3FE8A

Crystal structure of a pheromone binding protein from apis mellifera with a serendipitous ligand soaked at ph 4.0
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
119
structure length
119
Chain Sequence
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH induced domain-swapping favors pheromone release
rcsb
source organism Apis mellifera
total genus 44
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3fe8A00
3CDNA 3NHTA 3R1OA 1ORGA 3CZ1A 2QEOA 3NGVA 3DZTA 3N7HA 3QMEA 4OZDA 3NHIA 2PQLA 3S0EA 3FE8A 1P28A 3D73A 2WC5A 2QEHA 3BFBA 2WCHA 1OOIX 3S0FA 3S0GA 4INWA 2WCJA 1TUJA 3B7AA 3PJIA 2WCMA 3L47A 1GM0A 3R1VA 1OOHA 1QWVA 3S0DA 5DICA 2ERBA 3BJHA 3DXLA 2L2CA 3Q8IA 2QDIA 3CZ0A 3B87A 4F7FA 1LS8A 2WC6A 1OOFA 3VB1A 3RZSA 3L4AA 3DYEA 2GTEA 2P71A 3D75A 3D78A 2P70A 3D77A 3FE9A 3CABA 3OGNA 2WCKA 1C3YA 3DY9A 2KPHA 3K1EA 3B86A 3BFHA 4JD9A 4PT1A 1C3ZA 3B88A 4FQTA 1T14A 3BFAA 4INXA 1XFRA 2FJYA 2H8VA 3FE6A 2QEVA 3L4LA 5EL2A 3CYZA 2WCLA 2JPOA 1OOGA 2QEBA 1OW4A 3CZ2A 1DQEA 3R1PA 1TWOA 3R72A 3V2LA 3D76A 3D74A 3S0BA 3B6XA 3S0AA
chains in the Genus database with same CATH superfamily
3WHUB 1KFXL 1KK7Z 2ZNEA 3FWBA 2H61C 4CFQA 1RROA 1XYDA 2WOSA 3QRXA 1G4YR 3M0WA 5I94A 1WDCB 3N7HA 3QMEA 4OZDA 1YURA 3BOWB 2KLDA 4MLWA 2PQLA 1FW4A 1P28A 2WCBA 2KQ6A 4BY5A 1DF0A 2BKHB 3EK8A 3NSLA 1U5IB 1ZUZA 3S0FA 4AOMA 1S36A 1YX8A 4GGNA 4I5LB 1QTXA 3LK0A 4U8DA 2A4JA 3B7AA 4PHJA 1K90D 3K21A 4QJ4B 5KU1A 4ORBB 4XYNA 1DTLA 1GM0A 1QX2A 1SPYA 1QWVA 1DT7B 1IGVA 1SBJA 3O6BA 4ORAB 3MSEB 5DICA 2ERBA 1KQMC 2M9GA 3OX5A 2YGUA 3SIAA 1K95A 2KBIA 1XO5A 3PN7C 2L2CA 2LE9B 1QJTA 3LCPC 4XJKA 1YR5A 2KI4B 1CMFA 1D1OA 2NCPA 5CSJA 3B87A 4ORCB 3IQOA 4F7FA 2DOQA 2L0PA 2L50A 1PALA 2QPTA 1YUUA 4FTGA 2ZN9A 1SCMB 1AP4A 1A29A 2LVIA 2O60A 3LK1A 2GTEA 3JVTB 1A4PA 1XFWO 3D75A 3ZNIA 3NSKA 3JTDB 2WORA 1BU3A 1KK7Y 1J1DA 4WQ2A 2P70A 3GOFA 3DVMA 1CFFA 2CXJA 1TOPA 1PSBA 2MLFC 3AKAA 3FE9A 3PLFB 2KFHA 1CMGA 2HETA 2BKIB 2BCXA 1QATA 1DEKA 4DIRA 1NSHA 1J7QA 1Q80A 2JNFA 4PHMA 5J3XA 1JFKA 1A03A 1LA0A 5AERA 2L5YA 3GK4X 2K60A 1RWYA 2OPOA 1ALVA 2I7AA 3CWGA 3SS3A 4PT1A 3TDUA 1SYMA 3EVRA 1AHRA 2CBLA 1Z2CB 2PALA 1WDCC 4INXA 4MZLA 1XFRA 1XFZO 4QJ3B 2H8VA 2M7LA 3KEVA 1K2HA 3L4LA 3NSIA 3I5HB 2D8NA 2LCPA 1N65A 2V53A 2WCLA 4ETOA 2EC6C 1C7WA 2KOTA 3OP0A 5B8IB 1KK8B 2K2AA 2L51A 2GV5A 1TNQA 5HKWA 1XFUO 1GJYA 1MXLC 2BBMA 1YUTA 4IJ7A 1L2OB 2ZRSA 1FI6A 1NX0A 2I18A 3RM1A 3V2LA 4L9MA 1X02A 2KGBC 1AVSA 3D76A 4F0ZB 1JBAA 1QIVA 3LL8B 1QVIY 1LXFC 2L5XB 1FF1A 2M29A 1B8RA 5DKNA 4DCKA 1SW8A 1H8BA 1ODBA 2F8PA 1M63B 1U5IA 2LLUA 3DVEA 1QV0A 4MSPA 4R1EA 1QLKA 1N2DA 1SL9A 3NHTA 2G9BA 4N1GA 5FYXA 3R1OA 3SG6A 4YGDB 2PRUA 3EK4A 3LLEA 4GBAA 4HREE 3SG5A 3DF0B 4UPGA 3TS5C 1NX3A 4JPZB 3NHIA 3EG5B 3VRPA 2P6BB 3CTNA 2JNXA 1S6CA 3ICBA 4M2OA 4OKHA 4FQOA 5HYDA 2QEHA 3BFBA 3PM8A 1CNPA 1F71A 1OZOA 2LUXA 2LNKA 1R6PA 1K9UA 3S0GA 1C7VA 2KGRA 3EKJA 1TTXA 2LV7A 1SCVA 1TUJA 2WCJA 3PJIA 1RFJA 2CNPA 1KWOC 3PM2A 1E8AA 2JT0A 2O5GA 2Y1NA 3L47A 3VRRA 3VGOA 3VROA 2NCOA 1DGUA 4MZJA 1TNPA 4PHNA 1OMDA 3TUYC 1A2XA 4YBHB 2I94A 4ZCUA 2KFGA 3WNXB 4D1EA 5HKYA 3DXLA 1DJIA 1DJHA 1W7IB 1JF0A 2LANA 1JF2A 1DVIA 2BAPA 3GK1A 1TCOB 1K96A 1LS8A 1KFXS 1QV1A 3BUOB 4HRGA 1OOFA 3VB1A 1EXRA 1DJXA 1FBVA 1BODA 1IG5A 1KK8C 1WLMA 3DVJA 1DELA 4I5KA 2BECA 1K94A 4YGAA 1YX7A 2F2PA 4IL1A 1BR4B 1L2OC 2QACA 3H4SE 2JULA 3D78A 1BOCA 5CSIA 3D10A 3EVVA 3TZ1A 1UHHA 3BUMB 1TNWA 1SK6D 2JXLA 2LAPA 5HKZA 3OGNA 2ZFDA 2WCKA 1OSAA 1XK4A 3CGAA 1C3YA 1Y1XA 3DY9A 2LVVA 2KPHA 1MWNA 2LLTA 2MJWB 1AUIB 1J7PA 2HPSA 1TNXA 3RLZA 1G8IA 4I5NB 1C3ZA 1QVIZ 1SR6C 2Y1MA 3B88A 4FQTA 1OMRA 1PVAA 2WCEA 3BFAA 4I5JA 1M31A 3OB1B 2CT9A 4PE1A 3SJSA 2FJYA 2ZRTA 3FE6A 2KNEA 3KPXA 2QEVA 4YRUA 5EL2A 1Z4HA 2CCMA 3CYZA 1XA5A 4NDBA 2OS8C 1SKTA 5IBWA 1K9PA 1Y6WA 3IQQA 4CPVA 1DJZA 4HSZA 2MBXA 1BMOA 2KAYA 2WC8A 1XFYO 2KDHA 1UUSA 3IF7A 2LUCA 3R1PA 4TNCA 1UHJA 3DF0A 2KI6D 2BE4A 1WRKA 1S6IA 2OTGC 2JQ6A 2MAZA 2LVKA 5CPVA 1PK0D 1S26D 3EK7A 3HX4A 3I5FB 1K93D 1KFUL 3O2PA 2HQWA 2R2IA 4WRIA 1SNLA 1RJVA 2JZIA 3S0AA 3FWCA 2L98A 3DD4A 3CDNA 1DJGA 5AANA 1C07A 3SS5A 4JWQA 3SG4A 1M46A 3IVTA 1IH0A 1MXEA 1ORGA 2E6WA 1IIOA 1B47A 1GQMA 1GGZA 1W9ZA 2MA2A 2QEOA 3BQ3A 3NGVA 4GNKB 4E68A 3DZTA 4WQ3A 3KF9A 5I2QA 2LMVA 1UHIA 2BBNA 2KYFA 3OX6A 4A4BA 1EH2A 2BCAA 2KBMA 2I2RE 1MUXA 2AMIA 3TDIA 1HT9A 3D73A 2K0JA 4JKTA 1IKUA 2E30A 2NXQA 3E3RA 3CLNA 5DKRA 1KCYA 2WCHA 1IWQA 1OOIX 1DGVA 1QX5B 4MRXA 1YUSA 4PHKA 4YGBB 1OMVA 2F3YA 4PE4A 4M2PA 1EL4A 2JPTA 5I2LA 1WLZA 2GGZA 1PULA 3NXAA 5GQQC 4PCWA 2KI4C 2M97A 4DS7A 2JTTA 1B4CA 4N1FA 1M39A 2F3ZA 3R1VA 4PDZA 4CFRA 2K61A 1LINA 4MEWA 4C0KA 3S0DA 4NDDA 2F2OA 1CM4A 1SCMC 2ZNDA 2L4IA 2VRGA 4KYNA 1NX1A 2MHHA 2Y4QA 2ZN8A 3JVTC 2KHNA 3O4YA 1CFDA 2TN4A 3JTDC 3Q8IA 1B7TZ 1GGWA 2KFFA 2QDIA 1WY9A 1R2UA 5G08A 1UURA 1CB1A 3CZ0A 3FIAA 1HQVA 3RZSA 3DVKA 3L4AA 1CDMA 1LKJA 3DYEA 1KQMB 4MBEA 2JU0A 1B8CA 2P71A 3PN7B 1SL8A 1JFJA 3I5IB 3KO0A 2K2FA 4PALA 3PFVA 2L4HA 1AJ5A 4NQGA 1F8HA 1JWDA 3D77A 5I2OA 3PSRA 1DMOA 1J55A 1SMGA 2H2KA 3SG3A 4OR9B 1NYAA 1QXPA 4Q04A 4M2QA 1MQ1A 3AAKA 2FCEA 5HLOA 5KTYA 2PYQA 5CSFA 4YGCB 5FI6A 2KSPA 1NCYA 3HCMA 1WRZA 2MRDA 3I5HC 3D0YB 5AEQA 4OV2A 2JOJA 2LM5A 2HQ8A 1PVBA 1TIZA 1CDPA 5FI2A 1QASA 4MVFA 1S5GZ 5D7FA 1XK4C 1M45A 1CDNA 4A4CA 1UWOA 1JSAA 1DJYA 4P5OE 3UNWA 4CLNA 2K7OA 5HLVA 2M1UA 2SASA 1MF8B 4YI8A 3CR4X 2NZ0A 1YRTB 4NDCA 1OOGA 1VRKA 5FI7A 1CTRA 5JOLA 2QEBA 1G33A 4GGFA 1V1FA 3CZ2A 1SL7A 1Y0VH 2NLNA 1IJ6A 1J1EA 3BYAA 1B7TY 1F55A 4MN0A 1NIWA 1S3PA 2K7BA 1XFXO 2K8MB 4DRWA 4QJ5B 3CZTX 3VRQA 1BLQA 3OHMB 1NX2A 1B1GA 1PSRA 2EC6B 4AQJA 1SY9A 1K8UA 2GGMA 1XVJA 4JQ0D 3BXKA 2LLSA 1BJFA 1V1GA 1H4BA 1F4QA 1WRLA 3S0BA 2H61A 1NPQA 1NWDA 2JXCA 1UHNA 3B6XA 5HL1A 2JWWA 3F45A 1CDLA 1J7RA 5PALA 1CM1A 1CFPA 1OOJA 1UP5A 2COLB 1BR1B 2M8UA 5K89A 1TUZA 1TCFA 3EKHA 1N0YA 1ZFSA 2CTNA 2SCPA 4P2YB 1EG3A 2EHBA 2LVJA 2M3WA 1CLMA 2PASA 1BT6A 4YI9A 3CZ1A 2LHIA 1IJ5A 3WXAA 1A75A 2LMUA 4YGEB 3SS4A 1EJ3A 3BUNB 2PMYA 1ZMZA 3I5IC 1J7OA 2Y5IA 3O4XA 4BY4A 1OE9B 2PSRA 3S0EA 3FE8A 1NCXA 2K7CA 2KQYA 4USLA 2WC5A 1QX7A 1LVCD 2K7DA 3VRNA 1KSMA 1IRJA 1MR8A 1SRAA 5TNCA 3I5GB 3TS5B 1JC2A 5D69A 1S5GY 2BCBA 5ER5A 1QS7A 1UHKA 2F33A 4INWA 4GUKA 1YRUB 2M49B 3SIBA 4C0LA 5D3OA 3WHTB 3CR5X 1DC1A 1YVLA 1CLLA 4ZCVA 3C1VA 2FJUB 1LA3A 1CLBA 2WCMA 1F70A 5AFPA 2WNDA 1OOHA 2M7NA 3SG2A 1B8LA 3AKBA 4DUQA 1CKKA 1KFUS 3BJHA 2BL0B 4N5XA 3AAJA 3FS7A 1AJ4A 1QIWA 2ZKMX 2M1KB 1F54A 1KSOA 1KWOB 3NSOA 1DF0B 1NP8A 1S1EA 2BE6A 5JJGA 3PATA 1IQ3A 2AUCA 3ZWHA 3GK2A 4PE0A 2WC6A 4GPLB 2FCDA 3KHEA 3SG7A 2LP2A 2BNXA 2M0RA 3TUYB 1RECA 1TRFA 3D0YA 3TDZA 5ER4X 3PALA 2KAVA 2KLEA 2FOTA 2JT3A 2Q4UA 1FPWA 4MRYA 2G2BA 2LHLA 1NCZA 1A75B 2KAXA 2Q91A 1RTP1 3CS1A 3O78A 1SSEB 4HRHA 3CABA 4XJKB 2KYCA 1AK8A 2EGDA 4MZKA 1B9AA 4AQIA 4CIDA 5F6TA 1JUOA 1CFCA 2JRFA 2PVBA 3OB2B 3BOWA 3K1EA 3OBVA 5KSZA 2HF5A 1Y1UA 2B1UA 3B86A 1QLSA 3BFHA 4JD9A 3BUWB 1XFVO 3UO9A 2JC2A 4GFTA 1EG4A 2L2EA 1PRWA 1T14A 1OZSA 2IS9A 2LC5A 2LP3A 4OVNF 1OQPA 2JTZA 5DKQA 1KQVA 1F4OA 1DJWA 2KI6C 3A4UB 5AXIA 1YTZC 3EVUA 4GAOA 4C0JA 1K9KA 3A8RA 1BG1A 2JPOA 1SR6B 1Y1AA 3I5GC 1RK9A 2WCFA 5BPJA 3CR2A 3I5FC 1OW4A 1FI5A 1W7JB 1IQ5A 1DQEA 5CSNA 1ALWA 1YVHA 4ICBA 2LMTA 1TWOA 3R72A 2JT8A 1ZOTB 1ZACA 2MLEC 2ISDA 3D74A 2OS8B 3BUXB 1BF5A 4GGFC 2AAOA 1TN4A 4PE7A 1MHOA 5I8NA 1L7ZA 2BL0C 2OTGB 1S6JA 2RGIA 1NUBA 4OCIA
chains in the Genus database with same CATH topology
3CDNA 3NHTA 3R1OA 1ORGA 3CZ1A 2QEOA 3NGVA 3DZTA 3N7HA 3QMEA 4OZDA 3NHIA 2PQLA 3S0EA 3FE8A 1P28A 3D73A 2WC5A 2QEHA 3BFBA 2WCHA 1OOIX 3S0FA 3S0GA 4INWA 2WCJA 1TUJA 3B7AA 3PJIA 2WCMA 3L47A 1GM0A 3R1VA 1OOHA 1QWVA 3S0DA 5DICA 2ERBA 3BJHA 3DXLA 2L2CA 3Q8IA 2QDIA 3CZ0A 3B87A 4F7FA 1LS8A 2WC6A 1OOFA 3VB1A 3RZSA 3L4AA 3DYEA 2GTEA 2P71A 3D75A 3D78A 2P70A 3D77A 3FE9A 3CABA 3OGNA 2WCKA 1C3YA 3DY9A 2KPHA 3K1EA 3B86A 3BFHA 4JD9A 4PT1A 1C3ZA 3B88A 4FQTA 1T14A 3BFAA 4INXA 1XFRA 2FJYA 2H8VA 3FE6A 2QEVA 3L4LA 5EL2A 3CYZA 2WCLA 2JPOA 1OOGA 2QEBA 1OW4A 3CZ2A 1DQEA 3R1PA 1TWOA 3R72A 3V2LA 3D76A 3D74A 3S0BA 3B6XA 3S0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CDN A;  3NHT A;  3R1O A;  1ORG A;  3CZ1 A;  2QEO A;  3NGV A;  3DZT A;  3N7H A;  3QME A;  4OZD A;  3NHI A;  2PQL A;  3S0E A;  3FE8 A;  1P28 A;  3D73 A;  2WC5 A;  2QEH A;  3BFB A;  2WCH A;  1OOI X;  3S0F A;  3S0G A;  4INW A;  2WCJ A;  1TUJ A;  3B7A A;  3PJI A;  2WCM A;  3L47 A;  1GM0 A;  3R1V A;  1OOH A;  1QWV A;  3S0D A;  5DIC A;  2ERB A;  3BJH A;  3DXL A;  2L2C A;  3Q8I A;  2QDI A;  3CZ0 A;  3B87 A;  4F7F A;  1LS8 A;  2WC6 A;  1OOF A;  3VB1 A;  3RZS A;  3L4A A;  3DYE A;  2GTE A;  2P71 A;  3D75 A;  3D78 A;  2P70 A;  3D77 A;  3FE9 A;  3CAB A;  3OGN A;  2WCK A;  1C3Y A;  3DY9 A;  2KPH A;  3K1E A;  3B86 A;  3BFH A;  4JD9 A;  4PT1 A;  1C3Z A;  3B88 A;  4FQT A;  1T14 A;  3BFA A;  4INX A;  1XFR A;  2FJY A;  2H8V A;  3FE6 A;  2QEV A;  3L4L A;  5EL2 A;  3CYZ A;  2WCL A;  2JPO A;  1OOG A;  2QEB A;  1OW4 A;  3CZ2 A;  1DQE A;  3R1P A;  1TWO A;  3R72 A;  3V2L A;  3D76 A;  3D74 A;  3S0B A;  3B6X A;  3S0A A; 
#chains in the Genus database with same CATH topology
 3WHU B;  1KFX L;  1KK7 Z;  2ZNE A;  3FWB A;  2H61 C;  4CFQ A;  1RRO A;  1XYD A;  2WOS A;  3QRX A;  1G4Y R;  3M0W A;  5I94 A;  1WDC B;  3N7H A;  3QME A;  4OZD A;  1YUR A;  3BOW B;  2KLD A;  4MLW A;  2PQL A;  1FW4 A;  1P28 A;  2WCB A;  2KQ6 A;  4BY5 A;  1DF0 A;  2BKH B;  3EK8 A;  3NSL A;  1U5I B;  1ZUZ A;  3S0F A;  4AOM A;  1S36 A;  1YX8 A;  4GGN A;  4I5L B;  1QTX A;  3LK0 A;  4U8D A;  2A4J A;  3B7A A;  4PHJ A;  1K90 D;  3K21 A;  4QJ4 B;  5KU1 A;  4ORB B;  4XYN A;  1DTL A;  1GM0 A;  1QX2 A;  1SPY A;  1QWV A;  1DT7 B;  1IGV A;  1SBJ A;  3O6B A;  4ORA B;  3MSE B;  5DIC A;  2ERB A;  1KQM C;  2M9G A;  3OX5 A;  2YGU A;  3SIA A;  1K95 A;  2KBI A;  1XO5 A;  3PN7 C;  2L2C A;  2LE9 B;  1QJT A;  3LCP C;  4XJK A;  1YR5 A;  2KI4 B;  1CMF A;  1D1O A;  2NCP A;  5CSJ A;  3B87 A;  4ORC B;  3IQO A;  4F7F A;  2DOQ A;  2L0P A;  2L50 A;  1PAL A;  2QPT A;  1YUU A;  4FTG A;  2ZN9 A;  1SCM B;  1AP4 A;  1A29 A;  2LVI A;  2O60 A;  3LK1 A;  2GTE A;  3JVT B;  1A4P A;  1XFW O;  3D75 A;  3ZNI A;  3NSK A;  3JTD B;  2WOR A;  1BU3 A;  1KK7 Y;  1J1D A;  4WQ2 A;  2P70 A;  3GOF A;  3DVM A;  1CFF A;  2CXJ A;  1TOP A;  1PSB A;  2MLF C;  3AKA A;  3FE9 A;  3PLF B;  2KFH A;  1CMG A;  2HET A;  2BKI B;  2BCX A;  1QAT A;  1DEK A;  4DIR A;  1NSH A;  1J7Q A;  1Q80 A;  2JNF A;  4PHM A;  5J3X A;  1JFK A;  1A03 A;  1LA0 A;  5AER A;  2L5Y A;  3GK4 X;  2K60 A;  1RWY A;  2OPO A;  1ALV A;  2I7A A;  3CWG A;  3SS3 A;  4PT1 A;  3TDU A;  1SYM A;  3EVR A;  1AHR A;  2CBL A;  1Z2C B;  2PAL A;  1WDC C;  4INX A;  4MZL A;  1XFR A;  1XFZ O;  4QJ3 B;  2H8V A;  2M7L A;  3KEV A;  1K2H A;  3L4L A;  3NSI A;  3I5H B;  2D8N A;  2LCP A;  1N65 A;  2V53 A;  2WCL A;  4ETO A;  2EC6 C;  1C7W A;  2KOT A;  3OP0 A;  5B8I B;  1KK8 B;  2K2A A;  2L51 A;  2GV5 A;  1TNQ A;  5HKW A;  1XFU O;  1GJY A;  1MXL C;  2BBM A;  1YUT A;  4IJ7 A;  1L2O B;  2ZRS A;  1FI6 A;  1NX0 A;  2I18 A;  3RM1 A;  3V2L A;  4L9M A;  1X02 A;  2KGB C;  1AVS A;  3D76 A;  4F0Z B;  1JBA A;  1QIV A;  3LL8 B;  1QVI Y;  1LXF C;  2L5X B;  1FF1 A;  2M29 A;  1B8R A;  5DKN A;  4DCK A;  1SW8 A;  1H8B A;  1ODB A;  2F8P A;  1M63 B;  1U5I A;  2LLU A;  3DVE A;  1QV0 A;  4MSP A;  4R1E A;  1QLK A;  1N2D A;  1SL9 A;  3NHT A;  2G9B A;  4N1G A;  5FYX A;  3R1O A;  3SG6 A;  4YGD B;  2PRU A;  3EK4 A;  3LLE A;  4GBA A;  4HRE E;  3SG5 A;  3DF0 B;  4UPG A;  3TS5 C;  1NX3 A;  4JPZ B;  3NHI A;  3EG5 B;  3VRP A;  2P6B B;  3CTN A;  2JNX A;  1S6C A;  3ICB A;  4M2O A;  4OKH A;  4FQO A;  5HYD A;  2QEH A;  3BFB A;  3PM8 A;  1CNP A;  1F71 A;  1OZO A;  2LUX A;  2LNK A;  1R6P A;  1K9U A;  3S0G A;  1C7V A;  2KGR A;  3EKJ A;  1TTX A;  2LV7 A;  1SCV A;  1TUJ A;  2WCJ A;  3PJI A;  1RFJ A;  2CNP A;  1KWO C;  3PM2 A;  1E8A A;  2JT0 A;  2O5G A;  2Y1N A;  3L47 A;  3VRR A;  3VGO A;  3VRO A;  2NCO A;  1DGU A;  4MZJ A;  1TNP A;  4PHN A;  1OMD A;  3TUY C;  1A2X A;  4YBH B;  2I94 A;  4ZCU A;  2KFG A;  3WNX B;  4D1E A;  5HKY A;  3DXL A;  1DJI A;  1DJH A;  1W7I B;  1JF0 A;  2LAN A;  1JF2 A;  1DVI A;  2BAP A;  3GK1 A;  1TCO B;  1K96 A;  1LS8 A;  1KFX S;  1QV1 A;  3BUO B;  4HRG A;  1OOF A;  3VB1 A;  1EXR A;  1DJX A;  1FBV A;  1BOD A;  1IG5 A;  1KK8 C;  1WLM A;  3DVJ A;  1DEL A;  4I5K A;  2BEC A;  1K94 A;  4YGA A;  1YX7 A;  2F2P A;  4IL1 A;  1BR4 B;  1L2O C;  2QAC A;  3H4S E;  2JUL A;  3D78 A;  1BOC A;  5CSI A;  3D10 A;  3EVV A;  3TZ1 A;  1UHH A;  3BUM B;  1TNW A;  1SK6 D;  2JXL A;  2LAP A;  5HKZ A;  3OGN A;  2ZFD A;  2WCK A;  1OSA A;  1XK4 A;  3CGA A;  1C3Y A;  1Y1X A;  3DY9 A;  2LVV A;  2KPH A;  1MWN A;  2LLT A;  2MJW B;  1AUI B;  1J7P A;  2HPS A;  1TNX A;  3RLZ A;  1G8I A;  4I5N B;  1C3Z A;  1QVI Z;  1SR6 C;  2Y1M A;  3B88 A;  4FQT A;  1OMR A;  1PVA A;  2WCE A;  3BFA A;  4I5J A;  1M31 A;  3OB1 B;  2CT9 A;  4PE1 A;  3SJS A;  2FJY A;  2ZRT A;  3FE6 A;  2KNE A;  3KPX A;  2QEV A;  4YRU A;  5EL2 A;  1Z4H A;  2CCM A;  3CYZ A;  1XA5 A;  4NDB A;  2OS8 C;  1SKT A;  5IBW A;  1K9P A;  1Y6W A;  3IQQ A;  4CPV A;  1DJZ A;  4HSZ A;  2MBX A;  1BMO A;  2KAY A;  2WC8 A;  1XFY O;  2KDH A;  1UUS A;  3IF7 A;  2LUC A;  3R1P A;  4TNC A;  1UHJ A;  3DF0 A;  2KI6 D;  2BE4 A;  1WRK A;  1S6I A;  2OTG C;  2JQ6 A;  2MAZ A;  2LVK A;  5CPV A;  1PK0 D;  1S26 D;  3EK7 A;  3HX4 A;  3I5F B;  1K93 D;  1KFU L;  3O2P A;  2HQW A;  2R2I A;  4WRI A;  1SNL A;  1RJV A;  2JZI A;  3S0A A;  3FWC A;  2L98 A;  3DD4 A;  3CDN A;  1DJG A;  5AAN A;  1C07 A;  3SS5 A;  4JWQ A;  3SG4 A;  1M46 A;  3IVT A;  1IH0 A;  1MXE A;  1ORG A;  2E6W A;  1IIO A;  1B47 A;  1GQM A;  1GGZ A;  1W9Z A;  2MA2 A;  2QEO A;  3BQ3 A;  3NGV A;  4GNK B;  4E68 A;  3DZT A;  4WQ3 A;  3KF9 A;  5I2Q A;  2LMV A;  1UHI A;  2BBN A;  2KYF A;  3OX6 A;  4A4B A;  1EH2 A;  2BCA A;  2KBM A;  2I2R E;  1MUX A;  2AMI A;  3TDI A;  1HT9 A;  3D73 A;  2K0J A;  4JKT A;  1IKU A;  2E30 A;  2NXQ A;  3E3R A;  3CLN A;  5DKR A;  1KCY A;  2WCH A;  1IWQ A;  1OOI X;  1DGV A;  1QX5 B;  4MRX A;  1YUS A;  4PHK A;  4YGB B;  1OMV A;  2F3Y A;  4PE4 A;  4M2P A;  1EL4 A;  2JPT A;  5I2L A;  1WLZ A;  2GGZ A;  1PUL A;  3NXA A;  5GQQ C;  4PCW A;  2KI4 C;  2M97 A;  4DS7 A;  2JTT A;  1B4C A;  4N1F A;  1M39 A;  2F3Z A;  3R1V A;  4PDZ A;  4CFR A;  2K61 A;  1LIN A;  4MEW A;  4C0K A;  3S0D A;  4NDD A;  2F2O A;  1CM4 A;  1SCM C;  2ZND A;  2L4I A;  2VRG A;  4KYN A;  1NX1 A;  2MHH A;  2Y4Q A;  2ZN8 A;  3JVT C;  2KHN A;  3O4Y A;  1CFD A;  2TN4 A;  3JTD C;  3Q8I A;  1B7T Z;  1GGW A;  2KFF A;  2QDI A;  1WY9 A;  1R2U A;  5G08 A;  1UUR A;  1CB1 A;  3CZ0 A;  3FIA A;  1HQV A;  3RZS A;  3DVK A;  3L4A A;  1CDM A;  1LKJ A;  3DYE A;  1KQM B;  4MBE A;  2JU0 A;  1B8C A;  2P71 A;  3PN7 B;  1SL8 A;  1JFJ A;  3I5I B;  3KO0 A;  2K2F A;  4PAL A;  3PFV A;  2L4H A;  1AJ5 A;  4NQG A;  1F8H A;  1JWD A;  3D77 A;  5I2O A;  3PSR A;  1DMO A;  1J55 A;  1SMG A;  2H2K A;  3SG3 A;  4OR9 B;  1NYA A;  1QXP A;  4Q04 A;  4M2Q A;  1MQ1 A;  3AAK A;  2FCE A;  5HLO A;  5KTY A;  2PYQ A;  5CSF A;  4YGC B;  5FI6 A;  2KSP A;  1NCY A;  3HCM A;  1WRZ A;  2MRD A;  3I5H C;  3D0Y B;  5AEQ A;  4OV2 A;  2JOJ A;  2LM5 A;  2HQ8 A;  1PVB A;  1TIZ A;  1CDP A;  5FI2 A;  1QAS A;  4MVF A;  1S5G Z;  5D7F A;  1XK4 C;  1M45 A;  1CDN A;  4A4C A;  1UWO A;  1JSA A;  1DJY A;  4P5O E;  3UNW A;  4CLN A;  2K7O A;  5HLV A;  2M1U A;  2SAS A;  1MF8 B;  4YI8 A;  3CR4 X;  2NZ0 A;  1YRT B;  4NDC A;  1OOG A;  1VRK A;  5FI7 A;  1CTR A;  5JOL A;  2QEB A;  1G33 A;  4GGF A;  1V1F A;  3CZ2 A;  1SL7 A;  1Y0V H;  2NLN A;  1IJ6 A;  1J1E A;  3BYA A;  1B7T Y;  1F55 A;  4MN0 A;  1NIW A;  1S3P A;  2K7B A;  1XFX O;  2K8M B;  4DRW A;  4QJ5 B;  3CZT X;  3VRQ A;  1BLQ A;  3OHM B;  1NX2 A;  1B1G A;  1PSR A;  2EC6 B;  4AQJ A;  1SY9 A;  1K8U A;  2GGM A;  1XVJ A;  4JQ0 D;  3BXK A;  2LLS A;  1BJF A;  1V1G A;  1H4B A;  1F4Q A;  1WRL A;  3S0B A;  2H61 A;  1NPQ A;  1NWD A;  2JXC A;  1UHN A;  3B6X A;  5HL1 A;  2JWW A;  3F45 A;  1CDL A;  1J7R A;  5PAL A;  1CM1 A;  1CFP A;  1OOJ A;  1UP5 A;  2COL B;  1BR1 B;  2M8U A;  5K89 A;  1TUZ A;  1TCF A;  3EKH A;  1N0Y A;  1ZFS A;  2CTN A;  2SCP A;  4P2Y B;  1EG3 A;  2EHB A;  2LVJ A;  2M3W A;  1CLM A;  2PAS A;  1BT6 A;  4YI9 A;  3CZ1 A;  2LHI A;  1IJ5 A;  3WXA A;  1A75 A;  2LMU A;  4YGE B;  3SS4 A;  1EJ3 A;  3BUN B;  2PMY A;  1ZMZ A;  3I5I C;  1J7O A;  2Y5I A;  3O4X A;  4BY4 A;  1OE9 B;  2PSR A;  3S0E A;  3FE8 A;  1NCX A;  2K7C A;  2KQY A;  4USL A;  2WC5 A;  1QX7 A;  1LVC D;  2K7D A;  3VRN A;  1KSM A;  1IRJ A;  1MR8 A;  1SRA A;  5TNC A;  3I5G B;  3TS5 B;  1JC2 A;  5D69 A;  1S5G Y;  2BCB A;  5ER5 A;  1QS7 A;  1UHK A;  2F33 A;  4INW A;  4GUK A;  1YRU B;  2M49 B;  3SIB A;  4C0L A;  5D3O A;  3WHT B;  3CR5 X;  1DC1 A;  1YVL A;  1CLL A;  4ZCV A;  3C1V A;  2FJU B;  1LA3 A;  1CLB A;  2WCM A;  1F70 A;  5AFP A;  2WND A;  1OOH A;  2M7N A;  3SG2 A;  1B8L A;  3AKB A;  4DUQ A;  1CKK A;  1KFU S;  3BJH A;  2BL0 B;  4N5X A;  3AAJ A;  3FS7 A;  1AJ4 A;  1QIW A;  2ZKM X;  2M1K B;  1F54 A;  1KSO A;  1KWO B;  3NSO A;  1DF0 B;  1NP8 A;  1S1E A;  2BE6 A;  5JJG A;  3PAT A;  1IQ3 A;  2AUC A;  3ZWH A;  3GK2 A;  4PE0 A;  2WC6 A;  4GPL B;  2FCD A;  3KHE A;  3SG7 A;  2LP2 A;  2BNX A;  2M0R A;  3TUY B;  1REC A;  1TRF A;  3D0Y A;  3TDZ A;  5ER4 X;  3PAL A;  2KAV A;  2KLE A;  2FOT A;  2JT3 A;  2Q4U A;  1FPW A;  4MRY A;  2G2B A;  2LHL A;  1NCZ A;  1A75 B;  2KAX A;  2Q91 A;  1RTP 1;  3CS1 A;  3O78 A;  1SSE B;  4HRH A;  3CAB A;  4XJK B;  2KYC A;  1AK8 A;  2EGD A;  4MZK A;  1B9A A;  4AQI A;  4CID A;  5F6T A;  1JUO A;  1CFC A;  2JRF A;  2PVB A;  3OB2 B;  3BOW A;  3K1E A;  3OBV A;  5KSZ A;  2HF5 A;  1Y1U A;  2B1U A;  3B86 A;  1QLS A;  3BFH A;  4JD9 A;  3BUW B;  1XFV O;  3UO9 A;  2JC2 A;  4GFT A;  1EG4 A;  2L2E A;  1PRW A;  1T14 A;  1OZS A;  2IS9 A;  2LC5 A;  2LP3 A;  4OVN F;  1OQP A;  2JTZ A;  5DKQ A;  1KQV A;  1F4O A;  1DJW A;  2KI6 C;  3A4U B;  5AXI A;  1YTZ C;  3EVU A;  4GAO A;  4C0J A;  1K9K A;  3A8R A;  1BG1 A;  2JPO A;  1SR6 B;  1Y1A A;  3I5G C;  1RK9 A;  2WCF A;  5BPJ A;  3CR2 A;  3I5F C;  1OW4 A;  1FI5 A;  1W7J B;  1IQ5 A;  1DQE A;  5CSN A;  1ALW A;  1YVH A;  4ICB A;  2LMT A;  1TWO A;  3R72 A;  2JT8 A;  1ZOT B;  1ZAC A;  2MLE C;  2ISD A;  3D74 A;  2OS8 B;  3BUX B;  1BF5 A;  4GGF C;  2AAO A;  1TN4 A;  4PE7 A;  1MHO A;  5I8N A;  1L7Z A;  2BL0 C;  2OTG B;  1S6J A;  2RGI A;  1NUB A;  4OCI A; 
#chains in the Genus database with same CATH homology
 3CDN A;  3NHT A;  3R1O A;  1ORG A;  3CZ1 A;  2QEO A;  3NGV A;  3DZT A;  3N7H A;  3QME A;  4OZD A;  3NHI A;  2PQL A;  3S0E A;  3FE8 A;  1P28 A;  3D73 A;  2WC5 A;  2QEH A;  3BFB A;  2WCH A;  1OOI X;  3S0F A;  3S0G A;  4INW A;  2WCJ A;  1TUJ A;  3B7A A;  3PJI A;  2WCM A;  3L47 A;  1GM0 A;  3R1V A;  1OOH A;  1QWV A;  3S0D A;  5DIC A;  2ERB A;  3BJH A;  3DXL A;  2L2C A;  3Q8I A;  2QDI A;  3CZ0 A;  3B87 A;  4F7F A;  1LS8 A;  2WC6 A;  1OOF A;  3VB1 A;  3RZS A;  3L4A A;  3DYE A;  2GTE A;  2P71 A;  3D75 A;  3D78 A;  2P70 A;  3D77 A;  3FE9 A;  3CAB A;  3OGN A;  2WCK A;  1C3Y A;  3DY9 A;  2KPH A;  3K1E A;  3B86 A;  3BFH A;  4JD9 A;  4PT1 A;  1C3Z A;  3B88 A;  4FQT A;  1T14 A;  3BFA A;  4INX A;  1XFR A;  2FJY A;  2H8V A;  3FE6 A;  2QEV A;  3L4L A;  5EL2 A;  3CYZ A;  2WCL A;  2JPO A;  1OOG A;  2QEB A;  1OW4 A;  3CZ2 A;  1DQE A;  3R1P A;  1TWO A;  3R72 A;  3V2L A;  3D76 A;  3D74 A;  3S0B A;  3B6X A;  3S0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...