2LP2A

Solution structure and dynamics of human s100a1 protein modified at cysteine 85 with homocysteine disulfide bond formation in calcium saturated form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title Impact of calcium binding and thionylation of S100A1 protein on its nuclear magnetic resonance-derived structure and backbone dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 27
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lp2A00
5D69A 1A75B 2ZFDA 1LINA 1NCXA 5F6TA 2JZIA 3VRPA 3KPXA 4FTGA 3TDZA 5CSNA 1OQPA 4GAOA 2M49B 5CSJA 1BT6A 1DJXA 2M9GA 2MJWB 1BU3A 1YVLA 1Y6WA 2LUXA 2KAXA 3KO0A 1SL9A 2K8MB 1F8HA 1NP8A 4GGFA 3BOWB 1QS7A 1W7JB 2BCBA 2SCPA 1PVBA 2JT8A 2KNEA 2Y1MA 4WQ3A 5HKWA 5HKYA 4MZJA 1FPWA 1UHIA 2FCEA 1BG1A 2KHNA 1FI5A 5HLOA 1WRZA 2BCAA 2KFHA 2ZN9A 2F3ZA 2G2BA 3CR5X 4I5LB 5DKNA 1PVAA 2E6WA 2O60A 5IBWA 3NSKA 4PCWA 4GFTA 1DJGA 3WHTB 4MZKA 3DVJA 1UURA 4CIDA 1EL4A 1OE9B 1QX2A 1V1FA 3CR4X 2AMIA 1QATA 1UHJA 1AJ4A 1BJFA 4M2QA 1C7WA 1RTP1 1QV0A 1U5IB 1HQVA 3GOFA 1S6JA 2L51A 3BUWB 4MZLA 4ORAB 2MA2A 2DOQA 2M7LA 3TS5B 1QXPA 1MHOA 1CDPA 1B8CA 1OMVA 1QJTA 2KYCA 1QVIY 4PE7A 1B7TY 4GBAA 2BBMA 5FYXA 1TOPA 1YX7A 3DD4A 5AERA 1OMDA 1TNXA 1QVIZ 2SASA 1BLQA 2BL0C 1F55A 2A4JA 1S3PA 4F0ZB 3BUNB 3PSRA 1YRTB 3OP0A 2PRUA 1IWQA 1E8AA 1GGZA 1QIVA 3BUOB 4MSPA 2CTNA 1QX5B 2F3YA 2LMVA 1NUBA 2LE9B 1QIWA 2TN4A 1TNWA 2PMYA 1CDMA 4E68A 1NYAA 1D1OA 1XFYO 4PHJA 2L98A 2LAPA 3SIAA 4PE1A 3JTDB 3SJSA 1OOJA 1S5GZ 3TUYC 1RFJA 1TNPA 5HLVA 1J7PA 1NCZA 1YUSA 1BF5A 2G9BA 2F2OA 3IQOA 5HKZA 3RM1A 1Q80A 1ALVA 1OMRA 2LV7A 2K7BA 2F2PA 3PN7B 3TS5C 4XJKB 4BY4A 2GV5A 1WDCB 1B8LA 4YBHB 5JJGA 4OV2A 2K61A 3CWGA 3D0YB 1IJ6A 1J7OA 1CB1A 1QV1A 1OZOA 5D7FA 1J1DA 1NPQA 4I5NB 4MRYA 3LCPC 1SR6B 1UWOA 2ZRSA 3SG3A 1SYMA 4YGBB 1SK6D 1N2DA 1XK4A 4NDDA 3WNXB 4BY5A 1Y1UA 2LMUA 2BE4A 3LK0A 1PK0D 4HSZA 1DJZA 2LUCA 1SNLA 1BR4B 1JF0A 2RGIA 1AHRA 4WRIA 4JWQA 2KBMA 3OB2B 1WRKA 4YGEB 4YI9A 3I5FB 1XFWO 1SRAA 1CDLA 2JWWA 4I5KA 4R1EA 1MR8A 3BUMB 2LLSA 1JSAA 2M29A 4WQ2A 5CPVA 3JTDC 4OR9B 5BPJA 3KF9A 1NWDA 1J7QA 1S6CA 1F54A 1SCVA 2B1UA 2K7DA 2OTGB 2K0JA 3IF7A 1KK8B 2NZ0A 3I5HB 1M39A 2LLUA 1CFPA 1KQMB 4NDBA 1R2UA 1WLZA 4MBEA 4P5OE 1KFUL 1DGUA 1H4BA 1IJ5A 1KSOA 1Y1XA 1TN4A 2HETA 1K2HA 3AAJA 1G8IA 3CTNA 4AQJA 2I7AA 1XFXO 2MBXA 4GNKB 2OS8B 2K2AA 1ZACA 4DS7A 3BUXB 2LP2A 1SR6C 1PSRA 2JXCA 4PDZA 3EK7A 1CLLA 2Y1NA 3NSIA 1PSBA 2JC2A 5AANA 1G4YR 2BECA 3NSLA 2WOSA 1MXLC 3ICBA 2LHLA 2LLTA 3O4YA 1SCMB 3FIAA 1K8UA 1QLSA 1JFJA 1SL8A 4CPVA 1K9UA 1DJWA 1K95A 1IG5A 1M46A 1K96A 2MHHA 2KDHA 1DMOA 1TRFA 2M1KB 3LLEA 1JFKA 5GQQC 2OTGC 1CNPA 2LCPA 1A2XA 4JQ0D 2JQ6A 1XFZO 4PHKA 2JOJA 2L4IA 4HRGA 1J7RA 3O78A 2MAZA 2ZKMX 4M2PA 1N65A 3DF0A 4GPLB 4DCKA 2M3WA 1PULA 1TNQA 1EJ3A 5AFPA 2FOTA 2OS8C 1BOCA 2CNPA 2FJUB 3EKJA 1EG4A 2JNFA 4CLNA 3FS7A 4DRWA 1EH2A 1YR5A 1CFFA 2HPSA 1RROA 2KAYA 4M2OA 4TNCA 2JT3A 1W7IB 3JVTB 3ZWHA 1B7TZ 4QJ4B 2H61C 3C1VA 4ICBA 2L4HA 5CSIA 1GQMA 1J1EA 1OZSA 3SG4A 3OB1B 3VGOA 3GK2A 1CMFA 1L2OB 2KI6D 4ORCB 2ZNEA 3DVEA 5AEQA 1AP4A 3A4UB 3FWCA 1MUXA 1YUTA 1A4PA 4USLA 1N0YA 1KK7Y 1AJ5A 3EKHA 3GK4X 1IRJA 1QLKA 2M0RA 1JF2A 4NQGA 2EHBA 3DVKA 2GGZA 3CR2A 3OX6A 2H2KA 1LKJA 4YGAA 4N1FA 2KFFA 4C0JA 1KFXS 1Y1AA 1DJIA 2NCPA 2PVBA 2LVJA 3LK1A 3PALA 4YGCB 1JWDA 4IL1A 1KCYA 2ZN8A 3HX4A 1RK9A 1BODA 5KTYA 1JC2A 1CKKA 1QASA 2JULA 3BYAA 3PLFB 1CM1A 1FW4A 2L2EA 1XVJA 1SPYA 2F33A 3TDUA 2JRFA 5KSZA 1QX7A 1NX0A 3WXAA 3I5IB 2EC6B 3DVMA 3CGAA 3NSOA 5JOLA 4YRUA 3SG5A 2LMTA 1SKTA 1DF0B 4N5XA 1CDNA 5K89A 1XO5A 1DJYA 2BKIB 2ZNDA 1WLMA 4DUQA 2KAVA 1A03A 1F4QA 2KI4B 1Y0VH 2HQ8A 3SG6A 1EG3A 3QRXA 1CMGA 2JT0A 1F4OA 2EGDA 3EVRA 2ISDA 3FWBA 1SMGA 3AKBA 2HF5A 3I5GB 5J3XA 3PM8A 1FBVA 1S6IA 3VRRA 3F45A 3PN7C 1F71A 3ZNIA 3MSEB 4PE4A 1WDCC 2WCEA 2WCFA 1L7ZA 3EVVA 5CSFA 1HT9A 2M7NA 2MLFC 1R6PA 2K2FA 4PE0A 3LL8B 2I94A 5G08A 2R2IA 1F70A 2M97A 1XFUO 5I2QA 1UHHA 1LXFC 1NCYA 5I2LA 1BMOA 1LA0A 5ER4X 1DGVA 1A75A 1YVHA 2KSPA 2EC6C 2CBLA 2BCXA 1YUUA 1XA5A 1KSMA 4MEWA 4XYNA 2HQWA 1K90D 2LVVA 2KQYA 2L5XB 3I5FC 1NX2A 2K7OA 3WHUB 3BOWA 3GK1A 2KI4C 1PALA 3K21A 2LVKA 1S36A 1BR1B 3HCMA 3BXKA 4OKHA 3RLZA 4A4BA 2H61A 4OCIA 2Q4UA 1YURA 2WORA 3OX5A 3SIBA 3I5GC 5AXIA 1B9AA 1KK8C 3I5HC 1X02A 2LP3A 1KQMC 4ZCVA 5B8IB 2BL0B 2JPTA 5DKRA 3VRNA 1EXRA 3CS1A 1K93D 1RJVA 1S1EA 1IH0A 4NDCA 2QPTA 3TZ1A 1CLBA 2WCBA 3A8RA 1SY9A 3M0WA 1B1GA 1SL7A 4YI8A 1ODBA 1GGWA 1DT7B 2JTTA 3AAKA 1C7VA 2BE6A 1U5IA 1NX3A 2KFGA 2LANA 2E30A 3DF0B 1NSHA 1V1GA 4QJ5B 4OVNF 4AQIA 2Y4QA 2D8NA 3VROA 1WY9A 3KHEA 3SG2A 3TUYB 3VRQA 4ETOA 2FCDA 2NLNA 3PFVA 1TCFA 1CFCA 1SCMC 1UHKA 4MVFA 1K94A 1ALWA 2AAOA 3E3RA 1AK8A 1C07A 4GGFC 1MF8B 1DJHA 3AKAA 2WNDA 4UPGA 1MXEA 1S26D 5I2OA 1DTLA 2OPOA 1A29A 2KYFA 2LM5A 2AUCA 2L50A 3CZTX 1SBJA 3EK8A 1M31A 4FQOA 1TIZA 1YX8A 2MLEC 1CTRA 4A4CA 4C0KA 1SW8A 2F8PA 2PSRA 1KK7Z 4ZCUA 1JUOA 2MRDA 2NXQA 2COLB 1G33A 1RECA 2CXJA 2PASA 1RWYA 5KU1A 1PRWA 1B4CA 1GJYA 4L9MA 2JNXA 3H4SE 1KWOB 3CLNA 1UP5A 2K7CA 2L0PA 3D10A 5I8NA 1S5GY 1VRKA 2I2RE 2IS9A 1YRUB 1K9PA 1TTXA 4P2YB 2Q91A 1MWNA 4PALA 4CFQA 2CCMA 3JVTC 4Q04A 3SG7A 1ZFSA 4MLWA 1IQ3A 4XJKA 1CLMA 1KFUS 1TCOB 3PATA 1KQVA 3D0YA 1L2OC 3EVUA 1UHNA 2P6BB 3OHMB 4GUKA 4ORBB 2CT9A 1LVCD 1NX1A 1ZUZA 2ZRTA 1DVIA 4MRXA 3KEVA 1K9KA 1XFVO 2KI6C 1NIWA 4U8DA 1JBAA 2BKHB 1H8BA 5ER5A 4AOMA 2JTZA 1FI6A 2O5GA 4I5JA 2JXLA 1DF0A 2I18A 2JU0A 4QJ3B 1AVSA 2V53A 1MQ1A 1IQ5A 1WRLA 3IQQA 4PHNA 2WC8A 2LNKA 5HYDA 3O6BA 4JPZB 2NCOA 1M63B 4C0LA 1J55A 5PALA 2KBIA 5TNCA 1KWOC 2QACA 4HRHA 2LC5A 1KFXL 2M1UA 2KOTA 2KGRA 3EK4A 4DIRA 1OSAA 1QTXA 2VRGA 4PHMA 1YTZC 2Y5IA 4YGDB 4MN0A 1B8RA 2BBNA 2GGMA 2KQ6A 1B47A 4D1EA 4N1GA 2PALA 1AUIB 1UUSA 1XYDA 1IGVA 1IKUA 4GGNA 3I5IC 1CM4A 1ZMZA 3BQ3A 4CFRA 3NXAA 4HREE 3TDIA 1FF1A 2LVIA 1LA3A 3O2PA 5DKQA 1XK4C 2KGBC 1M45A 2LHIA 1ZOTB 1CFDA 2M8UA
chains in the Genus database with same CATH superfamily
5D69A 1A75B 2ZFDA 1LINA 1NCXA 5F6TA 2JZIA 3VRPA 3KPXA 4FTGA 1P28A 5CSNA 1OQPA 4GAOA 2M49B 5CSJA 3S0BA 3TDZA 1BT6A 2WCHA 1DJXA 2M9GA 2MJWB 1BU3A 1YVLA 1Y6WA 2LUXA 2KAXA 3KO0A 1SL9A 2K8MB 1F8HA 1NP8A 4GGFA 3BOWB 1QS7A 1W7JB 2BCBA 2SCPA 1PVBA 2JT8A 2KNEA 2Y1MA 1DQEA 4WQ3A 5HKWA 5HKYA 4MZJA 1FPWA 1UHIA 2FCEA 1BG1A 2KHNA 1FI5A 5HLOA 1WRZA 1T14A 2BCAA 2KFHA 2ZN9A 2F3ZA 2G2BA 3CR5X 4I5LB 5DKNA 4OZDA 2JPOA 1PVAA 2E6WA 3DYEA 2O60A 5IBWA 3NSKA 3CZ0A 4PCWA 4GFTA 1DJGA 1TWOA 3WHTB 3R1VA 3DVJA 4MZKA 1UURA 3OGNA 4CIDA 1EL4A 1OE9B 3DXLA 1QX2A 1V1FA 3CR4X 2AMIA 1DELA 1OOFA 1QATA 1UHJA 1AJ4A 1BJFA 4M2QA 1C7WA 1RTP1 1QV0A 1U5IB 1HQVA 3GOFA 1S6JA 2L51A 3BUWB 4MZLA 2PQLA 4ORAB 3CYZA 2MA2A 2DOQA 2M7LA 3S0DA 3TS5B 3BJHA 1QXPA 1MHOA 1CDPA 1B8CA 1OMVA 1QJTA 2KPHA 2KYCA 4F7FA 1QVIY 4PE7A 1B7TY 4GBAA 2BBMA 3D75A 5FYXA 1TUZA 1TOPA 1YX7A 3B7AA 3DD4A 5AERA 1OMDA 1TNXA 1QVIZ 2SASA 1BLQA 2BL0C 1F55A 2A4JA 1Z2CB 1S3PA 1Z4HA 4F0ZB 3BUNB 3PSRA 1YRTB 3DZTA 1QWVA 3OP0A 2PRUA 1IWQA 1DEKA 1E8AA 1GGZA 1QIVA 2WCMA 3BUOB 4MSPA 2WCJA 2CTNA 1QX5B 2F3YA 5D3OA 2LMVA 1IIOA 1NUBA 2LE9B 1QIWA 2TN4A 1TNWA 2PMYA 1CDMA 4E68A 1NYAA 1D1OA 1XFYO 4PHJA 2L98A 2LAPA 3SIAA 5EL2A 4PE1A 3JTDB 3SJSA 1OOJA 1S5GZ 3TUYC 1RFJA 1TNPA 2ERBA 5HLVA 1J7PA 1NCZA 1YUSA 1BF5A 2G9BA 2F2OA 3IQOA 5HKZA 3RM1A 1Q80A 1ALVA 1OMRA 2LV7A 2K7BA 2F2PA 3NHIA 3PN7B 3TS5C 4XJKB 4BY4A 2GV5A 1WDCB 5FI2A 1B8LA 4YBHB 5JJGA 4OV2A 2K61A 3CWGA 3D0YB 1IJ6A 1J7OA 1CB1A 1QV1A 1OZOA 5D7FA 1J1DA 1LS8A 1NPQA 4I5NB 4MRYA 3LCPC 1SR6B 1UWOA 2ZRSA 3SG3A 1SYMA 3D74A 1SK6D 1N2DA 1XK4A 4NDDA 4YGBB 3WNXB 4BY5A 1Y1UA 2LMUA 2QEBA 3CZ1A 3DY9A 2BE4A 3LK0A 1PK0D 2WC5A 4HSZA 1DJZA 2LUCA 3VB1A 1SNLA 1BR4B 1JF0A 2RGIA 1AHRA 4WRIA 4JWQA 2KBMA 3OB2B 1WRKA 4YGEB 4YI9A 3I5FB 1XFWO 1SRAA 1CDLA 2JWWA 4I5KA 4R1EA 3N7HA 1MR8A 2QEOA 3BUMB 2LLSA 1JSAA 2M29A 4WQ2A 5CPVA 3JTDC 4OR9B 5BPJA 3KF9A 1NWDA 1J7QA 1S6CA 1F54A 1SCVA 2B1UA 2K7DA 2OTGB 3B6XA 2K0JA 2L2CA 3IF7A 1KK8B 2NZ0A 3I5HB 1M39A 2LLUA 1CFPA 1KQMB 3D78A 3IVTA 4NDBA 1R2UA 1WLZA 4MBEA 1W9ZA 4P5OE 1KFUL 1DGUA 1H4BA 1IJ5A 1KSOA 1Y1XA 1OOHA 1TN4A 2HETA 1K2HA 3AAJA 1G8IA 3CTNA 4AQJA 3UO9A 2P70A 2I7AA 1XFXO 2MBXA 3FE9A 2OS8B 4GNKB 2K2AA 1ZACA 4DS7A 3BUXB 2LP2A 1SR6C 1PSRA 2JXCA 4PDZA 1XFRA 3EK7A 1CLLA 2Y1NA 3NSIA 1PSBA 2FJYA 2JC2A 5AANA 1G4YR 2BECA 3NSLA 2WOSA 1MXLC 3ICBA 2LHLA 2LLTA 3O4YA 1SCMB 3FIAA 1K8UA 1QLSA 1JFJA 1SL8A 4CPVA 1K9UA 1DJWA 1K95A 1IG5A 2YGUA 2WC6A 1M46A 1K96A 2MHHA 3UNWA 2KDHA 1DMOA 1TRFA 2M1KB 3LLEA 1JFKA 5GQQC 2OTGC 1CNPA 2LCPA 1A2XA 4JQ0D 2JQ6A 1XFZO 4PHKA 2JOJA 2L4IA 4HRGA 1J7RA 3O78A 2MAZA 2ZKMX 4M2PA 1N65A 3DF0A 4GPLB 4DCKA 2M3WA 1PULA 1TNQA 1EJ3A 1DC1A 5AFPA 4KYNA 2FOTA 2OS8C 1ORGA 1BOCA 2CNPA 2FJUB 3EKJA 1EG4A 2JNFA 4CLNA 3FS7A 4DRWA 3B87A 1EH2A 1YR5A 1CFFA 2HPSA 1RROA 2KAYA 4M2OA 4TNCA 2JT3A 1W7IB 3JVTB 2WCLA 3ZWHA 1B7TZ 4QJ4B 2H61C 3C1VA 3CABA 2L4HA 4ICBA 1GQMA 5CSIA 1J1EA 1OZSA 3SG4A 3OB1B 3VGOA 3GK2A 1CMFA 1L2OB 2KI6D 4ORCB 2ZNEA 3DVEA 5AEQA 1AP4A 3A4UB 3FWCA 1MUXA 1YUTA 1A4PA 4USLA 1N0YA 1KK7Y 1AJ5A 3EKHA 3GK4X 1IRJA 3PJIA 1QLKA 4INXA 2M0RA 1JF2A 4NQGA 2EHBA 3DVKA 2GGZA 3CR2A 3OX6A 2H2KA 1LKJA 4YGAA 4PT1A 4N1FA 2KFFA 4C0JA 1KFXS 1DJIA 2NCPA 2PVBA 2LVJA 3LK1A 3PALA 3BFHA 4YGCB 1JWDA 3D76A 4IL1A 1KCYA 2ZN8A 3HX4A 3FE6A 1RK9A 1BODA 2BNXA 5KTYA 1GM0A 1JC2A 5FI6A 1CKKA 3CDNA 1QASA 2JULA 5HL1A 3BYAA 3PLFB 1CM1A 3BFBA 1FW4A 2L2EA 4JD9A 3SS4A 1XVJA 1SPYA 2GTEA 2F33A 3B88A 3OBVA 4JKTA 3TDUA 2JRFA 5KSZA 1QX7A 1NX0A 3WXAA 2P71A 3I5IB 2EC6B 3DVMA 3CGAA 3FE8A 3NSOA 5JOLA 4YRUA 3SG5A 2LMTA 1SKTA 3SS5A 1DF0B 4N5XA 1CDNA 5K89A 1XO5A 1DJYA 2BKIB 2ZNDA 1WLMA 3S0GA 4DUQA 2KAVA 1A03A 1F4QA 2KI4B 1Y0VH 2HQ8A 2L5YA 3SG6A 1EG3A 3QRXA 1CMGA 2JT0A 1F4OA 2EGDA 3EVRA 3Q8IA 2ISDA 3FWBA 1SMGA 3AKBA 2HF5A 3I5GB 4INWA 5J3XA 3PM8A 1FBVA 1S6IA 3VRRA 3L47A 3S0AA 3F45A 3PN7C 1F71A 1SSEB 3MSEB 4PE4A 1WDCC 3ZNIA 2WCEA 2WCFA 1L7ZA 3EVVA 5CSFA 1HT9A 2PYQA 2M7NA 2MLFC 1R6PA 2K2FA 4PE0A 3LL8B 2I94A 5G08A 2R2IA 1F70A 2M97A 1XFUO 5I2QA 1UHHA 1LXFC 3B86A 1NCYA 5I2LA 1BMOA 1LA0A 5ER4X 1DGVA 1A75A 1YVHA 2KSPA 2EC6C 2CBLA 2BCXA 1ZOTB 1YUUA 1KSMA 1XA5A 4MEWA 4XYNA 2HQWA 1K90D 2LVVA 2KQYA 2L5XB 3R1PA 3I5FC 1NX2A 2K7OA 3WHUB 3BOWA 3GK1A 2KI4C 1PALA 3K21A 2LVKA 1S36A 1BR1B 3HCMA 3BXKA 3BFAA 4OKHA 3QMEA 3RLZA 4A4BA 2H61A 4OCIA 2Q4UA 2H8VA 1YURA 2WORA 3OX5A 3R72A 3SIBA 3I5GC 5AXIA 1B9AA 1KK8C 3I5HC 1X02A 2LP3A 1KQMC 4ZCVA 5B8IB 2BL0B 2JPTA 5DKRA 3VRNA 5I94A 1EXRA 3CS1A 1K93D 1RJVA 1S1EA 1IH0A 4NDCA 2QPTA 3TZ1A 3R1OA 1CLBA 2WCBA 3A8RA 1SY9A 3M0WA 1B1GA 1SL7A 4YI8A 1ODBA 1GGWA 5FI7A 1DT7B 2JTTA 3AAKA 1C7VA 2BE6A 1U5IA 1OOGA 1NX3A 2KFGA 2LANA 4IJ7A 2E30A 2KLDA 3DF0B 1NSHA 1V1GA 4QJ5B 4OVNF 4AQIA 2Y4QA 1C3ZA 2D8NA 3VROA 1WY9A 3KHEA 3K1EA 3SG2A 3TUYB 3EG5B 3VRQA 2FCDA 4ETOA 2NLNA 3PFVA 1TCFA 2QDIA 1CFCA 1SCMC 1UHKA 4MVFA 1K94A 1ALWA 2AAOA 3E3RA 1AK8A 1C07A 4GGFC 1MF8B 1DJHA 3AKAA 2WNDA 4UPGA 1MXEA 1S26D 5I2OA 1DTLA 2OPOA 1A29A 2KYFA 2LM5A 2AUCA 2L50A 3CZTX 1SBJA 3EK8A 1M31A 4FQOA 5DICA 1TIZA 1YX8A 1OOIX 1CTRA 2MLEC 4A4CA 4C0KA 1SW8A 2F8PA 2PSRA 1C3YA 1KK7Z 4ZCUA 1JUOA 2MRDA 2NXQA 2COLB 1G33A 1RECA 2CXJA 2PASA 1RWYA 5KU1A 2QEVA 1PRWA 2KLEA 1B4CA 1GJYA 4L9MA 2JNXA 1OW4A 3NGVA 3H4SE 1KWOB 3CLNA 1UP5A 2K7CA 2L0PA 3D10A 5I8NA 1S5GY 1VRKA 2I2RE 3D73A 2IS9A 1YRUB 1K9PA 1TTXA 4P2YB 2Q91A 1MWNA 4PALA 4CFQA 2CCMA 3JVTC 4Q04A 3SG7A 1ZFSA 4MLWA 1IQ3A 4XJKA 1CLMA 1KFUS 3L4LA 1TUJA 1TCOB 3NHTA 3PATA 1KQVA 3D0YA 2WCKA 1L2OC 3CZ2A 3EVUA 2QEHA 1UHNA 2P6BB 3OHMB 4GUKA 4ORBB 2BAPA 3L4AA 2CT9A 1LVCD 1NX1A 1ZUZA 2ZRTA 1DVIA 4MRXA 3KEVA 1K9KA 1XFVO 2KI6C 1NIWA 4U8DA 1JBAA 2BKHB 1H8BA 5ER5A 4AOMA 2JTZA 1FI6A 2O5GA 4I5JA 2JXLA 1DF0A 3V2LA 2I18A 2JU0A 4QJ3B 1AVSA 2V53A 1MQ1A 3S0FA 1IQ5A 1WRLA 3IQQA 4PHNA 2WC8A 2LNKA 5HYDA 3O6BA 4JPZB 2NCOA 1M63B 4C0LA 1J55A 5PALA 2KBIA 5TNCA 1KWOC 2QACA 3D77A 4HRHA 3PM2A 2LC5A 1KFXL 2M1UA 3O4XA 2KOTA 2KGRA 3EK4A 4DIRA 1OSAA 2K60A 1QTXA 2VRGA 4PHMA 1YTZC 2Y5IA 4YGDB 4MN0A 1B8RA 2BBNA 4FQTA 2GGMA 2KQ6A 1B47A 4D1EA 4N1GA 2PALA 1AUIB 1UUSA 1XYDA 1IGVA 1IKUA 3S0EA 4GGNA 3I5IC 1CM4A 1ZMZA 3BQ3A 4CFRA 3NXAA 4HREE 3SS3A 3TDIA 2LVIA 1LA3A 3O2PA 1FF1A 5DKQA 1XK4C 2KGBC 1M45A 3RZSA 2LHIA 1Y1AA 1CFDA 2M8UA
chains in the Genus database with same CATH topology
5D69A 1A75B 2ZFDA 1LINA 1NCXA 5F6TA 2JZIA 3VRPA 3KPXA 4FTGA 3TDZA 5CSNA 1OQPA 4GAOA 2M49B 5CSJA 1BT6A 1DJXA 2M9GA 2MJWB 1BU3A 1YVLA 1Y6WA 2LUXA 2KAXA 3KO0A 1SL9A 2K8MB 1F8HA 1NP8A 4GGFA 3BOWB 1QS7A 1W7JB 2BCBA 2SCPA 1PVBA 2JT8A 2KNEA 2Y1MA 4WQ3A 5HKWA 5HKYA 4MZJA 1FPWA 1UHIA 2FCEA 1BG1A 2KHNA 1FI5A 5HLOA 1WRZA 2BCAA 2KFHA 2ZN9A 2F3ZA 2G2BA 3CR5X 4I5LB 5DKNA 1PVAA 2E6WA 2O60A 5IBWA 3NSKA 4PCWA 4GFTA 1DJGA 3WHTB 4MZKA 3DVJA 1UURA 4CIDA 1EL4A 1OE9B 1QX2A 1V1FA 3CR4X 2AMIA 1QATA 1UHJA 1AJ4A 1BJFA 4M2QA 1C7WA 1RTP1 1QV0A 1U5IB 1HQVA 3GOFA 1S6JA 2L51A 3BUWB 4MZLA 4ORAB 2MA2A 2DOQA 2M7LA 3TS5B 1QXPA 1MHOA 1CDPA 1B8CA 1OMVA 1QJTA 2KYCA 1QVIY 4PE7A 1B7TY 4GBAA 2BBMA 5FYXA 1TOPA 1YX7A 3DD4A 5AERA 1OMDA 1TNXA 1QVIZ 2SASA 1BLQA 2BL0C 1F55A 2A4JA 1S3PA 4F0ZB 3BUNB 3PSRA 1YRTB 3OP0A 2PRUA 1IWQA 1E8AA 1GGZA 1QIVA 3BUOB 4MSPA 2CTNA 1QX5B 2F3YA 2LMVA 1NUBA 2LE9B 1QIWA 2TN4A 1TNWA 2PMYA 1CDMA 4E68A 1NYAA 1D1OA 1XFYO 4PHJA 2L98A 2LAPA 3SIAA 4PE1A 3JTDB 3SJSA 1OOJA 1S5GZ 3TUYC 1RFJA 1TNPA 5HLVA 1J7PA 1NCZA 1YUSA 1BF5A 2G9BA 2F2OA 3IQOA 5HKZA 3RM1A 1Q80A 1ALVA 1OMRA 2LV7A 2K7BA 2F2PA 3PN7B 3TS5C 4XJKB 4BY4A 2GV5A 1WDCB 1B8LA 4YBHB 5JJGA 4OV2A 2K61A 3CWGA 3D0YB 1IJ6A 1J7OA 1CB1A 1QV1A 1OZOA 5D7FA 1J1DA 1NPQA 4I5NB 4MRYA 3LCPC 1SR6B 1UWOA 2ZRSA 3SG3A 1SYMA 4YGBB 1SK6D 1N2DA 1XK4A 4NDDA 3WNXB 4BY5A 1Y1UA 2LMUA 2BE4A 3LK0A 1PK0D 4HSZA 1DJZA 2LUCA 1SNLA 1BR4B 1JF0A 2RGIA 1AHRA 4WRIA 4JWQA 2KBMA 3OB2B 1WRKA 4YGEB 4YI9A 3I5FB 1XFWO 1SRAA 1CDLA 2JWWA 4I5KA 4R1EA 1MR8A 3BUMB 2LLSA 1JSAA 2M29A 4WQ2A 5CPVA 3JTDC 4OR9B 5BPJA 3KF9A 1NWDA 1J7QA 1S6CA 1F54A 1SCVA 2B1UA 2K7DA 2OTGB 2K0JA 3IF7A 1KK8B 2NZ0A 3I5HB 1M39A 2LLUA 1CFPA 1KQMB 4NDBA 1R2UA 1WLZA 4MBEA 4P5OE 1KFUL 1DGUA 1H4BA 1IJ5A 1KSOA 1Y1XA 1TN4A 2HETA 1K2HA 3AAJA 1G8IA 3CTNA 4AQJA 2I7AA 1XFXO 2MBXA 4GNKB 2OS8B 2K2AA 1ZACA 4DS7A 3BUXB 2LP2A 1SR6C 1PSRA 2JXCA 4PDZA 3EK7A 1CLLA 2Y1NA 3NSIA 1PSBA 2JC2A 5AANA 1G4YR 2BECA 3NSLA 2WOSA 1MXLC 3ICBA 2LHLA 2LLTA 3O4YA 1SCMB 3FIAA 1K8UA 1QLSA 1JFJA 1SL8A 4CPVA 1K9UA 1DJWA 1K95A 1IG5A 1M46A 1K96A 2MHHA 2KDHA 1DMOA 1TRFA 2M1KB 3LLEA 1JFKA 5GQQC 2OTGC 1CNPA 2LCPA 1A2XA 4JQ0D 2JQ6A 1XFZO 4PHKA 2JOJA 2L4IA 4HRGA 1J7RA 3O78A 2MAZA 2ZKMX 4M2PA 1N65A 3DF0A 4GPLB 4DCKA 2M3WA 1PULA 1TNQA 1EJ3A 5AFPA 2FOTA 2OS8C 1BOCA 2CNPA 2FJUB 3EKJA 1EG4A 2JNFA 4CLNA 3FS7A 4DRWA 1EH2A 1YR5A 1CFFA 2HPSA 1RROA 2KAYA 4M2OA 4TNCA 2JT3A 1W7IB 3JVTB 3ZWHA 1B7TZ 4QJ4B 2H61C 3C1VA 4ICBA 2L4HA 5CSIA 1GQMA 1J1EA 1OZSA 3SG4A 3OB1B 3VGOA 3GK2A 1CMFA 1L2OB 2KI6D 4ORCB 2ZNEA 3DVEA 5AEQA 1AP4A 3A4UB 3FWCA 1MUXA 1YUTA 1A4PA 4USLA 1N0YA 1KK7Y 1AJ5A 3EKHA 3GK4X 1IRJA 1QLKA 2M0RA 1JF2A 4NQGA 2EHBA 3DVKA 2GGZA 3CR2A 3OX6A 2H2KA 1LKJA 4YGAA 4N1FA 2KFFA 4C0JA 1KFXS 1Y1AA 1DJIA 2NCPA 2PVBA 2LVJA 3LK1A 3PALA 4YGCB 1JWDA 4IL1A 1KCYA 2ZN8A 3HX4A 1RK9A 1BODA 5KTYA 1JC2A 1CKKA 1QASA 2JULA 3BYAA 3PLFB 1CM1A 1FW4A 2L2EA 1XVJA 1SPYA 2F33A 3TDUA 2JRFA 5KSZA 1QX7A 1NX0A 3WXAA 3I5IB 2EC6B 3DVMA 3CGAA 3NSOA 5JOLA 4YRUA 3SG5A 2LMTA 1SKTA 1DF0B 4N5XA 1CDNA 5K89A 1XO5A 1DJYA 2BKIB 2ZNDA 1WLMA 4DUQA 2KAVA 1A03A 1F4QA 2KI4B 1Y0VH 2HQ8A 3SG6A 1EG3A 3QRXA 1CMGA 2JT0A 1F4OA 2EGDA 3EVRA 2ISDA 3FWBA 1SMGA 3AKBA 2HF5A 3I5GB 5J3XA 3PM8A 1FBVA 1S6IA 3VRRA 3F45A 3PN7C 1F71A 3ZNIA 3MSEB 4PE4A 1WDCC 2WCEA 2WCFA 1L7ZA 3EVVA 5CSFA 1HT9A 2M7NA 2MLFC 1R6PA 2K2FA 4PE0A 3LL8B 2I94A 5G08A 2R2IA 1F70A 2M97A 1XFUO 5I2QA 1UHHA 1LXFC 1NCYA 5I2LA 1BMOA 1LA0A 5ER4X 1DGVA 1A75A 1YVHA 2KSPA 2EC6C 2CBLA 2BCXA 1YUUA 1XA5A 1KSMA 4MEWA 4XYNA 2HQWA 1K90D 2LVVA 2KQYA 2L5XB 3I5FC 1NX2A 2K7OA 3WHUB 3BOWA 3GK1A 2KI4C 1PALA 3K21A 2LVKA 1S36A 1BR1B 3HCMA 3BXKA 4OKHA 3RLZA 4A4BA 2H61A 4OCIA 2Q4UA 1YURA 2WORA 3OX5A 3SIBA 3I5GC 5AXIA 1B9AA 1KK8C 3I5HC 1X02A 2LP3A 1KQMC 4ZCVA 5B8IB 2BL0B 2JPTA 5DKRA 3VRNA 1EXRA 3CS1A 1K93D 1RJVA 1S1EA 1IH0A 4NDCA 2QPTA 3TZ1A 1CLBA 2WCBA 3A8RA 1SY9A 3M0WA 1B1GA 1SL7A 4YI8A 1ODBA 1GGWA 1DT7B 2JTTA 3AAKA 1C7VA 2BE6A 1U5IA 1NX3A 2KFGA 2LANA 2E30A 3DF0B 1NSHA 1V1GA 4QJ5B 4OVNF 4AQIA 2Y4QA 2D8NA 3VROA 1WY9A 3KHEA 3SG2A 3TUYB 3VRQA 4ETOA 2FCDA 2NLNA 3PFVA 1TCFA 1CFCA 1SCMC 1UHKA 4MVFA 1K94A 1ALWA 2AAOA 3E3RA 1AK8A 1C07A 4GGFC 1MF8B 1DJHA 3AKAA 2WNDA 4UPGA 1MXEA 1S26D 5I2OA 1DTLA 2OPOA 1A29A 2KYFA 2LM5A 2AUCA 2L50A 3CZTX 1SBJA 3EK8A 1M31A 4FQOA 1TIZA 1YX8A 2MLEC 1CTRA 4A4CA 4C0KA 1SW8A 2F8PA 2PSRA 1KK7Z 4ZCUA 1JUOA 2MRDA 2NXQA 2COLB 1G33A 1RECA 2CXJA 2PASA 1RWYA 5KU1A 1PRWA 1B4CA 1GJYA 4L9MA 2JNXA 3H4SE 1KWOB 3CLNA 1UP5A 2K7CA 2L0PA 3D10A 5I8NA 1S5GY 1VRKA 2I2RE 2IS9A 1YRUB 1K9PA 1TTXA 4P2YB 2Q91A 1MWNA 4PALA 4CFQA 2CCMA 3JVTC 4Q04A 3SG7A 1ZFSA 4MLWA 1IQ3A 4XJKA 1CLMA 1KFUS 1TCOB 3PATA 1KQVA 3D0YA 1L2OC 3EVUA 1UHNA 2P6BB 3OHMB 4GUKA 4ORBB 2CT9A 1LVCD 1NX1A 1ZUZA 2ZRTA 1DVIA 4MRXA 3KEVA 1K9KA 1XFVO 2KI6C 1NIWA 4U8DA 1JBAA 2BKHB 1H8BA 5ER5A 4AOMA 2JTZA 1FI6A 2O5GA 4I5JA 2JXLA 1DF0A 2I18A 2JU0A 4QJ3B 1AVSA 2V53A 1MQ1A 1IQ5A 1WRLA 3IQQA 4PHNA 2WC8A 2LNKA 5HYDA 3O6BA 4JPZB 2NCOA 1M63B 4C0LA 1J55A 5PALA 2KBIA 5TNCA 1KWOC 2QACA 4HRHA 2LC5A 1KFXL 2M1UA 2KOTA 2KGRA 3EK4A 4DIRA 1OSAA 1QTXA 2VRGA 4PHMA 1YTZC 2Y5IA 4YGDB 4MN0A 1B8RA 2BBNA 2GGMA 2KQ6A 1B47A 4D1EA 4N1GA 2PALA 1AUIB 1UUSA 1XYDA 1IGVA 1IKUA 4GGNA 3I5IC 1CM4A 1ZMZA 3BQ3A 4CFRA 3NXAA 4HREE 3TDIA 1FF1A 2LVIA 1LA3A 3O2PA 5DKQA 1XK4C 2KGBC 1M45A 2LHIA 1ZOTB 1CFDA 2M8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D69 A;  1A75 B;  2ZFD A;  1LIN A;  1NCX A;  5F6T A;  2JZI A;  3VRP A;  3KPX A;  4FTG A;  3TDZ A;  5CSN A;  1OQP A;  4GAO A;  2M49 B;  5CSJ A;  1BT6 A;  1DJX A;  2M9G A;  2MJW B;  1BU3 A;  1YVL A;  1Y6W A;  2LUX A;  2KAX A;  3KO0 A;  1SL9 A;  2K8M B;  1F8H A;  1NP8 A;  4GGF A;  3BOW B;  1QS7 A;  1W7J B;  2BCB A;  2SCP A;  1PVB A;  2JT8 A;  2KNE A;  2Y1M A;  4WQ3 A;  5HKW A;  5HKY A;  4MZJ A;  1FPW A;  1UHI A;  2FCE A;  1BG1 A;  2KHN A;  1FI5 A;  5HLO A;  1WRZ A;  2BCA A;  2KFH A;  2ZN9 A;  2F3Z A;  2G2B A;  3CR5 X;  4I5L B;  5DKN A;  1PVA A;  2E6W A;  2O60 A;  5IBW A;  3NSK A;  4PCW A;  4GFT A;  1DJG A;  3WHT B;  4MZK A;  3DVJ A;  1UUR A;  4CID A;  1EL4 A;  1OE9 B;  1QX2 A;  1V1F A;  3CR4 X;  2AMI A;  1QAT A;  1UHJ A;  1AJ4 A;  1BJF A;  4M2Q A;  1C7W A;  1RTP 1;  1QV0 A;  1U5I B;  1HQV A;  3GOF A;  1S6J A;  2L51 A;  3BUW B;  4MZL A;  4ORA B;  2MA2 A;  2DOQ A;  2M7L A;  3TS5 B;  1QXP A;  1MHO A;  1CDP A;  1B8C A;  1OMV A;  1QJT A;  2KYC A;  1QVI Y;  4PE7 A;  1B7T Y;  4GBA A;  2BBM A;  5FYX A;  1TOP A;  1YX7 A;  3DD4 A;  5AER A;  1OMD A;  1TNX A;  1QVI Z;  2SAS A;  1BLQ A;  2BL0 C;  1F55 A;  2A4J A;  1S3P A;  4F0Z B;  3BUN B;  3PSR A;  1YRT B;  3OP0 A;  2PRU A;  1IWQ A;  1E8A A;  1GGZ A;  1QIV A;  3BUO B;  4MSP A;  2CTN A;  1QX5 B;  2F3Y A;  2LMV A;  1NUB A;  2LE9 B;  1QIW A;  2TN4 A;  1TNW A;  2PMY A;  1CDM A;  4E68 A;  1NYA A;  1D1O A;  1XFY O;  4PHJ A;  2L98 A;  2LAP A;  3SIA A;  4PE1 A;  3JTD B;  3SJS A;  1OOJ A;  1S5G Z;  3TUY C;  1RFJ A;  1TNP A;  5HLV A;  1J7P A;  1NCZ A;  1YUS A;  1BF5 A;  2G9B A;  2F2O A;  3IQO A;  5HKZ A;  3RM1 A;  1Q80 A;  1ALV A;  1OMR A;  2LV7 A;  2K7B A;  2F2P A;  3PN7 B;  3TS5 C;  4XJK B;  4BY4 A;  2GV5 A;  1WDC B;  1B8L A;  4YBH B;  5JJG A;  4OV2 A;  2K61 A;  3CWG A;  3D0Y B;  1IJ6 A;  1J7O A;  1CB1 A;  1QV1 A;  1OZO A;  5D7F A;  1J1D A;  1NPQ A;  4I5N B;  4MRY A;  3LCP C;  1SR6 B;  1UWO A;  2ZRS A;  3SG3 A;  1SYM A;  4YGB B;  1SK6 D;  1N2D A;  1XK4 A;  4NDD A;  3WNX B;  4BY5 A;  1Y1U A;  2LMU A;  2BE4 A;  3LK0 A;  1PK0 D;  4HSZ A;  1DJZ A;  2LUC A;  1SNL A;  1BR4 B;  1JF0 A;  2RGI A;  1AHR A;  4WRI A;  4JWQ A;  2KBM A;  3OB2 B;  1WRK A;  4YGE B;  4YI9 A;  3I5F B;  1XFW O;  1SRA A;  1CDL A;  2JWW A;  4I5K A;  4R1E A;  1MR8 A;  3BUM B;  2LLS A;  1JSA A;  2M29 A;  4WQ2 A;  5CPV A;  3JTD C;  4OR9 B;  5BPJ A;  3KF9 A;  1NWD A;  1J7Q A;  1S6C A;  1F54 A;  1SCV A;  2B1U A;  2K7D A;  2OTG B;  2K0J A;  3IF7 A;  1KK8 B;  2NZ0 A;  3I5H B;  1M39 A;  2LLU A;  1CFP A;  1KQM B;  4NDB A;  1R2U A;  1WLZ A;  4MBE A;  4P5O E;  1KFU L;  1DGU A;  1H4B A;  1IJ5 A;  1KSO A;  1Y1X A;  1TN4 A;  2HET A;  1K2H A;  3AAJ A;  1G8I A;  3CTN A;  4AQJ A;  2I7A A;  1XFX O;  2MBX A;  4GNK B;  2OS8 B;  2K2A A;  1ZAC A;  4DS7 A;  3BUX B;  2LP2 A;  1SR6 C;  1PSR A;  2JXC A;  4PDZ A;  3EK7 A;  1CLL A;  2Y1N A;  3NSI A;  1PSB A;  2JC2 A;  5AAN A;  1G4Y R;  2BEC A;  3NSL A;  2WOS A;  1MXL C;  3ICB A;  2LHL A;  2LLT A;  3O4Y A;  1SCM B;  3FIA A;  1K8U A;  1QLS A;  1JFJ A;  1SL8 A;  4CPV A;  1K9U A;  1DJW A;  1K95 A;  1IG5 A;  1M46 A;  1K96 A;  2MHH A;  2KDH A;  1DMO A;  1TRF A;  2M1K B;  3LLE A;  1JFK A;  5GQQ C;  2OTG C;  1CNP A;  2LCP A;  1A2X A;  4JQ0 D;  2JQ6 A;  1XFZ O;  4PHK A;  2JOJ A;  2L4I A;  4HRG A;  1J7R A;  3O78 A;  2MAZ A;  2ZKM X;  4M2P A;  1N65 A;  3DF0 A;  4GPL B;  4DCK A;  2M3W A;  1PUL A;  1TNQ A;  1EJ3 A;  5AFP A;  2FOT A;  2OS8 C;  1BOC A;  2CNP A;  2FJU B;  3EKJ A;  1EG4 A;  2JNF A;  4CLN A;  3FS7 A;  4DRW A;  1EH2 A;  1YR5 A;  1CFF A;  2HPS A;  1RRO A;  2KAY A;  4M2O A;  4TNC A;  2JT3 A;  1W7I B;  3JVT B;  3ZWH A;  1B7T Z;  4QJ4 B;  2H61 C;  3C1V A;  4ICB A;  2L4H A;  5CSI A;  1GQM A;  1J1E A;  1OZS A;  3SG4 A;  3OB1 B;  3VGO A;  3GK2 A;  1CMF A;  1L2O B;  2KI6 D;  4ORC B;  2ZNE A;  3DVE A;  5AEQ A;  1AP4 A;  3A4U B;  3FWC A;  1MUX A;  1YUT A;  1A4P A;  4USL A;  1N0Y A;  1KK7 Y;  1AJ5 A;  3EKH A;  3GK4 X;  1IRJ A;  1QLK A;  2M0R A;  1JF2 A;  4NQG A;  2EHB A;  3DVK A;  2GGZ A;  3CR2 A;  3OX6 A;  2H2K A;  1LKJ A;  4YGA A;  4N1F A;  2KFF A;  4C0J A;  1KFX S;  1Y1A A;  1DJI A;  2NCP A;  2PVB A;  2LVJ A;  3LK1 A;  3PAL A;  4YGC B;  1JWD A;  4IL1 A;  1KCY A;  2ZN8 A;  3HX4 A;  1RK9 A;  1BOD A;  5KTY A;  1JC2 A;  1CKK A;  1QAS A;  2JUL A;  3BYA A;  3PLF B;  1CM1 A;  1FW4 A;  2L2E A;  1XVJ A;  1SPY A;  2F33 A;  3TDU A;  2JRF A;  5KSZ A;  1QX7 A;  1NX0 A;  3WXA A;  3I5I B;  2EC6 B;  3DVM A;  3CGA A;  3NSO A;  5JOL A;  4YRU A;  3SG5 A;  2LMT A;  1SKT A;  1DF0 B;  4N5X A;  1CDN A;  5K89 A;  1XO5 A;  1DJY A;  2BKI B;  2ZND A;  1WLM A;  4DUQ A;  2KAV A;  1A03 A;  1F4Q A;  2KI4 B;  1Y0V H;  2HQ8 A;  3SG6 A;  1EG3 A;  3QRX A;  1CMG A;  2JT0 A;  1F4O A;  2EGD A;  3EVR A;  2ISD A;  3FWB A;  1SMG A;  3AKB A;  2HF5 A;  3I5G B;  5J3X A;  3PM8 A;  1FBV A;  1S6I A;  3VRR A;  3F45 A;  3PN7 C;  1F71 A;  3ZNI A;  3MSE B;  4PE4 A;  1WDC C;  2WCE A;  2WCF A;  1L7Z A;  3EVV A;  5CSF A;  1HT9 A;  2M7N A;  2MLF C;  1R6P A;  2K2F A;  4PE0 A;  3LL8 B;  2I94 A;  5G08 A;  2R2I A;  1F70 A;  2M97 A;  1XFU O;  5I2Q A;  1UHH A;  1LXF C;  1NCY A;  5I2L A;  1BMO A;  1LA0 A;  5ER4 X;  1DGV A;  1A75 A;  1YVH A;  2KSP A;  2EC6 C;  2CBL A;  2BCX A;  1YUU A;  1XA5 A;  1KSM A;  4MEW A;  4XYN A;  2HQW A;  1K90 D;  2LVV A;  2KQY A;  2L5X B;  3I5F C;  1NX2 A;  2K7O A;  3WHU B;  3BOW A;  3GK1 A;  2KI4 C;  1PAL A;  3K21 A;  2LVK A;  1S36 A;  1BR1 B;  3HCM A;  3BXK A;  4OKH A;  3RLZ A;  4A4B A;  2H61 A;  4OCI A;  2Q4U A;  1YUR A;  2WOR A;  3OX5 A;  3SIB A;  3I5G C;  5AXI A;  1B9A A;  1KK8 C;  3I5H C;  1X02 A;  2LP3 A;  1KQM C;  4ZCV A;  5B8I B;  2BL0 B;  2JPT A;  5DKR A;  3VRN A;  1EXR A;  3CS1 A;  1K93 D;  1RJV A;  1S1E A;  1IH0 A;  4NDC A;  2QPT A;  3TZ1 A;  1CLB A;  2WCB A;  3A8R A;  1SY9 A;  3M0W A;  1B1G A;  1SL7 A;  4YI8 A;  1ODB A;  1GGW A;  1DT7 B;  2JTT A;  3AAK A;  1C7V A;  2BE6 A;  1U5I A;  1NX3 A;  2KFG A;  2LAN A;  2E30 A;  3DF0 B;  1NSH A;  1V1G A;  4QJ5 B;  4OVN F;  4AQI A;  2Y4Q A;  2D8N A;  3VRO A;  1WY9 A;  3KHE A;  3SG2 A;  3TUY B;  3VRQ A;  4ETO A;  2FCD A;  2NLN A;  3PFV A;  1TCF A;  1CFC A;  1SCM C;  1UHK A;  4MVF A;  1K94 A;  1ALW A;  2AAO A;  3E3R A;  1AK8 A;  1C07 A;  4GGF C;  1MF8 B;  1DJH A;  3AKA A;  2WND A;  4UPG A;  1MXE A;  1S26 D;  5I2O A;  1DTL A;  2OPO A;  1A29 A;  2KYF A;  2LM5 A;  2AUC A;  2L50 A;  3CZT X;  1SBJ A;  3EK8 A;  1M31 A;  4FQO A;  1TIZ A;  1YX8 A;  2MLE C;  1CTR A;  4A4C A;  4C0K A;  1SW8 A;  2F8P A;  2PSR A;  1KK7 Z;  4ZCU A;  1JUO A;  2MRD A;  2NXQ A;  2COL B;  1G33 A;  1REC A;  2CXJ A;  2PAS A;  1RWY A;  5KU1 A;  1PRW A;  1B4C A;  1GJY A;  4L9M A;  2JNX A;  3H4S E;  1KWO B;  3CLN A;  1UP5 A;  2K7C A;  2L0P A;  3D10 A;  5I8N A;  1S5G Y;  1VRK A;  2I2R E;  2IS9 A;  1YRU B;  1K9P A;  1TTX A;  4P2Y B;  2Q91 A;  1MWN A;  4PAL A;  4CFQ A;  2CCM A;  3JVT C;  4Q04 A;  3SG7 A;  1ZFS A;  4MLW A;  1IQ3 A;  4XJK A;  1CLM A;  1KFU S;  1TCO B;  3PAT A;  1KQV A;  3D0Y A;  1L2O C;  3EVU A;  1UHN A;  2P6B B;  3OHM B;  4GUK A;  4ORB B;  2CT9 A;  1LVC D;  1NX1 A;  1ZUZ A;  2ZRT A;  1DVI A;  4MRX A;  3KEV A;  1K9K A;  1XFV O;  2KI6 C;  1NIW A;  4U8D A;  1JBA A;  2BKH B;  1H8B A;  5ER5 A;  4AOM A;  2JTZ A;  1FI6 A;  2O5G A;  4I5J A;  2JXL A;  1DF0 A;  2I18 A;  2JU0 A;  4QJ3 B;  1AVS A;  2V53 A;  1MQ1 A;  1IQ5 A;  1WRL A;  3IQQ A;  4PHN A;  2WC8 A;  2LNK A;  5HYD A;  3O6B A;  4JPZ B;  2NCO A;  1M63 B;  4C0L A;  1J55 A;  5PAL A;  2KBI A;  5TNC A;  1KWO C;  2QAC A;  4HRH A;  2LC5 A;  1KFX L;  2M1U A;  2KOT A;  2KGR A;  3EK4 A;  4DIR A;  1OSA A;  1QTX A;  2VRG A;  4PHM A;  1YTZ C;  2Y5I A;  4YGD B;  4MN0 A;  1B8R A;  2BBN A;  2GGM A;  2KQ6 A;  1B47 A;  4D1E A;  4N1G A;  2PAL A;  1AUI B;  1UUS A;  1XYD A;  1IGV A;  1IKU A;  4GGN A;  3I5I C;  1CM4 A;  1ZMZ A;  3BQ3 A;  4CFR A;  3NXA A;  4HRE E;  3TDI A;  1FF1 A;  2LVI A;  1LA3 A;  3O2P A;  5DKQ A;  1XK4 C;  2KGB C;  1M45 A;  2LHI A;  1ZOT B;  1CFD A;  2M8U A; 
#chains in the Genus database with same CATH topology
 5D69 A;  1A75 B;  2ZFD A;  1LIN A;  1NCX A;  5F6T A;  2JZI A;  3VRP A;  3KPX A;  4FTG A;  1P28 A;  5CSN A;  1OQP A;  4GAO A;  2M49 B;  5CSJ A;  3S0B A;  3TDZ A;  1BT6 A;  2WCH A;  1DJX A;  2M9G A;  2MJW B;  1BU3 A;  1YVL A;  1Y6W A;  2LUX A;  2KAX A;  3KO0 A;  1SL9 A;  2K8M B;  1F8H A;  1NP8 A;  4GGF A;  3BOW B;  1QS7 A;  1W7J B;  2BCB A;  2SCP A;  1PVB A;  2JT8 A;  2KNE A;  2Y1M A;  1DQE A;  4WQ3 A;  5HKW A;  5HKY A;  4MZJ A;  1FPW A;  1UHI A;  2FCE A;  1BG1 A;  2KHN A;  1FI5 A;  5HLO A;  1WRZ A;  1T14 A;  2BCA A;  2KFH A;  2ZN9 A;  2F3Z A;  2G2B A;  3CR5 X;  4I5L B;  5DKN A;  4OZD A;  2JPO A;  1PVA A;  2E6W A;  3DYE A;  2O60 A;  5IBW A;  3NSK A;  3CZ0 A;  4PCW A;  4GFT A;  1DJG A;  1TWO A;  3WHT B;  3R1V A;  3DVJ A;  4MZK A;  1UUR A;  3OGN A;  4CID A;  1EL4 A;  1OE9 B;  3DXL A;  1QX2 A;  1V1F A;  3CR4 X;  2AMI A;  1DEL A;  1OOF A;  1QAT A;  1UHJ A;  1AJ4 A;  1BJF A;  4M2Q A;  1C7W A;  1RTP 1;  1QV0 A;  1U5I B;  1HQV A;  3GOF A;  1S6J A;  2L51 A;  3BUW B;  4MZL A;  2PQL A;  4ORA B;  3CYZ A;  2MA2 A;  2DOQ A;  2M7L A;  3S0D A;  3TS5 B;  3BJH A;  1QXP A;  1MHO A;  1CDP A;  1B8C A;  1OMV A;  1QJT A;  2KPH A;  2KYC A;  4F7F A;  1QVI Y;  4PE7 A;  1B7T Y;  4GBA A;  2BBM A;  3D75 A;  5FYX A;  1TUZ A;  1TOP A;  1YX7 A;  3B7A A;  3DD4 A;  5AER A;  1OMD A;  1TNX A;  1QVI Z;  2SAS A;  1BLQ A;  2BL0 C;  1F55 A;  2A4J A;  1Z2C B;  1S3P A;  1Z4H A;  4F0Z B;  3BUN B;  3PSR A;  1YRT B;  3DZT A;  1QWV A;  3OP0 A;  2PRU A;  1IWQ A;  1DEK A;  1E8A A;  1GGZ A;  1QIV A;  2WCM A;  3BUO B;  4MSP A;  2WCJ A;  2CTN A;  1QX5 B;  2F3Y A;  5D3O A;  2LMV A;  1IIO A;  1NUB A;  2LE9 B;  1QIW A;  2TN4 A;  1TNW A;  2PMY A;  1CDM A;  4E68 A;  1NYA A;  1D1O A;  1XFY O;  4PHJ A;  2L98 A;  2LAP A;  3SIA A;  5EL2 A;  4PE1 A;  3JTD B;  3SJS A;  1OOJ A;  1S5G Z;  3TUY C;  1RFJ A;  1TNP A;  2ERB A;  5HLV A;  1J7P A;  1NCZ A;  1YUS A;  1BF5 A;  2G9B A;  2F2O A;  3IQO A;  5HKZ A;  3RM1 A;  1Q80 A;  1ALV A;  1OMR A;  2LV7 A;  2K7B A;  2F2P A;  3NHI A;  3PN7 B;  3TS5 C;  4XJK B;  4BY4 A;  2GV5 A;  1WDC B;  5FI2 A;  1B8L A;  4YBH B;  5JJG A;  4OV2 A;  2K61 A;  3CWG A;  3D0Y B;  1IJ6 A;  1J7O A;  1CB1 A;  1QV1 A;  1OZO A;  5D7F A;  1J1D A;  1LS8 A;  1NPQ A;  4I5N B;  4MRY A;  3LCP C;  1SR6 B;  1UWO A;  2ZRS A;  3SG3 A;  1SYM A;  3D74 A;  1SK6 D;  1N2D A;  1XK4 A;  4NDD A;  4YGB B;  3WNX B;  4BY5 A;  1Y1U A;  2LMU A;  2QEB A;  3CZ1 A;  3DY9 A;  2BE4 A;  3LK0 A;  1PK0 D;  2WC5 A;  4HSZ A;  1DJZ A;  2LUC A;  3VB1 A;  1SNL A;  1BR4 B;  1JF0 A;  2RGI A;  1AHR A;  4WRI A;  4JWQ A;  2KBM A;  3OB2 B;  1WRK A;  4YGE B;  4YI9 A;  3I5F B;  1XFW O;  1SRA A;  1CDL A;  2JWW A;  4I5K A;  4R1E A;  3N7H A;  1MR8 A;  2QEO A;  3BUM B;  2LLS A;  1JSA A;  2M29 A;  4WQ2 A;  5CPV A;  3JTD C;  4OR9 B;  5BPJ A;  3KF9 A;  1NWD A;  1J7Q A;  1S6C A;  1F54 A;  1SCV A;  2B1U A;  2K7D A;  2OTG B;  3B6X A;  2K0J A;  2L2C A;  3IF7 A;  1KK8 B;  2NZ0 A;  3I5H B;  1M39 A;  2LLU A;  1CFP A;  1KQM B;  3D78 A;  3IVT A;  4NDB A;  1R2U A;  1WLZ A;  4MBE A;  1W9Z A;  4P5O E;  1KFU L;  1DGU A;  1H4B A;  1IJ5 A;  1KSO A;  1Y1X A;  1OOH A;  1TN4 A;  2HET A;  1K2H A;  3AAJ A;  1G8I A;  3CTN A;  4AQJ A;  3UO9 A;  2P70 A;  2I7A A;  1XFX O;  2MBX A;  3FE9 A;  2OS8 B;  4GNK B;  2K2A A;  1ZAC A;  4DS7 A;  3BUX B;  2LP2 A;  1SR6 C;  1PSR A;  2JXC A;  4PDZ A;  1XFR A;  3EK7 A;  1CLL A;  2Y1N A;  3NSI A;  1PSB A;  2FJY A;  2JC2 A;  5AAN A;  1G4Y R;  2BEC A;  3NSL A;  2WOS A;  1MXL C;  3ICB A;  2LHL A;  2LLT A;  3O4Y A;  1SCM B;  3FIA A;  1K8U A;  1QLS A;  1JFJ A;  1SL8 A;  4CPV A;  1K9U A;  1DJW A;  1K95 A;  1IG5 A;  2YGU A;  2WC6 A;  1M46 A;  1K96 A;  2MHH A;  3UNW A;  2KDH A;  1DMO A;  1TRF A;  2M1K B;  3LLE A;  1JFK A;  5GQQ C;  2OTG C;  1CNP A;  2LCP A;  1A2X A;  4JQ0 D;  2JQ6 A;  1XFZ O;  4PHK A;  2JOJ A;  2L4I A;  4HRG A;  1J7R A;  3O78 A;  2MAZ A;  2ZKM X;  4M2P A;  1N65 A;  3DF0 A;  4GPL B;  4DCK A;  2M3W A;  1PUL A;  1TNQ A;  1EJ3 A;  1DC1 A;  5AFP A;  4KYN A;  2FOT A;  2OS8 C;  1ORG A;  1BOC A;  2CNP A;  2FJU B;  3EKJ A;  1EG4 A;  2JNF A;  4CLN A;  3FS7 A;  4DRW A;  3B87 A;  1EH2 A;  1YR5 A;  1CFF A;  2HPS A;  1RRO A;  2KAY A;  4M2O A;  4TNC A;  2JT3 A;  1W7I B;  3JVT B;  2WCL A;  3ZWH A;  1B7T Z;  4QJ4 B;  2H61 C;  3C1V A;  3CAB A;  2L4H A;  4ICB A;  1GQM A;  5CSI A;  1J1E A;  1OZS A;  3SG4 A;  3OB1 B;  3VGO A;  3GK2 A;  1CMF A;  1L2O B;  2KI6 D;  4ORC B;  2ZNE A;  3DVE A;  5AEQ A;  1AP4 A;  3A4U B;  3FWC A;  1MUX A;  1YUT A;  1A4P A;  4USL A;  1N0Y A;  1KK7 Y;  1AJ5 A;  3EKH A;  3GK4 X;  1IRJ A;  3PJI A;  1QLK A;  4INX A;  2M0R A;  1JF2 A;  4NQG A;  2EHB A;  3DVK A;  2GGZ A;  3CR2 A;  3OX6 A;  2H2K A;  1LKJ A;  4YGA A;  4PT1 A;  4N1F A;  2KFF A;  4C0J A;  1KFX S;  1DJI A;  2NCP A;  2PVB A;  2LVJ A;  3LK1 A;  3PAL A;  3BFH A;  4YGC B;  1JWD A;  3D76 A;  4IL1 A;  1KCY A;  2ZN8 A;  3HX4 A;  3FE6 A;  1RK9 A;  1BOD A;  2BNX A;  5KTY A;  1GM0 A;  1JC2 A;  5FI6 A;  1CKK A;  3CDN A;  1QAS A;  2JUL A;  5HL1 A;  3BYA A;  3PLF B;  1CM1 A;  3BFB A;  1FW4 A;  2L2E A;  4JD9 A;  3SS4 A;  1XVJ A;  1SPY A;  2GTE A;  2F33 A;  3B88 A;  3OBV A;  4JKT A;  3TDU A;  2JRF A;  5KSZ A;  1QX7 A;  1NX0 A;  3WXA A;  2P71 A;  3I5I B;  2EC6 B;  3DVM A;  3CGA A;  3FE8 A;  3NSO A;  5JOL A;  4YRU A;  3SG5 A;  2LMT A;  1SKT A;  3SS5 A;  1DF0 B;  4N5X A;  1CDN A;  5K89 A;  1XO5 A;  1DJY A;  2BKI B;  2ZND A;  1WLM A;  3S0G A;  4DUQ A;  2KAV A;  1A03 A;  1F4Q A;  2KI4 B;  1Y0V H;  2HQ8 A;  2L5Y A;  3SG6 A;  1EG3 A;  3QRX A;  1CMG A;  2JT0 A;  1F4O A;  2EGD A;  3EVR A;  3Q8I A;  2ISD A;  3FWB A;  1SMG A;  3AKB A;  2HF5 A;  3I5G B;  4INW A;  5J3X A;  3PM8 A;  1FBV A;  1S6I A;  3VRR A;  3L47 A;  3S0A A;  3F45 A;  3PN7 C;  1F71 A;  1SSE B;  3MSE B;  4PE4 A;  1WDC C;  3ZNI A;  2WCE A;  2WCF A;  1L7Z A;  3EVV A;  5CSF A;  1HT9 A;  2PYQ A;  2M7N A;  2MLF C;  1R6P A;  2K2F A;  4PE0 A;  3LL8 B;  2I94 A;  5G08 A;  2R2I A;  1F70 A;  2M97 A;  1XFU O;  5I2Q A;  1UHH A;  1LXF C;  3B86 A;  1NCY A;  5I2L A;  1BMO A;  1LA0 A;  5ER4 X;  1DGV A;  1A75 A;  1YVH A;  2KSP A;  2EC6 C;  2CBL A;  2BCX A;  1ZOT B;  1YUU A;  1KSM A;  1XA5 A;  4MEW A;  4XYN A;  2HQW A;  1K90 D;  2LVV A;  2KQY A;  2L5X B;  3R1P A;  3I5F C;  1NX2 A;  2K7O A;  3WHU B;  3BOW A;  3GK1 A;  2KI4 C;  1PAL A;  3K21 A;  2LVK A;  1S36 A;  1BR1 B;  3HCM A;  3BXK A;  3BFA A;  4OKH A;  3QME A;  3RLZ A;  4A4B A;  2H61 A;  4OCI A;  2Q4U A;  2H8V A;  1YUR A;  2WOR A;  3OX5 A;  3R72 A;  3SIB A;  3I5G C;  5AXI A;  1B9A A;  1KK8 C;  3I5H C;  1X02 A;  2LP3 A;  1KQM C;  4ZCV A;  5B8I B;  2BL0 B;  2JPT A;  5DKR A;  3VRN A;  5I94 A;  1EXR A;  3CS1 A;  1K93 D;  1RJV A;  1S1E A;  1IH0 A;  4NDC A;  2QPT A;  3TZ1 A;  3R1O A;  1CLB A;  2WCB A;  3A8R A;  1SY9 A;  3M0W A;  1B1G A;  1SL7 A;  4YI8 A;  1ODB A;  1GGW A;  5FI7 A;  1DT7 B;  2JTT A;  3AAK A;  1C7V A;  2BE6 A;  1U5I A;  1OOG A;  1NX3 A;  2KFG A;  2LAN A;  4IJ7 A;  2E30 A;  2KLD A;  3DF0 B;  1NSH A;  1V1G A;  4QJ5 B;  4OVN F;  4AQI A;  2Y4Q A;  1C3Z A;  2D8N A;  3VRO A;  1WY9 A;  3KHE A;  3K1E A;  3SG2 A;  3TUY B;  3EG5 B;  3VRQ A;  2FCD A;  4ETO A;  2NLN A;  3PFV A;  1TCF A;  2QDI A;  1CFC A;  1SCM C;  1UHK A;  4MVF A;  1K94 A;  1ALW A;  2AAO A;  3E3R A;  1AK8 A;  1C07 A;  4GGF C;  1MF8 B;  1DJH A;  3AKA A;  2WND A;  4UPG A;  1MXE A;  1S26 D;  5I2O A;  1DTL A;  2OPO A;  1A29 A;  2KYF A;  2LM5 A;  2AUC A;  2L50 A;  3CZT X;  1SBJ A;  3EK8 A;  1M31 A;  4FQO A;  5DIC A;  1TIZ A;  1YX8 A;  1OOI X;  1CTR A;  2MLE C;  4A4C A;  4C0K A;  1SW8 A;  2F8P A;  2PSR A;  1C3Y A;  1KK7 Z;  4ZCU A;  1JUO A;  2MRD A;  2NXQ A;  2COL B;  1G33 A;  1REC A;  2CXJ A;  2PAS A;  1RWY A;  5KU1 A;  2QEV A;  1PRW A;  2KLE A;  1B4C A;  1GJY A;  4L9M A;  2JNX A;  1OW4 A;  3NGV A;  3H4S E;  1KWO B;  3CLN A;  1UP5 A;  2K7C A;  2L0P A;  3D10 A;  5I8N A;  1S5G Y;  1VRK A;  2I2R E;  3D73 A;  2IS9 A;  1YRU B;  1K9P A;  1TTX A;  4P2Y B;  2Q91 A;  1MWN A;  4PAL A;  4CFQ A;  2CCM A;  3JVT C;  4Q04 A;  3SG7 A;  1ZFS A;  4MLW A;  1IQ3 A;  4XJK A;  1CLM A;  1KFU S;  3L4L A;  1TUJ A;  1TCO B;  3NHT A;  3PAT A;  1KQV A;  3D0Y A;  2WCK A;  1L2O C;  3CZ2 A;  3EVU A;  2QEH A;  1UHN A;  2P6B B;  3OHM B;  4GUK A;  4ORB B;  2BAP A;  3L4A A;  2CT9 A;  1LVC D;  1NX1 A;  1ZUZ A;  2ZRT A;  1DVI A;  4MRX A;  3KEV A;  1K9K A;  1XFV O;  2KI6 C;  1NIW A;  4U8D A;  1JBA A;  2BKH B;  1H8B A;  5ER5 A;  4AOM A;  2JTZ A;  1FI6 A;  2O5G A;  4I5J A;  2JXL A;  1DF0 A;  3V2L A;  2I18 A;  2JU0 A;  4QJ3 B;  1AVS A;  2V53 A;  1MQ1 A;  3S0F A;  1IQ5 A;  1WRL A;  3IQQ A;  4PHN A;  2WC8 A;  2LNK A;  5HYD A;  3O6B A;  4JPZ B;  2NCO A;  1M63 B;  4C0L A;  1J55 A;  5PAL A;  2KBI A;  5TNC A;  1KWO C;  2QAC A;  3D77 A;  4HRH A;  3PM2 A;  2LC5 A;  1KFX L;  2M1U A;  3O4X A;  2KOT A;  2KGR A;  3EK4 A;  4DIR A;  1OSA A;  2K60 A;  1QTX A;  2VRG A;  4PHM A;  1YTZ C;  2Y5I A;  4YGD B;  4MN0 A;  1B8R A;  2BBN A;  4FQT A;  2GGM A;  2KQ6 A;  1B47 A;  4D1E A;  4N1G A;  2PAL A;  1AUI B;  1UUS A;  1XYD A;  1IGV A;  1IKU A;  3S0E A;  4GGN A;  3I5I C;  1CM4 A;  1ZMZ A;  3BQ3 A;  4CFR A;  3NXA A;  4HRE E;  3SS3 A;  3TDI A;  2LVI A;  1LA3 A;  3O2P A;  1FF1 A;  5DKQ A;  1XK4 C;  2KGB C;  1M45 A;  3RZS A;  2LHI A;  1Y1A A;  1CFD A;  2M8U A; 
#chains in the Genus database with same CATH homology
 5D69 A;  1A75 B;  2ZFD A;  1LIN A;  1NCX A;  5F6T A;  2JZI A;  3VRP A;  3KPX A;  4FTG A;  3TDZ A;  5CSN A;  1OQP A;  4GAO A;  2M49 B;  5CSJ A;  1BT6 A;  1DJX A;  2M9G A;  2MJW B;  1BU3 A;  1YVL A;  1Y6W A;  2LUX A;  2KAX A;  3KO0 A;  1SL9 A;  2K8M B;  1F8H A;  1NP8 A;  4GGF A;  3BOW B;  1QS7 A;  1W7J B;  2BCB A;  2SCP A;  1PVB A;  2JT8 A;  2KNE A;  2Y1M A;  4WQ3 A;  5HKW A;  5HKY A;  4MZJ A;  1FPW A;  1UHI A;  2FCE A;  1BG1 A;  2KHN A;  1FI5 A;  5HLO A;  1WRZ A;  2BCA A;  2KFH A;  2ZN9 A;  2F3Z A;  2G2B A;  3CR5 X;  4I5L B;  5DKN A;  1PVA A;  2E6W A;  2O60 A;  5IBW A;  3NSK A;  4PCW A;  4GFT A;  1DJG A;  3WHT B;  4MZK A;  3DVJ A;  1UUR A;  4CID A;  1EL4 A;  1OE9 B;  1QX2 A;  1V1F A;  3CR4 X;  2AMI A;  1QAT A;  1UHJ A;  1AJ4 A;  1BJF A;  4M2Q A;  1C7W A;  1RTP 1;  1QV0 A;  1U5I B;  1HQV A;  3GOF A;  1S6J A;  2L51 A;  3BUW B;  4MZL A;  4ORA B;  2MA2 A;  2DOQ A;  2M7L A;  3TS5 B;  1QXP A;  1MHO A;  1CDP A;  1B8C A;  1OMV A;  1QJT A;  2KYC A;  1QVI Y;  4PE7 A;  1B7T Y;  4GBA A;  2BBM A;  5FYX A;  1TOP A;  1YX7 A;  3DD4 A;  5AER A;  1OMD A;  1TNX A;  1QVI Z;  2SAS A;  1BLQ A;  2BL0 C;  1F55 A;  2A4J A;  1S3P A;  4F0Z B;  3BUN B;  3PSR A;  1YRT B;  3OP0 A;  2PRU A;  1IWQ A;  1E8A A;  1GGZ A;  1QIV A;  3BUO B;  4MSP A;  2CTN A;  1QX5 B;  2F3Y A;  2LMV A;  1NUB A;  2LE9 B;  1QIW A;  2TN4 A;  1TNW A;  2PMY A;  1CDM A;  4E68 A;  1NYA A;  1D1O A;  1XFY O;  4PHJ A;  2L98 A;  2LAP A;  3SIA A;  4PE1 A;  3JTD B;  3SJS A;  1OOJ A;  1S5G Z;  3TUY C;  1RFJ A;  1TNP A;  5HLV A;  1J7P A;  1NCZ A;  1YUS A;  1BF5 A;  2G9B A;  2F2O A;  3IQO A;  5HKZ A;  3RM1 A;  1Q80 A;  1ALV A;  1OMR A;  2LV7 A;  2K7B A;  2F2P A;  3PN7 B;  3TS5 C;  4XJK B;  4BY4 A;  2GV5 A;  1WDC B;  1B8L A;  4YBH B;  5JJG A;  4OV2 A;  2K61 A;  3CWG A;  3D0Y B;  1IJ6 A;  1J7O A;  1CB1 A;  1QV1 A;  1OZO A;  5D7F A;  1J1D A;  1NPQ A;  4I5N B;  4MRY A;  3LCP C;  1SR6 B;  1UWO A;  2ZRS A;  3SG3 A;  1SYM A;  4YGB B;  1SK6 D;  1N2D A;  1XK4 A;  4NDD A;  3WNX B;  4BY5 A;  1Y1U A;  2LMU A;  2BE4 A;  3LK0 A;  1PK0 D;  4HSZ A;  1DJZ A;  2LUC A;  1SNL A;  1BR4 B;  1JF0 A;  2RGI A;  1AHR A;  4WRI A;  4JWQ A;  2KBM A;  3OB2 B;  1WRK A;  4YGE B;  4YI9 A;  3I5F B;  1XFW O;  1SRA A;  1CDL A;  2JWW A;  4I5K A;  4R1E A;  1MR8 A;  3BUM B;  2LLS A;  1JSA A;  2M29 A;  4WQ2 A;  5CPV A;  3JTD C;  4OR9 B;  5BPJ A;  3KF9 A;  1NWD A;  1J7Q A;  1S6C A;  1F54 A;  1SCV A;  2B1U A;  2K7D A;  2OTG B;  2K0J A;  3IF7 A;  1KK8 B;  2NZ0 A;  3I5H B;  1M39 A;  2LLU A;  1CFP A;  1KQM B;  4NDB A;  1R2U A;  1WLZ A;  4MBE A;  4P5O E;  1KFU L;  1DGU A;  1H4B A;  1IJ5 A;  1KSO A;  1Y1X A;  1TN4 A;  2HET A;  1K2H A;  3AAJ A;  1G8I A;  3CTN A;  4AQJ A;  2I7A A;  1XFX O;  2MBX A;  4GNK B;  2OS8 B;  2K2A A;  1ZAC A;  4DS7 A;  3BUX B;  2LP2 A;  1SR6 C;  1PSR A;  2JXC A;  4PDZ A;  3EK7 A;  1CLL A;  2Y1N A;  3NSI A;  1PSB A;  2JC2 A;  5AAN A;  1G4Y R;  2BEC A;  3NSL A;  2WOS A;  1MXL C;  3ICB A;  2LHL A;  2LLT A;  3O4Y A;  1SCM B;  3FIA A;  1K8U A;  1QLS A;  1JFJ A;  1SL8 A;  4CPV A;  1K9U A;  1DJW A;  1K95 A;  1IG5 A;  1M46 A;  1K96 A;  2MHH A;  2KDH A;  1DMO A;  1TRF A;  2M1K B;  3LLE A;  1JFK A;  5GQQ C;  2OTG C;  1CNP A;  2LCP A;  1A2X A;  4JQ0 D;  2JQ6 A;  1XFZ O;  4PHK A;  2JOJ A;  2L4I A;  4HRG A;  1J7R A;  3O78 A;  2MAZ A;  2ZKM X;  4M2P A;  1N65 A;  3DF0 A;  4GPL B;  4DCK A;  2M3W A;  1PUL A;  1TNQ A;  1EJ3 A;  5AFP A;  2FOT A;  2OS8 C;  1BOC A;  2CNP A;  2FJU B;  3EKJ A;  1EG4 A;  2JNF A;  4CLN A;  3FS7 A;  4DRW A;  1EH2 A;  1YR5 A;  1CFF A;  2HPS A;  1RRO A;  2KAY A;  4M2O A;  4TNC A;  2JT3 A;  1W7I B;  3JVT B;  3ZWH A;  1B7T Z;  4QJ4 B;  2H61 C;  3C1V A;  4ICB A;  2L4H A;  5CSI A;  1GQM A;  1J1E A;  1OZS A;  3SG4 A;  3OB1 B;  3VGO A;  3GK2 A;  1CMF A;  1L2O B;  2KI6 D;  4ORC B;  2ZNE A;  3DVE A;  5AEQ A;  1AP4 A;  3A4U B;  3FWC A;  1MUX A;  1YUT A;  1A4P A;  4USL A;  1N0Y A;  1KK7 Y;  1AJ5 A;  3EKH A;  3GK4 X;  1IRJ A;  1QLK A;  2M0R A;  1JF2 A;  4NQG A;  2EHB A;  3DVK A;  2GGZ A;  3CR2 A;  3OX6 A;  2H2K A;  1LKJ A;  4YGA A;  4N1F A;  2KFF A;  4C0J A;  1KFX S;  1Y1A A;  1DJI A;  2NCP A;  2PVB A;  2LVJ A;  3LK1 A;  3PAL A;  4YGC B;  1JWD A;  4IL1 A;  1KCY A;  2ZN8 A;  3HX4 A;  1RK9 A;  1BOD A;  5KTY A;  1JC2 A;  1CKK A;  1QAS A;  2JUL A;  3BYA A;  3PLF B;  1CM1 A;  1FW4 A;  2L2E A;  1XVJ A;  1SPY A;  2F33 A;  3TDU A;  2JRF A;  5KSZ A;  1QX7 A;  1NX0 A;  3WXA A;  3I5I B;  2EC6 B;  3DVM A;  3CGA A;  3NSO A;  5JOL A;  4YRU A;  3SG5 A;  2LMT A;  1SKT A;  1DF0 B;  4N5X A;  1CDN A;  5K89 A;  1XO5 A;  1DJY A;  2BKI B;  2ZND A;  1WLM A;  4DUQ A;  2KAV A;  1A03 A;  1F4Q A;  2KI4 B;  1Y0V H;  2HQ8 A;  3SG6 A;  1EG3 A;  3QRX A;  1CMG A;  2JT0 A;  1F4O A;  2EGD A;  3EVR A;  2ISD A;  3FWB A;  1SMG A;  3AKB A;  2HF5 A;  3I5G B;  5J3X A;  3PM8 A;  1FBV A;  1S6I A;  3VRR A;  3F45 A;  3PN7 C;  1F71 A;  3ZNI A;  3MSE B;  4PE4 A;  1WDC C;  2WCE A;  2WCF A;  1L7Z A;  3EVV A;  5CSF A;  1HT9 A;  2M7N A;  2MLF C;  1R6P A;  2K2F A;  4PE0 A;  3LL8 B;  2I94 A;  5G08 A;  2R2I A;  1F70 A;  2M97 A;  1XFU O;  5I2Q A;  1UHH A;  1LXF C;  1NCY A;  5I2L A;  1BMO A;  1LA0 A;  5ER4 X;  1DGV A;  1A75 A;  1YVH A;  2KSP A;  2EC6 C;  2CBL A;  2BCX A;  1YUU A;  1XA5 A;  1KSM A;  4MEW A;  4XYN A;  2HQW A;  1K90 D;  2LVV A;  2KQY A;  2L5X B;  3I5F C;  1NX2 A;  2K7O A;  3WHU B;  3BOW A;  3GK1 A;  2KI4 C;  1PAL A;  3K21 A;  2LVK A;  1S36 A;  1BR1 B;  3HCM A;  3BXK A;  4OKH A;  3RLZ A;  4A4B A;  2H61 A;  4OCI A;  2Q4U A;  1YUR A;  2WOR A;  3OX5 A;  3SIB A;  3I5G C;  5AXI A;  1B9A A;  1KK8 C;  3I5H C;  1X02 A;  2LP3 A;  1KQM C;  4ZCV A;  5B8I B;  2BL0 B;  2JPT A;  5DKR A;  3VRN A;  1EXR A;  3CS1 A;  1K93 D;  1RJV A;  1S1E A;  1IH0 A;  4NDC A;  2QPT A;  3TZ1 A;  1CLB A;  2WCB A;  3A8R A;  1SY9 A;  3M0W A;  1B1G A;  1SL7 A;  4YI8 A;  1ODB A;  1GGW A;  1DT7 B;  2JTT A;  3AAK A;  1C7V A;  2BE6 A;  1U5I A;  1NX3 A;  2KFG A;  2LAN A;  2E30 A;  3DF0 B;  1NSH A;  1V1G A;  4QJ5 B;  4OVN F;  4AQI A;  2Y4Q A;  2D8N A;  3VRO A;  1WY9 A;  3KHE A;  3SG2 A;  3TUY B;  3VRQ A;  4ETO A;  2FCD A;  2NLN A;  3PFV A;  1TCF A;  1CFC A;  1SCM C;  1UHK A;  4MVF A;  1K94 A;  1ALW A;  2AAO A;  3E3R A;  1AK8 A;  1C07 A;  4GGF C;  1MF8 B;  1DJH A;  3AKA A;  2WND A;  4UPG A;  1MXE A;  1S26 D;  5I2O A;  1DTL A;  2OPO A;  1A29 A;  2KYF A;  2LM5 A;  2AUC A;  2L50 A;  3CZT X;  1SBJ A;  3EK8 A;  1M31 A;  4FQO A;  1TIZ A;  1YX8 A;  2MLE C;  1CTR A;  4A4C A;  4C0K A;  1SW8 A;  2F8P A;  2PSR A;  1KK7 Z;  4ZCU A;  1JUO A;  2MRD A;  2NXQ A;  2COL B;  1G33 A;  1REC A;  2CXJ A;  2PAS A;  1RWY A;  5KU1 A;  1PRW A;  1B4C A;  1GJY A;  4L9M A;  2JNX A;  3H4S E;  1KWO B;  3CLN A;  1UP5 A;  2K7C A;  2L0P A;  3D10 A;  5I8N A;  1S5G Y;  1VRK A;  2I2R E;  2IS9 A;  1YRU B;  1K9P A;  1TTX A;  4P2Y B;  2Q91 A;  1MWN A;  4PAL A;  4CFQ A;  2CCM A;  3JVT C;  4Q04 A;  3SG7 A;  1ZFS A;  4MLW A;  1IQ3 A;  4XJK A;  1CLM A;  1KFU S;  1TCO B;  3PAT A;  1KQV A;  3D0Y A;  1L2O C;  3EVU A;  1UHN A;  2P6B B;  3OHM B;  4GUK A;  4ORB B;  2CT9 A;  1LVC D;  1NX1 A;  1ZUZ A;  2ZRT A;  1DVI A;  4MRX A;  3KEV A;  1K9K A;  1XFV O;  2KI6 C;  1NIW A;  4U8D A;  1JBA A;  2BKH B;  1H8B A;  5ER5 A;  4AOM A;  2JTZ A;  1FI6 A;  2O5G A;  4I5J A;  2JXL A;  1DF0 A;  2I18 A;  2JU0 A;  4QJ3 B;  1AVS A;  2V53 A;  1MQ1 A;  1IQ5 A;  1WRL A;  3IQQ A;  4PHN A;  2WC8 A;  2LNK A;  5HYD A;  3O6B A;  4JPZ B;  2NCO A;  1M63 B;  4C0L A;  1J55 A;  5PAL A;  2KBI A;  5TNC A;  1KWO C;  2QAC A;  4HRH A;  2LC5 A;  1KFX L;  2M1U A;  2KOT A;  2KGR A;  3EK4 A;  4DIR A;  1OSA A;  1QTX A;  2VRG A;  4PHM A;  1YTZ C;  2Y5I A;  4YGD B;  4MN0 A;  1B8R A;  2BBN A;  2GGM A;  2KQ6 A;  1B47 A;  4D1E A;  4N1G A;  2PAL A;  1AUI B;  1UUS A;  1XYD A;  1IGV A;  1IKU A;  4GGN A;  3I5I C;  1CM4 A;  1ZMZ A;  3BQ3 A;  4CFR A;  3NXA A;  4HRE E;  3TDI A;  1FF1 A;  2LVI A;  1LA3 A;  3O2P A;  5DKQ A;  1XK4 C;  2KGB C;  1M45 A;  2LHI A;  1ZOT B;  1CFD A;  2M8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...