2LP2A

Solution structure and dynamics of human s100a1 protein modified at cysteine 85 with homocysteine disulfide bond formation in calcium saturated form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A1
publication title Impact of calcium binding and thionylation of S100A1 protein on its nuclear magnetic resonance-derived structure and backbone dynamics.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lp2A00
2K2AA 2FCDA 1DJIA 5CSNA 2JT3A 3LK1A 3TS5C 3SG4A 1B8CA 2BCAA 2OS8C 1C7VA 1FPWA 1SCVA 4YI9A 2CT9A 1MQ1A 1OOJA 2ZN9A 3CR5X 5HLVA 4P5OE 4PCWA 3EVVA 3OP0A 1LA0A 4MVFA 2I7AA 4DRWA 2LANA 4GNKB 1CB1A 1W7IB 1OMRA 1SCMB 2ZNEA 3KF9A 2GGMA 3EK4A 4ZCUA 2K7OA 4QJ4B 5TNCA 1CFDA 2WORA 4HRGA 1PSRA 1JWDA 3MSEB 2JTTA 1YUSA 2NXQA 3CS1A 1K93D 3CWGA 1SL7A 1B1GA 1WLZA 5HKZA 1XK4A 3JTDC 5CSFA 1KWOB 4A4CA 1DJWA 1J7QA 2JXCA 1KK8C 3EK7A 1WRKA 4MSPA 1B7TZ 1QV0A 4WQ2A 2CXJA 1N2DA 2JTZA 2K2FA 2Q91A 4NQGA 2I94A 1IG5A 1L7ZA 2Y5IA 1QVIZ 1K90D 1S6CA 2VRGA 3F45A 1A75B 4HRHA 1S5GZ 3ZNIA 1DJXA 3IQOA 4PALA 2KHNA 4YBHB 1IKUA 1YRUB 2M9GA 2LAPA 1CFPA 4HREE 1F4QA 1BT6A 1ZUZA 4GGNA 5IBWA 4JPZB 1RTP1 2JOJA 1QIWA 2KAYA 5DKQA 2JPTA 2D8NA 1SCMC 2L50A 2BE6A 2PVBA 1F71A 1G4YR 4MZLA 2SCPA 3FWBA 1TNQA 3RLZA 1A2XA 2JT8A 1YRTB 3TZ1A 4PHKA 2Y1NA 1LA3A 3JVTB 1AJ5A 1SYMA 3LCPC 3NSKA 4F0ZB 1RFJA 1DVIA 2WNDA 4N1GA 5HLOA 5KU1A 3TDIA 1FF1A 1S6JA 2LP2A 3PSRA 4XYNA 4YGEB 5FYXA 4D1EA 5I8NA 1GGZA 5ER5A 2A4JA 1YX7A 1A29A 2COLB 1BOCA 4PE4A 1F4OA 5JOLA 1TTXA 2PMYA 1YR5A 5HKYA 1DJYA 1UUSA 1FI6A 4GFTA 3OB2B 4MZKA 2K7DA 1SMGA 1DF0A 1EJ3A 2K7CA 3PFVA 1IJ6A 4OR9B 1K9UA 1OSAA 3I5IC 1CFFA 1V1FA 1XO5A 2LVIA 3AAJA 1KFUS 1SY9A 4C0JA 2M8UA 1CMFA 2R2IA 5DKNA 1K94A 1ZOTB 4I5KA 3D0YB 4FTGA 2DOQA 2KFHA 2OTGC 3VRQA 3BUMB 1DGVA 1SL8A 4XJKA 3O4YA 3IQQA 1CMGA 2JU0A 2WCBA 3DVMA 2K7BA 3WHTB 1QV1A 1NPQA 1D1OA 2AUCA 1J1DA 3WXAA 1IJ5A 2HQ8A 3WNXB 3VGOA 5KSZA 2KFGA 2LUCA 1UP5A 2O60A 3DF0B 2M97A 3I5HB 1ZACA 1UHJA 1SR6C 1NP8A 2JNFA 1F70A 2KDHA 2QPTA 4GUKA 1MUXA 4CLNA 2GV5A 2F2OA 3PN7B 1CDPA 1YVLA 4U8DA 1B47A 2LLSA 3HX4A 3ICBA 2JNXA 3E3RA 2LLUA 3RM1A 1DJGA 1QATA 1KQMB 1M45A 1S1EA 1JBAA 1FI5A 2JT0A 5K89A 1EXRA 4TNCA 2MBXA 3VRRA 1XFVO 4PE1A 3TUYC 1TOPA 2WCFA 1IGVA 2LM5A 2Y4QA 3I5FC 1BG1A 1K2HA 2KI4B 4OV2A 1M31A 3LLEA 1OMVA 2BKHB 1TRFA 1BR4B 2P6BB 1SBJA 2JXLA 3EVRA 1S26D 3PALA 4BY5A 1G8IA 4CFRA 1U5IA 2K61A 1HT9A 4PDZA 1IH0A 3SIAA 1GJYA 3I5GC 1UHKA 3NSIA 2KGRA 2LMTA 2KBMA 4M2PA 1CDLA 2FOTA 1YVHA 4I5NB 5I2LA 2KGBC 5D69A 1XVJA 1SW8A 2H2KA 4YGDB 1XFYO 1TCFA 3GOFA 3OX5A 4YGBB 5AEQA 2BCXA 4MLWA 3EKHA 1NX2A 3GK4X 2KBIA 4PE7A 1MXEA 1J55A 4CPVA 3BOWA 4ZCVA 2ISDA 1TNWA 3EVUA 2FCEA 3AKAA 3QRXA 4WQ3A 1RJVA 2CTNA 2EHBA 3FWCA 3HCMA 2LMUA 4MN0A 2BECA 5I2OA 1BR1B 1BU3A 1A03A 5AANA 2KFFA 4C0KA 1M46A 3K21A 4IL1A 4A4BA 1X02A 1UHIA 2KYCA 2JULA 1M63B 4ORBB 1KK7Y 1W7JB 2LHIA 1IQ5A 2EC6B 1QX7A 1YUTA 1K9PA 1WDCB 1JFKA 2Q4UA 1JSAA 2G2BA 1A4PA 1S3PA 4ETOA 1SRAA 4JWQA 1CM1A 1CLBA 3VRNA 5BPJA 1DJZA 2L4HA 1BODA 1NYAA 2B1UA 2E6WA 3BUXB 1CNPA 1XFXO 1WLMA 2KI6C 2M29A 1OE9B 4I5LB 1BMOA 1LXFC 1RECA 4CFQA 4UPGA 2BL0B 1L2OB 2WCEA 4DIRA 1UURA 1YTZC 1NCXA 1KWOC 2JZIA 1CKKA 3PATA 2KAVA 2LNKA 2CBLA 2JWWA 2ZNDA 4M2QA 1QTXA 1MHOA 1WRLA 2O5GA 4QJ3B 5KTYA 1XFUO 2EGDA 2G9BA 1IWQA 2LP3A 2TN4A 1KCYA 4JQ0D 4HSZA 1QASA 1OZOA 1S36A 1KFUL 2I18A 5B8IB 2Y1MA 1MR8A 1F54A 4M2OA 2PASA 1TIZA 1AVSA 1EG4A 1BJFA 3AAKA 4P2YB 5HYDA 2M3WA 1F55A 1PULA 5CSIA 1LKJA 1NWDA 3SG6A 1PVAA 3BQ3A 3BUNB 1Y1UA 1PRWA 1R6PA 3BUOB 1AHRA 1UHNA 1AP4A 1A75A 4MRYA 3TS5B 5D7FA 2KSPA 2KYFA 4I5JA 1Y1AA 3CR2A 1NCYA 2AMIA 2LMVA 1SPYA 2MRDA 2QACA 4CIDA 1J7OA 3H4SE 3JVTC 5F6TA 4GBAA 1Q80A 1KK7Z 2KOTA 2FJUB 5AERA 1QXPA 4PHJA 2CCMA 1CDNA 2HQWA 2L51A 1JF2A 2KI6D 4OVNF 1J7PA 2KQ6A 3CGAA 1WRZA 4GPLB 2BBMA 3PM8A 4N5XA 1XYDA 1L2OC 1DGUA 1NX3A 1N65A 1RK9A 2MLEC 1TNPA 1JC2A 1SNLA 1UHHA 4MEWA 1CLMA 4MRXA 1EH2A 1C07A 1H4BA 4L9MA 4YGCB 5HKWA 4AOMA 1B8RA 3FIAA 3JTDB 3VRPA 4E68A 4NDDA 4PHNA 3D10A 4Q04A 1KK8B 3KHEA 2K0JA 2LUXA 2I2RE 1BLQA 3DVJA 1JF0A 2SASA 1SL9A 2JC2A 1H8BA 1NUBA 4GAOA 2MHHA 1TNXA 1F8HA 1ALWA 3GK2A 4DS7A 3FS7A 1CTRA 5DKRA 1TCOB 1K96A 1M39A 4NDCA 2LVJA 5I2QA 1OZSA 3OHMB 1KQVA 2M1UA 4R1EA 1B4CA 2LLTA 4OKHA 1YX8A 3OX6A 3I5HC 3D0YA 1LVCD 1SKTA 1PVBA 3C1VA 3EKJA 1MF8B 2ZRTA 1E8AA 2RGIA 1N0YA 1TN4A 1XK4C 5JJGA 1WY9A 3OB1B 3PN7C 4PE0A 1S6IA 1LINA 3A8RA 1J7RA 2ZRSA 1JFJA 2MAZA 2OPOA 3BXKA 2M0RA 3EK8A 1QX2A 3DF0A 1DF0B 2M49B 2NLNA 1KQMC 1ZMZA 2JQ6A 2BBNA 1DTLA 2ZN8A 5AFPA 1QJTA 2LC5A 3DVKA 1AJ4A 1K8UA 1K9KA 1K95A 5PALA 3TDUA 2WC8A 3VROA 4ORCB 1BF5A 2L0PA 1RROA 1NX1A 4MZJA 4WRIA 3ZWHA 2L2EA 4USLA 2MJWB 1CFCA 3KO0A 2HF5A 2LCPA 2BKIB 4ORAB 4XJKB 2KI4C 1CDMA 1IQ3A 1NX0A 3I5IB 4ICBA 3IF7A 3BUWB 1GGWA 1XFWO 1RWYA 1KFXL 2L98A 3O6BA 1QLSA 1KSOA 1EL4A 2AAOA 2IS9A 4DCKA 1KFXS 2OTGB 1AUIB 1DMOA 2L4IA 2WOSA 1DT7B 1HQVA 2F33A 1C7WA 2HPSA 5ER4X 5AXIA 2ZFDA 1QS7A 2PRUA 5CPVA 1EG3A 3LL8B 3SJSA 1AK8A 3NSOA 1PK0D 4PHMA 3O78A 4DUQA 1NSHA 1PALA 2NCOA 3CR4X 1B8LA 2MLFC 3TDZA 1V1GA 2F8PA 2M7LA 1SR6B 2HETA 4YRUA 1QIVA 2F3ZA 2LHLA 4AQJA 2MA2A 4AQIA 3PLFB 1YUUA 1CM4A 1ALVA 2KAXA 2LE9B 3WHUB 1G33A 3SG2A 2LV7A 2K8MB 4FQOA 1YURA 2LVKA 3SG5A 1Y1XA 2E30A 2KNEA 2L5XB 4QJ5B 2CNPA 2EC6C 1J1EA 2JRFA 1IRJA 2OS8B 1WDCC 2KQYA 4C0LA 1MXLC 1PSBA 1FW4A 4YGAA 1FBVA 1R2UA 2F3YA 1U5IB 2LVVA 1NCZA 2ZKMX 1GQMA 3NSLA 3SG7A 3TUYB 3KPXA 1ZFSA 4YI8A 1Y6WA 1CLLA 2F2PA 1NIWA 2BCBA 3GK1A 1ODBA 3I5FB 3O2PA 4MBEA 4GGFC 1B9AA 3KEVA 2BL0C 3LK0A 5CSJA 3NXAA 3SG3A 4OCIA 4N1FA 1DJHA 2M7NA 2PALA 3DD4A 1XA5A 3AKBA 2H61C 1QLKA 3DVEA 1XFZO 3I5GB 1B7TY 1OMDA 3BOWB 1QX5B 2PSRA 1JUOA 3A4UB 3M0WA 2V53A 3CZTX 1Y0VH 2BE4A 1OQPA 4GGFA 4NDBA 1QVIY 3SIBA 2NCPA 3CLNA 4BY4A 1S5GY 2GGZA 5J3XA 2NZ0A 1MWNA 1KSMA 1VRKA 3CTNA 2H61A 2M1KB 1UWOA 3BYAA 5G08A 1SK6D 5GQQC
chains in the Genus database with same CATH superfamily
2K2AA 2FCDA 1DJIA 5CSNA 4PT1A 2JT3A 3LK1A 3TS5C 3SG4A 1B8CA 1TUJA 1TWOA 2BCAA 2QEHA 2JPOA 2OS8C 1C7VA 1FPWA 1SCVA 4YI9A 2CT9A 1MQ1A 1OOJA 2ZN9A 3CR5X 5HLVA 4P5OE 4PCWA 3EVVA 3OP0A 1LA0A 4MVFA 2I7AA 4DRWA 2LANA 4GNKB 1CB1A 1W7IB 1OMRA 1SCMB 2ZNEA 4JKTA 3KF9A 2GGMA 3EK4A 4ZCUA 3OGNA 2K7OA 4QJ4B 5TNCA 1CFDA 2WORA 1OW4A 4HRGA 1PSRA 3BFAA 1JWDA 3MSEB 2JTTA 1YUSA 2NXQA 3CS1A 1K93D 3CWGA 1SL7A 1B1GA 1WLZA 5HKZA 1XK4A 3JTDC 5CSFA 1KWOB 4A4CA 1DJWA 2WCMA 1J7QA 2JXCA 1KK8C 3EK7A 1WRKA 4MSPA 2BAPA 1B7TZ 1QV0A 4WQ2A 2CXJA 1N2DA 2JTZA 2K2FA 2Q91A 4NQGA 2I94A 1IG5A 1L7ZA 2Y5IA 3B86A 1QVIZ 1K90D 1S6CA 2VRGA 3F45A 1A75B 4HRHA 1S5GZ 3ZNIA 1C3YA 1DJXA 3IQOA 4PALA 2KHNA 4YBHB 1IKUA 1YRUB 2M9GA 3PJIA 2LAPA 1CFPA 4HREE 1F4QA 1BT6A 1ZUZA 3DZTA 3BJHA 4GGNA 3R72A 1XFRA 5IBWA 3IVTA 4JPZB 1RTP1 2JOJA 1QIWA 2KAYA 5DKQA 2JPTA 2D8NA 1SCMC 2L50A 2BE6A 2PVBA 4INXA 1G4YR 1F71A 4MZLA 2SCPA 3FWBA 1TNQA 3RLZA 1A2XA 2JT8A 1YRTB 3R1VA 3TZ1A 4PHKA 2Y1NA 1LA3A 3JVTB 3NHTA 1AJ5A 3DYEA 1SYMA 3LCPC 3NSKA 5D3OA 1RFJA 4F0ZB 1DVIA 2WNDA 4N1GA 5HLOA 5KU1A 3TDIA 1Z4HA 1S6JA 2LP2A 1FF1A 3PSRA 4XYNA 1C3ZA 4YGEB 5FYXA 4D1EA 5I8NA 2P71A 1GGZA 5ER5A 2A4JA 1YX7A 4INWA 1A29A 2COLB 1BOCA 4PE4A 1F4OA 5JOLA 1TTXA 2PMYA 1YR5A 3O4XA 5FI2A 1DJYA 1UUSA 5HKYA 1W9ZA 4GFTA 1FI6A 3OB2B 4MZKA 2K7DA 1SMGA 1DF0A 1EJ3A 2K7CA 3PFVA 1IJ6A 4OR9B 1K9UA 1OSAA 3I5IC 1CFFA 1V1FA 1XO5A 2LVIA 2PYQA 3AAJA 1KFUS 1SY9A 2P70A 4C0JA 2M8UA 1CMFA 2R2IA 5DKNA 1K94A 1DC1A 1ZOTB 4I5KA 3D0YB 3EG5B 4FTGA 2DOQA 2KFHA 2OTGC 3CZ2A 3BUMB 3VRQA 1DGVA 1SL8A 4XJKA 3O4YA 3IQQA 1CMGA 2JU0A 2WCBA 3DVMA 2K7BA 3WHTB 2PQLA 1QV1A 1NPQA 1D1OA 3D76A 2AUCA 1J1DA 3WXAA 1IJ5A 3FE6A 2HQ8A 3WNXB 3VGOA 5KSZA 1DELA 2KFGA 2LUCA 1UP5A 2O60A 3DF0B 2M97A 3I5HB 1ZACA 1UHJA 1SR6C 1NP8A 2JNFA 1F70A 2KDHA 2QPTA 4GUKA 1MUXA 4CLNA 2GV5A 1DQEA 2F2OA 3PN7B 1CDPA 1YVLA 3SS3A 4U8DA 1B47A 2LLSA 3HX4A 3ICBA 3Q8IA 2JNXA 2WCLA 1LS8A 3E3RA 2LLUA 3RM1A 1DJGA 1QATA 1KQMB 1M45A 1S1EA 1JBAA 1FI5A 2L2CA 2JT0A 5K89A 1EXRA 4TNCA 2MBXA 3VRRA 1XFVO 4PE1A 3TUYC 1TOPA 1TUZA 2WCFA 1IGVA 1ORGA 2LM5A 2Y4QA 3I5FC 1BG1A 3S0FA 1K2HA 2KI4B 4OV2A 1M31A 3LLEA 1OMVA 2BKHB 1TRFA 1BR4B 2P6BB 1SBJA 3DXLA 2JXLA 3EVRA 1S26D 3PALA 4BY5A 1G8IA 4CFRA 1U5IA 2K61A 1HT9A 4PDZA 1IH0A 3SIAA 1GJYA 3I5GC 1UHKA 3NSIA 4JD9A 2KGRA 3D77A 2LMTA 2KBMA 4M2PA 3R1PA 4OZDA 1CDLA 2FOTA 1YVHA 4I5NB 5I2LA 1OOHA 2KGBC 5D69A 1XVJA 1SW8A 2H2KA 2WCKA 1XFYO 4YGDB 1TCFA 3GOFA 3OX5A 4YGBB 5AEQA 2BCXA 4MLWA 3EKHA 1NX2A 3GK4X 2KBIA 4PE7A 1MXEA 1J55A 3NGVA 4CPVA 3BOWA 4ZCVA 5I94A 2WCJA 3OBVA 1TNWA 3EVUA 5EL2A 2ISDA 2FCEA 3AKAA 3QRXA 4WQ3A 1RJVA 2CTNA 2EHBA 3FWCA 3HCMA 3CZ0A 2LMUA 4MN0A 1DEKA 2BECA 5I2OA 1BR1B 1BU3A 1A03A 5AANA 3S0GA 2KFFA 4C0KA 1M46A 3K21A 4IL1A 3BFBA 4A4BA 1X02A 1UHIA 2KYCA 2JULA 1M63B 2BNXA 4ORBB 1KK7Y 3UNWA 1W7JB 2LHIA 1IQ5A 2EC6B 1QX7A 1YUTA 1K9PA 1WDCB 1JFKA 2Q4UA 1JSAA 2G2BA 1A4PA 1S3PA 3S0AA 4ETOA 4F7FA 1SRAA 4JWQA 1CM1A 1CLBA 3VRNA 1P28A 4KYNA 5BPJA 1DJZA 1OOGA 2L4HA 1BODA 1NYAA 2B1UA 2E6WA 3S0DA 3BUXB 1CNPA 1XFXO 1WLMA 2KI6C 2M29A 1OE9B 4I5LB 1BMOA 1LXFC 1RECA 5FI7A 4CFQA 4UPGA 2BL0B 1L2OB 2WCEA 4DIRA 1UURA 1YTZC 3DY9A 1NCXA 1KWOC 2JZIA 2L5YA 1CKKA 3PATA 2KAVA 2LNKA 2CBLA 2JWWA 2ZNDA 4M2QA 1QTXA 1MHOA 1WRLA 2O5GA 4QJ3B 5KTYA 1XFUO 2EGDA 2G9BA 1IWQA 2LP3A 2TN4A 1KCYA 4JQ0D 4HSZA 1QASA 2WC6A 1OZOA 1S36A 1KFUL 2I18A 5B8IB 2Y1MA 1MR8A 1F54A 4M2OA 3FE8A 2PASA 4FQTA 1TIZA 1AVSA 1EG4A 1BJFA 3AAKA 4P2YB 5HYDA 2M3WA 1F55A 1PULA 5CSIA 1LKJA 1NWDA 3SG6A 1PVAA 3BQ3A 3N7HA 3BUNB 1Y1UA 1PRWA 1R6PA 3BUOB 1AHRA 1UHNA 1AP4A 1A75A 4MRYA 3TS5B 5D7FA 2KSPA 2KYFA 4I5JA 1Y1AA 3CR2A 3SS5A 1NCYA 2AMIA 2LMVA 1SPYA 1IIOA 1OOFA 2MRDA 2QACA 4CIDA 3K1EA 1QWVA 1J7OA 3H4SE 3JVTC 5F6TA 4GBAA 1Q80A 1KK7Z 2KOTA 2FJUB 5AERA 1QXPA 4PHJA 2CCMA 1CDNA 2HQWA 2L51A 1JF2A 2KI6D 4OVNF 1J7PA 2KQ6A 2KLEA 3CZ1A 3CGAA 1WRZA 4GPLB 2BBMA 3PM8A 4N5XA 1XYDA 1L2OC 1DGUA 1NX3A 1N65A 1RK9A 2MLEC 1TNPA 1JC2A 1SNLA 1UHHA 3B87A 2H8VA 4MEWA 2WC5A 1CLMA 4MRXA 1EH2A 1C07A 1H4BA 4L9MA 4YGCB 5HKWA 4AOMA 1B8RA 3FIAA 3JTDB 3VRPA 4E68A 4NDDA 4PHNA 3D10A 4Q04A 1KK8B 3KHEA 2K0JA 2LUXA 2I2RE 1BLQA 3DVJA 1JF0A 2SASA 3PM2A 2K60A 1SL9A 3QMEA 2JC2A 5HL1A 1H8BA 1NUBA 4GAOA 3S0BA 2MHHA 3L47A 1TNXA 1F8HA 1ALWA 3D75A 3GK2A 4DS7A 3FS7A 1CTRA 5DKRA 1TCOB 1K96A 1M39A 4NDCA 2LVJA 5I2QA 1OZSA 3OHMB 1KQVA 2M1UA 3D73A 4R1EA 3CABA 2LLTA 4OKHA 1B4CA 1YX8A 3OX6A 3I5HC 3D0YA 1LVCD 1SKTA 1PVBA 3C1VA 3EKJA 1MF8B 2ZRTA 1E8AA 2RGIA 1N0YA 1TN4A 1XK4C 3NHIA 5JJGA 1WY9A 3CDNA 3OB1B 3PN7C 1S6IA 4PE0A 1LINA 3S0EA 3A8RA 1J7RA 2ZRSA 1JFJA 3R1OA 3V2LA 2MAZA 2OPOA 3BXKA 2M0RA 1Z2CB 3EK8A 1QX2A 3DF0A 3SS4A 1DF0B 2M49B 2NLNA 1KQMC 1SSEB 1ZMZA 2JQ6A 2BBNA 1DTLA 2ZN8A 2QEBA 1QJTA 2LC5A 5AFPA 3DVKA 1AJ4A 1K8UA 1K9KA 1K95A 5PALA 3TDUA 2WC8A 3VROA 4ORCB 1BF5A 5FI6A 2L0PA 1RROA 1NX1A 4MZJA 4WRIA 3ZWHA 2L2EA 2KLDA 3FE9A 4USLA 2MJWB 1CFCA 3KO0A 2HF5A 2LCPA 2BKIB 4ORAB 4XJKB 2KI4C 1CDMA 1IQ3A 1NX0A 3I5IB 4ICBA 3IF7A 3BUWB 1GGWA 3L4LA 1XFWO 1RWYA 1KFXL 2L98A 3B7AA 1QLSA 3O6BA 1KSOA 1EL4A 2AAOA 2IS9A 3CYZA 5DICA 2KPHA 4DCKA 1KFXS 3D78A 2OTGB 1AUIB 1DMOA 2L4IA 2FJYA 2WOSA 1DT7B 1HQVA 2F33A 1C7WA 2HPSA 5ER4X 5AXIA 3B88A 2ZFDA 1QS7A 2PRUA 5CPVA 1EG3A 3LL8B 3SJSA 1AK8A 3NSOA 1PK0D 4PHMA 3UO9A 2YGUA 3O78A 4DUQA 1NSHA 1PALA 2NCOA 2QEOA 3CR4X 1B8LA 2MLFC 3TDZA 1V1GA 2F8PA 3B6XA 1SR6B 3L4AA 2M7LA 1GM0A 2HETA 4YRUA 1QIVA 2F3ZA 2LHLA 4AQJA 2MA2A 4AQIA 3PLFB 1YUUA 1CM4A 1ALVA 2KAXA 2LE9B 3WHUB 1G33A 3SG2A 2LV7A 2WCHA 2K8MB 4FQOA 1YURA 2LVKA 3SG5A 1Y1XA 2E30A 2KNEA 2L5XB 4QJ5B 2QEVA 2CNPA 2EC6C 2GTEA 1J1EA 2JRFA 1IRJA 2OS8B 1WDCC 2KQYA 4C0LA 1MXLC 1PSBA 1FW4A 2QDIA 4YGAA 1FBVA 1R2UA 2F3YA 1U5IB 2LVVA 1NCZA 2ZKMX 1GQMA 3NSLA 3SG7A 3TUYB 3KPXA 1ZFSA 3BFHA 4YI8A 1Y6WA 1CLLA 2F2PA 1NIWA 2BCBA 3GK1A 1ODBA 3I5FB 3O2PA 2ERBA 4MBEA 4GGFC 3VB1A 1B9AA 4IJ7A 3D74A 3KEVA 2BL0C 3LK0A 5CSJA 3NXAA 3SG3A 4OCIA 4N1FA 1DJHA 2M7NA 2PALA 3DD4A 1XA5A 3AKBA 2H61C 1QLKA 3DVEA 1OOIX 1XFZO 3I5GB 1B7TY 1OMDA 1T14A 3BOWB 1QX5B 2PSRA 1JUOA 3A4UB 3M0WA 2V53A 3CZTX 1Y0VH 1OQPA 2BE4A 4GGFA 3RZSA 4NDBA 1QVIY 3SIBA 2NCPA 3CLNA 4BY4A 1S5GY 2GGZA 5J3XA 2NZ0A 1MWNA 1KSMA 1VRKA 3CTNA 2H61A 2M1KB 1UWOA 3BYAA 5G08A 1SK6D 5GQQC
chains in the Genus database with same CATH topology
2K2AA 2FCDA 1DJIA 5CSNA 2JT3A 3LK1A 3TS5C 3SG4A 1B8CA 2BCAA 2OS8C 1C7VA 1FPWA 1SCVA 4YI9A 2CT9A 1MQ1A 1OOJA 2ZN9A 3CR5X 5HLVA 4P5OE 4PCWA 3EVVA 3OP0A 1LA0A 4MVFA 2I7AA 4DRWA 2LANA 4GNKB 1CB1A 1W7IB 1OMRA 1SCMB 2ZNEA 3KF9A 2GGMA 3EK4A 4ZCUA 2K7OA 4QJ4B 5TNCA 1CFDA 2WORA 4HRGA 1PSRA 1JWDA 3MSEB 2JTTA 1YUSA 2NXQA 3CS1A 1K93D 3CWGA 1SL7A 1B1GA 1WLZA 5HKZA 1XK4A 3JTDC 5CSFA 1KWOB 4A4CA 1DJWA 1J7QA 2JXCA 1KK8C 3EK7A 1WRKA 4MSPA 1B7TZ 1QV0A 4WQ2A 2CXJA 1N2DA 2JTZA 2K2FA 2Q91A 4NQGA 2I94A 1IG5A 1L7ZA 2Y5IA 1QVIZ 1K90D 1S6CA 2VRGA 3F45A 1A75B 4HRHA 1S5GZ 3ZNIA 1DJXA 3IQOA 4PALA 2KHNA 4YBHB 1IKUA 1YRUB 2M9GA 2LAPA 1CFPA 4HREE 1F4QA 1BT6A 1ZUZA 4GGNA 5IBWA 4JPZB 1RTP1 2JOJA 1QIWA 2KAYA 5DKQA 2JPTA 2D8NA 1SCMC 2L50A 2BE6A 2PVBA 1F71A 1G4YR 4MZLA 2SCPA 3FWBA 1TNQA 3RLZA 1A2XA 2JT8A 1YRTB 3TZ1A 4PHKA 2Y1NA 1LA3A 3JVTB 1AJ5A 1SYMA 3LCPC 3NSKA 4F0ZB 1RFJA 1DVIA 2WNDA 4N1GA 5HLOA 5KU1A 3TDIA 1FF1A 1S6JA 2LP2A 3PSRA 4XYNA 4YGEB 5FYXA 4D1EA 5I8NA 1GGZA 5ER5A 2A4JA 1YX7A 1A29A 2COLB 1BOCA 4PE4A 1F4OA 5JOLA 1TTXA 2PMYA 1YR5A 5HKYA 1DJYA 1UUSA 1FI6A 4GFTA 3OB2B 4MZKA 2K7DA 1SMGA 1DF0A 1EJ3A 2K7CA 3PFVA 1IJ6A 4OR9B 1K9UA 1OSAA 3I5IC 1CFFA 1V1FA 1XO5A 2LVIA 3AAJA 1KFUS 1SY9A 4C0JA 2M8UA 1CMFA 2R2IA 5DKNA 1K94A 1ZOTB 4I5KA 3D0YB 4FTGA 2DOQA 2KFHA 2OTGC 3VRQA 3BUMB 1DGVA 1SL8A 4XJKA 3O4YA 3IQQA 1CMGA 2JU0A 2WCBA 3DVMA 2K7BA 3WHTB 1QV1A 1NPQA 1D1OA 2AUCA 1J1DA 3WXAA 1IJ5A 2HQ8A 3WNXB 3VGOA 5KSZA 2KFGA 2LUCA 1UP5A 2O60A 3DF0B 2M97A 3I5HB 1ZACA 1UHJA 1SR6C 1NP8A 2JNFA 1F70A 2KDHA 2QPTA 4GUKA 1MUXA 4CLNA 2GV5A 2F2OA 3PN7B 1CDPA 1YVLA 4U8DA 1B47A 2LLSA 3HX4A 3ICBA 2JNXA 3E3RA 2LLUA 3RM1A 1DJGA 1QATA 1KQMB 1M45A 1S1EA 1JBAA 1FI5A 2JT0A 5K89A 1EXRA 4TNCA 2MBXA 3VRRA 1XFVO 4PE1A 3TUYC 1TOPA 2WCFA 1IGVA 2LM5A 2Y4QA 3I5FC 1BG1A 1K2HA 2KI4B 4OV2A 1M31A 3LLEA 1OMVA 2BKHB 1TRFA 1BR4B 2P6BB 1SBJA 2JXLA 3EVRA 1S26D 3PALA 4BY5A 1G8IA 4CFRA 1U5IA 2K61A 1HT9A 4PDZA 1IH0A 3SIAA 1GJYA 3I5GC 1UHKA 3NSIA 2KGRA 2LMTA 2KBMA 4M2PA 1CDLA 2FOTA 1YVHA 4I5NB 5I2LA 2KGBC 5D69A 1XVJA 1SW8A 2H2KA 4YGDB 1XFYO 1TCFA 3GOFA 3OX5A 4YGBB 5AEQA 2BCXA 4MLWA 3EKHA 1NX2A 3GK4X 2KBIA 4PE7A 1MXEA 1J55A 4CPVA 3BOWA 4ZCVA 2ISDA 1TNWA 3EVUA 2FCEA 3AKAA 3QRXA 4WQ3A 1RJVA 2CTNA 2EHBA 3FWCA 3HCMA 2LMUA 4MN0A 2BECA 5I2OA 1BR1B 1BU3A 1A03A 5AANA 2KFFA 4C0KA 1M46A 3K21A 4IL1A 4A4BA 1X02A 1UHIA 2KYCA 2JULA 1M63B 4ORBB 1KK7Y 1W7JB 2LHIA 1IQ5A 2EC6B 1QX7A 1YUTA 1K9PA 1WDCB 1JFKA 2Q4UA 1JSAA 2G2BA 1A4PA 1S3PA 4ETOA 1SRAA 4JWQA 1CM1A 1CLBA 3VRNA 5BPJA 1DJZA 2L4HA 1BODA 1NYAA 2B1UA 2E6WA 3BUXB 1CNPA 1XFXO 1WLMA 2KI6C 2M29A 1OE9B 4I5LB 1BMOA 1LXFC 1RECA 4CFQA 4UPGA 2BL0B 1L2OB 2WCEA 4DIRA 1UURA 1YTZC 1NCXA 1KWOC 2JZIA 1CKKA 3PATA 2KAVA 2LNKA 2CBLA 2JWWA 2ZNDA 4M2QA 1QTXA 1MHOA 1WRLA 2O5GA 4QJ3B 5KTYA 1XFUO 2EGDA 2G9BA 1IWQA 2LP3A 2TN4A 1KCYA 4JQ0D 4HSZA 1QASA 1OZOA 1S36A 1KFUL 2I18A 5B8IB 2Y1MA 1MR8A 1F54A 4M2OA 2PASA 1TIZA 1AVSA 1EG4A 1BJFA 3AAKA 4P2YB 5HYDA 2M3WA 1F55A 1PULA 5CSIA 1LKJA 1NWDA 3SG6A 1PVAA 3BQ3A 3BUNB 1Y1UA 1PRWA 1R6PA 3BUOB 1AHRA 1UHNA 1AP4A 1A75A 4MRYA 3TS5B 5D7FA 2KSPA 2KYFA 4I5JA 1Y1AA 3CR2A 1NCYA 2AMIA 2LMVA 1SPYA 2MRDA 2QACA 4CIDA 1J7OA 3H4SE 3JVTC 5F6TA 4GBAA 1Q80A 1KK7Z 2KOTA 2FJUB 5AERA 1QXPA 4PHJA 2CCMA 1CDNA 2HQWA 2L51A 1JF2A 2KI6D 4OVNF 1J7PA 2KQ6A 3CGAA 1WRZA 4GPLB 2BBMA 3PM8A 4N5XA 1XYDA 1L2OC 1DGUA 1NX3A 1N65A 1RK9A 2MLEC 1TNPA 1JC2A 1SNLA 1UHHA 4MEWA 1CLMA 4MRXA 1EH2A 1C07A 1H4BA 4L9MA 4YGCB 5HKWA 4AOMA 1B8RA 3FIAA 3JTDB 3VRPA 4E68A 4NDDA 4PHNA 3D10A 4Q04A 1KK8B 3KHEA 2K0JA 2LUXA 2I2RE 1BLQA 3DVJA 1JF0A 2SASA 1SL9A 2JC2A 1H8BA 1NUBA 4GAOA 2MHHA 1TNXA 1F8HA 1ALWA 3GK2A 4DS7A 3FS7A 1CTRA 5DKRA 1TCOB 1K96A 1M39A 4NDCA 2LVJA 5I2QA 1OZSA 3OHMB 1KQVA 2M1UA 4R1EA 1B4CA 2LLTA 4OKHA 1YX8A 3OX6A 3I5HC 3D0YA 1LVCD 1SKTA 1PVBA 3C1VA 3EKJA 1MF8B 2ZRTA 1E8AA 2RGIA 1N0YA 1TN4A 1XK4C 5JJGA 1WY9A 3OB1B 3PN7C 4PE0A 1S6IA 1LINA 3A8RA 1J7RA 2ZRSA 1JFJA 2MAZA 2OPOA 3BXKA 2M0RA 3EK8A 1QX2A 3DF0A 1DF0B 2M49B 2NLNA 1KQMC 1ZMZA 2JQ6A 2BBNA 1DTLA 2ZN8A 5AFPA 1QJTA 2LC5A 3DVKA 1AJ4A 1K8UA 1K9KA 1K95A 5PALA 3TDUA 2WC8A 3VROA 4ORCB 1BF5A 2L0PA 1RROA 1NX1A 4MZJA 4WRIA 3ZWHA 2L2EA 4USLA 2MJWB 1CFCA 3KO0A 2HF5A 2LCPA 2BKIB 4ORAB 4XJKB 2KI4C 1CDMA 1IQ3A 1NX0A 3I5IB 4ICBA 3IF7A 3BUWB 1GGWA 1XFWO 1RWYA 1KFXL 2L98A 3O6BA 1QLSA 1KSOA 1EL4A 2AAOA 2IS9A 4DCKA 1KFXS 2OTGB 1AUIB 1DMOA 2L4IA 2WOSA 1DT7B 1HQVA 2F33A 1C7WA 2HPSA 5ER4X 5AXIA 2ZFDA 1QS7A 2PRUA 5CPVA 1EG3A 3LL8B 3SJSA 1AK8A 3NSOA 1PK0D 4PHMA 3O78A 4DUQA 1NSHA 1PALA 2NCOA 3CR4X 1B8LA 2MLFC 3TDZA 1V1GA 2F8PA 2M7LA 1SR6B 2HETA 4YRUA 1QIVA 2F3ZA 2LHLA 4AQJA 2MA2A 4AQIA 3PLFB 1YUUA 1CM4A 1ALVA 2KAXA 2LE9B 3WHUB 1G33A 3SG2A 2LV7A 2K8MB 4FQOA 1YURA 2LVKA 3SG5A 1Y1XA 2E30A 2KNEA 2L5XB 4QJ5B 2CNPA 2EC6C 1J1EA 2JRFA 1IRJA 2OS8B 1WDCC 2KQYA 4C0LA 1MXLC 1PSBA 1FW4A 4YGAA 1FBVA 1R2UA 2F3YA 1U5IB 2LVVA 1NCZA 2ZKMX 1GQMA 3NSLA 3SG7A 3TUYB 3KPXA 1ZFSA 4YI8A 1Y6WA 1CLLA 2F2PA 1NIWA 2BCBA 3GK1A 1ODBA 3I5FB 3O2PA 4MBEA 4GGFC 1B9AA 3KEVA 2BL0C 3LK0A 5CSJA 3NXAA 3SG3A 4OCIA 4N1FA 1DJHA 2M7NA 2PALA 3DD4A 1XA5A 3AKBA 2H61C 1QLKA 3DVEA 1XFZO 3I5GB 1B7TY 1OMDA 3BOWB 1QX5B 2PSRA 1JUOA 3A4UB 3M0WA 2V53A 3CZTX 1Y0VH 2BE4A 1OQPA 4GGFA 4NDBA 1QVIY 3SIBA 2NCPA 3CLNA 4BY4A 1S5GY 2GGZA 5J3XA 2NZ0A 1MWNA 1KSMA 1VRKA 3CTNA 2H61A 2M1KB 1UWOA 3BYAA 5G08A 1SK6D 5GQQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2A A;  2FCD A;  1DJI A;  5CSN A;  2JT3 A;  3LK1 A;  3TS5 C;  3SG4 A;  1B8C A;  2BCA A;  2OS8 C;  1C7V A;  1FPW A;  1SCV A;  4YI9 A;  2CT9 A;  1MQ1 A;  1OOJ A;  2ZN9 A;  3CR5 X;  5HLV A;  4P5O E;  4PCW A;  3EVV A;  3OP0 A;  1LA0 A;  4MVF A;  2I7A A;  4DRW A;  2LAN A;  4GNK B;  1CB1 A;  1W7I B;  1OMR A;  1SCM B;  2ZNE A;  3KF9 A;  2GGM A;  3EK4 A;  4ZCU A;  2K7O A;  4QJ4 B;  5TNC A;  1CFD A;  2WOR A;  4HRG A;  1PSR A;  1JWD A;  3MSE B;  2JTT A;  1YUS A;  2NXQ A;  3CS1 A;  1K93 D;  3CWG A;  1SL7 A;  1B1G A;  1WLZ A;  5HKZ A;  1XK4 A;  3JTD C;  5CSF A;  1KWO B;  4A4C A;  1DJW A;  1J7Q A;  2JXC A;  1KK8 C;  3EK7 A;  1WRK A;  4MSP A;  1B7T Z;  1QV0 A;  4WQ2 A;  2CXJ A;  1N2D A;  2JTZ A;  2K2F A;  2Q91 A;  4NQG A;  2I94 A;  1IG5 A;  1L7Z A;  2Y5I A;  1QVI Z;  1K90 D;  1S6C A;  2VRG A;  3F45 A;  1A75 B;  4HRH A;  1S5G Z;  3ZNI A;  1DJX A;  3IQO A;  4PAL A;  2KHN A;  4YBH B;  1IKU A;  1YRU B;  2M9G A;  2LAP A;  1CFP A;  4HRE E;  1F4Q A;  1BT6 A;  1ZUZ A;  4GGN A;  5IBW A;  4JPZ B;  1RTP 1;  2JOJ A;  1QIW A;  2KAY A;  5DKQ A;  2JPT A;  2D8N A;  1SCM C;  2L50 A;  2BE6 A;  2PVB A;  1F71 A;  1G4Y R;  4MZL A;  2SCP A;  3FWB A;  1TNQ A;  3RLZ A;  1A2X A;  2JT8 A;  1YRT B;  3TZ1 A;  4PHK A;  2Y1N A;  1LA3 A;  3JVT B;  1AJ5 A;  1SYM A;  3LCP C;  3NSK A;  4F0Z B;  1RFJ A;  1DVI A;  2WND A;  4N1G A;  5HLO A;  5KU1 A;  3TDI A;  1FF1 A;  1S6J A;  2LP2 A;  3PSR A;  4XYN A;  4YGE B;  5FYX A;  4D1E A;  5I8N A;  1GGZ A;  5ER5 A;  2A4J A;  1YX7 A;  1A29 A;  2COL B;  1BOC A;  4PE4 A;  1F4O A;  5JOL A;  1TTX A;  2PMY A;  1YR5 A;  5HKY A;  1DJY A;  1UUS A;  1FI6 A;  4GFT A;  3OB2 B;  4MZK A;  2K7D A;  1SMG A;  1DF0 A;  1EJ3 A;  2K7C A;  3PFV A;  1IJ6 A;  4OR9 B;  1K9U A;  1OSA A;  3I5I C;  1CFF A;  1V1F A;  1XO5 A;  2LVI A;  3AAJ A;  1KFU S;  1SY9 A;  4C0J A;  2M8U A;  1CMF A;  2R2I A;  5DKN A;  1K94 A;  1ZOT B;  4I5K A;  3D0Y B;  4FTG A;  2DOQ A;  2KFH A;  2OTG C;  3VRQ A;  3BUM B;  1DGV A;  1SL8 A;  4XJK A;  3O4Y A;  3IQQ A;  1CMG A;  2JU0 A;  2WCB A;  3DVM A;  2K7B A;  3WHT B;  1QV1 A;  1NPQ A;  1D1O A;  2AUC A;  1J1D A;  3WXA A;  1IJ5 A;  2HQ8 A;  3WNX B;  3VGO A;  5KSZ A;  2KFG A;  2LUC A;  1UP5 A;  2O60 A;  3DF0 B;  2M97 A;  3I5H B;  1ZAC A;  1UHJ A;  1SR6 C;  1NP8 A;  2JNF A;  1F70 A;  2KDH A;  2QPT A;  4GUK A;  1MUX A;  4CLN A;  2GV5 A;  2F2O A;  3PN7 B;  1CDP A;  1YVL A;  4U8D A;  1B47 A;  2LLS A;  3HX4 A;  3ICB A;  2JNX A;  3E3R A;  2LLU A;  3RM1 A;  1DJG A;  1QAT A;  1KQM B;  1M45 A;  1S1E A;  1JBA A;  1FI5 A;  2JT0 A;  5K89 A;  1EXR A;  4TNC A;  2MBX A;  3VRR A;  1XFV O;  4PE1 A;  3TUY C;  1TOP A;  2WCF A;  1IGV A;  2LM5 A;  2Y4Q A;  3I5F C;  1BG1 A;  1K2H A;  2KI4 B;  4OV2 A;  1M31 A;  3LLE A;  1OMV A;  2BKH B;  1TRF A;  1BR4 B;  2P6B B;  1SBJ A;  2JXL A;  3EVR A;  1S26 D;  3PAL A;  4BY5 A;  1G8I A;  4CFR A;  1U5I A;  2K61 A;  1HT9 A;  4PDZ A;  1IH0 A;  3SIA A;  1GJY A;  3I5G C;  1UHK A;  3NSI A;  2KGR A;  2LMT A;  2KBM A;  4M2P A;  1CDL A;  2FOT A;  1YVH A;  4I5N B;  5I2L A;  2KGB C;  5D69 A;  1XVJ A;  1SW8 A;  2H2K A;  4YGD B;  1XFY O;  1TCF A;  3GOF A;  3OX5 A;  4YGB B;  5AEQ A;  2BCX A;  4MLW A;  3EKH A;  1NX2 A;  3GK4 X;  2KBI A;  4PE7 A;  1MXE A;  1J55 A;  4CPV A;  3BOW A;  4ZCV A;  2ISD A;  1TNW A;  3EVU A;  2FCE A;  3AKA A;  3QRX A;  4WQ3 A;  1RJV A;  2CTN A;  2EHB A;  3FWC A;  3HCM A;  2LMU A;  4MN0 A;  2BEC A;  5I2O A;  1BR1 B;  1BU3 A;  1A03 A;  5AAN A;  2KFF A;  4C0K A;  1M46 A;  3K21 A;  4IL1 A;  4A4B A;  1X02 A;  1UHI A;  2KYC A;  2JUL A;  1M63 B;  4ORB B;  1KK7 Y;  1W7J B;  2LHI A;  1IQ5 A;  2EC6 B;  1QX7 A;  1YUT A;  1K9P A;  1WDC B;  1JFK A;  2Q4U A;  1JSA A;  2G2B A;  1A4P A;  1S3P A;  4ETO A;  1SRA A;  4JWQ A;  1CM1 A;  1CLB A;  3VRN A;  5BPJ A;  1DJZ A;  2L4H A;  1BOD A;  1NYA A;  2B1U A;  2E6W A;  3BUX B;  1CNP A;  1XFX O;  1WLM A;  2KI6 C;  2M29 A;  1OE9 B;  4I5L B;  1BMO A;  1LXF C;  1REC A;  4CFQ A;  4UPG A;  2BL0 B;  1L2O B;  2WCE A;  4DIR A;  1UUR A;  1YTZ C;  1NCX A;  1KWO C;  2JZI A;  1CKK A;  3PAT A;  2KAV A;  2LNK A;  2CBL A;  2JWW A;  2ZND A;  4M2Q A;  1QTX A;  1MHO A;  1WRL A;  2O5G A;  4QJ3 B;  5KTY A;  1XFU O;  2EGD A;  2G9B A;  1IWQ A;  2LP3 A;  2TN4 A;  1KCY A;  4JQ0 D;  4HSZ A;  1QAS A;  1OZO A;  1S36 A;  1KFU L;  2I18 A;  5B8I B;  2Y1M A;  1MR8 A;  1F54 A;  4M2O A;  2PAS A;  1TIZ A;  1AVS A;  1EG4 A;  1BJF A;  3AAK A;  4P2Y B;  5HYD A;  2M3W A;  1F55 A;  1PUL A;  5CSI A;  1LKJ A;  1NWD A;  3SG6 A;  1PVA A;  3BQ3 A;  3BUN B;  1Y1U A;  1PRW A;  1R6P A;  3BUO B;  1AHR A;  1UHN A;  1AP4 A;  1A75 A;  4MRY A;  3TS5 B;  5D7F A;  2KSP A;  2KYF A;  4I5J A;  1Y1A A;  3CR2 A;  1NCY A;  2AMI A;  2LMV A;  1SPY A;  2MRD A;  2QAC A;  4CID A;  1J7O A;  3H4S E;  3JVT C;  5F6T A;  4GBA A;  1Q80 A;  1KK7 Z;  2KOT A;  2FJU B;  5AER A;  1QXP A;  4PHJ A;  2CCM A;  1CDN A;  2HQW A;  2L51 A;  1JF2 A;  2KI6 D;  4OVN F;  1J7P A;  2KQ6 A;  3CGA A;  1WRZ A;  4GPL B;  2BBM A;  3PM8 A;  4N5X A;  1XYD A;  1L2O C;  1DGU A;  1NX3 A;  1N65 A;  1RK9 A;  2MLE C;  1TNP A;  1JC2 A;  1SNL A;  1UHH A;  4MEW A;  1CLM A;  4MRX A;  1EH2 A;  1C07 A;  1H4B A;  4L9M A;  4YGC B;  5HKW A;  4AOM A;  1B8R A;  3FIA A;  3JTD B;  3VRP A;  4E68 A;  4NDD A;  4PHN A;  3D10 A;  4Q04 A;  1KK8 B;  3KHE A;  2K0J A;  2LUX A;  2I2R E;  1BLQ A;  3DVJ A;  1JF0 A;  2SAS A;  1SL9 A;  2JC2 A;  1H8B A;  1NUB A;  4GAO A;  2MHH A;  1TNX A;  1F8H A;  1ALW A;  3GK2 A;  4DS7 A;  3FS7 A;  1CTR A;  5DKR A;  1TCO B;  1K96 A;  1M39 A;  4NDC A;  2LVJ A;  5I2Q A;  1OZS A;  3OHM B;  1KQV A;  2M1U A;  4R1E A;  1B4C A;  2LLT A;  4OKH A;  1YX8 A;  3OX6 A;  3I5H C;  3D0Y A;  1LVC D;  1SKT A;  1PVB A;  3C1V A;  3EKJ A;  1MF8 B;  2ZRT A;  1E8A A;  2RGI A;  1N0Y A;  1TN4 A;  1XK4 C;  5JJG A;  1WY9 A;  3OB1 B;  3PN7 C;  4PE0 A;  1S6I A;  1LIN A;  3A8R A;  1J7R A;  2ZRS A;  1JFJ A;  2MAZ A;  2OPO A;  3BXK A;  2M0R A;  3EK8 A;  1QX2 A;  3DF0 A;  1DF0 B;  2M49 B;  2NLN A;  1KQM C;  1ZMZ A;  2JQ6 A;  2BBN A;  1DTL A;  2ZN8 A;  5AFP A;  1QJT A;  2LC5 A;  3DVK A;  1AJ4 A;  1K8U A;  1K9K A;  1K95 A;  5PAL A;  3TDU A;  2WC8 A;  3VRO A;  4ORC B;  1BF5 A;  2L0P A;  1RRO A;  1NX1 A;  4MZJ A;  4WRI A;  3ZWH A;  2L2E A;  4USL A;  2MJW B;  1CFC A;  3KO0 A;  2HF5 A;  2LCP A;  2BKI B;  4ORA B;  4XJK B;  2KI4 C;  1CDM A;  1IQ3 A;  1NX0 A;  3I5I B;  4ICB A;  3IF7 A;  3BUW B;  1GGW A;  1XFW O;  1RWY A;  1KFX L;  2L98 A;  3O6B A;  1QLS A;  1KSO A;  1EL4 A;  2AAO A;  2IS9 A;  4DCK A;  1KFX S;  2OTG B;  1AUI B;  1DMO A;  2L4I A;  2WOS A;  1DT7 B;  1HQV A;  2F33 A;  1C7W A;  2HPS A;  5ER4 X;  5AXI A;  2ZFD A;  1QS7 A;  2PRU A;  5CPV A;  1EG3 A;  3LL8 B;  3SJS A;  1AK8 A;  3NSO A;  1PK0 D;  4PHM A;  3O78 A;  4DUQ A;  1NSH A;  1PAL A;  2NCO A;  3CR4 X;  1B8L A;  2MLF C;  3TDZ A;  1V1G A;  2F8P A;  2M7L A;  1SR6 B;  2HET A;  4YRU A;  1QIV A;  2F3Z A;  2LHL A;  4AQJ A;  2MA2 A;  4AQI A;  3PLF B;  1YUU A;  1CM4 A;  1ALV A;  2KAX A;  2LE9 B;  3WHU B;  1G33 A;  3SG2 A;  2LV7 A;  2K8M B;  4FQO A;  1YUR A;  2LVK A;  3SG5 A;  1Y1X A;  2E30 A;  2KNE A;  2L5X B;  4QJ5 B;  2CNP A;  2EC6 C;  1J1E A;  2JRF A;  1IRJ A;  2OS8 B;  1WDC C;  2KQY A;  4C0L A;  1MXL C;  1PSB A;  1FW4 A;  4YGA A;  1FBV A;  1R2U A;  2F3Y A;  1U5I B;  2LVV A;  1NCZ A;  2ZKM X;  1GQM A;  3NSL A;  3SG7 A;  3TUY B;  3KPX A;  1ZFS A;  4YI8 A;  1Y6W A;  1CLL A;  2F2P A;  1NIW A;  2BCB A;  3GK1 A;  1ODB A;  3I5F B;  3O2P A;  4MBE A;  4GGF C;  1B9A A;  3KEV A;  2BL0 C;  3LK0 A;  5CSJ A;  3NXA A;  3SG3 A;  4OCI A;  4N1F A;  1DJH A;  2M7N A;  2PAL A;  3DD4 A;  1XA5 A;  3AKB A;  2H61 C;  1QLK A;  3DVE A;  1XFZ O;  3I5G B;  1B7T Y;  1OMD A;  3BOW B;  1QX5 B;  2PSR A;  1JUO A;  3A4U B;  3M0W A;  2V53 A;  3CZT X;  1Y0V H;  2BE4 A;  1OQP A;  4GGF A;  4NDB A;  1QVI Y;  3SIB A;  2NCP A;  3CLN A;  4BY4 A;  1S5G Y;  2GGZ A;  5J3X A;  2NZ0 A;  1MWN A;  1KSM A;  1VRK A;  3CTN A;  2H61 A;  2M1K B;  1UWO A;  3BYA A;  5G08 A;  1SK6 D;  5GQQ C; 
#chains in the Genus database with same CATH topology
 2K2A A;  2FCD A;  1DJI A;  5CSN A;  4PT1 A;  2JT3 A;  3LK1 A;  3TS5 C;  3SG4 A;  1B8C A;  1TUJ A;  1TWO A;  2BCA A;  2QEH A;  2JPO A;  2OS8 C;  1C7V A;  1FPW A;  1SCV A;  4YI9 A;  2CT9 A;  1MQ1 A;  1OOJ A;  2ZN9 A;  3CR5 X;  5HLV A;  4P5O E;  4PCW A;  3EVV A;  3OP0 A;  1LA0 A;  4MVF A;  2I7A A;  4DRW A;  2LAN A;  4GNK B;  1CB1 A;  1W7I B;  1OMR A;  1SCM B;  2ZNE A;  4JKT A;  3KF9 A;  2GGM A;  3EK4 A;  4ZCU A;  3OGN A;  2K7O A;  4QJ4 B;  5TNC A;  1CFD A;  2WOR A;  1OW4 A;  4HRG A;  1PSR A;  3BFA A;  1JWD A;  3MSE B;  2JTT A;  1YUS A;  2NXQ A;  3CS1 A;  1K93 D;  3CWG A;  1SL7 A;  1B1G A;  1WLZ A;  5HKZ A;  1XK4 A;  3JTD C;  5CSF A;  1KWO B;  4A4C A;  1DJW A;  2WCM A;  1J7Q A;  2JXC A;  1KK8 C;  3EK7 A;  1WRK A;  4MSP A;  2BAP A;  1B7T Z;  1QV0 A;  4WQ2 A;  2CXJ A;  1N2D A;  2JTZ A;  2K2F A;  2Q91 A;  4NQG A;  2I94 A;  1IG5 A;  1L7Z A;  2Y5I A;  3B86 A;  1QVI Z;  1K90 D;  1S6C A;  2VRG A;  3F45 A;  1A75 B;  4HRH A;  1S5G Z;  3ZNI A;  1C3Y A;  1DJX A;  3IQO A;  4PAL A;  2KHN A;  4YBH B;  1IKU A;  1YRU B;  2M9G A;  3PJI A;  2LAP A;  1CFP A;  4HRE E;  1F4Q A;  1BT6 A;  1ZUZ A;  3DZT A;  3BJH A;  4GGN A;  3R72 A;  1XFR A;  5IBW A;  3IVT A;  4JPZ B;  1RTP 1;  2JOJ A;  1QIW A;  2KAY A;  5DKQ A;  2JPT A;  2D8N A;  1SCM C;  2L50 A;  2BE6 A;  2PVB A;  4INX A;  1G4Y R;  1F71 A;  4MZL A;  2SCP A;  3FWB A;  1TNQ A;  3RLZ A;  1A2X A;  2JT8 A;  1YRT B;  3R1V A;  3TZ1 A;  4PHK A;  2Y1N A;  1LA3 A;  3JVT B;  3NHT A;  1AJ5 A;  3DYE A;  1SYM A;  3LCP C;  3NSK A;  5D3O A;  1RFJ A;  4F0Z B;  1DVI A;  2WND A;  4N1G A;  5HLO A;  5KU1 A;  3TDI A;  1Z4H A;  1S6J A;  2LP2 A;  1FF1 A;  3PSR A;  4XYN A;  1C3Z A;  4YGE B;  5FYX A;  4D1E A;  5I8N A;  2P71 A;  1GGZ A;  5ER5 A;  2A4J A;  1YX7 A;  4INW A;  1A29 A;  2COL B;  1BOC A;  4PE4 A;  1F4O A;  5JOL A;  1TTX A;  2PMY A;  1YR5 A;  3O4X A;  5FI2 A;  1DJY A;  1UUS A;  5HKY A;  1W9Z A;  4GFT A;  1FI6 A;  3OB2 B;  4MZK A;  2K7D A;  1SMG A;  1DF0 A;  1EJ3 A;  2K7C A;  3PFV A;  1IJ6 A;  4OR9 B;  1K9U A;  1OSA A;  3I5I C;  1CFF A;  1V1F A;  1XO5 A;  2LVI A;  2PYQ A;  3AAJ A;  1KFU S;  1SY9 A;  2P70 A;  4C0J A;  2M8U A;  1CMF A;  2R2I A;  5DKN A;  1K94 A;  1DC1 A;  1ZOT B;  4I5K A;  3D0Y B;  3EG5 B;  4FTG A;  2DOQ A;  2KFH A;  2OTG C;  3CZ2 A;  3BUM B;  3VRQ A;  1DGV A;  1SL8 A;  4XJK A;  3O4Y A;  3IQQ A;  1CMG A;  2JU0 A;  2WCB A;  3DVM A;  2K7B A;  3WHT B;  2PQL A;  1QV1 A;  1NPQ A;  1D1O A;  3D76 A;  2AUC A;  1J1D A;  3WXA A;  1IJ5 A;  3FE6 A;  2HQ8 A;  3WNX B;  3VGO A;  5KSZ A;  1DEL A;  2KFG A;  2LUC A;  1UP5 A;  2O60 A;  3DF0 B;  2M97 A;  3I5H B;  1ZAC A;  1UHJ A;  1SR6 C;  1NP8 A;  2JNF A;  1F70 A;  2KDH A;  2QPT A;  4GUK A;  1MUX A;  4CLN A;  2GV5 A;  1DQE A;  2F2O A;  3PN7 B;  1CDP A;  1YVL A;  3SS3 A;  4U8D A;  1B47 A;  2LLS A;  3HX4 A;  3ICB A;  3Q8I A;  2JNX A;  2WCL A;  1LS8 A;  3E3R A;  2LLU A;  3RM1 A;  1DJG A;  1QAT A;  1KQM B;  1M45 A;  1S1E A;  1JBA A;  1FI5 A;  2L2C A;  2JT0 A;  5K89 A;  1EXR A;  4TNC A;  2MBX A;  3VRR A;  1XFV O;  4PE1 A;  3TUY C;  1TOP A;  1TUZ A;  2WCF A;  1IGV A;  1ORG A;  2LM5 A;  2Y4Q A;  3I5F C;  1BG1 A;  3S0F A;  1K2H A;  2KI4 B;  4OV2 A;  1M31 A;  3LLE A;  1OMV A;  2BKH B;  1TRF A;  1BR4 B;  2P6B B;  1SBJ A;  3DXL A;  2JXL A;  3EVR A;  1S26 D;  3PAL A;  4BY5 A;  1G8I A;  4CFR A;  1U5I A;  2K61 A;  1HT9 A;  4PDZ A;  1IH0 A;  3SIA A;  1GJY A;  3I5G C;  1UHK A;  3NSI A;  4JD9 A;  2KGR A;  3D77 A;  2LMT A;  2KBM A;  4M2P A;  3R1P A;  4OZD A;  1CDL A;  2FOT A;  1YVH A;  4I5N B;  5I2L A;  1OOH A;  2KGB C;  5D69 A;  1XVJ A;  1SW8 A;  2H2K A;  2WCK A;  1XFY O;  4YGD B;  1TCF A;  3GOF A;  3OX5 A;  4YGB B;  5AEQ A;  2BCX A;  4MLW A;  3EKH A;  1NX2 A;  3GK4 X;  2KBI A;  4PE7 A;  1MXE A;  1J55 A;  3NGV A;  4CPV A;  3BOW A;  4ZCV A;  5I94 A;  2WCJ A;  3OBV A;  1TNW A;  3EVU A;  5EL2 A;  2ISD A;  2FCE A;  3AKA A;  3QRX A;  4WQ3 A;  1RJV A;  2CTN A;  2EHB A;  3FWC A;  3HCM A;  3CZ0 A;  2LMU A;  4MN0 A;  1DEK A;  2BEC A;  5I2O A;  1BR1 B;  1BU3 A;  1A03 A;  5AAN A;  3S0G A;  2KFF A;  4C0K A;  1M46 A;  3K21 A;  4IL1 A;  3BFB A;  4A4B A;  1X02 A;  1UHI A;  2KYC A;  2JUL A;  1M63 B;  2BNX A;  4ORB B;  1KK7 Y;  3UNW A;  1W7J B;  2LHI A;  1IQ5 A;  2EC6 B;  1QX7 A;  1YUT A;  1K9P A;  1WDC B;  1JFK A;  2Q4U A;  1JSA A;  2G2B A;  1A4P A;  1S3P A;  3S0A A;  4ETO A;  4F7F A;  1SRA A;  4JWQ A;  1CM1 A;  1CLB A;  3VRN A;  1P28 A;  4KYN A;  5BPJ A;  1DJZ A;  1OOG A;  2L4H A;  1BOD A;  1NYA A;  2B1U A;  2E6W A;  3S0D A;  3BUX B;  1CNP A;  1XFX O;  1WLM A;  2KI6 C;  2M29 A;  1OE9 B;  4I5L B;  1BMO A;  1LXF C;  1REC A;  5FI7 A;  4CFQ A;  4UPG A;  2BL0 B;  1L2O B;  2WCE A;  4DIR A;  1UUR A;  1YTZ C;  3DY9 A;  1NCX A;  1KWO C;  2JZI A;  2L5Y A;  1CKK A;  3PAT A;  2KAV A;  2LNK A;  2CBL A;  2JWW A;  2ZND A;  4M2Q A;  1QTX A;  1MHO A;  1WRL A;  2O5G A;  4QJ3 B;  5KTY A;  1XFU O;  2EGD A;  2G9B A;  1IWQ A;  2LP3 A;  2TN4 A;  1KCY A;  4JQ0 D;  4HSZ A;  1QAS A;  2WC6 A;  1OZO A;  1S36 A;  1KFU L;  2I18 A;  5B8I B;  2Y1M A;  1MR8 A;  1F54 A;  4M2O A;  3FE8 A;  2PAS A;  4FQT A;  1TIZ A;  1AVS A;  1EG4 A;  1BJF A;  3AAK A;  4P2Y B;  5HYD A;  2M3W A;  1F55 A;  1PUL A;  5CSI A;  1LKJ A;  1NWD A;  3SG6 A;  1PVA A;  3BQ3 A;  3N7H A;  3BUN B;  1Y1U A;  1PRW A;  1R6P A;  3BUO B;  1AHR A;  1UHN A;  1AP4 A;  1A75 A;  4MRY A;  3TS5 B;  5D7F A;  2KSP A;  2KYF A;  4I5J A;  1Y1A A;  3CR2 A;  3SS5 A;  1NCY A;  2AMI A;  2LMV A;  1SPY A;  1IIO A;  1OOF A;  2MRD A;  2QAC A;  4CID A;  3K1E A;  1QWV A;  1J7O A;  3H4S E;  3JVT C;  5F6T A;  4GBA A;  1Q80 A;  1KK7 Z;  2KOT A;  2FJU B;  5AER A;  1QXP A;  4PHJ A;  2CCM A;  1CDN A;  2HQW A;  2L51 A;  1JF2 A;  2KI6 D;  4OVN F;  1J7P A;  2KQ6 A;  2KLE A;  3CZ1 A;  3CGA A;  1WRZ A;  4GPL B;  2BBM A;  3PM8 A;  4N5X A;  1XYD A;  1L2O C;  1DGU A;  1NX3 A;  1N65 A;  1RK9 A;  2MLE C;  1TNP A;  1JC2 A;  1SNL A;  1UHH A;  3B87 A;  2H8V A;  4MEW A;  2WC5 A;  1CLM A;  4MRX A;  1EH2 A;  1C07 A;  1H4B A;  4L9M A;  4YGC B;  5HKW A;  4AOM A;  1B8R A;  3FIA A;  3JTD B;  3VRP A;  4E68 A;  4NDD A;  4PHN A;  3D10 A;  4Q04 A;  1KK8 B;  3KHE A;  2K0J A;  2LUX A;  2I2R E;  1BLQ A;  3DVJ A;  1JF0 A;  2SAS A;  3PM2 A;  2K60 A;  1SL9 A;  3QME A;  2JC2 A;  5HL1 A;  1H8B A;  1NUB A;  4GAO A;  3S0B A;  2MHH A;  3L47 A;  1TNX A;  1F8H A;  1ALW A;  3D75 A;  3GK2 A;  4DS7 A;  3FS7 A;  1CTR A;  5DKR A;  1TCO B;  1K96 A;  1M39 A;  4NDC A;  2LVJ A;  5I2Q A;  1OZS A;  3OHM B;  1KQV A;  2M1U A;  3D73 A;  4R1E A;  3CAB A;  2LLT A;  4OKH A;  1B4C A;  1YX8 A;  3OX6 A;  3I5H C;  3D0Y A;  1LVC D;  1SKT A;  1PVB A;  3C1V A;  3EKJ A;  1MF8 B;  2ZRT A;  1E8A A;  2RGI A;  1N0Y A;  1TN4 A;  1XK4 C;  3NHI A;  5JJG A;  1WY9 A;  3CDN A;  3OB1 B;  3PN7 C;  1S6I A;  4PE0 A;  1LIN A;  3S0E A;  3A8R A;  1J7R A;  2ZRS A;  1JFJ A;  3R1O A;  3V2L A;  2MAZ A;  2OPO A;  3BXK A;  2M0R A;  1Z2C B;  3EK8 A;  1QX2 A;  3DF0 A;  3SS4 A;  1DF0 B;  2M49 B;  2NLN A;  1KQM C;  1SSE B;  1ZMZ A;  2JQ6 A;  2BBN A;  1DTL A;  2ZN8 A;  2QEB A;  1QJT A;  2LC5 A;  5AFP A;  3DVK A;  1AJ4 A;  1K8U A;  1K9K A;  1K95 A;  5PAL A;  3TDU A;  2WC8 A;  3VRO A;  4ORC B;  1BF5 A;  5FI6 A;  2L0P A;  1RRO A;  1NX1 A;  4MZJ A;  4WRI A;  3ZWH A;  2L2E A;  2KLD A;  3FE9 A;  4USL A;  2MJW B;  1CFC A;  3KO0 A;  2HF5 A;  2LCP A;  2BKI B;  4ORA B;  4XJK B;  2KI4 C;  1CDM A;  1IQ3 A;  1NX0 A;  3I5I B;  4ICB A;  3IF7 A;  3BUW B;  1GGW A;  3L4L A;  1XFW O;  1RWY A;  1KFX L;  2L98 A;  3B7A A;  1QLS A;  3O6B A;  1KSO A;  1EL4 A;  2AAO A;  2IS9 A;  3CYZ A;  5DIC A;  2KPH A;  4DCK A;  1KFX S;  3D78 A;  2OTG B;  1AUI B;  1DMO A;  2L4I A;  2FJY A;  2WOS A;  1DT7 B;  1HQV A;  2F33 A;  1C7W A;  2HPS A;  5ER4 X;  5AXI A;  3B88 A;  2ZFD A;  1QS7 A;  2PRU A;  5CPV A;  1EG3 A;  3LL8 B;  3SJS A;  1AK8 A;  3NSO A;  1PK0 D;  4PHM A;  3UO9 A;  2YGU A;  3O78 A;  4DUQ A;  1NSH A;  1PAL A;  2NCO A;  2QEO A;  3CR4 X;  1B8L A;  2MLF C;  3TDZ A;  1V1G A;  2F8P A;  3B6X A;  1SR6 B;  3L4A A;  2M7L A;  1GM0 A;  2HET A;  4YRU A;  1QIV A;  2F3Z A;  2LHL A;  4AQJ A;  2MA2 A;  4AQI A;  3PLF B;  1YUU A;  1CM4 A;  1ALV A;  2KAX A;  2LE9 B;  3WHU B;  1G33 A;  3SG2 A;  2LV7 A;  2WCH A;  2K8M B;  4FQO A;  1YUR A;  2LVK A;  3SG5 A;  1Y1X A;  2E30 A;  2KNE A;  2L5X B;  4QJ5 B;  2QEV A;  2CNP A;  2EC6 C;  2GTE A;  1J1E A;  2JRF A;  1IRJ A;  2OS8 B;  1WDC C;  2KQY A;  4C0L A;  1MXL C;  1PSB A;  1FW4 A;  2QDI A;  4YGA A;  1FBV A;  1R2U A;  2F3Y A;  1U5I B;  2LVV A;  1NCZ A;  2ZKM X;  1GQM A;  3NSL A;  3SG7 A;  3TUY B;  3KPX A;  1ZFS A;  3BFH A;  4YI8 A;  1Y6W A;  1CLL A;  2F2P A;  1NIW A;  2BCB A;  3GK1 A;  1ODB A;  3I5F B;  3O2P A;  2ERB A;  4MBE A;  4GGF C;  3VB1 A;  1B9A A;  4IJ7 A;  3D74 A;  3KEV A;  2BL0 C;  3LK0 A;  5CSJ A;  3NXA A;  3SG3 A;  4OCI A;  4N1F A;  1DJH A;  2M7N A;  2PAL A;  3DD4 A;  1XA5 A;  3AKB A;  2H61 C;  1QLK A;  3DVE A;  1OOI X;  1XFZ O;  3I5G B;  1B7T Y;  1OMD A;  1T14 A;  3BOW B;  1QX5 B;  2PSR A;  1JUO A;  3A4U B;  3M0W A;  2V53 A;  3CZT X;  1Y0V H;  1OQP A;  2BE4 A;  4GGF A;  3RZS A;  4NDB A;  1QVI Y;  3SIB A;  2NCP A;  3CLN A;  4BY4 A;  1S5G Y;  2GGZ A;  5J3X A;  2NZ0 A;  1MWN A;  1KSM A;  1VRK A;  3CTN A;  2H61 A;  2M1K B;  1UWO A;  3BYA A;  5G08 A;  1SK6 D;  5GQQ C; 
#chains in the Genus database with same CATH homology
 2K2A A;  2FCD A;  1DJI A;  5CSN A;  2JT3 A;  3LK1 A;  3TS5 C;  3SG4 A;  1B8C A;  2BCA A;  2OS8 C;  1C7V A;  1FPW A;  1SCV A;  4YI9 A;  2CT9 A;  1MQ1 A;  1OOJ A;  2ZN9 A;  3CR5 X;  5HLV A;  4P5O E;  4PCW A;  3EVV A;  3OP0 A;  1LA0 A;  4MVF A;  2I7A A;  4DRW A;  2LAN A;  4GNK B;  1CB1 A;  1W7I B;  1OMR A;  1SCM B;  2ZNE A;  3KF9 A;  2GGM A;  3EK4 A;  4ZCU A;  2K7O A;  4QJ4 B;  5TNC A;  1CFD A;  2WOR A;  4HRG A;  1PSR A;  1JWD A;  3MSE B;  2JTT A;  1YUS A;  2NXQ A;  3CS1 A;  1K93 D;  3CWG A;  1SL7 A;  1B1G A;  1WLZ A;  5HKZ A;  1XK4 A;  3JTD C;  5CSF A;  1KWO B;  4A4C A;  1DJW A;  1J7Q A;  2JXC A;  1KK8 C;  3EK7 A;  1WRK A;  4MSP A;  1B7T Z;  1QV0 A;  4WQ2 A;  2CXJ A;  1N2D A;  2JTZ A;  2K2F A;  2Q91 A;  4NQG A;  2I94 A;  1IG5 A;  1L7Z A;  2Y5I A;  1QVI Z;  1K90 D;  1S6C A;  2VRG A;  3F45 A;  1A75 B;  4HRH A;  1S5G Z;  3ZNI A;  1DJX A;  3IQO A;  4PAL A;  2KHN A;  4YBH B;  1IKU A;  1YRU B;  2M9G A;  2LAP A;  1CFP A;  4HRE E;  1F4Q A;  1BT6 A;  1ZUZ A;  4GGN A;  5IBW A;  4JPZ B;  1RTP 1;  2JOJ A;  1QIW A;  2KAY A;  5DKQ A;  2JPT A;  2D8N A;  1SCM C;  2L50 A;  2BE6 A;  2PVB A;  1F71 A;  1G4Y R;  4MZL A;  2SCP A;  3FWB A;  1TNQ A;  3RLZ A;  1A2X A;  2JT8 A;  1YRT B;  3TZ1 A;  4PHK A;  2Y1N A;  1LA3 A;  3JVT B;  1AJ5 A;  1SYM A;  3LCP C;  3NSK A;  4F0Z B;  1RFJ A;  1DVI A;  2WND A;  4N1G A;  5HLO A;  5KU1 A;  3TDI A;  1FF1 A;  1S6J A;  2LP2 A;  3PSR A;  4XYN A;  4YGE B;  5FYX A;  4D1E A;  5I8N A;  1GGZ A;  5ER5 A;  2A4J A;  1YX7 A;  1A29 A;  2COL B;  1BOC A;  4PE4 A;  1F4O A;  5JOL A;  1TTX A;  2PMY A;  1YR5 A;  5HKY A;  1DJY A;  1UUS A;  1FI6 A;  4GFT A;  3OB2 B;  4MZK A;  2K7D A;  1SMG A;  1DF0 A;  1EJ3 A;  2K7C A;  3PFV A;  1IJ6 A;  4OR9 B;  1K9U A;  1OSA A;  3I5I C;  1CFF A;  1V1F A;  1XO5 A;  2LVI A;  3AAJ A;  1KFU S;  1SY9 A;  4C0J A;  2M8U A;  1CMF A;  2R2I A;  5DKN A;  1K94 A;  1ZOT B;  4I5K A;  3D0Y B;  4FTG A;  2DOQ A;  2KFH A;  2OTG C;  3VRQ A;  3BUM B;  1DGV A;  1SL8 A;  4XJK A;  3O4Y A;  3IQQ A;  1CMG A;  2JU0 A;  2WCB A;  3DVM A;  2K7B A;  3WHT B;  1QV1 A;  1NPQ A;  1D1O A;  2AUC A;  1J1D A;  3WXA A;  1IJ5 A;  2HQ8 A;  3WNX B;  3VGO A;  5KSZ A;  2KFG A;  2LUC A;  1UP5 A;  2O60 A;  3DF0 B;  2M97 A;  3I5H B;  1ZAC A;  1UHJ A;  1SR6 C;  1NP8 A;  2JNF A;  1F70 A;  2KDH A;  2QPT A;  4GUK A;  1MUX A;  4CLN A;  2GV5 A;  2F2O A;  3PN7 B;  1CDP A;  1YVL A;  4U8D A;  1B47 A;  2LLS A;  3HX4 A;  3ICB A;  2JNX A;  3E3R A;  2LLU A;  3RM1 A;  1DJG A;  1QAT A;  1KQM B;  1M45 A;  1S1E A;  1JBA A;  1FI5 A;  2JT0 A;  5K89 A;  1EXR A;  4TNC A;  2MBX A;  3VRR A;  1XFV O;  4PE1 A;  3TUY C;  1TOP A;  2WCF A;  1IGV A;  2LM5 A;  2Y4Q A;  3I5F C;  1BG1 A;  1K2H A;  2KI4 B;  4OV2 A;  1M31 A;  3LLE A;  1OMV A;  2BKH B;  1TRF A;  1BR4 B;  2P6B B;  1SBJ A;  2JXL A;  3EVR A;  1S26 D;  3PAL A;  4BY5 A;  1G8I A;  4CFR A;  1U5I A;  2K61 A;  1HT9 A;  4PDZ A;  1IH0 A;  3SIA A;  1GJY A;  3I5G C;  1UHK A;  3NSI A;  2KGR A;  2LMT A;  2KBM A;  4M2P A;  1CDL A;  2FOT A;  1YVH A;  4I5N B;  5I2L A;  2KGB C;  5D69 A;  1XVJ A;  1SW8 A;  2H2K A;  4YGD B;  1XFY O;  1TCF A;  3GOF A;  3OX5 A;  4YGB B;  5AEQ A;  2BCX A;  4MLW A;  3EKH A;  1NX2 A;  3GK4 X;  2KBI A;  4PE7 A;  1MXE A;  1J55 A;  4CPV A;  3BOW A;  4ZCV A;  2ISD A;  1TNW A;  3EVU A;  2FCE A;  3AKA A;  3QRX A;  4WQ3 A;  1RJV A;  2CTN A;  2EHB A;  3FWC A;  3HCM A;  2LMU A;  4MN0 A;  2BEC A;  5I2O A;  1BR1 B;  1BU3 A;  1A03 A;  5AAN A;  2KFF A;  4C0K A;  1M46 A;  3K21 A;  4IL1 A;  4A4B A;  1X02 A;  1UHI A;  2KYC A;  2JUL A;  1M63 B;  4ORB B;  1KK7 Y;  1W7J B;  2LHI A;  1IQ5 A;  2EC6 B;  1QX7 A;  1YUT A;  1K9P A;  1WDC B;  1JFK A;  2Q4U A;  1JSA A;  2G2B A;  1A4P A;  1S3P A;  4ETO A;  1SRA A;  4JWQ A;  1CM1 A;  1CLB A;  3VRN A;  5BPJ A;  1DJZ A;  2L4H A;  1BOD A;  1NYA A;  2B1U A;  2E6W A;  3BUX B;  1CNP A;  1XFX O;  1WLM A;  2KI6 C;  2M29 A;  1OE9 B;  4I5L B;  1BMO A;  1LXF C;  1REC A;  4CFQ A;  4UPG A;  2BL0 B;  1L2O B;  2WCE A;  4DIR A;  1UUR A;  1YTZ C;  1NCX A;  1KWO C;  2JZI A;  1CKK A;  3PAT A;  2KAV A;  2LNK A;  2CBL A;  2JWW A;  2ZND A;  4M2Q A;  1QTX A;  1MHO A;  1WRL A;  2O5G A;  4QJ3 B;  5KTY A;  1XFU O;  2EGD A;  2G9B A;  1IWQ A;  2LP3 A;  2TN4 A;  1KCY A;  4JQ0 D;  4HSZ A;  1QAS A;  1OZO A;  1S36 A;  1KFU L;  2I18 A;  5B8I B;  2Y1M A;  1MR8 A;  1F54 A;  4M2O A;  2PAS A;  1TIZ A;  1AVS A;  1EG4 A;  1BJF A;  3AAK A;  4P2Y B;  5HYD A;  2M3W A;  1F55 A;  1PUL A;  5CSI A;  1LKJ A;  1NWD A;  3SG6 A;  1PVA A;  3BQ3 A;  3BUN B;  1Y1U A;  1PRW A;  1R6P A;  3BUO B;  1AHR A;  1UHN A;  1AP4 A;  1A75 A;  4MRY A;  3TS5 B;  5D7F A;  2KSP A;  2KYF A;  4I5J A;  1Y1A A;  3CR2 A;  1NCY A;  2AMI A;  2LMV A;  1SPY A;  2MRD A;  2QAC A;  4CID A;  1J7O A;  3H4S E;  3JVT C;  5F6T A;  4GBA A;  1Q80 A;  1KK7 Z;  2KOT A;  2FJU B;  5AER A;  1QXP A;  4PHJ A;  2CCM A;  1CDN A;  2HQW A;  2L51 A;  1JF2 A;  2KI6 D;  4OVN F;  1J7P A;  2KQ6 A;  3CGA A;  1WRZ A;  4GPL B;  2BBM A;  3PM8 A;  4N5X A;  1XYD A;  1L2O C;  1DGU A;  1NX3 A;  1N65 A;  1RK9 A;  2MLE C;  1TNP A;  1JC2 A;  1SNL A;  1UHH A;  4MEW A;  1CLM A;  4MRX A;  1EH2 A;  1C07 A;  1H4B A;  4L9M A;  4YGC B;  5HKW A;  4AOM A;  1B8R A;  3FIA A;  3JTD B;  3VRP A;  4E68 A;  4NDD A;  4PHN A;  3D10 A;  4Q04 A;  1KK8 B;  3KHE A;  2K0J A;  2LUX A;  2I2R E;  1BLQ A;  3DVJ A;  1JF0 A;  2SAS A;  1SL9 A;  2JC2 A;  1H8B A;  1NUB A;  4GAO A;  2MHH A;  1TNX A;  1F8H A;  1ALW A;  3GK2 A;  4DS7 A;  3FS7 A;  1CTR A;  5DKR A;  1TCO B;  1K96 A;  1M39 A;  4NDC A;  2LVJ A;  5I2Q A;  1OZS A;  3OHM B;  1KQV A;  2M1U A;  4R1E A;  1B4C A;  2LLT A;  4OKH A;  1YX8 A;  3OX6 A;  3I5H C;  3D0Y A;  1LVC D;  1SKT A;  1PVB A;  3C1V A;  3EKJ A;  1MF8 B;  2ZRT A;  1E8A A;  2RGI A;  1N0Y A;  1TN4 A;  1XK4 C;  5JJG A;  1WY9 A;  3OB1 B;  3PN7 C;  4PE0 A;  1S6I A;  1LIN A;  3A8R A;  1J7R A;  2ZRS A;  1JFJ A;  2MAZ A;  2OPO A;  3BXK A;  2M0R A;  3EK8 A;  1QX2 A;  3DF0 A;  1DF0 B;  2M49 B;  2NLN A;  1KQM C;  1ZMZ A;  2JQ6 A;  2BBN A;  1DTL A;  2ZN8 A;  5AFP A;  1QJT A;  2LC5 A;  3DVK A;  1AJ4 A;  1K8U A;  1K9K A;  1K95 A;  5PAL A;  3TDU A;  2WC8 A;  3VRO A;  4ORC B;  1BF5 A;  2L0P A;  1RRO A;  1NX1 A;  4MZJ A;  4WRI A;  3ZWH A;  2L2E A;  4USL A;  2MJW B;  1CFC A;  3KO0 A;  2HF5 A;  2LCP A;  2BKI B;  4ORA B;  4XJK B;  2KI4 C;  1CDM A;  1IQ3 A;  1NX0 A;  3I5I B;  4ICB A;  3IF7 A;  3BUW B;  1GGW A;  1XFW O;  1RWY A;  1KFX L;  2L98 A;  3O6B A;  1QLS A;  1KSO A;  1EL4 A;  2AAO A;  2IS9 A;  4DCK A;  1KFX S;  2OTG B;  1AUI B;  1DMO A;  2L4I A;  2WOS A;  1DT7 B;  1HQV A;  2F33 A;  1C7W A;  2HPS A;  5ER4 X;  5AXI A;  2ZFD A;  1QS7 A;  2PRU A;  5CPV A;  1EG3 A;  3LL8 B;  3SJS A;  1AK8 A;  3NSO A;  1PK0 D;  4PHM A;  3O78 A;  4DUQ A;  1NSH A;  1PAL A;  2NCO A;  3CR4 X;  1B8L A;  2MLF C;  3TDZ A;  1V1G A;  2F8P A;  2M7L A;  1SR6 B;  2HET A;  4YRU A;  1QIV A;  2F3Z A;  2LHL A;  4AQJ A;  2MA2 A;  4AQI A;  3PLF B;  1YUU A;  1CM4 A;  1ALV A;  2KAX A;  2LE9 B;  3WHU B;  1G33 A;  3SG2 A;  2LV7 A;  2K8M B;  4FQO A;  1YUR A;  2LVK A;  3SG5 A;  1Y1X A;  2E30 A;  2KNE A;  2L5X B;  4QJ5 B;  2CNP A;  2EC6 C;  1J1E A;  2JRF A;  1IRJ A;  2OS8 B;  1WDC C;  2KQY A;  4C0L A;  1MXL C;  1PSB A;  1FW4 A;  4YGA A;  1FBV A;  1R2U A;  2F3Y A;  1U5I B;  2LVV A;  1NCZ A;  2ZKM X;  1GQM A;  3NSL A;  3SG7 A;  3TUY B;  3KPX A;  1ZFS A;  4YI8 A;  1Y6W A;  1CLL A;  2F2P A;  1NIW A;  2BCB A;  3GK1 A;  1ODB A;  3I5F B;  3O2P A;  4MBE A;  4GGF C;  1B9A A;  3KEV A;  2BL0 C;  3LK0 A;  5CSJ A;  3NXA A;  3SG3 A;  4OCI A;  4N1F A;  1DJH A;  2M7N A;  2PAL A;  3DD4 A;  1XA5 A;  3AKB A;  2H61 C;  1QLK A;  3DVE A;  1XFZ O;  3I5G B;  1B7T Y;  1OMD A;  3BOW B;  1QX5 B;  2PSR A;  1JUO A;  3A4U B;  3M0W A;  2V53 A;  3CZT X;  1Y0V H;  2BE4 A;  1OQP A;  4GGF A;  4NDB A;  1QVI Y;  3SIB A;  2NCP A;  3CLN A;  4BY4 A;  1S5G Y;  2GGZ A;  5J3X A;  2NZ0 A;  1MWN A;  1KSM A;  1VRK A;  3CTN A;  2H61 A;  2M1K B;  1UWO A;  3BYA A;  5G08 A;  1SK6 D;  5GQQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...