3FE8A

Crystal structure of a pheromone binding protein from apis mellifera with a serendipitous ligand soaked at ph 4.0
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
119
structure length
119
Chain Sequence
b'APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH induced domain-swapping favors pheromone release
rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 44
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3fe8A00
3DYEA 3FE8A 2PQLA 1OOFA 5DICA 1TUJA 3VB1A 5EL2A 3CYZA 3NGVA 3NHIA 2ERBA 3FE9A 3CABA 3CZ2A 3B6XA 3BJHA 3QMEA 1T14A 3L4AA 3S0FA 4INXA 3FE6A 3L47A 4JD9A 2WCJA 3N7HA 3CDNA 1QWVA 2FJYA 1OW4A 3R72A 3B87A 3S0DA 2WCKA 2P71A 3DXLA 2WCHA 1XFRA 3D74A 2WC6A 3BFAA 3D75A 3S0AA 2P70A 3B86A 3V2LA 3D73A 3DZTA 2QEHA 2QEBA 1DQEA 1GM0A 2KPHA 3D78A 2QDIA 3R1OA 1ORGA 2L2CA 3RZSA 2QEOA 3BFHA 3CZ1A 2JPOA 3K1EA 4OZDA 3L4LA 2WC5A 4INWA 1OOHA 3S0GA 3PJIA 3B7AA 3S0EA 4FQTA 3D76A 1OOIX 2WCLA 3CZ0A 4F7FA 2WCMA 3B88A 2H8VA 3R1VA 1C3YA 3R1PA 3BFBA 2QEVA 1TWOA 1OOGA 4PT1A 2GTEA 3DY9A 1P28A 3OGNA 3S0BA 3Q8IA 3NHTA 3D77A 1C3ZA 1LS8A
chains in the Genus database with same CATH superfamily
2ISDA 2BCXA 1OOFA 4YBHB 4MEWA 1ZMZA 5DICA 1YUUA 4YGAA 2M7LA 2YGUA 3CYZA 4KYNA 1AHRA 1B8RA 2MA2A 2NCOA 1ODBA 1UHNA 1YRTB 1KWOB 3O6BA 3NHIA 2M3WA 1V1GA 2JZIA 5I94A 1TUZA 2M1KB 1QLSA 1J7OA 1XYDA 3B6XA 4UPGA 1DTLA 1T14A 2LMTA 1CDNA 4N1GA 1YR5A 1PRWA 4PE7A 2P6BB 4INXA 1OMVA 1XO5A 3FE6A 2WCJA 5I2LA 1WLMA 1J7RA 3CDNA 4QJ3B 3AKBA 1SL9A 2FJYA 1R2UA 3I5IB 1B7TY 1IWQA 3I5FB 1PULA 3IF7A 2KLEA 1F70A 2KBMA 5HL1A 2G9BA 1RWYA 1KK7Y 4GUKA 4PHNA 1TCFA 2P71A 1UHHA 2MRDA 4YGBB 1A2XA 1WDCB 1XFRA 2LM5A 1DJXA 4AOMA 2KAVA 2PSRA 1CLBA 1KWOC 1CFCA 1CFDA 1RROA 4JQ0D 2WC8A 1ZACA 3LK0A 1S3PA 3EK4A 1QX2A 2OS8B 2LMVA 3PFVA 3B86A 3OB1B 1BT6A 2HQ8A 1Z2CB 4D1EA 3D73A 2QEHA 4PCWA 2JTZA 4USLA 1JUOA 1DQEA 2KFHA 5FYXA 1NCXA 3CR4X 2QACA 5G08A 3GK1A 4NQGA 1S5GZ 3LL8B 2KAXA 2K8MB 2LAPA 2KNEA 2L2CA 3I5IC 4DRWA 2EC6B 2QEOA 1QXPA 2SCPA 3CR5X 3PSRA 2KLDA 2OTGC 2ZN9A 3BFHA 1PSRA 5JJGA 1CDLA 4OV2A 1SW8A 1NWDA 5F6TA 5KU1A 1WDCC 1CNPA 2PMYA 1J7PA 4ORCB 1WRLA 2MLFC 4I5JA 1QIWA 1FI5A 2GGZA 4DIRA 3KPXA 1GGWA 1OE9B 1XFWO 5D3OA 3TDIA 1U5IA 1YURA 1BODA 1SKTA 4P5OE 2OS8C 2KOTA 3FWCA 1EJ3A 1SK6D 2EGDA 2IS9A 3CLNA 3PJIA 4FTGA 4C0KA 4U8DA 3EVRA 4IL1A 1IQ3A 4DS7A 4WQ3A 2M0RA 4BY5A 1GQMA 5IBWA 2E6WA 1F4OA 4AQIA 2BL0B 1SPYA 1SMGA 1SR6C 1CKKA 2M9GA 3CWGA 1C3YA 5AEQA 1MR8A 1VRKA 5BPJA 3AAKA 3R1PA 3SS3A 1TRFA 2LLUA 2EC6C 1U5IB 3BFBA 2B1UA 2WOSA 3FS7A 3I5GB 3OBVA 4TNCA 3VRRA 4HREE 1JF2A 3BUOB 2HPSA 2BE4A 2KI4B 5AANA 1F55A 1S6CA 1A75B 2KI6C 3EKHA 3OGNA 3DD4A 4CIDA 2TN4A 1QVIZ 4ICBA 2Y1NA 1AJ5A 1J7QA 2L2EA 3Q8IA 3EK7A 5FI7A 3SG4A 1C3ZA 4QJ4B 1EXRA 1CFPA 4YGCB 1TNWA 1MQ1A 5DKNA 2JT3A 4MZJA 2K2AA 1NIWA 1TUJA 2ZNDA 4BY4A 1JF0A 2K7DA 1W9ZA 2ZN8A 2MLEC 3WXAA 4YGEB 2WCEA 1M46A 5D7FA 1K9PA 2ERBA 1H4BA 3JTDB 1TCOB 1G4YR 1RTP1 1TOPA 2Q4UA 3CABA 2DOQA 1BJFA 3CZ2A 1NX3A 2LMUA 1MXLC 2FCDA 1RECA 1N65A 1DELA 4GGFC 1DJGA 3LLEA 1Y1AA 4M2QA 4PE1A 3I5GC 1TIZA 4CFRA 3L4AA 5CSNA 2JNFA 4PE0A 4CFQA 3S0FA 3L47A 1K94A 1M39A 2KBIA 3N7HA 4MBEA 2D8NA 1QWVA 1QX7A 3DVEA 4GNKB 3TZ1A 1L2OB 4OR9B 1PALA 2GGMA 4YRUA 1AP4A 1J1DA 2L4IA 1LXFC 3B87A 3S0DA 2NLNA 3ZWHA 2LLSA 3O78A 1W7JB 2LP2A 2QPTA 4JPZB 1V1FA 1MUXA 1A4PA 1HQVA 3SJSA 2G2BA 2WC6A 5KTYA 1YTZC 1CMFA 2K7OA 3S0AA 3SG3A 2CXJA 3OB2B 1N2DA 2JOJA 1EL4A 1KFUL 2BBMA 1GM0A 4PE4A 2SASA 3PN7B 1Y1UA 2KPHA 1GGZA 1XK4A 1EG3A 4PDZA 5AXIA 2LVIA 2QDIA 3EVUA 1DT7B 1L2OC 1ORGA 3RZSA 4AQJA 2R2IA 4XYNA 1DEKA 3NSLA 1B1GA 2PYQA 3DVJA 1FI6A 3I5HB 1QV0A 3IQOA 2CNPA 1QLKA 2Q91A 1KSMA 2LUCA 1MF8B 5TNCA 1AJ4A 5FI6A 4OZDA 1N0YA 3L4LA 2Y4QA 3KHEA 4MVFA 5J3XA 1G8IA 1CLMA 1RJVA 1KK7Z 1ZUZA 2WC5A 3CZTX 2M49B 4MSPA 1KK8B 4OCIA 5CSFA 2BNXA 1MXEA 1SCMB 1SL8A 1YX7A 2HF5A 4YGDB 2FOTA 1YVHA 4HSZA 1Q80A 4PALA 1XFXO 3D76A 3CZ0A 1DMOA 1XA5A 4F7FA 1YVLA 5I8NA 1DC1A 3RLZA 1SNLA 2Y5IA 1XFYO 2WCMA 3BYAA 1IIOA 3B88A 2H8VA 3I5FC 3R1VA 4M2PA 5JOLA 1TTXA 2ZRSA 1Y6WA 3BXKA 2LVKA 2BBNA 3WHUB 1DVIA 1B8LA 1SYMA 3GOFA 5ER5A 5HKYA 1CTRA 1IQ5A 2KFGA 1TN4A 2QEVA 2MJWB 1SRAA 1NX2A 1QIVA 5HKWA 3NSIA 3DY9A 4FQOA 4CPVA 3I5HC 2CT9A 1QX5B 2ZNEA 4L9MA 1ZFSA 2JXLA 3S0BA 1DGUA 1Y0VH 1QS7A 1Y1XA 2BAPA 3PATA 2HQWA 3PLFB 1GJYA 3OHMB 2H2KA 3JVTB 2PASA 1OSAA 1OMDA 2PQLA 1K9UA 3SG2A 1TNXA 1B9AA 2WORA 1KK8C 3GK4X 5DKRA 3WHTB 3VB1A 1SCMC 3H4SE 5EL2A 1G33A 3AKAA 4R1EA 1NSHA 4WRIA 3HCMA 4I5KA 1CM1A 1DJWA 1KSOA 1TNQA 3BUWB 4N1FA 3VROA 4A4CA 1D1OA 3F45A 2LNKA 2PALA 3SS5A 2MHHA 3BOWA 1S26D 4NDBA 4YI8A 2K61A 3BUNB 2BKHB 4PHJA 3QMEA 1IG5A 2LP3A 1NCYA 2JRFA 2JWWA 1S36A 3D10A 5CPVA 2O5GA 2KQ6A 1CLLA 2F8PA 2LVJA 2E30A 3HX4A 3FIAA 2COLB 3BQ3A 1OW4A 3BOWB 4MRYA 3R72A 4WQ2A 2JT0A 5FI2A 1AVSA 2F2OA 3UO9A 1K90D 2KAYA 1FF1A 3JVTC 1K96A 3DXLA 2K60A 1LINA 1R6PA 2CTNA 1YRUB 2WCHA 2JU0A 2ZKMX 4DUQA 4E68A 1LVCD 2BL0C 2L98A 1XFZO 2KDHA 3BFAA 1JBAA 2I18A 3EK8A 2KGBC 3D75A 3VRQA 2PVBA 2WCFA 4ORBB 1JSAA 1H8BA 2F33A 2PRUA 2LUXA 4MLWA 1BR1B 1NX1A 2KI4C 3DZTA 3D0YA 2QEBA 2O60A 2F3YA 2GV5A 2LHIA 1RK9A 5HLOA 2NCPA 1M45A 2M7NA 2M29A 4ORAB 2BE6A 1WY9A 4N5XA 5K89A 1LA0A 2L5XB 1YUTA 3DF0A 1DJZA 2JT8A 2JPOA 1JC2A 1F8HA 2FJUB 2LC5A 2BCAA 3OP0A 3SIBA 2H61A 1RFJA 3CR2A 2LLTA 1NCZA 1DF0A 1SY9A 3JTDC 1UWOA 2F3ZA 2KSPA 4MRXA 1YX8A 4DCKA 5KSZA 1C07A 1KQVA 4GPLB 1NX0A 4PHKA 2NXQA 3SIAA 3TS5B 3TUYB 2I7AA 3O4XA 2L50A 2MBXA 1IRJA 2WNDA 5CSIA 5D69A 1B8CA 3DF0B 3S0GA 2I94A 3B7AA 1OZOA 2I2RE 4I5LB 2WCLA 4JWQA 2JPTA 3BUXB 1UUSA 1PK0D 2F2PA 1OQPA 1Z4HA 1DF0B 2OPOA 3ICBA 3OX5A 1QATA 2LCPA 2ZRTA 3IVTA 5AFPA 1J1EA 4F0ZB 1F4QA 1UURA 2LHLA 4GFTA 1OOGA 3EVVA 3QRXA 1B47A 2LV7A 3KO0A 1XFUO 5I2QA 3PALA 3RM1A 1NUBA 2V53A 1B7TZ 1P28A 4NDCA 3NXAA 4MZLA 3GK2A 3SS4A 2AMIA 1ALVA 1KQMB 1S6IA 2K0JA 3LK1A 3D77A 1BMOA 2VRGA 3BUMB 1FPWA 3SG6A 2A4JA 1LA3A 1S6JA 1LS8A 1X02A 1JFKA 2L5YA 3MSEB 2OTGB 3DYEA 3FE8A 4IJ7A 3TS5C 1KFUS 3CS1A 2JULA 3TUYC 2AAOA 2KYFA 4M2OA 1E8AA 4GAOA 3TDUA 1QASA 5PALA 2BECA 1UHJA 1DJHA 3NGVA 1EH2A 4C0LA 3PN7C 4OKHA 2H61C 2AUCA 2L51A 3FE9A 4GGNA 4ZCUA 1ALWA 1S5GY 4I5NB 3PM8A 1AK8A 2HETA 3BJHA 3WNXB 1BU3A 1PVBA 1BOCA 1C7WA 1XVJA 2K2FA 3C1VA 2L0PA 4C0JA 3PM2A 1YUSA 1C7VA 3O2PA 4JD9A 5HLVA 3VRNA 1FBVA 1QV1A 1B4CA 4Q04A 3M0WA 4P2YB 1XK4C 3A4UB 2JTTA 2Y1MA 4JKTA 4YI9A 1SR6B 2KYCA 1CB1A 1IKUA 1KQMC 2JC2A 1SL7A 1KCYA 2WCKA 4A4BA 2M8UA 1K8UA 1HT9A 2K7BA 3DVMA 4ZCVA 1TNPA 4ETOA 1NP8A 3D74A 1NYAA 2ZFDA 1F71A 1IJ5A 3E3RA 2WCBA 5HYDA 1MHOA 3SG7A 1PSBA 1A29A 1UHKA 2JQ6A 2JXCA 1QJTA 3SG5A 1L7ZA 2NZ0A 3EG5B 3FWBA 5GQQC 2P70A 4GGFA 4PHMA 3V2LA 2K7CA 2KQYA 3CGAA 1PVAA 2KHNA 1K95A 1BR4B 2KFFA 5ER4X 1A75A 2LE9B 1IH0A 3AAJA 3EKJA 3DVKA 1QVIY 3ZNIA 1SSEB 2BKIB 3D78A 3OX6A 3R1OA 2LVVA 1KFXL 2LANA 4MZKA 4XJKA 1J55A 5HKZA 2L4HA 1OOJA 3CZ1A 1MWNA 4GBAA 3IQQA 3TDZA 3NSOA 3KF9A 4HRGA 1FW4A 2BCBA 2KI6D 3K1EA 2MAZA 2RGIA 1CDPA 1CFFA 1UHIA 3UNWA 1UP5A 1S1EA 2M97A 2M1UA 1A03A 1SBJA 1JFJA 3LCPC 2FCEA 1ZOTB 4XJKB 1K2HA 1IJ6A 2CCMA 1BLQA 1M31A 4INWA 1OOHA 2EHBA 5B8IB 5CSJA 1IGVA 3S0EA 4FQTA 1OMRA 4CLNA 1DJIA 4OVNF 1QTXA 1OOIX 5DKQA 1K93D 3NSKA 3K21A 2JNXA 1KFXS 4HRHA 1W7IB 5I2OA 1CDMA 1BF5A 1M63B 1TWOA 1JWDA 3D0YB 1OZSA 4QJ5B 1BG1A 4PT1A 2GTEA 1WRKA 3VGOA 1NPQA 1F54A 1WRZA 1LKJA 3A8RA 1CMGA 1EG4A 3VRPA 1K9KA 3O4YA 2CBLA 1DGVA 1AUIB 5AERA 3KEVA 1CM4A 3NHTA 1SCVA 4MN0A 3CTNA 1DJYA 4NDDA 1WLZA 1XFVO 2KGRA
chains in the Genus database with same CATH topology
3DYEA 3FE8A 2PQLA 1OOFA 5DICA 1TUJA 3VB1A 5EL2A 3CYZA 3NGVA 3NHIA 2ERBA 3FE9A 3CABA 3CZ2A 3B6XA 3BJHA 3QMEA 1T14A 3L4AA 3S0FA 4INXA 3FE6A 3L47A 4JD9A 2WCJA 3N7HA 3CDNA 1QWVA 2FJYA 1OW4A 3R72A 3B87A 3S0DA 2WCKA 2P71A 3DXLA 2WCHA 1XFRA 3D74A 2WC6A 3BFAA 3D75A 3S0AA 2P70A 3B86A 3V2LA 3D73A 3DZTA 2QEHA 2QEBA 1DQEA 1GM0A 2KPHA 3D78A 2QDIA 3R1OA 1ORGA 2L2CA 3RZSA 2QEOA 3BFHA 3CZ1A 2JPOA 3K1EA 4OZDA 3L4LA 2WC5A 4INWA 1OOHA 3S0GA 3PJIA 3B7AA 3S0EA 4FQTA 3D76A 1OOIX 2WCLA 3CZ0A 4F7FA 2WCMA 3B88A 2H8VA 3R1VA 1C3YA 3R1PA 3BFBA 2QEVA 1TWOA 1OOGA 4PT1A 2GTEA 3DY9A 1P28A 3OGNA 3S0BA 3Q8IA 3NHTA 3D77A 1C3ZA 1LS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DYE A;  3FE8 A;  2PQL A;  1OOF A;  5DIC A;  1TUJ A;  3VB1 A;  5EL2 A;  3CYZ A;  3NGV A;  3NHI A;  2ERB A;  3FE9 A;  3CAB A;  3CZ2 A;  3B6X A;  3BJH A;  3QME A;  1T14 A;  3L4A A;  3S0F A;  4INX A;  3FE6 A;  3L47 A;  4JD9 A;  2WCJ A;  3N7H A;  3CDN A;  1QWV A;  2FJY A;  1OW4 A;  3R72 A;  3B87 A;  3S0D A;  2WCK A;  2P71 A;  3DXL A;  2WCH A;  1XFR A;  3D74 A;  2WC6 A;  3BFA A;  3D75 A;  3S0A A;  2P70 A;  3B86 A;  3V2L A;  3D73 A;  3DZT A;  2QEH A;  2QEB A;  1DQE A;  1GM0 A;  2KPH A;  3D78 A;  2QDI A;  3R1O A;  1ORG A;  2L2C A;  3RZS A;  2QEO A;  3BFH A;  3CZ1 A;  2JPO A;  3K1E A;  4OZD A;  3L4L A;  2WC5 A;  4INW A;  1OOH A;  3S0G A;  3PJI A;  3B7A A;  3S0E A;  4FQT A;  3D76 A;  1OOI X;  2WCL A;  3CZ0 A;  4F7F A;  2WCM A;  3B88 A;  2H8V A;  3R1V A;  1C3Y A;  3R1P A;  3BFB A;  2QEV A;  1TWO A;  1OOG A;  4PT1 A;  2GTE A;  3DY9 A;  1P28 A;  3OGN A;  3S0B A;  3Q8I A;  3NHT A;  3D77 A;  1C3Z A;  1LS8 A; 
#chains in the Genus database with same CATH topology
 2ISD A;  2BCX A;  1OOF A;  4YBH B;  4MEW A;  1ZMZ A;  5DIC A;  1YUU A;  4YGA A;  2M7L A;  2YGU A;  3CYZ A;  4KYN A;  1AHR A;  1B8R A;  2MA2 A;  2NCO A;  1ODB A;  1UHN A;  1YRT B;  1KWO B;  3O6B A;  3NHI A;  2M3W A;  1V1G A;  2JZI A;  5I94 A;  1TUZ A;  2M1K B;  1QLS A;  1J7O A;  1XYD A;  3B6X A;  4UPG A;  1DTL A;  1T14 A;  2LMT A;  1CDN A;  4N1G A;  1YR5 A;  1PRW A;  4PE7 A;  2P6B B;  4INX A;  1OMV A;  1XO5 A;  3FE6 A;  2WCJ A;  5I2L A;  1WLM A;  1J7R A;  3CDN A;  4QJ3 B;  3AKB A;  1SL9 A;  2FJY A;  1R2U A;  3I5I B;  1B7T Y;  1IWQ A;  3I5F B;  1PUL A;  3IF7 A;  2KLE A;  1F70 A;  2KBM A;  5HL1 A;  2G9B A;  1RWY A;  1KK7 Y;  4GUK A;  4PHN A;  1TCF A;  2P71 A;  1UHH A;  2MRD A;  4YGB B;  1A2X A;  1WDC B;  1XFR A;  2LM5 A;  1DJX A;  4AOM A;  2KAV A;  2PSR A;  1CLB A;  1KWO C;  1CFC A;  1CFD A;  1RRO A;  4JQ0 D;  2WC8 A;  1ZAC A;  3LK0 A;  1S3P A;  3EK4 A;  1QX2 A;  2OS8 B;  2LMV A;  3PFV A;  3B86 A;  3OB1 B;  1BT6 A;  2HQ8 A;  1Z2C B;  4D1E A;  3D73 A;  2QEH A;  4PCW A;  2JTZ A;  4USL A;  1JUO A;  1DQE A;  2KFH A;  5FYX A;  1NCX A;  3CR4 X;  2QAC A;  5G08 A;  3GK1 A;  4NQG A;  1S5G Z;  3LL8 B;  2KAX A;  2K8M B;  2LAP A;  2KNE A;  2L2C A;  3I5I C;  4DRW A;  2EC6 B;  2QEO A;  1QXP A;  2SCP A;  3CR5 X;  3PSR A;  2KLD A;  2OTG C;  2ZN9 A;  3BFH A;  1PSR A;  5JJG A;  1CDL A;  4OV2 A;  1SW8 A;  1NWD A;  5F6T A;  5KU1 A;  1WDC C;  1CNP A;  2PMY A;  1J7P A;  4ORC B;  1WRL A;  2MLF C;  4I5J A;  1QIW A;  1FI5 A;  2GGZ A;  4DIR A;  3KPX A;  1GGW A;  1OE9 B;  1XFW O;  5D3O A;  3TDI A;  1U5I A;  1YUR A;  1BOD A;  1SKT A;  4P5O E;  2OS8 C;  2KOT A;  3FWC A;  1EJ3 A;  1SK6 D;  2EGD A;  2IS9 A;  3CLN A;  3PJI A;  4FTG A;  4C0K A;  4U8D A;  3EVR A;  4IL1 A;  1IQ3 A;  4DS7 A;  4WQ3 A;  2M0R A;  4BY5 A;  1GQM A;  5IBW A;  2E6W A;  1F4O A;  4AQI A;  2BL0 B;  1SPY A;  1SMG A;  1SR6 C;  1CKK A;  2M9G A;  3CWG A;  1C3Y A;  5AEQ A;  1MR8 A;  1VRK A;  5BPJ A;  3AAK A;  3R1P A;  3SS3 A;  1TRF A;  2LLU A;  2EC6 C;  1U5I B;  3BFB A;  2B1U A;  2WOS A;  3FS7 A;  3I5G B;  3OBV A;  4TNC A;  3VRR A;  4HRE E;  1JF2 A;  3BUO B;  2HPS A;  2BE4 A;  2KI4 B;  5AAN A;  1F55 A;  1S6C A;  1A75 B;  2KI6 C;  3EKH A;  3OGN A;  3DD4 A;  4CID A;  2TN4 A;  1QVI Z;  4ICB A;  2Y1N A;  1AJ5 A;  1J7Q A;  2L2E A;  3Q8I A;  3EK7 A;  5FI7 A;  3SG4 A;  1C3Z A;  4QJ4 B;  1EXR A;  1CFP A;  4YGC B;  1TNW A;  1MQ1 A;  5DKN A;  2JT3 A;  4MZJ A;  2K2A A;  1NIW A;  1TUJ A;  2ZND A;  4BY4 A;  1JF0 A;  2K7D A;  1W9Z A;  2ZN8 A;  2MLE C;  3WXA A;  4YGE B;  2WCE A;  1M46 A;  5D7F A;  1K9P A;  2ERB A;  1H4B A;  3JTD B;  1TCO B;  1G4Y R;  1RTP 1;  1TOP A;  2Q4U A;  3CAB A;  2DOQ A;  1BJF A;  3CZ2 A;  1NX3 A;  2LMU A;  1MXL C;  2FCD A;  1REC A;  1N65 A;  1DEL A;  4GGF C;  1DJG A;  3LLE A;  1Y1A A;  4M2Q A;  4PE1 A;  3I5G C;  1TIZ A;  4CFR A;  3L4A A;  5CSN A;  2JNF A;  4PE0 A;  4CFQ A;  3S0F A;  3L47 A;  1K94 A;  1M39 A;  2KBI A;  3N7H A;  4MBE A;  2D8N A;  1QWV A;  1QX7 A;  3DVE A;  4GNK B;  3TZ1 A;  1L2O B;  4OR9 B;  1PAL A;  2GGM A;  4YRU A;  1AP4 A;  1J1D A;  2L4I A;  1LXF C;  3B87 A;  3S0D A;  2NLN A;  3ZWH A;  2LLS A;  3O78 A;  1W7J B;  2LP2 A;  2QPT A;  4JPZ B;  1V1F A;  1MUX A;  1A4P A;  1HQV A;  3SJS A;  2G2B A;  2WC6 A;  5KTY A;  1YTZ C;  1CMF A;  2K7O A;  3S0A A;  3SG3 A;  2CXJ A;  3OB2 B;  1N2D A;  2JOJ A;  1EL4 A;  1KFU L;  2BBM A;  1GM0 A;  4PE4 A;  2SAS A;  3PN7 B;  1Y1U A;  2KPH A;  1GGZ A;  1XK4 A;  1EG3 A;  4PDZ A;  5AXI A;  2LVI A;  2QDI A;  3EVU A;  1DT7 B;  1L2O C;  1ORG A;  3RZS A;  4AQJ A;  2R2I A;  4XYN A;  1DEK A;  3NSL A;  1B1G A;  2PYQ A;  3DVJ A;  1FI6 A;  3I5H B;  1QV0 A;  3IQO A;  2CNP A;  1QLK A;  2Q91 A;  1KSM A;  2LUC A;  1MF8 B;  5TNC A;  1AJ4 A;  5FI6 A;  4OZD A;  1N0Y A;  3L4L A;  2Y4Q A;  3KHE A;  4MVF A;  5J3X A;  1G8I A;  1CLM A;  1RJV A;  1KK7 Z;  1ZUZ A;  2WC5 A;  3CZT X;  2M49 B;  4MSP A;  1KK8 B;  4OCI A;  5CSF A;  2BNX A;  1MXE A;  1SCM B;  1SL8 A;  1YX7 A;  2HF5 A;  4YGD B;  2FOT A;  1YVH A;  4HSZ A;  1Q80 A;  4PAL A;  1XFX O;  3D76 A;  3CZ0 A;  1DMO A;  1XA5 A;  4F7F A;  1YVL A;  5I8N A;  1DC1 A;  3RLZ A;  1SNL A;  2Y5I A;  1XFY O;  2WCM A;  3BYA A;  1IIO A;  3B88 A;  2H8V A;  3I5F C;  3R1V A;  4M2P A;  5JOL A;  1TTX A;  2ZRS A;  1Y6W A;  3BXK A;  2LVK A;  2BBN A;  3WHU B;  1DVI A;  1B8L A;  1SYM A;  3GOF A;  5ER5 A;  5HKY A;  1CTR A;  1IQ5 A;  2KFG A;  1TN4 A;  2QEV A;  2MJW B;  1SRA A;  1NX2 A;  1QIV A;  5HKW A;  3NSI A;  3DY9 A;  4FQO A;  4CPV A;  3I5H C;  2CT9 A;  1QX5 B;  2ZNE A;  4L9M A;  1ZFS A;  2JXL A;  3S0B A;  1DGU A;  1Y0V H;  1QS7 A;  1Y1X A;  2BAP A;  3PAT A;  2HQW A;  3PLF B;  1GJY A;  3OHM B;  2H2K A;  3JVT B;  2PAS A;  1OSA A;  1OMD A;  2PQL A;  1K9U A;  3SG2 A;  1TNX A;  1B9A A;  2WOR A;  1KK8 C;  3GK4 X;  5DKR A;  3WHT B;  3VB1 A;  1SCM C;  3H4S E;  5EL2 A;  1G33 A;  3AKA A;  4R1E A;  1NSH A;  4WRI A;  3HCM A;  4I5K A;  1CM1 A;  1DJW A;  1KSO A;  1TNQ A;  3BUW B;  4N1F A;  3VRO A;  4A4C A;  1D1O A;  3F45 A;  2LNK A;  2PAL A;  3SS5 A;  2MHH A;  3BOW A;  1S26 D;  4NDB A;  4YI8 A;  2K61 A;  3BUN B;  2BKH B;  4PHJ A;  3QME A;  1IG5 A;  2LP3 A;  1NCY A;  2JRF A;  2JWW A;  1S36 A;  3D10 A;  5CPV A;  2O5G A;  2KQ6 A;  1CLL A;  2F8P A;  2LVJ A;  2E30 A;  3HX4 A;  3FIA A;  2COL B;  3BQ3 A;  1OW4 A;  3BOW B;  4MRY A;  3R72 A;  4WQ2 A;  2JT0 A;  5FI2 A;  1AVS A;  2F2O A;  3UO9 A;  1K90 D;  2KAY A;  1FF1 A;  3JVT C;  1K96 A;  3DXL A;  2K60 A;  1LIN A;  1R6P A;  2CTN A;  1YRU B;  2WCH A;  2JU0 A;  2ZKM X;  4DUQ A;  4E68 A;  1LVC D;  2BL0 C;  2L98 A;  1XFZ O;  2KDH A;  3BFA A;  1JBA A;  2I18 A;  3EK8 A;  2KGB C;  3D75 A;  3VRQ A;  2PVB A;  2WCF A;  4ORB B;  1JSA A;  1H8B A;  2F33 A;  2PRU A;  2LUX A;  4MLW A;  1BR1 B;  1NX1 A;  2KI4 C;  3DZT A;  3D0Y A;  2QEB A;  2O60 A;  2F3Y A;  2GV5 A;  2LHI A;  1RK9 A;  5HLO A;  2NCP A;  1M45 A;  2M7N A;  2M29 A;  4ORA B;  2BE6 A;  1WY9 A;  4N5X A;  5K89 A;  1LA0 A;  2L5X B;  1YUT A;  3DF0 A;  1DJZ A;  2JT8 A;  2JPO A;  1JC2 A;  1F8H A;  2FJU B;  2LC5 A;  2BCA A;  3OP0 A;  3SIB A;  2H61 A;  1RFJ A;  3CR2 A;  2LLT A;  1NCZ A;  1DF0 A;  1SY9 A;  3JTD C;  1UWO A;  2F3Z A;  2KSP A;  4MRX A;  1YX8 A;  4DCK A;  5KSZ A;  1C07 A;  1KQV A;  4GPL B;  1NX0 A;  4PHK A;  2NXQ A;  3SIA A;  3TS5 B;  3TUY B;  2I7A A;  3O4X A;  2L50 A;  2MBX A;  1IRJ A;  2WND A;  5CSI A;  5D69 A;  1B8C A;  3DF0 B;  3S0G A;  2I94 A;  3B7A A;  1OZO A;  2I2R E;  4I5L B;  2WCL A;  4JWQ A;  2JPT A;  3BUX B;  1UUS A;  1PK0 D;  2F2P A;  1OQP A;  1Z4H A;  1DF0 B;  2OPO A;  3ICB A;  3OX5 A;  1QAT A;  2LCP A;  2ZRT A;  3IVT A;  5AFP A;  1J1E A;  4F0Z B;  1F4Q A;  1UUR A;  2LHL A;  4GFT A;  1OOG A;  3EVV A;  3QRX A;  1B47 A;  2LV7 A;  3KO0 A;  1XFU O;  5I2Q A;  3PAL A;  3RM1 A;  1NUB A;  2V53 A;  1B7T Z;  1P28 A;  4NDC A;  3NXA A;  4MZL A;  3GK2 A;  3SS4 A;  2AMI A;  1ALV A;  1KQM B;  1S6I A;  2K0J A;  3LK1 A;  3D77 A;  1BMO A;  2VRG A;  3BUM B;  1FPW A;  3SG6 A;  2A4J A;  1LA3 A;  1S6J A;  1LS8 A;  1X02 A;  1JFK A;  2L5Y A;  3MSE B;  2OTG B;  3DYE A;  3FE8 A;  4IJ7 A;  3TS5 C;  1KFU S;  3CS1 A;  2JUL A;  3TUY C;  2AAO A;  2KYF A;  4M2O A;  1E8A A;  4GAO A;  3TDU A;  1QAS A;  5PAL A;  2BEC A;  1UHJ A;  1DJH A;  3NGV A;  1EH2 A;  4C0L A;  3PN7 C;  4OKH A;  2H61 C;  2AUC A;  2L51 A;  3FE9 A;  4GGN A;  4ZCU A;  1ALW A;  1S5G Y;  4I5N B;  3PM8 A;  1AK8 A;  2HET A;  3BJH A;  3WNX B;  1BU3 A;  1PVB A;  1BOC A;  1C7W A;  1XVJ A;  2K2F A;  3C1V A;  2L0P A;  4C0J A;  3PM2 A;  1YUS A;  1C7V A;  3O2P A;  4JD9 A;  5HLV A;  3VRN A;  1FBV A;  1QV1 A;  1B4C A;  4Q04 A;  3M0W A;  4P2Y B;  1XK4 C;  3A4U B;  2JTT A;  2Y1M A;  4JKT A;  4YI9 A;  1SR6 B;  2KYC A;  1CB1 A;  1IKU A;  1KQM C;  2JC2 A;  1SL7 A;  1KCY A;  2WCK A;  4A4B A;  2M8U A;  1K8U A;  1HT9 A;  2K7B A;  3DVM A;  4ZCV A;  1TNP A;  4ETO A;  1NP8 A;  3D74 A;  1NYA A;  2ZFD A;  1F71 A;  1IJ5 A;  3E3R A;  2WCB A;  5HYD A;  1MHO A;  3SG7 A;  1PSB A;  1A29 A;  1UHK A;  2JQ6 A;  2JXC A;  1QJT A;  3SG5 A;  1L7Z A;  2NZ0 A;  3EG5 B;  3FWB A;  5GQQ C;  2P70 A;  4GGF A;  4PHM A;  3V2L A;  2K7C A;  2KQY A;  3CGA A;  1PVA A;  2KHN A;  1K95 A;  1BR4 B;  2KFF A;  5ER4 X;  1A75 A;  2LE9 B;  1IH0 A;  3AAJ A;  3EKJ A;  3DVK A;  1QVI Y;  3ZNI A;  1SSE B;  2BKI B;  3D78 A;  3OX6 A;  3R1O A;  2LVV A;  1KFX L;  2LAN A;  4MZK A;  4XJK A;  1J55 A;  5HKZ A;  2L4H A;  1OOJ A;  3CZ1 A;  1MWN A;  4GBA A;  3IQQ A;  3TDZ A;  3NSO A;  3KF9 A;  4HRG A;  1FW4 A;  2BCB A;  2KI6 D;  3K1E A;  2MAZ A;  2RGI A;  1CDP A;  1CFF A;  1UHI A;  3UNW A;  1UP5 A;  1S1E A;  2M97 A;  2M1U A;  1A03 A;  1SBJ A;  1JFJ A;  3LCP C;  2FCE A;  1ZOT B;  4XJK B;  1K2H A;  1IJ6 A;  2CCM A;  1BLQ A;  1M31 A;  4INW A;  1OOH A;  2EHB A;  5B8I B;  5CSJ A;  1IGV A;  3S0E A;  4FQT A;  1OMR A;  4CLN A;  1DJI A;  4OVN F;  1QTX A;  1OOI X;  5DKQ A;  1K93 D;  3NSK A;  3K21 A;  2JNX A;  1KFX S;  4HRH A;  1W7I B;  5I2O A;  1CDM A;  1BF5 A;  1M63 B;  1TWO A;  1JWD A;  3D0Y B;  1OZS A;  4QJ5 B;  1BG1 A;  4PT1 A;  2GTE A;  1WRK A;  3VGO A;  1NPQ A;  1F54 A;  1WRZ A;  1LKJ A;  3A8R A;  1CMG A;  1EG4 A;  3VRP A;  1K9K A;  3O4Y A;  2CBL A;  1DGV A;  1AUI B;  5AER A;  3KEV A;  1CM4 A;  3NHT A;  1SCV A;  4MN0 A;  3CTN A;  1DJY A;  4NDD A;  1WLZ A;  1XFV O;  2KGR A; 
#chains in the Genus database with same CATH homology
 3DYE A;  3FE8 A;  2PQL A;  1OOF A;  5DIC A;  1TUJ A;  3VB1 A;  5EL2 A;  3CYZ A;  3NGV A;  3NHI A;  2ERB A;  3FE9 A;  3CAB A;  3CZ2 A;  3B6X A;  3BJH A;  3QME A;  1T14 A;  3L4A A;  3S0F A;  4INX A;  3FE6 A;  3L47 A;  4JD9 A;  2WCJ A;  3N7H A;  3CDN A;  1QWV A;  2FJY A;  1OW4 A;  3R72 A;  3B87 A;  3S0D A;  2WCK A;  2P71 A;  3DXL A;  2WCH A;  1XFR A;  3D74 A;  2WC6 A;  3BFA A;  3D75 A;  3S0A A;  2P70 A;  3B86 A;  3V2L A;  3D73 A;  3DZT A;  2QEH A;  2QEB A;  1DQE A;  1GM0 A;  2KPH A;  3D78 A;  2QDI A;  3R1O A;  1ORG A;  2L2C A;  3RZS A;  2QEO A;  3BFH A;  3CZ1 A;  2JPO A;  3K1E A;  4OZD A;  3L4L A;  2WC5 A;  4INW A;  1OOH A;  3S0G A;  3PJI A;  3B7A A;  3S0E A;  4FQT A;  3D76 A;  1OOI X;  2WCL A;  3CZ0 A;  4F7F A;  2WCM A;  3B88 A;  2H8V A;  3R1V A;  1C3Y A;  3R1P A;  3BFB A;  2QEV A;  1TWO A;  1OOG A;  4PT1 A;  2GTE A;  3DY9 A;  1P28 A;  3OGN A;  3S0B A;  3Q8I A;  3NHT A;  3D77 A;  1C3Z A;  1LS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...