2LP2A

Solution structure and dynamics of human s100a1 protein modified at cysteine 85 with homocysteine disulfide bond formation in calcium saturated form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of calcium binding and thionylation of S100A1 protein on its nuclear magnetic resonance-derived structure and backbone dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A1
total genus 27
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lp2A00
1LA3A 2L4HA 2JWWA 1C7VA 4CFRA 2I18A 1YX7A 4GGNA 2M0RA 2MBXA 3SG4A 4YGEB 1DJWA 1K9UA 1KQMB 3CWGA 4OCIA 2G2BA 1YUUA 2MJWB 4MRYA 2K61A 4YBHB 1XVJA 4YI9A 5GQQC 2Y1MA 1OZOA 2CTNA 2F2PA 1NYAA 1NX2A 3PM8A 3I5GB 4PALA 4GAOA 3IQOA 1Y6WA 1BLQA 1J7PA 1C7WA 3SIBA 2CNPA 1UHNA 1TNXA 1ZOTB 2KDHA 3DF0A 1MR8A 1ZFSA 1DJYA 1XFYO 2MLEC 1BF5A 1HT9A 5AFPA 3LLEA 4MEWA 3ZNIA 2KI6D 2MA2A 4PE0A 5DKRA 3TS5B 4A4BA 2COLB 1PVAA 4ICBA 5PALA 2FCDA 1F71A 1M45A 1KFUS 5CSIA 2PMYA 1CLBA 1JFKA 3CZTX 4Q04A 1KWOC 2LP3A 2I94A 1S1EA 5JJGA 1WDCB 4C0KA 1TNQA 2MRDA 1PSRA 3DVMA 1CLLA 4GGFC 4F0ZB 2PASA 1QTXA 1UURA 1F55A 1DJXA 1S5GZ 2BBMA 1SMGA 4HSZA 4MRXA 1B9AA 1J55A 1TRFA 5ER5A 1DTLA 4NDCA 2AAOA 2OS8C 4PHJA 4M2OA 1NUBA 1NP8A 2Y5IA 5I8NA 3BYAA 4E68A 2WCBA 3SG5A 1PRWA 1L2OC 1S6CA 1OQPA 2L5XB 2KFGA 1XA5A 1BR4B 3O2PA 2HF5A 1W7JB 2KAXA 2ISDA 2GGZA 1C07A 1XFXO 4M2PA 1G4YR 1TNPA 1NSHA 5ER4X 2JXLA 3SG6A 1FPWA 1JFJA 2PRUA 2BKHB 4I5LB 5JOLA 2WNDA 1NX3A 1IJ6A 1S5GY 2F2OA 3TZ1A 1MXLC 2JQ6A 1CFDA 1XO5A 3SJSA 5HKYA 1BR1B 2LMUA 1DJGA 1L2OB 1MWNA 2JRFA 3CLNA 4GBAA 2KNEA 2WCEA 5CPVA 2CT9A 2LHLA 4AQJA 1U5IB 2H61C 2SASA 3HX4A 1Y1UA 3I5HB 3TDUA 1EG4A 1SBJA 2BCXA 3VRRA 1JBAA 2M7NA 1VRKA 3SG2A 1EL4A 1V1GA 1SKTA 1WDCC 3WXAA 3BUWB 1PALA 1SL7A 1CMFA 2BBNA 1EH2A 2I2RE 4DUQA 1KWOB 4I5JA 1LKJA 2KI4B 3PSRA 1DVIA 2LAPA 4JQ0D 4MN0A 2K2FA 4ETOA 3EKHA 2KAVA 1FI6A 4WRIA 2M29A 5IBWA 1SCMC 2K7DA 2KSPA 2JC2A 1KQVA 4PE1A 1B7TY 3SG7A 2FJUB 2F33A 1A29A 3VRQA 1H8BA 1JF0A 3JTDB 1HQVA 5AEQA 1K2HA 3NSKA 1NX0A 3QRXA 4GPLB 4XJKB 5HLOA 1QVIY 1QIVA 1Y0VH 5DKQA 1SRAA 3CR4X 4GFTA 5D69A 2KAYA 4MSPA 4BY4A 1BODA 1QASA 2BE4A 2LVVA 3CS1A 4ZCUA 4PHNA 1R2UA 4CFQA 5CSNA 2FOTA 1SL9A 2KBIA 1D1OA 2LVIA 3CTNA 4NDBA 1NCZA 2E6WA 1LINA 4MBEA 3D10A 4OV2A 4I5NB 1AUIB 1YUTA 1AK8A 3PN7B 2R2IA 1DMOA 2LCPA 1S6JA 3WNXB 2K0JA 4GUKA 2LHIA 4C0LA 5KSZA 2RGIA 4ORAB 1OE9B 1CFCA 1WLZA 1QIWA 1S3PA 1MUXA 2Y4QA 4P5OE 4ORBB 2AMIA 3DVKA 1PULA 1J1DA 1WY9A 1YURA 1XFVO 2WOSA 1CNPA 1F4OA 2ZFDA 5AANA 4UPGA 1IWQA 4PE4A 1K90D 2MHHA 2M8UA 1BMOA 3HCMA 1XK4A 1TOPA 1YRUB 2F3YA 2JZIA 2KFHA 3CGAA 3KO0A 1SCMB 2K7CA 2M97A 4ORCB 1GGWA 2CCMA 4M2QA 4D1EA 1PVBA 2NCOA 2O60A 2ZN8A 3NSLA 3OHMB 2KHNA 5F6TA 4QJ4B 1LA0A 2OPOA 2NCPA 2PALA 2OTGC 1K9PA 3D0YA 4L9MA 1QJTA 1XYDA 4JWQA 1IQ5A 1UHIA 1NIWA 2JNFA 2QACA 1XK4C 1Y1AA 2KQYA 1SYMA 1QXPA 4DCKA 3NSOA 1CDNA 2I7AA 1KQMC 1B1GA 1KSOA 1CB1A 3FWBA 1IGVA 3LK0A 1EJ3A 3BUOB 3CR5X 1Q80A 2CBLA 1XFUO 4CIDA 2M49B 1V1FA 4YGCB 2SCPA 3K21A 1LXFC 1S36A 2LLTA 1NWDA 1QV1A 1RFJA 2PSRA 2EC6B 3OP0A 4N1FA 2K7OA 1SW8A 1EXRA 1K96A 2ZN9A 4N5XA 2L2EA 1YVLA 2E30A 2K2AA 3WHUB 2GGMA 1QV0A 1MXEA 5HKWA 2LM5A 1JUOA 3IQQA 1AP4A 4GGFA 1MQ1A 2JXCA 1GJYA 1NCYA 3KEVA 2BCAA 1SR6B 1NCXA 1DT7B 3NXAA 3KPXA 5DKNA 2KBMA 1A03A 1KSMA 1S26D 1BT6A 2JPTA 1CFFA 1SK6D 1G8IA 2EGDA 2L4IA 1WRLA 2JTZA 4YI8A 3VRNA 1B47A 2OTGB 2M3WA 1K93D 2NLNA 1JSAA 3BQ3A 2LP2A 1F4QA 4CLNA 1RTP1 1IH0A 1QATA 4MLWA 1SCVA 2GV5A 1GQMA 3I5FB 2A4JA 1BG1A 1MF8B 2K7BA 2KGRA 1DGVA 1F8HA 2M1KB 3AKAA 1YX8A 3I5HC 4P2YB 3OB1B 1M46A 4AOMA 1DF0B 1KK8B 2F3ZA 2WC8A 1RK9A 1UUSA 2LUCA 2BKIB 5FYXA 3GK2A 1CM4A 1BJFA 1OMRA 3CR2A 4IL1A 2HETA 1KFXS 2FCEA 3EVUA 3O4YA 2ZKMX 3FS7A 3PFVA 2LANA 2ZNEA 3EK8A 3I5IB 1NX1A 1DGUA 2KYCA 3ZWHA 4ZCVA 5KTYA 1TTXA 4PDZA 1FBVA 1M31A 5B8IB 1UHHA 3FWCA 3OB2B 2LNKA 1PSBA 1OMDA 4BY5A 2F8PA 3VROA 5I2LA 3SG3A 2CXJA 4N1GA 2M1UA 1ZMZA 1JWDA 3D0YB 3F45A 3BOWB 4YGAA 1CFPA 4NQGA 1R6PA 3C1VA 1JC2A 2L50A 2H2KA 3GK4X 3O6BA 1B8RA 3WHTB 1UWOA 3IF7A 4DIRA 2OS8B 4C0JA 3PATA 1OMVA 1LVCD 4PHKA 2KI6C 3TUYB 3LL8B 1CDMA 5G08A 4NDDA 2L51A 1ALVA 3MSEB 4JPZB 3RLZA 1PK0D 1CTRA 1WRZA 4CPVA 1YR5A 1CMGA 1B4CA 2ZNDA 2BL0B 5AERA 3JTDC 5BPJA 4WQ3A 1A2XA 4I5KA 3KF9A 4U8DA 2JT0A 2L98A 1S6IA 1RROA 1UHJA 2JT3A 3BXKA 3EVVA 2BECA 1W7IB 4MZKA 4QJ5B 1OSAA 1BOCA 1F70A 2JT8A 1IKUA 4HRGA 2BL0C 4PE7A 2AUCA 1TCFA 2B1UA 1K94A 3TDIA 2JOJA 2LMVA 3E3RA 1K95A 2PVBA 1SY9A 1ODBA 1WRKA 3TUYC 5D7FA 3DF0B 2LLSA 1AHRA 1YTZC 2LVJA 5J3XA 1EG3A 1YUSA 2M9GA 2G9BA 1OOJA 2HQWA 1A75B 3GOFA 2EHBA 4XJKA 2WORA 2LVKA 1CDPA 1KK7Y 5K89A 2BE6A 2Y1NA 3PN7C 2DOQA 1B8CA 1L7ZA 5I2OA 2KI4C 3AAKA 1FI5A 2HQ8A 2JU0A 1CLMA 1N0YA 4GNKB 1QS7A 1GGZA 1MHOA 1ZUZA 3KHEA 4OR9B 5HLVA 3LCPC 4HRHA 1IRJA 1QX5B 1K9KA 4YRUA 2LUXA 3VRPA 1UP5A 3EK7A 1DF0A 5TNCA 2L0PA 1QX2A 2LMTA 1KFXL 3PALA 5I2QA 4MZLA 3JVTC 4AQIA 5HKZA 3LK1A 1UHKA 3TDZA 1J1EA 3BUXB 3RM1A 2MAZA 1BU3A 2KQ6A 3EKJA 1RWYA 2D8NA 3JVTB 2NZ0A 4OKHA 1IJ5A 1IG5A 1KFUL 1B8LA 1AJ5A 2IS9A 1M39A 3AAJA 1OZSA 2QPTA 1YVHA 1SPYA 5CSJA 1U5IA 1SNLA 1F54A 1ALWA 2P6BB 3EK4A 1G33A 2LE9B 3EVRA 1QLKA 3OX6A 1YRTB 2JNXA 3PLFB 1A75A 2ZRTA 3NSIA 4DRWA 4HREE 3FIAA 3A8RA 3I5IC 2M7LA 1Y1XA 1FF1A 1QLSA 1TCOB 1KCYA 1B7TZ 3TS5C 2KOTA 1XFWO 2LV7A 3H4SE 1TIZA 3O78A 3VGOA 1E8AA 1X02A 2Q91A 2KYFA 2TN4A 3ICBA 1DJZA 2H61A 3A4UB 2VRGA 2MLFC 3GK1A 1KK8C 1QX7A 1ZACA 1NPQA 4FQOA 4FTGA 1AJ4A 3BUMB 3DVEA 5CSFA 4TNCA 2KFFA 4OVNF 4PCWA 3I5FC 1J7RA 4DS7A 1TNWA 2LLUA 2EC6C 4A4CA 1TN4A 3BUNB 4PHMA 1N65A 4MVFA 1K8UA 4WQ2A 5AXIA 5KU1A 2NXQA 3SIAA 4USLA 4YGBB 1CM1A 1N2DA 2V53A 2JTTA 1M63B 2Q4UA 1SR6C 1J7QA 2WCFA 1J7OA 1CDLA 1FW4A 4R1EA 2HPSA 3I5GC 2KGBC 1XFZO 3AKBA 4QJ3B 3OX5A 3BOWA 1IQ3A 1RECA 2BCBA 1A4PA 2K8MB 2LC5A 4XYNA 1CKKA 2O5GA 2ZRSA 1WLMA 1DJHA 1H4BA 1KK7Z 5HYDA 1SL8A 1JF2A 1RJVA 4MZJA 4YGDB 3DVJA 3M0WA 1AVSA 1QVIZ 1DJIA 2JULA 3DD4A
chains in the Genus database with same CATH superfamily
1LA3A 2L4HA 2JWWA 3UNWA 1C7VA 4CFRA 2I18A 1YX7A 4GGNA 2M0RA 5DICA 2MBXA 4YGEB 3SG4A 1DJWA 1K9UA 1KQMB 3CWGA 4OCIA 2G2BA 1YUUA 2MJWB 4MRYA 2K61A 4YBHB 1XVJA 4YI9A 5GQQC 2Y1MA 1OZOA 2CTNA 2F2PA 1NYAA 1NX2A 3NGVA 3I5GB 3PM8A 4PALA 4GAOA 3IQOA 1Y6WA 1BLQA 1J7PA 1C7WA 3SIBA 2CNPA 3CZ0A 1UHNA 1TNXA 1ZOTB 2KDHA 3DF0A 1MR8A 1ZFSA 1DJYA 1XFYO 2MLEC 1BF5A 5FI2A 1HT9A 5AFPA 3LLEA 4MEWA 3ZNIA 2KI6D 2MA2A 2QEHA 4PE0A 5DKRA 3TS5B 2COLB 1PVAA 2KLEA 4A4BA 4ICBA 5PALA 2FCDA 1F71A 1M45A 1KFUS 3FE6A 5CSIA 2PMYA 1CLBA 1JFKA 3CZTX 4Q04A 3PJIA 1KWOC 2LP3A 2I94A 1S1EA 3B87A 3OGNA 5JJGA 3DY9A 1WDCB 4C0KA 1TNQA 2GTEA 1PSRA 2MRDA 1CLLA 3DVMA 4GGFC 4F0ZB 2PASA 1QTXA 1UURA 1F55A 1DJXA 1S5GZ 2BBMA 1SMGA 4HSZA 4MRXA 1B9AA 1J55A 3S0BA 1TRFA 5ER5A 1DTLA 4NDCA 2AAOA 2OS8C 4PHJA 3SS3A 4M2OA 1NUBA 1NP8A 1T14A 2Y5IA 3BYAA 5I8NA 2WCBA 2P71A 4E68A 3SG5A 1PRWA 1L2OC 3D75A 3S0AA 1S6CA 1OQPA 2L5XB 2KFGA 3BFAA 1XA5A 1BR4B 3O2PA 5EL2A 2HF5A 1W7JB 2KAXA 2ISDA 2BNXA 2GGZA 1C07A 1XFXO 3Q8IA 4M2PA 1G4YR 1TNPA 1NSHA 1ORGA 5ER4X 2JXLA 3SG6A 1FPWA 1JFJA 2PRUA 2BKHB 4I5LB 2ERBA 5JOLA 3CZ1A 2WNDA 1NX3A 1IJ6A 1S5GY 2F2OA 3S0GA 1MXLC 2JQ6A 1CFDA 1XO5A 3SJSA 3TZ1A 1BR1B 2LMUA 1DJGA 1L2OB 2P70A 1MWNA 2JRFA 3CLNA 4GBAA 2KNEA 2WCKA 2WCEA 5CPVA 2CT9A 2LHLA 4AQJA 1U5IB 2H61C 1C3ZA 2SASA 3HX4A 1Y1UA 3I5HB 3TDUA 1GM0A 1EG4A 1SBJA 2BCXA 3VRRA 2JPOA 1JBAA 2M7NA 1VRKA 3SG2A 1EL4A 1V1GA 1SKTA 1WDCC 3WXAA 3BUWB 1PALA 1SL7A 1CMFA 2BBNA 1EH2A 2I2RE 4DUQA 1KWOB 3DXLA 4I5JA 1LKJA 2KI4B 3PSRA 1DVIA 2LAPA 4JQ0D 4MN0A 2K2FA 4ETOA 3EKHA 2KAVA 5FI7A 1FI6A 4WRIA 2M29A 5IBWA 3L4LA 1SCMC 2K7DA 2KSPA 2JC2A 1KQVA 4PE1A 1B7TY 3SG7A 2FJUB 2F33A 1A29A 3VRQA 1H8BA 1JF0A 1P28A 1HQVA 3JTDB 5AEQA 1K2HA 2QEVA 3NSKA 1NX0A 3QRXA 4GPLB 4XJKB 5HLOA 1DEKA 1QVIY 1QIVA 1Y0VH 5DKQA 1SRAA 3CR4X 4GFTA 5D69A 2KAYA 2PQLA 4MSPA 4BY4A 1BODA 1QASA 2BE4A 2LVVA 3CS1A 4ZCUA 4PHNA 1R2UA 4CFQA 5CSNA 2FOTA 1SL9A 2KBIA 1D1OA 2LVIA 3L47A 3CTNA 4NDBA 1NCZA 4INXA 2E6WA 1LINA 4MBEA 3D10A 2WCHA 2WC5A 4OV2A 4I5NB 1AUIB 1YUTA 1AK8A 3PN7B 2R2IA 1DMOA 2LCPA 1S6JA 4KYNA 3WNXB 2K0JA 4GUKA 2LHIA 4C0LA 5KSZA 2RGIA 4ORAB 1OE9B 2L2CA 1CFCA 1WLZA 1QIWA 1S3PA 1MUXA 2Y4QA 4P5OE 4ORBB 2AMIA 3DVKA 1PULA 4OZDA 1J1DA 1DQEA 1WY9A 1YURA 1XFVO 2WOSA 3SS4A 1CNPA 1F4OA 2ZFDA 5AANA 4UPGA 1IWQA 5D3OA 2PYQA 4PE4A 1K90D 2MHHA 2M8UA 1BMOA 3HCMA 1XK4A 1TOPA 1YRUB 2F3YA 2JZIA 2KFHA 3CGAA 3KO0A 1SCMB 3NHIA 2K7CA 2M97A 4ORCB 1GGWA 2CCMA 4M2QA 4D1EA 1PVBA 2NCOA 2O60A 2ZN8A 3NSLA 3OHMB 2KHNA 5F6TA 4QJ4B 1LA0A 2OPOA 2NCPA 2PALA 2OTGC 1K9PA 3D0YA 4L9MA 1QJTA 1XYDA 4JWQA 1IQ5A 1UHIA 1NIWA 2JNFA 2QACA 1XK4C 1Y1AA 2KQYA 1SYMA 1QXPA 4DCKA 5HL1A 3NSOA 3CABA 1CDNA 2I7AA 2QEOA 1KQMC 1B1GA 1KSOA 4PT1A 3FWBA 1IGVA 1CB1A 3LK0A 1EJ3A 3BUOB 3CR5X 3R1VA 4JKTA 1Q80A 2CBLA 1XFUO 4CIDA 2M49B 1V1FA 3B6XA 4YGCB 3B88A 2SCPA 1C3YA 3K21A 1LXFC 1S36A 2LLTA 1NWDA 1QV1A 1RFJA 2WC6A 2PSRA 1SSEB 4JD9A 2EC6B 3OP0A 4N1FA 2K7OA 1SW8A 1EXRA 1K96A 2ZN9A 1TUZA 2YGUA 4N5XA 1OOIX 2L2EA 1YVLA 2E30A 2K2AA 3BFHA 3WHUB 2GGMA 1QV0A 2WCLA 1MXEA 5HKWA 2LM5A 1JUOA 3IQQA 1AP4A 4GGFA 1MQ1A 2JXCA 1GJYA 1NCYA 3KEVA 2BCAA 1SR6B 1NCXA 3BFBA 4IJ7A 3NXAA 1DT7B 3KPXA 5DKNA 2KBMA 1A03A 1KSMA 3QMEA 1S26D 1BT6A 2JPTA 3EG5B 1SK6D 1G8IA 2EGDA 2L4IA 3L4AA 1WRLA 2JTZA 4YI8A 3VRNA 1B47A 3FE9A 3D76A 2OTGB 2M3WA 1K93D 2NLNA 1JSAA 3BQ3A 2LP2A 1F4QA 4CLNA 1RTP1 1IH0A 1QATA 4MLWA 1SCVA 2GV5A 1GQMA 3I5FB 2A4JA 1BG1A 1MF8B 2K7BA 2KGRA 1DGVA 1F8HA 2M1KB 3AKAA 1YX8A 3I5HC 4P2YB 3OB1B 1M46A 4AOMA 1DF0B 1KK8B 2BAPA 2F3ZA 3BJHA 2WC8A 1RK9A 1QWVA 1UUSA 2LUCA 2BKIB 5FYXA 3GK2A 1CM4A 3S0FA 1BJFA 1OMRA 3N7HA 3CR2A 4IL1A 1DC1A 2HETA 1KFXS 2FCEA 3EVUA 3O4YA 2ZKMX 1Z2CB 3FS7A 3IVTA 2LANA 3PFVA 2ZNEA 3EK8A 2QEBA 3I5IB 1NX1A 1DGUA 2KYCA 3ZWHA 4ZCVA 5KTYA 1TTXA 4PDZA 1FBVA 1M31A 5B8IB 1UHHA 3FWCA 3OB2B 2LNKA 1PSBA 1XFRA 1OMDA 4BY5A 2F8PA 3VROA 3R72A 5I2LA 5HKYA 3SG3A 1LS8A 2CXJA 3D77A 4N1GA 2M1UA 1ZMZA 1JWDA 3RZSA 3D0YB 3B86A 3F45A 3BOWB 4YGAA 1CFPA 4NQGA 1R6PA 3C1VA 3S0DA 2L50A 1JC2A 3V2LA 2FJYA 2H2KA 3GK4X 3D73A 5I94A 3UO9A 1OOHA 3K1EA 3O6BA 1B8RA 3WHTB 1UWOA 3IF7A 4DIRA 2OS8B 4C0JA 3PATA 1OMVA 1LVCD 4PHKA 2KI6C 3TUYB 3LL8B 1CDMA 5G08A 4NDDA 2L51A 1ALVA 3MSEB 4JPZB 3RLZA 1PK0D 1CTRA 1WRZA 4CPVA 1YR5A 1CMGA 1B4CA 2ZNDA 1OOGA 2BL0B 5AERA 2L5YA 3JTDC 3DZTA 1OW4A 4WQ3A 2WCMA 5BPJA 1CFFA 1A2XA 4I5KA 3KF9A 4U8DA 2JT0A 2L98A 3CZ2A 1S6IA 1RROA 1UHJA 2JT3A 3BXKA 3EVVA 2BECA 1W7IB 4MZKA 4QJ5B 1OSAA 1BOCA 1F70A 2JT8A 1IKUA 4HRGA 2BL0C 2KLDA 4PE7A 2AUCA 1TCFA 2B1UA 1K94A 3TDIA 2JOJA 3B7AA 2LMVA 3E3RA 1K95A 2PVBA 1SY9A 1ODBA 1WRKA 3TUYC 5D7FA 3DF0B 3R1PA 2LLSA 1AHRA 1YTZC 2LVJA 5J3XA 1EG3A 1YUSA 2M9GA 2G9BA 1OOJA 2HQWA 1A75B 3GOFA 2EHBA 4XJKA 3NHTA 2WORA 2LVKA 1CDPA 1KK7Y 3S0EA 2BE6A 5K89A 3D78A 2Y1NA 3PN7C 2DOQA 1IIOA 1TUJA 1B8CA 2QDIA 1L7ZA 5I2OA 2KI4C 3AAKA 1FI5A 2HQ8A 2JU0A 1CLMA 1N0YA 4GNKB 1QS7A 1GGZA 1MHOA 1ZUZA 3KHEA 4OR9B 5HLVA 3LCPC 4HRHA 1IRJA 1QX5B 1K9KA 5FI6A 2LUXA 3VRPA 4YRUA 1UP5A 3EK7A 1DF0A 1OOFA 5TNCA 3VB1A 2L0PA 1QX2A 1W9ZA 2LMTA 1KFXL 2H8VA 3PALA 5I2QA 4MZLA 1Z4HA 3JVTC 4AQIA 5HKZA 3LK1A 3D74A 1UHKA 3R1OA 1J1EA 3TDZA 3BUXB 3RM1A 2MAZA 1BU3A 2KQ6A 3EKJA 1RWYA 2D8NA 3JVTB 2NZ0A 4OKHA 1IJ5A 3CDNA 1IG5A 1KFUL 1B8LA 1AJ5A 2IS9A 1M39A 3AAJA 1OZSA 2QPTA 1YVHA 1SPYA 5CSJA 1U5IA 1SNLA 1F54A 1ALWA 2P6BB 2WCJA 3EK4A 1G33A 2LE9B 3EVRA 1QLKA 3OBVA 3OX6A 1YRTB 2JNXA 3PLFB 1A75A 2ZRTA 3NSIA 4DRWA 4HREE 3FIAA 3A8RA 3I5IC 2M7LA 1Y1XA 1FF1A 1QLSA 1TCOB 3CYZA 1KCYA 2K60A 1B7TZ 3TS5C 2KOTA 1XFWO 2LV7A 3H4SE 1TIZA 3O78A 3VGOA 1E8AA 1X02A 2Q91A 2KYFA 2TN4A 3ICBA 1DJZA 2H61A 3A4UB 2VRGA 2MLFC 3GK1A 1KK8C 1QX7A 1ZACA 1NPQA 3PM2A 4FQOA 4FTGA 1AJ4A 3BUMB 3DVEA 5CSFA 4TNCA 3O4XA 2KFFA 4OVNF 4F7FA 4PCWA 3FE8A 3I5FC 1J7RA 4DS7A 1TNWA 2LLUA 2EC6C 4INWA 3SS5A 2KPHA 4A4CA 1TN4A 3BUNB 4PHMA 1N65A 4MVFA 1K8UA 4WQ2A 1TWOA 5AXIA 5KU1A 2NXQA 3SIAA 4USLA 4YGBB 1CM1A 1N2DA 2V53A 2JTTA 1M63B 2Q4UA 1SR6C 1J7QA 2WCFA 1J7OA 1CDLA 1FW4A 4R1EA 2HPSA 3I5GC 2KGBC 1XFZO 3AKBA 3DYEA 4QJ3B 3OX5A 3BOWA 1IQ3A 1RECA 2BCBA 1A4PA 2K8MB 2LC5A 4XYNA 1CKKA 2O5GA 2ZRSA 1WLMA 1DJHA 1H4BA 1KK7Z 5HYDA 1SL8A 1JF2A 1RJVA 4MZJA 4YGDB 3DVJA 4FQTA 3M0WA 1AVSA 1QVIZ 1DELA 1DJIA 2JULA 3DD4A
chains in the Genus database with same CATH topology
1LA3A 2L4HA 2JWWA 1C7VA 4CFRA 2I18A 1YX7A 4GGNA 2M0RA 2MBXA 3SG4A 4YGEB 1DJWA 1K9UA 1KQMB 3CWGA 4OCIA 2G2BA 1YUUA 2MJWB 4MRYA 2K61A 4YBHB 1XVJA 4YI9A 5GQQC 2Y1MA 1OZOA 2CTNA 2F2PA 1NYAA 1NX2A 3PM8A 3I5GB 4PALA 4GAOA 3IQOA 1Y6WA 1BLQA 1J7PA 1C7WA 3SIBA 2CNPA 1UHNA 1TNXA 1ZOTB 2KDHA 3DF0A 1MR8A 1ZFSA 1DJYA 1XFYO 2MLEC 1BF5A 1HT9A 5AFPA 3LLEA 4MEWA 3ZNIA 2KI6D 2MA2A 4PE0A 5DKRA 3TS5B 4A4BA 2COLB 1PVAA 4ICBA 5PALA 2FCDA 1F71A 1M45A 1KFUS 5CSIA 2PMYA 1CLBA 1JFKA 3CZTX 4Q04A 1KWOC 2LP3A 2I94A 1S1EA 5JJGA 1WDCB 4C0KA 1TNQA 2MRDA 1PSRA 3DVMA 1CLLA 4GGFC 4F0ZB 2PASA 1QTXA 1UURA 1F55A 1DJXA 1S5GZ 2BBMA 1SMGA 4HSZA 4MRXA 1B9AA 1J55A 1TRFA 5ER5A 1DTLA 4NDCA 2AAOA 2OS8C 4PHJA 4M2OA 1NUBA 1NP8A 2Y5IA 5I8NA 3BYAA 4E68A 2WCBA 3SG5A 1PRWA 1L2OC 1S6CA 1OQPA 2L5XB 2KFGA 1XA5A 1BR4B 3O2PA 2HF5A 1W7JB 2KAXA 2ISDA 2GGZA 1C07A 1XFXO 4M2PA 1G4YR 1TNPA 1NSHA 5ER4X 2JXLA 3SG6A 1FPWA 1JFJA 2PRUA 2BKHB 4I5LB 5JOLA 2WNDA 1NX3A 1IJ6A 1S5GY 2F2OA 3TZ1A 1MXLC 2JQ6A 1CFDA 1XO5A 3SJSA 5HKYA 1BR1B 2LMUA 1DJGA 1L2OB 1MWNA 2JRFA 3CLNA 4GBAA 2KNEA 2WCEA 5CPVA 2CT9A 2LHLA 4AQJA 1U5IB 2H61C 2SASA 3HX4A 1Y1UA 3I5HB 3TDUA 1EG4A 1SBJA 2BCXA 3VRRA 1JBAA 2M7NA 1VRKA 3SG2A 1EL4A 1V1GA 1SKTA 1WDCC 3WXAA 3BUWB 1PALA 1SL7A 1CMFA 2BBNA 1EH2A 2I2RE 4DUQA 1KWOB 4I5JA 1LKJA 2KI4B 3PSRA 1DVIA 2LAPA 4JQ0D 4MN0A 2K2FA 4ETOA 3EKHA 2KAVA 1FI6A 4WRIA 2M29A 5IBWA 1SCMC 2K7DA 2KSPA 2JC2A 1KQVA 4PE1A 1B7TY 3SG7A 2FJUB 2F33A 1A29A 3VRQA 1H8BA 1JF0A 3JTDB 1HQVA 5AEQA 1K2HA 3NSKA 1NX0A 3QRXA 4GPLB 4XJKB 5HLOA 1QVIY 1QIVA 1Y0VH 5DKQA 1SRAA 3CR4X 4GFTA 5D69A 2KAYA 4MSPA 4BY4A 1BODA 1QASA 2BE4A 2LVVA 3CS1A 4ZCUA 4PHNA 1R2UA 4CFQA 5CSNA 2FOTA 1SL9A 2KBIA 1D1OA 2LVIA 3CTNA 4NDBA 1NCZA 2E6WA 1LINA 4MBEA 3D10A 4OV2A 4I5NB 1AUIB 1YUTA 1AK8A 3PN7B 2R2IA 1DMOA 2LCPA 1S6JA 3WNXB 2K0JA 4GUKA 2LHIA 4C0LA 5KSZA 2RGIA 4ORAB 1OE9B 1CFCA 1WLZA 1QIWA 1S3PA 1MUXA 2Y4QA 4P5OE 4ORBB 2AMIA 3DVKA 1PULA 1J1DA 1WY9A 1YURA 1XFVO 2WOSA 1CNPA 1F4OA 2ZFDA 5AANA 4UPGA 1IWQA 4PE4A 1K90D 2MHHA 2M8UA 1BMOA 3HCMA 1XK4A 1TOPA 1YRUB 2F3YA 2JZIA 2KFHA 3CGAA 3KO0A 1SCMB 2K7CA 2M97A 4ORCB 1GGWA 2CCMA 4M2QA 4D1EA 1PVBA 2NCOA 2O60A 2ZN8A 3NSLA 3OHMB 2KHNA 5F6TA 4QJ4B 1LA0A 2OPOA 2NCPA 2PALA 2OTGC 1K9PA 3D0YA 4L9MA 1QJTA 1XYDA 4JWQA 1IQ5A 1UHIA 1NIWA 2JNFA 2QACA 1XK4C 1Y1AA 2KQYA 1SYMA 1QXPA 4DCKA 3NSOA 1CDNA 2I7AA 1KQMC 1B1GA 1KSOA 1CB1A 3FWBA 1IGVA 3LK0A 1EJ3A 3BUOB 3CR5X 1Q80A 2CBLA 1XFUO 4CIDA 2M49B 1V1FA 4YGCB 2SCPA 3K21A 1LXFC 1S36A 2LLTA 1NWDA 1QV1A 1RFJA 2PSRA 2EC6B 3OP0A 4N1FA 2K7OA 1SW8A 1EXRA 1K96A 2ZN9A 4N5XA 2L2EA 1YVLA 2E30A 2K2AA 3WHUB 2GGMA 1QV0A 1MXEA 5HKWA 2LM5A 1JUOA 3IQQA 1AP4A 4GGFA 1MQ1A 2JXCA 1GJYA 1NCYA 3KEVA 2BCAA 1SR6B 1NCXA 1DT7B 3NXAA 3KPXA 5DKNA 2KBMA 1A03A 1KSMA 1S26D 1BT6A 2JPTA 1CFFA 1SK6D 1G8IA 2EGDA 2L4IA 1WRLA 2JTZA 4YI8A 3VRNA 1B47A 2OTGB 2M3WA 1K93D 2NLNA 1JSAA 3BQ3A 2LP2A 1F4QA 4CLNA 1RTP1 1IH0A 1QATA 4MLWA 1SCVA 2GV5A 1GQMA 3I5FB 2A4JA 1BG1A 1MF8B 2K7BA 2KGRA 1DGVA 1F8HA 2M1KB 3AKAA 1YX8A 3I5HC 4P2YB 3OB1B 1M46A 4AOMA 1DF0B 1KK8B 2F3ZA 2WC8A 1RK9A 1UUSA 2LUCA 2BKIB 5FYXA 3GK2A 1CM4A 1BJFA 1OMRA 3CR2A 4IL1A 2HETA 1KFXS 2FCEA 3EVUA 3O4YA 2ZKMX 3FS7A 3PFVA 2LANA 2ZNEA 3EK8A 3I5IB 1NX1A 1DGUA 2KYCA 3ZWHA 4ZCVA 5KTYA 1TTXA 4PDZA 1FBVA 1M31A 5B8IB 1UHHA 3FWCA 3OB2B 2LNKA 1PSBA 1OMDA 4BY5A 2F8PA 3VROA 5I2LA 3SG3A 2CXJA 4N1GA 2M1UA 1ZMZA 1JWDA 3D0YB 3F45A 3BOWB 4YGAA 1CFPA 4NQGA 1R6PA 3C1VA 1JC2A 2L50A 2H2KA 3GK4X 3O6BA 1B8RA 3WHTB 1UWOA 3IF7A 4DIRA 2OS8B 4C0JA 3PATA 1OMVA 1LVCD 4PHKA 2KI6C 3TUYB 3LL8B 1CDMA 5G08A 4NDDA 2L51A 1ALVA 3MSEB 4JPZB 3RLZA 1PK0D 1CTRA 1WRZA 4CPVA 1YR5A 1CMGA 1B4CA 2ZNDA 2BL0B 5AERA 3JTDC 5BPJA 4WQ3A 1A2XA 4I5KA 3KF9A 4U8DA 2JT0A 2L98A 1S6IA 1RROA 1UHJA 2JT3A 3BXKA 3EVVA 2BECA 1W7IB 4MZKA 4QJ5B 1OSAA 1BOCA 1F70A 2JT8A 1IKUA 4HRGA 2BL0C 4PE7A 2AUCA 1TCFA 2B1UA 1K94A 3TDIA 2JOJA 2LMVA 3E3RA 1K95A 2PVBA 1SY9A 1ODBA 1WRKA 3TUYC 5D7FA 3DF0B 2LLSA 1AHRA 1YTZC 2LVJA 5J3XA 1EG3A 1YUSA 2M9GA 2G9BA 1OOJA 2HQWA 1A75B 3GOFA 2EHBA 4XJKA 2WORA 2LVKA 1CDPA 1KK7Y 5K89A 2BE6A 2Y1NA 3PN7C 2DOQA 1B8CA 1L7ZA 5I2OA 2KI4C 3AAKA 1FI5A 2HQ8A 2JU0A 1CLMA 1N0YA 4GNKB 1QS7A 1GGZA 1MHOA 1ZUZA 3KHEA 4OR9B 5HLVA 3LCPC 4HRHA 1IRJA 1QX5B 1K9KA 4YRUA 2LUXA 3VRPA 1UP5A 3EK7A 1DF0A 5TNCA 2L0PA 1QX2A 2LMTA 1KFXL 3PALA 5I2QA 4MZLA 3JVTC 4AQIA 5HKZA 3LK1A 1UHKA 3TDZA 1J1EA 3BUXB 3RM1A 2MAZA 1BU3A 2KQ6A 3EKJA 1RWYA 2D8NA 3JVTB 2NZ0A 4OKHA 1IJ5A 1IG5A 1KFUL 1B8LA 1AJ5A 2IS9A 1M39A 3AAJA 1OZSA 2QPTA 1YVHA 1SPYA 5CSJA 1U5IA 1SNLA 1F54A 1ALWA 2P6BB 3EK4A 1G33A 2LE9B 3EVRA 1QLKA 3OX6A 1YRTB 2JNXA 3PLFB 1A75A 2ZRTA 3NSIA 4DRWA 4HREE 3FIAA 3A8RA 3I5IC 2M7LA 1Y1XA 1FF1A 1QLSA 1TCOB 1KCYA 1B7TZ 3TS5C 2KOTA 1XFWO 2LV7A 3H4SE 1TIZA 3O78A 3VGOA 1E8AA 1X02A 2Q91A 2KYFA 2TN4A 3ICBA 1DJZA 2H61A 3A4UB 2VRGA 2MLFC 3GK1A 1KK8C 1QX7A 1ZACA 1NPQA 4FQOA 4FTGA 1AJ4A 3BUMB 3DVEA 5CSFA 4TNCA 2KFFA 4OVNF 4PCWA 3I5FC 1J7RA 4DS7A 1TNWA 2LLUA 2EC6C 4A4CA 1TN4A 3BUNB 4PHMA 1N65A 4MVFA 1K8UA 4WQ2A 5AXIA 5KU1A 2NXQA 3SIAA 4USLA 4YGBB 1CM1A 1N2DA 2V53A 2JTTA 1M63B 2Q4UA 1SR6C 1J7QA 2WCFA 1J7OA 1CDLA 1FW4A 4R1EA 2HPSA 3I5GC 2KGBC 1XFZO 3AKBA 4QJ3B 3OX5A 3BOWA 1IQ3A 1RECA 2BCBA 1A4PA 2K8MB 2LC5A 4XYNA 1CKKA 2O5GA 2ZRSA 1WLMA 1DJHA 1H4BA 1KK7Z 5HYDA 1SL8A 1JF2A 1RJVA 4MZJA 4YGDB 3DVJA 3M0WA 1AVSA 1QVIZ 1DJIA 2JULA 3DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LA3 A;  2L4H A;  2JWW A;  1C7V A;  4CFR A;  2I18 A;  1YX7 A;  4GGN A;  2M0R A;  2MBX A;  3SG4 A;  4YGE B;  1DJW A;  1K9U A;  1KQM B;  3CWG A;  4OCI A;  2G2B A;  1YUU A;  2MJW B;  4MRY A;  2K61 A;  4YBH B;  1XVJ A;  4YI9 A;  5GQQ C;  2Y1M A;  1OZO A;  2CTN A;  2F2P A;  1NYA A;  1NX2 A;  3PM8 A;  3I5G B;  4PAL A;  4GAO A;  3IQO A;  1Y6W A;  1BLQ A;  1J7P A;  1C7W A;  3SIB A;  2CNP A;  1UHN A;  1TNX A;  1ZOT B;  2KDH A;  3DF0 A;  1MR8 A;  1ZFS A;  1DJY A;  1XFY O;  2MLE C;  1BF5 A;  1HT9 A;  5AFP A;  3LLE A;  4MEW A;  3ZNI A;  2KI6 D;  2MA2 A;  4PE0 A;  5DKR A;  3TS5 B;  4A4B A;  2COL B;  1PVA A;  4ICB A;  5PAL A;  2FCD A;  1F71 A;  1M45 A;  1KFU S;  5CSI A;  2PMY A;  1CLB A;  1JFK A;  3CZT X;  4Q04 A;  1KWO C;  2LP3 A;  2I94 A;  1S1E A;  5JJG A;  1WDC B;  4C0K A;  1TNQ A;  2MRD A;  1PSR A;  3DVM A;  1CLL A;  4GGF C;  4F0Z B;  2PAS A;  1QTX A;  1UUR A;  1F55 A;  1DJX A;  1S5G Z;  2BBM A;  1SMG A;  4HSZ A;  4MRX A;  1B9A A;  1J55 A;  1TRF A;  5ER5 A;  1DTL A;  4NDC A;  2AAO A;  2OS8 C;  4PHJ A;  4M2O A;  1NUB A;  1NP8 A;  2Y5I A;  5I8N A;  3BYA A;  4E68 A;  2WCB A;  3SG5 A;  1PRW A;  1L2O C;  1S6C A;  1OQP A;  2L5X B;  2KFG A;  1XA5 A;  1BR4 B;  3O2P A;  2HF5 A;  1W7J B;  2KAX A;  2ISD A;  2GGZ A;  1C07 A;  1XFX O;  4M2P A;  1G4Y R;  1TNP A;  1NSH A;  5ER4 X;  2JXL A;  3SG6 A;  1FPW A;  1JFJ A;  2PRU A;  2BKH B;  4I5L B;  5JOL A;  2WND A;  1NX3 A;  1IJ6 A;  1S5G Y;  2F2O A;  3TZ1 A;  1MXL C;  2JQ6 A;  1CFD A;  1XO5 A;  3SJS A;  5HKY A;  1BR1 B;  2LMU A;  1DJG A;  1L2O B;  1MWN A;  2JRF A;  3CLN A;  4GBA A;  2KNE A;  2WCE A;  5CPV A;  2CT9 A;  2LHL A;  4AQJ A;  1U5I B;  2H61 C;  2SAS A;  3HX4 A;  1Y1U A;  3I5H B;  3TDU A;  1EG4 A;  1SBJ A;  2BCX A;  3VRR A;  1JBA A;  2M7N A;  1VRK A;  3SG2 A;  1EL4 A;  1V1G A;  1SKT A;  1WDC C;  3WXA A;  3BUW B;  1PAL A;  1SL7 A;  1CMF A;  2BBN A;  1EH2 A;  2I2R E;  4DUQ A;  1KWO B;  4I5J A;  1LKJ A;  2KI4 B;  3PSR A;  1DVI A;  2LAP A;  4JQ0 D;  4MN0 A;  2K2F A;  4ETO A;  3EKH A;  2KAV A;  1FI6 A;  4WRI A;  2M29 A;  5IBW A;  1SCM C;  2K7D A;  2KSP A;  2JC2 A;  1KQV A;  4PE1 A;  1B7T Y;  3SG7 A;  2FJU B;  2F33 A;  1A29 A;  3VRQ A;  1H8B A;  1JF0 A;  3JTD B;  1HQV A;  5AEQ A;  1K2H A;  3NSK A;  1NX0 A;  3QRX A;  4GPL B;  4XJK B;  5HLO A;  1QVI Y;  1QIV A;  1Y0V H;  5DKQ A;  1SRA A;  3CR4 X;  4GFT A;  5D69 A;  2KAY A;  4MSP A;  4BY4 A;  1BOD A;  1QAS A;  2BE4 A;  2LVV A;  3CS1 A;  4ZCU A;  4PHN A;  1R2U A;  4CFQ A;  5CSN A;  2FOT A;  1SL9 A;  2KBI A;  1D1O A;  2LVI A;  3CTN A;  4NDB A;  1NCZ A;  2E6W A;  1LIN A;  4MBE A;  3D10 A;  4OV2 A;  4I5N B;  1AUI B;  1YUT A;  1AK8 A;  3PN7 B;  2R2I A;  1DMO A;  2LCP A;  1S6J A;  3WNX B;  2K0J A;  4GUK A;  2LHI A;  4C0L A;  5KSZ A;  2RGI A;  4ORA B;  1OE9 B;  1CFC A;  1WLZ A;  1QIW A;  1S3P A;  1MUX A;  2Y4Q A;  4P5O E;  4ORB B;  2AMI A;  3DVK A;  1PUL A;  1J1D A;  1WY9 A;  1YUR A;  1XFV O;  2WOS A;  1CNP A;  1F4O A;  2ZFD A;  5AAN A;  4UPG A;  1IWQ A;  4PE4 A;  1K90 D;  2MHH A;  2M8U A;  1BMO A;  3HCM A;  1XK4 A;  1TOP A;  1YRU B;  2F3Y A;  2JZI A;  2KFH A;  3CGA A;  3KO0 A;  1SCM B;  2K7C A;  2M97 A;  4ORC B;  1GGW A;  2CCM A;  4M2Q A;  4D1E A;  1PVB A;  2NCO A;  2O60 A;  2ZN8 A;  3NSL A;  3OHM B;  2KHN A;  5F6T A;  4QJ4 B;  1LA0 A;  2OPO A;  2NCP A;  2PAL A;  2OTG C;  1K9P A;  3D0Y A;  4L9M A;  1QJT A;  1XYD A;  4JWQ A;  1IQ5 A;  1UHI A;  1NIW A;  2JNF A;  2QAC A;  1XK4 C;  1Y1A A;  2KQY A;  1SYM A;  1QXP A;  4DCK A;  3NSO A;  1CDN A;  2I7A A;  1KQM C;  1B1G A;  1KSO A;  1CB1 A;  3FWB A;  1IGV A;  3LK0 A;  1EJ3 A;  3BUO B;  3CR5 X;  1Q80 A;  2CBL A;  1XFU O;  4CID A;  2M49 B;  1V1F A;  4YGC B;  2SCP A;  3K21 A;  1LXF C;  1S36 A;  2LLT A;  1NWD A;  1QV1 A;  1RFJ A;  2PSR A;  2EC6 B;  3OP0 A;  4N1F A;  2K7O A;  1SW8 A;  1EXR A;  1K96 A;  2ZN9 A;  4N5X A;  2L2E A;  1YVL A;  2E30 A;  2K2A A;  3WHU B;  2GGM A;  1QV0 A;  1MXE A;  5HKW A;  2LM5 A;  1JUO A;  3IQQ A;  1AP4 A;  4GGF A;  1MQ1 A;  2JXC A;  1GJY A;  1NCY A;  3KEV A;  2BCA A;  1SR6 B;  1NCX A;  1DT7 B;  3NXA A;  3KPX A;  5DKN A;  2KBM A;  1A03 A;  1KSM A;  1S26 D;  1BT6 A;  2JPT A;  1CFF A;  1SK6 D;  1G8I A;  2EGD A;  2L4I A;  1WRL A;  2JTZ A;  4YI8 A;  3VRN A;  1B47 A;  2OTG B;  2M3W A;  1K93 D;  2NLN A;  1JSA A;  3BQ3 A;  2LP2 A;  1F4Q A;  4CLN A;  1RTP 1;  1IH0 A;  1QAT A;  4MLW A;  1SCV A;  2GV5 A;  1GQM A;  3I5F B;  2A4J A;  1BG1 A;  1MF8 B;  2K7B A;  2KGR A;  1DGV A;  1F8H A;  2M1K B;  3AKA A;  1YX8 A;  3I5H C;  4P2Y B;  3OB1 B;  1M46 A;  4AOM A;  1DF0 B;  1KK8 B;  2F3Z A;  2WC8 A;  1RK9 A;  1UUS A;  2LUC A;  2BKI B;  5FYX A;  3GK2 A;  1CM4 A;  1BJF A;  1OMR A;  3CR2 A;  4IL1 A;  2HET A;  1KFX S;  2FCE A;  3EVU A;  3O4Y A;  2ZKM X;  3FS7 A;  3PFV A;  2LAN A;  2ZNE A;  3EK8 A;  3I5I B;  1NX1 A;  1DGU A;  2KYC A;  3ZWH A;  4ZCV A;  5KTY A;  1TTX A;  4PDZ A;  1FBV A;  1M31 A;  5B8I B;  1UHH A;  3FWC A;  3OB2 B;  2LNK A;  1PSB A;  1OMD A;  4BY5 A;  2F8P A;  3VRO A;  5I2L A;  3SG3 A;  2CXJ A;  4N1G A;  2M1U A;  1ZMZ A;  1JWD A;  3D0Y B;  3F45 A;  3BOW B;  4YGA A;  1CFP A;  4NQG A;  1R6P A;  3C1V A;  1JC2 A;  2L50 A;  2H2K A;  3GK4 X;  3O6B A;  1B8R A;  3WHT B;  1UWO A;  3IF7 A;  4DIR A;  2OS8 B;  4C0J A;  3PAT A;  1OMV A;  1LVC D;  4PHK A;  2KI6 C;  3TUY B;  3LL8 B;  1CDM A;  5G08 A;  4NDD A;  2L51 A;  1ALV A;  3MSE B;  4JPZ B;  3RLZ A;  1PK0 D;  1CTR A;  1WRZ A;  4CPV A;  1YR5 A;  1CMG A;  1B4C A;  2ZND A;  2BL0 B;  5AER A;  3JTD C;  5BPJ A;  4WQ3 A;  1A2X A;  4I5K A;  3KF9 A;  4U8D A;  2JT0 A;  2L98 A;  1S6I A;  1RRO A;  1UHJ A;  2JT3 A;  3BXK A;  3EVV A;  2BEC A;  1W7I B;  4MZK A;  4QJ5 B;  1OSA A;  1BOC A;  1F70 A;  2JT8 A;  1IKU A;  4HRG A;  2BL0 C;  4PE7 A;  2AUC A;  1TCF A;  2B1U A;  1K94 A;  3TDI A;  2JOJ A;  2LMV A;  3E3R A;  1K95 A;  2PVB A;  1SY9 A;  1ODB A;  1WRK A;  3TUY C;  5D7F A;  3DF0 B;  2LLS A;  1AHR A;  1YTZ C;  2LVJ A;  5J3X A;  1EG3 A;  1YUS A;  2M9G A;  2G9B A;  1OOJ A;  2HQW A;  1A75 B;  3GOF A;  2EHB A;  4XJK A;  2WOR A;  2LVK A;  1CDP A;  1KK7 Y;  5K89 A;  2BE6 A;  2Y1N A;  3PN7 C;  2DOQ A;  1B8C A;  1L7Z A;  5I2O A;  2KI4 C;  3AAK A;  1FI5 A;  2HQ8 A;  2JU0 A;  1CLM A;  1N0Y A;  4GNK B;  1QS7 A;  1GGZ A;  1MHO A;  1ZUZ A;  3KHE A;  4OR9 B;  5HLV A;  3LCP C;  4HRH A;  1IRJ A;  1QX5 B;  1K9K A;  4YRU A;  2LUX A;  3VRP A;  1UP5 A;  3EK7 A;  1DF0 A;  5TNC A;  2L0P A;  1QX2 A;  2LMT A;  1KFX L;  3PAL A;  5I2Q A;  4MZL A;  3JVT C;  4AQI A;  5HKZ A;  3LK1 A;  1UHK A;  3TDZ A;  1J1E A;  3BUX B;  3RM1 A;  2MAZ A;  1BU3 A;  2KQ6 A;  3EKJ A;  1RWY A;  2D8N A;  3JVT B;  2NZ0 A;  4OKH A;  1IJ5 A;  1IG5 A;  1KFU L;  1B8L A;  1AJ5 A;  2IS9 A;  1M39 A;  3AAJ A;  1OZS A;  2QPT A;  1YVH A;  1SPY A;  5CSJ A;  1U5I A;  1SNL A;  1F54 A;  1ALW A;  2P6B B;  3EK4 A;  1G33 A;  2LE9 B;  3EVR A;  1QLK A;  3OX6 A;  1YRT B;  2JNX A;  3PLF B;  1A75 A;  2ZRT A;  3NSI A;  4DRW A;  4HRE E;  3FIA A;  3A8R A;  3I5I C;  2M7L A;  1Y1X A;  1FF1 A;  1QLS A;  1TCO B;  1KCY A;  1B7T Z;  3TS5 C;  2KOT A;  1XFW O;  2LV7 A;  3H4S E;  1TIZ A;  3O78 A;  3VGO A;  1E8A A;  1X02 A;  2Q91 A;  2KYF A;  2TN4 A;  3ICB A;  1DJZ A;  2H61 A;  3A4U B;  2VRG A;  2MLF C;  3GK1 A;  1KK8 C;  1QX7 A;  1ZAC A;  1NPQ A;  4FQO A;  4FTG A;  1AJ4 A;  3BUM B;  3DVE A;  5CSF A;  4TNC A;  2KFF A;  4OVN F;  4PCW A;  3I5F C;  1J7R A;  4DS7 A;  1TNW A;  2LLU A;  2EC6 C;  4A4C A;  1TN4 A;  3BUN B;  4PHM A;  1N65 A;  4MVF A;  1K8U A;  4WQ2 A;  5AXI A;  5KU1 A;  2NXQ A;  3SIA A;  4USL A;  4YGB B;  1CM1 A;  1N2D A;  2V53 A;  2JTT A;  1M63 B;  2Q4U A;  1SR6 C;  1J7Q A;  2WCF A;  1J7O A;  1CDL A;  1FW4 A;  4R1E A;  2HPS A;  3I5G C;  2KGB C;  1XFZ O;  3AKB A;  4QJ3 B;  3OX5 A;  3BOW A;  1IQ3 A;  1REC A;  2BCB A;  1A4P A;  2K8M B;  2LC5 A;  4XYN A;  1CKK A;  2O5G A;  2ZRS A;  1WLM A;  1DJH A;  1H4B A;  1KK7 Z;  5HYD A;  1SL8 A;  1JF2 A;  1RJV A;  4MZJ A;  4YGD B;  3DVJ A;  3M0W A;  1AVS A;  1QVI Z;  1DJI A;  2JUL A;  3DD4 A; 
#chains in the Genus database with same CATH topology
 1LA3 A;  2L4H A;  2JWW A;  3UNW A;  1C7V A;  4CFR A;  2I18 A;  1YX7 A;  4GGN A;  2M0R A;  5DIC A;  2MBX A;  4YGE B;  3SG4 A;  1DJW A;  1K9U A;  1KQM B;  3CWG A;  4OCI A;  2G2B A;  1YUU A;  2MJW B;  4MRY A;  2K61 A;  4YBH B;  1XVJ A;  4YI9 A;  5GQQ C;  2Y1M A;  1OZO A;  2CTN A;  2F2P A;  1NYA A;  1NX2 A;  3NGV A;  3I5G B;  3PM8 A;  4PAL A;  4GAO A;  3IQO A;  1Y6W A;  1BLQ A;  1J7P A;  1C7W A;  3SIB A;  2CNP A;  3CZ0 A;  1UHN A;  1TNX A;  1ZOT B;  2KDH A;  3DF0 A;  1MR8 A;  1ZFS A;  1DJY A;  1XFY O;  2MLE C;  1BF5 A;  5FI2 A;  1HT9 A;  5AFP A;  3LLE A;  4MEW A;  3ZNI A;  2KI6 D;  2MA2 A;  2QEH A;  4PE0 A;  5DKR A;  3TS5 B;  2COL B;  1PVA A;  2KLE A;  4A4B A;  4ICB A;  5PAL A;  2FCD A;  1F71 A;  1M45 A;  1KFU S;  3FE6 A;  5CSI A;  2PMY A;  1CLB A;  1JFK A;  3CZT X;  4Q04 A;  3PJI A;  1KWO C;  2LP3 A;  2I94 A;  1S1E A;  3B87 A;  3OGN A;  5JJG A;  3DY9 A;  1WDC B;  4C0K A;  1TNQ A;  2GTE A;  1PSR A;  2MRD A;  1CLL A;  3DVM A;  4GGF C;  4F0Z B;  2PAS A;  1QTX A;  1UUR A;  1F55 A;  1DJX A;  1S5G Z;  2BBM A;  1SMG A;  4HSZ A;  4MRX A;  1B9A A;  1J55 A;  3S0B A;  1TRF A;  5ER5 A;  1DTL A;  4NDC A;  2AAO A;  2OS8 C;  4PHJ A;  3SS3 A;  4M2O A;  1NUB A;  1NP8 A;  1T14 A;  2Y5I A;  3BYA A;  5I8N A;  2WCB A;  2P71 A;  4E68 A;  3SG5 A;  1PRW A;  1L2O C;  3D75 A;  3S0A A;  1S6C A;  1OQP A;  2L5X B;  2KFG A;  3BFA A;  1XA5 A;  1BR4 B;  3O2P A;  5EL2 A;  2HF5 A;  1W7J B;  2KAX A;  2ISD A;  2BNX A;  2GGZ A;  1C07 A;  1XFX O;  3Q8I A;  4M2P A;  1G4Y R;  1TNP A;  1NSH A;  1ORG A;  5ER4 X;  2JXL A;  3SG6 A;  1FPW A;  1JFJ A;  2PRU A;  2BKH B;  4I5L B;  2ERB A;  5JOL A;  3CZ1 A;  2WND A;  1NX3 A;  1IJ6 A;  1S5G Y;  2F2O A;  3S0G A;  1MXL C;  2JQ6 A;  1CFD A;  1XO5 A;  3SJS A;  3TZ1 A;  1BR1 B;  2LMU A;  1DJG A;  1L2O B;  2P70 A;  1MWN A;  2JRF A;  3CLN A;  4GBA A;  2KNE A;  2WCK A;  2WCE A;  5CPV A;  2CT9 A;  2LHL A;  4AQJ A;  1U5I B;  2H61 C;  1C3Z A;  2SAS A;  3HX4 A;  1Y1U A;  3I5H B;  3TDU A;  1GM0 A;  1EG4 A;  1SBJ A;  2BCX A;  3VRR A;  2JPO A;  1JBA A;  2M7N A;  1VRK A;  3SG2 A;  1EL4 A;  1V1G A;  1SKT A;  1WDC C;  3WXA A;  3BUW B;  1PAL A;  1SL7 A;  1CMF A;  2BBN A;  1EH2 A;  2I2R E;  4DUQ A;  1KWO B;  3DXL A;  4I5J A;  1LKJ A;  2KI4 B;  3PSR A;  1DVI A;  2LAP A;  4JQ0 D;  4MN0 A;  2K2F A;  4ETO A;  3EKH A;  2KAV A;  5FI7 A;  1FI6 A;  4WRI A;  2M29 A;  5IBW A;  3L4L A;  1SCM C;  2K7D A;  2KSP A;  2JC2 A;  1KQV A;  4PE1 A;  1B7T Y;  3SG7 A;  2FJU B;  2F33 A;  1A29 A;  3VRQ A;  1H8B A;  1JF0 A;  1P28 A;  1HQV A;  3JTD B;  5AEQ A;  1K2H A;  2QEV A;  3NSK A;  1NX0 A;  3QRX A;  4GPL B;  4XJK B;  5HLO A;  1DEK A;  1QVI Y;  1QIV A;  1Y0V H;  5DKQ A;  1SRA A;  3CR4 X;  4GFT A;  5D69 A;  2KAY A;  2PQL A;  4MSP A;  4BY4 A;  1BOD A;  1QAS A;  2BE4 A;  2LVV A;  3CS1 A;  4ZCU A;  4PHN A;  1R2U A;  4CFQ A;  5CSN A;  2FOT A;  1SL9 A;  2KBI A;  1D1O A;  2LVI A;  3L47 A;  3CTN A;  4NDB A;  1NCZ A;  4INX A;  2E6W A;  1LIN A;  4MBE A;  3D10 A;  2WCH A;  2WC5 A;  4OV2 A;  4I5N B;  1AUI B;  1YUT A;  1AK8 A;  3PN7 B;  2R2I A;  1DMO A;  2LCP A;  1S6J A;  4KYN A;  3WNX B;  2K0J A;  4GUK A;  2LHI A;  4C0L A;  5KSZ A;  2RGI A;  4ORA B;  1OE9 B;  2L2C A;  1CFC A;  1WLZ A;  1QIW A;  1S3P A;  1MUX A;  2Y4Q A;  4P5O E;  4ORB B;  2AMI A;  3DVK A;  1PUL A;  4OZD A;  1J1D A;  1DQE A;  1WY9 A;  1YUR A;  1XFV O;  2WOS A;  3SS4 A;  1CNP A;  1F4O A;  2ZFD A;  5AAN A;  4UPG A;  1IWQ A;  5D3O A;  2PYQ A;  4PE4 A;  1K90 D;  2MHH A;  2M8U A;  1BMO A;  3HCM A;  1XK4 A;  1TOP A;  1YRU B;  2F3Y A;  2JZI A;  2KFH A;  3CGA A;  3KO0 A;  1SCM B;  3NHI A;  2K7C A;  2M97 A;  4ORC B;  1GGW A;  2CCM A;  4M2Q A;  4D1E A;  1PVB A;  2NCO A;  2O60 A;  2ZN8 A;  3NSL A;  3OHM B;  2KHN A;  5F6T A;  4QJ4 B;  1LA0 A;  2OPO A;  2NCP A;  2PAL A;  2OTG C;  1K9P A;  3D0Y A;  4L9M A;  1QJT A;  1XYD A;  4JWQ A;  1IQ5 A;  1UHI A;  1NIW A;  2JNF A;  2QAC A;  1XK4 C;  1Y1A A;  2KQY A;  1SYM A;  1QXP A;  4DCK A;  5HL1 A;  3NSO A;  3CAB A;  1CDN A;  2I7A A;  2QEO A;  1KQM C;  1B1G A;  1KSO A;  4PT1 A;  3FWB A;  1IGV A;  1CB1 A;  3LK0 A;  1EJ3 A;  3BUO B;  3CR5 X;  3R1V A;  4JKT A;  1Q80 A;  2CBL A;  1XFU O;  4CID A;  2M49 B;  1V1F A;  3B6X A;  4YGC B;  3B88 A;  2SCP A;  1C3Y A;  3K21 A;  1LXF C;  1S36 A;  2LLT A;  1NWD A;  1QV1 A;  1RFJ A;  2WC6 A;  2PSR A;  1SSE B;  4JD9 A;  2EC6 B;  3OP0 A;  4N1F A;  2K7O A;  1SW8 A;  1EXR A;  1K96 A;  2ZN9 A;  1TUZ A;  2YGU A;  4N5X A;  1OOI X;  2L2E A;  1YVL A;  2E30 A;  2K2A A;  3BFH A;  3WHU B;  2GGM A;  1QV0 A;  2WCL A;  1MXE A;  5HKW A;  2LM5 A;  1JUO A;  3IQQ A;  1AP4 A;  4GGF A;  1MQ1 A;  2JXC A;  1GJY A;  1NCY A;  3KEV A;  2BCA A;  1SR6 B;  1NCX A;  3BFB A;  4IJ7 A;  3NXA A;  1DT7 B;  3KPX A;  5DKN A;  2KBM A;  1A03 A;  1KSM A;  3QME A;  1S26 D;  1BT6 A;  2JPT A;  3EG5 B;  1SK6 D;  1G8I A;  2EGD A;  2L4I A;  3L4A A;  1WRL A;  2JTZ A;  4YI8 A;  3VRN A;  1B47 A;  3FE9 A;  3D76 A;  2OTG B;  2M3W A;  1K93 D;  2NLN A;  1JSA A;  3BQ3 A;  2LP2 A;  1F4Q A;  4CLN A;  1RTP 1;  1IH0 A;  1QAT A;  4MLW A;  1SCV A;  2GV5 A;  1GQM A;  3I5F B;  2A4J A;  1BG1 A;  1MF8 B;  2K7B A;  2KGR A;  1DGV A;  1F8H A;  2M1K B;  3AKA A;  1YX8 A;  3I5H C;  4P2Y B;  3OB1 B;  1M46 A;  4AOM A;  1DF0 B;  1KK8 B;  2BAP A;  2F3Z A;  3BJH A;  2WC8 A;  1RK9 A;  1QWV A;  1UUS A;  2LUC A;  2BKI B;  5FYX A;  3GK2 A;  1CM4 A;  3S0F A;  1BJF A;  1OMR A;  3N7H A;  3CR2 A;  4IL1 A;  1DC1 A;  2HET A;  1KFX S;  2FCE A;  3EVU A;  3O4Y A;  2ZKM X;  1Z2C B;  3FS7 A;  3IVT A;  2LAN A;  3PFV A;  2ZNE A;  3EK8 A;  2QEB A;  3I5I B;  1NX1 A;  1DGU A;  2KYC A;  3ZWH A;  4ZCV A;  5KTY A;  1TTX A;  4PDZ A;  1FBV A;  1M31 A;  5B8I B;  1UHH A;  3FWC A;  3OB2 B;  2LNK A;  1PSB A;  1XFR A;  1OMD A;  4BY5 A;  2F8P A;  3VRO A;  3R72 A;  5I2L A;  5HKY A;  3SG3 A;  1LS8 A;  2CXJ A;  3D77 A;  4N1G A;  2M1U A;  1ZMZ A;  1JWD A;  3RZS A;  3D0Y B;  3B86 A;  3F45 A;  3BOW B;  4YGA A;  1CFP A;  4NQG A;  1R6P A;  3C1V A;  3S0D A;  2L50 A;  1JC2 A;  3V2L A;  2FJY A;  2H2K A;  3GK4 X;  3D73 A;  5I94 A;  3UO9 A;  1OOH A;  3K1E A;  3O6B A;  1B8R A;  3WHT B;  1UWO A;  3IF7 A;  4DIR A;  2OS8 B;  4C0J A;  3PAT A;  1OMV A;  1LVC D;  4PHK A;  2KI6 C;  3TUY B;  3LL8 B;  1CDM A;  5G08 A;  4NDD A;  2L51 A;  1ALV A;  3MSE B;  4JPZ B;  3RLZ A;  1PK0 D;  1CTR A;  1WRZ A;  4CPV A;  1YR5 A;  1CMG A;  1B4C A;  2ZND A;  1OOG A;  2BL0 B;  5AER A;  2L5Y A;  3JTD C;  3DZT A;  1OW4 A;  4WQ3 A;  2WCM A;  5BPJ A;  1CFF A;  1A2X A;  4I5K A;  3KF9 A;  4U8D A;  2JT0 A;  2L98 A;  3CZ2 A;  1S6I A;  1RRO A;  1UHJ A;  2JT3 A;  3BXK A;  3EVV A;  2BEC A;  1W7I B;  4MZK A;  4QJ5 B;  1OSA A;  1BOC A;  1F70 A;  2JT8 A;  1IKU A;  4HRG A;  2BL0 C;  2KLD A;  4PE7 A;  2AUC A;  1TCF A;  2B1U A;  1K94 A;  3TDI A;  2JOJ A;  3B7A A;  2LMV A;  3E3R A;  1K95 A;  2PVB A;  1SY9 A;  1ODB A;  1WRK A;  3TUY C;  5D7F A;  3DF0 B;  3R1P A;  2LLS A;  1AHR A;  1YTZ C;  2LVJ A;  5J3X A;  1EG3 A;  1YUS A;  2M9G A;  2G9B A;  1OOJ A;  2HQW A;  1A75 B;  3GOF A;  2EHB A;  4XJK A;  3NHT A;  2WOR A;  2LVK A;  1CDP A;  1KK7 Y;  3S0E A;  2BE6 A;  5K89 A;  3D78 A;  2Y1N A;  3PN7 C;  2DOQ A;  1IIO A;  1TUJ A;  1B8C A;  2QDI A;  1L7Z A;  5I2O A;  2KI4 C;  3AAK A;  1FI5 A;  2HQ8 A;  2JU0 A;  1CLM A;  1N0Y A;  4GNK B;  1QS7 A;  1GGZ A;  1MHO A;  1ZUZ A;  3KHE A;  4OR9 B;  5HLV A;  3LCP C;  4HRH A;  1IRJ A;  1QX5 B;  1K9K A;  5FI6 A;  2LUX A;  3VRP A;  4YRU A;  1UP5 A;  3EK7 A;  1DF0 A;  1OOF A;  5TNC A;  3VB1 A;  2L0P A;  1QX2 A;  1W9Z A;  2LMT A;  1KFX L;  2H8V A;  3PAL A;  5I2Q A;  4MZL A;  1Z4H A;  3JVT C;  4AQI A;  5HKZ A;  3LK1 A;  3D74 A;  1UHK A;  3R1O A;  1J1E A;  3TDZ A;  3BUX B;  3RM1 A;  2MAZ A;  1BU3 A;  2KQ6 A;  3EKJ A;  1RWY A;  2D8N A;  3JVT B;  2NZ0 A;  4OKH A;  1IJ5 A;  3CDN A;  1IG5 A;  1KFU L;  1B8L A;  1AJ5 A;  2IS9 A;  1M39 A;  3AAJ A;  1OZS A;  2QPT A;  1YVH A;  1SPY A;  5CSJ A;  1U5I A;  1SNL A;  1F54 A;  1ALW A;  2P6B B;  2WCJ A;  3EK4 A;  1G33 A;  2LE9 B;  3EVR A;  1QLK A;  3OBV A;  3OX6 A;  1YRT B;  2JNX A;  3PLF B;  1A75 A;  2ZRT A;  3NSI A;  4DRW A;  4HRE E;  3FIA A;  3A8R A;  3I5I C;  2M7L A;  1Y1X A;  1FF1 A;  1QLS A;  1TCO B;  3CYZ A;  1KCY A;  2K60 A;  1B7T Z;  3TS5 C;  2KOT A;  1XFW O;  2LV7 A;  3H4S E;  1TIZ A;  3O78 A;  3VGO A;  1E8A A;  1X02 A;  2Q91 A;  2KYF A;  2TN4 A;  3ICB A;  1DJZ A;  2H61 A;  3A4U B;  2VRG A;  2MLF C;  3GK1 A;  1KK8 C;  1QX7 A;  1ZAC A;  1NPQ A;  3PM2 A;  4FQO A;  4FTG A;  1AJ4 A;  3BUM B;  3DVE A;  5CSF A;  4TNC A;  3O4X A;  2KFF A;  4OVN F;  4F7F A;  4PCW A;  3FE8 A;  3I5F C;  1J7R A;  4DS7 A;  1TNW A;  2LLU A;  2EC6 C;  4INW A;  3SS5 A;  2KPH A;  4A4C A;  1TN4 A;  3BUN B;  4PHM A;  1N65 A;  4MVF A;  1K8U A;  4WQ2 A;  1TWO A;  5AXI A;  5KU1 A;  2NXQ A;  3SIA A;  4USL A;  4YGB B;  1CM1 A;  1N2D A;  2V53 A;  2JTT A;  1M63 B;  2Q4U A;  1SR6 C;  1J7Q A;  2WCF A;  1J7O A;  1CDL A;  1FW4 A;  4R1E A;  2HPS A;  3I5G C;  2KGB C;  1XFZ O;  3AKB A;  3DYE A;  4QJ3 B;  3OX5 A;  3BOW A;  1IQ3 A;  1REC A;  2BCB A;  1A4P A;  2K8M B;  2LC5 A;  4XYN A;  1CKK A;  2O5G A;  2ZRS A;  1WLM A;  1DJH A;  1H4B A;  1KK7 Z;  5HYD A;  1SL8 A;  1JF2 A;  1RJV A;  4MZJ A;  4YGD B;  3DVJ A;  4FQT A;  3M0W A;  1AVS A;  1QVI Z;  1DEL A;  1DJI A;  2JUL A;  3DD4 A; 
#chains in the Genus database with same CATH homology
 1LA3 A;  2L4H A;  2JWW A;  1C7V A;  4CFR A;  2I18 A;  1YX7 A;  4GGN A;  2M0R A;  2MBX A;  3SG4 A;  4YGE B;  1DJW A;  1K9U A;  1KQM B;  3CWG A;  4OCI A;  2G2B A;  1YUU A;  2MJW B;  4MRY A;  2K61 A;  4YBH B;  1XVJ A;  4YI9 A;  5GQQ C;  2Y1M A;  1OZO A;  2CTN A;  2F2P A;  1NYA A;  1NX2 A;  3PM8 A;  3I5G B;  4PAL A;  4GAO A;  3IQO A;  1Y6W A;  1BLQ A;  1J7P A;  1C7W A;  3SIB A;  2CNP A;  1UHN A;  1TNX A;  1ZOT B;  2KDH A;  3DF0 A;  1MR8 A;  1ZFS A;  1DJY A;  1XFY O;  2MLE C;  1BF5 A;  1HT9 A;  5AFP A;  3LLE A;  4MEW A;  3ZNI A;  2KI6 D;  2MA2 A;  4PE0 A;  5DKR A;  3TS5 B;  4A4B A;  2COL B;  1PVA A;  4ICB A;  5PAL A;  2FCD A;  1F71 A;  1M45 A;  1KFU S;  5CSI A;  2PMY A;  1CLB A;  1JFK A;  3CZT X;  4Q04 A;  1KWO C;  2LP3 A;  2I94 A;  1S1E A;  5JJG A;  1WDC B;  4C0K A;  1TNQ A;  2MRD A;  1PSR A;  3DVM A;  1CLL A;  4GGF C;  4F0Z B;  2PAS A;  1QTX A;  1UUR A;  1F55 A;  1DJX A;  1S5G Z;  2BBM A;  1SMG A;  4HSZ A;  4MRX A;  1B9A A;  1J55 A;  1TRF A;  5ER5 A;  1DTL A;  4NDC A;  2AAO A;  2OS8 C;  4PHJ A;  4M2O A;  1NUB A;  1NP8 A;  2Y5I A;  5I8N A;  3BYA A;  4E68 A;  2WCB A;  3SG5 A;  1PRW A;  1L2O C;  1S6C A;  1OQP A;  2L5X B;  2KFG A;  1XA5 A;  1BR4 B;  3O2P A;  2HF5 A;  1W7J B;  2KAX A;  2ISD A;  2GGZ A;  1C07 A;  1XFX O;  4M2P A;  1G4Y R;  1TNP A;  1NSH A;  5ER4 X;  2JXL A;  3SG6 A;  1FPW A;  1JFJ A;  2PRU A;  2BKH B;  4I5L B;  5JOL A;  2WND A;  1NX3 A;  1IJ6 A;  1S5G Y;  2F2O A;  3TZ1 A;  1MXL C;  2JQ6 A;  1CFD A;  1XO5 A;  3SJS A;  5HKY A;  1BR1 B;  2LMU A;  1DJG A;  1L2O B;  1MWN A;  2JRF A;  3CLN A;  4GBA A;  2KNE A;  2WCE A;  5CPV A;  2CT9 A;  2LHL A;  4AQJ A;  1U5I B;  2H61 C;  2SAS A;  3HX4 A;  1Y1U A;  3I5H B;  3TDU A;  1EG4 A;  1SBJ A;  2BCX A;  3VRR A;  1JBA A;  2M7N A;  1VRK A;  3SG2 A;  1EL4 A;  1V1G A;  1SKT A;  1WDC C;  3WXA A;  3BUW B;  1PAL A;  1SL7 A;  1CMF A;  2BBN A;  1EH2 A;  2I2R E;  4DUQ A;  1KWO B;  4I5J A;  1LKJ A;  2KI4 B;  3PSR A;  1DVI A;  2LAP A;  4JQ0 D;  4MN0 A;  2K2F A;  4ETO A;  3EKH A;  2KAV A;  1FI6 A;  4WRI A;  2M29 A;  5IBW A;  1SCM C;  2K7D A;  2KSP A;  2JC2 A;  1KQV A;  4PE1 A;  1B7T Y;  3SG7 A;  2FJU B;  2F33 A;  1A29 A;  3VRQ A;  1H8B A;  1JF0 A;  3JTD B;  1HQV A;  5AEQ A;  1K2H A;  3NSK A;  1NX0 A;  3QRX A;  4GPL B;  4XJK B;  5HLO A;  1QVI Y;  1QIV A;  1Y0V H;  5DKQ A;  1SRA A;  3CR4 X;  4GFT A;  5D69 A;  2KAY A;  4MSP A;  4BY4 A;  1BOD A;  1QAS A;  2BE4 A;  2LVV A;  3CS1 A;  4ZCU A;  4PHN A;  1R2U A;  4CFQ A;  5CSN A;  2FOT A;  1SL9 A;  2KBI A;  1D1O A;  2LVI A;  3CTN A;  4NDB A;  1NCZ A;  2E6W A;  1LIN A;  4MBE A;  3D10 A;  4OV2 A;  4I5N B;  1AUI B;  1YUT A;  1AK8 A;  3PN7 B;  2R2I A;  1DMO A;  2LCP A;  1S6J A;  3WNX B;  2K0J A;  4GUK A;  2LHI A;  4C0L A;  5KSZ A;  2RGI A;  4ORA B;  1OE9 B;  1CFC A;  1WLZ A;  1QIW A;  1S3P A;  1MUX A;  2Y4Q A;  4P5O E;  4ORB B;  2AMI A;  3DVK A;  1PUL A;  1J1D A;  1WY9 A;  1YUR A;  1XFV O;  2WOS A;  1CNP A;  1F4O A;  2ZFD A;  5AAN A;  4UPG A;  1IWQ A;  4PE4 A;  1K90 D;  2MHH A;  2M8U A;  1BMO A;  3HCM A;  1XK4 A;  1TOP A;  1YRU B;  2F3Y A;  2JZI A;  2KFH A;  3CGA A;  3KO0 A;  1SCM B;  2K7C A;  2M97 A;  4ORC B;  1GGW A;  2CCM A;  4M2Q A;  4D1E A;  1PVB A;  2NCO A;  2O60 A;  2ZN8 A;  3NSL A;  3OHM B;  2KHN A;  5F6T A;  4QJ4 B;  1LA0 A;  2OPO A;  2NCP A;  2PAL A;  2OTG C;  1K9P A;  3D0Y A;  4L9M A;  1QJT A;  1XYD A;  4JWQ A;  1IQ5 A;  1UHI A;  1NIW A;  2JNF A;  2QAC A;  1XK4 C;  1Y1A A;  2KQY A;  1SYM A;  1QXP A;  4DCK A;  3NSO A;  1CDN A;  2I7A A;  1KQM C;  1B1G A;  1KSO A;  1CB1 A;  3FWB A;  1IGV A;  3LK0 A;  1EJ3 A;  3BUO B;  3CR5 X;  1Q80 A;  2CBL A;  1XFU O;  4CID A;  2M49 B;  1V1F A;  4YGC B;  2SCP A;  3K21 A;  1LXF C;  1S36 A;  2LLT A;  1NWD A;  1QV1 A;  1RFJ A;  2PSR A;  2EC6 B;  3OP0 A;  4N1F A;  2K7O A;  1SW8 A;  1EXR A;  1K96 A;  2ZN9 A;  4N5X A;  2L2E A;  1YVL A;  2E30 A;  2K2A A;  3WHU B;  2GGM A;  1QV0 A;  1MXE A;  5HKW A;  2LM5 A;  1JUO A;  3IQQ A;  1AP4 A;  4GGF A;  1MQ1 A;  2JXC A;  1GJY A;  1NCY A;  3KEV A;  2BCA A;  1SR6 B;  1NCX A;  1DT7 B;  3NXA A;  3KPX A;  5DKN A;  2KBM A;  1A03 A;  1KSM A;  1S26 D;  1BT6 A;  2JPT A;  1CFF A;  1SK6 D;  1G8I A;  2EGD A;  2L4I A;  1WRL A;  2JTZ A;  4YI8 A;  3VRN A;  1B47 A;  2OTG B;  2M3W A;  1K93 D;  2NLN A;  1JSA A;  3BQ3 A;  2LP2 A;  1F4Q A;  4CLN A;  1RTP 1;  1IH0 A;  1QAT A;  4MLW A;  1SCV A;  2GV5 A;  1GQM A;  3I5F B;  2A4J A;  1BG1 A;  1MF8 B;  2K7B A;  2KGR A;  1DGV A;  1F8H A;  2M1K B;  3AKA A;  1YX8 A;  3I5H C;  4P2Y B;  3OB1 B;  1M46 A;  4AOM A;  1DF0 B;  1KK8 B;  2F3Z A;  2WC8 A;  1RK9 A;  1UUS A;  2LUC A;  2BKI B;  5FYX A;  3GK2 A;  1CM4 A;  1BJF A;  1OMR A;  3CR2 A;  4IL1 A;  2HET A;  1KFX S;  2FCE A;  3EVU A;  3O4Y A;  2ZKM X;  3FS7 A;  3PFV A;  2LAN A;  2ZNE A;  3EK8 A;  3I5I B;  1NX1 A;  1DGU A;  2KYC A;  3ZWH A;  4ZCV A;  5KTY A;  1TTX A;  4PDZ A;  1FBV A;  1M31 A;  5B8I B;  1UHH A;  3FWC A;  3OB2 B;  2LNK A;  1PSB A;  1OMD A;  4BY5 A;  2F8P A;  3VRO A;  5I2L A;  3SG3 A;  2CXJ A;  4N1G A;  2M1U A;  1ZMZ A;  1JWD A;  3D0Y B;  3F45 A;  3BOW B;  4YGA A;  1CFP A;  4NQG A;  1R6P A;  3C1V A;  1JC2 A;  2L50 A;  2H2K A;  3GK4 X;  3O6B A;  1B8R A;  3WHT B;  1UWO A;  3IF7 A;  4DIR A;  2OS8 B;  4C0J A;  3PAT A;  1OMV A;  1LVC D;  4PHK A;  2KI6 C;  3TUY B;  3LL8 B;  1CDM A;  5G08 A;  4NDD A;  2L51 A;  1ALV A;  3MSE B;  4JPZ B;  3RLZ A;  1PK0 D;  1CTR A;  1WRZ A;  4CPV A;  1YR5 A;  1CMG A;  1B4C A;  2ZND A;  2BL0 B;  5AER A;  3JTD C;  5BPJ A;  4WQ3 A;  1A2X A;  4I5K A;  3KF9 A;  4U8D A;  2JT0 A;  2L98 A;  1S6I A;  1RRO A;  1UHJ A;  2JT3 A;  3BXK A;  3EVV A;  2BEC A;  1W7I B;  4MZK A;  4QJ5 B;  1OSA A;  1BOC A;  1F70 A;  2JT8 A;  1IKU A;  4HRG A;  2BL0 C;  4PE7 A;  2AUC A;  1TCF A;  2B1U A;  1K94 A;  3TDI A;  2JOJ A;  2LMV A;  3E3R A;  1K95 A;  2PVB A;  1SY9 A;  1ODB A;  1WRK A;  3TUY C;  5D7F A;  3DF0 B;  2LLS A;  1AHR A;  1YTZ C;  2LVJ A;  5J3X A;  1EG3 A;  1YUS A;  2M9G A;  2G9B A;  1OOJ A;  2HQW A;  1A75 B;  3GOF A;  2EHB A;  4XJK A;  2WOR A;  2LVK A;  1CDP A;  1KK7 Y;  5K89 A;  2BE6 A;  2Y1N A;  3PN7 C;  2DOQ A;  1B8C A;  1L7Z A;  5I2O A;  2KI4 C;  3AAK A;  1FI5 A;  2HQ8 A;  2JU0 A;  1CLM A;  1N0Y A;  4GNK B;  1QS7 A;  1GGZ A;  1MHO A;  1ZUZ A;  3KHE A;  4OR9 B;  5HLV A;  3LCP C;  4HRH A;  1IRJ A;  1QX5 B;  1K9K A;  4YRU A;  2LUX A;  3VRP A;  1UP5 A;  3EK7 A;  1DF0 A;  5TNC A;  2L0P A;  1QX2 A;  2LMT A;  1KFX L;  3PAL A;  5I2Q A;  4MZL A;  3JVT C;  4AQI A;  5HKZ A;  3LK1 A;  1UHK A;  3TDZ A;  1J1E A;  3BUX B;  3RM1 A;  2MAZ A;  1BU3 A;  2KQ6 A;  3EKJ A;  1RWY A;  2D8N A;  3JVT B;  2NZ0 A;  4OKH A;  1IJ5 A;  1IG5 A;  1KFU L;  1B8L A;  1AJ5 A;  2IS9 A;  1M39 A;  3AAJ A;  1OZS A;  2QPT A;  1YVH A;  1SPY A;  5CSJ A;  1U5I A;  1SNL A;  1F54 A;  1ALW A;  2P6B B;  3EK4 A;  1G33 A;  2LE9 B;  3EVR A;  1QLK A;  3OX6 A;  1YRT B;  2JNX A;  3PLF B;  1A75 A;  2ZRT A;  3NSI A;  4DRW A;  4HRE E;  3FIA A;  3A8R A;  3I5I C;  2M7L A;  1Y1X A;  1FF1 A;  1QLS A;  1TCO B;  1KCY A;  1B7T Z;  3TS5 C;  2KOT A;  1XFW O;  2LV7 A;  3H4S E;  1TIZ A;  3O78 A;  3VGO A;  1E8A A;  1X02 A;  2Q91 A;  2KYF A;  2TN4 A;  3ICB A;  1DJZ A;  2H61 A;  3A4U B;  2VRG A;  2MLF C;  3GK1 A;  1KK8 C;  1QX7 A;  1ZAC A;  1NPQ A;  4FQO A;  4FTG A;  1AJ4 A;  3BUM B;  3DVE A;  5CSF A;  4TNC A;  2KFF A;  4OVN F;  4PCW A;  3I5F C;  1J7R A;  4DS7 A;  1TNW A;  2LLU A;  2EC6 C;  4A4C A;  1TN4 A;  3BUN B;  4PHM A;  1N65 A;  4MVF A;  1K8U A;  4WQ2 A;  5AXI A;  5KU1 A;  2NXQ A;  3SIA A;  4USL A;  4YGB B;  1CM1 A;  1N2D A;  2V53 A;  2JTT A;  1M63 B;  2Q4U A;  1SR6 C;  1J7Q A;  2WCF A;  1J7O A;  1CDL A;  1FW4 A;  4R1E A;  2HPS A;  3I5G C;  2KGB C;  1XFZ O;  3AKB A;  4QJ3 B;  3OX5 A;  3BOW A;  1IQ3 A;  1REC A;  2BCB A;  1A4P A;  2K8M B;  2LC5 A;  4XYN A;  1CKK A;  2O5G A;  2ZRS A;  1WLM A;  1DJH A;  1H4B A;  1KK7 Z;  5HYD A;  1SL8 A;  1JF2 A;  1RJV A;  4MZJ A;  4YGD B;  3DVJ A;  3M0W A;  1AVS A;  1QVI Z;  1DJI A;  2JUL A;  3DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...