4C0LA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one magnesium ion and mg:gdp (mggdp-miros)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords MITOCHONDRIAL RHO GTPASE
total genus 120
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0lA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0lA03
2CTNA 4B6EA 2A78A 1MXEA 4TTPA 3SIAA 2F3TA 3B8HA 2BBTA 4C2TA 2JLQA 1LV7A 4CW7A 5FH9A 5HYDA 4D4LA 2BL0C 2NZ0A 1KTVA 2JATA 3QENA 3SI7A 4C2UA 1GKIA 1KO5A 2PT5A 3QF7A 1KDPA 1U0HC 1E96A 3LXXA 4DDVA 1QX2A 1FP6A 3ND9A 4RD2A 4Q9IA 3GLGE 1DELA 3GEEA 3WRXC 4MITA 2Y5IA 1EJ3A 3EC1A 2RGDA 3JZMA 3FKSD 2KAVA 2CE2X 4TYNA 1JSAA 1W4CA 3K1JA 2ZE8A 4Q1FA 2LV7A 3BUNB 1RECA 3LK0A 1NMYA 3I73A 4GBMA 2H7VA 3CPEA 4D1EA 4LPSA 3CLVA 1E2HA 2GILA 2QE7D 2KBEA 4GT1A 1FP7A 4L15A 2G1KA 1M1YE 4HLUA 1R6BX 2MSEB 3SFVA 1LS1A 2FOLA 2R6CA 1S3SA 2V55B 2W6JD 3O8BA 5DYGA 1O87A 5GJVC 4CVNA 2JC2A 3JTDC 4TT3A 3U60B 1RZ3A 2BKIB 1G3RA 4BRUA 2YV5A 2F2PA 1OW3B 3QE0A 1OZOA 3AF3A 4EJSA 1YRAA 5BYJA 2ZNDA 5FOTA 3WMGA 3Q9LA 1CKKA 4A0FA 5AR1A 4N1GA 1NI3A 1P73A 3P4YA 2NLNA 2IYQA 3C5CA 3CBQA 2TN4A 2ZTSA 1Z6YA 3M0WA 3KHEA 1TF7A 2LLSA 1CS4C 1S36A 2GXSA 3BS4A 4QJ5A 4V02A 2A9KA 2JEOA 2OTGB 2IA5A 4PPQA 3TZ1A 4NL4H 4NYMR 3RRYA 4Q9KA 1T3HA 1TNPA 1XD9A 2EWWA 3ONWA 1B8CA 1S6IA 2ORVA 3UPUA 2RCNA 2ZREA 1N6KA 4UXHA 1KK7Y 2K7OA 5LBIA 2JT8A 3JVTC 4LUCA 4YGBB 1BF5A 1SHZA 1OXSC 1XXHE 2D2FA 3GLIB 4QGFA 4UNRA 721PA 2LUXA 4LBWA 3CH4B 1JF0A 2VA8A 5DKNA 4DRWA 3DMNA 2O8EB 3ASZA 2AR7A 3FIAA 2NPIA 3P20A 2Q21A 4GP6A 3SBDA 1YE8A 1TQDA 2IT1A 3U3JA 4M2OA 1S9DA 2EFCB 3VQTA 2NTYC 5KSOA 4MKGA 4MZJA 2BJVA 3T12A 2CVFA 2O8EA 1FPMA 5D69A 2H18A 2R9VA 2BKHB 1JR6A 4KV9A 3QKUA 5D3MA 4UNPA 1ZM2A 1MKYA 2X19A 4ACBA 3ASYA 1AQUA 4P33A 4I1VA 2LVVA 1YURA 4QGGA 2ZXUA 3PATA 1GNRA 3B60A 821PA 2GEVA 2ZRIA 3FHTA 4AKEA 1JJ7A 5JJGA 4ORAB 1AN0A 4I1UA 2JGNA 1G7SA 5JHGB 3CWGA 2H17A 3AVOA 1W0JD 5JWRA 1G8YA 1XP8A 1L7VC 1N6RA 2V6IA 2CK3A 4PAOA 3GK2A 2V3CC 2DHRA 4CLNA 4G5SA 1S1EA 2ORIA 1K9UA 4JBWA 1G3QA 2DBYA 3IEVA 3PEYA 1I2DA 1OE0A 1KI2A 4ORCB 1F54A 4A4BA 3DF0A 1TPZA 4PAMA 4DUQA 5FBLB 2BCAA 4JZKA 1QIWA 4NCHA 4C9BA 3AF4A 2BOVA 1GVNB 2ZR7A 4MGYR 1UHJA 5CIWA 1NBMA 2NO7A 3WBKA 5K8UA 3GLHE 4JKIA 1DAIA 5CDFA 2VHUA 4K46A 2ZRHA 2GZHA 2LLTA 5C18A 5EE9A 2BJWA 3SJAA 3KZ1E 2HPSA 2RGCA 4GOKA 2KDHA 1DAKA 2OAP1 3AH8A 3LBIA 3N2EA 2PLFA 4MEWA 1SVLA 3THOA 1PK0D 3K0CC 2R44A 4OBEA 3NH6A 5HZHA 3B82A 2LP2A 1IN5A 1LW7A 1IRJA 4D80A 1NBMD 4AKGA 5CSNA 4URVR 2HYIC 4M2PA 2E1RA 4Z51A 1JALA 4GMXA 3SJCA 4GGNA 2DR3A 2JT0A 1G20E 3AKCA 2GA8A 1UKZA 1QF9A 4JL8A 3OIWA 3RNLA 4R1EA 5JRJA 1KSHA 1SHKA 3K70B 2YOHA 3CRMA 2FH5B 2TMKA 1ZNXA 2GJKA 5JRZA 3CRQA 1XFYO 2XOKD 1NKSA 2ZR0A 3RRNA 1WDCB 1ZM7A 4PQFA 3HYTA 2MLEC 2PZFA 2Z43A 3NSOA 5KSZA 1WE2A 3LFUA 3GQBA 4FINA 3H4SE 2WJJA 4JVMA 1R0YA 2BWJA 3U7GA 4D2IA 3V9PA 4QKQA 1CULC 4D82A 2WMNB 2WJYA 5SZKB 2WVJA 1XD2B 1UKYA 1SKTA 3A1TA 5AUPB 1G5RA 2RGXA 3TQFA 3SHFA 4TT3D 3MWJA 1Q1EA 3BE4A 1F48A 4HDCA 4RFSA 1HH4A 2VBCA 1YUUA 1W2GA 1WY9A 1XD8A 4YGDB 2VO1A 1PZNA 4A6XA 5J47A 3K21A 1YZGA 4TL8A 2D8NA 3VR1A 2ZANA 4MUBA 2UKDA 5FBVB 2V1UA 2IHYA 4ZKDA 1OMDA 2BCXA 2R6FA 1GIAA 4W7SA 3K09C 2WCBA 2GZDA 1ZC4A 4LC0A 5JECA 1XTJA 2GBLC 2XOKA 1T8TA 3RLFA 1Q44A 1OH6A 4U8DA 1XBTA 5C46F 1Q0UA 4HLUC 2DY1A 2OPOA 4ZV4A 1NP8A 4XSHA 4P4TA 2B6HA 3BOSA 4G1UC 3TUIC 3NXSA 4DEXA 1YR5A 3GLHA 3A6PC 3X2SA 1QV0A 1Y6WA 4OV2A 1BMFD 1TQ2A 3FTQA 2JASA 3IILA 5FL7D 2IUSA 2LHLA 3WY9A 1BLQA 4B3DA 2Q91A 2ZUDA 1DF0A 2QUZA 3FMPB 3QY0A 4WZ6A 3M1IA 3PVSA 3RSOA 2AXNA 2JJ8A 1SULA 3A37A 1NN1A 3CNOA 1WRLA 3T1TA 1E2IA 4P3YA 3ZVLA 3RM1A 2I18A 1MXLC 2A7QA 4M9QA 4CEIA 1GGWA 3VGOA 3PEWA 3N2IA 2Y1MA 5F9HA 4Q1BA 4B2LA 3PN7B 4BLRA 4GBAA 2COLB 2QGNA 1KJZA 3R9XA 4JLDA 1COWA 4WRIA 1BMFA 5JWHA 1UHIA 3AKAA 1VECA 4NCJA 5LD2C 4BFUA 1XEXA 3WXAA 5ER5A 2JAQA 2F3YA 5B8IB 1QHGA 4QM6A 1W5TA 4GPTA 1X1RA 3O2PA 4O2RA 3CRVA 4JLAA 1TNQA 4E03A 3TUZC 3ICQB 1W4RA 2FU5C 1T0HB 3QVUA 1YR8A 3FGNA 4MRRA 5KSYA 3EK8A 1AS3A 3TK1A 3EC2A 1HQVA 1SCMB 5IT5A 4B35A 4CFQA 1S8FA 2C9CA 2ZRLA 4IW3B 1HV8A 1WXQA 1NVUQ 3QJYA 1HYQA 5KTYA 2PBRA 4NYIQ 1NN5A 4TLBA 2LUCA 1KKLA 2BBMA 3BB3A 1XFVO 2REBA 2PCJA 4LHXA 1N6LA 2JTZA 1XMJA 1KI9A 4WVFA 2RB4A 3A1UA 1ZW6A 4KFSA 2F6RA 1C1YA 1QIVA 2WORA 4BFXA 1VCMA 1KI6A 2DYKA 3U44B 3CR5X 5HLOA 4YMUA 5M04A 1S9HA 1NNEA 3VU9B 1WQ1R 2GVDC 3FOZA 2PMDA 4B3CA 2WOOA 4NBSA 3GEHA 4I5NB 3SS8A 4ICBA 1LB1B 2XJ4A 5CYOA 2AX4A 4Q66C 3D3QA 3THXB 5FOWA 3L0SA 5PALA 2MLFC 1K90D 4IVPA 1JQJC 2W2XA 2QRZA 2AL7A 3I3SR 4PE7A 1U5IA 1PUJA 3UWKA 4GZLA 1EG3A 3I5IC 3UIEA 1W7IB 4PO9A 3OP0A 1FUKA 2HT6A 1CJKC 5AJYA 3QSYA 5KHOC 3PALA 1J7OA 2RGNC 1KI3A 3K9GA 3GFOA 4LHVA 3WNBA 5G40A 4JLMA 4OHXA 3OX5A 4RD0A 3AVPA 3U61B 2QSZA 3TR0A 1RROA 3GJ4A 2NCOA 2ZEJA 1LA3A 1IBRA 2AFHE 4YLGA 4BY4A 5AUOB 4AYWA 1ZINA 1GRQA 1E4VA 1QHSA 2YINC 2O52A 3W9YA 3DOFA 4GNKB 2F9LA 1FW6A 2WNDA 3A8TA 2ASEA 3A1VA 4CFRA 1GUAA 1ZUIA 2J7PD 4CF7A 2WTUA 2N42A 1D9XA 1E2JA 5HKKA 4B2IA 5JCPA 2WIAA 3PENA 2H8KA 4B3GA 3LQQA 4U00A 5JBQA 1E1QA 4GOJA 1N5IA 4A9AA 2LLUA 2QM8A 2GBLA 1E2FA 2F43A 3L0OA 1D2MA 1GDDA 1W4AA 2IW3A 1OXUA 2IYVA 3I62A 4IDNA 4OHVA 2BC9A 1V43A 2PJRA 4KSBA 4Q1CA 4UNQA 5CIQA 4DCVA 1D1OA 2ANCA 2DB3A 1ALWA 4M1YA 1WCV1 4XWOA 1TF5A 2R2AA 1KZ7B 4RZ3A 4IJMA 4B34A 1ZFSA 1GNPA 2B7CA 2ZR9A 3LA6A 5J5CA 4YMVA 2O8DB 4UQOA 1U8YA 1EFHA 1HURA 2PLRA 3ZS8A 2QACA 4QHYA 3EK4A 3VRQA 2PALA 2J41A 2NQ2C 2C2HA 3CM0A 5JEEA 1XPUA 2CVHA 3Q7QA 4O2LA 1CIPA 4A2WA 1CF4A 1D2EA 2O8CA 3GEIA 4ARZB 4MYCA 3ADKA 2AD1A 2QEQA 4YGCB 2CBLA 1U2RA 4YMWA 1J1DA 4U7DA 4L4UA 3IUYA 3QXSA 5SZHB 5E95A 2PL3A 1V1GA 3UKDA 4J0QA 3RS4A 1RJ9A 5A5GA 1FNNA 3KFVA 2QGZA 5L3RA 1ZVQA 3FWBA 2KGBC 3OB1B 1TQ6A 1SL8A 1R2UA 2BM0A 2BDTA 2D3WA 2ZFDA 3CWQA 2DWOA 2R6DA 3NVAA 4JS0A 1S1MA 4M1MA 3U4QA 4HRGA 1RK9A 3BXZA 4FIDA 1IWQA 1JECA 1Q22A 4EPYA 3SZRA 2RHMA 2PMKA 4RD1A 1U81A 3SR0A 1FQKA 3P27A 3VX3A 1KI6B 5BWMA 1G8PA 3C4JA 1UWOA 3SYKA 4B71A 1E2LA 5FOSA 2O8FA 221PA 2R62A 4ASUD 1JAHA 3SG4A 5LDDC 1VKJA 1VPLA 2C99A 4QBFA 2C9YA 4YRUA 3D6TB 2J5XA 4Z8YA 3FWYA 5JCZA 2ZSEA 1LXFC 1A2XA 1DVRA 2JLWA 3HX4A 1F6BA 1E2EA 4HSZA 1OHHD 4IEIA 3SBEA 2AD5A 3WHUB 4Q03A 1F8HA 3LAWA 5FR1A 1NLYA 4OHYA 3SDZA 3ADBA 5DLQC 2CHGA 3I5GB 1NPQA 2WWWA 3QEOA 1ZUZA 2ZPTX 3I5FC 1G3MA 5JS8A 1UJ2A 1MHOA 1ZUHA 2BBSA 2KFHA 3L0IB 4OQLA 3BH0A 4E07A 1KK8C 4NDBA 4I5JA 2P0EA 4LJ8A 1KSJA 1XO5A 3DVLA 4HEJA 3WYFA 3X1WA 4I1SA 2IK8A 4LC1A 1B1GA 2BIFA 2BL0B 3DOEA 2EGDA 5JZVA 1KKMA 3EW9A 4BE7B 2CJWA 4BY5A 2QP3A 1AIPA 2BHRA 1NIPA 1K94A 1IONA 4MRPA 2HEIA 4P4UA 2M29A 2WWIA 1A2KC 1T91A 2BEJA 2ATVA 2HDNB 3TBKA 3LBHA 2G0NA 4TLCA 3VRRA 3NBFA 4YONB 5DO9A 1A29A 3WNDA 4HUTA 2QSYA 4DLYA 1HT2E 4GAOA 1WF3A 3AVWA 2W0MA 5JFGA 4Q02A 2KWIA 5H1YA 2IYLD 1XMVA 4BGDA 4JIMA 3VRNA 2VRGA 1ZU5A 1Z3IX 5CSJA 4BFZA 3ZH9B 1TL7C 5IDVA 1QX7A 4AOMA 1DAGA 4R2HA 1CDMA 2WJVA 4B47A 3A4NA 2KOTA 1G64A 4TMTA 1QATA 4UPGA 3MGCA 2CXJA 4URXR 2WJIA 2ZETA 2VF8A 5G3ZA 4F7WA 1XNJA 2JDIA 4FCWA 4OQNA 4YQFA 2IYTA 3PSRA 2A5DA 1DS6A 2CL6X 3PV0A 4Q4AA 3O8RA 3Q5DA 2MAZA 2G83A 1NUBA 4KBFA 3O8DA 4E68A 2RKOA 3H1TA 4XYNA 4L5BA 2ZS7A 1KDTA 2GCOB 2OBMA 3EG5A 1OZSA 3O6BA 3CONA 3ETLA 2OLKA 4X8OA 1E2GA 3T06B 1IN4A 1KQMC 1WRZA 4IOLA 4GMDA 2DFLA 1II8B 4FMCB 4HDOB 4V0OA 4MRYA 2O8BB 1AJ5A 1BR1B 3TDZA 2ORWA 1CJUC 4YC7A 5E4FA 5IK2D 4KLNA 3VKGA 4W5JA 2Z4RA 5EE1A 2AK3A 2NO1A 2WOSA 3JVTB 5LB4A 4QBHA 2XNDA 3THYB 4B48A 3L8YA 2ZS9A 5EZ5A 1S0UA 1UEIA 3K70D 1DVIA 5GVSA 3OIYA 2DWPA 3QKTA 2QG6A 2GAOA 4JBYA 4KI0A 3Q7PA 2IYYA 1N6OA 1QTXA 1LINA 2CCMA 2OS8B 4P32A 4QFMA 4GSYA 5AERA 4ZCUA 1NVVQ 5IK2A 4XD7A 3KO0A 1N5KA 3AF0A 4B74A 2KBFA 3B1XA 1E94E 1EK0A 2L4HA 1E9AA 1JPNA 5AK0A 5FFMA 1E79A 4ASUA 2WSMA 2D62A 1P9NA 3WRYC 1W1WA 2KSQA 1JF2A 1K9KA 1YRBA 2OV2A 4HLCA 3W5JA 1VRKA 2L51A 3P4XA 5CB6A 1PALA 3QG1A 4ORBB 3WBJA 5BYKA 1VHLA 4LCBA 3P26A 2VH5R 4DB2A 3Q3JB 1P72A 3LLUA 1CLUA 4NQGA 3BB1A 1E0AA 2XAUA 1B4CA 2Z4SA 5CJ2A 3K09A 3FDIA 4KODA 4PSVA 1G6OA 1BR4B 1SVKA 2ZM5A 4WIAA 3PFVA 3SG7A 1GITA 2L4IA 1MUXA 5FTNA 1YZUA 4IDPA 1QG2A 4DCSA 4PAQA 1VCIA 2CLDX 5P21A 1J7RA 4TL9A 5K89A 2F9MA 4KFUA 4Q4LA 2BBNA 4BFVA 5LPNA 1N6HA 2HLDD 4H1UA 3REFA 4C0QC 3DD4A 1XFAA 3SG2A 1DOAA 5C4MA 1ZCAA 4NP6A 3DDCA 3W90A 2F1IA 3HR8A 1P7CA 2P6RA 2GJ8A 2WJGA 1KGDA 1XTKA 2QU8A 2C04A 4ZIRB 1YRUB 5FOXA 1AM4D 1KOFA 3BK7A 1AHRA 1JWDA 3MD0A 4XWAA 3LDAA 1PLKA 3PFIA 2IXFA 1DJZA 1WLZA 4M1TA 2A5GA 3G0HA 1W36C 5DE3A 5CLLA 2C77A 3EZ9A 1JNYA 4FXPA 2ZAOA 3GJXC 1EWQA 1OT3A 2GCPA 2HQWA 1ZD9A 5BN4A 4LJ7A 1ZOTB 5ELXA 1NLFA 2MSDB 2GDJA 3PEVA 4C0AC 1ZD8A 1Z0FA 2PZGA 3MLEA 4M1SA 2VTKA 4NH0A 2JJ1A 3EZ7A 1SXJD 1IY1A 1N3BA 2FPMA 3EXAA 3IPYA 2H57A 2O0JA 3EK7A 4KAXA 5HE8A 2O8FB 4EPVA 3PN7C 3IQQA 2O0HA 5CK5A 5FPHA 4V03A 1TEXA 2OBNA 621PA 2ZJ8A 1TOPA 1A2BA 4M4SA 1R0ZA 1GWNA 3E3RA 1NY5A 3MUFA 1KCYA 2VP5A 5TB5A 4TZ0A 4QJ5B 2PMYA 4WW0A 4MQBA 4R9UC 5EP4A 2FZLA 3ZZTA 1Z0AA 2Z83A 2FCDA 4TMXA 4EJSB 2JULA 2PRUA 4XTRA 2WBLC 1FTSA 5DN6D 1G17A 4ZIRA 1IQ3A 4O0MA 4HZUB 1Q3HA 1A75B 3NBXX 1YR9A 2GK6A 3IO5A 1QZXA 1WB9A 1B23P 3SG3A 3VRPA 2AMIA 3FYHA 2JLVA 3VROA 1OFUX 4IXNA 5EZ6B 3OEED 1XZPA 2WKRA 1EESA 1C4OA 1JC2A 1SRAA 4OI4A 2BE4A 3FHOA 5KDLA 3DZDA 1SGWA 2BMDA 4ETOA 3EVRA 1KI7A 2BCJQ 4A36A 4MZKA 4R98A 3NSIA 4BLOA 2WMOB 1KIMA 4BZQA 3K0FB 3SHWA 2EYUA 1E9EA 3L43A 2WWXA 1R4AA 1NX3A 1SPYA 2VP2A 4BQSA 4BEJA 1KWOC 5JOLA 3CZPA 4MKHA 4KSCA 4XVQA 3NC1C 4M22A 5HKZA 3THWA 5DN6A 4JJZA 4AI6A 1COWD 4NCNA 4JLBA 4JT2A 1B7TZ 1OQPA 5DHAA 4PE0A 1EG4A 4A4CA 3UK6A 5D3MB 5L3SB 3NIBA 1E4YA 2L50A 2L5XB 1HT9A 2UZIR 4JKYA 1MF8B 5E7JA 1WP9A 4XVUA 1ZRHA 2JRFA 1OXTA 1JJVA 3RANA 3VR4A 3KUCA 1FPWA 4TSFD 2MJWB 5TNCA 1DGUA 1NX0A 2NO0A 3VMFA 1Z22A 1II8A 1W36B 2FOTA 1MV5A 1ZNZA 2F3RA 2B7BA 4NMMA 3TUYC 3ZVNA 1K9PA 2VSOA 3VNUA 4E22A 3VR5A 1IH0A 5TV2A 2J45A 2VSXA 3F8TA 4HB4A 4B75A 2IC5A 1Y63A 1KO8A 1KI8A 1K96A 3NSLA 4NE2A 5JSZA 1FL9A 1HTWA 2G2BA 1GL9B 5I2OA 2K2AA 2VIIA 1O3YA 2Q3MA 5G08A 3A4MA 4QNMA 5EP1A 1OFTA 4PZZA 2GKSA 2QT0A 4URZR 2EU8A 4N3NA 2GZAA 1U8AA 5L8VA 2LNKA 1E1QD 2RGNA 4B32A 2O5GA 2G6BA 1KK1A 4W9MC 2KYCA 3IQWA 4DIRA 1KNQA 1C7WA 4IVRA 3KKNA 4K8OA 1GKUB 4DIDA 3IO3A 3NWJA 1U0LA 3IDQA 3PQCA 1W4BA 4Q7MB 2FDCA 1Y1UA 1G41A 1H4BA 3PCRB 5TY0A 1IJFA 4OKSA 3WNXB 2HXSA 4B44A 3BUWB 1QVAA 3PIRA 1S5GY 2VP9A 5IF9A 4AD8A 3BAFA 1F55A 2P67A 3WP1B 1R6PA 1II9A 3VHXA 4JMPA 3HR7A 2IF2A 2CLSA 1J7QA 1ZJ6A 1A5TA 1OIWA 2J0QA 1A03A 4V0LA 1GRNA 1US8A 3KQUA 4L9SA 1GRRA 1SBJA 1ODFA 5DKRA 5GVRA 5BN5A 1D2NA 1IN8A 2QTHA 4RY2A 1KWOB 1AK8A 1XEXB 4CEJA 1JR3D 5HPYB 4AQJA 4JL5A 3BORA 4M8NE 4TL7A 1MOZA 1JXMA 4D4JA 4DHEA 4F93B 3WYGA 1M7BA 3AM1A 1UHKA 2EVWX 3CF2A 1E2NA 5SZJA 2OS8C 2ZRDA 3N70A 1IN7A 4QRHA 2AK2A 4Q7LA 4EPTA 2ZJOA 1T4GA 1L4UA 4DBLC 3NEJA 2I2RE 2BM1A 2DFTA 4ZI3A 5B30A 1TTTA 2HF5A 2L98A 2B8TA 2ODWA 2QMEA 4Q21A 4BUJA 4LRWA 4LPKA 1NWDA 5L3SA 4P2YB 2JU0A 1SXJA 4RSGA 4UXIA 5EXXA 3GLGB 1CJTC 1OB2A 4TNCA 3JVVA 2I4IA 2CBZA 4RFVA 5CSIA 2OAQ1 4QG7A 3DZ8A 3OAAD 2KJQA 3I8XA 2WWGA 4Z8XA 5DYIA 3KX2A 1AUIB 1E1RD 421PA 4D4KA 5EUQB 2HXYA 3C14C 4EFLA 4C0KA 2L0PA 1TADA 1G7RA 3WMFA 4OI0A 1MABB 1M34E 3MJHA 4PO1A 4ZCLA 4V0ME 4GRAA 1M46A 2F8PA 1P2VA 2ZRMA 5K8TA 4Q7JB 3SYLA 2ZRKA 1I4LD 2YZ2A 3H0KA 4WZAE 1Z5ZA 5ER4X 4GL2A 4LBZA 2H1LA 3W3ZB 2YWEA 4LJ9A 2FE4A 1F70A 2G77B 4QJ3A 1M39A 1CMGA 4LK2A 4AY2A 1EFTA 4Q4HA 1NJGA 2SCPA 4C4PA 4JLVA 4HZUA 4BLQA 1MH1A 1ZBDA 4EDHA 4I1OA 5AANA 3CF6R 1L2TA 4HUQA 5UKDA 1BOCA 1YKSA 3TMKA 4DEYA 3EX7C 1AQYA 1EH2A 1SR6C 5DSZA 4IFBA 3KKOA 1VG9B 2AKYA 5FUYA 4F91B 2PSRA 1E1RA 3H4MA 4LI0A 1L4YA 4N1AA 2MA2A 1G7CA 5EE5B 1CU1A 4PHJA 1W49A 4HAUA 3RC3A 1XFUO 1SVMA 3RYTC 1QV1A 2A3RA 1OFHA 4QHTA 4A0GA 3TSZA 4HB0A 1S1CA 4OI1A 2FSFA 1KAOA 1GQMA 5DKQA 2WM9B 3FMFA 3LY5A 1S3GA 1GAJA 3PUXA 1KSFX 3IPXA 1ZMXA 5L3VA 4ACAA 1CFFA 1Q80A 2K7CA 2HYDA 4QGHA 1FZQA 3DO6A 4UNSA 1VCOA 3RS0A 1DJGA 4ESVA 1CFDA 1CKEA 1N2CE 1NBME 1RWYA 1IAQA 2XB2A 2ODEA 2FA9A 1TCOB 3C8UA 1UPTA 4G5OA 3KXLA 1DJHA 4YGEB 3BIFA 2P5SA 2ZS8A 3LX8A 3TAHA 4L16A 2NOAA 3GJ3A 4GGFA 3K9HA 1QVIY 3EA0A 4JJKA 1SXJE 1KMHB 1L8QA 4DKXA 3CB4A 1E2QA 1KJWA 1PVOA 4F4IA 2XITA 1UBCA 5CITA 4I81A 2GESA 1S2MA 4PX9A 4Q01A 4DLVA 2IS9A 5AEQA 3FS7A 1J8YF 1E9DA 1UKEA 2X1VA 3GFPA 4HAXA 4EQ6B 3S1AB 2K2FA 4D81A 4EKDA 3DF0B 5CDFE 1UBEA 5DISB 4PHGA 3IQXA 3D31A 3BWDD 2KB0A 1W7JB 4DLZA 1GL6A 2X2EA 4DWJA 1CEEA 1XU4A 3EWSA 3LW7A 3VKWA 5EUMA 4YI9A 2MMCA 4AKIA 4TYPA 1QVRA 1VMAA 1PSBA 1XX6A 3LWNA 3P32A 3AAJA 4HLDA 4HRHA 4V0MA 2IYWA 4WA7A 3R9IA 2QNRA 4USLA 1N0YA 3LQRA 5CJPA 3SYNA 1ZAKA 1DJYA 1ODBA 3KF9A 3D7MA 1WA5A 1E2KA 3JTDB 3IHWA 4H1VA 2EC6C 4BLTA 1RRPA 1E99A 4IRUB 3BOWA 1RTP1 2LKDA 1QHNA 2BV3A 4GZMA 2DFKB 1IKUA 2ZRPA 3QBVA 1CDPA 3TKLA 1KSOA 8OHMA 2VF7A 1GSIA 1U5IB 2LM5A 2FMXA 4IL1A 1E0SA 1DAHA 2M97A 4DRZA 1Z29A 2R8RA 4BFTA 1DE0A 1TF2A 1S96A 2HETA 2DFNA 4LJ5A 2BE6A 2LVIA 1MWNA 4DDTA 1W0JA 2AKAB 4DZZA 1JEEA 2QP4A 4W5WA 4XJKA 4TN1A 4D0LB 1HT1E 1RRCA 3BFVA 2HJVA 4PQYA 1AA9A 3BERA 1LKJA 4PHKA 4B3FX 2FFBA 5BXQC 3J81k 4CPVA 5TDHA 5IRCD 1XF9A 3WHTB 5IBWA 1MABA 3K0CA 2R6AA 3T5DA 3HU1A 2QAGC 2M49B 3A58B 1ZM4A 3I5YA 4UKDA 4NDDA 1TX4B 4AC9A 1S6JA 3ND8A 1XMIA 4IVQA 1M2OB 3ECCA 3QQ5A 4TMZA 5KNBA 1YZQA 3KKQA 3GD7A 2AXPA 1P61B 3KFXA 4I99A 2SHKA 2W6JA 5HR5A 1TEVA 1XJ0A 2GEUA 5FBQB 4A8JC 4FN5A 1IM2A 2YYZA 3PUZA 4M1KA 2E30A 3A4UB 4C0JA 1SKYE 4DJTA 4XH9B 3VR6A 4CEIB 2ONKA 5H68A 1NN3A 1SXJB 2CCKA 1L7ZA 4XSGA 2PASA 4QJ4A 4NCIA 3BYAA 4KFRA 3HWSA 1SMGA 1I4DD 3VAAA 3BUXB 1J7PA 1QHHA 2JPTA 1UHNA 3GLHB 5HKYA 3T35A 2GGZA 1CFCA 4MRSA 1UADA 1RIFA 3BBPA 1VG8A 2W83A 2GAAA 1RYFA 4DLRA 1DEKA 2XB4A 4Q9HA 5FUVA 1OH8A 4Q9JA 2GXUA 1QVIZ 2P2LA 4PE4A 4PXAA 4DT1A 5HLVA 1UP5A 2V7QD 2FF7A 4KVGA 4Z1MD 4JWQA 1GFIA 3AGQA 3QKRA 5BQ5A 4V0NA 1CM4A 2GEDA 3TE6A 5KDOA 2KNEA 4MLWA 1YX8A 1E9FA 2I3BA 1NF3A 3B7GA 3BH6A 4LDJA 2IWRA 1XFZO 1UBGA 2XZOA 1M7HA 1SYMA 3QNUA 1FBVA 3I5HB 4G3XA 4KHZA 3CR4X 4GP7A 2CHVA 1VDZA 4PSAA 1N5JA 3SEAA 2BEKA 2R65A 3DMDA 3IIMA 4CT5A 2NMVA 3K9LA 4FI3C 1LVCD 1UFQA 2Y8EA 4LZZA 5HCIA 3RSLA 4ZDKA 3GLIE 4YBHB 2F7SA 2XXAA 1WDTA 4PHMA 3MG9A 2ERXA 2E87A 5E7MA 1BOFA 1Z0IA 4JVSB 3REGA 4HDQB 1T5IA 5KOYA 1WBBA 1P60A 3ZLJA 3LV8A 4QC2A 3LRPA 4A82A 2M3WA 1Q21A 2JXCA 2OEPA 2GWHA 3EIQA 5KU1A 4ZDWA 1DAFA 1OF1A 3ZVRA 3EZ2A 4GOXA 2LMTA 1YX7A 3HYRA 4KXFB 4PZYA 5JEDA 1GL7A 1K5DA 1MO6A 5KDDA 1JFKA 1LS6A 1AJ4A 3KXIA 2NGRA 3AAKA 4DLSA 3IF7A 2Y1NA 3H86A 3MWYW 4M21A 2QBYA 1AP4A 3OEHD 2BMJA 1GP2A 3TUJC 1M8PA 4RCYA 1E9RA 2YJTD 1QASA 2KAYA 2OUKA 2OILA 3QXHA 4LBVA 2J0SA 2X8AA 1E79D 2OCBA 2ZUCA 5JS7A 4IDQA 4KVAA 1UUSA 1FTNA 4P5OE 2OT3B 1BKDR 2QAJA 1CR2A 3GMTA 2D06A 1C9KA 2PVBA 2OBLA 1YZKA 3NH9A 4URYR 4YDSA 3ADCA 2XEXA 2Z0MA 1R8SA 1SR6B 2FJUB 1KI4A 4Q18A 3EWAA 1CRQA 5FPTA 3I92A 4RFSB 2ANBA 1GNQA 1YTZC 4RCZA 4XTCS 3THWB 3SQWA 4WQ2A 3NXAA 3GLFB 1JR3A 4Q47A 4ZDIA 2P5TB 2C78A 2CMKA 4DS7A 2GHIA 4QBGB 3X1DA 2RGAA 1GG2A 2REOA 4HREE 4M1WA 2WKPA 1ZM3A 5F9FA 4TMKA 1CJMA 1Y0VH 3UATA 3TNFA 2QAGA 5TVKA 2V54A 5GADl 3BUOB 1N65A 5BW8A 4IDOA 2P6NA 3C1VA 3AGPA 4ITRC 1TNDA 1J90A 3Q72A 2F33A 2Q3FA 3SU8A 1Z8FA 5CK4A 5DIFA 3S1AA 3CPJB 3HP1A 2H16A 1BO6A 2X77A 2O8CB 2FSIA 3I5GC 1MO3A 4TSFA 1NSHA 1P9RA 1HQCA 2AN9A 1R0XA 3VHLB 1G4UR 1U0JA 3BD9A 3UXMA 2QROA 3HU2A 2VP4A 5EE3A 5FI0B 3LXRA 4MN0A 4PHFA 3RRZA 3EPKA 1NYAA 4GGFC 4JBXA 2A4JA 2CNWA 4R2IA 2OG2A 1RVDA 4GFDA 2OFWA 2KSPA 2WSSA 1PRWA 2YC4C 2D2EA 2XGJA 2CL0X 4IKEA 4OJKA 1CM1A 2J87A 2Z5FA 3Q5EA 3U4QB 1K6MA 1B9AA 1HY3A 1YUSA 1G8HA 1FX0A 3PM8A 2ZUBA 3CR8A 2BECA 1X6VA 4QBIA 4MRXA 2IEYA 4WXPA 1ZC3A 2IBMA 5GQQC 1NP6A 4PALA 2ZJ2A 2ZRTA 4HB2A 2J9RA 1CLMA 3KJHA 2D74A 4C30A 1A4PA 3HPQA 2FV8A 3OHMA 4ARZA 4DCNA 4DDUA 4M9XA 2NZJA 5J4LA 2IS2A 4BLSA 2QL6A 4S2EA 3DVMA 2XSZD 3OFND 4EJSC 1XPRA 1XYDA 1DTLA 3AF1A 4TYYA 2J59A 4KFTA 4DVGA 3ZD7A 4LSGA 4BLPA 1CLLA 1ESNA 2OTGC 1OXXK 1P5ZB 3HU3A 5AJVB 1NN0A 4G01B 3T61A 1OOJA 4JQ0D 1PULA 2OCYC 2QZ4A 1HEIA 2WSSD 3G82C 1FI5A 1E6CA 2QE7A 4P4SA 5D3QA 3GP8A 2EFEB 1EX6A 2F3ZA 3TDUA 1KQVA 2NZ8A 3IBYA 4B73A 2FGJA 1KFXS 3E5HA 5TMPA 1BIFA 1F2UA 1KO7A 1P75A 5FUWA 2JIZD 3FE2A 2LVJA 2GJSA 3KKPA 4HAVA 1VYUA 3OAAA 2OO7A 1VHTA 2V9PA 2NXQA 3BRWD 3SJBA 4EUNA 3O4YA 1TCFA 2G9BA 1DADA 3DVEA 3O47A 4ERNA 3AQ4A 5FR2A 3ZZ0A 3H2YA 1G33A 2ZYUX 2UZ3A 3OX6A 2D4HA 2OXRA 1P6XA 1V1FA 3BXKA 3CH5A 3AVUA 2ZI4A 2HV8A 4HAWA 1PVBA 3AKYA 1E2PA 3AUYA 1WBDA 1KK2A 5FOUA 3LCPC 4OQXA 1IGVA 4K81B 3ZZUA 5E3HA 3AVVA 2VYFA 2ZRCA 3A36A 3CUEF 3T15A 2VRWA 4B2PA 2CDNA 2YHSA 1OH7A 3EKJA 2JXLA 3IIKA 1KY3A 4FMDB 4LV6A 4MGZR 5G3YA 1X8KA 4A0RA 1OH5A 1IOZA 5DHFA 1B8RA 3K0AA 1NCXA 2AHOA 4D25A 1K5GA 2LMVA 2GJAA 3LW8A 2IXEA 4L9WA 3O78A 2H2KA 3SN6A 1Z6TA 1EFRA 2QM7A 3TLXA 2QMUA 2A5FA 3FVQA 5FBWB 1S4QA 1FQJA 3KL4A 4A8JB 4NYMQ 3FHCB 3K0EA 3OFNA 5FUXA 1G4YR 521PA 5AFPA 1IN6A 1SL9A 1X8LA 4NTZA 3MCAA 1XVJA 3GLGA 1S3PA 5JI3E 1ZP6A 4FMCF 4NHOA 2WC8A 3KJGA 4PZLA 5AJWA 4U5XA 1F4OA 1OIXA 2REXB 1I4TD 4D4MA 5K8LA 2FX3A 4Q04A 2PX0A 2ZN8A 4QJ3B 3CRRA 4Q9LA 1AZSC 2JJ1D 1RC8A 4WQ3A 1SZPA 2LE9B 2WKQA 2EC6B 3VR2A 5F3WB 1M63B 2Q3HA 4NONA 2AWNA 4G5GA 2ZJBA 1XTRA 2IL1A 4LV8B 3AP3A 4S35A 3WMEA 3UMRA 4WOPA 4DCTA 1AGRA 5L3QB 4DCUA 4JSYA 2XXAB 3T5GA 1KK3A 3THXA 3IBGA 1XMSA 4RVCA 3L8ZA 1W44A 3KEVA 1NVXQ 2N1BA 3I1FA 4AIIA 4JL6A 4LWZA 4N1FA 4MYTA 3N5CA 3EVVA 4CYMA 1XEWY 2OFOA 5HTKA 3AP2A 4JLKA 1XDBA 1XXHA 1YR7A 1J1EA 1XEFA 2YWGA 2RGBA 3B1ZA 3C16C 3ZQJA 2G88A 2EFGA 1CJVC 2GETA 2ZI9A 3UG7A 3KDSE 3E70C 1IY0A 1CMFA 2CE7A 1CLBA 1CRPA 1XA5A 3H84A 2KHNA 1U94A 3DL0A 3GJ8A 1BT6A 3OZXA 1MR3F 4F4CA 2WHXA 1FOEB 1U90A 2BCGY 1CFPA 3CLNA 1OFIA 4LY6A 1NKTA 4PPFA 4ZCVA 4ZO4A 3A8RA 2C8VA 3KXKA 3BFKA 4O3MA 1YRTB 4JYBA 1TTXA 1F2TA 3QBTA 4NCKA 5FPKA 1CTRA 2KFFA 3WYAA 3AKBA 3F0TA 1VYVA 2JJ2A 3CNLA 3B2EA 3F5FA 3C41J 3W6NA 3CNNA 3PUVA 1SVOA 3GPLA 1JPJA 1NVVR 1KFXL 1QHHB 1UEJA 2GCOA 1EWRA 2MMGA 2ZE7A 3OIVA 4PFSA 3R7WA 5C2JB 1Z63A 3KTAB 2VSFA 5DI3A 3QG5A 3K70C 1PVAA 1NRJB 1XD2A 1SL7A 1SVSA 1GILA 1X8JA 5H8WA 4HATA 1IXRC 3CIOA 4FCTA 5EQTA 5F2EA 1IQPA 4HZIA 3SC3A 4C7OB 4TMWA 4OK6A 3WNCA 5CSFA 1ZCBA 1BYUA 2WZQA 1R5BA 1JBKA 2J46A 1NCZA 3PXGA 1PV4A 2KFGA 1KFUL 2OM2A 2W6ID 3LD9A 2KAXA 1LNZA 4Q00A 4F38A 3QF4A 1T3LA 3LO5A 4MKIA 1J2JA 2QRNA 4CRWB 5F6TA 2ZRBA 2MSCB 1OYWA 2ZRJA 5IHPA 2LVKA 3KQKA 5CM9C 3BGWA 2ONJA 1G5PA 1ZD1A 4Q48A 3K0AB 2D7CA 2J0UA 2PJZA 4Z54A 3I61A 1T9HA 1K2HA 2FNAA 2HF8A 2FSHA 2PT7A 1IJEA 3C7KA 2Q6TA 3I32A 3IGFA 3L0PA 2I1VB 4BASA 2ZIAA 2ZI7A 3KQHA 4I5KA 2WAXA 1MT0A 1DG1G 5KPJA 3ICBA 1ANKA 1RE0A 3FFAA 1Q1BA 3B5JA 2GTPA 3FKSA 3QPVA 4PHHA 1MRNA 5L3QA 2FEOA 3ZD6A 4MUAA 1CBUA 3LH5A 1TMKA 4ESHA 4JLPA 2G0TA 4US1R 3NG1A 2K7BA 2A5JA 3B9PA 3SE0A 1UDWA 1NX2A 1DJWA 3Q8XB 2LAPA 3W34A 2KI6D 2JLZA 1Z2AA 2Q9AA 4GUKA 4X8HA 2C96A 3CX7A 3AF2A 5SZIA 1F2UB 1OIVA 4B76A 1MO5A 1KYIA 3EPJA 5BPJA 1IY2A 2V1XA 3OHMB 3RLZA 3FFBA 4BECA 2EHBA 1XFWO 2H61A 3R8CA 5JSZB 3X1XA 3NC0C 1M31A 2IYXA 3G5UA 1A75A 1X3SA 2JLUA 1FUUA 1RW4A 3NDPA 2ZN9A 4I5LB 1W36D 3RRMA 1G9XA 4RZUA 1CP2A 3JVUA 5K8IA 5GJBA 1WLMA 1Z0JA 3F45A 1U98A 2XTMA 2FCEA 1OB5A 2EYQA 3RHFA 5F98A 4A8JA 3K0SA 4XJKB 4OHZA 3QPWA 1K95A 4ZPXA 1W5SA 2IS6A 5TXGA 1Q57A 1E0JA 1G19A 1AS0A 3ZS9A 2VHCA 4DC9A 4B6FA 3UWOA 2Q9CA 4US0R 3TSWA 3AVYA 4PR0A 3FB4A 3TVTA 1YHNA 2KI6C 3TIFA 3GJ7A 5TARA 4DSNA 2JDID 2GRJA 1OJLA 4TQUS 2HCBA 2WOJA 4IOKA 2JT3A 1JUOA 3GOFA 2OHFA 3FPAA 2ZITA 4UXJA 3UANA 2BBOA 4BFSA 1PJRA 1G16A 5CYPA 3ZIAA 5D7FA 4QL3A 1E8AA 2JNFA 4MVFA 4KYUA 4RZ2A 3CGAA 1G291 1G3UA 1CXZA 2QQ0A 2E9SA 3QXJA 5EE0A 2FN4A 2LKCA 2J7PA 3GLIA 3W8RA 3I72A 5B58C 4BEBA 1EXRA 1TIZA 3DPUA 2P6BB 4D6PA 4UJ5A 2VHQA 3GCGA 3ZGXA 3C5HA 2IF0A 5KSPA 1Y1XA 3FWCA 1F71A 3NEYA 1OSAA 1M74A 1SVWA 4PTLA 4PDZA 3EVUA 2EW1A 4OYHA 4TWZA 1E9SA 1X02A 2VP6A 2XNDD 2JCSA 2CNWD 2M7NA 1Z0DA 1XCMA 2B21A 2FJUA 2AWOA 1TQ4A 2ZYVX 2LCFA 5KYKA 3IQOA 1TU4A 4MDEA 4MRVA 1AKYA 2QQEA 1E2MA 1KSMA 4N0EA 1W2HA 4TMVA 2QENA 1B0UA 2XZLA 4OCIA 1FMJA 2W2TA 1N6NA 3SG5A 1JI0A 4OL0A 5J4KA 2QPOA 4MYUA 5AJXA 2SASA 2FFAA 1ZUNB 2BCBA 3I5FB 1NG1A 4AWXA 4LOAA 3X1ZA 4A6PA 1DO0A 2W58A 5DNYB 4CT4B 4MBEA 3CKLA 1FFHA 4JLOA 3MJRA 2M1UA 2L0XA 2NPFA 2ZU0C 2Z6VA 1ZU4A 4MZLA 2F2OA 1DARA 1A82A 1EL4A 1Z0KA 2NO6A 2RGEA 2N46A 2B8WA 2JTTA 4A4DA 4C0BA 1K8RA 2H5EA 1XRJA 3I5IB 1Q3TA 1SY9A 1YQTA 3FMOB 3QXXA 4NYIR 1P2UA 2WV9A 3T1OA 2F1RA 4QXAA 1W46A 4OVNF 3KB1A 1HQYE 1G21E 2ZVPX 3TRFA 2WWHA 3ZNIA 2GK7A 3K53A 1G8GA 3B78A 2IYUA 3D0YB 3PR1A 4WZBE 5H70A 1RFJA 2YKGA 5FL7A 2G3YA 4TLEA 5GJCA 3LLEA 4OK5A 1EG7A 2ZYTX 4PE1A 4F0ZB 2IYZA 2JNXA 2Q9BA 4PPGA 4C0LA 2PH1A 5ANRB 3GLFA 3ZQ6A 1YUTA 1R5NA 3RS7A 4R71A 4FWTA 2FFQA 1UF9A 1PLJA 4DSUA 4XVRA 1R0WA 4RD3A 4IDHA 3SG6A 2EWVA 4P31A 3OIUA 1ZNYA 2A5YB 3QKRB 1YVHA 1SNLA 2M9GA 1V5WA 5J4VA 4KBGA 3UMSA 1KNXA 1KDRA 3ADDA 3U3RA 4OKHA 1ESMA 1LY1A 4WBSA 2X2FA 4Q4HB 2J0VA 1TN4A 5DGXA 1DF0B 4AKHA 4ZCMA 5HKWA 1AK2A 2CHQA 2JLSA 2RH5A 1M7GA 2V7QA 1R7RA 1H8HA 4JLNA 3WHLA 2J0UB 2YNMA 4GFTA 1G1MA 1N6IA 2YOFA 4JT4A 3KQLA 4IOJA 4NDZA 2CJWB 4LJ4A 1KI1A 1KK0A 4ON9A 3U7FB 2ZYWX 3A1SA 4YMTA 2AAOA 1GJYA 2JLRA 3PUWA 1Z6GA 1JQLB 1OPXA 3BB4A 1ETUA 4PSKA 3MSXA 1FF1A 3EIEA 3BUMB 1EFCA 2ZSFA 3AVTA 4XD7D 4X8MA 3CR2A 1SVIA 3VNVA 4A0HA 3RDPA 3R9WA 4E5UA 3EZFA 4L9MA 4LJYA 4Z1MA 3THYA 1F60A 1KQMB 3VX4A 3HCMA 2XX3A 3NBYC 1KHTA 1YR6A 3R7WB 4RD6A 3KB2A 5AWFC 3WXMA 4Q4JB 2YWFA 1HE1C 1E0KA 4ZDJA 4FD2A 2I94A 3SFZA 1GZSA 2OXCA 3P1JA 2IS1A 2KBIA 1QHYA 1XXHB 2I1QA 1CTQA 4IEEA 3W6PA 5KNDA 3CZTX 1Z83A 5B2ZA 1CR1A 2ZE6A 1BG1A 5J4HA 2I7AA 2AUCA 1U8ZA 3U3KA 1B7TY 2G9NA 5CPVA 4OHWA 1XK4A 3CF0A 5JJKA 4DLUA 2VHTA 4PC1A 2GGMA 1G4AE 3I5XA 2JIZA 4BZPA 3LL8B 1RJ9B 3ZWHA 5A4JA 5B57C 3HDTA 2HQ8A 3U2QA 3T1VA 1P9WA 3KJEA 3SNHA 3L2OB 1XK4C 2C95A 2QPAA 3EAQA 2B1UA 1CB1A 1C07A 4FW9A 4G5QA 4NKRA 1U99A 2P3SA 3B6EA 4B33A 2ZI6A 4N5XA 4AK9A 3W3AA 4OQMA 2JJ2D 2NCPA 1LFDB 1N6PA 1OHHA 1IJ5A 1EFUA 1NL3A 3B9QA 4AG6A 5CB8A 3BC1A 4LYFA 1S6CA 3IEUA 3W6OA 3GLFE 4D26A 2WJHA 2YWHA 4POAA 3AVQA 1BODA 1YZLA 1CDLA 2J3EA 2OZEA 3EIHA 3GJ5A 3K9NA 3RWOA 2GF0A 1Z2CA 2K8MB 5C1BA 3M6AA 5JLJA 1VCNA 4KO8A 1Q20A 1CR0A 1NIWA 4LYAA 3KPXA 1UBFA 4M2LA 4B3BA 1SKQA 4EQ6A 2GV5A 3OEHA 3QVVA 2IEZA 2ZJYA 4DSTA 4A1FA 1EFRD 1SCMC 1E98A 3M4YA 4Y0AA 5CM8B 1MRSA 3GK4X 1KJYA 2IYRA 2QN6A 1ZACA 1AS2A 1NG9A 4PC2A 1WRBA 2J1LA 1NSFA 4TYQA 2V4ZA 1JEDA 4MDFA 1S5GZ 1D5CA 3O8CA 2G1JA 3DVJA 3D8BA 2M0RA 3OB2B 1RRGA 2PEYA 4DUGA 2OSBA 5AXIA 2QTFA 2OFXA 3U3OA 1J99A 4NYJQ 2OCAA 5LD2B 1GGZA 1P2TA 2ZI5A 1H8ED 3PITA 4Q19A 3GFTA 2MBXA 1E32A 3CPHA 3K0FA 2WCEA 4TLAA 1LF5A 4QNRA 3EARA 1PUIA 2F43B 2YC2C 2ZSDA 2ODBA 2C98A 2FG5A 3OE7D 2QY9A 3V4RA 4FTGA 1NMZA 2D7DA 2VPPA 1XJQA 3CX6A 3PJRA 3QIAA 3CX8A 4XOIA 2Q0HA 3V00A 2PZEA 3TVDA 3GJ0A 5EP2A 5KPDA 5FBRB 1VIAA 4HAYA 3VKHA 2LANA 1N0VC 2OLJA 2XJ9A 2E6WA 4GNKA 1MO4A 5FTMA 5GJWC 3WP0A 3DM5A 4TZ6A 1SK6D 1G7TA 2ERYA 4QGAA 5FTKA 4D0GA 2JLYA 2JWWA 4I4LA 1W7AA 1WDCC 5HCNA 1T8UA 4Q1EA 2C5LA 2HT1A 1AVSA 1R8QA 1E69A 2CL7X 4HUQB 2W6IA 4UNNA 5EP3A 1GM5A 1OYYA 1M45A 3DEFA 1H8EA 1DJIA 1H8HD 2ATXA 3I8SA 3CR7A 4KCGA 1AKEA 1ZIPA 1NMXA 1QDEA 3QOFA 4DLTA 1K93D 1J55A 4EIWA 1ZNWA 1OXVA 3VU9A 1XCGB 3E1SA 1BU3A 5HZKA 4MSPA 4NZYA 2C03A 1QHIA 4ABYA 1RYHA 1NX1A 3KJIA 3VTKA 1ZYUA 1MR8A 4JPZB 2IUTA 3CRW1 2W0SA 3OF5A 1N5LA 4IOMA 2IX3A 1A1VA 1N2DA 4MYHA 4HAZA 2RGIA 2IYSA 3MRSA 2LC5A 4LV5B 3RS3A 4URUR 1W48A 4YDHB 2HLDA 3KUDA 1Z47A 2QMOA 2ZE5A 3HPRA 2R2IA 3EKHA 3DM9B 121PA 4M9ZA 3R8FA 1DAEA 1KO4A 4C0HA 3LK1A 3U44A 3U5ZB 4PHNA 2CCGA 2GNOA 4PC3A 3FMIA 2KQ6A 4M9SA 5I8NA 4UJ3A 2K0JA 3B13B 4LYHA 3EA5A 4YGAA 2PCLA 3ZIAD 3TH5A 4ZI2A 1ELOA 3W8NA 1W47A 1ONBA 3GK1A 4RD4A 4DCKA 3CWZA 2CT9A 2B92A 3TSOA 1BH2A 2VP0A 4HLQB 1BMOA 1T5LA 1F3OA 3EZ6A 5G53C 3ICEA 4ILEA 2JOJA 1C7VA 2K61A 3DVKA 1YZTA 4HB3A 2JZIA 1EGAA 2KI5A 5KNCA 4JVNA 2FPKA 1RJVA 1IQ5A 3BQ3A 1UHHA 5LB2A 1KO1A 2O8BA 4PC6A 1FNMA 2A30A 5EXSA 2MRDA 2ZSAA 1XTIA 3F3YA 4CGZA 5I2LA 1HUQA 1JXOA 2KE5A 1VIYA 3BH7A 4P0TA 2A2ZA 3RS5A 1QXPA 3MWKA 3HJNA 3A4LA 4QHSA 1KZGB 2EQBA 4BRWA 1E9CA 5AUNB 2GXAA 1XB2A 2DCUA 2IXGA 4U02A 3TR5A 2KYFA 1ZMZA 1LF0A 2FZ4A 2NO9A 3M0EA 5G41A 1OV4A 4DB4A 2ZRFA 1ZM9A 1DPFA 4TL6A 1WMSA 4YXWD 2GXQA 3NSKA 2VEDA 2ZI3A 3A1WA 4AURA 2HF9A 4IHQA 2KQYA 2M1KB 4MGKR 2CK3D 1HE8B 3RABA 1JR3E 4LBYA 5FTJA 1G3IA 1QLKA 3DKPA 1NIJA 3LNCA 3V4FA 4C3ZA 2ZJZA 4JSTA 2GJ9A 4BWYA 2WCFA 3AB3A 3LVQE 3PG5A 2P65A 4LHZA 1K8UA 3ZYCA 1Q1QA 1G6HA 3AKDA 4HYYA 1FI6A 2ZJ5A 1BYIA 1UDXA 4B43A 2QI9C 1CDNA 3NHBA 1A7JA 1FMLA 3EPHA 2J7KA 3PUYA 4MGIR 4Q1AA 1IJ6A 1N0UA 1CNPA 1NLZA 3Q85A 3UMFA 1IG5A 4M53A 4EPRA 2LP3A 1OMVA 2RMKA 3LBNA 1OMRA 1OLOA 4LGMA 4V0KA 5FI1B 2M7LA 4Q1DA 3RS2A 2XNSA 2ZAMA 4TQ9A 2IWHA 3T34A 1JB1A 1P3JA 1TUEA 4GI7A 1QLSA 2ECKA 4TTQA 4NYJR 2BMEA 2CNPA 4OK3A 4X8LA 3W5IA 4MH0R 4PANA 4OQFA 3BFXA 1Z28A 5FTLA 1G8IA 4JVLA 4M0LA 1D6JA 4JYCA 1TRFA 1YU9A 5EXTA 1VG1A 2ZRGA 1Z06A 2CEAA 1QRAA 4Q4AB 4XIGS 4AYTA 4AYXA 4AQIA 2CLCX 4QJ4B 1Y3AA 1YZNA 2FPLA 4WXRA 1KMQA 3EASA 3VFDA 1VG0B 1T3SA 3OE7A 4KU4A 4C0SA 4FQOA 1QBKC 2C9OA 1KAGA 4LJAA 4G5RA 3QI2A 5FPSA 2V53A 2ZU6A 1I2MA 2XZPA 3AV0B 3IKJA 3OESA 2FWRA 4FMBB 4II7A 5B64A 5FOVA 1OSNA 3MAAC 4FMDF 4DXAA 4CEJB 1SQ5A 2R6GA 1DGVA 1QHXA 4QOSA 2GVZC 2H92A 4LJ6A 4A92A 2PX3A 2QORA 5CLQA 1SCVA 3K8YA 5C4GB 5DI9A 1US8B 1N25A 1J7KA 4MRNA 4YI8A 2MHHA 1TAGA 5FYXA 1Z08A 2UVQA 1XFXO 2FGKA 1Q1ZA 2F55A 3BJIC 4CEHA 3TGPA 2W2VA 3RC8A 5EJEA 2XSZA 4LYJA 3AUXA 3CZQA 1OKKA 1TNWA 1R10A 2RAPA 1B8LA 2LMUA 2ZSBA 3IHLA 4P4SB 3U7EB 2O8DA 4OJQA 1D9ZA 3EPLA 1ALVA 3QPUA 1EXMA 4XWKA 5JWOA 1B47A 3TAUA 1J70A 1A4RA 2BVNA 4BPBA 2KI4C 1XCPA 4RKEA 5EXPA 2ZVQX 2QA5A 1VTKA 3CO5A 1G5TA 1U9IC 1DAMA 3QEJA 4KJZA 2XTZA 4WAUA 1KFUS 3AKEA 3SQXA 2Y4QA 4OI2A 2BKEA 2ZQ5A 4RKFA 1NY6A 3I4LA 2WPDD 1G8FA 4PQRA 1XTSA 2W00A 1P4SA 3BOWB 3UG6A 4A2QA 5HE9A 1RFLA 4F4JA 1CR4A 4YXWA 1X86B 2OE2A 2RGGA 4FCVA 1NJFA 4N0DA 3QKSA 2FSGA 4O25A 3R20A 4PPNA 1KY2A 1XWIA 1Z6AA 1FX0B 1E3MA 4XJXA 4KYIB 2WIBA 3E2IA 2BMFA 2ZRNA 3SJZA 4QM7A 1H65A 2WWFA 1D8TA 3AVXA 5DH9A 3RVBA 2ISDA 4KLZA 5JHHB 2KGRA 4EPWA 3RWMB 1NSTA 3KQNA 1EX7A 1Z6XA 1KSGA 2ZJAA 3KKMA 3U7HB 1QX5B 1PLLA 1TUIA 5I2QA 4Q7KA 2QTVB 3JZAA 2QPTA 1KK7Z 3QKSB 3QUSA 4LHWA 2Q4UA 1LTQA 4ZCIA 1L2OC 2HUPA 2LHIA 1JAIA 2NG1A 1DTSA 4E09A 2IUUA 4B3XA 1U9IA 3AP1A 1TU3A 2IS4A 2K5UA 3U3MA 3ZDQA 3DKVA 1HA3A 3IIJA 5AJZA 3LX5A 4M1OA 1RPZA 4G0NA 1S26D 3CS1A 4LHYA 4HSEA 3D10A 1RKBA 1LVGA 1PSRA 2EFHB 5FL3A 4ZKEA 1TNXA 1E9BA 1ZIOA 2ODNA 5JI2E 1MQ1A 2FFHA 1XJCA 2QP9X 4RZXA 4W5HA 3QXCA 1XEWX 3TS5C 4BZXA 1L2OB 1OE9B 4RJLA 2ZRAA 2O5VA 1VYTA 4TTRA 1R2QA 4US2R 2O0KA 4DSOA 4F92B 1JFJA 4DLXA 4EFNA 4M2QA 2PEZA 1UURA 1DBSA 4PHTA 2HJGA 2RHDA 3TW8B 2EFDB 5BN3A 4KITB 3SOPA 1QG4A 1T6NA 3PLFB 2VL7A 3WHKA 3U6BA 1II0A 1XTQA 2HCJB 2QAGB 1SW8A 2GF9A 2V8OA 2H61C 3TJZA 4CZ2A 1N0WA 4TLDA 5JMTA 3B1YA 3QF4B 1F5NA 1GOTA 1KK8B 1YVLA 5FPYA 5J3XA 1IXSB 1X1SA 3SJSA 4EAQA 4CEHB 5A0FA 4PCWA 1M6NA 4NDCA 1KMHA 4LX0A 2DOQA 2WAYA 4EFMA 3ZVMA 1OKKD 1UAAA 5KUTA 1GTVA 3CTNA 4YMSA 1Q12A 1UKVY 3T1QA 5KO2A 2BKUA 3LVRE 2ZKMX 3AEZA 3KTAA 2QMHA 4IXMA 5DI3B 1H8BA 4Q5IA 5E7IA 3TDIA 3TQCA 1DMOA 4DIEA 4DDWA 1DO2A 1RRFA 3NTUA 1UM8A 3MMPA 4MA4A 4AG5A 2GCNA 1NCYA 6Q21A 1P62B 1IHUA 1F2TB 1W0KD 4DUGD 1Y1AA 4GPLB 5J4YA 4C7OA 2BBWA 4PC7A 1BS1A 3B85A 1GKYA 2OCPA 1BJFA 3SIBA 5J40A 2YOGA 1IXZA 4BFYA 3B1VA 3NKVA 1QS7A 2F1HA 4FWIB 1YJ5A 2M8UA 4OR9B 4R7ZA 2JA1A 2LWIA 1SXJC 2O60A 2WICA 3LLMA 3OEEA 4PO8A 4A15A 3FKQA 3QRXA 2JLXA 1G18A 2V6JA 1W0KA 4URWR 4TYWA 4D0NA 2QT1A 1FW4A 1AJEA 2K7DA 3VR3A 2NIPA 3RAPR 4DLWA 4CDGA 1P2SA 3CW2A 2CXXA 1WRKA 2WPDA 2XTNA 3NDBB 1DT7B 1YVDA 2OESA 1QJTA 3X1YA 2VHJA 1NVWQ 2LCPA 1SKYB 2VQSA 2FEMA 1AGPA 2ZRSA 3L82B 3U6KA 2JQ6A 3PEUA 4Q4JA 1J8MF 2QBYB 2VLIA 3GJ6A 3I5HC 4HI0E 4Y0VA 2WWYA 3MWLA 5HKKD 2AFIE 1Z07A 3MSEB 1LA0A 2F1JA 4BFWA 3NBZC 3MFYA 4L8GA 4DT1B 2CCJA 2P6UA 2ZNEA 1R5OA 3D0YA 2KBMA 2IHBA 3NHAA 1AZTA 3C15C 5AUQA 2ZROA 4A2PA 3TW4A 2YVUA 4EPXA 1JBAA 3B1WA 2KI4B 4CIDA 4H9GA 4IFEA 1DJXA 3ZJYA 5JJIA 1T0JB 1XZQA 4GDFA 3TS5B 4TQAA 2L2EA 4NPHA 4MKFA 1XPOA 2DPXA 3DHWC 1DG3A 1KDOA 4NU0A 1F4QA 1E2DA 5JJLA 3TUYB 2DWQA 4JLJA
chains in the Genus database with same CATH superfamily
5JBIA 1RI4A 1YCHA 1XAIA 4DLPA 1MXEA 1L1EA 3F1KA 4RXMA 4TTPA 3SIAA 3PUKA 2OXFA 2BBTA 3B8HA 1YR1A 5TRTA 2HHHB 4C2TA 4F3TA 3OZUA 2NZ0A 2CXQA 2JATA 3SI7A 1GG8A 2Q2VA 1GKIA 3GJYA 4TV9B 1KO5A 2PT5A 4XDHA 1DBPA 1O7JA 4BDSA 1U0HC 1E96A 1P4GA 2WTXA 3A04A 4Z7QB 2NQTA 1A7KA 5JTTA 3GLGE 2CV2A 4L4YA 4MITA 3OZCA 1EJ3A 3M4NA 5FUMA 1BAPA 1W4CA 3PPIA 1RQLA 2NQ8A 2Q41A 4Q1FA 3MZ0A 1RECA 4MQEB 4BQNA 1Q5PA 1WL8A 3WHIA 5B36A 4GBMA 3CYFA 2H1OA 4YUZA 4D1EA 1AQ6A 1VM6A 3GCWA 4AMYA 4D9BA 4Z5XA 2JARA 2FN3A 4ZVOA 4UMVA 2VDRB 2FOLA 3DHEA 1GCUA 5DYGA 2WUGA 2JC2A 3JTDC 1OLSB 1V25A 3R3JA 3RQIA 1HEYA 1VJ1A 4RPJA 3O21A 3TS1A 2PL9A 2WQ7A 2YV5A 1MU0A 1OW3B 2G70A 3BMCA 1Y3BE 3T7KA 4RS4A 3CVXA 2PUJA 1WWKA 2ZNDA 5FOTA 2ZLBA 2I91A 1WQ4A 5JRDS 4A0FA 2EHDA 4HWRA 3LC1O 4HNAA 4EMTA 3FB1A 5DSXA 1D6NA 2ZTSA 3CBQA 1Z6YA 3M0WA 3KHEA 1Y80A 2LLSA 1CS4C 2C2MA 1DZIA 1Q11A 3A0UA 3HKEB 5K0BA 2OTGB 1T5BA 4JQZA 3ZQKA 4NL4H 3NIGB 4NYMR 4O5OA 2EWWA 1PJQA 1XD9A 1TO2E 2G08A 1SZCA 2NV6A 3CLUC 3I2JA 3IQDB 4N6GA 3DTVB 1N6KA 3CNEA 3ENZA 4UM8B 1KK7Y 4HNHA 1Z18A 2Q1SA 2QW0X 3QWHA 4LRUA 1IZ7A 1BF5A 3F6EX 2BTQA 3D5EA 4ZQCB 2SECE 4C2AA 5I4CA 1TUZA 1MCZA 1XXHE 2D2FA 3TEFA 3TQTA 4UNRA 3GLIB 4LBWA 3DG9A 1XRNA 2CMDA 3SDSA 4KO4S 1JF0A 4GI1A 3DMNA 2O8EB 5GM1A 4AMBA 3P20A 2W2LD 2WAAA 5A03A 3FH0A 2GO7A 3WKBA 4DJEC 5KJ6A 4YAWA 3U3JA 1ABFA 1S9DA 3UUWA 5KSOA 4MZJA 3IELA 2QD1A 2Q50A 3E58A 3KPUA 3KFLA 4B6QA 5D69A 1PIWA 3M89A 1QFJA 5LMZA 3QKUA 5D3MA 4UNPA 5AM4A 4ACBA 4KKXB 3DDUA 2IHVA 1X7DA 1EDDA 1PJAA 2JIMA 3ASYA 3D43A 3IXQA 3ZW7A 2NYRA 4I1VA 3EFHA 4AULA 1JLMA 3HZRA 3N87A 5ALSA 3B60A 3WZ2A 3TQRA 1VJTA 1EU1A 2FDRA 2ZRIA 2HTEA 3B7WA 2DPMA 3PWZA 3R41A 1RQ7A 5JJGA 4UQLA 1OTHA 1RAAA 5ENDA 4F04A 3KSBC 4MV0A 1L7XA 4X1KB 4R4JA 3CWGA 3O3OB 3CTMA 1GQSA 5JXGA 1W0JD 1LPSA 2RAVA 1G8YA 4RS3A 3IQEA 3SF8B 3PF8A 3GK2A 2DHRA 4JBWA 1K9UA 3FLAA 1G3QA 2DBYA 3L8HA 2JHCA 4HQRA 3TXAA 3B6MA 3VZCA 2FP4A 1E77A 4OM8A 5K6RA 4G4SP 1HFJA 3S2SA 3FDXA 4AX8A 2VAPA 2WF5A 3C1UA 2RC6A 2BCAA 4FOTA 4OY3A 3JWIA 3I4FA 3REQB 3AF4A 5T3UA 4RJTA 5KHAA 1UHJA 2D5AA 1GFSA 1OU4A 1L4EA 1OBHA 3DE3X 3OLQA 2G5TA 1TT7A 2GZHA 2LLTA 3H2JA 3ZWBA 3R6GA 5REQB 5SYNA 1X38A 2XMRA 3VNBA 3ZY4A 2PLFA 1A4XA 4L5IA 4CR7A 2LP4Y 1KIFA 1FRVA 4OBEA 3S0AA 4CR6A 3A4VA 4CM5A 3VOAA 2QVYX 3GRZA 3Q9UA 4GMKA 1B1CA 4D80A 1NBMD 3GY0A 3D73A 1OAAA 4XRRA 3MYYA 3B87A 3I9JA 4C2BA 3DWEX 2IZ7A 1YJAA 3T4UA 2PRSA 3GJTA 1UKZA 1Y4AE 3PGMA 2OBFA 3MTGA 3U19A 4KFCA 3U9TA 1H4QA 4P7FA 1E3QA 3EC7A 3OUZA 4CTKA 1H1DA 2GH1A 4ZYXA 3NIWA 3KT8A 1ES9A 3CRMA 1HO3A 3FCOA 4GUAA 1BE8A 2FH5B 2VTDA 3CRQA 3NHUA 1F06A 2XUQA 4YAEA 1ZM7A 3A11A 3WLAA 1RXEA 1ZJWA 1KYWA 3DEIA 4PQFA 3Q6MA 1J97A 4IXWA 1TJPB 3DEHA 4N8DA 2PZFA 1UJNA 3BFHA 4X1OA 1J9GA 2Z9BA 3AEQB 1MGPA 2X7XA 3OZTA 1M8FA 4D2IA 2ZB8A 3IT3A 4D82A 4DSZA 4J0IA 1SKTA 1RRVA 2QT9A 5CW1A 5T7BA 1E7QA 3TQFA 4TT3D 3AERB 2ATIA 1F48A 2WZBA 2VO1A 2AQ8A 1HGXA 5C81A 2D2IA 5J47A 4RTSA 3K21A 3B38A 2HF2A 3ICVA 1VGRA 5DT2A 2V1UA 5C8XA 4CETA 3MOGA 3U26A 2R6FA 1K66A 9LDTA 5HJ7A 2IXAA 4IDBA 5CYFA 1ISSA 1FP4B 2W71A 1JLHA 2GZDA 3OO1A 4Y6QA 1XTJA 2XOKA 4KYNA 1C30A 1T8TA 5I8PA 1OH6A 3HCFA 1JDSA 1Q0UA 3AONB 4YY3B 1I7SB 2OPOA 2QTTA 4HDKB 4YJ3A 1HXHA 3V2GA 4XYGA 4DEXA 3VYVA 1FUIA 5GZ3A 1AKWA 1V11A 3GLHA 3KR9A 4KYTA 3STTA 4OV2A 1M54A 1LI4A 1VLVA 1YZVA 2A1UB 3FTQA 1XQXA 3R4VA 2JASA 4GPBA 3IR5A 4FHCA 3WY9A 4B3DA 1SBNE 2A0KA 4YUXA 2Q91A 1DF0A 5IT4A 3HACA 3SLGA 1FC0A 4WZ6A 2CWDA 4P2BA 4RACA 1RMTA 2OFPA 1JIKA 2G5GX 3T1TA 1WRLA 4GG1A 3IV6A 1K7XB 4C6TB 3ZVLA 2WYHA 1CQPA 1PYDA 3IPAA 3O9MA 5LKRA 1RPJA 4YHHB 1VRVA 2Y1MA 1IQRA 3N2IA 4WFKA 3WWDA 3VPHA 2BZGA 2P4UA 1NF9A 4KGXA 4LGYA 1BMFA 3AKAA 1VECA 1TMGE 4KRGA 1XNQB 4QYIA 1H9BA 5DSTA 1RM3A 2JAQA 4EVQA 5FA8A 1QHGA 1GPDG 2ZPUA 3GT7A 4OPMA 3O2PA 4G1MB 1RPNA 4UC0A 3BFBA 4ZAFA 3LPAA 3R0JA 4I55A 3QVUA 5JO9A 3RVKA 1Y9AA 4QRDA 1AQJA 1XN1A 2NUPB 3BGSA 2AFHB 3OQ1A 3EC2A 3EVGA 2HUNA 5IT5A 4B35A 1GR1A 4JP2A 3GEPA 3C8ZA 5JSQA 4CFQA 1I5EA 4S1WA 4BC0A 2ZRLA 4IW3B 2J07A 4UBIA 1HV8A 4WLUA 1NVUQ 3H1FA 5KTYA 3BWVA 2HH9A 2LUCA 4I8XA 3S70A 2BBMA 4Z86A 5KNCA 5HVNA 5ICGA 4ZGBA 5AHKA 2QXYA 1DJPA 1RZVA 4DR7B 3I62A 1XMJA 2PSDA 1NURA 1T9GS 4CTNA 2I67A 4P3PA 4WVFA 2NSLA 4P98A 3A1UA 1NUPA 1ZW6A 4TS4A 2PMEA 3T52A 1QIVA 1QFXA 3K1TA 2LDBA 1VCMA 4V2IA 2DYKA 1FU4A 4YMUA 2RIPA 1S9HA 4DMGA 1JQAA 1PK8A 3VSAA 1YNSA 2IY8A 5EERA 3SSAA 3VZRA 5C51B 2GCIA 2JBAB 2FPIB 4RBNA 2XJ4A 2HWXA 2GASA 3THXB 2VJQA 3GMDA 5FOWA 4AKTA 3L0SA 1S4MA 2DBRA 2MLFC 1XRMA 3A7EA 3LPDA 2W2XA 2AL7A 1H2XA 1U5IA 4JUFA 1EG3A 2XMCA 3E22B 4KQXA 2XDWA 1X92A 4RANA 4TWRA 2ZTVA 1UMDA 3FM9A 2JFYA 1CJKC 2QLMA 1WUIS 1U7ZA 2CLOB 3QSYA 3ILXA 4RGYA 3OFKA 4J7UA 2A0FA 4K40A 1CP3A 1J7OA 1DEAA 3ROKA 5GIPE 3K9GA 1WCYA 4EX7A 4EY6A 4WSOA 5SICE 5G40A 1OW4A 3AEQA 5FB3A 3Q0EA 1I80A 2QUBA 1WOMA 3OU7A 4AU1A 1QRSA 2I34A 4RD0A 1B6RA 3U61B 2WF8A 4P58A 1UQTA 1I14A 3PRYA 4QUBA 3C3BA 3EGOA 4RHTA 2O23A 1RROA 5LZ8A 3EOAI 5K0JA 3AEKA 5AUOB 3H5NA 5LJLA 2KX7A 3W9YA 5IKPA 3DOFA 3FE9A 1DXQA 5B12A 1XU9A 1FW6A 5U4QA 3HV0A 3KOWA 4CCWA 3EZXA 1GUAA 1NVAA 2YHUA 5DCWA 1H69A 2GPTA 2R96A 1WB6A 4TT8A 5F12A 5FBKA 4TPKA 1Z5GA 4YUAA 4KG7A 3E1KA 3EJWA 1O5IA 4B2IA 3LPMA 5JCPA 1M2JA 3L04A 2IHUA 3COZA 3MWDA 1UCFA 4U00A 4GOJA 4HRVA 1GN8A 4A9AA 1XQWA 4XWWA 2GBLA 1VKNA 1E2FA 1XRLA 4A7PA 2F43A 4M0EA 5EKUA 4LWQA 4RMNA 3IAHA 4F1JA 1M33A 1W4AA 1YDFA 1PSDA 2HFJA 2IW3A 2HU7A 1FDIA 2RJOA 4IDNA 4TXMA 3TZKA 2BC9A 1BXZA 3USES 1V43A 3ZX5A 3DOIA 4Q1CA 4UNQA 5CIQA 2PJRA 1AV6A 1OJ7A 2N9UA 4G5FA 4JU9A 2Q62A 4M1YA 4QO7A 1C7EA 1EE1A 2R2AA 3R3SA 4RZ3A 3GAFA 1KR2A 1LDYA 3DCYA 4B34A 1GNPA 4YMVA 4CKBA 3KQYA 3NRCA 1U7HA 1HURA 2LIPA 2EF0A 1Z6QA 1Z5UA 2QACA 2PALA 2RKWA 1L5QA 3CM0A 3R44A 2VT6A 3Q7QA 2XVYA 2P75A 1U2DA 3SZMA 3BSSA 3WLKX 5FWNA 2ZB4A 1PGQA 2W6PA 3GRFA 1U2RA 2CBLA 1XAGA 1ZMTA 4YMWA 1QGED 2QM3A 1I7DA 4U7DA 5KTMA 4L4UA 4YCDA 5FA6A 2PL3A 2YJ4A 1RJ9A 3R8XA 1QRTA 2R97A 1KOJA 5DGHA 2XI4A 4GXQA 5FUVA 5TQJA 3VPGA 1SL8A 3OLXA 4YBZA 2D3WA 3MTEA 4EWLA 2J0QA 2DWOA 4AG3A 4IMIB 2J4FA 4HRGA 4QUDA 4O1MA 1IWQA 1JECA 5C34B 5LYJA 5AW9A 4EPYA 3GQVA 3S28A 1IPFA 3M6LA 1DWQA 3VX3A 5BWMA 4EG3A 3C4JA 2X0RA 2MINB 2UUCB 3TO5A 2YZKA 4ASUD 4PTZA 1SHJA 1JAHA 1Z75A 1E61A 3SG4A 2UVPA 2ZIGA 3HY4A 5JNWA 3I04A 1VPLA 4AJOA 2WMDA 1JRLA 3E5RA 4HQ6A 3T5BA 1CZLA 3FWYA 1K4YA 2ZSEA 3WK7A 1QQ6A 5JCZA 1YFLA 3FJYA 3HC7A 1GU7A 4KWTA 3HX4A 4HSZA 4A23A 3KP1A 1CYDA 4IQ4A 3KQMA 1F8HA 1VLJA 1AURA 1S2DA 3AZPA 4JJ8A 4NBRA 1YH3A 3O26A 2B2XA 5BSWA 2ZKIA 1TT5A 4UULA 3WLJA 1ZUZA 3I5FC 1G3MA 4ZOCA 3R7DA 1EWVA 1UJ2A 2XOXA 2BBSA 2KFHA 2VNSA 3GCXA 3BH0A 3I6QA 3IDOA 1VLLA 1AGNA 5A05A 4I5JA 1PVVA 3R5TA 1XO5A 4HEJA 4KIGA 4XPZA 3WYFA 4NBKA 3DOEA 4P7JA 1QH9A 3GJRA 3QFCA 1QGZA 1VL0A 2H8VA 2DJIA 2EKQA 3GRKA 4MYDA 2WU4A 2DE0X 4BE7B 1UJCA 3ULKA 2MR6A 1NIPA 3E7PA 3L1JA 3WIEA 4P4UA 2M29A 1CHDA 2E6UX 4DA7A 2ZTMA 3EIFA 3WL4A 1EFVB 1KETA 3DR3A 3IP7A 4LSMA 3WNDA 2QSYA 2QYOA 1USIA 1HT2E 1QS0A 3DDWA 3H5WA 4B40A 1U3TA 4BVAA 5JFGA 1HORA 1NBIA 3PC3A 1RRMA 1XMVA 1PJBA 3ETNA 2VRGA 1LBSA 3CZ5A 3D0RA 5E2IA 1ULZA 4EB8A 5CSJA 5EJ4A 1EVJA 2DKNA 2BKAA 2YFHA 3JAKB 5EWLA 3TM4A 2O14A 3ZH9B 4YRTA 4I5GA 1QX7A 3ELYA 2PUCA 1IIBA 4B7XA 1J2RA 1VIMA 3A4NA 1G64A 3C48A 4M0MA 3EDOA 3MGCA 1SG6A 1LPMA 2XZTA 2EP8A 4MI9A 4RFLA 2A92A 4XA8A 4FCWA 5G3ZA 4F7WA 4ZT4A 3SP1A 5IJ0B 3E82A 5BPHA 2I2FA 4AM8A 3O8RA 1YL7A 4EI9A 3PV0A 3EBPA 3F6RA 2MAZA 1S8AA 2PH7A 2BAGA 4F85A 1X7YA 4XYNA 4L5BA 2ZS7A 4RV9A 1KDTA 1OZSA 4YAOA 3Q2OA 5K5EA 2OA0A 1WSBA 4X20B 2FRXA 3NDRA 1WRZA 4GMDA 3R0VA 2DFLA 4MP3A 2EJBA 4MRYA 1CJUC 5E4FA 2QR5A 2WIKA 2YN4A 4GH5A 1XTBA 4TV8F 5EE1A 3GPDG 3INYA 2AK3A 2JIPA 5F77A 3JVTB 4G9BA 3S3TA 2B1IA 2XNDA 4B48A 4BMDA 2ZS9A 3PNPA 5EZ5A 4TXJA 3M81A 3FF4A 1XZCA 3AR5A 3K5PA 3OIYA 2DWPA 3QKTA 2QG6A 4JBYA 4ND6A 3U3ZA 5HS4A 4KR7A 1T6XA 4Q6WA 3D64A 3KD2A 3SZUA 3P2YA 5JD6A 1QTXA 1CR6A 4FI3F 1UDRA 4P32A 4EFDA 4YXFA 3IVAA 3LQ1A 1GJRA 4QFMA 4GSYA 1RQXA 3AUKA 2BHTA 4ZCUA 3WLFA 3ZD9A 3CU5A 1WVIA 4D56A 4XD7A 5K0CA 1SZDA 4J4BA 3JTMA 1I2BA 4A73A 4KUEA 1PR2A 5G0SA 5AK0A 2V5VA 1U8CB 2PGDA 1V45E 3EXEA 2PKYX 3W9BA 1NOJA 5JLAA 2V03A 5J1SB 1YJCA 3K9QO 1K9KA 1YRBA 2OV2A 4H0FA 1AUXA 1VRKA 1HDGO 2JFQA 3BJEA 3P4XA 2ZCVA 3R40A 4WESB 3R7SA 3CUKA 4U6QA 3T41A 2GAFA 4HYTA 3V1TC 5JCOA 3NHYA 4WCFC 1YDEA 3P26A 1ZJ4A 3L1HA 4CM4B 3PC4A 2HDHA 2C97A 3Q88A 1JH8A 1Y8QA 2HA6A 5E1DA 3K09A 1MJFA 4E1AA 1DEXA 3D8UA 1SVKA 4N47A 3VSCA 4BAZA 4B3RB 4ZOBA 1CEYA 4IJ6A 1U1EA 5AOCA 1V6AA 3KRTA 2L4IA 1PS9A 1VSUA 2FPGB 3A27A 3H1AA 5FTNA 1EWTA 3TNDA 4K9NA 4TL9A 2F9MA 4Q4LA 2BBNA 3WIUA 2HLDD 3REFA 4DG8A 5AHOA 2QYSA 5AI9A 1DOAA 1YCDA 4ISBA 2E7ZA 2YASA 5C4MA 1RRKA 1GTJ1 3QPDA 3ZCQA 1JFFA 3DXFA 5L40A 3BVPA 4I5FA 1JDBC 3ZTYA 3EGXB 2C04A 1IG0A 1DHTA 3E81A 3EG9A 3I58A 1C3LA 1Y7LA 4K5QA 3VZDA 5K8VA 5LNK6 2BSXA 1GZ3A 1QE3A 3BK7A 3KLNA 4HWOA 4U2FA 5G4LA 5J43A 1IRXA 1PLKA 3BDVA 4L85A 4PS1A 5HK8A 4Z99A 3W5BA 2Q6OA 1FJGB 1T4CB 2C77A 2XV1A 2YJ3A 3SDBA 3OLCX 3GJXC 1QTIA 2VHVA 3BILA 4FDLA 2O19A 1GA1A 1W5BA 3K1EA 4P4NA 1ZD9A 2FW8A 3GLUA 3B48A 1ZOTB 1BGXT 3I4CA 3R23A 4LJ7A 4PYMA 1NLFA 1SCNE 3L5OA 4FQ5A 4RWEA 3SHOA 4C0AC 4DAOA 5JCXA 4L73A 3MLEA 4M1SA 2VTKA 3LQFA 3DBHB 4E5NA 3EZ7A 4ITVA 3DEZA 1GAXA 1IY1A 5ECGC 1I2ZA 2YXNA 2BEVA 1PV1A 4OATA 4QOJA 4ALLA 1YXMA 1Z7YA 2IEGA 5FPHA 1LPOA 3IEXA 4V03A 3LJKA 4YCBA 3SIWA 1ZSVA 4ZMBA 1A2BA 1JILA 1GWNA 2P5YA 5IG2A 1I13A 3GK3A 1QP0A 3MUFA 1KCYA 2VP5A 1O0BA 5HOQA 4TZ0A 3L7BA 3OMWA 1U2ZA 2AMJA 3PD1A 1IK4A 4PSUA 4U63A 5EZYF 4LWOA 4ZOLA 3WRVA 1OILA 1P9OA 4HADA 4QYSA 4EJSB 1E3DA 5DN6D 2JULA 5JJ5A 3R6DA 5LBTA 1AQIA 1NXSA 3RIYA 4EJ0A 3HA2A 4FYPA 1IQ3A 4KOAA 3ROEA 1A75B 2BDUA 1THGA 1X7XA 2PFSA 3IO5A 2X8WA 1B23P 3RJTA 4IL5A 1T1RA 3SG3A 2XDQA 3VRPA 3Q3EA 3L0DA 3OCUA 3VROA 1FRQA 4FKMA 5BOSB 4JENA 4HP8A 2AW5A 2JKVA 3PSAA 4A03A 3UT6A 1T4BA 4PYLA 1P39A 3P0HA 4MI1A 1SRAA 4FKZA 4OI4A 1KY4A 3FHOA 3T7CA 4FU0A 4ZVNA 2TECE 4ETOA 4QYTA 1AHNA 4A36A 2FWBA 4I5EA 4R98A 4BLOA 1PK9A 4KAAA 1KIMA 4PAGA 4BZQA 3SHWA 3PFGA 2EYUA 3SQDA 4MWSA 4FNMA 2WWXA 4RVHA 3W2FA 1R4AA 1DKMA 1Z0ZA 1SPYA 3K1AA 3NWBA 3F78A 5JOLA 5IJ9B 3U16A 3NWOA 2QVXX 3WADA 4KSCA 3OT1A 4M22A 1Z37A 3V4VB 4AI6A 1R12A 4NCNA 3FGZA 2H2DA 3VPFA 3N76A 4JLBA 4F60A 3R6TA 2QDXA 1B7TZ 4E03A 5B3KA 3GEMA 5CXXA 4A4CA 1BQ3A 1XJWA 2ERCA 1E6UA 3W3AD 1JR2A 3ZZ1A 3HN2A 2L50A 2YBEA 4ZQHA 4F97A 3A9TA 4J7XA 2XRZA 2UZIR 3E5NA 1NW9B 3FUVA 3GC6A 3BEDA 1EGVB 3GZTB 2PU5A 4JN6B 1V3UA 4HDNA 1ZRHA 2JRFA 3VR4A 3KUCA 4TSFD 4OHKA 2HQ1A 5IC6A 13PKA 3BCHA 4CKWB 3D6VA 4EZBA 5HW0A 5L4NA 3UJNA 3RJMA 3FBWA 2ZYGA 1II8A 4H7HA 3OZEA 1V48A 2LTAA 1MV5A 3HHPA 2BZ0A 1ZNZA 3IODA 2B7BA 4ZVUA 5EMMA 3ZVNA 1K9PA 2VSOA 4UU7A 4Y1FA 4ZT3A 3VR5A 1IH0A 4HNRA 3V7FA 4E22A 5TV2A 3F8TA 2P40A 4PAWA 3V4ZA 3FOEC 3I9FA 4HDRB 2O07A 3U3XA 1JHVA 1S01A 4J0FA 1K96A 1TTPB 2X6TA 4QDKA 2ODQA 4INPA 5G0VA 2G2BA 5JARA 3JQFC 2VIIA 4BV8A 2Q3MA 5G08A 4DJJA 5LU9A 3HDJA 1WXDA 1OFTA 4QYIB 3WLIA 5C52B 4WACA 4W5RA 2GZAA 3U7QB 3GNQA 1U8AA 1O97C 2Q6VA 4U1RA 2LNKA 4E5KA 5BMVA 4P2GA 3TD6A 5IYZF 4W9MC 2FQ1A 2JC3A 4UMEA 3A4YA 4DIRA 3IQWA 4R7GA 5J58A 3NWJA 3LYLA 1IN1A 4Q7MB 3KBOA 4AUNA 4WN3A 1NYQA 2WWRA 4O4HA 5KYUA 1G41A 4GIBA 3CEMA 4G9GA 3WO1A 5ICCA 4OKSA 3WNXB 3SJ7A 3BUWB 3OTWA 1BQ4A 3PIRA 1S5GY 2VP9A 4ARVA 1BWRA 2Q5OA 4QXOA 4S2UA 4KR0A 5K6AA 2P67A 3L7DA 4O4JF 4DILA 2GPYA 1A9QA 2VAMA 3IDAA 2J9FA 1ADGA 1Z5VA 2BM9A 1J7QA 1ZJ6A 1A5TA 1OIWA 2SKCA 1A03A 3QNMA 1GRNA 1US8A 3VV3A 3S29A 2JB9A 5BV7A 1G2PA 1NUHA 5GVRA 3WB0A 2DKFA 3PHLA 1D2NA 1IN8A 2QTHA 4NAHA 1UMCB 4JEIA 4RY2A 1P3DA 5CLGA 1NXVA 4KE6A 1Y8AA 4JJEA 3GLTA 4RF3A 3A6ZA 2N75A 4BQQA 1GPBA 5HPYB 4HCJA 4JL5A 3BORA 3DZKA 4IY1A 4HVTA 4QRIA 5A9SB 3A6HA 1HG0A 3F47A 1JXMA 2PRZA 3D5TA 4D4JA 4F93B 1GFWA 1RM4A 2EVWX 4G85A 3ORYA 2EC5A 4BX2A 3S7TA 3QMMA 5U1PA 2C5SA 1T4GA 1Z4PX 4CMGA 3G8DA 1VA4A 1O77A 1P4HA 2BFCB 2I2RE 4WECA 3WB9A 4ZI3A 2JJMA 4I19A 4BUJA 2XBMA 1U0BB 4UW9A 3N9IA 4Q82A 1TB4A 3AI2A 3FMVA 3L40A 4IV8A 4RSGA 1F17A 1FBNA 1Z8HA 2PRYA 3RFFA 5F23A 3D4OA 4RFVA 2CBZA 2RAFA 3RVRA 4JYZA 2RBKA 5CSIA 3UHFA 2AW3A 1HFWA 1SUIA 3OAAD 4HUJA 4Z8XA 2WWGA 3DPSA 3KX2A 4OLHA 2Y1OA 4IAOA 4IHJA 2NP7A 1SQ6A 2GN2A 2JFFA 4MEJA 1GTRA 3PQ2A 3GRAA 1EM8A 4B4OA 4D4KA 2R7LA 2HXYA 1NUTA 2GK4A 3IVXA 2ID4A 1QP8A 3I3OA 4C0KA 1VJGA 1DQPA 4MWCA 4RW0A 3J81A 3MJHA 4PO1A 1E64A 3A25A 3QUBA 4GRAA 4F5WA 1E1KA 1P2VA 1U6JA 4N3GA 3UGKA 1L5MA 1Q1GA 2MSLA 3NRBA 2HIHA