1IH0A

Structure of the c-domain of human cardiac troponin c in complex with ca2+ sensitizer emd 57033
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
GKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES
publication title Structure of the C-domain of human cardiac troponin C in complex with the Ca2+ sensitizing drug EMD 57033.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 17
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ih0A00
1EH2A 3OHMB 4C0LA 2JPTA 2COLB 1M46A 4CLNA 4DUQA 2ZFDA 1IGVA 1WLMA 2BL0B 1CM4A 2OTGB 1PVBA 1OE9B 1DMOA 1JWDA 2LHLA 3JTDC 2L4IA 1BODA 1G8IA 3TZ1A 1XA5A 1Y1UA 2KQ6A 3O2PA 4DRWA 4YRUA 1FI6A 1WRZA 3D0YA 3BUOB 1SKTA 3QRXA 3A8RA 1U5IB 2O60A 4XJKA 2LVJA 1RTP1 4ORCB 4IL1A 1JFJA 1AP4A 1IH0A 2M97A 1KQVA 4GAOA 4YGBB 2O5GA 3OP0A 3TDIA 2BCAA 1PSRA 1GGWA 1RWYA 3CR5X 4BY4A 5HLVA 2KAVA 3O78A 4ORAB 4WQ3A 2L2EA 5TNCA 1J7QA 5HKYA 4DS7A 2M8UA 1W7IB 1K94A 4NDCA 3AKBA 4HRHA 1KK8B 4ICBA 1WLZA 5B8IB 1QS7A 1UURA 3EK7A 4AQIA 4MBEA 3AAJA 2BL0C 4QJ3B 2KQYA 1YTZC 2SASA 1KSOA 3BQ3A 4MSPA 3I5IB 1ALVA 1XFYO 5KU1A 2Q91A 3TUYC 1H8BA 2K8MB 2KHNA 5ER5A 1UHKA 1SCMB 1QATA 1QASA 5D7FA 2KAXA 1BLQA 1CB1A 4M2PA 4MN0A 2BCBA 2LNKA 1GQMA 5AXIA 5CSNA 3SIBA 2L98A 3DVEA 4N1FA 2LHIA 4D1EA 3HX4A 1N2DA 4OKHA 1RROA 1DJWA 3NSIA 1BMOA 1S5GZ 2M7NA 1ALWA 2SCPA 3DVJA 3I5GB 1TCOB 2KFGA 2QPTA 3O4YA 4ZCUA 1S1EA 2WORA 2MHHA 3CS1A 2ZKMX 3BUWB 3C1VA 2CNPA 1FF1A 1SCVA 1LA0A 2MRDA 1KK8C 3I5HC 1TNQA 2M29A 1A4PA 2PRUA 4TNCA 1HQVA 2KI6C 4U8DA 3SJSA 2NXQA 4YI8A 2E6WA 1DJHA 3PN7B 1FPWA 1SYMA 1K9UA 2VRGA 2M49B 3SIAA 1S6JA 4M2QA 1S6CA 3I5IC 1JF2A 1CDNA 4MEWA 5F6TA 1GGZA 1SCMC 3E3RA 4N5XA 1OQPA 1XK4A 1JUOA 5I2LA 1PRWA 2H2KA 4Q04A 3DVKA 3SG2A 1FW4A 2GV5A 1KFXS 1DJZA 3VRQA 1UP5A 4P2YB 1XYDA 1JBAA 1NYAA 1QTXA 1MF8B 2K7DA 3KPXA 1B9AA 1UHHA 1DGUA 5AFPA 2V53A 3TS5B 3VGOA 4MVFA 1KK7Z 2ZRSA 3IQQA 3KO0A 4UPGA 3IQOA 2BCXA 1OOJA 1TRFA 1PULA 2KGBC 1LVCD 1QXPA 1LKJA 1TCFA 4GGFC 2ZN8A 4DIRA 1K96A 1ZFSA 2JTZA 3KF9A 3PN7C 1A2XA 1XFVO 1V1GA 5HYDA 1FI5A 1S6IA 4ORBB 5K89A 1TNXA 2NCOA 1LINA 2LV7A 5JJGA 4PHNA 1A03A 1NCYA 2LC5A 1SBJA 2WOSA 1S5GY 3PLFB 1OZOA 4FTGA 4I5JA 1AUIB 1DJYA 3PALA 1EXRA 1M39A 2NLNA 3M0WA 1KFUS 1YURA 2JC2A 1UUSA 2LVKA 2WCFA 1SL9A 2PALA 3FWCA 1F54A 2D8NA 4NDBA 2I94A 1CFFA 1CNPA 1RFJA 2H61C 5DKRA 4MZKA 3NXAA 1CFCA 1Y6WA 2JTTA 3LCPC 1MWNA 1W7JB 1IJ5A 3SG6A 3CLNA 1DGVA 3TS5C 4GFTA 1E8AA 4YBHB 2OS8B 2LMUA 1NPQA 1YVHA 4E68A 1NSHA 4OV2A 1G33A 4PHJA 2KSPA 1BR1B 1B8RA 4F0ZB 1TN4A 2OPOA 3LL8B 3EK8A 1OSAA 1NX1A 3D0YB 3I5FB 2M9GA 2F3YA 1BG1A 1CDMA 4XJKB 1EG4A 1C07A 2LE9B 2M7LA 3VRNA 1DVIA 1YX8A 1OZSA 1EJ3A 3MSEB 4FQOA 5JOLA 1RK9A 4GBAA 2GGZA 5AANA 2OTGC 1B7TY 2LLUA 3RM1A 2F2PA 3NSKA 1KK7Y 1SNLA 2Y1MA 2FOTA 3NSLA 1IWQA 1MXLC 4C0JA 2CCMA 1UWOA 3FS7A 1CDLA 2KBIA 3HCMA 2IS9A 1Y1AA 3GK2A 4NDDA 1MQ1A 1PVAA 1DJGA 3EVRA 4PHKA 1YRUB 2OS8C 3CGAA 4GUKA 3EK4A 4ETOA 4GNKB 4PE0A 1OMDA 2JXCA 4HREE 2LP3A 2GGMA 3BUXB 3CWGA 1AHRA 2AMIA 1ZACA 1RECA 1UHNA 4PDZA 1M63B 1KWOB 4YGDB 4CFRA 1JF0A 2M0RA 3EVUA 5HLOA 2HF5A 1PSBA 3CR4X 2AUCA 1DJXA 1CMFA 4CIDA 1Q80A 4DCKA 5IBWA 1R2UA 1K8UA 2PSRA 4YGCB 3TDUA 1SL7A 1J55A 1SMGA 2FCDA 1J7RA 1S26D 2ZN9A 4YGAA 3TDZA 1XO5A 1N65A 1BU3A 1SPYA 2E30A 3WXAA 1MXEA 3FIAA 1RJVA 3A4UB 4WRIA 5CSFA 3F45A 2KAYA 4PHMA 1WRKA 2PMYA 2LVIA 2FCEA 1WY9A 1ZOTB 1QVIZ 1UHIA 1XVJA 5CPVA 1HT9A 5J3XA 4A4BA 1YUTA 1DT7B 2F8PA 2K2AA 1YUSA 2B1UA 2LMVA 2JT3A 3I5GC 1B7TZ 1TNWA 1MUXA 2BBNA 1B47A 2JULA 4MZLA 4USLA 1DF0A 1NX2A 3LLEA 1SW8A 3BOWA 4I5NB 1WDCB 3KHEA 1J7OA 1KWOC 2WC8A 5HKWA 5CSIA 1CFPA 1EL4A 3CR2A 3JVTB 3LK1A 2L4HA 4N1GA 4QJ5B 1KCYA 1CMGA 1PALA 1R6PA 1UHJA 2F3ZA 1IRJA 1GJYA 4MZJA 2CXJA 4I5LB 4MRXA 2L50A 5KSZA 2HQWA 2PASA 2K7CA 1MR8A 1TOPA 1OMRA 1J1EA 1N0YA 2KOTA 4MRYA 2PVBA 2JNXA 2KI4B 1BR4B 3BOWB 3GK1A 2LCPA 1KFXL 2JWWA 2M1KB 2DOQA 4JPZB 3ZNIA 1IKUA 2KFHA 4PE4A 2KYFA 4HSZA 1A75A 3WHTB 1SR6B 2P6BB 4PCWA 1SRAA 1IG5A 4WQ2A 2I18A 1QV0A 1B8CA 2KNEA 4A4CA 1CKKA 3DF0A 3PFVA 1B4CA 1F71A 2ISDA 1D1OA 4YGEB 1QX2A 1SK6D 2LMTA 1KQMB 1TIZA 1VRKA 1K90D 1ZMZA 2JNFA 3BUNB 1K93D 4PE1A 5CSJA 1NIWA 1JSAA 1BJFA 1L7ZA 4QJ4B 3VRPA 1XK4C 1AVSA 1U5IA 1WDCC 2Y1NA 3DD4A 4L9MA 4NQGA 1G4YR 1F8HA 1QX7A 3DVMA 3JVTC 2CBLA 3PM8A 1A75B 5PALA 1YUUA 2L5XB 1S3PA 2HETA 5DKQA 2LUCA 5GQQC 2M1UA 1B1GA 1F55A 2TN4A 3OB1B 3SG3A 1YRTB 2CTNA 3DF0B 1QLKA 3TUYB 1QVIY 5AERA 2FJUB 4OVNF 1S36A 1DTLA 1F4OA 1KFUL 2MLEC 1PK0D 1TTXA 2JRFA 2KI4C 1V1FA 2NZ0A 1DJIA 3NSOA 5I8NA 1CDPA 1CM1A 3H4SE 2MLFC 2EC6B 2KI6D 1K9PA 1SR6C 3AKAA 3SG7A 1C7VA 1L2OB 2JXLA 1LA3A 1ODBA 1KSMA 2M3WA 4JQ0D 4GPLB 3ICBA 4XYNA 3EKHA 1AJ4A 2KDHA 1K9KA 2K7OA 2WNDA 1CLMA 2MA2A 2RGIA 2BKHB 2K2FA 1F70A 1KQMC 2AAOA 4JWQA 5FYXA 1IJ6A 2KYCA 3I5HB 3BUMB 2L51A 2QACA 3KEVA 1B8LA 5D69A 2BBMA 2JT8A 2CT9A 5I2OA 1M31A 3FWBA 1QIVA 1QJTA 1TNPA 4GGNA 1CFDA 2LP2A 1JFKA 2A4JA 1NWDA 1YVLA 3GOFA 3I5FC 2Q4UA 1NX3A 2ZNEA 3O6BA 2G9BA 1QIWA 4C0KA 4OCIA 3AAKA 3LK0A 1CLBA 2ZRTA 1YR5A 2LUXA 4AQJA 4OR9B 2LAPA 1FBVA 1WRLA 4PALA 1IQ3A 3EKJA 2KBMA 4M2OA 4GGFA 2EC6C 1C7WA 2I7AA 1L2OC 1BOCA 1SY9A 2BKIB 2JU0A 3VRRA 1NCZA 2LM5A 2L0PA 3CTNA 1BF5A 2EGDA 1XFZO 2KGRA 4MLWA 2F2OA 2MJWB 2F33A 1CTRA 1LXFC 3PATA 4PE7A 3IF7A 3SG4A 5I2QA 1IQ5A 2HPSA 3VROA 5AEQA 3GK4X 2JZIA 1CLLA 2NCPA 3PSRA 1K95A 1NP8A 5HKZA 1BT6A 1QX5B 2BECA 2EHBA 2LLTA 2H61A 2KFFA 1XFWO 2WCEA 1EG3A 3SG5A 2JT0A 1NCXA 2Y4QA 4P5OE 2LVVA 3CZTX 2BE6A 2MAZA 5BPJA 1QLSA 1X02A 5KTYA 2LANA 3BXKA 1QV1A 3OX6A 3JTDB 1XFUO 1A29A 4CFQA 2I2RE 5ER4X 2MBXA 4I5KA 1M45A 2BE4A 3RLZA 3OX5A 1XFXO 4YI9A 1JC2A 3BYAA 3OB2B 3D10A 1DF0B 1NX0A 3WNXB 4BY5A 4AOMA 1MHOA 1NUBA 1K2HA 4CPVA 1AJ5A 2G2BA 2WCBA 5DKNA 1Y0VH 1J1DA 4HRGA 2R2IA 2K0JA 4ZCVA 1J7PA 5G08A 3ZWHA 4R1EA 3EVVA 2Y5IA 3WHUB 2K61A 1SL8A 2JOJA 2ZNDA 3K21A 1YX7A 1AK8A 1OMVA 1Y1XA 1ZUZA 2LLSA 2JQ6A 1H4BA 1F4QA 2HQ8A 2K7BA
chains in the Genus database with same CATH superfamily
1EH2A 3OHMB 4C0LA 2JPTA 2COLB 1M46A 4CLNA 4DUQA 2ZFDA 1IGVA 1WLMA 2L5YA 2BL0B 1CM4A 2OTGB 1PVBA 1OE9B 1DMOA 1JWDA 3IVTA 2LHLA 3JTDC 1JSAA 3BFBA 3OBVA 2L4IA 1BODA 1G8IA 3TZ1A 1XA5A 1Y1UA 2KQ6A 3O2PA 4DRWA 4YRUA 1FI6A 1WRZA 2QDIA 3BUOB 3D0YA 4OZDA 1SKTA 3QRXA 3A8RA 1U5IB 2O60A 4XJKA 2LVJA 1RTP1 4ORCB 4IL1A 1JFJA 1AP4A 1TUZA 1IH0A 2M97A 1KQVA 4KYNA 4GAOA 4YGBB 2O5GA 3OP0A 3TDIA 2BCAA 1OOIX 1PSRA 1GGWA 1RWYA 3CR5X 4BY4A 5HLVA 2KAVA 3O78A 4ORAB 4WQ3A 2L2EA 5TNCA 1J7QA 5HKYA 4DS7A 2M8UA 1W7IB 1K94A 1XFRA 4NDCA 3AKBA 4HRHA 1KK8B 4F7FA 4ICBA 1WLZA 5B8IB 1QS7A 1UURA 3CZ0A 3EK7A 4AQIA 4MBEA 3AAJA 3S0AA 2BL0C 4QJ3B 3DYEA 2KQYA 1YTZC 2QEOA 2SASA 1KSOA 3BQ3A 3EG5B 4MSPA 3I5IB 1ALVA 1XFYO 5KU1A 2Q91A 3TUYC 1H8BA 1DELA 2K8MB 2KHNA 5ER5A 1UHKA 1SCMB 1QATA 1QASA 5D7FA 2KAXA 1BLQA 1CB1A 1TUJA 4M2PA 4MN0A 2BCBA 2LNKA 1GQMA 5AXIA 5CSNA 3SIBA 2L98A 3DVEA 4N1FA 2LHIA 4D1EA 3BFAA 3HX4A 1N2DA 4OKHA 1RROA 1DJWA 3NSIA 1BMOA 1S5GZ 2M7NA 1ALWA 2SCPA 3DVJA 1IIOA 3I5GB 1TCOB 2KFGA 2QPTA 3O4YA 4ZCUA 1S1EA 2WORA 2MHHA 3CS1A 2ZKMX 3BFHA 2KPHA 3BUWB 3C1VA 2CNPA 3CYZA 1FF1A 1SCVA 2KLEA 1LA0A 2MRDA 1KK8C 3I5HC 1TNQA 2M29A 1A4PA 2PRUA 4TNCA 1HQVA 2KI6C 4U8DA 3SJSA 2NXQA 4YI8A 2E6WA 1DJHA 3PN7B 1FPWA 1SYMA 1K9UA 4JKTA 2VRGA 2M49B 3SIAA 1S6JA 4M2QA 1S6CA 3I5IC 1JF2A 1CDNA 4MEWA 5F6TA 1GGZA 1SCMC 3E3RA 4N5XA 1OQPA 1XK4A 1JUOA 5I2LA 1PRWA 2H2KA 1Z2CB 4Q04A 3DVKA 3SG2A 1TWOA 1FW4A 2GV5A 3V2LA 1KFXS 1DJZA 3VRQA 1UP5A 3CABA 4P2YB 1XYDA 1JBAA 1NYAA 1QTXA 1MF8B 2K7DA 2QEVA 3KPXA 1B9AA 1UHHA 1DGUA 5AFPA 2V53A 3TS5B 3VGOA 4MVFA 1KK7Z 3K1EA 2ZRSA 3R72A 3IQQA 3KO0A 1W9ZA 4UPGA 3IQOA 2BCXA 1OOJA 1TRFA 1PULA 2KGBC 1LVCD 1QXPA 1LKJA 1TCFA 4GGFC 2ZN8A 4DIRA 1K96A 1ZFSA 2JTZA 2PYQA 3KF9A 3PN7C 1A2XA 1XFVO 1V1GA 5HYDA 1FI5A 1S6IA 4ORBB 5K89A 1TNXA 2NCOA 1LINA 2WCHA 2LV7A 5JJGA 4PHNA 1A03A 1NCYA 2LC5A 3S0DA 1SBJA 3RZSA 2WOSA 1S5GY 3PLFB 1OZOA 2ERBA 1C3YA 4FTGA 4I5JA 1AUIB 1DJYA 3PALA 1EXRA 1M39A 2NLNA 3M0WA 5FI7A 3FE6A 1KFUS 1YURA 2JC2A 1UUSA 2LVKA 2WCFA 1SL9A 2PALA 3O4XA 3FWCA 1F54A 2D8NA 4NDBA 2I94A 3UNWA 1CFFA 1CNPA 1RFJA 2H61C 5DKRA 4MZKA 3NXAA 1CFCA 1Y6WA 2JTTA 3LCPC 1OW4A 1MWNA 1W7JB 1IJ5A 3SG6A 3CLNA 1DGVA 3TS5C 4GFTA 1E8AA 3PJIA 4YBHB 2OS8B 2LMUA 2K60A 1NPQA 1YVHA 4E68A 2L2CA 1NSHA 4OV2A 1G33A 4PHJA 2KSPA 1GM0A 1C3ZA 3Q8IA 1BR1B 3NGVA 1B8RA 4IJ7A 4F0ZB 1TN4A 2OPOA 3LL8B 3EK8A 1OSAA 1NX1A 3D0YB 3I5FB 2M9GA 2F3YA 1BG1A 1CDMA 4XJKB 1EG4A 1C07A 2LE9B 2M7LA 3VRNA 1DVIA 1YX8A 1OZSA 1EJ3A 3MSEB 4FQOA 5JOLA 1RK9A 4GBAA 2GGZA 5AANA 2OTGC 1B7TY 2LLUA 3RM1A 2F2PA 3NSKA 1KK7Y 1SNLA 2Y1MA 2FOTA 3NSLA 1IWQA 1MXLC 4C0JA 2CCMA 1UWOA 3FS7A 1CDLA 2KBIA 3HCMA 2IS9A 3DZTA 1Y1AA 3GK2A 4NDDA 1MQ1A 2KLDA 1PVAA 1DJGA 3EVRA 4PHKA 1YRUB 2OS8C 3CGAA 4GUKA 3EK4A 2BNXA 4ETOA 3D73A 4GNKB 4PE0A 1OMDA 2JXCA 4HREE 2LP3A 2GGMA 3BUXB 3CWGA 1AHRA 2AMIA 1ZACA 1RECA 1UHNA 4PDZA 1M63B 1KWOB 4YGDB 4CFRA 1JF0A 2M0RA 3EVUA 5HLOA 2HF5A 1PSBA 2WCJA 3CR4X 2AUCA 1LS8A 1DJXA 1CMFA 4CIDA 1Q80A 3CZ1A 3L47A 3NHIA 4DCKA 5IBWA 1R2UA 3D75A 1K8UA 1DEKA 2PSRA 4YGCB 3TDUA 1SL7A 1J55A 2WC6A 1SMGA 2FCDA 1J7RA 1S26D 2ZN9A 4YGAA 3TDZA 3D76A 1XO5A 1N65A 3R1PA 1BU3A 1DQEA 1SPYA 2E30A 3WXAA 1MXEA 3FIAA 1OOFA 3CZ2A 1RJVA 3A4UB 4WRIA 5CSFA 3F45A 2KAYA 4PHMA 5FI2A 1WRKA 2PMYA 2LVIA 2FCEA 1WY9A 1ZOTB 1QVIZ 1UHIA 1XVJA 5CPVA 1HT9A 3D78A 5J3XA 4A4BA 1YUTA 1DT7B 2F8PA 2K2AA 1YUSA 2B1UA 2LMVA 2JT3A 3I5GC 3DY9A 5I94A 1B7TZ 1TNWA 1MUXA 2BBNA 1B47A 2JULA 4MZLA 4USLA 1DF0A 1NX2A 3LLEA 1SW8A 3BOWA 4I5NB 1WDCB 3KHEA 1J7OA 1KWOC 2WC8A 5HKWA 5CSIA 1CFPA 3D74A 1EL4A 3CR2A 3B86A 3JVTB 2L4HA 3LK1A 4N1GA 4QJ5B 2H8VA 1KCYA 1CMGA 1PALA 1R6PA 1UHJA 3L4AA 2F3ZA 1IRJA 1GJYA 4MZJA 2CXJA 4I5LB 4MRXA 2L50A 5KSZA 2HQWA 2PASA 2K7CA 1MR8A 1TOPA 1OMRA 1J1EA 1N0YA 2KOTA 4MRYA 2PVBA 2QEHA 2JNXA 2KI4B 1BR4B 3BOWB 3GK1A 2LCPA 1KFXL 2JWWA 2M1KB 2DOQA 2WC5A 4JPZB 4INWA 3VB1A 3ZNIA 1IKUA 2KFHA 3SS3A 4PE4A 2KYFA 4HSZA 1A75A 3WHTB 5EL2A 1SR6B 2P6BB 4PCWA 1SRAA 1IG5A 4WQ2A 2I18A 1QV0A 1B8CA 2FJYA 2KNEA 3FE9A 4A4CA 3DF0A 3PFVA 3PM2A 1B4CA 2ISDA 1CKKA 1F71A 1D1OA 3B6XA 1QX2A 1SK6D 2LMTA 4YGEB 1KQMB 1TIZA 1VRKA 1K90D 1ZMZA 2JNFA 3BUNB 1K93D 2P70A 4PE1A 5CSJA 1NIWA 5DICA 1BJFA 1L7ZA 2WCKA 3VRPA 1XK4C 1AVSA 4QJ4B 1U5IA 1WDCC 2Y1NA 3DD4A 4L9MA 4NQGA 1G4YR 1F8HA 1QX7A 3DVMA 3B7AA 3JVTC 3CDNA 2CBLA 3PM8A 1A75B 5PALA 1YUUA 2L5XB 1S3PA 2WCMA 2HETA 5DKQA 2LUCA 5GQQC 5HL1A 2M1UA 1B1GA 1F55A 2TN4A 3OB1B 3SG3A 1YRTB 2CTNA 3DF0B 1QLKA 3TUYB 1QVIY 3SS5A 5AERA 2FJUB 2P71A 1S36A 4OVNF 1QWVA 1DTLA 1F4OA 1KFUL 2MLEC 1PK0D 1TTXA 2JRFA 2KI4C 1V1FA 3QMEA 2NZ0A 1DJIA 3NSOA 5I8NA 1CDPA 1CM1A 3H4SE 3R1VA 2MLFC 2EC6B 3UO9A 2KI6D 3FE8A 1K9PA 1SR6C 3AKAA 3BJHA 3SG7A 1L2OB 2JXLA 1C7VA 1LA3A 1ODBA 1KSMA 2M3WA 4JQ0D 4GPLB 3ICBA 4XYNA 3EKHA 1AJ4A 2KDHA 1K9KA 2K7OA 2WNDA 1CLMA 2MA2A 2RGIA 3B87A 2BKHB 2GTEA 2K2FA 3D77A 1F70A 1KQMC 2AAOA 4JWQA 5FYXA 1IJ6A 2KYCA 3I5HB 3BUMB 2L51A 2QACA 3S0GA 3KEVA 1B8LA 3SS4A 5D69A 2BBMA 2JT8A 2CT9A 5I2OA 1M31A 3FWBA 1QIVA 1QJTA 1TNPA 4GGNA 3S0FA 1CFDA 2LP2A 1JFKA 2A4JA 1NWDA 1YVLA 3GOFA 3I5FC 1DC1A 2Q4UA 1NX3A 2ZNEA 3B88A 2G9BA 3O6BA 1QIWA 4C0KA 4OCIA 3AAKA 3LK0A 1CLBA 2ZRTA 1YR5A 2LUXA 4FQTA 4AQJA 4OR9B 2LAPA 1FBVA 1WRLA 4PALA 1IQ3A 3S0BA 3EKJA 2KBMA 4M2OA 4GGFA 2EC6C 1C7WA 4INXA 2I7AA 1L2OC 1BOCA 1SSEB 1SY9A 2BKIB 2JU0A 3VRRA 1NCZA 2LM5A 2WCLA 2L0PA 3CTNA 1BF5A 2EGDA 1XFZO 2KGRA 4MLWA 2BAPA 2F2OA 2F33A 1CTRA 1LXFC 2MJWB 3PATA 4PE7A 3IF7A 3SG4A 5I2QA 1IQ5A 2HPSA 3VROA 3R1OA 5AEQA 3GK4X 2JZIA 1CLLA 2NCPA 3PSRA 1K95A 1NP8A 5HKZA 1BT6A 1QX5B 2BECA 3N7HA 2EHBA 2LLTA 3S0EA 2YGUA 2H61A 2KFFA 2QEBA 1XFWO 2WCEA 1EG3A 3SG5A 2JT0A 3NHTA 1NCXA 2Y4QA 4P5OE 2LVVA 3CZTX 1OOHA 2BE6A 2MAZA 5BPJA 1QLSA 1X02A 5KTYA 2LANA 3BXKA 1T14A 1QV1A 3OX6A 3JTDB 1OOGA 3OGNA 1XFUO 1A29A 4CFQA 2I2RE 5ER4X 2MBXA 3L4LA 4I5KA 1M45A 2BE4A 3RLZA 3OX5A 1ORGA 1XFXO 4YI9A 1JC2A 5D3OA 4PT1A 3BYAA 3OB2B 3D10A 1DF0B 1P28A 1NX0A 3WNXB 4BY5A 4AOMA 1MHOA 1NUBA 1K2HA 4CPVA 1AJ5A 2JPOA 2G2BA 2WCBA 5DKNA 1Y0VH 1J1DA 4HRGA 2R2IA 2K0JA 4ZCVA 1J7PA 5G08A 3DXLA 4R1EA 3ZWHA 4JD9A 3EVVA 2Y5IA 3WHUB 2K61A 1SL8A 2PQLA 2JOJA 2ZNDA 5FI6A 3K21A 1YX7A 1AK8A 1OMVA 1Y1XA 1ZUZA 1Z4HA 2LLSA 2JQ6A 1H4BA 1F4QA 2HQ8A 2K7BA
chains in the Genus database with same CATH topology
1EH2A 3OHMB 4C0LA 2JPTA 2COLB 1M46A 4CLNA 4DUQA 2ZFDA 1IGVA 1WLMA 2BL0B 1CM4A 2OTGB 1PVBA 1OE9B 1DMOA 1JWDA 2LHLA 3JTDC 2L4IA 1BODA 1G8IA 3TZ1A 1XA5A 1Y1UA 2KQ6A 3O2PA 4DRWA 4YRUA 1FI6A 1WRZA 3D0YA 3BUOB 1SKTA 3QRXA 3A8RA 1U5IB 2O60A 4XJKA 2LVJA 1RTP1 4ORCB 4IL1A 1JFJA 1AP4A 1IH0A 2M97A 1KQVA 4GAOA 4YGBB 2O5GA 3OP0A 3TDIA 2BCAA 1PSRA 1GGWA 1RWYA 3CR5X 4BY4A 5HLVA 2KAVA 3O78A 4ORAB 4WQ3A 2L2EA 5TNCA 1J7QA 5HKYA 4DS7A 2M8UA 1W7IB 1K94A 4NDCA 3AKBA 4HRHA 1KK8B 4ICBA 1WLZA 5B8IB 1QS7A 1UURA 3EK7A 4AQIA 4MBEA 3AAJA 2BL0C 4QJ3B 2KQYA 1YTZC 2SASA 1KSOA 3BQ3A 4MSPA 3I5IB 1ALVA 1XFYO 5KU1A 2Q91A 3TUYC 1H8BA 2K8MB 2KHNA 5ER5A 1UHKA 1SCMB 1QATA 1QASA 5D7FA 2KAXA 1BLQA 1CB1A 4M2PA 4MN0A 2BCBA 2LNKA 1GQMA 5AXIA 5CSNA 3SIBA 2L98A 3DVEA 4N1FA 2LHIA 4D1EA 3HX4A 1N2DA 4OKHA 1RROA 1DJWA 3NSIA 1BMOA 1S5GZ 2M7NA 1ALWA 2SCPA 3DVJA 3I5GB 1TCOB 2KFGA 2QPTA 3O4YA 4ZCUA 1S1EA 2WORA 2MHHA 3CS1A 2ZKMX 3BUWB 3C1VA 2CNPA 1FF1A 1SCVA 1LA0A 2MRDA 1KK8C 3I5HC 1TNQA 2M29A 1A4PA 2PRUA 4TNCA 1HQVA 2KI6C 4U8DA 3SJSA 2NXQA 4YI8A 2E6WA 1DJHA 3PN7B 1FPWA 1SYMA 1K9UA 2VRGA 2M49B 3SIAA 1S6JA 4M2QA 1S6CA 3I5IC 1JF2A 1CDNA 4MEWA 5F6TA 1GGZA 1SCMC 3E3RA 4N5XA 1OQPA 1XK4A 1JUOA 5I2LA 1PRWA 2H2KA 4Q04A 3DVKA 3SG2A 1FW4A 2GV5A 1KFXS 1DJZA 3VRQA 1UP5A 4P2YB 1XYDA 1JBAA 1NYAA 1QTXA 1MF8B 2K7DA 3KPXA 1B9AA 1UHHA 1DGUA 5AFPA 2V53A 3TS5B 3VGOA 4MVFA 1KK7Z 2ZRSA 3IQQA 3KO0A 4UPGA 3IQOA 2BCXA 1OOJA 1TRFA 1PULA 2KGBC 1LVCD 1QXPA 1LKJA 1TCFA 4GGFC 2ZN8A 4DIRA 1K96A 1ZFSA 2JTZA 3KF9A 3PN7C 1A2XA 1XFVO 1V1GA 5HYDA 1FI5A 1S6IA 4ORBB 5K89A 1TNXA 2NCOA 1LINA 2LV7A 5JJGA 4PHNA 1A03A 1NCYA 2LC5A 1SBJA 2WOSA 1S5GY 3PLFB 1OZOA 4FTGA 4I5JA 1AUIB 1DJYA 3PALA 1EXRA 1M39A 2NLNA 3M0WA 1KFUS 1YURA 2JC2A 1UUSA 2LVKA 2WCFA 1SL9A 2PALA 3FWCA 1F54A 2D8NA 4NDBA 2I94A 1CFFA 1CNPA 1RFJA 2H61C 5DKRA 4MZKA 3NXAA 1CFCA 1Y6WA 2JTTA 3LCPC 1MWNA 1W7JB 1IJ5A 3SG6A 3CLNA 1DGVA 3TS5C 4GFTA 1E8AA 4YBHB 2OS8B 2LMUA 1NPQA 1YVHA 4E68A 1NSHA 4OV2A 1G33A 4PHJA 2KSPA 1BR1B 1B8RA 4F0ZB 1TN4A 2OPOA 3LL8B 3EK8A 1OSAA 1NX1A 3D0YB 3I5FB 2M9GA 2F3YA 1BG1A 1CDMA 4XJKB 1EG4A 1C07A 2LE9B 2M7LA 3VRNA 1DVIA 1YX8A 1OZSA 1EJ3A 3MSEB 4FQOA 5JOLA 1RK9A 4GBAA 2GGZA 5AANA 2OTGC 1B7TY 2LLUA 3RM1A 2F2PA 3NSKA 1KK7Y 1SNLA 2Y1MA 2FOTA 3NSLA 1IWQA 1MXLC 4C0JA 2CCMA 1UWOA 3FS7A 1CDLA 2KBIA 3HCMA 2IS9A 1Y1AA 3GK2A 4NDDA 1MQ1A 1PVAA 1DJGA 3EVRA 4PHKA 1YRUB 2OS8C 3CGAA 4GUKA 3EK4A 4ETOA 4GNKB 4PE0A 1OMDA 2JXCA 4HREE 2LP3A 2GGMA 3BUXB 3CWGA 1AHRA 2AMIA 1ZACA 1RECA 1UHNA 4PDZA 1M63B 1KWOB 4YGDB 4CFRA 1JF0A 2M0RA 3EVUA 5HLOA 2HF5A 1PSBA 3CR4X 2AUCA 1DJXA 1CMFA 4CIDA 1Q80A 4DCKA 5IBWA 1R2UA 1K8UA 2PSRA 4YGCB 3TDUA 1SL7A 1J55A 1SMGA 2FCDA 1J7RA 1S26D 2ZN9A 4YGAA 3TDZA 1XO5A 1N65A 1BU3A 1SPYA 2E30A 3WXAA 1MXEA 3FIAA 1RJVA 3A4UB 4WRIA 5CSFA 3F45A 2KAYA 4PHMA 1WRKA 2PMYA 2LVIA 2FCEA 1WY9A 1ZOTB 1QVIZ 1UHIA 1XVJA 5CPVA 1HT9A 5J3XA 4A4BA 1YUTA 1DT7B 2F8PA 2K2AA 1YUSA 2B1UA 2LMVA 2JT3A 3I5GC 1B7TZ 1TNWA 1MUXA 2BBNA 1B47A 2JULA 4MZLA 4USLA 1DF0A 1NX2A 3LLEA 1SW8A 3BOWA 4I5NB 1WDCB 3KHEA 1J7OA 1KWOC 2WC8A 5HKWA 5CSIA 1CFPA 1EL4A 3CR2A 3JVTB 3LK1A 2L4HA 4N1GA 4QJ5B 1KCYA 1CMGA 1PALA 1R6PA 1UHJA 2F3ZA 1IRJA 1GJYA 4MZJA 2CXJA 4I5LB 4MRXA 2L50A 5KSZA 2HQWA 2PASA 2K7CA 1MR8A 1TOPA 1OMRA 1J1EA 1N0YA 2KOTA 4MRYA 2PVBA 2JNXA 2KI4B 1BR4B 3BOWB 3GK1A 2LCPA 1KFXL 2JWWA 2M1KB 2DOQA 4JPZB 3ZNIA 1IKUA 2KFHA 4PE4A 2KYFA 4HSZA 1A75A 3WHTB 1SR6B 2P6BB 4PCWA 1SRAA 1IG5A 4WQ2A 2I18A 1QV0A 1B8CA 2KNEA 4A4CA 1CKKA 3DF0A 3PFVA 1B4CA 1F71A 2ISDA 1D1OA 4YGEB 1QX2A 1SK6D 2LMTA 1KQMB 1TIZA 1VRKA 1K90D 1ZMZA 2JNFA 3BUNB 1K93D 4PE1A 5CSJA 1NIWA 1JSAA 1BJFA 1L7ZA 4QJ4B 3VRPA 1XK4C 1AVSA 1U5IA 1WDCC 2Y1NA 3DD4A 4L9MA 4NQGA 1G4YR 1F8HA 1QX7A 3DVMA 3JVTC 2CBLA 3PM8A 1A75B 5PALA 1YUUA 2L5XB 1S3PA 2HETA 5DKQA 2LUCA 5GQQC 2M1UA 1B1GA 1F55A 2TN4A 3OB1B 3SG3A 1YRTB 2CTNA 3DF0B 1QLKA 3TUYB 1QVIY 5AERA 2FJUB 4OVNF 1S36A 1DTLA 1F4OA 1KFUL 2MLEC 1PK0D 1TTXA 2JRFA 2KI4C 1V1FA 2NZ0A 1DJIA 3NSOA 5I8NA 1CDPA 1CM1A 3H4SE 2MLFC 2EC6B 2KI6D 1K9PA 1SR6C 3AKAA 3SG7A 1C7VA 1L2OB 2JXLA 1LA3A 1ODBA 1KSMA 2M3WA 4JQ0D 4GPLB 3ICBA 4XYNA 3EKHA 1AJ4A 2KDHA 1K9KA 2K7OA 2WNDA 1CLMA 2MA2A 2RGIA 2BKHB 2K2FA 1F70A 1KQMC 2AAOA 4JWQA 5FYXA 1IJ6A 2KYCA 3I5HB 3BUMB 2L51A 2QACA 3KEVA 1B8LA 5D69A 2BBMA 2JT8A 2CT9A 5I2OA 1M31A 3FWBA 1QIVA 1QJTA 1TNPA 4GGNA 1CFDA 2LP2A 1JFKA 2A4JA 1NWDA 1YVLA 3GOFA 3I5FC 2Q4UA 1NX3A 2ZNEA 3O6BA 2G9BA 1QIWA 4C0KA 4OCIA 3AAKA 3LK0A 1CLBA 2ZRTA 1YR5A 2LUXA 4AQJA 4OR9B 2LAPA 1FBVA 1WRLA 4PALA 1IQ3A 3EKJA 2KBMA 4M2OA 4GGFA 2EC6C 1C7WA 2I7AA 1L2OC 1BOCA 1SY9A 2BKIB 2JU0A 3VRRA 1NCZA 2LM5A 2L0PA 3CTNA 1BF5A 2EGDA 1XFZO 2KGRA 4MLWA 2F2OA 2MJWB 2F33A 1CTRA 1LXFC 3PATA 4PE7A 3IF7A 3SG4A 5I2QA 1IQ5A 2HPSA 3VROA 5AEQA 3GK4X 2JZIA 1CLLA 2NCPA 3PSRA 1K95A 1NP8A 5HKZA 1BT6A 1QX5B 2BECA 2EHBA 2LLTA 2H61A 2KFFA 1XFWO 2WCEA 1EG3A 3SG5A 2JT0A 1NCXA 2Y4QA 4P5OE 2LVVA 3CZTX 2BE6A 2MAZA 5BPJA 1QLSA 1X02A 5KTYA 2LANA 3BXKA 1QV1A 3OX6A 3JTDB 1XFUO 1A29A 4CFQA 2I2RE 5ER4X 2MBXA 4I5KA 1M45A 2BE4A 3RLZA 3OX5A 1XFXO 4YI9A 1JC2A 3BYAA 3OB2B 3D10A 1DF0B 1NX0A 3WNXB 4BY5A 4AOMA 1MHOA 1NUBA 1K2HA 4CPVA 1AJ5A 2G2BA 2WCBA 5DKNA 1Y0VH 1J1DA 4HRGA 2R2IA 2K0JA 4ZCVA 1J7PA 5G08A 3ZWHA 4R1EA 3EVVA 2Y5IA 3WHUB 2K61A 1SL8A 2JOJA 2ZNDA 3K21A 1YX7A 1AK8A 1OMVA 1Y1XA 1ZUZA 2LLSA 2JQ6A 1H4BA 1F4QA 2HQ8A 2K7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH2 A;  3OHM B;  4C0L A;  2JPT A;  2COL B;  1M46 A;  4CLN A;  4DUQ A;  2ZFD A;  1IGV A;  1WLM A;  2BL0 B;  1CM4 A;  2OTG B;  1PVB A;  1OE9 B;  1DMO A;  1JWD A;  2LHL A;  3JTD C;  2L4I A;  1BOD A;  1G8I A;  3TZ1 A;  1XA5 A;  1Y1U A;  2KQ6 A;  3O2P A;  4DRW A;  4YRU A;  1FI6 A;  1WRZ A;  3D0Y A;  3BUO B;  1SKT A;  3QRX A;  3A8R A;  1U5I B;  2O60 A;  4XJK A;  2LVJ A;  1RTP 1;  4ORC B;  4IL1 A;  1JFJ A;  1AP4 A;  1IH0 A;  2M97 A;  1KQV A;  4GAO A;  4YGB B;  2O5G A;  3OP0 A;  3TDI A;  2BCA A;  1PSR A;  1GGW A;  1RWY A;  3CR5 X;  4BY4 A;  5HLV A;  2KAV A;  3O78 A;  4ORA B;  4WQ3 A;  2L2E A;  5TNC A;  1J7Q A;  5HKY A;  4DS7 A;  2M8U A;  1W7I B;  1K94 A;  4NDC A;  3AKB A;  4HRH A;  1KK8 B;  4ICB A;  1WLZ A;  5B8I B;  1QS7 A;  1UUR A;  3EK7 A;  4AQI A;  4MBE A;  3AAJ A;  2BL0 C;  4QJ3 B;  2KQY A;  1YTZ C;  2SAS A;  1KSO A;  3BQ3 A;  4MSP A;  3I5I B;  1ALV A;  1XFY O;  5KU1 A;  2Q91 A;  3TUY C;  1H8B A;  2K8M B;  2KHN A;  5ER5 A;  1UHK A;  1SCM B;  1QAT A;  1QAS A;  5D7F A;  2KAX A;  1BLQ A;  1CB1 A;  4M2P A;  4MN0 A;  2BCB A;  2LNK A;  1GQM A;  5AXI A;  5CSN A;  3SIB A;  2L98 A;  3DVE A;  4N1F A;  2LHI A;  4D1E A;  3HX4 A;  1N2D A;  4OKH A;  1RRO A;  1DJW A;  3NSI A;  1BMO A;  1S5G Z;  2M7N A;  1ALW A;  2SCP A;  3DVJ A;  3I5G B;  1TCO B;  2KFG A;  2QPT A;  3O4Y A;  4ZCU A;  1S1E A;  2WOR A;  2MHH A;  3CS1 A;  2ZKM X;  3BUW B;  3C1V A;  2CNP A;  1FF1 A;  1SCV A;  1LA0 A;  2MRD A;  1KK8 C;  3I5H C;  1TNQ A;  2M29 A;  1A4P A;  2PRU A;  4TNC A;  1HQV A;  2KI6 C;  4U8D A;  3SJS A;  2NXQ A;  4YI8 A;  2E6W A;  1DJH A;  3PN7 B;  1FPW A;  1SYM A;  1K9U A;  2VRG A;  2M49 B;  3SIA A;  1S6J A;  4M2Q A;  1S6C A;  3I5I C;  1JF2 A;  1CDN A;  4MEW A;  5F6T A;  1GGZ A;  1SCM C;  3E3R A;  4N5X A;  1OQP A;  1XK4 A;  1JUO A;  5I2L A;  1PRW A;  2H2K A;  4Q04 A;  3DVK A;  3SG2 A;  1FW4 A;  2GV5 A;  1KFX S;  1DJZ A;  3VRQ A;  1UP5 A;  4P2Y B;  1XYD A;  1JBA A;  1NYA A;  1QTX A;  1MF8 B;  2K7D A;  3KPX A;  1B9A A;  1UHH A;  1DGU A;  5AFP A;  2V53 A;  3TS5 B;  3VGO A;  4MVF A;  1KK7 Z;  2ZRS A;  3IQQ A;  3KO0 A;  4UPG A;  3IQO A;  2BCX A;  1OOJ A;  1TRF A;  1PUL A;  2KGB C;  1LVC D;  1QXP A;  1LKJ A;  1TCF A;  4GGF C;  2ZN8 A;  4DIR A;  1K96 A;  1ZFS A;  2JTZ A;  3KF9 A;  3PN7 C;  1A2X A;  1XFV O;  1V1G A;  5HYD A;  1FI5 A;  1S6I A;  4ORB B;  5K89 A;  1TNX A;  2NCO A;  1LIN A;  2LV7 A;  5JJG A;  4PHN A;  1A03 A;  1NCY A;  2LC5 A;  1SBJ A;  2WOS A;  1S5G Y;  3PLF B;  1OZO A;  4FTG A;  4I5J A;  1AUI B;  1DJY A;  3PAL A;  1EXR A;  1M39 A;  2NLN A;  3M0W A;  1KFU S;  1YUR A;  2JC2 A;  1UUS A;  2LVK A;  2WCF A;  1SL9 A;  2PAL A;  3FWC A;  1F54 A;  2D8N A;  4NDB A;  2I94 A;  1CFF A;  1CNP A;  1RFJ A;  2H61 C;  5DKR A;  4MZK A;  3NXA A;  1CFC A;  1Y6W A;  2JTT A;  3LCP C;  1MWN A;  1W7J B;  1IJ5 A;  3SG6 A;  3CLN A;  1DGV A;  3TS5 C;  4GFT A;  1E8A A;  4YBH B;  2OS8 B;  2LMU A;  1NPQ A;  1YVH A;  4E68 A;  1NSH A;  4OV2 A;  1G33 A;  4PHJ A;  2KSP A;  1BR1 B;  1B8R A;  4F0Z B;  1TN4 A;  2OPO A;  3LL8 B;  3EK8 A;  1OSA A;  1NX1 A;  3D0Y B;  3I5F B;  2M9G A;  2F3Y A;  1BG1 A;  1CDM A;  4XJK B;  1EG4 A;  1C07 A;  2LE9 B;  2M7L A;  3VRN A;  1DVI A;  1YX8 A;  1OZS A;  1EJ3 A;  3MSE B;  4FQO A;  5JOL A;  1RK9 A;  4GBA A;  2GGZ A;  5AAN A;  2OTG C;  1B7T Y;  2LLU A;  3RM1 A;  2F2P A;  3NSK A;  1KK7 Y;  1SNL A;  2Y1M A;  2FOT A;  3NSL A;  1IWQ A;  1MXL C;  4C0J A;  2CCM A;  1UWO A;  3FS7 A;  1CDL A;  2KBI A;  3HCM A;  2IS9 A;  1Y1A A;  3GK2 A;  4NDD A;  1MQ1 A;  1PVA A;  1DJG A;  3EVR A;  4PHK A;  1YRU B;  2OS8 C;  3CGA A;  4GUK A;  3EK4 A;  4ETO A;  4GNK B;  4PE0 A;  1OMD A;  2JXC A;  4HRE E;  2LP3 A;  2GGM A;  3BUX B;  3CWG A;  1AHR A;  2AMI A;  1ZAC A;  1REC A;  1UHN A;  4PDZ A;  1M63 B;  1KWO B;  4YGD B;  4CFR A;  1JF0 A;  2M0R A;  3EVU A;  5HLO A;  2HF5 A;  1PSB A;  3CR4 X;  2AUC A;  1DJX A;  1CMF A;  4CID A;  1Q80 A;  4DCK A;  5IBW A;  1R2U A;  1K8U A;  2PSR A;  4YGC B;  3TDU A;  1SL7 A;  1J55 A;  1SMG A;  2FCD A;  1J7R A;  1S26 D;  2ZN9 A;  4YGA A;  3TDZ A;  1XO5 A;  1N65 A;  1BU3 A;  1SPY A;  2E30 A;  3WXA A;  1MXE A;  3FIA A;  1RJV A;  3A4U B;  4WRI A;  5CSF A;  3F45 A;  2KAY A;  4PHM A;  1WRK A;  2PMY A;  2LVI A;  2FCE A;  1WY9 A;  1ZOT B;  1QVI Z;  1UHI A;  1XVJ A;  5CPV A;  1HT9 A;  5J3X A;  4A4B A;  1YUT A;  1DT7 B;  2F8P A;  2K2A A;  1YUS A;  2B1U A;  2LMV A;  2JT3 A;  3I5G C;  1B7T Z;  1TNW A;  1MUX A;  2BBN A;  1B47 A;  2JUL A;  4MZL A;  4USL A;  1DF0 A;  1NX2 A;  3LLE A;  1SW8 A;  3BOW A;  4I5N B;  1WDC B;  3KHE A;  1J7O A;  1KWO C;  2WC8 A;  5HKW A;  5CSI A;  1CFP A;  1EL4 A;  3CR2 A;  3JVT B;  3LK1 A;  2L4H A;  4N1G A;  4QJ5 B;  1KCY A;  1CMG A;  1PAL A;  1R6P A;  1UHJ A;  2F3Z A;  1IRJ A;  1GJY A;  4MZJ A;  2CXJ A;  4I5L B;  4MRX A;  2L50 A;  5KSZ A;  2HQW A;  2PAS A;  2K7C A;  1MR8 A;  1TOP A;  1OMR A;  1J1E A;  1N0Y A;  2KOT A;  4MRY A;  2PVB A;  2JNX A;  2KI4 B;  1BR4 B;  3BOW B;  3GK1 A;  2LCP A;  1KFX L;  2JWW A;  2M1K B;  2DOQ A;  4JPZ B;  3ZNI A;  1IKU A;  2KFH A;  4PE4 A;  2KYF A;  4HSZ A;  1A75 A;  3WHT B;  1SR6 B;  2P6B B;  4PCW A;  1SRA A;  1IG5 A;  4WQ2 A;  2I18 A;  1QV0 A;  1B8C A;  2KNE A;  4A4C A;  1CKK A;  3DF0 A;  3PFV A;  1B4C A;  1F71 A;  2ISD A;  1D1O A;  4YGE B;  1QX2 A;  1SK6 D;  2LMT A;  1KQM B;  1TIZ A;  1VRK A;  1K90 D;  1ZMZ A;  2JNF A;  3BUN B;  1K93 D;  4PE1 A;  5CSJ A;  1NIW A;  1JSA A;  1BJF A;  1L7Z A;  4QJ4 B;  3VRP A;  1XK4 C;  1AVS A;  1U5I A;  1WDC C;  2Y1N A;  3DD4 A;  4L9M A;  4NQG A;  1G4Y R;  1F8H A;  1QX7 A;  3DVM A;  3JVT C;  2CBL A;  3PM8 A;  1A75 B;  5PAL A;  1YUU A;  2L5X B;  1S3P A;  2HET A;  5DKQ A;  2LUC A;  5GQQ C;  2M1U A;  1B1G A;  1F55 A;  2TN4 A;  3OB1 B;  3SG3 A;  1YRT B;  2CTN A;  3DF0 B;  1QLK A;  3TUY B;  1QVI Y;  5AER A;  2FJU B;  4OVN F;  1S36 A;  1DTL A;  1F4O A;  1KFU L;  2MLE C;  1PK0 D;  1TTX A;  2JRF A;  2KI4 C;  1V1F A;  2NZ0 A;  1DJI A;  3NSO A;  5I8N A;  1CDP A;  1CM1 A;  3H4S E;  2MLF C;  2EC6 B;  2KI6 D;  1K9P A;  1SR6 C;  3AKA A;  3SG7 A;  1C7V A;  1L2O B;  2JXL A;  1LA3 A;  1ODB A;  1KSM A;  2M3W A;  4JQ0 D;  4GPL B;  3ICB A;  4XYN A;  3EKH A;  1AJ4 A;  2KDH A;  1K9K A;  2K7O A;  2WND A;  1CLM A;  2MA2 A;  2RGI A;  2BKH B;  2K2F A;  1F70 A;  1KQM C;  2AAO A;  4JWQ A;  5FYX A;  1IJ6 A;  2KYC A;  3I5H B;  3BUM B;  2L51 A;  2QAC A;  3KEV A;  1B8L A;  5D69 A;  2BBM A;  2JT8 A;  2CT9 A;  5I2O A;  1M31 A;  3FWB A;  1QIV A;  1QJT A;  1TNP A;  4GGN A;  1CFD A;  2LP2 A;  1JFK A;  2A4J A;  1NWD A;  1YVL A;  3GOF A;  3I5F C;  2Q4U A;  1NX3 A;  2ZNE A;  3O6B A;  2G9B A;  1QIW A;  4C0K A;  4OCI A;  3AAK A;  3LK0 A;  1CLB A;  2ZRT A;  1YR5 A;  2LUX A;  4AQJ A;  4OR9 B;  2LAP A;  1FBV A;  1WRL A;  4PAL A;  1IQ3 A;  3EKJ A;  2KBM A;  4M2O A;  4GGF A;  2EC6 C;  1C7W A;  2I7A A;  1L2O C;  1BOC A;  1SY9 A;  2BKI B;  2JU0 A;  3VRR A;  1NCZ A;  2LM5 A;  2L0P A;  3CTN A;  1BF5 A;  2EGD A;  1XFZ O;  2KGR A;  4MLW A;  2F2O A;  2MJW B;  2F33 A;  1CTR A;  1LXF C;  3PAT A;  4PE7 A;  3IF7 A;  3SG4 A;  5I2Q A;  1IQ5 A;  2HPS A;  3VRO A;  5AEQ A;  3GK4 X;  2JZI A;  1CLL A;  2NCP A;  3PSR A;  1K95 A;  1NP8 A;  5HKZ A;  1BT6 A;  1QX5 B;  2BEC A;  2EHB A;  2LLT A;  2H61 A;  2KFF A;  1XFW O;  2WCE A;  1EG3 A;  3SG5 A;  2JT0 A;  1NCX A;  2Y4Q A;  4P5O E;  2LVV A;  3CZT X;  2BE6 A;  2MAZ A;  5BPJ A;  1QLS A;  1X02 A;  5KTY A;  2LAN A;  3BXK A;  1QV1 A;  3OX6 A;  3JTD B;  1XFU O;  1A29 A;  4CFQ A;  2I2R E;  5ER4 X;  2MBX A;  4I5K A;  1M45 A;  2BE4 A;  3RLZ A;  3OX5 A;  1XFX O;  4YI9 A;  1JC2 A;  3BYA A;  3OB2 B;  3D10 A;  1DF0 B;  1NX0 A;  3WNX B;  4BY5 A;  4AOM A;  1MHO A;  1NUB A;  1K2H A;  4CPV A;  1AJ5 A;  2G2B A;  2WCB A;  5DKN A;  1Y0V H;  1J1D A;  4HRG A;  2R2I A;  2K0J A;  4ZCV A;  1J7P A;  5G08 A;  3ZWH A;  4R1E A;  3EVV A;  2Y5I A;  3WHU B;  2K61 A;  1SL8 A;  2JOJ A;  2ZND A;  3K21 A;  1YX7 A;  1AK8 A;  1OMV A;  1Y1X A;  1ZUZ A;  2LLS A;  2JQ6 A;  1H4B A;  1F4Q A;  2HQ8 A;  2K7B A; 
#chains in the Genus database with same CATH topology
 1EH2 A;  3OHM B;  4C0L A;  2JPT A;  2COL B;  1M46 A;  4CLN A;  4DUQ A;  2ZFD A;  1IGV A;  1WLM A;  2L5Y A;  2BL0 B;  1CM4 A;  2OTG B;  1PVB A;  1OE9 B;  1DMO A;  1JWD A;  3IVT A;  2LHL A;  3JTD C;  1JSA A;  3BFB A;  3OBV A;  2L4I A;  1BOD A;  1G8I A;  3TZ1 A;  1XA5 A;  1Y1U A;  2KQ6 A;  3O2P A;  4DRW A;  4YRU A;  1FI6 A;  1WRZ A;  2QDI A;  3BUO B;  3D0Y A;  4OZD A;  1SKT A;  3QRX A;  3A8R A;  1U5I B;  2O60 A;  4XJK A;  2LVJ A;  1RTP 1;  4ORC B;  4IL1 A;  1JFJ A;  1AP4 A;  1TUZ A;  1IH0 A;  2M97 A;  1KQV A;  4KYN A;  4GAO A;  4YGB B;  2O5G A;  3OP0 A;  3TDI A;  2BCA A;  1OOI X;  1PSR A;  1GGW A;  1RWY A;  3CR5 X;  4BY4 A;  5HLV A;  2KAV A;  3O78 A;  4ORA B;  4WQ3 A;  2L2E A;  5TNC A;  1J7Q A;  5HKY A;  4DS7 A;  2M8U A;  1W7I B;  1K94 A;  1XFR A;  4NDC A;  3AKB A;  4HRH A;  1KK8 B;  4F7F A;  4ICB A;  1WLZ A;  5B8I B;  1QS7 A;  1UUR A;  3CZ0 A;  3EK7 A;  4AQI A;  4MBE A;  3AAJ A;  3S0A A;  2BL0 C;  4QJ3 B;  3DYE A;  2KQY A;  1YTZ C;  2QEO A;  2SAS A;  1KSO A;  3BQ3 A;  3EG5 B;  4MSP A;  3I5I B;  1ALV A;  1XFY O;  5KU1 A;  2Q91 A;  3TUY C;  1H8B A;  1DEL A;  2K8M B;  2KHN A;  5ER5 A;  1UHK A;  1SCM B;  1QAT A;  1QAS A;  5D7F A;  2KAX A;  1BLQ A;  1CB1 A;  1TUJ A;  4M2P A;  4MN0 A;  2BCB A;  2LNK A;  1GQM A;  5AXI A;  5CSN A;  3SIB A;  2L98 A;  3DVE A;  4N1F A;  2LHI A;  4D1E A;  3BFA A;  3HX4 A;  1N2D A;  4OKH A;  1RRO A;  1DJW A;  3NSI A;  1BMO A;  1S5G Z;  2M7N A;  1ALW A;  2SCP A;  3DVJ A;  1IIO A;  3I5G B;  1TCO B;  2KFG A;  2QPT A;  3O4Y A;  4ZCU A;  1S1E A;  2WOR A;  2MHH A;  3CS1 A;  2ZKM X;  3BFH A;  2KPH A;  3BUW B;  3C1V A;  2CNP A;  3CYZ A;  1FF1 A;  1SCV A;  2KLE A;  1LA0 A;  2MRD A;  1KK8 C;  3I5H C;  1TNQ A;  2M29 A;  1A4P A;  2PRU A;  4TNC A;  1HQV A;  2KI6 C;  4U8D A;  3SJS A;  2NXQ A;  4YI8 A;  2E6W A;  1DJH A;  3PN7 B;  1FPW A;  1SYM A;  1K9U A;  4JKT A;  2VRG A;  2M49 B;  3SIA A;  1S6J A;  4M2Q A;  1S6C A;  3I5I C;  1JF2 A;  1CDN A;  4MEW A;  5F6T A;  1GGZ A;  1SCM C;  3E3R A;  4N5X A;  1OQP A;  1XK4 A;  1JUO A;  5I2L A;  1PRW A;  2H2K A;  1Z2C B;  4Q04 A;  3DVK A;  3SG2 A;  1TWO A;  1FW4 A;  2GV5 A;  3V2L A;  1KFX S;  1DJZ A;  3VRQ A;  1UP5 A;  3CAB A;  4P2Y B;  1XYD A;  1JBA A;  1NYA A;  1QTX A;  1MF8 B;  2K7D A;  2QEV A;  3KPX A;  1B9A A;  1UHH A;  1DGU A;  5AFP A;  2V53 A;  3TS5 B;  3VGO A;  4MVF A;  1KK7 Z;  3K1E A;  2ZRS A;  3R72 A;  3IQQ A;  3KO0 A;  1W9Z A;  4UPG A;  3IQO A;  2BCX A;  1OOJ A;  1TRF A;  1PUL A;  2KGB C;  1LVC D;  1QXP A;  1LKJ A;  1TCF A;  4GGF C;  2ZN8 A;  4DIR A;  1K96 A;  1ZFS A;  2JTZ A;  2PYQ A;  3KF9 A;  3PN7 C;  1A2X A;  1XFV O;  1V1G A;  5HYD A;  1FI5 A;  1S6I A;  4ORB B;  5K89 A;  1TNX A;  2NCO A;  1LIN A;  2WCH A;  2LV7 A;  5JJG A;  4PHN A;  1A03 A;  1NCY A;  2LC5 A;  3S0D A;  1SBJ A;  3RZS A;  2WOS A;  1S5G Y;  3PLF B;  1OZO A;  2ERB A;  1C3Y A;  4FTG A;  4I5J A;  1AUI B;  1DJY A;  3PAL A;  1EXR A;  1M39 A;  2NLN A;  3M0W A;  5FI7 A;  3FE6 A;  1KFU S;  1YUR A;  2JC2 A;  1UUS A;  2LVK A;  2WCF A;  1SL9 A;  2PAL A;  3O4X A;  3FWC A;  1F54 A;  2D8N A;  4NDB A;  2I94 A;  3UNW A;  1CFF A;  1CNP A;  1RFJ A;  2H61 C;  5DKR A;  4MZK A;  3NXA A;  1CFC A;  1Y6W A;  2JTT A;  3LCP C;  1OW4 A;  1MWN A;  1W7J B;  1IJ5 A;  3SG6 A;  3CLN A;  1DGV A;  3TS5 C;  4GFT A;  1E8A A;  3PJI A;  4YBH B;  2OS8 B;  2LMU A;  2K60 A;  1NPQ A;  1YVH A;  4E68 A;  2L2C A;  1NSH A;  4OV2 A;  1G33 A;  4PHJ A;  2KSP A;  1GM0 A;  1C3Z A;  3Q8I A;  1BR1 B;  3NGV A;  1B8R A;  4IJ7 A;  4F0Z B;  1TN4 A;  2OPO A;  3LL8 B;  3EK8 A;  1OSA A;  1NX1 A;  3D0Y B;  3I5F B;  2M9G A;  2F3Y A;  1BG1 A;  1CDM A;  4XJK B;  1EG4 A;  1C07 A;  2LE9 B;  2M7L A;  3VRN A;  1DVI A;  1YX8 A;  1OZS A;  1EJ3 A;  3MSE B;  4FQO A;  5JOL A;  1RK9 A;  4GBA A;  2GGZ A;  5AAN A;  2OTG C;  1B7T Y;  2LLU A;  3RM1 A;  2F2P A;  3NSK A;  1KK7 Y;  1SNL A;  2Y1M A;  2FOT A;  3NSL A;  1IWQ A;  1MXL C;  4C0J A;  2CCM A;  1UWO A;  3FS7 A;  1CDL A;  2KBI A;  3HCM A;  2IS9 A;  3DZT A;  1Y1A A;  3GK2 A;  4NDD A;  1MQ1 A;  2KLD A;  1PVA A;  1DJG A;  3EVR A;  4PHK A;  1YRU B;  2OS8 C;  3CGA A;  4GUK A;  3EK4 A;  2BNX A;  4ETO A;  3D73 A;  4GNK B;  4PE0 A;  1OMD A;  2JXC A;  4HRE E;  2LP3 A;  2GGM A;  3BUX B;  3CWG A;  1AHR A;  2AMI A;  1ZAC A;  1REC A;  1UHN A;  4PDZ A;  1M63 B;  1KWO B;  4YGD B;  4CFR A;  1JF0 A;  2M0R A;  3EVU A;  5HLO A;  2HF5 A;  1PSB A;  2WCJ A;  3CR4 X;  2AUC A;  1LS8 A;  1DJX A;  1CMF A;  4CID A;  1Q80 A;  3CZ1 A;  3L47 A;  3NHI A;  4DCK A;  5IBW A;  1R2U A;  3D75 A;  1K8U A;  1DEK A;  2PSR A;  4YGC B;  3TDU A;  1SL7 A;  1J55 A;  2WC6 A;  1SMG A;  2FCD A;  1J7R A;  1S26 D;  2ZN9 A;  4YGA A;  3TDZ A;  3D76 A;  1XO5 A;  1N65 A;  3R1P A;  1BU3 A;  1DQE A;  1SPY A;  2E30 A;  3WXA A;  1MXE A;  3FIA A;  1OOF A;  3CZ2 A;  1RJV A;  3A4U B;  4WRI A;  5CSF A;  3F45 A;  2KAY A;  4PHM A;  5FI2 A;  1WRK A;  2PMY A;  2LVI A;  2FCE A;  1WY9 A;  1ZOT B;  1QVI Z;  1UHI A;  1XVJ A;  5CPV A;  1HT9 A;  3D78 A;  5J3X A;  4A4B A;  1YUT A;  1DT7 B;  2F8P A;  2K2A A;  1YUS A;  2B1U A;  2LMV A;  2JT3 A;  3I5G C;  3DY9 A;  5I94 A;  1B7T Z;  1TNW A;  1MUX A;  2BBN A;  1B47 A;  2JUL A;  4MZL A;  4USL A;  1DF0 A;  1NX2 A;  3LLE A;  1SW8 A;  3BOW A;  4I5N B;  1WDC B;  3KHE A;  1J7O A;  1KWO C;  2WC8 A;  5HKW A;  5CSI A;  1CFP A;  3D74 A;  1EL4 A;  3CR2 A;  3B86 A;  3JVT B;  2L4H A;  3LK1 A;  4N1G A;  4QJ5 B;  2H8V A;  1KCY A;  1CMG A;  1PAL A;  1R6P A;  1UHJ A;  3L4A A;  2F3Z A;  1IRJ A;  1GJY A;  4MZJ A;  2CXJ A;  4I5L B;  4MRX A;  2L50 A;  5KSZ A;  2HQW A;  2PAS A;  2K7C A;  1MR8 A;  1TOP A;  1OMR A;  1J1E A;  1N0Y A;  2KOT A;  4MRY A;  2PVB A;  2QEH A;  2JNX A;  2KI4 B;  1BR4 B;  3BOW B;  3GK1 A;  2LCP A;  1KFX L;  2JWW A;  2M1K B;  2DOQ A;  2WC5 A;  4JPZ B;  4INW A;  3VB1 A;  3ZNI A;  1IKU A;  2KFH A;  3SS3 A;  4PE4 A;  2KYF A;  4HSZ A;  1A75 A;  3WHT B;  5EL2 A;  1SR6 B;  2P6B B;  4PCW A;  1SRA A;  1IG5 A;  4WQ2 A;  2I18 A;  1QV0 A;  1B8C A;  2FJY A;  2KNE A;  3FE9 A;  4A4C A;  3DF0 A;  3PFV A;  3PM2 A;  1B4C A;  2ISD A;  1CKK A;  1F71 A;  1D1O A;  3B6X A;  1QX2 A;  1SK6 D;  2LMT A;  4YGE B;  1KQM B;  1TIZ A;  1VRK A;  1K90 D;  1ZMZ A;  2JNF A;  3BUN B;  1K93 D;  2P70 A;  4PE1 A;  5CSJ A;  1NIW A;  5DIC A;  1BJF A;  1L7Z A;  2WCK A;  3VRP A;  1XK4 C;  1AVS A;  4QJ4 B;  1U5I A;  1WDC C;  2Y1N A;  3DD4 A;  4L9M A;  4NQG A;  1G4Y R;  1F8H A;  1QX7 A;  3DVM A;  3B7A A;  3JVT C;  3CDN A;  2CBL A;  3PM8 A;  1A75 B;  5PAL A;  1YUU A;  2L5X B;  1S3P A;  2WCM A;  2HET A;  5DKQ A;  2LUC A;  5GQQ C;  5HL1 A;  2M1U A;  1B1G A;  1F55 A;  2TN4 A;  3OB1 B;  3SG3 A;  1YRT B;  2CTN A;  3DF0 B;  1QLK A;  3TUY B;  1QVI Y;  3SS5 A;  5AER A;  2FJU B;  2P71 A;  1S36 A;  4OVN F;  1QWV A;  1DTL A;  1F4O A;  1KFU L;  2MLE C;  1PK0 D;  1TTX A;  2JRF A;  2KI4 C;  1V1F A;  3QME A;  2NZ0 A;  1DJI A;  3NSO A;  5I8N A;  1CDP A;  1CM1 A;  3H4S E;  3R1V A;  2MLF C;  2EC6 B;  3UO9 A;  2KI6 D;  3FE8 A;  1K9P A;  1SR6 C;  3AKA A;  3BJH A;  3SG7 A;  1L2O B;  2JXL A;  1C7V A;  1LA3 A;  1ODB A;  1KSM A;  2M3W A;  4JQ0 D;  4GPL B;  3ICB A;  4XYN A;  3EKH A;  1AJ4 A;  2KDH A;  1K9K A;  2K7O A;  2WND A;  1CLM A;  2MA2 A;  2RGI A;  3B87 A;  2BKH B;  2GTE A;  2K2F A;  3D77 A;  1F70 A;  1KQM C;  2AAO A;  4JWQ A;  5FYX A;  1IJ6 A;  2KYC A;  3I5H B;  3BUM B;  2L51 A;  2QAC A;  3S0G A;  3KEV A;  1B8L A;  3SS4 A;  5D69 A;  2BBM A;  2JT8 A;  2CT9 A;  5I2O A;  1M31 A;  3FWB A;  1QIV A;  1QJT A;  1TNP A;  4GGN A;  3S0F A;  1CFD A;  2LP2 A;  1JFK A;  2A4J A;  1NWD A;  1YVL A;  3GOF A;  3I5F C;  1DC1 A;  2Q4U A;  1NX3 A;  2ZNE A;  3B88 A;  2G9B A;  3O6B A;  1QIW A;  4C0K A;  4OCI A;  3AAK A;  3LK0 A;  1CLB A;  2ZRT A;  1YR5 A;  2LUX A;  4FQT A;  4AQJ A;  4OR9 B;  2LAP A;  1FBV A;  1WRL A;  4PAL A;  1IQ3 A;  3S0B A;  3EKJ A;  2KBM A;  4M2O A;  4GGF A;  2EC6 C;  1C7W A;  4INX A;  2I7A A;  1L2O C;  1BOC A;  1SSE B;  1SY9 A;  2BKI B;  2JU0 A;  3VRR A;  1NCZ A;  2LM5 A;  2WCL A;  2L0P A;  3CTN A;  1BF5 A;  2EGD A;  1XFZ O;  2KGR A;  4MLW A;  2BAP A;  2F2O A;  2F33 A;  1CTR A;  1LXF C;  2MJW B;  3PAT A;  4PE7 A;  3IF7 A;  3SG4 A;  5I2Q A;  1IQ5 A;  2HPS A;  3VRO A;  3R1O A;  5AEQ A;  3GK4 X;  2JZI A;  1CLL A;  2NCP A;  3PSR A;  1K95 A;  1NP8 A;  5HKZ A;  1BT6 A;  1QX5 B;  2BEC A;  3N7H A;  2EHB A;  2LLT A;  3S0E A;  2YGU A;  2H61 A;  2KFF A;  2QEB A;  1XFW O;  2WCE A;  1EG3 A;  3SG5 A;  2JT0 A;  3NHT A;  1NCX A;  2Y4Q A;  4P5O E;  2LVV A;  3CZT X;  1OOH A;  2BE6 A;  2MAZ A;  5BPJ A;  1QLS A;  1X02 A;  5KTY A;  2LAN A;  3BXK A;  1T14 A;  1QV1 A;  3OX6 A;  3JTD B;  1OOG A;  3OGN A;  1XFU O;  1A29 A;  4CFQ A;  2I2R E;  5ER4 X;  2MBX A;  3L4L A;  4I5K A;  1M45 A;  2BE4 A;  3RLZ A;  3OX5 A;  1ORG A;  1XFX O;  4YI9 A;  1JC2 A;  5D3O A;  4PT1 A;  3BYA A;  3OB2 B;  3D10 A;  1DF0 B;  1P28 A;  1NX0 A;  3WNX B;  4BY5 A;  4AOM A;  1MHO A;  1NUB A;  1K2H A;  4CPV A;  1AJ5 A;  2JPO A;  2G2B A;  2WCB A;  5DKN A;  1Y0V H;  1J1D A;  4HRG A;  2R2I A;  2K0J A;  4ZCV A;  1J7P A;  5G08 A;  3DXL A;  4R1E A;  3ZWH A;  4JD9 A;  3EVV A;  2Y5I A;  3WHU B;  2K61 A;  1SL8 A;  2PQL A;  2JOJ A;  2ZND A;  5FI6 A;  3K21 A;  1YX7 A;  1AK8 A;  1OMV A;  1Y1X A;  1ZUZ A;  1Z4H A;  2LLS A;  2JQ6 A;  1H4B A;  1F4Q A;  2HQ8 A;  2K7B A; 
#chains in the Genus database with same CATH homology
 1EH2 A;  3OHM B;  4C0L A;  2JPT A;  2COL B;  1M46 A;  4CLN A;  4DUQ A;  2ZFD A;  1IGV A;  1WLM A;  2BL0 B;  1CM4 A;  2OTG B;  1PVB A;  1OE9 B;  1DMO A;  1JWD A;  2LHL A;  3JTD C;  2L4I A;  1BOD A;  1G8I A;  3TZ1 A;  1XA5 A;  1Y1U A;  2KQ6 A;  3O2P A;  4DRW A;  4YRU A;  1FI6 A;  1WRZ A;  3D0Y A;  3BUO B;  1SKT A;  3QRX A;  3A8R A;  1U5I B;  2O60 A;  4XJK A;  2LVJ A;  1RTP 1;  4ORC B;  4IL1 A;  1JFJ A;  1AP4 A;  1IH0 A;  2M97 A;  1KQV A;  4GAO A;  4YGB B;  2O5G A;  3OP0 A;  3TDI A;  2BCA A;  1PSR A;  1GGW A;  1RWY A;  3CR5 X;  4BY4 A;  5HLV A;  2KAV A;  3O78 A;  4ORA B;  4WQ3 A;  2L2E A;  5TNC A;  1J7Q A;  5HKY A;  4DS7 A;  2M8U A;  1W7I B;  1K94 A;  4NDC A;  3AKB A;  4HRH A;  1KK8 B;  4ICB A;  1WLZ A;  5B8I B;  1QS7 A;  1UUR A;  3EK7 A;  4AQI A;  4MBE A;  3AAJ A;  2BL0 C;  4QJ3 B;  2KQY A;  1YTZ C;  2SAS A;  1KSO A;  3BQ3 A;  4MSP A;  3I5I B;  1ALV A;  1XFY O;  5KU1 A;  2Q91 A;  3TUY C;  1H8B A;  2K8M B;  2KHN A;  5ER5 A;  1UHK A;  1SCM B;  1QAT A;  1QAS A;  5D7F A;  2KAX A;  1BLQ A;  1CB1 A;  4M2P A;  4MN0 A;  2BCB A;  2LNK A;  1GQM A;  5AXI A;  5CSN A;  3SIB A;  2L98 A;  3DVE A;  4N1F A;  2LHI A;  4D1E A;  3HX4 A;  1N2D A;  4OKH A;  1RRO A;  1DJW A;  3NSI A;  1BMO A;  1S5G Z;  2M7N A;  1ALW A;  2SCP A;  3DVJ A;  3I5G B;  1TCO B;  2KFG A;  2QPT A;  3O4Y A;  4ZCU A;  1S1E A;  2WOR A;  2MHH A;  3CS1 A;  2ZKM X;  3BUW B;  3C1V A;  2CNP A;  1FF1 A;  1SCV A;  1LA0 A;  2MRD A;  1KK8 C;  3I5H C;  1TNQ A;  2M29 A;  1A4P A;  2PRU A;  4TNC A;  1HQV A;  2KI6 C;  4U8D A;  3SJS A;  2NXQ A;  4YI8 A;  2E6W A;  1DJH A;  3PN7 B;  1FPW A;  1SYM A;  1K9U A;  2VRG A;  2M49 B;  3SIA A;  1S6J A;  4M2Q A;  1S6C A;  3I5I C;  1JF2 A;  1CDN A;  4MEW A;  5F6T A;  1GGZ A;  1SCM C;  3E3R A;  4N5X A;  1OQP A;  1XK4 A;  1JUO A;  5I2L A;  1PRW A;  2H2K A;  4Q04 A;  3DVK A;  3SG2 A;  1FW4 A;  2GV5 A;  1KFX S;  1DJZ A;  3VRQ A;  1UP5 A;  4P2Y B;  1XYD A;  1JBA A;  1NYA A;  1QTX A;  1MF8 B;  2K7D A;  3KPX A;  1B9A A;  1UHH A;  1DGU A;  5AFP A;  2V53 A;  3TS5 B;  3VGO A;  4MVF A;  1KK7 Z;  2ZRS A;  3IQQ A;  3KO0 A;  4UPG A;  3IQO A;  2BCX A;  1OOJ A;  1TRF A;  1PUL A;  2KGB C;  1LVC D;  1QXP A;  1LKJ A;  1TCF A;  4GGF C;  2ZN8 A;  4DIR A;  1K96 A;  1ZFS A;  2JTZ A;  3KF9 A;  3PN7 C;  1A2X A;  1XFV O;  1V1G A;  5HYD A;  1FI5 A;  1S6I A;  4ORB B;  5K89 A;  1TNX A;  2NCO A;  1LIN A;  2LV7 A;  5JJG A;  4PHN A;  1A03 A;  1NCY A;  2LC5 A;  1SBJ A;  2WOS A;  1S5G Y;  3PLF B;  1OZO A;  4FTG A;  4I5J A;  1AUI B;  1DJY A;  3PAL A;  1EXR A;  1M39 A;  2NLN A;  3M0W A;  1KFU S;  1YUR A;  2JC2 A;  1UUS A;  2LVK A;  2WCF A;  1SL9 A;  2PAL A;  3FWC A;  1F54 A;  2D8N A;  4NDB A;  2I94 A;  1CFF A;  1CNP A;  1RFJ A;  2H61 C;  5DKR A;  4MZK A;  3NXA A;  1CFC A;  1Y6W A;  2JTT A;  3LCP C;  1MWN A;  1W7J B;  1IJ5 A;  3SG6 A;  3CLN A;  1DGV A;  3TS5 C;  4GFT A;  1E8A A;  4YBH B;  2OS8 B;  2LMU A;  1NPQ A;  1YVH A;  4E68 A;  1NSH A;  4OV2 A;  1G33 A;  4PHJ A;  2KSP A;  1BR1 B;  1B8R A;  4F0Z B;  1TN4 A;  2OPO A;  3LL8 B;  3EK8 A;  1OSA A;  1NX1 A;  3D0Y B;  3I5F B;  2M9G A;  2F3Y A;  1BG1 A;  1CDM A;  4XJK B;  1EG4 A;  1C07 A;  2LE9 B;  2M7L A;  3VRN A;  1DVI A;  1YX8 A;  1OZS A;  1EJ3 A;  3MSE B;  4FQO A;  5JOL A;  1RK9 A;  4GBA A;  2GGZ A;  5AAN A;  2OTG C;  1B7T Y;  2LLU A;  3RM1 A;  2F2P A;  3NSK A;  1KK7 Y;  1SNL A;  2Y1M A;  2FOT A;  3NSL A;  1IWQ A;  1MXL C;  4C0J A;  2CCM A;  1UWO A;  3FS7 A;  1CDL A;  2KBI A;  3HCM A;  2IS9 A;  1Y1A A;  3GK2 A;  4NDD A;  1MQ1 A;  1PVA A;  1DJG A;  3EVR A;  4PHK A;  1YRU B;  2OS8 C;  3CGA A;  4GUK A;  3EK4 A;  4ETO A;  4GNK B;  4PE0 A;  1OMD A;  2JXC A;  4HRE E;  2LP3 A;  2GGM A;  3BUX B;  3CWG A;  1AHR A;  2AMI A;  1ZAC A;  1REC A;  1UHN A;  4PDZ A;  1M63 B;  1KWO B;  4YGD B;  4CFR A;  1JF0 A;  2M0R A;  3EVU A;  5HLO A;  2HF5 A;  1PSB A;  3CR4 X;  2AUC A;  1DJX A;  1CMF A;  4CID A;  1Q80 A;  4DCK A;  5IBW A;  1R2U A;  1K8U A;  2PSR A;  4YGC B;  3TDU A;  1SL7 A;  1J55 A;  1SMG A;  2FCD A;  1J7R A;  1S26 D;  2ZN9 A;  4YGA A;  3TDZ A;  1XO5 A;  1N65 A;  1BU3 A;  1SPY A;  2E30 A;  3WXA A;  1MXE A;  3FIA A;  1RJV A;  3A4U B;  4WRI A;  5CSF A;  3F45 A;  2KAY A;  4PHM A;  1WRK A;  2PMY A;  2LVI A;  2FCE A;  1WY9 A;  1ZOT B;  1QVI Z;  1UHI A;  1XVJ A;  5CPV A;  1HT9 A;  5J3X A;  4A4B A;  1YUT A;  1DT7 B;  2F8P A;  2K2A A;  1YUS A;  2B1U A;  2LMV A;  2JT3 A;  3I5G C;  1B7T Z;  1TNW A;  1MUX A;  2BBN A;  1B47 A;  2JUL A;  4MZL A;  4USL A;  1DF0 A;  1NX2 A;  3LLE A;  1SW8 A;  3BOW A;  4I5N B;  1WDC B;  3KHE A;  1J7O A;  1KWO C;  2WC8 A;  5HKW A;  5CSI A;  1CFP A;  1EL4 A;  3CR2 A;  3JVT B;  3LK1 A;  2L4H A;  4N1G A;  4QJ5 B;  1KCY A;  1CMG A;  1PAL A;  1R6P A;  1UHJ A;  2F3Z A;  1IRJ A;  1GJY A;  4MZJ A;  2CXJ A;  4I5L B;  4MRX A;  2L50 A;  5KSZ A;  2HQW A;  2PAS A;  2K7C A;  1MR8 A;  1TOP A;  1OMR A;  1J1E A;  1N0Y A;  2KOT A;  4MRY A;  2PVB A;  2JNX A;  2KI4 B;  1BR4 B;  3BOW B;  3GK1 A;  2LCP A;  1KFX L;  2JWW A;  2M1K B;  2DOQ A;  4JPZ B;  3ZNI A;  1IKU A;  2KFH A;  4PE4 A;  2KYF A;  4HSZ A;  1A75 A;  3WHT B;  1SR6 B;  2P6B B;  4PCW A;  1SRA A;  1IG5 A;  4WQ2 A;  2I18 A;  1QV0 A;  1B8C A;  2KNE A;  4A4C A;  1CKK A;  3DF0 A;  3PFV A;  1B4C A;  1F71 A;  2ISD A;  1D1O A;  4YGE B;  1QX2 A;  1SK6 D;  2LMT A;  1KQM B;  1TIZ A;  1VRK A;  1K90 D;  1ZMZ A;  2JNF A;  3BUN B;  1K93 D;  4PE1 A;  5CSJ A;  1NIW A;  1JSA A;  1BJF A;  1L7Z A;  4QJ4 B;  3VRP A;  1XK4 C;  1AVS A;  1U5I A;  1WDC C;  2Y1N A;  3DD4 A;  4L9M A;  4NQG A;  1G4Y R;  1F8H A;  1QX7 A;  3DVM A;  3JVT C;  2CBL A;  3PM8 A;  1A75 B;  5PAL A;  1YUU A;  2L5X B;  1S3P A;  2HET A;  5DKQ A;  2LUC A;  5GQQ C;  2M1U A;  1B1G A;  1F55 A;  2TN4 A;  3OB1 B;  3SG3 A;  1YRT B;  2CTN A;  3DF0 B;  1QLK A;  3TUY B;  1QVI Y;  5AER A;  2FJU B;  4OVN F;  1S36 A;  1DTL A;  1F4O A;  1KFU L;  2MLE C;  1PK0 D;  1TTX A;  2JRF A;  2KI4 C;  1V1F A;  2NZ0 A;  1DJI A;  3NSO A;  5I8N A;  1CDP A;  1CM1 A;  3H4S E;  2MLF C;  2EC6 B;  2KI6 D;  1K9P A;  1SR6 C;  3AKA A;  3SG7 A;  1C7V A;  1L2O B;  2JXL A;  1LA3 A;  1ODB A;  1KSM A;  2M3W A;  4JQ0 D;  4GPL B;  3ICB A;  4XYN A;  3EKH A;  1AJ4 A;  2KDH A;  1K9K A;  2K7O A;  2WND A;  1CLM A;  2MA2 A;  2RGI A;  2BKH B;  2K2F A;  1F70 A;  1KQM C;  2AAO A;  4JWQ A;  5FYX A;  1IJ6 A;  2KYC A;  3I5H B;  3BUM B;  2L51 A;  2QAC A;  3KEV A;  1B8L A;  5D69 A;  2BBM A;  2JT8 A;  2CT9 A;  5I2O A;  1M31 A;  3FWB A;  1QIV A;  1QJT A;  1TNP A;  4GGN A;  1CFD A;  2LP2 A;  1JFK A;  2A4J A;  1NWD A;  1YVL A;  3GOF A;  3I5F C;  2Q4U A;  1NX3 A;  2ZNE A;  3O6B A;  2G9B A;  1QIW A;  4C0K A;  4OCI A;  3AAK A;  3LK0 A;  1CLB A;  2ZRT A;  1YR5 A;  2LUX A;  4AQJ A;  4OR9 B;  2LAP A;  1FBV A;  1WRL A;  4PAL A;  1IQ3 A;  3EKJ A;  2KBM A;  4M2O A;  4GGF A;  2EC6 C;  1C7W A;  2I7A A;  1L2O C;  1BOC A;  1SY9 A;  2BKI B;  2JU0 A;  3VRR A;  1NCZ A;  2LM5 A;  2L0P A;  3CTN A;  1BF5 A;  2EGD A;  1XFZ O;  2KGR A;  4MLW A;  2F2O A;  2MJW B;  2F33 A;  1CTR A;  1LXF C;  3PAT A;  4PE7 A;  3IF7 A;  3SG4 A;  5I2Q A;  1IQ5 A;  2HPS A;  3VRO A;  5AEQ A;  3GK4 X;  2JZI A;  1CLL A;  2NCP A;  3PSR A;  1K95 A;  1NP8 A;  5HKZ A;  1BT6 A;  1QX5 B;  2BEC A;  2EHB A;  2LLT A;  2H61 A;  2KFF A;  1XFW O;  2WCE A;  1EG3 A;  3SG5 A;  2JT0 A;  1NCX A;  2Y4Q A;  4P5O E;  2LVV A;  3CZT X;  2BE6 A;  2MAZ A;  5BPJ A;  1QLS A;  1X02 A;  5KTY A;  2LAN A;  3BXK A;  1QV1 A;  3OX6 A;  3JTD B;  1XFU O;  1A29 A;  4CFQ A;  2I2R E;  5ER4 X;  2MBX A;  4I5K A;  1M45 A;  2BE4 A;  3RLZ A;  3OX5 A;  1XFX O;  4YI9 A;  1JC2 A;  3BYA A;  3OB2 B;  3D10 A;  1DF0 B;  1NX0 A;  3WNX B;  4BY5 A;  4AOM A;  1MHO A;  1NUB A;  1K2H A;  4CPV A;  1AJ5 A;  2G2B A;  2WCB A;  5DKN A;  1Y0V H;  1J1D A;  4HRG A;  2R2I A;  2K0J A;  4ZCV A;  1J7P A;  5G08 A;  3ZWH A;  4R1E A;  3EVV A;  2Y5I A;  3WHU B;  2K61 A;  1SL8 A;  2JOJ A;  2ZND A;  3K21 A;  1YX7 A;  1AK8 A;  1OMV A;  1Y1X A;  1ZUZ A;  2LLS A;  2JQ6 A;  1H4B A;  1F4Q A;  2HQ8 A;  2K7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...