2LP2A

Solution structure and dynamics of human s100a1 protein modified at cysteine 85 with homocysteine disulfide bond formation in calcium saturated form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title Impact of calcium binding and thionylation of S100A1 protein on its nuclear magnetic resonance-derived structure and backbone dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 27
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lp2A00
2KI4C 3BOWB 1OMVA 1QS7A 3TDZA 3EVUA 3GK4X 1KCYA 2GGMA 2JOJA 1G4YR 1JFKA 5HKWA 4I5KA 1BJFA 1ZMZA 2NZ0A 4MSPA 1C7WA 5CSNA 1V1GA 3NSKA 1W7IB 5CSFA 1UHNA 1ALWA 2FOTA 2WOSA 1BMOA 1RWYA 1SMGA 1GGZA 3ZWHA 1CFCA 1S26D 4MVFA 1N65A 3WHUB 2LMTA 4UPGA 2BKIB 3LL8B 3NSIA 1E8AA 3DVJA 4M2OA 1FI6A 2LCPA 3EKHA 2OS8B 3GOFA 2GGZA 5KU1A 2KQYA 2M8UA 2MLFC 4TNCA 4A4BA 3I5GB 3AKBA 4L9MA 2Y4QA 3LLEA 1RTP1 3CZTX 3KPXA 3EK8A 4A4CA 1CM4A 2KAYA 4GFTA 3JVTB 5GQQC 1BOCA 3NSLA 2P6BB 2K7BA 1KSMA 2M97A 3LK0A 1BLQA 2JTTA 2JWWA 4GBAA 4M2PA 2F3YA 2LHLA 1YX8A 1A29A 2WORA 2BE4A 1IRJA 1UWOA 1F4OA 1A2XA 1KFUS 3ZNIA 1TCFA 4YI9A 1F4QA 2CT9A 2G2BA 2M49B 3BOWA 3FWBA 1CFPA 4XJKA 3SJSA 2R2IA 1SYMA 2LE9B 2JULA 2BL0C 3MSEB 1A75B 4QJ5B 2Y1MA 1U5IB 3O2PA 1ZACA 2F2OA 1IKUA 3KO0A 1QVIZ 1K9PA 1TNPA 3BXKA 4NQGA 4NDBA 5I8NA 2KFHA 1BU3A 3FWCA 1M46A 2H61C 1GQMA 2NXQA 2KGRA 2M1KB 1AVSA 2JZIA 4F0ZB 4MRXA 5CSIA 1QV0A 1MUXA 2JT3A 1KQVA 4CLNA 2WCFA 4ZCVA 4JWQA 1K90D 1SRAA 2O5GA 1D1OA 2KSPA 1WRKA 2H61A 1NYAA 2JU0A 2IS9A 1QASA 1OMDA 1KQMC 4YRUA 3O6BA 4YGBB 2QPTA 1GJYA 1EXRA 3K21A 4PHJA 1AJ4A 2FCDA 1F70A 2ZKMX 1EG4A 2BCBA 2NCOA 3NXAA 5HLOA 1CKKA 2NCPA 4AQIA 3JTDB 1K93D 4C0JA 1B8CA 1B4CA 2I94A 4PHNA 4GNKB 1Y1XA 5AFPA 2KI4B 1MXLC 2E6WA 3CS1A 4CFQA 3BUOB 1MXEA 1J55A 3O78A 5ER4X 3PALA 4U8DA 5KTYA 1SR6C 1BG1A 2AAOA 2KBMA 4MRYA 3M0WA 1U5IA 4GGFC 4HRGA 2HETA 3AAKA 4ICBA 5D69A 1S36A 4FTGA 1SL9A 3SIBA 1OSAA 3WHTB 1CFDA 4DS7A 2JRFA 4C0KA 3PM8A 1DT7B 5PALA 5HKZA 2I7AA 1IJ5A 2KNEA 3BUNB 5CSJA 2JNXA 1EL4A 1YUUA 4GGFA 1XYDA 1KFXL 3FS7A 1XFVO 1CMFA 2JXCA 4HREE 1DF0B 3BUMB 2F3ZA 2L98A 2LMUA 1B47A 3C1VA 4QJ4B 2KBIA 1LINA 2OPOA 1YRTB 1MR8A 1YVHA 4OKHA 4N1FA 2CTNA 4CIDA 2DOQA 2WCEA 1K8UA 4PE7A 4XJKB 3FIAA 1BT6A 1PSBA 4OR9B 1N2DA 2L4IA 1MF8B 1YUTA 2F2PA 1RECA 2A4JA 3A4UB 5FYXA 5CPVA 1OZOA 2LVVA 4ORCB 5AEQA 2MRDA 4I5LB 1CDNA 2OTGC 2SCPA 1SBJA 1CLLA 1IJ6A 1B8RA 4NDCA 3PLFB 2BL0B 1YRUB 2G9BA 5DKNA 3TS5C 1JSAA 1SCMC 4DCKA 1QIWA 1S5GZ 3PFVA 4YGCB 2TN4A 1RROA 2BKHB 2BCXA 1JFJA 1ZOTB 3CTNA 2EHBA 1DJYA 1NPQA 1XVJA 1Y6WA 2MBXA 1V1FA 4OCIA 4PE4A 2JQ6A 1F55A 4ETOA 1DF0A 1S1EA 2CNPA 1WRLA 1R2UA 1KSOA 3ICBA 2AMIA 4DIRA 1UUSA 1H8BA 5K89A 4P5OE 3TDUA 1LVCD 2GV5A 1DGVA 1KQMB 4XYNA 5DKQA 3IF7A 2MAZA 2ISDA 1JC2A 4BY4A 2LVKA 1NCYA 1OOJA 1MQ1A 3VRPA 1A4PA 1XK4C 2PVBA 2EC6C 4MEWA 2ZRSA 4USLA 1W7JB 2K2AA 1YR5A 2K8MB 4P2YB 4N5XA 2MHHA 5D7FA 1AUIB 1DJZA 3I5FC 3D10A 4QJ3B 1NCXA 5I2OA 4PALA 5IBWA 4PE1A 3OP0A 2L51A 3IQQA 1SL8A 3BUXB 1VRKA 4MBEA 3VRRA 2CBLA 1SR6B 1XK4A 1OE9B 1SW8A 2VRGA 4YBHB 1XFWO 5AANA 1AK8A 2K7DA 2LUXA 1CM1A 1PALA 2K7OA 2Q4UA 3HCMA 1IQ3A 1L7ZA 1QX2A 1YUSA 1JUOA 1SNLA 3AAJA 1KFXS 1FW4A 2D8NA 2JT0A 2JXLA 2PASA 1AJ5A 1SK6D 1NX0A 1G8IA 1WDCB 2LLTA 2ZNDA 5AXIA 3OB1B 1PULA 3EVVA 4MLWA 5DKRA 1XA5A 2ZFDA 1J1EA 1RFJA 1YURA 4PDZA 4E68A 2FCEA 1B8LA 1CLMA 1UHIA 4OV2A 4YI8A 1DJHA 1DJIA 2B1UA 1DJGA 1NX2A 2RGIA 4MZJA 2F33A 3OX6A 4R1EA 3TUYB 2ZN8A 1YX7A 1S5GY 3F45A 4BY5A 2LV7A 1IWQA 1DGUA 1NX3A 2KFFA 5HKYA 1IGVA 2KI6D 2LVJA 1FI5A 1LA0A 3AKAA 3CGAA 5KSZA 1N0YA 4GGNA 3SG5A 1IH0A 2SASA 3KF9A 1XFYO 2BCAA 1HT9A 3PSRA 3OB2B 1RK9A 1QX5B 2K7CA 3EK4A 1QTXA 2M7LA 2LP2A 3LK1A 1CNPA 1NIWA 1WDCC 3O4YA 1GGWA 3VGOA 1YTZC 4ORBB 2OTGB 2HQWA 2KOTA 2KI6C 1WLZA 5BPJA 2QACA 3TS5B 2L2EA 1J7RA 1SCMB 1TNXA 1ALVA 1KK8C 1QIVA 3I5IC 4YGDB 4C0LA 3TUYC 3D0YA 1UHHA 3VRNA 1JBAA 4N1GA 1QXPA 1M31A 2MA2A 3VROA 1S6IA 5AERA 4I5JA 2KYCA 2L0PA 1TRFA 2K2FA 5G08A 2KYFA 1TTXA 2CXJA 4M2QA 1CLBA 4HRHA 5TNCA 1K95A 1S6JA 2ZN9A 2LVIA 3QRXA 2PMYA 1J7OA 1PVAA 3PN7C 1WY9A 1AHRA 3EKJA 2LC5A 1TNQA 4NDDA 2KQ6A 1M39A 2LAPA 2M0RA 1B9AA 1JF0A 1K9UA 1TIZA 2JNFA 1XO5A 4I5NB 2WNDA 2JPTA 1SY9A 4JQ0D 2LNKA 5JJGA 1B1GA 3NSOA 1PRWA 2EC6B 4YGAA 1OMRA 1QV1A 2Y1NA 1KWOC 3SIAA 5F6TA 4MN0A 3DVEA 5B8IB 2KAXA 2FJUB 1S6CA 3I5FB 4PHMA 1BODA 4GUKA 3I5HC 2E30A 3HX4A 4WQ3A 1PK0D 3SG6A 2KGBC 2M7NA 1JWDA 3GK1A 2BBNA 3SG2A 3DVMA 3TDIA 3SG4A 4JPZB 4MZKA 1Y1AA 1K96A 1DMOA 4IL1A 1QX7A 4Q04A 3PATA 1NCZA 1KK7Y 1CB1A 1H4BA 1L2OB 4GPLB 3SG7A 1BR1B 1QLKA 2BE6A 1CMGA 1NX1A 2LP3A 1B7TZ 1XFZO 1K94A 5JOLA 1JF2A 4MZLA 1R6PA 3CR2A 1WLMA 4FQOA 1IG5A 1HQVA 3DF0B 3A8RA 1MWNA 4YGEB 1RJVA 3H4SE 2EGDA 1TOPA 2PRUA 1K9KA 1BR4B 1NP8A 2LLSA 2MJWB 5ER5A 1CDLA 1UURA 1SKTA 1SL7A 1YVLA 3EK7A 2BBMA 1AP4A 3BUWB 3IQOA 2LUCA 4ZCUA 1PVBA 2JT8A 2M9GA 2HQ8A 1XFUO 4ORAB 3DD4A 1FPWA 1OQPA 3SG3A 1Q80A 2LMVA 4PHKA 1EJ3A 4DRWA 1ODBA 1DJWA 3KEVA 3BYAA 3LCPC 3WNXB 2M29A 1CTRA 3D0YB 1J7PA 1L2OC 1OZSA 1F71A 2I2RE 2OS8C 2LLUA 2K0JA 1QATA 1UHKA 3KHEA 1PSRA 2AUCA 3GK2A 5I2QA 2KFGA 1WRZA 3I5GC 1Y1UA 2KAVA 2LANA 2CCMA 2PSRA 3E3RA 5I2LA 2MLEC 1KK8B 1F54A 1CDPA 3I5IB 1MHOA 3OHMB 4HSZA 3JVTC 4OVNF 1TNWA 2I18A 3CR4X 5J3XA 1C07A 1LXFC 2WCBA 3VRQA 2L4HA 1UP5A 2M3WA 3TZ1A 3CLNA 2V53A 1F8HA 3EVRA 2ZNEA 1UHJA 3DF0A 2JTZA 1J7QA 1FF1A 3CR5X 1NSHA 1A03A 3RLZA 1KK7Z 3PN7B 1SCVA 2LM5A 5HLVA 1CDMA 4AOMA 4DUQA 2Q91A 4AQJA 2BECA 1EH2A 1KFUL 2F8PA 1NUBA 1EG3A 2NLNA 1NWDA 3DVKA 1C7VA 1CFFA 2M1UA 1B7TY 1SPYA 2KDHA 1KWOB 1QJTA 4WQ2A 1M45A 1Y0VH 1J1DA 2HPSA 4PE0A 2Y5IA 3I5HB 2K61A 5HYDA 1A75A 1TN4A 1S3PA 1LKJA 2HF5A 1K2HA 1XFXO 3OX5A 2WC8A 4GAOA 3CWGA 3RM1A 4CPVA 1DTLA 3BQ3A 4CFRA 4PCWA 1ZFSA 2KHNA 1G33A 1DJXA 1TCOB 2L50A 1BF5A 1X02A 2COLB 3WXAA 2H2KA 1FBVA 1M63B 2L5XB 4D1EA 1DVIA 4WRIA 2JC2A 2O60A 3JTDC 1IQ5A 1QLSA 2PALA 1ZUZA 2ZRTA 1QVIY 1LA3A 2LHIA
chains in the Genus database with same CATH superfamily
2KI4C 3BOWB 1OMVA 1QS7A 3TDZA 3EVUA 3GK4X 1KCYA 2GGMA 2JOJA 1G4YR 1JFKA 5HKWA 4I5KA 1BJFA 1ZMZA 2JPOA 2NZ0A 4MSPA 1C7WA 5CSNA 1V1GA 3NSKA 1W7IB 5CSFA 1UHNA 1ALWA 2FOTA 2WOSA 1BMOA 1RWYA 1SMGA 1GGZA 3NHTA 3ZWHA 1CFCA 1S26D 3D74A 4MVFA 1N65A 3BJHA 2LMTA 3WHUB 3NHIA 4UPGA 2BKIB 3LL8B 3NSIA 1E8AA 3DVJA 4M2OA 1FI6A 2LCPA 3EKHA 2OS8B 3GOFA 2GGZA 5KU1A 2KQYA 2M8UA 2WCMA 2MLFC 4TNCA 4A4BA 3I5GB 3AKBA 4L9MA 2Y4QA 3LLEA 1RTP1 3S0GA 3CZTX 3KPXA 3EK8A 1DC1A 4A4CA 1CM4A 2KAYA 4GFTA 3JVTB 5GQQC 1BOCA 1P28A 3NSLA 2P6BB 2K7BA 1KSMA 2M97A 3LK0A 1BLQA 2JTTA 2JWWA 3CZ0A 4GBAA 4M2PA 2F3YA 2LHLA 1YX8A 1A29A 2WORA 1UWOA 1IRJA 2BE4A 1F4OA 1A2XA 1KFUS 4INXA 3ZNIA 1TCFA 4YI9A 1F4QA 2CT9A 2G2BA 2M49B 3BOWA 3FWBA 1CFPA 4XJKA 3SJSA 2R2IA 2WC6A 1SYMA 2LE9B 4KYNA 2JULA 2BL0C 3DZTA 3MSEB 1A75B 4QJ5B 2Y1MA 1U5IB 3O2PA 1ZACA 2F2OA 1IKUA 3KO0A 1QVIZ 1K9PA 1TNPA 3BXKA 4NQGA 4NDBA 5I8NA 2KFHA 1BU3A 3FWCA 1M46A 2GTEA 1OOHA 1GQMA 2H61C 2NXQA 3SS5A 2KGRA 2M1KB 1AVSA 2JZIA 4F0ZB 4MRXA 1DEKA 5CSIA 1QV0A 1MUXA 2JT3A 1KQVA 4CLNA 2WCFA 4ZCVA 4JWQA 4FQTA 1K90D 1SRAA 2O5GA 1D1OA 2KSPA 1WRKA 2H61A 1NYAA 2JU0A 2IS9A 1QASA 1OMDA 1KQMC 4YRUA 3O6BA 4YGBB 2QPTA 1GJYA 1EXRA 3K21A 4PHJA 1AJ4A 2FCDA 1F70A 1QWVA 2ZKMX 1EG4A 2BCBA 2NCOA 3NXAA 5HLOA 1CKKA 2BNXA 2NCPA 4AQIA 3JTDB 1K93D 4C0JA 1B8CA 3B7AA 4IJ7A 1B4CA 2PQLA 3SS3A 2I94A 4PHNA 4GNKB 1Y1XA 5AFPA 2KI4B 1MXLC 2E6WA 3CS1A 4CFQA 3BUOB 1MXEA 1J55A 2WC5A 3O78A 3PALA 4U8DA 5ER4X 1SR6C 5KTYA 2QDIA 1BG1A 2AAOA 2KBMA 4MRYA 3M0WA 1U5IA 4GGFC 4HRGA 2HETA 3AAKA 4ICBA 5D69A 1S36A 4FTGA 1SL9A 3SIBA 1OSAA 3CDNA 1CFDA 3WHTB 2JRFA 4DS7A 4C0KA 3PM8A 1DT7B 5PALA 5HKZA 2I7AA 1IJ5A 2KNEA 3BUNB 5CSJA 3B6XA 2JNXA 1EL4A 1YUUA 3FE8A 4GGFA 1LS8A 4INWA 1XYDA 1KFXL 3FS7A 1XFVO 1CMFA 2JXCA 3CYZA 4HREE 1DF0B 3BUMB 2F3ZA 2L98A 2LMUA 1B47A 3C1VA 4QJ4B 2KBIA 4JKTA 1LINA 2OPOA 3RZSA 1YRTB 1MR8A 1YVHA 4OKHA 4N1FA 2CTNA 4CIDA 2DOQA 2WCEA 1K8UA 4PE7A 4XJKB 3FIAA 1BT6A 3CZ2A 1PSBA 4OR9B 1N2DA 2L4IA 1MF8B 1YUTA 2F2PA 1RECA 2A4JA 3A4UB 5FYXA 5CPVA 1OZOA 2LVVA 4ORCB 4OZDA 5AEQA 2MRDA 3DXLA 4I5LB 1CDNA 2OTGC 2SCPA 1SBJA 1CLLA 1IJ6A 1B8RA 1TWOA 4JD9A 2YGUA 4NDCA 3PLFB 2BL0B 1YRUB 2G9BA 3B88A 3OBVA 5DKNA 3TS5C 1C3YA 1SCMC 4DCKA 1JSAA 1QIWA 1S5GZ 3PFVA 4YGCB 2TN4A 1RROA 2BKHB 2BCXA 1JFJA 1ZOTB 3EG5B 3CTNA 1DQEA 2EHBA 1DJYA 2H8VA 1NPQA 1XVJA 1Y6WA 2MBXA 1V1FA 4OCIA 4PE4A 1Z2CB 2JQ6A 1F55A 4ETOA 1DF0A 1S1EA 4F7FA 2CNPA 1WRLA 1R2UA 1KSOA 2L2CA 3FE9A 2AMIA 3ICBA 4DIRA 1UUSA 1H8BA 5K89A 4P5OE 3TDUA 1LVCD 2GV5A 1DGVA 1KQMB 4XYNA 5DKQA 3IF7A 2MAZA 2ISDA 1JC2A 4BY4A 2LVKA 1NCYA 3L4LA 1OOJA 1MQ1A 3VRPA 3Q8IA 1A4PA 3V2LA 1XK4C 2PVBA 2EC6C 4MEWA 2QEVA 2ZRSA 4USLA 1W7JB 3CABA 2K2AA 1YR5A 2K8MB 4P2YB 4N5XA 3N7HA 2MHHA 5D3OA 5D7FA 1AUIB 1DJZA 1T14A 2BAPA 3I5FC 3D10A 4QJ3B 1NCXA 5I2OA 4PALA 5IBWA 1XFRA 4PE1A 3OP0A 2L51A 3IQQA 1SL8A 3BUXB 1VRKA 3QMEA 4MBEA 3VRRA 2CBLA 1SR6B 3B86A 1XK4A 1OE9B 1SW8A 2VRGA 3D76A 1XFWO 4YBHB 5AANA 1AK8A 2K7DA 2LUXA 1CM1A 1PALA 2K7OA 2Q4UA 3DY9A 3HCMA 1IQ3A 1L7ZA 1QX2A 1YUSA 1JUOA 1SNLA 3AAJA 1KFXS 1FW4A 2D8NA 2JT0A 2JXLA 2PASA 1AJ5A 1SK6D 1NX0A 1G8IA 1WDCB 2LLTA 2ZNDA 5AXIA 3OB1B 1PULA 3EVVA 4MLWA 5DKRA 5HL1A 1XA5A 2ZFDA 3R72A 1J1EA 1RFJA 3BFAA 1YURA 2QEHA 4PDZA 4E68A 2FCEA 1B8LA 3S0DA 1CLMA 1UHIA 2P70A 4OV2A 4YI8A 1DJHA 1DJIA 2B1UA 1DJGA 1NX2A 2RGIA 4MZJA 2F33A 3OX6A 4R1EA 3TUYB 2ZN8A 3BFBA 1YX7A 1S5GY 3F45A 1Z4HA 4BY5A 2LV7A 1IWQA 1DGUA 1NX3A 2KFFA 5HKYA 2WCKA 1IGVA 2KI6D 2LVJA 1FI5A 1LA0A 3AKAA 3CGAA 5KSZA 1N0YA 4GGNA 3SG5A 1IH0A 2SASA 3KF9A 1XFYO 2BCAA 1HT9A 3R1VA 3PSRA 3OB2B 1RK9A 1QX5B 2K7CA 3EK4A 1QTXA 2L5YA 2LP2A 2M7LA 3LK1A 3PM2A 1NIWA 1OW4A 1WDCC 3O4YA 1CNPA 1GGWA 3VGOA 1YTZC 4ORBB 2OTGB 2HQWA 2KOTA 2KLEA 2KI6C 1WLZA 5BPJA 2QACA 3TS5B 2L2EA 3K1EA 1J7RA 1SCMB 1TNXA 1TUJA 1ALVA 3L4AA 1KK8C 3BFHA 1QIVA 3FE6A 3I5IC 4YGDB 4C0LA 3TUYC 3D0YA 1UHHA 3VRNA 1JBAA 4N1GA 1QXPA 1M31A 2QEBA 2MA2A 3VROA 1S6IA 5AERA 4I5JA 2KPHA 2KYCA 2L0PA 1TRFA 2K2FA 5G08A 2KYFA 1TTXA 2CXJA 3IVTA 4M2QA 1CLBA 3OGNA 4HRHA 5TNCA 1K95A 1S6JA 2ZN9A 2LVIA 3QRXA 2PMYA 1J7OA 1PVAA 1OOGA 3PN7C 1WY9A 1AHRA 3EKJA 3L47A 2LC5A 1TNQA 4NDDA 2KQ6A 1M39A 1ORGA 2LAPA 2M0RA 1B9AA 1JF0A 1K9UA 1TIZA 2JNFA 3UNWA 1XO5A 4I5NB 2WNDA 2JPTA 1DELA 1SY9A 2K60A 5DICA 4JQ0D 2LNKA 3D73A 5JJGA 1B1GA 3NSOA 1PRWA 2EC6B 4YGAA 1OMRA 1QV1A 5FI2A 1C3ZA 2Y1NA 1KWOC 2KLDA 5F6TA 4MN0A 3SIAA 3DVEA 5B8IB 2KAXA 2FJUB 1S6CA 3I5FB 4PHMA 3PJIA 4GUKA 3I5HC 1BODA 2E30A 3HX4A 5EL2A 4WQ3A 1PK0D 3SG6A 2KGBC 2M7NA 1JWDA 3GK1A 2BBNA 3SG2A 3DVMA 3TDIA 3O4XA 3SG4A 4JPZB 4MZKA 1Y1AA 1K96A 1DMOA 4IL1A 1QX7A 4Q04A 3PATA 3D78A 1NCZA 3D77A 1KK7Y 1CB1A 1H4BA 1L2OB 4GPLB 3SG7A 1BR1B 1QLKA 2BE6A 1IIOA 1CMGA 1NX1A 2LP3A 1B7TZ 1XFZO 1K94A 5JOLA 1JF2A 4MZLA 1R6PA 3CR2A 1WLMA 3S0EA 4FQOA 1IG5A 3UO9A 1HQVA 3DF0B 3A8RA 1MWNA 4YGEB 1RJVA 3H4SE 2EGDA 1TOPA 2PRUA 1K9KA 1BR4B 2WCLA 1NP8A 2LLSA 2MJWB 5ER5A 1CDLA 1UURA 1SKTA 1SL7A 1TUZA 1YVLA 3EK7A 2BBMA 1AP4A 3BUWB 3IQOA 2FJYA 2LUCA 4ZCUA 1PVBA 5I94A 2JT8A 2M9GA 2HQ8A 1XFUO 4ORAB 3DD4A 1FPWA 1OQPA 3SG3A 1Q80A 2LMVA 4PHKA 5FI7A 1EJ3A 4DRWA 1ODBA 1DJWA 3KEVA 3BYAA 3LCPC 1OOIX 3WNXB 2M29A 1CTRA 3D0YB 1J7PA 1L2OC 1OZSA 1F71A 2I2RE 2OS8C 2LLUA 3NGVA 2K0JA 1QATA 1UHKA 3KHEA 1PSRA 2AUCA 3GK2A 5I2QA 2KFGA 1WRZA 3I5GC 1Y1UA 2KAVA 2LANA 2CCMA 2PSRA 3E3RA 5I2LA 2MLEC 1KK8B 3S0FA 1CDPA 3I5IB 1F54A 1MHOA 1OOFA 3OHMB 4HSZA 3JVTC 4OVNF 1TNWA 2I18A 3CR4X 4PT1A 5J3XA 1C07A 1LXFC 2WCBA 3VRQA 2L4HA 1UP5A 2M3WA 3TZ1A 3CLNA 2V53A 1F8HA 3EVRA 2ZNEA 1UHJA 3DF0A 2JTZA 1J7QA 1FF1A 3CR5X 1NSHA 1A03A 3RLZA 1KK7Z 3PN7B 1SCVA 2LM5A 5HLVA 1CDMA 3S0BA 4AOMA 4DUQA 3S0AA 2Q91A 4AQJA 2BECA 3B87A 1EH2A 2QEOA 1KFUL 2F8PA 1NUBA 1EG3A 2NLNA 1NWDA 3DVKA 5FI6A 1C7VA 1CFFA 2M1UA 1B7TY 1SPYA 2KDHA 3VB1A 1KWOB 1QJTA 4WQ2A 1M45A 1Y0VH 1J1DA 2HPSA 4PE0A 2Y5IA 3I5HB 2K61A 5HYDA 1A75A 3D75A 1TN4A 1S3PA 1LKJA 2HF5A 1K2HA 2WCHA 1XFXO 3OX5A 2WC8A 4GAOA 3CWGA 3RM1A 3CZ1A 4CPVA 1DTLA 3BQ3A 4CFRA 4PCWA 1GM0A 3SS4A 1ZFSA 2KHNA 1G33A 1DJXA 1TCOB 2L50A 2PYQA 1BF5A 1X02A 2COLB 3WXAA 2H2KA 3R1PA 1FBVA 1M63B 2L5XB 4D1EA 1DVIA 4WRIA 2JC2A 3R1OA 2O60A 2WCJA 1SSEB 3DYEA 3JTDC 1IQ5A 1QLSA 2PALA 1ZUZA 2P71A 2ERBA 2ZRTA 1QVIY 1LA3A 1W9ZA 2LHIA
chains in the Genus database with same CATH topology
2KI4C 3BOWB 1OMVA 1QS7A 3TDZA 3EVUA 3GK4X 1KCYA 2GGMA 2JOJA 1G4YR 1JFKA 5HKWA 4I5KA 1BJFA 1ZMZA 2NZ0A 4MSPA 1C7WA 5CSNA 1V1GA 3NSKA 1W7IB 5CSFA 1UHNA 1ALWA 2FOTA 2WOSA 1BMOA 1RWYA 1SMGA 1GGZA 3ZWHA 1CFCA 1S26D 4MVFA 1N65A 3WHUB 2LMTA 4UPGA 2BKIB 3LL8B 3NSIA 1E8AA 3DVJA 4M2OA 1FI6A 2LCPA 3EKHA 2OS8B 3GOFA 2GGZA 5KU1A 2KQYA 2M8UA 2MLFC 4TNCA 4A4BA 3I5GB 3AKBA 4L9MA 2Y4QA 3LLEA 1RTP1 3CZTX 3KPXA 3EK8A 4A4CA 1CM4A 2KAYA 4GFTA 3JVTB 5GQQC 1BOCA 3NSLA 2P6BB 2K7BA 1KSMA 2M97A 3LK0A 1BLQA 2JTTA 2JWWA 4GBAA 4M2PA 2F3YA 2LHLA 1YX8A 1A29A 2WORA 2BE4A 1IRJA 1UWOA 1F4OA 1A2XA 1KFUS 3ZNIA 1TCFA 4YI9A 1F4QA 2CT9A 2G2BA 2M49B 3BOWA 3FWBA 1CFPA 4XJKA 3SJSA 2R2IA 1SYMA 2LE9B 2JULA 2BL0C 3MSEB 1A75B 4QJ5B 2Y1MA 1U5IB 3O2PA 1ZACA 2F2OA 1IKUA 3KO0A 1QVIZ 1K9PA 1TNPA 3BXKA 4NQGA 4NDBA 5I8NA 2KFHA 1BU3A 3FWCA 1M46A 2H61C 1GQMA 2NXQA 2KGRA 2M1KB 1AVSA 2JZIA 4F0ZB 4MRXA 5CSIA 1QV0A 1MUXA 2JT3A 1KQVA 4CLNA 2WCFA 4ZCVA 4JWQA 1K90D 1SRAA 2O5GA 1D1OA 2KSPA 1WRKA 2H61A 1NYAA 2JU0A 2IS9A 1QASA 1OMDA 1KQMC 4YRUA 3O6BA 4YGBB 2QPTA 1GJYA 1EXRA 3K21A 4PHJA 1AJ4A 2FCDA 1F70A 2ZKMX 1EG4A 2BCBA 2NCOA 3NXAA 5HLOA 1CKKA 2NCPA 4AQIA 3JTDB 1K93D 4C0JA 1B8CA 1B4CA 2I94A 4PHNA 4GNKB 1Y1XA 5AFPA 2KI4B 1MXLC 2E6WA 3CS1A 4CFQA 3BUOB 1MXEA 1J55A 3O78A 5ER4X 3PALA 4U8DA 5KTYA 1SR6C 1BG1A 2AAOA 2KBMA 4MRYA 3M0WA 1U5IA 4GGFC 4HRGA 2HETA 3AAKA 4ICBA 5D69A 1S36A 4FTGA 1SL9A 3SIBA 1OSAA 3WHTB 1CFDA 4DS7A 2JRFA 4C0KA 3PM8A 1DT7B 5PALA 5HKZA 2I7AA 1IJ5A 2KNEA 3BUNB 5CSJA 2JNXA 1EL4A 1YUUA 4GGFA 1XYDA 1KFXL 3FS7A 1XFVO 1CMFA 2JXCA 4HREE 1DF0B 3BUMB 2F3ZA 2L98A 2LMUA 1B47A 3C1VA 4QJ4B 2KBIA 1LINA 2OPOA 1YRTB 1MR8A 1YVHA 4OKHA 4N1FA 2CTNA 4CIDA 2DOQA 2WCEA 1K8UA 4PE7A 4XJKB 3FIAA 1BT6A 1PSBA 4OR9B 1N2DA 2L4IA 1MF8B 1YUTA 2F2PA 1RECA 2A4JA 3A4UB 5FYXA 5CPVA 1OZOA 2LVVA 4ORCB 5AEQA 2MRDA 4I5LB 1CDNA 2OTGC 2SCPA 1SBJA 1CLLA 1IJ6A 1B8RA 4NDCA 3PLFB 2BL0B 1YRUB 2G9BA 5DKNA 3TS5C 1JSAA 1SCMC 4DCKA 1QIWA 1S5GZ 3PFVA 4YGCB 2TN4A 1RROA 2BKHB 2BCXA 1JFJA 1ZOTB 3CTNA 2EHBA 1DJYA 1NPQA 1XVJA 1Y6WA 2MBXA 1V1FA 4OCIA 4PE4A 2JQ6A 1F55A 4ETOA 1DF0A 1S1EA 2CNPA 1WRLA 1R2UA 1KSOA 3ICBA 2AMIA 4DIRA 1UUSA 1H8BA 5K89A 4P5OE 3TDUA 1LVCD 2GV5A 1DGVA 1KQMB 4XYNA 5DKQA 3IF7A 2MAZA 2ISDA 1JC2A 4BY4A 2LVKA 1NCYA 1OOJA 1MQ1A 3VRPA 1A4PA 1XK4C 2PVBA 2EC6C 4MEWA 2ZRSA 4USLA 1W7JB 2K2AA 1YR5A 2K8MB 4P2YB 4N5XA 2MHHA 5D7FA 1AUIB 1DJZA 3I5FC 3D10A 4QJ3B 1NCXA 5I2OA 4PALA 5IBWA 4PE1A 3OP0A 2L51A 3IQQA 1SL8A 3BUXB 1VRKA 4MBEA 3VRRA 2CBLA 1SR6B 1XK4A 1OE9B 1SW8A 2VRGA 4YBHB 1XFWO 5AANA 1AK8A 2K7DA 2LUXA 1CM1A 1PALA 2K7OA 2Q4UA 3HCMA 1IQ3A 1L7ZA 1QX2A 1YUSA 1JUOA 1SNLA 3AAJA 1KFXS 1FW4A 2D8NA 2JT0A 2JXLA 2PASA 1AJ5A 1SK6D 1NX0A 1G8IA 1WDCB 2LLTA 2ZNDA 5AXIA 3OB1B 1PULA 3EVVA 4MLWA 5DKRA 1XA5A 2ZFDA 1J1EA 1RFJA 1YURA 4PDZA 4E68A 2FCEA 1B8LA 1CLMA 1UHIA 4OV2A 4YI8A 1DJHA 1DJIA 2B1UA 1DJGA 1NX2A 2RGIA 4MZJA 2F33A 3OX6A 4R1EA 3TUYB 2ZN8A 1YX7A 1S5GY 3F45A 4BY5A 2LV7A 1IWQA 1DGUA 1NX3A 2KFFA 5HKYA 1IGVA 2KI6D 2LVJA 1FI5A 1LA0A 3AKAA 3CGAA 5KSZA 1N0YA 4GGNA 3SG5A 1IH0A 2SASA 3KF9A 1XFYO 2BCAA 1HT9A 3PSRA 3OB2B 1RK9A 1QX5B 2K7CA 3EK4A 1QTXA 2M7LA 2LP2A 3LK1A 1CNPA 1NIWA 1WDCC 3O4YA 1GGWA 3VGOA 1YTZC 4ORBB 2OTGB 2HQWA 2KOTA 2KI6C 1WLZA 5BPJA 2QACA 3TS5B 2L2EA 1J7RA 1SCMB 1TNXA 1ALVA 1KK8C 1QIVA 3I5IC 4YGDB 4C0LA 3TUYC 3D0YA 1UHHA 3VRNA 1JBAA 4N1GA 1QXPA 1M31A 2MA2A 3VROA 1S6IA 5AERA 4I5JA 2KYCA 2L0PA 1TRFA 2K2FA 5G08A 2KYFA 1TTXA 2CXJA 4M2QA 1CLBA 4HRHA 5TNCA 1K95A 1S6JA 2ZN9A 2LVIA 3QRXA 2PMYA 1J7OA 1PVAA 3PN7C 1WY9A 1AHRA 3EKJA 2LC5A 1TNQA 4NDDA 2KQ6A 1M39A 2LAPA 2M0RA 1B9AA 1JF0A 1K9UA 1TIZA 2JNFA 1XO5A 4I5NB 2WNDA 2JPTA 1SY9A 4JQ0D 2LNKA 5JJGA 1B1GA 3NSOA 1PRWA 2EC6B 4YGAA 1OMRA 1QV1A 2Y1NA 1KWOC 3SIAA 5F6TA 4MN0A 3DVEA 5B8IB 2KAXA 2FJUB 1S6CA 3I5FB 4PHMA 1BODA 4GUKA 3I5HC 2E30A 3HX4A 4WQ3A 1PK0D 3SG6A 2KGBC 2M7NA 1JWDA 3GK1A 2BBNA 3SG2A 3DVMA 3TDIA 3SG4A 4JPZB 4MZKA 1Y1AA 1K96A 1DMOA 4IL1A 1QX7A 4Q04A 3PATA 1NCZA 1KK7Y 1CB1A 1H4BA 1L2OB 4GPLB 3SG7A 1BR1B 1QLKA 2BE6A 1CMGA 1NX1A 2LP3A 1B7TZ 1XFZO 1K94A 5JOLA 1JF2A 4MZLA 1R6PA 3CR2A 1WLMA 4FQOA 1IG5A 1HQVA 3DF0B 3A8RA 1MWNA 4YGEB 1RJVA 3H4SE 2EGDA 1TOPA 2PRUA 1K9KA 1BR4B 1NP8A 2LLSA 2MJWB 5ER5A 1CDLA 1UURA 1SKTA 1SL7A 1YVLA 3EK7A 2BBMA 1AP4A 3BUWB 3IQOA 2LUCA 4ZCUA 1PVBA 2JT8A 2M9GA 2HQ8A 1XFUO 4ORAB 3DD4A 1FPWA 1OQPA 3SG3A 1Q80A 2LMVA 4PHKA 1EJ3A 4DRWA 1ODBA 1DJWA 3KEVA 3BYAA 3LCPC 3WNXB 2M29A 1CTRA 3D0YB 1J7PA 1L2OC 1OZSA 1F71A 2I2RE 2OS8C 2LLUA 2K0JA 1QATA 1UHKA 3KHEA 1PSRA 2AUCA 3GK2A 5I2QA 2KFGA 1WRZA 3I5GC 1Y1UA 2KAVA 2LANA 2CCMA 2PSRA 3E3RA 5I2LA 2MLEC 1KK8B 1F54A 1CDPA 3I5IB 1MHOA 3OHMB 4HSZA 3JVTC 4OVNF 1TNWA 2I18A 3CR4X 5J3XA 1C07A 1LXFC 2WCBA 3VRQA 2L4HA 1UP5A 2M3WA 3TZ1A 3CLNA 2V53A 1F8HA 3EVRA 2ZNEA 1UHJA 3DF0A 2JTZA 1J7QA 1FF1A 3CR5X 1NSHA 1A03A 3RLZA 1KK7Z 3PN7B 1SCVA 2LM5A 5HLVA 1CDMA 4AOMA 4DUQA 2Q91A 4AQJA 2BECA 1EH2A 1KFUL 2F8PA 1NUBA 1EG3A 2NLNA 1NWDA 3DVKA 1C7VA 1CFFA 2M1UA 1B7TY 1SPYA 2KDHA 1KWOB 1QJTA 4WQ2A 1M45A 1Y0VH 1J1DA 2HPSA 4PE0A 2Y5IA 3I5HB 2K61A 5HYDA 1A75A 1TN4A 1S3PA 1LKJA 2HF5A 1K2HA 1XFXO 3OX5A 2WC8A 4GAOA 3CWGA 3RM1A 4CPVA 1DTLA 3BQ3A 4CFRA 4PCWA 1ZFSA 2KHNA 1G33A 1DJXA 1TCOB 2L50A 1BF5A 1X02A 2COLB 3WXAA 2H2KA 1FBVA 1M63B 2L5XB 4D1EA 1DVIA 4WRIA 2JC2A 2O60A 3JTDC 1IQ5A 1QLSA 2PALA 1ZUZA 2ZRTA 1QVIY 1LA3A 2LHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI4 C;  3BOW B;  1OMV A;  1QS7 A;  3TDZ A;  3EVU A;  3GK4 X;  1KCY A;  2GGM A;  2JOJ A;  1G4Y R;  1JFK A;  5HKW A;  4I5K A;  1BJF A;  1ZMZ A;  2NZ0 A;  4MSP A;  1C7W A;  5CSN A;  1V1G A;  3NSK A;  1W7I B;  5CSF A;  1UHN A;  1ALW A;  2FOT A;  2WOS A;  1BMO A;  1RWY A;  1SMG A;  1GGZ A;  3ZWH A;  1CFC A;  1S26 D;  4MVF A;  1N65 A;  3WHU B;  2LMT A;  4UPG A;  2BKI B;  3LL8 B;  3NSI A;  1E8A A;  3DVJ A;  4M2O A;  1FI6 A;  2LCP A;  3EKH A;  2OS8 B;  3GOF A;  2GGZ A;  5KU1 A;  2KQY A;  2M8U A;  2MLF C;  4TNC A;  4A4B A;  3I5G B;  3AKB A;  4L9M A;  2Y4Q A;  3LLE A;  1RTP 1;  3CZT X;  3KPX A;  3EK8 A;  4A4C A;  1CM4 A;  2KAY A;  4GFT A;  3JVT B;  5GQQ C;  1BOC A;  3NSL A;  2P6B B;  2K7B A;  1KSM A;  2M97 A;  3LK0 A;  1BLQ A;  2JTT A;  2JWW A;  4GBA A;  4M2P A;  2F3Y A;  2LHL A;  1YX8 A;  1A29 A;  2WOR A;  2BE4 A;  1IRJ A;  1UWO A;  1F4O A;  1A2X A;  1KFU S;  3ZNI A;  1TCF A;  4YI9 A;  1F4Q A;  2CT9 A;  2G2B A;  2M49 B;  3BOW A;  3FWB A;  1CFP A;  4XJK A;  3SJS A;  2R2I A;  1SYM A;  2LE9 B;  2JUL A;  2BL0 C;  3MSE B;  1A75 B;  4QJ5 B;  2Y1M A;  1U5I B;  3O2P A;  1ZAC A;  2F2O A;  1IKU A;  3KO0 A;  1QVI Z;  1K9P A;  1TNP A;  3BXK A;  4NQG A;  4NDB A;  5I8N A;  2KFH A;  1BU3 A;  3FWC A;  1M46 A;  2H61 C;  1GQM A;  2NXQ A;  2KGR A;  2M1K B;  1AVS A;  2JZI A;  4F0Z B;  4MRX A;  5CSI A;  1QV0 A;  1MUX A;  2JT3 A;  1KQV A;  4CLN A;  2WCF A;  4ZCV A;  4JWQ A;  1K90 D;  1SRA A;  2O5G A;  1D1O A;  2KSP A;  1WRK A;  2H61 A;  1NYA A;  2JU0 A;  2IS9 A;  1QAS A;  1OMD A;  1KQM C;  4YRU A;  3O6B A;  4YGB B;  2QPT A;  1GJY A;  1EXR A;  3K21 A;  4PHJ A;  1AJ4 A;  2FCD A;  1F70 A;  2ZKM X;  1EG4 A;  2BCB A;  2NCO A;  3NXA A;  5HLO A;  1CKK A;  2NCP A;  4AQI A;  3JTD B;  1K93 D;  4C0J A;  1B8C A;  1B4C A;  2I94 A;  4PHN A;  4GNK B;  1Y1X A;  5AFP A;  2KI4 B;  1MXL C;  2E6W A;  3CS1 A;  4CFQ A;  3BUO B;  1MXE A;  1J55 A;  3O78 A;  5ER4 X;  3PAL A;  4U8D A;  5KTY A;  1SR6 C;  1BG1 A;  2AAO A;  2KBM A;  4MRY A;  3M0W A;  1U5I A;  4GGF C;  4HRG A;  2HET A;  3AAK A;  4ICB A;  5D69 A;  1S36 A;  4FTG A;  1SL9 A;  3SIB A;  1OSA A;  3WHT B;  1CFD A;  4DS7 A;  2JRF A;  4C0K A;  3PM8 A;  1DT7 B;  5PAL A;  5HKZ A;  2I7A A;  1IJ5 A;  2KNE A;  3BUN B;  5CSJ A;  2JNX A;  1EL4 A;  1YUU A;  4GGF A;  1XYD A;  1KFX L;  3FS7 A;  1XFV O;  1CMF A;  2JXC A;  4HRE E;  1DF0 B;  3BUM B;  2F3Z A;  2L98 A;  2LMU A;  1B47 A;  3C1V A;  4QJ4 B;  2KBI A;  1LIN A;  2OPO A;  1YRT B;  1MR8 A;  1YVH A;  4OKH A;  4N1F A;  2CTN A;  4CID A;  2DOQ A;  2WCE A;  1K8U A;  4PE7 A;  4XJK B;  3FIA A;  1BT6 A;  1PSB A;  4OR9 B;  1N2D A;  2L4I A;  1MF8 B;  1YUT A;  2F2P A;  1REC A;  2A4J A;  3A4U B;  5FYX A;  5CPV A;  1OZO A;  2LVV A;  4ORC B;  5AEQ A;  2MRD A;  4I5L B;  1CDN A;  2OTG C;  2SCP A;  1SBJ A;  1CLL A;  1IJ6 A;  1B8R A;  4NDC A;  3PLF B;  2BL0 B;  1YRU B;  2G9B A;  5DKN A;  3TS5 C;  1JSA A;  1SCM C;  4DCK A;  1QIW A;  1S5G Z;  3PFV A;  4YGC B;  2TN4 A;  1RRO A;  2BKH B;  2BCX A;  1JFJ A;  1ZOT B;  3CTN A;  2EHB A;  1DJY A;  1NPQ A;  1XVJ A;  1Y6W A;  2MBX A;  1V1F A;  4OCI A;  4PE4 A;  2JQ6 A;  1F55 A;  4ETO A;  1DF0 A;  1S1E A;  2CNP A;  1WRL A;  1R2U A;  1KSO A;  3ICB A;  2AMI A;  4DIR A;  1UUS A;  1H8B A;  5K89 A;  4P5O E;  3TDU A;  1LVC D;  2GV5 A;  1DGV A;  1KQM B;  4XYN A;  5DKQ A;  3IF7 A;  2MAZ A;  2ISD A;  1JC2 A;  4BY4 A;  2LVK A;  1NCY A;  1OOJ A;  1MQ1 A;  3VRP A;  1A4P A;  1XK4 C;  2PVB A;  2EC6 C;  4MEW A;  2ZRS A;  4USL A;  1W7J B;  2K2A A;  1YR5 A;  2K8M B;  4P2Y B;  4N5X A;  2MHH A;  5D7F A;  1AUI B;  1DJZ A;  3I5F C;  3D10 A;  4QJ3 B;  1NCX A;  5I2O A;  4PAL A;  5IBW A;  4PE1 A;  3OP0 A;  2L51 A;  3IQQ A;  1SL8 A;  3BUX B;  1VRK A;  4MBE A;  3VRR A;  2CBL A;  1SR6 B;  1XK4 A;  1OE9 B;  1SW8 A;  2VRG A;  4YBH B;  1XFW O;  5AAN A;  1AK8 A;  2K7D A;  2LUX A;  1CM1 A;  1PAL A;  2K7O A;  2Q4U A;  3HCM A;  1IQ3 A;  1L7Z A;  1QX2 A;  1YUS A;  1JUO A;  1SNL A;  3AAJ A;  1KFX S;  1FW4 A;  2D8N A;  2JT0 A;  2JXL A;  2PAS A;  1AJ5 A;  1SK6 D;  1NX0 A;  1G8I A;  1WDC B;  2LLT A;  2ZND A;  5AXI A;  3OB1 B;  1PUL A;  3EVV A;  4MLW A;  5DKR A;  1XA5 A;  2ZFD A;  1J1E A;  1RFJ A;  1YUR A;  4PDZ A;  4E68 A;  2FCE A;  1B8L A;  1CLM A;  1UHI A;  4OV2 A;  4YI8 A;  1DJH A;  1DJI A;  2B1U A;  1DJG A;  1NX2 A;  2RGI A;  4MZJ A;  2F33 A;  3OX6 A;  4R1E A;  3TUY B;  2ZN8 A;  1YX7 A;  1S5G Y;  3F45 A;  4BY5 A;  2LV7 A;  1IWQ A;  1DGU A;  1NX3 A;  2KFF A;  5HKY A;  1IGV A;  2KI6 D;  2LVJ A;  1FI5 A;  1LA0 A;  3AKA A;  3CGA A;  5KSZ A;  1N0Y A;  4GGN A;  3SG5 A;  1IH0 A;  2SAS A;  3KF9 A;  1XFY O;  2BCA A;  1HT9 A;  3PSR A;  3OB2 B;  1RK9 A;  1QX5 B;  2K7C A;  3EK4 A;  1QTX A;  2M7L A;  2LP2 A;  3LK1 A;  1CNP A;  1NIW A;  1WDC C;  3O4Y A;  1GGW A;  3VGO A;  1YTZ C;  4ORB B;  2OTG B;  2HQW A;  2KOT A;  2KI6 C;  1WLZ A;  5BPJ A;  2QAC A;  3TS5 B;  2L2E A;  1J7R A;  1SCM B;  1TNX A;  1ALV A;  1KK8 C;  1QIV A;  3I5I C;  4YGD B;  4C0L A;  3TUY C;  3D0Y A;  1UHH A;  3VRN A;  1JBA A;  4N1G A;  1QXP A;  1M31 A;  2MA2 A;  3VRO A;  1S6I A;  5AER A;  4I5J A;  2KYC A;  2L0P A;  1TRF A;  2K2F A;  5G08 A;  2KYF A;  1TTX A;  2CXJ A;  4M2Q A;  1CLB A;  4HRH A;  5TNC A;  1K95 A;  1S6J A;  2ZN9 A;  2LVI A;  3QRX A;  2PMY A;  1J7O A;  1PVA A;  3PN7 C;  1WY9 A;  1AHR A;  3EKJ A;  2LC5 A;  1TNQ A;  4NDD A;  2KQ6 A;  1M39 A;  2LAP A;  2M0R A;  1B9A A;  1JF0 A;  1K9U A;  1TIZ A;  2JNF A;  1XO5 A;  4I5N B;  2WND A;  2JPT A;  1SY9 A;  4JQ0 D;  2LNK A;  5JJG A;  1B1G A;  3NSO A;  1PRW A;  2EC6 B;  4YGA A;  1OMR A;  1QV1 A;  2Y1N A;  1KWO C;  3SIA A;  5F6T A;  4MN0 A;  3DVE A;  5B8I B;  2KAX A;  2FJU B;  1S6C A;  3I5F B;  4PHM A;  1BOD A;  4GUK A;  3I5H C;  2E30 A;  3HX4 A;  4WQ3 A;  1PK0 D;  3SG6 A;  2KGB C;  2M7N A;  1JWD A;  3GK1 A;  2BBN A;  3SG2 A;  3DVM A;  3TDI A;  3SG4 A;  4JPZ B;  4MZK A;  1Y1A A;  1K96 A;  1DMO A;  4IL1 A;  1QX7 A;  4Q04 A;  3PAT A;  1NCZ A;  1KK7 Y;  1CB1 A;  1H4B A;  1L2O B;  4GPL B;  3SG7 A;  1BR1 B;  1QLK A;  2BE6 A;  1CMG A;  1NX1 A;  2LP3 A;  1B7T Z;  1XFZ O;  1K94 A;  5JOL A;  1JF2 A;  4MZL A;  1R6P A;  3CR2 A;  1WLM A;  4FQO A;  1IG5 A;  1HQV A;  3DF0 B;  3A8R A;  1MWN A;  4YGE B;  1RJV A;  3H4S E;  2EGD A;  1TOP A;  2PRU A;  1K9K A;  1BR4 B;  1NP8 A;  2LLS A;  2MJW B;  5ER5 A;  1CDL A;  1UUR A;  1SKT A;  1SL7 A;  1YVL A;  3EK7 A;  2BBM A;  1AP4 A;  3BUW B;  3IQO A;  2LUC A;  4ZCU A;  1PVB A;  2JT8 A;  2M9G A;  2HQ8 A;  1XFU O;  4ORA B;  3DD4 A;  1FPW A;  1OQP A;  3SG3 A;  1Q80 A;  2LMV A;  4PHK A;  1EJ3 A;  4DRW A;  1ODB A;  1DJW A;  3KEV A;  3BYA A;  3LCP C;  3WNX B;  2M29 A;  1CTR A;  3D0Y B;  1J7P A;  1L2O C;  1OZS A;  1F71 A;  2I2R E;  2OS8 C;  2LLU A;  2K0J A;  1QAT A;  1UHK A;  3KHE A;  1PSR A;  2AUC A;  3GK2 A;  5I2Q A;  2KFG A;  1WRZ A;  3I5G C;  1Y1U A;  2KAV A;  2LAN A;  2CCM A;  2PSR A;  3E3R A;  5I2L A;  2MLE C;  1KK8 B;  1F54 A;  1CDP A;  3I5I B;  1MHO A;  3OHM B;  4HSZ A;  3JVT C;  4OVN F;  1TNW A;  2I18 A;  3CR4 X;  5J3X A;  1C07 A;  1LXF C;  2WCB A;  3VRQ A;  2L4H A;  1UP5 A;  2M3W A;  3TZ1 A;  3CLN A;  2V53 A;  1F8H A;  3EVR A;  2ZNE A;  1UHJ A;  3DF0 A;  2JTZ A;  1J7Q A;  1FF1 A;  3CR5 X;  1NSH A;  1A03 A;  3RLZ A;  1KK7 Z;  3PN7 B;  1SCV A;  2LM5 A;  5HLV A;  1CDM A;  4AOM A;  4DUQ A;  2Q91 A;  4AQJ A;  2BEC A;  1EH2 A;  1KFU L;  2F8P A;  1NUB A;  1EG3 A;  2NLN A;  1NWD A;  3DVK A;  1C7V A;  1CFF A;  2M1U A;  1B7T Y;  1SPY A;  2KDH A;  1KWO B;  1QJT A;  4WQ2 A;  1M45 A;  1Y0V H;  1J1D A;  2HPS A;  4PE0 A;  2Y5I A;  3I5H B;  2K61 A;  5HYD A;  1A75 A;  1TN4 A;  1S3P A;  1LKJ A;  2HF5 A;  1K2H A;  1XFX O;  3OX5 A;  2WC8 A;  4GAO A;  3CWG A;  3RM1 A;  4CPV A;  1DTL A;  3BQ3 A;  4CFR A;  4PCW A;  1ZFS A;  2KHN A;  1G33 A;  1DJX A;  1TCO B;  2L50 A;  1BF5 A;  1X02 A;  2COL B;  3WXA A;  2H2K A;  1FBV A;  1M63 B;  2L5X B;  4D1E A;  1DVI A;  4WRI A;  2JC2 A;  2O60 A;  3JTD C;  1IQ5 A;  1QLS A;  2PAL A;  1ZUZ A;  2ZRT A;  1QVI Y;  1LA3 A;  2LHI A; 
#chains in the Genus database with same CATH topology
 2KI4 C;  3BOW B;  1OMV A;  1QS7 A;  3TDZ A;  3EVU A;  3GK4 X;  1KCY A;  2GGM A;  2JOJ A;  1G4Y R;  1JFK A;  5HKW A;  4I5K A;  1BJF A;  1ZMZ A;  2JPO A;  2NZ0 A;  4MSP A;  1C7W A;  5CSN A;  1V1G A;  3NSK A;  1W7I B;  5CSF A;  1UHN A;  1ALW A;  2FOT A;  2WOS A;  1BMO A;  1RWY A;  1SMG A;  1GGZ A;  3NHT A;  3ZWH A;  1CFC A;  1S26 D;  3D74 A;  4MVF A;  1N65 A;  3BJH A;  2LMT A;  3WHU B;  3NHI A;  4UPG A;  2BKI B;  3LL8 B;  3NSI A;  1E8A A;  3DVJ A;  4M2O A;  1FI6 A;  2LCP A;  3EKH A;  2OS8 B;  3GOF A;  2GGZ A;  5KU1 A;  2KQY A;  2M8U A;  2WCM A;  2MLF C;  4TNC A;  4A4B A;  3I5G B;  3AKB A;  4L9M A;  2Y4Q A;  3LLE A;  1RTP 1;  3S0G A;  3CZT X;  3KPX A;  3EK8 A;  1DC1 A;  4A4C A;  1CM4 A;  2KAY A;  4GFT A;  3JVT B;  5GQQ C;  1BOC A;  1P28 A;  3NSL A;  2P6B B;  2K7B A;  1KSM A;  2M97 A;  3LK0 A;  1BLQ A;  2JTT A;  2JWW A;  3CZ0 A;  4GBA A;  4M2P A;  2F3Y A;  2LHL A;  1YX8 A;  1A29 A;  2WOR A;  1UWO A;  1IRJ A;  2BE4 A;  1F4O A;  1A2X A;  1KFU S;  4INX A;  3ZNI A;  1TCF A;  4YI9 A;  1F4Q A;  2CT9 A;  2G2B A;  2M49 B;  3BOW A;  3FWB A;  1CFP A;  4XJK A;  3SJS A;  2R2I A;  2WC6 A;  1SYM A;  2LE9 B;  4KYN A;  2JUL A;  2BL0 C;  3DZT A;  3MSE B;  1A75 B;  4QJ5 B;  2Y1M A;  1U5I B;  3O2P A;  1ZAC A;  2F2O A;  1IKU A;  3KO0 A;  1QVI Z;  1K9P A;  1TNP A;  3BXK A;  4NQG A;  4NDB A;  5I8N A;  2KFH A;  1BU3 A;  3FWC A;  1M46 A;  2GTE A;  1OOH A;  1GQM A;  2H61 C;  2NXQ A;  3SS5 A;  2KGR A;  2M1K B;  1AVS A;  2JZI A;  4F0Z B;  4MRX A;  1DEK A;  5CSI A;  1QV0 A;  1MUX A;  2JT3 A;  1KQV A;  4CLN A;  2WCF A;  4ZCV A;  4JWQ A;  4FQT A;  1K90 D;  1SRA A;  2O5G A;  1D1O A;  2KSP A;  1WRK A;  2H61 A;  1NYA A;  2JU0 A;  2IS9 A;  1QAS A;  1OMD A;  1KQM C;  4YRU A;  3O6B A;  4YGB B;  2QPT A;  1GJY A;  1EXR A;  3K21 A;  4PHJ A;  1AJ4 A;  2FCD A;  1F70 A;  1QWV A;  2ZKM X;  1EG4 A;  2BCB A;  2NCO A;  3NXA A;  5HLO A;  1CKK A;  2BNX A;  2NCP A;  4AQI A;  3JTD B;  1K93 D;  4C0J A;  1B8C A;  3B7A A;  4IJ7 A;  1B4C A;  2PQL A;  3SS3 A;  2I94 A;  4PHN A;  4GNK B;  1Y1X A;  5AFP A;  2KI4 B;  1MXL C;  2E6W A;  3CS1 A;  4CFQ A;  3BUO B;  1MXE A;  1J55 A;  2WC5 A;  3O78 A;  3PAL A;  4U8D A;  5ER4 X;  1SR6 C;  5KTY A;  2QDI A;  1BG1 A;  2AAO A;  2KBM A;  4MRY A;  3M0W A;  1U5I A;  4GGF C;  4HRG A;  2HET A;  3AAK A;  4ICB A;  5D69 A;  1S36 A;  4FTG A;  1SL9 A;  3SIB A;  1OSA A;  3CDN A;  1CFD A;  3WHT B;  2JRF A;  4DS7 A;  4C0K A;  3PM8 A;  1DT7 B;  5PAL A;  5HKZ A;  2I7A A;  1IJ5 A;  2KNE A;  3BUN B;  5CSJ A;  3B6X A;  2JNX A;  1EL4 A;  1YUU A;  3FE8 A;  4GGF A;  1LS8 A;  4INW A;  1XYD A;  1KFX L;  3FS7 A;  1XFV O;  1CMF A;  2JXC A;  3CYZ A;  4HRE E;  1DF0 B;  3BUM B;  2F3Z A;  2L98 A;  2LMU A;  1B47 A;  3C1V A;  4QJ4 B;  2KBI A;  4JKT A;  1LIN A;  2OPO A;  3RZS A;  1YRT B;  1MR8 A;  1YVH A;  4OKH A;  4N1F A;  2CTN A;  4CID A;  2DOQ A;  2WCE A;  1K8U A;  4PE7 A;  4XJK B;  3FIA A;  1BT6 A;  3CZ2 A;  1PSB A;  4OR9 B;  1N2D A;  2L4I A;  1MF8 B;  1YUT A;  2F2P A;  1REC A;  2A4J A;  3A4U B;  5FYX A;  5CPV A;  1OZO A;  2LVV A;  4ORC B;  4OZD A;  5AEQ A;  2MRD A;  3DXL A;  4I5L B;  1CDN A;  2OTG C;  2SCP A;  1SBJ A;  1CLL A;  1IJ6 A;  1B8R A;  1TWO A;  4JD9 A;  2YGU A;  4NDC A;  3PLF B;  2BL0 B;  1YRU B;  2G9B A;  3B88 A;  3OBV A;  5DKN A;  3TS5 C;  1C3Y A;  1SCM C;  4DCK A;  1JSA A;  1QIW A;  1S5G Z;  3PFV A;  4YGC B;  2TN4 A;  1RRO A;  2BKH B;  2BCX A;  1JFJ A;  1ZOT B;  3EG5 B;  3CTN A;  1DQE A;  2EHB A;  1DJY A;  2H8V A;  1NPQ A;  1XVJ A;  1Y6W A;  2MBX A;  1V1F A;  4OCI A;  4PE4 A;  1Z2C B;  2JQ6 A;  1F55 A;  4ETO A;  1DF0 A;  1S1E A;  4F7F A;  2CNP A;  1WRL A;  1R2U A;  1KSO A;  2L2C A;  3FE9 A;  2AMI A;  3ICB A;  4DIR A;  1UUS A;  1H8B A;  5K89 A;  4P5O E;  3TDU A;  1LVC D;  2GV5 A;  1DGV A;  1KQM B;  4XYN A;  5DKQ A;  3IF7 A;  2MAZ A;  2ISD A;  1JC2 A;  4BY4 A;  2LVK A;  1NCY A;  3L4L A;  1OOJ A;  1MQ1 A;  3VRP A;  3Q8I A;  1A4P A;  3V2L A;  1XK4 C;  2PVB A;  2EC6 C;  4MEW A;  2QEV A;  2ZRS A;  4USL A;  1W7J B;  3CAB A;  2K2A A;  1YR5 A;  2K8M B;  4P2Y B;  4N5X A;  3N7H A;  2MHH A;  5D3O A;  5D7F A;  1AUI B;  1DJZ A;  1T14 A;  2BAP A;  3I5F C;  3D10 A;  4QJ3 B;  1NCX A;  5I2O A;  4PAL A;  5IBW A;  1XFR A;  4PE1 A;  3OP0 A;  2L51 A;  3IQQ A;  1SL8 A;  3BUX B;  1VRK A;  3QME A;  4MBE A;  3VRR A;  2CBL A;  1SR6 B;  3B86 A;  1XK4 A;  1OE9 B;  1SW8 A;  2VRG A;  3D76 A;  1XFW O;  4YBH B;  5AAN A;  1AK8 A;  2K7D A;  2LUX A;  1CM1 A;  1PAL A;  2K7O A;  2Q4U A;  3DY9 A;  3HCM A;  1IQ3 A;  1L7Z A;  1QX2 A;  1YUS A;  1JUO A;  1SNL A;  3AAJ A;  1KFX S;  1FW4 A;  2D8N A;  2JT0 A;  2JXL A;  2PAS A;  1AJ5 A;  1SK6 D;  1NX0 A;  1G8I A;  1WDC B;  2LLT A;  2ZND A;  5AXI A;  3OB1 B;  1PUL A;  3EVV A;  4MLW A;  5DKR A;  5HL1 A;  1XA5 A;  2ZFD A;  3R72 A;  1J1E A;  1RFJ A;  3BFA A;  1YUR A;  2QEH A;  4PDZ A;  4E68 A;  2FCE A;  1B8L A;  3S0D A;  1CLM A;  1UHI A;  2P70 A;  4OV2 A;  4YI8 A;  1DJH A;  1DJI A;  2B1U A;  1DJG A;  1NX2 A;  2RGI A;  4MZJ A;  2F33 A;  3OX6 A;  4R1E A;  3TUY B;  2ZN8 A;  3BFB A;  1YX7 A;  1S5G Y;  3F45 A;  1Z4H A;  4BY5 A;  2LV7 A;  1IWQ A;  1DGU A;  1NX3 A;  2KFF A;  5HKY A;  2WCK A;  1IGV A;  2KI6 D;  2LVJ A;  1FI5 A;  1LA0 A;  3AKA A;  3CGA A;  5KSZ A;  1N0Y A;  4GGN A;  3SG5 A;  1IH0 A;  2SAS A;  3KF9 A;  1XFY O;  2BCA A;  1HT9 A;  3R1V A;  3PSR A;  3OB2 B;  1RK9 A;  1QX5 B;  2K7C A;  3EK4 A;  1QTX A;  2L5Y A;  2LP2 A;  2M7L A;  3LK1 A;  3PM2 A;  1NIW A;  1OW4 A;  1WDC C;  3O4Y A;  1CNP A;  1GGW A;  3VGO A;  1YTZ C;  4ORB B;  2OTG B;  2HQW A;  2KOT A;  2KLE A;  2KI6 C;  1WLZ A;  5BPJ A;  2QAC A;  3TS5 B;  2L2E A;  3K1E A;  1J7R A;  1SCM B;  1TNX A;  1TUJ A;  1ALV A;  3L4A A;  1KK8 C;  3BFH A;  1QIV A;  3FE6 A;  3I5I C;  4YGD B;  4C0L A;  3TUY C;  3D0Y A;  1UHH A;  3VRN A;  1JBA A;  4N1G A;  1QXP A;  1M31 A;  2QEB A;  2MA2 A;  3VRO A;  1S6I A;  5AER A;  4I5J A;  2KPH A;  2KYC A;  2L0P A;  1TRF A;  2K2F A;  5G08 A;  2KYF A;  1TTX A;  2CXJ A;  3IVT A;  4M2Q A;  1CLB A;  3OGN A;  4HRH A;  5TNC A;  1K95 A;  1S6J A;  2ZN9 A;  2LVI A;  3QRX A;  2PMY A;  1J7O A;  1PVA A;  1OOG A;  3PN7 C;  1WY9 A;  1AHR A;  3EKJ A;  3L47 A;  2LC5 A;  1TNQ A;  4NDD A;  2KQ6 A;  1M39 A;  1ORG A;  2LAP A;  2M0R A;  1B9A A;  1JF0 A;  1K9U A;  1TIZ A;  2JNF A;  3UNW A;  1XO5 A;  4I5N B;  2WND A;  2JPT A;  1DEL A;  1SY9 A;  2K60 A;  5DIC A;  4JQ0 D;  2LNK A;  3D73 A;  5JJG A;  1B1G A;  3NSO A;  1PRW A;  2EC6 B;  4YGA A;  1OMR A;  1QV1 A;  5FI2 A;  1C3Z A;  2Y1N A;  1KWO C;  2KLD A;  5F6T A;  4MN0 A;  3SIA A;  3DVE A;  5B8I B;  2KAX A;  2FJU B;  1S6C A;  3I5F B;  4PHM A;  3PJI A;  4GUK A;  3I5H C;  1BOD A;  2E30 A;  3HX4 A;  5EL2 A;  4WQ3 A;  1PK0 D;  3SG6 A;  2KGB C;  2M7N A;  1JWD A;  3GK1 A;  2BBN A;  3SG2 A;  3DVM A;  3TDI A;  3O4X A;  3SG4 A;  4JPZ B;  4MZK A;  1Y1A A;  1K96 A;  1DMO A;  4IL1 A;  1QX7 A;  4Q04 A;  3PAT A;  3D78 A;  1NCZ A;  3D77 A;  1KK7 Y;  1CB1 A;  1H4B A;  1L2O B;  4GPL B;  3SG7 A;  1BR1 B;  1QLK A;  2BE6 A;  1IIO A;  1CMG A;  1NX1 A;  2LP3 A;  1B7T Z;  1XFZ O;  1K94 A;  5JOL A;  1JF2 A;  4MZL A;  1R6P A;  3CR2 A;  1WLM A;  3S0E A;  4FQO A;  1IG5 A;  3UO9 A;  1HQV A;  3DF0 B;  3A8R A;  1MWN A;  4YGE B;  1RJV A;  3H4S E;  2EGD A;  1TOP A;  2PRU A;  1K9K A;  1BR4 B;  2WCL A;  1NP8 A;  2LLS A;  2MJW B;  5ER5 A;  1CDL A;  1UUR A;  1SKT A;  1SL7 A;  1TUZ A;  1YVL A;  3EK7 A;  2BBM A;  1AP4 A;  3BUW B;  3IQO A;  2FJY A;  2LUC A;  4ZCU A;  1PVB A;  5I94 A;  2JT8 A;  2M9G A;  2HQ8 A;  1XFU O;  4ORA B;  3DD4 A;  1FPW A;  1OQP A;  3SG3 A;  1Q80 A;  2LMV A;  4PHK A;  5FI7 A;  1EJ3 A;  4DRW A;  1ODB A;  1DJW A;  3KEV A;  3BYA A;  3LCP C;  1OOI X;  3WNX B;  2M29 A;  1CTR A;  3D0Y B;  1J7P A;  1L2O C;  1OZS A;  1F71 A;  2I2R E;  2OS8 C;  2LLU A;  3NGV A;  2K0J A;  1QAT A;  1UHK A;  3KHE A;  1PSR A;  2AUC A;  3GK2 A;  5I2Q A;  2KFG A;  1WRZ A;  3I5G C;  1Y1U A;  2KAV A;  2LAN A;  2CCM A;  2PSR A;  3E3R A;  5I2L A;  2MLE C;  1KK8 B;  3S0F A;  1CDP A;  3I5I B;  1F54 A;  1MHO A;  1OOF A;  3OHM B;  4HSZ A;  3JVT C;  4OVN F;  1TNW A;  2I18 A;  3CR4 X;  4PT1 A;  5J3X A;  1C07 A;  1LXF C;  2WCB A;  3VRQ A;  2L4H A;  1UP5 A;  2M3W A;  3TZ1 A;  3CLN A;  2V53 A;  1F8H A;  3EVR A;  2ZNE A;  1UHJ A;  3DF0 A;  2JTZ A;  1J7Q A;  1FF1 A;  3CR5 X;  1NSH A;  1A03 A;  3RLZ A;  1KK7 Z;  3PN7 B;  1SCV A;  2LM5 A;  5HLV A;  1CDM A;  3S0B A;  4AOM A;  4DUQ A;  3S0A A;  2Q91 A;  4AQJ A;  2BEC A;  3B87 A;  1EH2 A;  2QEO A;  1KFU L;  2F8P A;  1NUB A;  1EG3 A;  2NLN A;  1NWD A;  3DVK A;  5FI6 A;  1C7V A;  1CFF A;  2M1U A;  1B7T Y;  1SPY A;  2KDH A;  3VB1 A;  1KWO B;  1QJT A;  4WQ2 A;  1M45 A;  1Y0V H;  1J1D A;  2HPS A;  4PE0 A;  2Y5I A;  3I5H B;  2K61 A;  5HYD A;  1A75 A;  3D75 A;  1TN4 A;  1S3P A;  1LKJ A;  2HF5 A;  1K2H A;  2WCH A;  1XFX O;  3OX5 A;  2WC8 A;  4GAO A;  3CWG A;  3RM1 A;  3CZ1 A;  4CPV A;  1DTL A;  3BQ3 A;  4CFR A;  4PCW A;  1GM0 A;  3SS4 A;  1ZFS A;  2KHN A;  1G33 A;  1DJX A;  1TCO B;  2L50 A;  2PYQ A;  1BF5 A;  1X02 A;  2COL B;  3WXA A;  2H2K A;  3R1P A;  1FBV A;  1M63 B;  2L5X B;  4D1E A;  1DVI A;  4WRI A;  2JC2 A;  3R1O A;  2O60 A;  2WCJ A;  1SSE B;  3DYE A;  3JTD C;  1IQ5 A;  1QLS A;  2PAL A;  1ZUZ A;  2P71 A;  2ERB A;  2ZRT A;  1QVI Y;  1LA3 A;  1W9Z A;  2LHI A; 
#chains in the Genus database with same CATH homology
 2KI4 C;  3BOW B;  1OMV A;  1QS7 A;  3TDZ A;  3EVU A;  3GK4 X;  1KCY A;  2GGM A;  2JOJ A;  1G4Y R;  1JFK A;  5HKW A;  4I5K A;  1BJF A;  1ZMZ A;  2NZ0 A;  4MSP A;  1C7W A;  5CSN A;  1V1G A;  3NSK A;  1W7I B;  5CSF A;  1UHN A;  1ALW A;  2FOT A;  2WOS A;  1BMO A;  1RWY A;  1SMG A;  1GGZ A;  3ZWH A;  1CFC A;  1S26 D;  4MVF A;  1N65 A;  3WHU B;  2LMT A;  4UPG A;  2BKI B;  3LL8 B;  3NSI A;  1E8A A;  3DVJ A;  4M2O A;  1FI6 A;  2LCP A;  3EKH A;  2OS8 B;  3GOF A;  2GGZ A;  5KU1 A;  2KQY A;  2M8U A;  2MLF C;  4TNC A;  4A4B A;  3I5G B;  3AKB A;  4L9M A;  2Y4Q A;  3LLE A;  1RTP 1;  3CZT X;  3KPX A;  3EK8 A;  4A4C A;  1CM4 A;  2KAY A;  4GFT A;  3JVT B;  5GQQ C;  1BOC A;  3NSL A;  2P6B B;  2K7B A;  1KSM A;  2M97 A;  3LK0 A;  1BLQ A;  2JTT A;  2JWW A;  4GBA A;  4M2P A;  2F3Y A;  2LHL A;  1YX8 A;  1A29 A;  2WOR A;  2BE4 A;  1IRJ A;  1UWO A;  1F4O A;  1A2X A;  1KFU S;  3ZNI A;  1TCF A;  4YI9 A;  1F4Q A;  2CT9 A;  2G2B A;  2M49 B;  3BOW A;  3FWB A;  1CFP A;  4XJK A;  3SJS A;  2R2I A;  1SYM A;  2LE9 B;  2JUL A;  2BL0 C;  3MSE B;  1A75 B;  4QJ5 B;  2Y1M A;  1U5I B;  3O2P A;  1ZAC A;  2F2O A;  1IKU A;  3KO0 A;  1QVI Z;  1K9P A;  1TNP A;  3BXK A;  4NQG A;  4NDB A;  5I8N A;  2KFH A;  1BU3 A;  3FWC A;  1M46 A;  2H61 C;  1GQM A;  2NXQ A;  2KGR A;  2M1K B;  1AVS A;  2JZI A;  4F0Z B;  4MRX A;  5CSI A;  1QV0 A;  1MUX A;  2JT3 A;  1KQV A;  4CLN A;  2WCF A;  4ZCV A;  4JWQ A;  1K90 D;  1SRA A;  2O5G A;  1D1O A;  2KSP A;  1WRK A;  2H61 A;  1NYA A;  2JU0 A;  2IS9 A;  1QAS A;  1OMD A;  1KQM C;  4YRU A;  3O6B A;  4YGB B;  2QPT A;  1GJY A;  1EXR A;  3K21 A;  4PHJ A;  1AJ4 A;  2FCD A;  1F70 A;  2ZKM X;  1EG4 A;  2BCB A;  2NCO A;  3NXA A;  5HLO A;  1CKK A;  2NCP A;  4AQI A;  3JTD B;  1K93 D;  4C0J A;  1B8C A;  1B4C A;  2I94 A;  4PHN A;  4GNK B;  1Y1X A;  5AFP A;  2KI4 B;  1MXL C;  2E6W A;  3CS1 A;  4CFQ A;  3BUO B;  1MXE A;  1J55 A;  3O78 A;  5ER4 X;  3PAL A;  4U8D A;  5KTY A;  1SR6 C;  1BG1 A;  2AAO A;  2KBM A;  4MRY A;  3M0W A;  1U5I A;  4GGF C;  4HRG A;  2HET A;  3AAK A;  4ICB A;  5D69 A;  1S36 A;  4FTG A;  1SL9 A;  3SIB A;  1OSA A;  3WHT B;  1CFD A;  4DS7 A;  2JRF A;  4C0K A;  3PM8 A;  1DT7 B;  5PAL A;  5HKZ A;  2I7A A;  1IJ5 A;  2KNE A;  3BUN B;  5CSJ A;  2JNX A;  1EL4 A;  1YUU A;  4GGF A;  1XYD A;  1KFX L;  3FS7 A;  1XFV O;  1CMF A;  2JXC A;  4HRE E;  1DF0 B;  3BUM B;  2F3Z A;  2L98 A;  2LMU A;  1B47 A;  3C1V A;  4QJ4 B;  2KBI A;  1LIN A;  2OPO A;  1YRT B;  1MR8 A;  1YVH A;  4OKH A;  4N1F A;  2CTN A;  4CID A;  2DOQ A;  2WCE A;  1K8U A;  4PE7 A;  4XJK B;  3FIA A;  1BT6 A;  1PSB A;  4OR9 B;  1N2D A;  2L4I A;  1MF8 B;  1YUT A;  2F2P A;  1REC A;  2A4J A;  3A4U B;  5FYX A;  5CPV A;  1OZO A;  2LVV A;  4ORC B;  5AEQ A;  2MRD A;  4I5L B;  1CDN A;  2OTG C;  2SCP A;  1SBJ A;  1CLL A;  1IJ6 A;  1B8R A;  4NDC A;  3PLF B;  2BL0 B;  1YRU B;  2G9B A;  5DKN A;  3TS5 C;  1JSA A;  1SCM C;  4DCK A;  1QIW A;  1S5G Z;  3PFV A;  4YGC B;  2TN4 A;  1RRO A;  2BKH B;  2BCX A;  1JFJ A;  1ZOT B;  3CTN A;  2EHB A;  1DJY A;  1NPQ A;  1XVJ A;  1Y6W A;  2MBX A;  1V1F A;  4OCI A;  4PE4 A;  2JQ6 A;  1F55 A;  4ETO A;  1DF0 A;  1S1E A;  2CNP A;  1WRL A;  1R2U A;  1KSO A;  3ICB A;  2AMI A;  4DIR A;  1UUS A;  1H8B A;  5K89 A;  4P5O E;  3TDU A;  1LVC D;  2GV5 A;  1DGV A;  1KQM B;  4XYN A;  5DKQ A;  3IF7 A;  2MAZ A;  2ISD A;  1JC2 A;  4BY4 A;  2LVK A;  1NCY A;  1OOJ A;  1MQ1 A;  3VRP A;  1A4P A;  1XK4 C;  2PVB A;  2EC6 C;  4MEW A;  2ZRS A;  4USL A;  1W7J B;  2K2A A;  1YR5 A;  2K8M B;  4P2Y B;  4N5X A;  2MHH A;  5D7F A;  1AUI B;  1DJZ A;  3I5F C;  3D10 A;  4QJ3 B;  1NCX A;  5I2O A;  4PAL A;  5IBW A;  4PE1 A;  3OP0 A;  2L51 A;  3IQQ A;  1SL8 A;  3BUX B;  1VRK A;  4MBE A;  3VRR A;  2CBL A;  1SR6 B;  1XK4 A;  1OE9 B;  1SW8 A;  2VRG A;  4YBH B;  1XFW O;  5AAN A;  1AK8 A;  2K7D A;  2LUX A;  1CM1 A;  1PAL A;  2K7O A;  2Q4U A;  3HCM A;  1IQ3 A;  1L7Z A;  1QX2 A;  1YUS A;  1JUO A;  1SNL A;  3AAJ A;  1KFX S;  1FW4 A;  2D8N A;  2JT0 A;  2JXL A;  2PAS A;  1AJ5 A;  1SK6 D;  1NX0 A;  1G8I A;  1WDC B;  2LLT A;  2ZND A;  5AXI A;  3OB1 B;  1PUL A;  3EVV A;  4MLW A;  5DKR A;  1XA5 A;  2ZFD A;  1J1E A;  1RFJ A;  1YUR A;  4PDZ A;  4E68 A;  2FCE A;  1B8L A;  1CLM A;  1UHI A;  4OV2 A;  4YI8 A;  1DJH A;  1DJI A;  2B1U A;  1DJG A;  1NX2 A;  2RGI A;  4MZJ A;  2F33 A;  3OX6 A;  4R1E A;  3TUY B;  2ZN8 A;  1YX7 A;  1S5G Y;  3F45 A;  4BY5 A;  2LV7 A;  1IWQ A;  1DGU A;  1NX3 A;  2KFF A;  5HKY A;  1IGV A;  2KI6 D;  2LVJ A;  1FI5 A;  1LA0 A;  3AKA A;  3CGA A;  5KSZ A;  1N0Y A;  4GGN A;  3SG5 A;  1IH0 A;  2SAS A;  3KF9 A;  1XFY O;  2BCA A;  1HT9 A;  3PSR A;  3OB2 B;  1RK9 A;  1QX5 B;  2K7C A;  3EK4 A;  1QTX A;  2M7L A;  2LP2 A;  3LK1 A;  1CNP A;  1NIW A;  1WDC C;  3O4Y A;  1GGW A;  3VGO A;  1YTZ C;  4ORB B;  2OTG B;  2HQW A;  2KOT A;  2KI6 C;  1WLZ A;  5BPJ A;  2QAC A;  3TS5 B;  2L2E A;  1J7R A;  1SCM B;  1TNX A;  1ALV A;  1KK8 C;  1QIV A;  3I5I C;  4YGD B;  4C0L A;  3TUY C;  3D0Y A;  1UHH A;  3VRN A;  1JBA A;  4N1G A;  1QXP A;  1M31 A;  2MA2 A;  3VRO A;  1S6I A;  5AER A;  4I5J A;  2KYC A;  2L0P A;  1TRF A;  2K2F A;  5G08 A;  2KYF A;  1TTX A;  2CXJ A;  4M2Q A;  1CLB A;  4HRH A;  5TNC A;  1K95 A;  1S6J A;  2ZN9 A;  2LVI A;  3QRX A;  2PMY A;  1J7O A;  1PVA A;  3PN7 C;  1WY9 A;  1AHR A;  3EKJ A;  2LC5 A;  1TNQ A;  4NDD A;  2KQ6 A;  1M39 A;  2LAP A;  2M0R A;  1B9A A;  1JF0 A;  1K9U A;  1TIZ A;  2JNF A;  1XO5 A;  4I5N B;  2WND A;  2JPT A;  1SY9 A;  4JQ0 D;  2LNK A;  5JJG A;  1B1G A;  3NSO A;  1PRW A;  2EC6 B;  4YGA A;  1OMR A;  1QV1 A;  2Y1N A;  1KWO C;  3SIA A;  5F6T A;  4MN0 A;  3DVE A;  5B8I B;  2KAX A;  2FJU B;  1S6C A;  3I5F B;  4PHM A;  1BOD A;  4GUK A;  3I5H C;  2E30 A;  3HX4 A;  4WQ3 A;  1PK0 D;  3SG6 A;  2KGB C;  2M7N A;  1JWD A;  3GK1 A;  2BBN A;  3SG2 A;  3DVM A;  3TDI A;  3SG4 A;  4JPZ B;  4MZK A;  1Y1A A;  1K96 A;  1DMO A;  4IL1 A;  1QX7 A;  4Q04 A;  3PAT A;  1NCZ A;  1KK7 Y;  1CB1 A;  1H4B A;  1L2O B;  4GPL B;  3SG7 A;  1BR1 B;  1QLK A;  2BE6 A;  1CMG A;  1NX1 A;  2LP3 A;  1B7T Z;  1XFZ O;  1K94 A;  5JOL A;  1JF2 A;  4MZL A;  1R6P A;  3CR2 A;  1WLM A;  4FQO A;  1IG5 A;  1HQV A;  3DF0 B;  3A8R A;  1MWN A;  4YGE B;  1RJV A;  3H4S E;  2EGD A;  1TOP A;  2PRU A;  1K9K A;  1BR4 B;  1NP8 A;  2LLS A;  2MJW B;  5ER5 A;  1CDL A;  1UUR A;  1SKT A;  1SL7 A;  1YVL A;  3EK7 A;  2BBM A;  1AP4 A;  3BUW B;  3IQO A;  2LUC A;  4ZCU A;  1PVB A;  2JT8 A;  2M9G A;  2HQ8 A;  1XFU O;  4ORA B;  3DD4 A;  1FPW A;  1OQP A;  3SG3 A;  1Q80 A;  2LMV A;  4PHK A;  1EJ3 A;  4DRW A;  1ODB A;  1DJW A;  3KEV A;  3BYA A;  3LCP C;  3WNX B;  2M29 A;  1CTR A;  3D0Y B;  1J7P A;  1L2O C;  1OZS A;  1F71 A;  2I2R E;  2OS8 C;  2LLU A;  2K0J A;  1QAT A;  1UHK A;  3KHE A;  1PSR A;  2AUC A;  3GK2 A;  5I2Q A;  2KFG A;  1WRZ A;  3I5G C;  1Y1U A;  2KAV A;  2LAN A;  2CCM A;  2PSR A;  3E3R A;  5I2L A;  2MLE C;  1KK8 B;  1F54 A;  1CDP A;  3I5I B;  1MHO A;  3OHM B;  4HSZ A;  3JVT C;  4OVN F;  1TNW A;  2I18 A;  3CR4 X;  5J3X A;  1C07 A;  1LXF C;  2WCB A;  3VRQ A;  2L4H A;  1UP5 A;  2M3W A;  3TZ1 A;  3CLN A;  2V53 A;  1F8H A;  3EVR A;  2ZNE A;  1UHJ A;  3DF0 A;  2JTZ A;  1J7Q A;  1FF1 A;  3CR5 X;  1NSH A;  1A03 A;  3RLZ A;  1KK7 Z;  3PN7 B;  1SCV A;  2LM5 A;  5HLV A;  1CDM A;  4AOM A;  4DUQ A;  2Q91 A;  4AQJ A;  2BEC A;  1EH2 A;  1KFU L;  2F8P A;  1NUB A;  1EG3 A;  2NLN A;  1NWD A;  3DVK A;  1C7V A;  1CFF A;  2M1U A;  1B7T Y;  1SPY A;  2KDH A;  1KWO B;  1QJT A;  4WQ2 A;  1M45 A;  1Y0V H;  1J1D A;  2HPS A;  4PE0 A;  2Y5I A;  3I5H B;  2K61 A;  5HYD A;  1A75 A;  1TN4 A;  1S3P A;  1LKJ A;  2HF5 A;  1K2H A;  1XFX O;  3OX5 A;  2WC8 A;  4GAO A;  3CWG A;  3RM1 A;  4CPV A;  1DTL A;  3BQ3 A;  4CFR A;  4PCW A;  1ZFS A;  2KHN A;  1G33 A;  1DJX A;  1TCO B;  2L50 A;  1BF5 A;  1X02 A;  2COL B;  3WXA A;  2H2K A;  1FBV A;  1M63 B;  2L5X B;  4D1E A;  1DVI A;  4WRI A;  2JC2 A;  2O60 A;  3JTD C;  1IQ5 A;  1QLS A;  2PAL A;  1ZUZ A;  2ZRT A;  1QVI Y;  1LA3 A;  2LHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...