R9UC 1YVDA 5L3QB 3TNFA 1AHRA 2RGDA 3BB4A 1W36D 4URXR 1K2HA 2R62A 3TDZA 1N6IA 2IXEA 5C4GB 2QQEA 2CCJA 4IJMA 4MKGA 1G8IA 1Z28A 1N6NA 5CB6A 1IXZA 3K0FB 2LM5A 2P65A 4DHEA 2AXPA 1XMJA 3DMDA 2LP2A 1N6HA 5EP4A 4N5XA 5KSYA 3LLMA 5C46F 1KAOA 2VO1A 3HWSA 1NBMD 3EVVA 3SYKA 3B6EA 1OJLA 1OFTA 3M1IA 5GJWC 3VU9B 2O5GA 3PUWA 4QBGB 2CLSA 4G5SA 4B2IA 3U44A 5DKQA 2G6BA 2JATA 1N2DA 3HPQA 4HLUC 4JVSB 2FNAA 5KSZA 3BXKA 2WKRA 4LJYA 5EUQB 1PLJA 4TT3D 3SJBA 4DLWA 2ZN8A 4FTGA 1KDPA 1R10A 1S2MA 4PSAA 4UJ5A 1ZM7A 3X1XA 2LLSA 3OIYA 2XZOA 1YURA 4D4MA 1TQ4A 5AJYA 2JLXA 3BK7A 3NH6A 2R65A 3K9LA 3QXXA 4IL1A 5BYJA 2QM8A 3KQNA 1AS2A 2M8UA 4B43A 1XCGB 3V4FA 1FOEB 1ZNZA 4ORCB 4U5XA 2YZ2A 1MO4A 1QJTA 4DIDA 4B75A 2EFEB 2ZUBA 3T06B 2DCUA 3VROA 2VQSA 2UZIR 1OHHD 2PRUA 2ZR0A 2LC5A 1DPFA 2FEMA 4PC7A 1RJ9A 2EYUA 4PHFA 3ZQ6A 2KAVA 2OTGB 1CM1A 2IHBA 4OI2A 5L8VA 1G8FA 2GEUA 4PQFA 1D1OA 2R6FA 5FPTA 3AVTA 4B3GA 5HKYA 4AWXA 1K96A 2K7OA 3WHKA 5DYIA 1R2UA 4KV9A 3DOEA 4TN1A 3N70A 4O3MA 1SL8A 3D0YB 3DVKA 3OHMA 3KJEA 3UATA 5JBQA 1A4PA 1KQMC 3PN7B 4I5NB 4JWQA 1S6CA 3I3SR 3QEJA 1UUSA 4KXFB 3O6BA 2GWHA 3MJHA 4RCZA 5JI2E 1XTIA 4AURA 4TQUS 1OPXA 1E9SA 1KI8A 3GP8A 2WCBA 1KZGB 1IJEA 3TSOA 1HT2E 2QN6A 4PO8A 1UWOA 1TIZA 1NL3A 1US8A 1XBTA 1P75A 1VRKA 2VL7A 2GKSA 4LOAA 3NC1C 4IEIA 1T3LA 1M7GA 3S1AB 1JEDA 4NYJR 3X1ZA 3T15A 3CH5A 1HH4A 1KJYA 4TMVA 3EIHA 1YU9A 5LD2C 1J2JA 1MRNA 1D2MA 4D6PA 4Z51A 1IJ6A 4KSCA 4OJQA 2NQ2C 1KWOB 1E9CA 1XRJA 4NYIQ 3FFAA 1SNLA 2ERXA 2TN4A 2XSZD 1G5TA 3WMFA 3W6NA 3KX2A 3WHTB 4QNRA 4D0NA 4M9SA 4PAMA 5HLVA 1E2NA 2YHSA 5FOSA 1WY9A 3TUYB 1SRAA 4M9XA 4M9QA 4WVFA 4IFBA 1BT6A 4X8HA 3EWSA 2ZREA 4DWJA 1EX6A 3PEYA 4HB3A 3C15C 2WC8A 3CTNA 5JHHB 2J9RA 5AJZA 5AANA 1IH0A 4LGMA 2TMKA 1GL6A 2CL0X 1CFPA 2ATVA 2VSFA 4GNKA 2ZVQX 3O4YA 1ZUIA 4B34A 4BLRA 3EPKA 4RCYA 1Q3HA 1XFXO 4XIGS 4RZ2A 3EG5A 1KI2A 2Q6TA 3SIAA 1E2PA 2WJJA 1XCMA 2WVJA 1U99A 3I5HB 2WJYA 3K0CC 4JVLA 3GEIA 1QHXA 1OH8A 4KLZA 1E4VA 2OCBA 5B58C 5CSNA 1E94E 1G19A 1G20E 1H8ED 2BJWA 2YJTD 3EIQA 4IVQA 1K95A 1P2SA 3BORA 4G5GA 3AKYA 4UJ3A 5FOVA 4A0RA 1DMOA 3H4MA 5HZHA 2BL0B 4AQIA 1CF4A 4CLNA 5FPSA 4IDNA 1S1EA 3IHLA 2EQBA 2N1BA 3TSWA 2ORVA 1GJYA 1LNZA 1UBFA 3EZFA 4OI4A 4E03A 3CPEA 1SQ5A 2IYVA 2ZE7A 1YZLA 3WMEA 4E09A 1G8PA 4MBEA 2JT3A 1J99A 1EWRA 1G4AE 1J7QA 2IF0A 3X1YA 3UIEA 1SZPA 4KBFA 8OHMA 5CSFA 1DAFA 3GJ4A 2GCNA 3C4JA 2HETA 3ZZUA 1NY5A 3OAAA 2WJVA 4LPKA 5DHAA 1UAAA 4O2LA 3JZAA 4OQXA 2V8OA 4NCNA 1ZINA 2BIFA 4FXPA 2EFDB 3SJZA 2FF7A 3HU3A 4DKXA 1Z0AA 2GILA 2XJ4A 4PR0A 1QS7A 4C0LA 1H8BA 1W48A 1Z2AA 2VHQA 4C0SA 1MABA 1VHLA 1P72A 2WPDD 3LWNA 4HLDA 5H70A 3AVWA 1CU1A 4I5LB 4OKHA 1XMIA 3ADCA 4RD2A 3QXHA 2J0UA 1CDNA 1XTKA 2XZLA 1KMHA 3ZJYA 5JJIA 5G08A 1NJFA 1N5JA 1W49A 1S6IA 2L50A 2ZJOA 3I5GB 1KJZA 2ZRGA 1R0YA 5E7JA 3P4XA 1Z2CA 2F6RA 3DVEA 2JJ1A 1JQJC 2V3CC 2QT1A 4DRZA 5LB4A 1OSNA 2F8PA 3U61B 1D2NA 1JI0A 4TMKA 2IYYA 3W6OA 2GVDC 1P9WA 1IN7A 1FFHA 1U0JA 1LA3A 2C04A 1AUIB 3F3YA 4LHXA 4I81A 5AXIA 3NXAA 5FPHA 1EH2A 2OCYC 3OX5A 3WXAA 2Q21A 3TZ1A 4B76A 1OH5A 3QPUA 1UKVY 3OP0A 2OO7A 1ZD9A 5IBWA 2Q3FA 2IWRA 2J0SA 3R9XA 5JSZA 2B1UA 1TN4A 1UBCA 2QMEA 3ZIAD 2QRZA 4I5KA 4R2IA 3THOA 2H61A 1SMGA 1Y1AA 1G7SA 1M45A 2RGEA 3IIJA 3KUCA 3LDAA 1WA5A 4WIAA 2DYKA 3Q7PA 3H1TA 3GFOA 2MSEB 3A1TA 2OPOA 3QKRB 4WZAE 4Z8YA 3RS7A 1SR6B 4FIDA 2KI6D 2MMGA 1FTSA 2AMIA 3RRYA 3O8RA 3RSOA 1A7JA 1W44A 2ZPTX 4EJSB 3TSZA 4C2TA 3QRXA 4KJZA 4I4LA 4M1WA 3TRFA 2GCOA 2ZRJA 4TYYA 1W4CA 3ICBA 1AGRA 1XCPA 4D4LA 1P9NA 4A0GA 4MUAA 5HKKA 4ESHA 3KQKA 4M53A 1OB2A 1G21E 3WYAA 4DCKA 4ASUD 4YGBB 3H86A 2IWHA 2IS4A 2JLUA 2YWHA 2FMXA 1GVNB 5EQTA 4PANA 1BIFA 2Z83A 4ZDKA 1KQVA 2OTGC 3AKAA 3QKUA 4LBYA 4DT1A 3K9NA 5SZJA 2IS6A 2KAYA 1KI9A 3CLVA 2OLKA 1S3GA 1NN1A 3ND8A 3BUMB 2VPPA 5J40A 3RRNA 1QHNA 2FSGA 3A8TA 3DVLA 3UXMA 1YTZC 2NXQA 3SN6A 1E9DA 3CNLA 2JASA 2ZIAA 1KCYA 1OMRA 2ORWA 2LMVA 4DB2A 2ZANA 1L7VC 3CF0A 3K09C 3PN7C 2LP3A 1A2BA 1CJTC 2OLJA 2LAPA 1W0JA 2P0EA 2XITA 4PPGA 2DOQA 1JAIA 1EG7A 3IDQA 3KJHA 1MWNA 3JTDB 1JEEA 2R44A 4HUQA 3GLIA 1C7WA 1XYDA 1XD8A 5G41A 4Q19A 1FP7A 5JJGA 1W4RA 1G64A 5B57C 2NO0A 1H8HD 1N5IA 4C0HA 3K70B 1XTQA 1QX2A 2J0VA 3LLUA 3CWZA 2Z6VA 1NI3A 2L2EA 1JC2A 1ZUNB 3PATA 1GNPA 1G8YA 2FFAA 1PJRA 4IOJA 4KU4A 4EAQA 3FS7A 2ERYA 4Q7MB 3SBDA 1DAGA 2KFGA 4MRYA 3PFVA 1QG4A 4BY4A 1L4YA 2OAP1 4GOJA 1T0JB 1ZD1A 4DRWA 2F1HA 2GAAA 2FGKA 1U0LA 1KWOC 3SDZA 1IG5A 3GK1A 1KK0A 1M7HA 2GXSA 2ZE5A 1LTQA 4AKEA 3R20A 2MMCA 4S35A 1YR8A 4XSHA 1AK2A 2E30A 1ZC3A 5D3QA 5EXXA 2XTMA 3J81k 2HCBA 2WAYA 4EIWA 2GTPA 3R8FA 3EPJA 3I4LA 3KDSE 4ZDIA 1ZM9A 2XZPA 1JSAA 1U94A 2QU8A 2BCAA 3TUYC 1TOPA 2F3ZA 3FE2A 3I72A 1E8AA 4JPZB 3QSYA 3LW7A 3HPRA 2M7NA 2OFWA 5FUWA 4OVNF 2W0MA 1SHKA 1BJFA 5PALA 3NC0C 1GRNA 4QJ5A 4A6PA 4DLSA 4AI6A 1NVUQ 3FTQA 4RVCA 5JJLA 2GXUA 1ZCAA 2VHUA 2VBCA 4TTQA 3VQTA 4B3DA 1F5NA 2GZHA 3C41J 2QBYA 4CIDA 4B3CA 5AUQA 4IW3B 1XPUA 3NSOA 1N6RA 3TR5A 2HQWA 1FQJA 2B21A 2HF8A 2K2FA 2XXAA 4EPVA 3TS5B 3TUJC 4Q1CA 3SJCA 1Q1QA 2WMNB 3CBQA 1OE9B 2V9PA 1E1RA 2IL1A 1SXJE 1S1CA 1HUQA 1R5OA 3CRVA 1CBUA 2BL0C 1ZMZA 1BG1A 1VCMA 1IQ3A 1G3RA 3EPLA 1HYQA 1E4YA 5KO2A 2O8CB 3QI2A 3RS2A 2QUZA 2VLIA 4JS0A 1U8AA 4B33A 3VNUA 4RFVA 4RKEA 5KSPA 1YJ5A 4GBAA 1VIYA 2G77B 2RKOA 4LC0A 5G40A 3U3JA 3T5DA 2GV5A 4B6FA 3AUXA 3CR5X 1P2TA 3NBFA 1YX7A 2NO1A 2XXAB 6Q21A 3TLXA 3SHWA 1J7PA 1SXJB 2WV9A 4NYMQ 3N5CA 1XFWO 4K8OA 1KDTA 1Z0KA 3HX4A 1W1WA 3KB2A 4OHXA 2FPKA 4WBSA 3RS3A 1NRJB 1NMXA 4URWR 3SYLA 2CL6X 2JU0A 4IOKA 1ZJ6A 4JLAA 2FPMA 4KODA 3RS4A 1M63B 3OFNA 4DDUA 5J4LA 1CJVC 3T61A 5FOUA 5TMPA 2GHIA 3VR1A 1QLKA 5FH9A 3UANA 3TW4A 3DF0A 1E2JA 4B47A 3UMRA 4BFZA 1GKUB 2KSPA 5L3SA 1UKZA 1TNXA 2PBRA 2OT3B 3ICEA 2F3RA 3FOZA 2F2OA 1T3SA 3LH5A 1VDZA 3L43A 4LJ4A 5I2LA 5JRZA 1G3IA 2QMOA 3QY0A 4TYPA 1XPOA 4WQ3A 1KSJA 2BMJA 2NO9A 3I5GC 5HPYB 4PC6A 3LA6A 4YMTA 3FFBA 1W36B 3C5HA 1N0YA 2WM9B 4BFYA 4G3XA 1SVKA 4YMWA 4PHNA 1RFLA 3OIWA 4HAUA 1CP2A 1JJ7A 3EK4A 2JJ2A 3CRMA 2LLUA 4GOXA 1D2EA 2AK3A 4CT5A 3QNUA 1W47A 2YOGA 1EL4A 1DO0A 2EFCB 2YVUA 3BD9A 4CZ2A 4MRXA 2CNWA 4FMDB 3SBEA 4TZ6A 2B8TA 3B82A 2OHFA 3AEZA 2FEOA 3REFA 1CJUC 3AGQA 4D1EA 3C5CA 4QGHA 121PA 2IA5A 5M04A 1QHHB 1Z6YA 821PA 3U5ZB 1KK7Z 3AV0B 4A15A 1G6OA 4OK6A 1II8B 4I99A 2CBZA 5AK0A 1CLMA 3BH6A 3AGPA 3E3RA 2I3BA 2LVJA 3QPVA 1F4OA 1OXXK 2J41A 2BOVA 2NGRA 1OFIA 2OXCA 3DOFA 2DWPA 2XTNA 4A2PA 4V02A 2J0QA 4R71A 1LV7A 1SR6C 2BKUA 2NPFA 3L0SA 1Q1BA 1ZCBA 2WIBA 3K21A 1E0SA 1KO8A 1YR7A 2HCJB 5IHPA 4EJSC 1L2TA 3W5IA 4WOPA 2IS9A 1MKYA 1WDTA 2ZI5A 2F55A 2JAQA 1E2IA 2QP3A 4Z54A 1YRBA 1JECA 1COWA 2N46A 2C9YA 3P26A 2GEDA 4P4SB 5AUPB 1QBKC 1W2HA 5C2JB 3GJ5A 3MWLA 5JEDA 1PRWA 4US1R 3RNLA 2OEPA 1IN5A 3NBYC 1DF0A 4OR9B 1RRGA 4JKIA 2MHHA 2ZJ2A 5KNDA 5CM9C 3EXAA 1XFYO 4FMDF 1R4AA 3HYRA 3CX6A 1DJGA 2KBIA 3AKDA 3SS8A 2BECA 1TQ2A 1WP9A 1Z06A 4IVRA 1AM4D 2QMUA 3NH9A 2WSSA 5FTJA 2J7PA 5DI3A 2ZRFA 1SBJA 4A4CA 1KAGA 1U90A 2CXXA 2W6IA 1ELOA 3GJXC 4JLPA 4OL0A 4QM6A 1TTTA 1Y0VH 1CMFA 1T6NA 4Z1MD 4BASA 2CBLA 3VX3A 2QGNA 2PSRA 1EGAA 1VKJA 1UFQA 4QC2A 4W5HA 3B85A 1K94A 4GMXA 5FTLA 1AKYA 1ZNYA 4RD4A 1ZNXA 1KDOA 3OX6A 1JWDA 3LX5A 3X2SA 1XP8A 3OAAD 1XNJA 1IY1A 2KBFA 2CTNA 1J1EA 3N2IA 1EFUA 3SZRA 4V0MA 3AM1A 1DTLA 5IT5A 3EARA 3Q9LA 3NTUA 4M0LA 3TBKA 3FKSA 4DSUA 1KK8B 3EC2A 2O52A 4IOMA 1NN3A 4A0FA 4DSTA 1QIWA 1S3PA 2K0JA 2G88A 2FE4A 2K8MB 2Y4QA 2ATXA 4HDQB 4RZXA 4HSEA 4LDJA 2ZI7A 2PZGA 2I1VB 3U2QA 1Q1EA 2ZSEA 2RHMA 5BYKA 4GZLA 3EAQA 1NG9A 2FGJA 2JJ1D 4M9ZA 4OQMA 1X6VA 1T9HA 3DKVA 5BN5A 3GJ6A 2GVZC 1LS6A 1NSFA 3QG5A 2FA9A 3ZS8A 2VEDA 4C0KA 3VHLB 4JLDA 5DLQC 3MRSA 3GLGA 3K70D 1RW4A 2JGNA 1SY9A 1O3YA 1KK7Y 1P2UA 3Q85A 4FCVA 4PPQA 4QG7A 1HEIA 4EKDA 2FPLA 4EUNA 1SL7A 2FZLA 1E2KA 3ZS9A 5FUVA 4TYWA 1XXHE 4MQBA 2VRGA 3TS5C 4FWTA 2MLFC 4DCNA 3RC3A 3QXCA 2UKDA 4L5BA 3L8ZA 5DNYB 1QVAA 4JIMA 2ZEJA 1AN0A 2OZEA 2V1UA 5BWMA 4DDVA 1MO6A 4NU0A 5I2OA 3THXA 4D25A 3PG5A 3WBKA 3KKOA 3SHFA 2OSBA 5JJKA 3FMPB 1T8TA 4KVAA 3ZD6A 1XMVA 4Y0VA 1XJCA 3A1UA 2IYWA 2KE5A 4TMZA 2J45A 2R6DA 4Q1AA 4W7SA 1XXHB 2A9KA 5CPVA 1PSRA 2BDTA 1HTWA 1SVIA 1QVIZ 1G9XA 4QRHA 2GA8A 2P3SA 2QRNA 4IXNA 4RFSB 2FJUA 2IC5A 2JEOA 1AS0A 1B8CA 2F43A 5EZ6B 3BUNB 4TWZA 5HCNA 3TE6A 3U60B 3LBHA 4BY5A 1B7TZ 2BE6A 2CDNA 3QEOA 2E87A 1W5TA 3LVQE 4FCTA 4JLKA 4TSFA 4KAXA 4I1VA 1S9DA 1OFUX 2G3YA 3QKSA 1U5IA 2PLRA 4GPTA 1OMVA 4HZUA 3U6KA 2ZFDA 1SCMB 2LMTA 1GP2A 3CX8A 4LV5B 1YQTA 2RB4A 2C8VA 5H1YA 2L51A 1G7TA 1NY6A 3TIFA 2NLNA 4EPWA 1MXLC 5TY0A 1LY1A 3I73A 3V4RA 4Q4HA 4CEIB 5D69A 4ACBA 1NVVR 2CJWA 2VP4A 2OILA 2GBLC 3BBPA 4DVGA 4GGFA 1BMOA 1W0JD 1X02A 2I2RE 4AIIA 1KHTA 2IYTA 3QG1A 2H92A 5HKWA 4LHWA 3B9PA 2QAGB 1RJVA 3IHWA 3UPUA 4JBXA 3VRRA 2NZJA 2A5DA 2M1KB 4PHKA 1W36C 3O8BA 1G291 2OBLA 2V7QD 5FR2A 3U7HB 3SIBA 3FWCA 3WHUB 1XTSA 4PE1A 1SXJD 2Q3MA 1EXMA 4NYMR 4FMCB 4B74A 5AUOB 4LYAA 4LJ9A 4L8GA 3QF7A 4M1MA 4MLWA 4QHYA 3CIOA 2ZQ5A 3THYA 3DVJA 5JECA 3MJRA 2NO7A 3GLFE 1OH6A 2AWOA 2H17A 4QNMA 1N0WA 4HZIA 2JOJA 4DJTA 3AB3A 1DGUA 4OHWA 1FUUA 4Q4JB 5EE1A 1F70A 1TU4A 3B1YA 4EPYA 4UKDA 2Z5FA 3TH5A 5J4YA 4BZQA 2KGBC 5AEQA 4TMWA 3R9IA 3MCAA 4ARZA 5J4KA 2ZE6A 2O0KA 4Q9JA 4KI0A 1BOFA 1MO5A 3HU2A 2QE7A 3QPWA 5FL3A 4LX0A 3GLFB 3SFVA 5HZKA 4P4UA 3ZLJA 2JJ8A 2ANBA 4BZPA 5IDVA 3U3KA 3NDBB 1H4BA 3PCRB 4A36A 3V9PA 2BV3A 2DPXA 4WXPA 1NX0A 2IXGA 3Q5EA 2DFLA 4NCJA 3T35A 3AKBA 4BEBA 2RGNC 1GILA 3PLFB 4CEJA 2CCMA 1N0VC 1KI6A 2MSDB 3GEEA 1SVMA 1UKYA 4LK2A 1R6BX 5F9HA 5CITA 2VTKA 1IKUA 2ZI4A 4BLSA 4UNRA 5JS8A 4ZCIA 2YWEA 3T1TA 1OYYA 2PMYA 3SG3A 2XTZA 2F1RA 4FMCF 2L5XB 1S6JA 2JLVA 1TAGA 4OK3A 3AQ4A 3WMGA 2ZU0C 4MYTA 1LF0A 4TTPA 1Z07A 4BQSA 1M31A 2L4HA 3KF9A 3TDIA 2G0NA 4RD1A 2A2ZA 4OI0A 1DAKA 2F3TA 2BJVA 2ZE8A 2LUCA 2ZRMA 3QF4A 3B5JA 1E9RA 2C9CA 2X77A 3IEVA 4TTRA 1KGDA 1N2CE 1JFKA 4L9WA 4CDGA 3VKGA 4U8DA 1KI7A 3LVRE 5KHOC 3FGNA 3A1VA 1OMDA 2F2PA 3IIKA 5CLQA 3VMFA 3TUZC 1VG1A 3LLEA 4A8JB 4MZLA 5DN6A 1CDPA 2P6NA 2JDIA 1UURA 2O8DB 4CYMA 5JMTA 4M2QA 1IWQA 1F2UA 4XH9B 3SG4A 2FOTA 4DLUA 4PE0A 1A75B 1VCIA 2YINC 5C1BA 4NQGA 3FIAA 1XJQA 2IYSA 3JVVA 4TL7A 5D3MB 4MGIR 4AC9A 1QHSA 3OFND 1PVAA 4BGDA 1VYUA 3O78A 1ZRHA 4BLPA 4KVGA 4TLAA 1WB9A 4YGDB 3O2PA 2AFIE 2Z43A 3WNBA 2IT1A 4XJKA 1S96A 4M8NE 3F45A 1KK8C 2IYQA 3KJGA 2C2HA 2UVQA 3B1WA 1K9PA 1S5GZ 3PUYA 1DAIA 4P32A 4XSGA 3FHTA 3KZ1E 1ALWA 1E2QA 1LF5A 1YE8A 1W7AA 1SK6D 2BE4A 1NX1A 4PE4A 1G16A 1VTKA 3B1VA 1X8LA 3UKDA 1EWQA 1JBAA 1RPZA 2AK2A 2N42A 1WDCB 2ASEA 1TU3A 3KFVA 4V0KA 4BFSA 1KMQA 2AN9A 2B7CA 3GK4X 3LK0A 2NOAA 1L8QA 4V0NA 4D4KA 2JJ2D 3QOFA 3T1VA 1JFJA 1NKSA 2ZRDA 4LV8B 1KK3A 3KQUA 1XEXA 4Q4LA 4TNCA 3AUYA 4B48A 4EFMA 2CNWD 5FL7A 1E3MA 1QRAA 1KYIA 5BPJA 2R6CA 3DM5A 4AKHA 2GXAA 2IUSA 5HR5A 1T4GA 3U44B 2GRJA 3W3AA 3RANA 2MBXA 4DLXA 1C1YA 1Y3AA 4LHVA 2ZRCA 4H1UA 3QF4B 2Q0HA 4FINA 4XTCS 3SU8A 5JWRA 3OIVA 2J5XA 1QHIA 2QORA 2BMEA 2ZSDA 1KFXS 1NWDA 1W5SA 4FN5A 4JVMA 3ZVNA 5KTYA 2D62A 2GCPA 5FPYA 4P0TA 3IILA 4LBVA 1IJFA 2ZS8A 2JNFA 3VR6A 2ZYVX 1ZOTB 2R9VA 1U8YA 3IO5A 2GAOA 3W5JA 2YC4C 2YYZA 1PVOA 5KNBA 2VHTA 1KI4A 2BVNA 2QSYA 3WHLA 4ITRC 2VF8A 3QUSA 3I5IB 4RSGA 1COWD 1RJ9B 2WSMA 5AWFC 4KCGA 4DLZA 1OV4A 2IS2A 2ZJBA 2B92A 2VHJA 2WHXA 2EU8A 3BAFA 4RD0A 1KFXL 4P5OE 1ZIOA 4XWOA 4GT1A 4MUBA 3A4MA 1TCFA 3UMSA 1I2MA 3AKCA 1Z0JA 1SCMC 2O0JA 4GP6A 2PCJA 4HYYA 3AP2A 3OHMB 3U7GA 4R1EA 2EFHB 2ZROA 2P67A 3EK8A 1AZTA 3WRYC 3C1VA 4A6XA 2OFOA 1FNMA 1FX0A 1UEJA 5TDHA 5K8UA 1OXVA 4YI9A 1IOZA 2Y5IA 2BEKA 2W6ID 2ZKMX 1XDBA 2QY9A 4GDFA 1B23P 1ANKA 4KSBA 4PSKA 1B8RA 1VIAA 3AVVA 2QAGC 2XNSA 1US8B 4G5OA 3CO5A 3B1XA 5TB5A 4PC1A 5EE0A 4A82A 1IQPA 2CL7X 2GJKA 2ZRPA 1YZNA 3K8YA 4LI0A 1CFDA 4M22A 1MH1A 5EXPA 1OOJA 2IUUA 1FP6A 3MMPA 2IX3A 1J1DA 3VR2A 2WWFA 2H16A 1S5GY 4MZKA 2QENA 1E9EA 2IEZA 3OEEA 3KL4A 3FKSD 3FVQA 4RY2A 4QJ3A 5JOLA 1XZPA 1ZU5A 2Z4SA 4Q02A 1FI6A 4QJ4A 4LJ6A 3KEVA 2FSFA 4EQ6A 4US2R 5JEEA 4QM7A 3MAAC 4JSTA 1K8UA 1GG2A 2JT0A 1RRFA 3I8XA 4LSGA 2G9NA 1D5CA 3KXIA 1YUUA 1QV0A 4UQOA 2QGZA 3EA0A 2KI6C 4O25A 5BN3A 2I1QA 5E95A 3B8HA 3MWKA 1E2FA 2BMDA 3C8UA 1XFVO 3FDIA 2MAZA 4KBGA 3UG6A 4GNKB 1Z6TA 1E6CA 4HREE 1ETUA 2Y1MA 1L4UA 1NLYA 2RMKA 2YOFA 1E9FA 3I1FA 2X19A 3PVSA 4A1FA 2M0RA 4XOIA 3IGFA 3K9HA 4PX9A 2P5TB 1AJ5A 1NCZA 1HT1E 3QJYA 5JI3E 4KO8A 3CX7A 2V6IA 1ZD8A 2F7SA 1XD2A 4LYHA 1UBGA 5IK2A 4GAOA 4HAYA 1CLBA 3VNVA 1Z0IA 1Z6AA 3DPUA 5CB8A 4AY2A 2VSOA 2BCXA 4X8LA 1WMSA 4LJ7A 4EPXA 2R6GA 1K9UA 2FN4A 3WXMA 3TKLA 1L2OB 3A6PC 3CZPA 2VF7A 4B32A 4BPBA 4YLGA 2CNPA 2WWIA 1ODBA 3ASZA 2KHNA 4PE7A 1E79A 2R8RA 4C7OA 4MKHA 3CR7A 2KI4B 1YUTA 1RKBA 1W46A 1XFAA 1QHYA 3CPJB 1YVLA 2QROA 3SOPA 3CLNA 3VX4A 1JXOA 3ICQB 3AF4A 1ZW6A 3NWJA 1S0UA 3K0AA 1JALA 1A5TA 1OXSC 2WWGA 2AR7A 1U9IA 1XTRA 3FMOB 1IAQA 2EYQA 3LRPA 1EESA 1G18A 4A8JC 3LCPC 2M7LA 4JMPA 1GGZA 2BBWA 1ZP6A 2IS1A 1GQMA 2G0TA 2W58A 4D0GA 1G5PA 4D2IA 3D6TB 1U0HC 1CXZA 2MA2A 2REOA 3QXSA 4H9GA 4OJKA 4UNSA 3OF5A 1II0A 1OB5A 3EIEA 3F5FA 1AVSA 4GPLB 3SI7A 4TSFD 4LBWA 4XWAA 3I5FB 1CLLA 1ONBA 2H18A 2ZS9A 3ZYCA 1MABB 2W2VA 1T0HB 1E9AA 1KTVA 2YNMA 3GLHA 1OH7A 1J8YF 4QBFA 1SGWA 4YMSA 1YX8A 2J0UB 1DEKA 1JR3A 2B8WA 1PZNA 2GJSA 3PM8A 1FUKA 4Z8XA 5DYGA 3RM1A 1KMHB 2BBSA 5DE3A 4DBLC 1WXQA 1UADA 2BCJQ 3LY5A 2QPAA 3HU1A 1EG4A 5CDFA 4Y0AA 1K5DA 4OHZA 1SPYA 4OQNA 1OIXA 2CEAA 3H84A 1BH2A 3R7WA 3LV8A 4OQLA 2V55B 1K8RA 1QATA 2HF5A 1CRQA 4E5UA 3I61A 3L0OA 3NSIA 1GOTA 5KSOA 3E5HA 521PA 4G1UC 1O87A 1ZC4A 2J1LA 2OFXA 1RFJA 4Q1EA 2LANA 4AG6A 1CEEA 2CHVA 4M1OA 3I32A 2ZR7A 1F4QA 4KHZA 1RIFA 2V54A 3HR7A 2JRFA 4PFSA 2OS8B 2QTFA 5JSZB 3ASYA 4TLCA 1KSHA 3L8YA 2CVFA 2XX3A 2ZJAA 4LC1A 3ZZ0A 2PL3A 2LNKA 1VG0B 1WQ1R 4NCHA 3GQBA 4Q48A 4DS7A 3M6AA 1MQ1A 1R0WA 3GOFA 4AOMA 2ZAOA 3EZ7A 1Q80A 3IIMA 2DWOA 3SJSA 5E7IA 4WXRA 2PJRA 2ZRKA 4CW7A 4NL4H 1SVWA 4ICBA 2LMUA 5BN4A 4F4CA 2YV5A 2JXCA 3H4SE 1ZACA 2PMDA 4UNQA 4YRUA 1SKTA 5I2QA 2QE7D 3U6BA 2LLTA 2IYZA 3GLHE 1ZMXA 1TX4B 2GCOB 3WNCA 5JFGA 1JR3E 3ETLA 2A4JA 1N6OA 4DLYA 2OBNA 5JZVA 2ZN9A 2ZUCA 3DKPA 4OBEA 1KSFX 3R8CA 2CK3A 1X86B 2F3YA 4I1SA 3B2EA 4IOLA 4XTRA 3I5IC 4WW0A 3ZH9B 3FWBA 1FTNA 2WJIA 4RKFA 3GLIE 1WBBA 1BYIA 4KYUA 3I5HC 4DT1B 1GRRA 1IY2A 1CKKA 1M1YE 1G1MA 2AHOA 3EC1A 1EFRA 2ZYWX 1JBKA 1Q20A 2A5YB 1QX7A 3RAPR 4TLEA 3U4QA 1UM8A 4RJLA 4BRWA 2XEXA 1YR6A 1DTSA 3SJAA 1NVVQ 2K2AA 1ZIPA 3I92A 4KYIB 4OYHA 3EZ6A 1N6LA 2ZNEA 2Z0MA 1JB1A 4HUQB 4GI7A 4B3FX 2ZVPX 3GLIB 2OAQ1 4M2LA 2JTZA 5CSJA 2VHCA 1V1FA 1S3SA 3U3OA 2WNDA 1EFTA 5A5GA 1GSIA 1NMZA 1N5KA 2AAOA 5DN6D 2NTYC 2ZITA 4JT4A 2JDID 4ZCUA 4TLBA 3BH0A 2HPSA 2WKQA 3VTKA 2P6RA 1GZSA 4JLVA 2AKYA 2GF9A 1A2KC 1K9KA 1BLQA 4YC7A 3AVXA 3W90A 4DDTA 1ESNA 2AUCA 1UDXA 3B13B 2KOTA 3PR1A 5LDDC 4URYR 1SL9A 5JRJA 1KOFA 1GWNA 2IYRA 2W2XA 1EXRA 3AF2A 4BEJA 4HAXA 3U7FB 1JF0A 3PEWA 1LXFC 1HA3A 2KBEA 2ODEA 1CDMA 1HE8B 5AFPA 2A78A 4LJ5A 1GDDA 3LW8A 5DGXA 4FI3C 1NP8A 1K6MA 2EC6B 4B35A 3P20A 1OW3B 1OZSA 1WCV1 1E98A 4RD6A 1YR5A 4XVQA 1KI3A 4ZIRA 3ZNIA 1E99A 2AD1A 3CR8A 2VSXA 2BKHB 5B30A 1Z63A 1FW4A 3PENA 3TK1A 2RGNA 5HKZA 3PALA 2KNEA 1V1GA 4YI8A 4R7ZA 2XB2A 5DHFA 3TVTA 4QJ5B 3LQQA 3BOWA 1PSBA 2CMKA 2J7KA 2KDHA 1D6JA 3RS0A 1F48A 3LD9A 3CW2A 2UZ3A 4Q5IA 3VRQA 1D8TA 3RWOA 2QBYB 3KKPA 4II7A 4M4SA 2ZXUA 1Y1UA 4QGGA 1QASA 1RECA 4YGAA 4HLUA 3W8NA 4A9AA 2M29A 4JLNA 1K93D 2IYUA 1RROA 4X8OA 2RGXA 5E3HA 1R0ZA 1KZ7B 4LRWA 2IYLD 4A0HA 2HXYA 2QEQA 2FOLA 3SQXA 4ETOA 5EP2A 2PH1A 5KDOA 2DBYA 1E2HA 2CE7A 4Q18A 2COLB 5A0FA 1P4SA 2KYCA 4Q66C 1G3QA 4TQAA 4XVRA 3BRWD 4AYWA 4CEHA 4M1KA 1JAHA 2E9SA 3VFDA 2QSZA 4N1FA 4HDCA 2GGMA 2GK6A 2PEZA 3VR5A 4B2LA 1LB1B 1ZU4A 3LXXA 1UHIA 3AVUA 1KK1A 5J3XA 2D7DA 1ZFSA 4JBWA 4HB0A 1NN0A 3NXSA 5KPDA 3RVBA 5FPKA 3KTAA 1A1VA 1K5GA 4ON9A 4ZI2A 3O47A 1KO7A 4AYTA 5UKDA 4TMTA 1L7ZA 4U7DA 1DGVA 1IGVA 2CT9A 3ZVLA 4EFNA 2IXFA 2PX3A 4OCIA 3LK1A 3NHBA 4MRSA 3C7KA 4BLTA 4OKSA 3GD7A 3DF0B 3I5FC 1A2XA 1YRTB 2DB3A 4F91B 4HATA 2WKPA 1NIWA 4O0MA 5L3SB 1IN8A 4C0QC 1BYUA 2HJVA 3U7EB 1FBVA 2KWIA 4XVUA 5GJBA 1M39A 2WIAA 1OF1A 1YZQA 4QGFA 1G41A 1FW6A 3LAWA 2QAJA 1F8HA 3SNHA 4GBMA 1N65A 1I2DA 4NTZA 2BKIB 4LHZA 2KFFA 3B60A 3X1WA 4U00A 3JTDC 1AKEA 4PZZA 1IQ5A 1NIJA 5DISB 2P6BB 3VHXA 4M2PA 2K7BA 1KSOA 1SYMA 1H8EA 1MV5A 1SVLA 1Z08A 5HTKA 4MGKR 3SE0A 4ZKDA 5K8IA 3K70C 3A8RA 5D7FA 1TPZA 3FHCB 3TW8B 4B3XA 2RGCA 1D9ZA 3VRPA 1LVCD 1P61B 2R6AA 1YUSA 3OESA 1J70A 4PZYA 2XJ9A 3ADDA 2OS8C 4ZCVA 2WOJA 3I5XA 1FNNA 1VMAA 4Q4AA 3TDUA 1M34E 2J3EA 1GITA 3OEED 2ECKA 3NBXX 2OXRA 4ZCLA 3NIBA 1OXTA 1KO4A 3UWOA 3RSLA 2JLQA 5FI1B 2R2IA 2QPTA 4L9MA 3DHWC 1QVRA 1Z0DA 3L82B 1UKEA 3EASA 2JT8A 4G5RA 4HB4A 3TUIC 3I8SA 1IJ5A 1TNQA 2D74A 3CNOA 1B9AA 5DKRA 2JCSA 2O8EA 3CGAA 5CIQA 4CFRA 3K0CA 2NCOA 2ANCA 1LS1A 1NKTA 3GFPA 5KDDA 4MYUA 5EE9A 3BOSA 4JLBA 2QP4A 4BLOA 4DLVA 4TZ0A 3MFYA 1XFZO 2BMFA 3CWGA 4LCBA 1NUBA 1ODFA 2WPDA 1VECA 1XK4C 5IK2D 1KQMB 2WCFA 2ONJA 4WQ2A 1CR0A 2C77A 2FWRA 2ODBA 5TARA 5J47A 1DF0B 2D2FA 2X1VA 1XO5A 1TCOB 1S1MA 1DELA 2ZRSA 1XF9A 2O0HA 4TMXA 3IPXA 3NDPA 3CR4X 2NZ8A 1PLKA 3GJ8A 3IKJA 3QKTA 2YKGA 4PHTA 1DBSA 1E79D 1OKKA 2I94A 2AX4A 2C96A 2WBLC 4XD7A 5EZ5A 2GJ8A 5DI3B 2GDJA 1CR2A 2AD5A 4GSYA 2WZQA 2C9OA 1CS4C 1TEXA 4V0ME 1LA0A 1W2GA 1F60A 3A36A 2PZEA 4NDCA 4DUGA 4YXWA 5FOTA 3BFXA 4HDOB 2ZJ5A 4MRVA 1NNEA 3G0HA 3CWQA 1KKLA 1MR8A 1E32A 1GL9B 1LVGA 3NBZC 3QBVA 1QLSA 3AVOA 1OZOA 1GIAA 1SVSA 5HKKD 2HLDA 1DADA 1AGPA 1R8QA 3ZIAA 1F54A 2HQ8A 4USLA 1SXJC 5KDLA 2W6JA 3WP1B 4YMVA 4MRRA 2YC2C 3AP3A 2K7CA 2XNDA 2Q9BA 4JZKA 4LY6A 3WYFA 1XA5A 3PUZA 1P60A 4PHHA 1QG2A 2DWQA 2ZTSA 3DM9B 4EFLA 4PAOA 1UBEA 4N1GA 4C3ZA 5SZIA 1Y6WA 1NP6A 3D3QA 3THWA 3GLGE 4V0LA 3AAJA 1Z29A 2PASA 1ZUZA 4NP6A 4M2OA 2O8FA 1VCNA 2VP2A 1JR3D 1KO5A 2CLCX 2XOKA 4KLNA 5L3QA 3KO0A 4PQYA 2Q9AA 2DFNA 2HV8A 3P1JA 3EKHA 2LCFA 1UP5A 3PEUA 1KY3A 1Z3IX 1X1RA 1SHZA 2G83A 4QGAA 1D9XA 1BODA 1TQDA 2IYXA 5J5CA 4QOSA 3VKWA 1U98A 5ANRB 1DARA 3K0FA 1WRBA 3ZVRA 4BFTA 2OCPA 4LV6A 2OCAA 4NHOA 4H1VA 3MUFA 2WORA 3GLGB 1J7KA 2F9LA 2NG1A 1AS3A 2LWIA 3CONA 3H0KA 5BQ5A 4PDZA 2HT1A 4GRAA 5GQQC 2JLYA 1C4OA 3PUVA 4YBHB 4GFDA 1PALA 3VU9A 3WYGA 4GL2A 4C9BA 1YZTA 4DCUA 1R2QA 4NH0A 5B2ZA 4HAVA 5EXTA 1U8ZA 1E2EA 3M4YA 1VG8A 3KXLA 4ABYA 3E70C 1Z8FA 2HXSA 5E7MA 4F4IA 1T8UA 5FTKA 1P6XA 3NEYA 4PTLA 1M46A 3THXB 4Q03A 1P3JA 3DZDA 4QHTA 4MEWA 3N2EA 4FD2A 4IDQA 5HE9A 4PO9A 4PCWA 5L3VA 1VCOA 4US0R 1IBRA 2AWNA 3JVUA 2VH5R 5HYDA 1N6KA 3GPLA 4PHMA 3T1OA 2GNOA 2J59A 3CRQA 1PULA 1X8JA 1RVDA 2FJUB 2F43B 1B8LA 3W34A 3IQOA 1WF3A 1ZM4A 1QDEA 2M3WA 2BCBA 2CK3D 2ZYTX 4JLMA 5TV2A 2WWXA 2LVIA 1J8MF 3QVUA 1OT3A 1XU4A 2CHQA 2L98A 3K0EA 1BU3A 3KFXA 5DH9A 4DB4A 1GRQA 5JWOA 3D0YA 3QKSB 1U5IB 1TQ6A 4HZUB 3SG2A 1EFRD 3BFVA 3BJIC 3K09A 1E1QA 4LZZA 1RTP1 4PC2A 4C0AC 2W2TA 4XWKA 1FPMA 1AJEA 1E1RD 1TMKA 1IN6A 4IVPA 4LYJA 4UXJA 1G4YR 4A2WA 5J4HA 2J87A 4Q4HB 4QKQA 3I5YA 2CJWB 4JYCA 3JVTB 4FWIB 3RLZA 5KPJA 1CKEA 1E2GA 1QVIY 4F0ZB 3KKNA 3TQFA 1DJZA 2DY1A 1OLOA 1XEWX 2G2BA 1RC8A 2LVKA 1RYHA 4TLDA 3RRMA 1DG3A 3A37A 4LBZA 4N3NA 1B7TY 3S1AA 3QENA 1BR4B 3ADBA 3W3ZB 4KITB 1YZKA 4PC3A 1NSTA 3P32A 3SG7A 1FMJA 5H8WA 1T5LA 4NDZA 3TGPA 1E2LA 5AR1A 1C9KA 4E68A 4I1UA 4URUR 4LPSA 3ZVMA 2ZI3A 2L0XA 5AERA 1NVXQ 4K81B 3F0TA 3THYB 1MUXA 1TTXA 1G5RA 5EUMA 4BWYA 3ECCA 4YQFA 4N0EA 1U81A 4DLTA 1T5IA 5BW8A 1W0KA 1X8KA 4D0LB 1CLUA 1ZM3A 3KB1A 3MG9A 4BFVA 1AP4A 1AIPA 2MJWB 3HCMA 2GEVA 3CZTX 5G53C 4MA4A 4ARZB 1G3UA 1R6PA 5GJCA 1WRKA 3PITA 4P3YA 3ND9A 3CM0A 1HQVA 5K8TA 2GXQA 3KXKA 5GJVC 5AJXA 2V53A 3EW9A 4P2YB 1GNQA 5GVRA 2JLWA 221PA 2ZUDA 4W5JA 2R2AA 2WJHA 3DZ8A 1DJWA 4CPVA 5FR1A 1NX2A 2IW3A 5LB2A 4ZCMA 1YVHA 2IBMA 1KNQA 3B7GA 4CEJB 1KI6B 4TL8A 2VP9A 1BS1A 1KY2A 3RWMB 3GJ7A 1CRPA 1CR4A 2P5SA 1WRZA 2BM0A 1J7OA 3KPXA 1Y1XA 3TJZA 4TYNA 5EP1A 3EZ2A 2FFHA 3FMFA 4DSOA 5ELXA 3WNDA 1UHHA 1GNRA 3O8CA 4ZPXA 1Q12A 2ZYUX 3QE0A 3VRNA 1G8HA 4F38A 2A5GA 4PAQA 3REGA 1TADA 2JIZA 3Q7QA 2JLRA 1LFDB 4ZO4A 4GFTA 1JPNA 4NCKA 4HRGA 3LL8B 3BB3A 2OESA 2W0SA 1G3MA 1BOCA 1CNPA 2I18A 1BMFA 4IDHA 5F9FA 1JR6A 2H2KA 1SKYE 1G4UR 1XPRA 1F2UB 1IXSB 5JHGB 3CF2A 4JKYA 3NVAA 1CTRA 1MHOA 1C7VA 4Q9KA 3NSLA 2BBNA 4L15A 4DCVA 1WRLA 4CFQA 3BERA 4IDOA 3CRW1 4LJ8A 4EPTA 3TAHA 4B44A 3QQ5A 1NYAA 4PPFA 1CDLA 3LQRA 4U02A 4JL8A 4CT4B 1VYVA 1XD9A 2QPOA 2FSHA 4P4TA 4YDHB 3VR3A 4DIEA 4OV2A 3VGOA 2QTHA 2XB4A 3B9QA 1NSHA 4B73A 4KFTA 4W5WA 4XJKB 1P9RA 3KQHA 4DIRA 1SKYB 3A1SA 3IQXA 3BQ3A 2H1LA 3IBGA 5HLOA 1CULC 3EX7C 1CFCA 4CVNA 1N0UA 1WE2A 1BO6A 1JJVA 2FSIA 2PT5A 1GAJA 2WMOB 2WSSD 3VAAA 2J7PD 4ZDWA 1X1SA 1PUIA 2P2LA 2ZSFA 4D4JA 4ESVA 2F33A 1S8FA 3GK2A 2NO6A 1PVBA 2A5JA 2ZR9A 4OQFA 4HUTA 3GFTA 1M2OB 2LE9B 1NF3A 3TQCA 4C0BA 4DSNA 4Q9HA 2VP0A 3IPYA 1KIMA 3SG6A 4G01B 1TNPA 1QV1A 4PHJA 2F1JA 1ALVA 2CE2X 2PCLA 1BKDR 4QL3A 1XEXB 4IKEA 1HQCA 3KKQA 3F8TA 5F2EA 2BBTA 1E0JA 4V03A 1DAMA 1YZGA 2RH5A 4N1AA 2DFTA 3T12A 3HYTA 2SHKA 1GKYA 4CGZA 1TF7A 1Q22A 2QTVB 3BXZA 4IHQA 4PSVA 3QKRA 5CLLA 3SYNA 4L16A 5DSZA 2ODNA 2PMKA 4XYNA 4K46A 4DLRA 2PALA 1NCYA 5CJPA 4Z1MA 1RRCA 3CR2A 2WWWA 2JLZA 2CLDX 1XZQA 2VRWA 4EJSA 2CXJA 2BM1A 4IXMA 2K61A 1Q1ZA 2C78A 5K89A 2KGRA 2RGGA 3FMIA 4L9SA 2ZSBA 3AP1A 3AKEA 2QL6A 4GMDA 2QP9X 2EW1A 3P4YA 5DKNA 1Z6XA 3A4LA 4WRIA 3TR0A 1CB1A 1G7RA 1B47A 1GUAA 1RK9A 3ZQJA 3CH4B 3OEHA 1Y63A 1AQYA 2V6JA 4LWZA 1QHGA 1TUIA 4HSZA 5CSIA 3AAKA 4YGCB 3BWDD 1LKJA 2PZFA 2M1UA 1Z0FA 3DVMA 2BCGY 2WAXA 2BHRA 2KQYA 2V4ZA 1C07A 2LV7A 3CS1A 1IM2A 1NN5A 2ZI6A 2ZETA 3C16C 4MDFA 1OIWA 5B64A 1RYFA 3SC3A 1R5NA 4PPNA 1YRUB 3PSRA 3K1JA 1EK0A 2FFBA 3EZ9A 3X1DA 1QF9A 2WICA 2ZJ8A 1M8PA 5CYPA 4MYHA 1QXPA 1NG1A 3BUOB 1TNDA 2JQ6A 2LKDA 3CUEF 1OKKD 1CIPA 2KQ6A 1FX0B 4XD7D 2IEYA 2ZRHA 5A4JA 5FUYA 2QACA 3JVTC 2LHLA 1R0XA 1KFUS 2H7VA 2ZJZA 3HJNA 4NDBA 1FI5A 4GGFC 4DUQA 4WZBE 3WBJA 1JNYA 1B0UA 3Q5DA 4DUGD 1OFHA 1AJ4A 2W00A 4YXWD 1FF1A 1IXRC 1OYWA 1TEVA 3OZXA 5EE5B 2K5UA 3RDPA 3VKHA 1DJYA 1MO3A 4BFWA 2KFHA 1G33A 3LNCA 1MXEA 3OB2B 1S9HA 2KB0A 2PT7A 1CR1A 2ZAMA 3C14C 1I4LD 1AK8A 1SVOA 3EWAA 3T5GA 4JLOA 5C4MA 4P31A 2HLDD 3DDCA 4IDPA 421PA 3SQWA 2DFKB 3K0SA 1UHJA 2ZSAA 2W6JD 4O2RA 4Q7KA 3AVYA 3OIUA 5ER4X 1TF2A 5CM8B 4YMUA 1Q57A 2XNDD 3BIFA 1NMYA 1HY3A 1KFUL 1QIVA 3ONWA 2LCPA 4HEJA 3TAUA 2QA5A 4QFMA 1VPLA 3PUXA 1KO1A 1DVRA 4Q01A 4Q00A 4QJ3B 4TQ9A 2PLFA 4QJ4B 1KJWA 4EQ6B 2NIPA 3BUXB 2ZRNA 5F98A 2FCDA 1DT7B 2G1KA 4Q21A 4DCTA 2XOKD 1MT0A 2ZI9A 5GADl 3RRZA 4YGEB 3DL0A 4E22A 1V43A 2ZM5A 2EWWA 3UWKA 5FBVB 621PA 4UXIA 2WTUA 1PV4A 2EVWX 2E6WA 2GK7A 4R98A 2OBMA 4LUCA 4FQOA 1TUEA 3FHOA 1F2TA 1CJKC 1XK4A 2H5EA 5J4VA 1NLZA 2JC2A 1WDCC 3OE7A 4JL6A 5DO9A 2L0PA 5HCIA 1DOAA 2ZU6A 1GTVA 4E07A 1GM5A 1XD2B 1F71A 2PEYA 4NMMA 5FBLB 3NKVA 2HYDA 4A4DA 2QZ4A 3MD0A 2GJ9A 2OM2A 3JZMA 4MVFA 1S4QA 1W7IB 4G0NA 2KSQA 4CRWB 5SZHB 1CJMA 2B7BA 2O8CA 4UPGA 3HDTA 4MRNA 1UHKA 2JPTA 4ERNA 2RGIA 4JBYA 4C7OB 3BS4A 5TXGA 3RHFA 2QNRA 1IN4A 3PQCA 1Z47A 2V7QA 1KI1A 2CCKA 3CZQA 4NBSA 1FZQA 1KKMA 1X3SA 3K0AB 3SFZA 2EGDA 2GZDA 2XAUA 4WZ6A 2O8BA 1SXJA 3PFIA 1SKQA 3WP0A 4B71A 3PXGA 2H8KA 1XVJA 1II9A 4Q9LA 2A30A 4HAZA 2ISDA 2FX3A 4JYBA 4R2HA 1XTJA 2BC9A 4KFRA 5H68A 4F4JA 3NSKA 2HEIA 4GGNA 5AUNB 5CDFE 3SEAA 5KUTA 1YHNA 2RGAA 4DZZA 3D10A 2WWHA 2AKAB 3GEHA 3DD4A 1DE0A 3T1QA 1I4DD 3QIAA 2H57A 1E2DA 2JULA 2I4IA 2ZJYA 1E1QD 2GF0A 3OB1B 2D7CA 2GBLA 3L0PA 5FOXA 5F3WB 3IF7A 3GLHB 3W9YA 5DIFA 2EFGA 3G82C 1B1GA 4ZDJA 5CJ2A 1E2MA 2Y1NA 1XX6A 3EPHA 2X8AA 5B8IB 1EX7A 2I7AA 3AVQA 2G9BA 3QBTA 4JJZA 1JXMA 1IONA 2QT0A 5KYKA 1BF5A 2HT6A 3QVVA 4IEEA 1MOZA 4KFUA 5JS7A 3M0EA 3KHEA 5FFMA 3R7WB 1F2TB 3RYTC 1Z83A 1P2VA 2EWVA 3IEUA 3LO5A 2D4HA 4MH0R 5JCPA 4PXAA 4BZXA 4HI0E 5SZKB 4BUJA 4OHYA 2NMVA 4PO1A 1DS6A 2JTTA 1TL7C 2OV2A 2PJZA 2Q9CA 3CKLA 2VP6A 1CTQA 3H2YA 1YZUA 1NBMA 4M1YA 5LBIA 1NPQA 3I62A 1KSMA 3L2OB 1QHHA 2FFQA 5KU1A 4NYIR 2HDNB 4Q7LA 3TMKA 4BRUA 1UDWA 1II8A 4A4BA 1HURA 1JUOA 5AJVB 4BECA 4F93B 2EHBA 1A4RA 3IO3A 4RD3A 2YWGA 4PQRA 4TT3A 2HJGA 2CHGA 1SCVA 1R5BA 4QHSA 4P33A 4QBHA 4HLCA 5F6TA 1PK0D 1AZSC 3GCGA 1W0KD 5FTMA 2F1IA 2L4IA 3AF3A 5K8LA 5FBWB 2FDCA 4MSPA 2GZAA 1XWIA 3K53A 2AL7A 2CCGA 5AJWA 1DVIA 1XJ0A 2B6HA 2WOOA 1FPWA 2D8NA 5FBQB 3BFKA 4D82A 2O8BB 2IHYA 5JLJA 2ZRLA 1OE0A 3DEFA 2BWJA 1UPTA 3MGCA 1UHNA 1ZUHA 3CRRA 3IQWA 1NJGA 2YOHA 1F55A 1OHHA 1AA9A 2P6UA 3BH7A 4JL5A 4D80A 1P62B 2ZNDA 1UEIA 4IRUB 4P4SA 2VIIA 2KI5A 4GP7A 1XFUO 3AH8A 4LYFA 3Q3JB 2QMHA 2NCPA 2A5FA 2D3WA 1V5WA 1DG1G 4S2EA 2LUXA 4ORBB 5FL7D 1VHTA 4EDHA 1DAHA 5FUXA 1N3BA 5LPNA 4I1OA 3V00A 2RAPA 1CM4A 1J7RA 1CFFA 2C99A 1KDRA 3FYHA 1SW8A 3GJ0A 4NONA 4QXAA 4M1SA 3U4QB 1NVWQ 1E0AA 1NBME 1NX3A 1XEWY 3RC8A 4F92B 4YDSA 2QQ0A 3A4UB 1MRSA 3EVRA 1L2OC 2FV8A 3A58B 3KQLA 1J90A 4X8MA 4A2QA 3FKQA 3Q72A 4B2PA 4LHYA 4JQ0D 2QM7A 2JIZD 4W9MC 1TNWA 2VA8A 2KI4C 4I5JA 5TVKA 3CNNA 4TL6A 5EXSA 3WRXC 4AD8A 1BMFD 1Z6GA 3IQQA 2Q91A 4ILEA 3Q8XB 4PALA 1NCXA 1R8SA 4EPRA 2M97A 3PIRA 1M7BA 3D8BA 3RS5A 3ZZTA 2V1XA 4OK5A 1I4TD 2GESA 4ZV4A 1Q0UA 3MSEB 2XSZA 2O5VA 5FBRB 1XB2A 3BE4A 1DO2A 1GKIA 1T91A 2QG6A 2VYFA 1QZXA 4NE2A 4HRHA 4GUKA 1Z22A 1N5LA 2A3RA 4MKIA 1Q21A 2ONKA 3K9GA 1G17A 1UF9A 3LX8A 3IUYA 1FMLA 2KAXA 1YRAA 1A29A 2ZRTA 1MF8B 2SASA 2F9MA 3P27A 1WLZA 4ZIRB 1DJIA 2LHIA 2JNXA 3E2IA 3PV0A 1H65A 5FI0B 4DXAA 3CB4A 3GJ3A 1N25A 2KYFA 1LW7A 3KUDA 2MLEC 4D81A 4BLQA 1A03A 1ZNWA 1AQUA 3BOWB 2ZRBA 1T3HA 4NKRA 4MKFA 4AG5A 1JF2A 4GOKA 1ESMA 2DR3A 5FOWA 3NG1A 5BXQC 2GGZA 4UNPA 3E1SA 2AXNA 4AKIA 1LINA 1W4BA 4AQJA 4M21A 4POAA 1W4AA 3AVPA 4OHVA 4WAUA 1HQYE 4JJKA 4FMBB 1JQLB 1B4CA 3D7MA 3W8RA 1MR3F 1ZM2A 1ZBDA 1E96A 2C5LA 1F6BA 4DCSA 3D31A 5C18A 2HUPA 3KKMA 1RE0A 4MRPA 4TYQA 4HB2A 4JT2A 3DO6A 5FTNA 1OIVA 2H61C 3MWJA 4D26A 2BBMA 3NEJA 1DJXA 1RRPA 4DEXA 4CEHB 1XXHA 1EFHA 4HLQB 4N0DA 5JWHA 4URVR 2NZ0A 4C4PA 3BB1A 1OSAA 4MGZR 4NYJQ 4RFSA 1Q3TA 4IFEA 1U9IC 2HYIC 1FQKA 3EVUA 1P7CA 5EE3A 3LXRA 2GETA 1PLLA 3UK6A 4WA7A 4B3BA 3OEHD 2MSCB 3KTAB 3HR8A 3NHAA 1Q44A 4C2UA 3KJIA 1S36A 5CYOA 4V0OA 5TNCA 3TVDA 1W7JB 3ZWHA 5ER5A 3M0WA 1VG9B 4MITA 2FU5C 4MN0A 1GGWA 1G7CA 3VR4A 2LVVA 2FG5A 3MWYW 5GVSA 1HE1C 4J0QA 1BR1B 1RWYA 1FL9A 1JPJA 4JVNA 1M74A 2W83A 2PX0A 4NPHA 4FCWA 4CEIA 2VP5A 4G5QA 1OXUA 2SCPA 4BE7B 1S26D 3RABA 2D2EA 3DMNA 4NCIA 2PVBA 1DAEA 2KJQA 1XMSA 2CVHA 3MLEA 5P21A 3R9WA 4Q9IA 2QAGA 3U3RA 2JWWA 4QBIA 2WOSA 1G6HA 2ZRAA 3L0IB 4MYCA 4CF7A 3LFUA 3LBIA 3T34A 1KSGA 2X2EA 1IRJA 3UG7A 3IBYA 1F3OA 4Q7JB 2M9GA 1E0KA 3MSXA 3EK7A 2DHRA 3FWYA 5LD2B 1KNXA 1IY0A 2C98A 3EA5A 5CK4A 5CK5A 1R7RA 1ZYUA 4KFSA 2IUTA 4Q04A 4XJXA 1U2RA 1QTXA 1XEFA 2WCEA 1YR9A 3ADKA 3CF6R 2WJGA 1KK2A 2GJAA 2LKCA 1HT9A 2O60A 3CPHA 4RZ3A 4ACAA 4Q1BA 1HV8A 4Q4JA 4BFXA 5EP3A 3WNXB 3B78A 4FW9A 3LBNA 1TRFA 2ZRIA 1J55A 1ZVQA 4M1TA 4Q4AB 3FB4A 2BEJA 3GMTA 721PA 3BGWA 2JXLA 2FZ4A 2FH5B 2Q3HA 1QX5B 2Z4RA 1E69A 4BFUA 3BC1A 1GFIA 1EG3A 3HP1A 4AK9A 4JLJA 4C30A 2BKEA 3RLFA 3GLFA 2EC6C 1VYTA 5HE8A 5KOYA 2E1RA 2X2FA 3A4NA 3WY9A 2O8EB 5EJEA 2M49B 3PJRA 1TF5A 5G3ZA 4ASUA 2OE2A 5IF9A 1WLMA 1A82A 2ODWA 4NZYA 2WWYA 4Q1DA 3OE7D 3B1ZA 2REBA 5KNCA 4UNNA 5JCZA 3BYAA 1P73A 2Q4UA 2JZIA 4DDWA 1EJ3A 4B6EA 5I8NA 2YWFA 3ZGXA 1OQPA 3UMFA 4A92A 4NDDA 2G1JA 3U3MA 2RGBA 4LJAA 3AF1A 5E4FA 4DEYA 4L4UA 2K7DA 2REXB 1K90D 4C0JA 2BBOA 2HF9A 2A7QA 4Q47A 4AYXA 5FYXA 4PHGA 3ZD7A 4RZUA 2MRDA 1GL7A 3EKJA 4PZLA 3BUWB 3SG5A 2C03A 2AFHE 3O8DA 1YKSA 2KBMA 2OUKA 4ZI3A 1H8HA 3SR0A 4UXHA 4A8JA 2OG2A 5G3YA 2O8DA 2NPIA 1IHUA 4ZKEA 2XGJA 5DI9A 3W6PA 3A1WA 2D06A 2Y8EA 1E9BA 4MDEA 1A75A 1ZAKA 1Z5ZA 4OI1A 1SULA 3FPAA 5CIWA 5D3MA 4ORAB 4DC9A 2ORIA 2RHDA 2JLSA 1PUJA 4MZJA 1NLFA 3PEVA 2ZS7A 5L3RA 1WBDA 1N6PA 4MGYR 2J46A 3ZDQA 1EFCA 2FCEA 1P5ZB 1DJHA 4HAWA 4GZMA 2QI9C 2IF2A 1G8GA
chains in the Genus database with same CATH superfamily
4W8OA 5LBUA 2XKKA 3HP7A 1KR2A 1XF1A 4IP0A 1RRVA 4GZ5A 1Z56C 1V37A 1ZGCA 3S4YA 1Z28A 1W4LA 5CB6A 2LM5A 5E3JA 5AESA 1SOAA 5EP4A 3FCYA 4L0MA 1OFTA 3GUYA 1MEEA 3U44A 1LKZA 3CEJA 4OUDA 4UVDA 5CXXA 3BXKA 4YJ3F 1UK7A 2LLSA 3NH6A 3ZDDA 3K6SA 3LE8A 3I52A 3R6WA 3IMFA 4B75A 1JWLA 1M2VB 2QRPA 2ZR0A 1GFZA 2ZJFA 2AMYA 5L8VA 3Q12A 4JMLA 2RHGB 1UZUA 1NJ5A 2W8BA 5JBQA 1A4PA 3PN7B 3O6BA 1QF6A 5TVGA 1NBWB 4RFLA 4CUJA 3ZXYA 2HSJA 4Y6PA 1J2JA 3OQHA 1BDJA 4FNMA 3WKEA 2Z4TA 2E4UA 2XSZD 2PYDA 4P6VF 4A03A 1HE2A 4EKGA 4B4UA 1E2NA 2HOQA 4X8HA 2ZREA 4DWJA 2ECPA 3FCSB 5I48A 4BLRA 4KWTA 3M49A 4ZAFA 5B1DA 1OBVA 4I9NA 4AECA 3EIQA 4C6TB 5FOVA 4FILA 4WRRA 5DM70 4LDNA 5FPSA 2G1UA 1UPCA 2V58A 1UBFA 3UAXA 4E03A 4JEHA 5EJ8A 1A77A 1EWRA 4BPBA 1J7QA 2WUWE 2E2WA 3R1IA 4L0QA 3UTDA 2VXYA 4X20B 4NCNA 3B8EA 3BG5A 3TIXB 2XJ4A 3ZWOA 5DM0A 4MR7A 1MABA 1AK9A 1OYOA 1CDNA 1KMHA 3DVEA 2IIPA 3SZ3A 1OSNA 2A86A 2Z5LA 4I81A 3NXAA 4MIOA 4QPJC 3OX5A 4B76A 1OH5A 3H2GA 2PYQA 3R9XA 2BM9A 2PUWA 4NBVA 2J8ZA 3LKDA 5FNVF 3U4MA 1UT8A 4UTOA 3EXEB 2GCOA 3INRA 3W05A 5JAUA 4AN0A 4WZAB 2ATCA 2DUWA 2OTGC 4WNAA 4UZFA 4OHOA 5JAZA 2GFHA 5KQRA 4PYMA 3NRCA 1GPJA 4DDMA 1CY2A 4J75A 4I50A 3IDQA 1T5BA 5FULA 5G41A 5JJGA 2NO0A 5M7EA 2L2EA 1M67A 2YW2A 5AXCA 3SDZA 2ZE5A 1G2IA 2MSKA 1P7PA 4QXRA 4TPKA 1YB2A 1LW6E 1JSAA 3RU2A 4GIBA 4OHCA 5AI0A 4DRXB 4O4HF 1ZCAA 5HIJA 1F5NA 3K05A 2ZOSA 3BSSA 3OT1A 2B21A 2B98A 1MGPA 1JA9A 1VLVA 3NDJA 4MQFB 3CBQA 1E1RA 1DFIA 3PKJA 4LZAA 4KAJA 4GR5A 1KYVA 1YB4A 5KO2A 1STOA 3MT0A 3FM9A 1YI0A 1IUPA 4NI5A 3OU6A 3VNAA 2QJFA 2MSNA 5E2BA 4JLAA 4KNYA 1QLKA 2JBHA 3G49A 1GKUB 2KSPA 4HVAA 3LH5A 2PGNA 5I2LA 1O0SA 2I62A 1ILWA 4TYPA 4CF4A 1PNTA 3ZV5A 2WM9B 2V0NA 1JJ7A 3CRMA 2JC3A 4HXEB 1W47A 2EFCB 1E62A 3B5IA 4MRXA 1S4MA 1I7LA 1Y6ZA 3C3WA 4AWAA 3K2BA 121PA 4QGHA 5M04A 4LDAA 4DA7A 1UDBA 1BU8A 4NJOA 4H1TA 2NGRA 2DWPA 3WGGA 4U8HA 4M37A 5IKOA 4UZSA 4UOZA 2RGRA 3JS5A 4PY2A 3CLSD 2D1FA 5CM9C 4ZVUA 4B4KA 1SUEA 2MYPA 1V41E 4R1NA 3TTVA 1N7IA 5ER9A 1XNHA 4PLWA 1MJHA 2QE6A 4CTJA 5KINB 1UM9B 1FU4A 2W6MA 4WHMA 1XNJA 2XRYA 4B83A 4QOGA 3EARA 5CH3A 4MTCA 3C8DA 3OZAA 3ZLUA 3SDBA 2RHMA 1PKEA 2JJ1D 3WKDA 2FA9A 2O05A 1O3YA 5TQJA 2RBKA 3CBGA 4GQIA 1V11A 2AN4A 1VKZA 1O8CA 2MLFC 2C3MA 1LBEA 3THXA 4O2BA 2DLNA 5CT5A 3ZY4A 3FMPB 2G1AA 3MBKA 4Q3CA 1EE1A 3R1VA 3LBHA 4BY5A 1U5BB 2PU7A 4UDYX 1U5IA 1OMVA 2RAUA 2IYFA 2GBLC 3NJRA 4DVGA 5ERXA 2IBTA 4IGKA 3UPUA 4JBXA 1NTOA 4MARA 1L5WA 3FWCA 1RCFA 1S3FA 3WIOA 5JCJD 4PRLA 1AO3A 1GU1A 3MJRA 1OH6A 4D4IA 4QNMA 4HZIA 3O2SB 3B1YA 4HNQA 5AEQA 3R9IA 2Z2XA 5EQJB 1DJQA 2DKFA 5JUWA 1RAEA 3EVEA 4YWHA 3I12A 2IZZA 2CLMB 1O89A 4P08A 3K3PA 1U7WA 1NX0A 3A11A 4FYIA 4RZHA 3EA4A 4BEBA 3QBDA 3NORA 5F9HA 3HWRA 4UNRA 3CZCA 3T1TA 4F3RA 2ZT6A 1B14A 5FRDA 3S44A 1ONOA 1TJ4A 3BWMA 3TDIA 1EKXA 3M9LA 3IJPA 3DFIA 3GWZA 3RUFA 1CDPA 1IWQA 1GA6A 3H1EA 1L7DA 2IYSA 4V24A 4D74A 4BGDA 4OHBA 1RHKA 2NZWA 5INTA 1WB9A 2Z43A 3INNA 4AJEA 3UGTA 1KQOA 3KLNA 4MR8A 1H4TA 2QX4A 5FBHA 4B45A 3HBAA 2CD9A 2ZRDA 5JAOA 1QRAA 5IFKA 1RYDA 4Z9FA 1JSZA 3GMSA 1ZR4A 1T4GA 3VTFA 4C7JA 1QE0A 3ACDA 3EWIA 2Q3BA 5FPYA 5C7LO 3VR6A 2R9VA 1U8FO 4DLZA 3HUDA 3WWEA 4II2A 4HJXA 1CY6A 1TCFA 4L9AA 4K3UA 4HYYA 3WFIA 1EXDA 5BSRA 1D09A 3K8OE 2WLTA 3ET5A 1P81A 4B6RA 2CDRA 2QY9A 1X7XB 4PSKA 1MO2A 3ZGYA 3SXPA 1N78A 4A82A 2CL7X 4CMKA 3ZW7A 3BL8A 5EIHA 3OEEA 3CVWA 1F0PA 1ZU5A 3JWIA 4JDUA 1RRFA 2BFDA 4DCMA 5DMHA 3WGJA 1FPQA 4ECAA 1CS0A 4NG4A 1OLXB 4BDSA 1KFBB 3CX7A 4NR0A 3DPUA 3T1HB 2DWCA 5CW1A 1BS2A 3LDFA 1K9UA 1J00A 2AQHA 3GGSA 4PZDA 1YC5A 4AJ2A 5FI7A 4YAIA 3DCJA 4G0ZA 3AF4A 2PA3A 1JMYA 3NX4A 5LZ5A 4NJEA 3DD1A 3H2BA 2PMCA 3SHQA 4XRGA 4LQCA 1PBTA 2H18A 4I9HA 1EK6A 4YMSA 3S40A 4RA9A 2QPAA 2AZDA 1SG9A 3A4YA 2JCXA 2Q4TA 2B9EA 3F8WA 1QATA 2IJGX 2ZP1A 4G9BA 5HMLA 1R6AA 1MXFA 2I2AA 1TQHA 2LNKA 5AVRA 3PC6A 4D44A 3I4FA 2ZRKA 3E9ZA 5FUBA 4X6XA 5I2QA 2QE7D 2VYNA 2IYZA 2P2CA 1ZMXA 3WK8A 1EGHA 4OHMA 1I7QB 4KVFA 2RHWA 2RAFA 3T5MA 2V9CA 2CK3A 4HGOA 3GLIE 5CLFA 3DZTA 4DCJA 3EC1A 1Q20A 4R9NA 2XEXA 3PHCA 4Q12A 2A9JA 4BQNA 2IDJA 1QHFA 3I1JA 5DN6D 4X54A 1JIJA 5KJFA 4LYEA 2PSJA 4HAXA 4K9PA 4NBKA 1TJPB 3QITA 3JQPA 1NP8A 2OHOA 1ORDA 5K0NA 3TI9A 5ECWA 1FW4A 5TPZD 2XB2A 4NVRA 1KEKA 2QBYB 5JNWA 3V7UA 1EJ0A 4OBXA 3GEMA 1U6KA 4LXIA 5KDOA 4EUKA 1FFSA 1IY8A 4EW1A 1E6UA 4M1KA 4HDCA 4HQLA 4G5YA 5C7YA 3F6YA 3KTAA 4YAGA 5SY6A 1YD7A 5AVJA 1GAXA 1DIHA 1IGVA 4EFNA 2JI4A 1E3JA 1I5EA 3TLMA 1TM1E 3PFWO 2WHPB 4CMEC 1ZH0A 2VDUE 4JUIA 3L1IA 2VHEA 3X1WA 3B60A 5LU8A 2VR1A 1FJHA 3W7AA 3MTGA 3A8RA 4X94A 3VNRA 1D0IA 2WOJA 1SG0A 2IIVA 1JLSA 2WHRA 3B6ZA 1ZZGA 2C82A 2QPTA 1ZD5A 1XQYA 3B12A 2D74A 3H0EA 2HFKA 2Y9MB 4O63O 5FYDA 5ALRA 1USUA 1AU9A 4CLRB 2PVCA 1QK4A 2NX2A 4UPDA 1IOWA 4HC4A 1VECA 2IZ5A 3C5EA 2ONJA 3ORQA 1CR0A 5KQPA 4TYMA 1S1MA 1XF9A 1TMOA 2D2IA 2XOXA 1P91A 1CUAA 2IGBA 3O4FA 2WZQA 3ND6A 4RADA 1LDBA 1F60A 1R00A 4ZZIA 1N92A 1YGPA 2C5SA 2R5FA 5HKKD 3AVOA 4FKZA 1R8QA 3WV5A 1X9IA 2Q9BA 4IO0A 4DWOA 1ZUZA 2GBPA 1VHJA 2ZB7A 3N7UA 4HG2A 3IB3A 3K0FA 1WRBA 1V3TA 4M99A 1XVVA 2X4LA 3H0KA 1YQEA 1YZTA 1YK0A 4WLFA 3RSFA 2VPQA 4G5HA 5EHGA 3TLBA 1QFZA 1VCOA 1VMEA 4S04A 2OHVA 4R51A 3ZHOA 1XQ1A 3DLPX 1TDJA 3TBHA 2FR8C 1DOHA 3KFXA 1A2QA 1OVGA 1I3NA 4P4GA 3T3NA 4E2ZA 3G0IA 3QM1A 3I5YA 1R0RE 3RLZA 1CKEA 3VH1A 2QK4A 4N3NA 4CE6A 2I34A 2ZWIA 1C9KA 4I1UA 4R0MA 4K1XA 3FLEA 2ZT5A 3I9NA 4MZXA 4AULA 2ZVJA 1SIBE 4ARZB 4MA4A 4BO8A 5IJ0A 1HQVA 3V8QA 2C1ZA 4Q0MA 4FOPA 4LZLA 2ZUDA 2R2AA 5A4AA 4JUAA 1KNQA 3B7GA 4LVUA 2HX1A 3GJ7A 1RLTA 2XRMA 3BFPA 2BM0A 1J7OA 4JI4B 3TJZA 3N2YA 3TR6A 4DSOA 4YV0A 3P9ZA 3T0IA 5TT0A 3F73A 3EVBA 1SJ9A 4IDHA 3KIPA 3OZTA 3EG9B 1L4MA 3QELB 1AVTA 3ZXUB 1XYYA 3WK4A 5JTUA 3VR3A 2UZ4A 4LOHA 4RDHA 1NSHA 4X6UA 4DPKA 3BIWA 1AUXA 3A9UA 5HLOA 4LKOA 5AVVA 1XFRA 4ZDWA 2ZSFA 3S5JA 2D5LA 2F33A 5BT8A 5ADVA 1FJGB 3S68A 3ONDA 3SG6A 1TNPA 4FDAA 4OFWA 3I04A 2R48A 4IF4A 2DFTA 4N4AA 3FMVA 5HL1A 4Z1MA 1HC7A 1SBNE 4P4LA 1RRCA 1T2VA 3C6KA 2XUQA 4UBNA 4H7JA 5ALFA 4OJMX 2QL6A 5IDXA 5BWCA 5HGXA 4FK8A 5EXEA 5HUQA 1WKBA 3LCCA 2XV1A 4CMJA 1JFSA 2NUTA 2ZETA 4X71A 1G21A 1SC9A 4XOUA 5LQKA 2WSLA 3Q5DA 2CDBA 1OYWA 4Y2GA 4BFWA 1MXEA 3EWAA 2B7LA 4TSKA 5KREA 1DC6A 2TMGA 5COAA 421PA 2DFKB 2FP3A 4UTVA 3FSGA 4CF3A 4MINA 2BFAA 1KO1A 3R24A 1KJWA 1DT7B 5A7FA 3NTLA 3DL0A 3UF0A 1TEZA 2RG1A 2VH2A 2GAJA 3GCZA 4XDYA 4I3GA 4N8EA 5KTMA 3THSA 5LDHA 2WG0A 3EGOA 4X6LA 4XB6B 1VGQA 5CFNA 2Y1LA 3DYEA 2DQZA 1A5AB 3AHDA 4KMOA 4RPKA 3NT4A 1XQ6A 3V1MA 1MNQA 4MV4A 1SC3A 2V7QA 5ALHA 4EEXA 2EGDA 1PL8A 2XAUA 4WZ6A 2A30A 4HAZA 1EVJA 1IH8A 1QPZA 3USES 2AG6A 3MMSA 2BFBB 2D0OB 3ZCPA 1DE0A 4Z0TA 2H57A 4H4EA 1E1QD 2GBLA 2YYSA 3NWBA 1S2DA 3A7DA 4YCJA 1JXMA 3OPYB 1OLUA 1WXGA 3KHEA 1DS6A 5AKLA 2Q1TA 3I62A 1X3LA 3CR3C 1ZEMA 1KSMA 3RK0A 1YV9A 3VRHA 3L2OB 5EJIA 4D8VA 4OFXA 4WKBA 2ODQA 5KKNB 1UDWA 4KO3S 2EHBA 4MROA 3IO3A 2CHGA 1ZN2A 1ECBA 5AVSA 2Q99A 3A1FA 4HFNA 5KOIA 3E7XA 4DS3A 1EK1A 1ZUHA 3E1GA 1OHHA 2P6UA 3QPDA 2KI5A 1A9RA 4QAJA 5EYPB 4S2EA 3GAZA 4CT0A 5LPNA 3H5WA 4IYJA 3T95A 1GCIA 3S8EA 5F1OA 4A2QA 1HE5A 1TNWA 1VKOA 3T7RA 3DMPA 4PALA 5EL2A 1Y7HA 2FXIA 4LRSB 1H66A 2I6FA 3L07A 3EEYA 1XB2A 2PWZA 4GWKA 3EVNA 4NE2A 3AHIA 2WFMA 1YACA 1MF8B 4XZ3A 1WOYA 1KQGA 2MLEC 3JQ8B 1PYOA 3DLIA 1IZYA 4NKRA 2DR3A 3TQSA 4JB8A 4RV5A 4GMKA 2I7VA 2OMEA 3MJVA 1W4AA 5ALQA 3Q1LA 3EW7A 4N48A 3K35A 1DWQA 2R7NA 2NYRA 4KN8A 1W2WB 1RE0A 2H6EA 4MRPA 3DT6A 5FTNA 1Y5IA 1DTWA 4AIRA 4KX3A 2V97A 5TIIA 5AKIA 2GETA 4WA7A 3DPIA 1TT5B 1CJCA 1TE2A 5EESA 4WFJA 3VR4A 2LVVA 3NGLA 4WXMA 3VVMA 2VP5A 5A5FA 4B87A 1RDFA 3E8MA 2HK9A 4BZWA 4CF7A 3LBIA 2IEIA 3GUUA 3IBYA 3I6QA 5KYGA 4JOCA 2E4XA 4G1FA 1AHIA 5AVWA 4DLBA 4QULA 3T3OA 2DUJA 4QDKA 3HH8A 1QX5B 3HRIA 3HP1A 3RLFA 3SDSA 5DTRA 2B99A 2OK8A 4BV9A 1AB6A 5E0OA 1RC0A 3DBHB 1L5QA 1JFVA 1ZD3A 3OOSA 4EK9A 4XI9A 1EINA 3AR2A 2XYVA 5FYXA 3BTUA 3K0HA 2ZBDA 4RZUA 3L1JA 2HXGA 2WD7A 1RACA 1GU0A 3KUUA 3R7FA 3B6JA 1AXEA 1OOEA 5JSQA 4V0SA 2XGJA 2GSDA 2DG2A 1PVVA 1NLFA 3NTQA 2JA1A 1NUQA 1X74A 2OZLB 1RHJA 4KO4S 4XASA 4D9FA 1YOVB 1G8IA 1OFGA 3S2FA 3A6DA 3TQOA 4AB1A 3M1IA 3ORRA 1JAZA 1N2DA 4AU1A 2VPWA 1T36B 2A0KA 3H3XA 1YURA 5AJYA 1QIEA 3CJRA 3H42B 5FUQA 1FOEB 3NRBA 4BNUA 3FETA 2HCTA 3VO8A 4BP3A 2KAVA 4DQDA 3L06A 5A6SA 3AVTA 1XVTA 1UP6A 2Q0QA 2I0FA 3OA0A 4AURA 5IANA 2JD2A 4UTPA 1NYTA 1HT2E 3NHJA 4ETIA 2XTAA 1U3VA 4LI3X 3M3PA 2VL7A 2C54A 1DOZA 2YMQA 2K87A 2OD2A 5DT9A 3W6UA 1SRQA 4DQVA 1PWXA 4Y1RB 1MRNA 2WUVA 1VSTA 1IVYA 1T2NA 2Y0PA 3VKVA 1QSGA 3FFAA 3WQQA 5KNDH 4GE0A 4IJQA 2NUPA 5EZQA 5HLVA 4E1VA 4PNHA 3EWSA 3CTNA 3S28A 2W2KA 1S8AA 4XA8A 1GL6A 1W5AA 4UDXX 3O4YA 3C8MA 3BE8A 5EJ6A 2CZQA 3ABOB 5AVZA 3K0CC 3CUUA 1JR4A 2YJTD 3Q6MA 4Z7JA 3NBKA 3FNFA 4FFDA 2WF5A 4INPA 4UMVA 4OAPA 4EQZA 4WK4B 4BNWA 4UBMA 4EO4A 5TEVA 4NFYA 2Z1NA 4E09A 2R6HA 4ZTBA 1TVMA 1T4CA 3I64A 4HQOA 1NY5A 3C6QA 1TCUA 3LHDA 4OQXA 4R1OA 1L7EA 3TFQA 3HU3A 4DKXA 1CX9B 3WDKA 4CMEA 4C0SA 3AVWA 3A9VA 1CU1A 3B3JA 3AWIA 1C4WA 3ZJYA 4IZIA 3KXDA 2ZJOA 4KE8A 2VNJA 4K6OA 1Z2CA 2XUDA 1DNPA 5I4IA 3EGEA 5KVSA 4XE5A 4ARBA 1U0JA 1XROA 3V8NA 2BR5A 2IRWA 3S8MA 3THOA 4LGCA 2RGEA 1WA5A 2YZNA 4H4DA 3ISTA 3D54D 3S2YA 1N1DA 5FEMA 4C2TA 5KU7A 1EWVA 3HJTA 3SS7X 3UMYA 1X7ZB 2D59A 4QTTB 1T9BA 4BVBA 4PANA 5LOVB 5AM2A 2Z83A 1KQVA 1HETA 5IYZF 1NZJA 4LTMA 4PBTA 2XWSA 3TX6A 1N2JA 3BJRA 1YO6A 3VPGA 1TLTA 1H8HD 4DMRA 1M2JA 3NVDA 1C3OB 3LLUA 1CQIA 5CNMA 1G8YA 2JFVA 1DAGA 4DMCA 3D8UA 4MRYA 3OPYI 3ZDEA 4BY4A 1ZD1A 5DICA 2BKLA 4OOFA 2JGIA 5LOVF 3GLSA 4BATA 4D9JA 2GTPA 1D7OA 1NONA 3PD7A 3Q7EA 1H5NA 3G1UA 1SBCA 4TTQA 4Q39A 4CIDA 3CZ4A 4IW3B 1XPUA 2I76A 5H7XA 2H2DA 3OCVA 3IEIA 1SSEB 3CLTC 3WLNA 4DDKA 1JYEA 3V6LA 2PPLA 4UHJA 1T14A 1P5HA 3QHQA 2O54A 2RKOA 4RVOA 1Y7TA 4BC0A 3I05A 2ZXEA 3UMMA 4NG5A 3GOHA 4NYMQ 4DM4A 3KB2A 2CXSA 4KEAA 1MJ5A 2FR8A 5JG7A 3KVNA 4A6DA 4FJ2A 3UANA 3ABZA 4N39A 3WA7A 1VDZA 2YWJA 3OWHA 1DBRA 1UJ6A 1V8ZA 5BW4A 2GI4A 2BMJA 2BL4A 3BDAA 4PAWA 1THTA 1QIKA 3CCFA 1U2QA 1EL4A 3U09A 2WZCA 1DMRA 3SBEA 2W2OA 4F84A 3IKVA 3K1ZA 1KK7Z 4A15A 4JEIA 1SBZA 4S1OA 1OOIX 3CF4G 4R71A 2WIBA 1N2GA 3Q3VA 1E0SA 3ZX5A 5EC8A 1KBZA 5ESWA 4GKVA 3UNWA 2G71A 4X65B 1HYEA 5FQOA 5AO9A 1YHYA 1Y4UA 4QT0A 4CM8B 2BECA 1WP9A 5J1SB 3OQOA 3WSWA 5F7JA 2I4RA 1PEYA 4D8TA 3STXA 4W5HA 1ZNYA 3ZHCA 2BH9A 1IZ0A 3LX5A 4C0XA 4RDIA 1V4BA 2QL5A 4ZYZA 4M0LA 3EC2A 1P2FA 3I6MA 4PWZA 5C8YF 5JXGA 4KNWA 2PZGA 2IOFK 3OECA 4MV9A 5B37A 4PPQA 3EXHC 1B1CA 2FPLA 4XB2A 2PUAA 4TM7A 3JQDA 1IXYA 1YBFA 4UMDA 2QEBA 3TS5C 4KK4A 4UEQA 4YRQA 1YE5A 4JIMA 4DDVA 1MO6A 3L02A 2X1MA 4MW9A 1F8FA 2HU8A 2Z2IA 4EUSA 4HXFB 5JSUA 3DV0A 5HCNA 4TWZA 2AG5A 3EISA 2BE6A 3HB4X 4R8LA 4TSFA 2G3YA 4GPTA 4CLDA 5H1YA 3FDJA 1YQTA 3IESA 3VPSA 3PGJA 3NUGA 1NDUA 2RHOA 3G6WA 2YXDA 1IPEA 3AHCA 1VKRA 5C8DA 4L8GA 3CIOA 2ZQ5A 2FFRA 4W5TA 1FW8A 1OX5A 1W87A 4EPYA 4BZQA 4TMWA 3QVTA 5IWCA 4KXWA 3VGJA 3R7AA 1YMVA 2FEPA 5K3EA 4LGVA 4WXPA 3Q5EA 1GILA 2IZ7A 3HBFA 3MRXA 1KI6A 4LK2A 3P9PA 2EL7A 3TPZA 1W35A 1TAGA 2F62A 3AQ4A 3ZK9A 2G0NA 2BJVA 1PT6A 4KGZA 1E9RA 2B20A 2X77A 2Y92A 3I42A 1AO0A 3EZYA 2F2PA 4G4IA 2P6NA 2O8DB 4MCHA 1O5IA 3X43A 3BFAA 3U62A 4AJJA 1TIPA 2ECOA 3IJRA 1GPYA 1PX2A 2V4UA 2J4CA 3U7QA 4DV6B 1K9PA 4P32A 3ZEAA 1BE8A 3MUNA 1KRHA 2VZLA 2BPOA 3KFVA 5LYJB 3T1VA 3H87A 1F4VA 1AUVA 2CNWD 4D41A 2D7JA 1AGXA 3NCHA 5D00A 3O2JA 3QVXA 5DBHX 3HLKA 3HVKA 3AEKA 4I1YA 1JT2A 2P2ZA 4GLFA 4NNOA 2C29D 3TJRA 3EUAA 3W5JA 1MD9A 1XNRB 2JANA 3WGMA 1RYBA 3B1JA 1KFXL 4HTFB 1BCSB 1U8UA 1RJWA 4XIIA 3PD0A 2EFHB 1WCWA 4A6XA 1FX0A 1ANKA 4LWQA 4H6VA 3E3OA 2GEKA 4TRMA 1QV7A 2WUEA 4BJ1A 1J1DA 1QFXA 4HT3B 2ZKIA 4QJ4A 3MAAC 1K8UA 1YUUA 3DR3A 3ZV3A 3EA0A 1CR6A 4YRPA 1E6CA 3E4CA 2IXBA 2X19A 3K9HA 3BWXA 2QPLA 2G5TA 3P5SA 4H77A 4JI2B 5IK2A 4MMXB 1P2BA 2VSOA 2QLNA 3PNOA 4YLGA 1A8SA 1SCDA 2WWIA 1E79A 1JXOA 2FHSA 1S0UA 3LRPA 4BEVA 5TR9A 2FOXA 3OO0A 3MB5A 4NDAA 2QLJA 1A96A 4H9GA 4AF7A 2I2WA 1LDGA 3SI7A 3G0GA 4LBWA 3AW8A 1ONBA 2GD0A 3E22A 3AILA 4UQLA 2PVPA 2PRKA 4BO0A 1Q0SA 1M1YA 1VL2A 5IXSA 3CLUD 2NSJA 2JRFA 3SF8B 1JP7A 1UBUS 1VG0B 4CU5A 2QN2A 1XZ8A 3UCXA 4R3UC 3NKLA 3OJXA 4WXRA 2EATA 1OZHA 1LDNA 4F4CA 2PMDA 3GLHE 2X8JB 3IFSA 3IP3A 1SWVA 3LUPA 4C03A 1ULSA 3RB8A 3FWBA 4RKFA 2HWYA 1M6WA 5HCUA 3ZHUA 2AHOA 3AEQB 3MM4A 1TYEB 2C0CA 3RAPR 1PEDA 3GJQA 5BVHA 1L1RA 2BZGA 4AXBA 3L41A 3TI7A 3I1IA 5F4BA 5LZ2A 4GI7A 1NW6A 2WNDA 4C29A 4GI3A 5KQLA 4ME6A 3ZV7A 2AC2A 4YC7A 4PHCA 1KOFA 2A7XA 4R0VA 4YAJA