1IH0A

Structure of the c-domain of human cardiac troponin c in complex with ca2+ sensitizer emd 57033
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
GKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES
publication title Structure of the C-domain of human cardiac troponin C in complex with the Ca2+ sensitizing drug EMD 57033.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ih0A00
1CTRA 3TUYB 1QASA 1H8BA 2M49B 1DJWA 1DJYA 2Y1NA 1TNPA 4HREE 1PSRA 3SG3A 1QLKA 2KI6D 5JJGA 5CSFA 3I5IB 4XJKB 1QVIZ 1RROA 3PATA 1L2OC 1A29A 2E30A 2LE9B 4MZJA 2H2KA 5K89A 5GQQC 4UPGA 4MSPA 3PLFB 2KFFA 1OZSA 1RWYA 1ZACA 2Y4QA 4OVNF 2MJWB 1SCVA 2M1UA 2KNEA 2EHBA 1PVBA 1F55A 4MRXA 1CDLA 2JT3A 2M0RA 1ODBA 3M0WA 4C0KA 1CMFA 2AUCA 2Y1MA 2PASA 4MEWA 1KSMA 3KF9A 1QS7A 2BKIB 4MZKA 1OQPA 2K61A 1WRLA 1AJ4A 3DD4A 3E3RA 1CLLA 2JOJA 3IQOA 4U8DA 1QATA 3VGOA 1NX2A 2KQYA 2JQ6A 2I7AA 5HKZA 4GPLB 2BE6A 4PHJA 1RTP1 4C0LA 1V1GA 1EG3A 1CFCA 5DKRA 1UP5A 1ZFSA 2Q4UA 4USLA 1BR4B 1UHHA 4PE1A 2JTZA 1J1EA 5HLOA 2L4HA 2FCDA 1R6PA 1YUUA 1FI5A 1TCOB 2OS8C 2ZNDA 3BOWB 3FWCA 1TNQA 2H61A 2L98A 2MAZA 3EVRA 5I2LA 3TDZA 2O5GA 1DGUA 1PK0D 1IWQA 1DJZA 3DF0B 1L7ZA 2ZRSA 3I5HC 1S5GY 1SW8A 1KFXS 1S6IA 4DIRA 2G9BA 4PALA 1CLMA 2LNKA 4I5KA 1HT9A 4A4BA 3WHUB 2LV7A 1AHRA 1IKUA 1YX8A 2EC6C 3DVEA 1QIWA 1IJ5A 3JTDB 4HRGA 1J7QA 1UHIA 2LMVA 1Y0VH 1SRAA 2L51A 2QACA 3LK1A 5HLVA 3DF0A 4MVFA 5JOLA 5B8IB 1XFXO 2GV5A 2LAPA 2NLNA 2BCAA 1DMOA 4AQIA 3KEVA 1BT6A 4Q04A 1OMRA 4YGAA 2LANA 1AUIB 2PALA 3KPXA 1WDCB 3I5GC 1NSHA 2BBMA 2WNDA 1E8AA 1Y6WA 2HPSA 2OTGC 1DJIA 1KK7Y 1FW4A 3A8RA 4ORAB 1NX0A 1UURA 1B7TY 3PM8A 4PHNA 2L2EA 1ALWA 1WRKA 1CFFA 5CSJA 1ALVA 1W7IB 2KBIA 2TN4A 5HYDA 1K2HA 3HCMA 1CFDA 2F3YA 2M8UA 2KQ6A 1FI6A 4NQGA 1XO5A 2CTNA 4ICBA 1S3PA 1CM4A 1TOPA 4DS7A 1GQMA 1XFWO 2HETA 1YRUB 2FJUB 2KAXA 4L9MA 4MN0A 2KAYA 2HQ8A 4TNCA 1KQMB 4PDZA 1M31A 1ZOTB 4OR9B 3VRQA 2ZNEA 1G33A 2M1KB 5DKNA 4CFQA 1K93D 1NYAA 3I5FB 5CPVA 1NCXA 4GUKA 1H4BA 3O2PA 1NX1A 4CLNA 3PSRA 3PN7C 1J7RA 3O4YA 1GJYA 2PVBA 2SASA 1SYMA 1SR6C 1XYDA 2M9GA 1M46A 1F54A 5TNCA 3AKBA 4MBEA 2F33A 4YBHB 4NDCA 3TUYC 1SK6D 1K9KA 2K7OA 2LUCA 1S1EA 3H4SE 2BCBA 5CSIA 1S5GZ 2KFHA 3DVKA 1RK9A 4BY5A 1C7WA 1K9PA 1S36A 5AXIA 1B47A 1KWOB 1KK8B 1EH2A 3D0YB 3TS5B 1AP4A 3CR4X 5AFPA 3EVVA 1TRFA 1CLBA 1LKJA 2GGMA 3I5IC 1OMDA 1KSOA 2VRGA 2LLSA 1XK4C 1OE9B 1YR5A 4FQOA 4CFRA 2F3ZA 1DVIA 4C0JA 1XFYO 1ZUZA 1JUOA 2M29A 4ZCUA 1JFJA 2KYCA 1KFUS 4DUQA 2COLB 1X02A 2CNPA 1SY9A 3D0YA 1GGZA 1F71A 4YGEB 2BCXA 4BY4A 4YI8A 1IGVA 3SG7A 1SMGA 4YGDB 3OB1B 1KK7Z 1MHOA 1MXEA 4IL1A 3TDIA 3WHTB 1B7TZ 4I5LB 1F8HA 1OSAA 2R2IA 2JC2A 2JNXA 1B4CA 3ICBA 3CR2A 3SIBA 1JWDA 1C07A 4P2YB 5BPJA 2NCPA 1CKKA 3AAKA 1N2DA 4N1FA 1DF0B 2LM5A 1B1GA 4DRWA 3FWBA 1NPQA 3OX5A 3SIAA 1J1DA 2MLFC 2JT8A 3D10A 3EKHA 1NCZA 1MWNA 4JPZB 1IRJA 2BL0B 2F8PA 1KFXL 1UHNA 4ZCVA 5D7FA 1K95A 2LHLA 1DF0A 2KI6C 1HQVA 1LINA 1R2UA 2M7NA 1DTLA 1UUSA 1F4OA 1K9UA 2LLTA 2B1UA 1WRZA 3FS7A 1A75B 1K90D 1XVJA 1XFUO 2WC8A 1C7VA 3C1VA 2BECA 3BYAA 2ZN9A 2LVIA 1CDNA 2L0PA 1D1OA 1PVAA 2L4IA 2ZN8A 4HRHA 1KQVA 1RJVA 2KBMA 5G08A 5I2OA 2NXQA 1VRKA 4YGCB 3JTDC 2CXJA 2WORA 3GK2A 3AAJA 1QXPA 3JVTB 4JQ0D 1CNPA 1XA5A 2JRFA 4QJ3B 2A4JA 5D69A 2LP2A 1A75A 3CR5X 1SCMB 4P5OE 1BODA 3EKJA 1DT7B 2DOQA 4CIDA 3EK4A 2NZ0A 1QX2A 1NX3A 1SL7A 1WDCC 3SG4A 5HKYA 4GBAA 1DGVA 1A2XA 1K96A 1NIWA 3NSOA 4OKHA 1B9AA 1YURA 1CFPA 2MRDA 4WQ2A 2K2FA 2KI4B 3NSIA 4AQJA 1B8RA 1BOCA 1SPYA 2FOTA 5IBWA 4PE0A 1Y1XA 1Y1AA 3BQ3A 1AK8A 2OPOA 1S26D 2ISDA 1J7OA 2PSRA 2LVKA 1SBJA 1MR8A 2LC5A 3OHMB 4GGFA 4GNKB 1DJHA 3DVMA 3MSEB 5J3XA 1FBVA 5AEQA 4GFTA 4WRIA 1BLQA 3LK0A 2IS9A 1EL4A 1KQMC 2LMUA 1Q80A 3BXKA 1TN4A 2MBXA 2SCPA 2WCBA 2I18A 4PE7A 5I8NA 3I5FC 1JF0A 5I2QA 2JULA 1IQ3A 2KFGA 1BG1A 1CM1A 4CPVA 1QV1A 4PHMA 3WXAA 2PRUA 1NUBA 3CLNA 2CCMA 3O78A 1PRWA 5HKWA 4HSZA 1J55A 4N1GA 1QV0A 2WCEA 1QIVA 5PALA 4M2PA 1WLZA 1JC2A 4ORCB 1FF1A 2LLUA 4FTGA 4D1EA 1NP8A 3WNXB 2K7DA 1F70A 1JF2A 4QJ5B 1S6CA 3IF7A 2M3WA 2KGBC 2LCPA 2LHIA 3HX4A 4I5NB 2BKHB 2BE4A 1KWOC 1KK8C 2AAOA 4NDDA 3TS5C 1N65A 1UHKA 1CDPA 1AJ5A 1YTZC 1QLSA 2ZKMX 1CB1A 1G8IA 3BUNB 3CTNA 5ER5A 2JXCA 2EGDA 1WLMA 1L2OB 1MXLC 3IQQA 2K2AA 1TCFA 1QX5B 5KU1A 4E68A 3VRRA 1XFZO 5DKQA 2MLEC 1MUXA 1OOJA 1UWOA 3SJSA 1QTXA 1NCYA 3LLEA 4YI9A 1KCYA 1FPWA 2F2OA 1M63B 4N5XA 4ETOA 1SL8A 1QX7A 2E6WA 1SL9A 2H61C 3VROA 2O60A 2M7LA 3AKAA 1J7PA 4AOMA 2LP3A 4YGBB 4XJKA 3QRXA 5ER4X 2MHHA 3VRNA 1XK4A 2V53A 2KOTA 2F2PA 3A4UB 2KDHA 2KGRA 4YRUA 3EVUA 4MRYA 3OB2B 4GGNA 3SG2A 2K8MB 1YUSA 1IJ6A 3DVJA 4M2QA 1UHJA 1MQ1A 3NSKA 3FIAA 1M39A 1V1FA 2BL0C 2K0JA 2L5XB 2JXLA 1PALA 1S6JA 1JFKA 2I2RE 2KYFA 1IH0A 3EK7A 1M45A 3GK4X 3SG5A 1G4YR 3RM1A 2OS8B 2KSPA 3GK1A 5CSNA 3BUWB 3PFVA 5F6TA 1DJXA 2LVVA 3OP0A 1TNXA 1JSAA 1XFVO 1BMOA 1YX7A 2LUXA 3I5HB 1BR1B 2KAVA 4MLWA 3TDUA 1GGWA 3OX6A 1A4PA 1MF8B 1F4QA 5AANA 3RLZA 1N0YA 1K8UA 1EJ3A 1LXFC 4MZLA 1PSBA 2EC6B 1QVIY 2L50A 1K94A 3GOFA 2Q91A 3JVTC 2FCEA 3K21A 2GGZA 2HF5A 3BOWA 1DJGA 1SCMC 2JNFA 2JT0A 4NDBA 4XYNA 2D8NA 3BUOB 2K7CA 1LA0A 1Y1UA 4WQ3A 1CDMA 1TIZA 3VRPA 1U5IB 4I5JA 3KO0A 1YVHA 2JTTA 1SNLA 2Y5IA 4OV2A 4GGFC 3I5GB 1IG5A 4PHKA 3TZ1A 5FYXA 2OTGB 3BUXB 2BBNA 1NWDA 4OCIA 3KHEA 2P6BB 2ZRTA 3CWGA 2WOSA 3NSLA 2KI4C 3PALA 5AERA 1BU3A 1A03A 3EK8A 2MA2A 1TNWA 4QJ4B 2KHNA 1IQ5A 1OMVA 1YVLA 2JZIA 1EG4A 1QJTA 1U5IA 4M2OA 2HQWA 2JPTA 1YUTA 4R1EA 2LVJA 2M97A 1WY9A 1ZMZA 2JWWA 3O6BA 1TTXA 4ORBB 1AVSA 1RFJA 3BUMB 3LCPC 4F0ZB 1B8LA 2RGIA 2PMYA 1EXRA 1RECA 5KSZA 1LVCD 4PCWA 2CT9A 4PE4A 2I94A 1B8CA 1PULA 3CZTX 1BJFA 3ZNIA 4GAOA 3ZWHA 2LMTA 1BF5A 4DCKA 2K7BA 3CGAA 3F45A 1OZOA 1SKTA 1W7JB 2JU0A 3LL8B 5KTYA 1CMGA 3CS1A 4A4CA 3SG6A 2ZFDA 3NXAA 2CBLA 2NCOA 1LA3A 3PN7B 1YRTB 2WCFA 1KFUL 2G2BA 1SR6B 2QPTA 1JBAA 2AMIA 4JWQA
chains in the Genus database with same CATH superfamily
1CTRA 3TUYB 1QASA 1H8BA 2M49B 1DJWA 1DJYA 4F7FA 2Y1NA 1TNPA 4HREE 1PSRA 3SG3A 1QLKA 2KI6D 1TUJA 2QEBA 5JJGA 5CSFA 3I5IB 4XJKB 1QVIZ 3PM2A 1RROA 3PATA 1L2OC 1A29A 2E30A 2LE9B 4MZJA 2H2KA 5K89A 5GQQC 4UPGA 4MSPA 1C3ZA 3PLFB 3QMEA 2KFFA 3UO9A 2QDIA 1OZSA 1RWYA 1ZACA 2Y4QA 4OVNF 2MJWB 1SCVA 2M1UA 2KNEA 2EHBA 1PVBA 1F55A 4MRXA 5FI2A 1CDLA 2JT3A 2K60A 2M0RA 1ODBA 3B88A 3M0WA 4C0KA 1CMFA 2WC6A 2AUCA 2Y1MA 2PASA 4MEWA 1KSMA 3KF9A 1QS7A 2BKIB 4MZKA 1OQPA 2K61A 1WRLA 1AJ4A 3DD4A 3E3RA 1CLLA 2JOJA 3IQOA 3VB1A 4U8DA 1QATA 3VGOA 1NX2A 2KQYA 2JQ6A 2I7AA 5HKZA 4GPLB 2BE6A 4PHJA 1RTP1 1W9ZA 1V1GA 1EG3A 4C0LA 2ERBA 1CFCA 5DKRA 1UP5A 1ZFSA 2Q4UA 4USLA 1BR4B 1UHHA 4PE1A 1QWVA 2JTZA 5EL2A 1J1EA 5HLOA 2L4HA 2FCDA 1R6PA 1YUUA 3NGVA 1TCOB 1FI5A 4FQTA 1DC1A 2OS8C 2ZNDA 3BOWB 3FWCA 1TNQA 2H61A 3CYZA 2L98A 2MAZA 3EVRA 5I2LA 3S0EA 3TDZA 2O5GA 1DGUA 1PK0D 1T14A 1IWQA 1DJZA 3DF0B 1L7ZA 2ZRSA 3SS3A 3I5HC 1S5GY 3S0FA 2BNXA 1SW8A 1KFXS 1S6IA 4DIRA 2G9BA 4PALA 1CLMA 2LNKA 4I5KA 1HT9A 4A4BA 2WCKA 3WHUB 2LV7A 1AHRA 2WCMA 1YX8A 2EC6C 1OW4A 1QIWA 1IJ5A 3DVEA 3JTDB 4HRGA 1UHIA 2LMVA 1Y0VH 1SRAA 2L51A 1IIOA 3K1EA 2QACA 3LK1A 5HLVA 3DF0A 4MVFA 5JOLA 3B7AA 1XFXO 2GV5A 2LAPA 2NLNA 2BCAA 5B8IB 1DMOA 5D3OA 4AQIA 3KEVA 1BT6A 4Q04A 1OMRA 3S0GA 4YGAA 2LANA 1AUIB 2PALA 3B6XA 3KPXA 1WDCB 3I5GC 1NSHA 2BBMA 1SSEB 2WNDA 1E8AA 1Y6WA 3IVTA 2HPSA 2OTGC 1DJIA 3BFBA 1KK7Y 1FW4A 3A8RA 4ORAB 1NX0A 1UURA 1B7TY 3PM8A 4PHNA 2L2EA 4PT1A 2PQLA 1ALWA 1WRKA 4KYNA 1CFFA 5CSJA 3SS4A 1ALVA 1W7IB 2KBIA 2TN4A 1DEKA 5HYDA 1K2HA 4OZDA 2QEVA 3HCMA 1CFDA 2F3YA 2M8UA 2KQ6A 1FI6A 1ORGA 4NQGA 1XO5A 2CTNA 4ICBA 1S3PA 1CM4A 1TOPA 4DS7A 2L2CA 3S0AA 1GQMA 1XFWO 2HETA 1YRUB 2FJUB 2KAXA 4L9MA 4MN0A 2KAYA 2QEHA 2HQ8A 4TNCA 1KQMB 3D74A 4PDZA 1OOGA 1M31A 1ZOTB 4OR9B 3VRQA 2GTEA 3RZSA 2ZNEA 1G33A 2M1KB 5DKNA 4CFQA 1K93D 1NYAA 3I5FB 4INWA 5CPVA 1NCXA 2WC5A 4GUKA 1H4BA 3O2PA 1NX1A 4CLNA 3PSRA 3PN7C 1J7RA 3O4YA 1GJYA 2PVBA 2SASA 3FE8A 1SYMA 1SR6C 4JKTA 1XYDA 2M9GA 4JD9A 1M46A 1F54A 5TNCA 3AKBA 4MBEA 2F33A 2L5YA 4YBHB 4NDCA 3TUYC 3BJHA 1SK6D 1K9KA 2BAPA 2K7OA 2LUCA 1S1EA 3H4SE 2BCBA 5CSIA 1S5GZ 2KFHA 3DVKA 1RK9A 4BY5A 1C7WA 1K9PA 1S36A 5AXIA 1B47A 1KWOB 1KK8B 1EH2A 3D0YB 3TS5B 1AP4A 3CR4X 5AFPA 3EVVA 1TRFA 3R1PA 1LKJA 2GGMA 3I5IC 1OMDA 3OGNA 1KSOA 2VRGA 1CLBA 2LLSA 1XK4C 1OE9B 1YR5A 4FQOA 4CFRA 2F3ZA 1DVIA 4C0JA 2H8VA 3EG5B 1XFYO 1ZUZA 1JUOA 2M29A 4ZCUA 1JFJA 2KYCA 1KFUS 4DUQA 2COLB 3NHTA 1X02A 2CNPA 1SY9A 3D0YA 1GGZA 1TUZA 1TWOA 4YGEB 1IKUA 1F71A 2BCXA 4BY4A 4YI8A 1IGVA 3SG7A 1SMGA 4YGDB 3OB1B 1KK7Z 1MHOA 1MXEA 4IL1A 3TDIA 3WHTB 1B7TZ 4I5LB 1F8HA 1OSAA 2R2IA 2JC2A 2JNXA 1B4CA 3ICBA 3CR2A 3SIBA 1JWDA 1C07A 4P2YB 5BPJA 2NCPA 1CKKA 3AAKA 1N2DA 4N1FA 1DF0B 2LM5A 3SS5A 1B1GA 4DRWA 3FWBA 1NPQA 3OX5A 3SIAA 1J1DA 2MLFC 2JT8A 3D10A 3DYEA 3EKHA 1NCZA 1MWNA 4JPZB 1IRJA 2BL0B 2F8PA 1KFXL 1UHNA 4ZCVA 5D7FA 1K95A 2LHLA 1DF0A 2KI6C 1HQVA 1LINA 1R2UA 2M7NA 1DTLA 1UUSA 1F4OA 3B87A 1K9UA 3D73A 2LLTA 2B1UA 2KLEA 1WRZA 3FS7A 3FE6A 1A75B 1K90D 3O4XA 1XVJA 1XFUO 2WC8A 1C7VA 3C1VA 2BECA 3BYAA 2ZN9A 2LVIA 1CDNA 2L0PA 1D1OA 1PVAA 2L4IA 2ZN8A 4HRHA 1KQVA 1DELA 1RJVA 2KBMA 5G08A 5I2OA 2NXQA 4INXA 1VRKA 4YGCB 3JTDC 2CXJA 2WORA 3GK2A 3AAJA 1QXPA 3JVTB 4JQ0D 1CNPA 1XA5A 2JRFA 4QJ3B 2A4JA 5D69A 2LP2A 1A75A 3CR5X 1SCMB 4P5OE 1BODA 3EKJA 2KPHA 1DT7B 2DOQA 4CIDA 3EK4A 2NZ0A 1QX2A 1NX3A 1SL7A 1WDCC 3SG4A 5HKYA 4GBAA 1DGVA 1A2XA 1K96A 1NIWA 3NSOA 3R1OA 4OKHA 1B9AA 1YURA 1CFPA 2MRDA 4WQ2A 2K2FA 2KI4B 3NSIA 4AQJA 1B8RA 1BOCA 1SPYA 3FE9A 1P28A 2FOTA 2YGUA 5IBWA 4PE0A 1Y1XA 1Y1AA 3BQ3A 1AK8A 2OPOA 1S26D 2ISDA 1J7OA 2PSRA 2LVKA 1SBJA 1MR8A 2LC5A 3OHMB 4GGFA 4GNKB 1DJHA 3DVMA 3MSEB 5J3XA 1FBVA 5AEQA 4GFTA 4WRIA 1BLQA 3LK0A 2IS9A 1EL4A 1KQMC 5FI7A 2LMUA 1Q80A 3BXKA 1TN4A 2MBXA 2SCPA 2WCBA 2I18A 4PE7A 5I8NA 3I5FC 1JF0A 5I2QA 2JULA 1IQ3A 2KFGA 1BG1A 1CM1A 4CPVA 1QV1A 4PHMA 3WXAA 2PRUA 1DQEA 1NUBA 3CLNA 2CCMA 3O78A 1PRWA 5HKWA 4HSZA 1J55A 4N1GA 2KLDA 1XFRA 1QV0A 2WCEA 1QIVA 2WCHA 5PALA 4M2PA 1LS8A 1WLZA 1JC2A 3CDNA 4ORCB 2QEOA 1FF1A 2LLUA 4FTGA 4D1EA 1NP8A 3WNXB 2K7DA 1F70A 1JF2A 3R1VA 4QJ5B 3Q8IA 1S6CA 3IF7A 3UNWA 2M3WA 2KGBC 2LCPA 2LHIA 3HX4A 3BFHA 4I5NB 2BE4A 2BKHB 1KWOC 1KK8C 2AAOA 4NDDA 3TS5C 1N65A 1UHKA 1CDPA 1AJ5A 1YTZC 1QLSA 2ZKMX 1CB1A 3OBVA 1G8IA 3BUNB 3CTNA 3L4LA 5ER5A 2JXCA 2EGDA 1WLMA 1L2OB 1MXLC 3CZ2A 2WCLA 2K2AA 1TCFA 3IQQA 1QX5B 2FJYA 5KU1A 4E68A 3VRRA 1XFZO 5DKQA 2MLEC 1MUXA 1OOJA 1UWOA 3SJSA 1QTXA 1NCYA 3LLEA 4YI9A 1KCYA 1FPWA 3CZ1A 2F2OA 1M63B 4N5XA 4ETOA 1SL8A 1Z4HA 1QX7A 2E6WA 1SL9A 2H61C 3VROA 1Z2CB 2O60A 3N7HA 3AKAA 2M7LA 4AOMA 2LP3A 1J7PA 4YGBB 4XJKA 3D78A 3QRXA 5ER4X 2MHHA 3VRNA 1XK4A 2V53A 2KOTA 2F2PA 3A4UB 2KDHA 2KGRA 4YRUA 3EVUA 4MRYA 3OB2B 4GGNA 3SG2A 2K8MB 5I94A 1YUSA 3PJIA 1IJ6A 3DVJA 4M2QA 1UHJA 5DICA 1MQ1A 3NSKA 3FIAA 1M39A 1V1FA 2BL0C 2K0JA 2L5XB 2JXLA 1PALA 1GM0A 1S6JA 1JFKA 2I2RE 2KYFA 1IH0A 3EK7A 1M45A 3GK4X 3SG5A 1G4YR 3RM1A 2OS8B 2KSPA 3GK1A 5CSNA 3BUWB 3PFVA 3R72A 5F6TA 3NHIA 1DJXA 2LVVA 3L4AA 3OP0A 3BFAA 1TNXA 1JSAA 3DZTA 1XFVO 1BMOA 1YX7A 2LUXA 3I5HB 1BR1B 2KAVA 4MLWA 5FI6A 3TDUA 3OX6A 1GGWA 1A4PA 1MF8B 1F4QA 4IJ7A 3L47A 2PYQA 5AANA 1N0YA 3RLZA 1K8UA 1EJ3A 1LXFC 4MZLA 1PSBA 2EC6B 1QVIY 2L50A 1K94A 3GOFA 2Q91A 3JVTC 2FCEA 3K21A 2GGZA 2HF5A 3BOWA 1DJGA 1SCMC 2JNFA 2JT0A 4NDBA 4XYNA 2D8NA 3BUOB 3D77A 3DXLA 1J7QA 2K7CA 1LA0A 1Y1UA 2P71A 4WQ3A 1CDMA 1TIZA 3VRPA 1U5IB 3CZ0A 3DY9A 3KO0A 4I5JA 1YVHA 2JTTA 1SNLA 2Y5IA 3CABA 3S0BA 4OV2A 4GGFC 3I5GB 1IG5A 4PHKA 3TZ1A 5FYXA 2OTGB 3BUXB 2BBNA 1NWDA 4OCIA 3KHEA 2P6BB 2ZRTA 3CWGA 2WOSA 3NSLA 2KI4C 3PALA 5AERA 1BU3A 1A03A 3EK8A 2MA2A 1TNWA 4QJ4B 2KHNA 1IQ5A 1OMVA 1YVLA 2JZIA 1EG4A 1QJTA 1U5IA 4M2OA 2HQWA 2JPTA 1YUTA 4R1EA 2LVJA 2M97A 1OOIX 1WY9A 1ZMZA 2JWWA 3O6BA 1TTXA 4ORBB 2P70A 1OOFA 1AVSA 1RFJA 3BUMB 3LCPC 4F0ZB 1B8LA 3V2LA 2RGIA 2PMYA 1EXRA 1RECA 5KSZA 1LVCD 4PCWA 2CT9A 4PE4A 2I94A 3S0DA 1B8CA 1PULA 3B86A 1BJFA 1OOHA 3CZTX 4GAOA 3ZNIA 2LMTA 3ZWHA 4DCKA 1BF5A 2K7BA 3CGAA 3D75A 3F45A 1OZOA 1SKTA 2WCJA 1W7JB 2JU0A 3LL8B 5KTYA 1CMGA 3CS1A 4A4CA 3SG6A 3D76A 2ZFDA 3NXAA 1C3YA 2CBLA 2NCOA 1LA3A 3PN7B 2JPOA 5HL1A 1YRTB 2WCFA 1KFUL 2G2BA 1SR6B 2QPTA 1JBAA 2AMIA 4JWQA
chains in the Genus database with same CATH topology
1CTRA 3TUYB 1QASA 1H8BA 2M49B 1DJWA 1DJYA 2Y1NA 1TNPA 4HREE 1PSRA 3SG3A 1QLKA 2KI6D 5JJGA 5CSFA 3I5IB 4XJKB 1QVIZ 1RROA 3PATA 1L2OC 1A29A 2E30A 2LE9B 4MZJA 2H2KA 5K89A 5GQQC 4UPGA 4MSPA 3PLFB 2KFFA 1OZSA 1RWYA 1ZACA 2Y4QA 4OVNF 2MJWB 1SCVA 2M1UA 2KNEA 2EHBA 1PVBA 1F55A 4MRXA 1CDLA 2JT3A 2M0RA 1ODBA 3M0WA 4C0KA 1CMFA 2AUCA 2Y1MA 2PASA 4MEWA 1KSMA 3KF9A 1QS7A 2BKIB 4MZKA 1OQPA 2K61A 1WRLA 1AJ4A 3DD4A 3E3RA 1CLLA 2JOJA 3IQOA 4U8DA 1QATA 3VGOA 1NX2A 2KQYA 2JQ6A 2I7AA 5HKZA 4GPLB 2BE6A 4PHJA 1RTP1 4C0LA 1V1GA 1EG3A 1CFCA 5DKRA 1UP5A 1ZFSA 2Q4UA 4USLA 1BR4B 1UHHA 4PE1A 2JTZA 1J1EA 5HLOA 2L4HA 2FCDA 1R6PA 1YUUA 1FI5A 1TCOB 2OS8C 2ZNDA 3BOWB 3FWCA 1TNQA 2H61A 2L98A 2MAZA 3EVRA 5I2LA 3TDZA 2O5GA 1DGUA 1PK0D 1IWQA 1DJZA 3DF0B 1L7ZA 2ZRSA 3I5HC 1S5GY 1SW8A 1KFXS 1S6IA 4DIRA 2G9BA 4PALA 1CLMA 2LNKA 4I5KA 1HT9A 4A4BA 3WHUB 2LV7A 1AHRA 1IKUA 1YX8A 2EC6C 3DVEA 1QIWA 1IJ5A 3JTDB 4HRGA 1J7QA 1UHIA 2LMVA 1Y0VH 1SRAA 2L51A 2QACA 3LK1A 5HLVA 3DF0A 4MVFA 5JOLA 5B8IB 1XFXO 2GV5A 2LAPA 2NLNA 2BCAA 1DMOA 4AQIA 3KEVA 1BT6A 4Q04A 1OMRA 4YGAA 2LANA 1AUIB 2PALA 3KPXA 1WDCB 3I5GC 1NSHA 2BBMA 2WNDA 1E8AA 1Y6WA 2HPSA 2OTGC 1DJIA 1KK7Y 1FW4A 3A8RA 4ORAB 1NX0A 1UURA 1B7TY 3PM8A 4PHNA 2L2EA 1ALWA 1WRKA 1CFFA 5CSJA 1ALVA 1W7IB 2KBIA 2TN4A 5HYDA 1K2HA 3HCMA 1CFDA 2F3YA 2M8UA 2KQ6A 1FI6A 4NQGA 1XO5A 2CTNA 4ICBA 1S3PA 1CM4A 1TOPA 4DS7A 1GQMA 1XFWO 2HETA 1YRUB 2FJUB 2KAXA 4L9MA 4MN0A 2KAYA 2HQ8A 4TNCA 1KQMB 4PDZA 1M31A 1ZOTB 4OR9B 3VRQA 2ZNEA 1G33A 2M1KB 5DKNA 4CFQA 1K93D 1NYAA 3I5FB 5CPVA 1NCXA 4GUKA 1H4BA 3O2PA 1NX1A 4CLNA 3PSRA 3PN7C 1J7RA 3O4YA 1GJYA 2PVBA 2SASA 1SYMA 1SR6C 1XYDA 2M9GA 1M46A 1F54A 5TNCA 3AKBA 4MBEA 2F33A 4YBHB 4NDCA 3TUYC 1SK6D 1K9KA 2K7OA 2LUCA 1S1EA 3H4SE 2BCBA 5CSIA 1S5GZ 2KFHA 3DVKA 1RK9A 4BY5A 1C7WA 1K9PA 1S36A 5AXIA 1B47A 1KWOB 1KK8B 1EH2A 3D0YB 3TS5B 1AP4A 3CR4X 5AFPA 3EVVA 1TRFA 1CLBA 1LKJA 2GGMA 3I5IC 1OMDA 1KSOA 2VRGA 2LLSA 1XK4C 1OE9B 1YR5A 4FQOA 4CFRA 2F3ZA 1DVIA 4C0JA 1XFYO 1ZUZA 1JUOA 2M29A 4ZCUA 1JFJA 2KYCA 1KFUS 4DUQA 2COLB 1X02A 2CNPA 1SY9A 3D0YA 1GGZA 1F71A 4YGEB 2BCXA 4BY4A 4YI8A 1IGVA 3SG7A 1SMGA 4YGDB 3OB1B 1KK7Z 1MHOA 1MXEA 4IL1A 3TDIA 3WHTB 1B7TZ 4I5LB 1F8HA 1OSAA 2R2IA 2JC2A 2JNXA 1B4CA 3ICBA 3CR2A 3SIBA 1JWDA 1C07A 4P2YB 5BPJA 2NCPA 1CKKA 3AAKA 1N2DA 4N1FA 1DF0B 2LM5A 1B1GA 4DRWA 3FWBA 1NPQA 3OX5A 3SIAA 1J1DA 2MLFC 2JT8A 3D10A 3EKHA 1NCZA 1MWNA 4JPZB 1IRJA 2BL0B 2F8PA 1KFXL 1UHNA 4ZCVA 5D7FA 1K95A 2LHLA 1DF0A 2KI6C 1HQVA 1LINA 1R2UA 2M7NA 1DTLA 1UUSA 1F4OA 1K9UA 2LLTA 2B1UA 1WRZA 3FS7A 1A75B 1K90D 1XVJA 1XFUO 2WC8A 1C7VA 3C1VA 2BECA 3BYAA 2ZN9A 2LVIA 1CDNA 2L0PA 1D1OA 1PVAA 2L4IA 2ZN8A 4HRHA 1KQVA 1RJVA 2KBMA 5G08A 5I2OA 2NXQA 1VRKA 4YGCB 3JTDC 2CXJA 2WORA 3GK2A 3AAJA 1QXPA 3JVTB 4JQ0D 1CNPA 1XA5A 2JRFA 4QJ3B 2A4JA 5D69A 2LP2A 1A75A 3CR5X 1SCMB 4P5OE 1BODA 3EKJA 1DT7B 2DOQA 4CIDA 3EK4A 2NZ0A 1QX2A 1NX3A 1SL7A 1WDCC 3SG4A 5HKYA 4GBAA 1DGVA 1A2XA 1K96A 1NIWA 3NSOA 4OKHA 1B9AA 1YURA 1CFPA 2MRDA 4WQ2A 2K2FA 2KI4B 3NSIA 4AQJA 1B8RA 1BOCA 1SPYA 2FOTA 5IBWA 4PE0A 1Y1XA 1Y1AA 3BQ3A 1AK8A 2OPOA 1S26D 2ISDA 1J7OA 2PSRA 2LVKA 1SBJA 1MR8A 2LC5A 3OHMB 4GGFA 4GNKB 1DJHA 3DVMA 3MSEB 5J3XA 1FBVA 5AEQA 4GFTA 4WRIA 1BLQA 3LK0A 2IS9A 1EL4A 1KQMC 2LMUA 1Q80A 3BXKA 1TN4A 2MBXA 2SCPA 2WCBA 2I18A 4PE7A 5I8NA 3I5FC 1JF0A 5I2QA 2JULA 1IQ3A 2KFGA 1BG1A 1CM1A 4CPVA 1QV1A 4PHMA 3WXAA 2PRUA 1NUBA 3CLNA 2CCMA 3O78A 1PRWA 5HKWA 4HSZA 1J55A 4N1GA 1QV0A 2WCEA 1QIVA 5PALA 4M2PA 1WLZA 1JC2A 4ORCB 1FF1A 2LLUA 4FTGA 4D1EA 1NP8A 3WNXB 2K7DA 1F70A 1JF2A 4QJ5B 1S6CA 3IF7A 2M3WA 2KGBC 2LCPA 2LHIA 3HX4A 4I5NB 2BKHB 2BE4A 1KWOC 1KK8C 2AAOA 4NDDA 3TS5C 1N65A 1UHKA 1CDPA 1AJ5A 1YTZC 1QLSA 2ZKMX 1CB1A 1G8IA 3BUNB 3CTNA 5ER5A 2JXCA 2EGDA 1WLMA 1L2OB 1MXLC 3IQQA 2K2AA 1TCFA 1QX5B 5KU1A 4E68A 3VRRA 1XFZO 5DKQA 2MLEC 1MUXA 1OOJA 1UWOA 3SJSA 1QTXA 1NCYA 3LLEA 4YI9A 1KCYA 1FPWA 2F2OA 1M63B 4N5XA 4ETOA 1SL8A 1QX7A 2E6WA 1SL9A 2H61C 3VROA 2O60A 2M7LA 3AKAA 1J7PA 4AOMA 2LP3A 4YGBB 4XJKA 3QRXA 5ER4X 2MHHA 3VRNA 1XK4A 2V53A 2KOTA 2F2PA 3A4UB 2KDHA 2KGRA 4YRUA 3EVUA 4MRYA 3OB2B 4GGNA 3SG2A 2K8MB 1YUSA 1IJ6A 3DVJA 4M2QA 1UHJA 1MQ1A 3NSKA 3FIAA 1M39A 1V1FA 2BL0C 2K0JA 2L5XB 2JXLA 1PALA 1S6JA 1JFKA 2I2RE 2KYFA 1IH0A 3EK7A 1M45A 3GK4X 3SG5A 1G4YR 3RM1A 2OS8B 2KSPA 3GK1A 5CSNA 3BUWB 3PFVA 5F6TA 1DJXA 2LVVA 3OP0A 1TNXA 1JSAA 1XFVO 1BMOA 1YX7A 2LUXA 3I5HB 1BR1B 2KAVA 4MLWA 3TDUA 1GGWA 3OX6A 1A4PA 1MF8B 1F4QA 5AANA 3RLZA 1N0YA 1K8UA 1EJ3A 1LXFC 4MZLA 1PSBA 2EC6B 1QVIY 2L50A 1K94A 3GOFA 2Q91A 3JVTC 2FCEA 3K21A 2GGZA 2HF5A 3BOWA 1DJGA 1SCMC 2JNFA 2JT0A 4NDBA 4XYNA 2D8NA 3BUOB 2K7CA 1LA0A 1Y1UA 4WQ3A 1CDMA 1TIZA 3VRPA 1U5IB 4I5JA 3KO0A 1YVHA 2JTTA 1SNLA 2Y5IA 4OV2A 4GGFC 3I5GB 1IG5A 4PHKA 3TZ1A 5FYXA 2OTGB 3BUXB 2BBNA 1NWDA 4OCIA 3KHEA 2P6BB 2ZRTA 3CWGA 2WOSA 3NSLA 2KI4C 3PALA 5AERA 1BU3A 1A03A 3EK8A 2MA2A 1TNWA 4QJ4B 2KHNA 1IQ5A 1OMVA 1YVLA 2JZIA 1EG4A 1QJTA 1U5IA 4M2OA 2HQWA 2JPTA 1YUTA 4R1EA 2LVJA 2M97A 1WY9A 1ZMZA 2JWWA 3O6BA 1TTXA 4ORBB 1AVSA 1RFJA 3BUMB 3LCPC 4F0ZB 1B8LA 2RGIA 2PMYA 1EXRA 1RECA 5KSZA 1LVCD 4PCWA 2CT9A 4PE4A 2I94A 1B8CA 1PULA 3CZTX 1BJFA 3ZNIA 4GAOA 3ZWHA 2LMTA 1BF5A 4DCKA 2K7BA 3CGAA 3F45A 1OZOA 1SKTA 1W7JB 2JU0A 3LL8B 5KTYA 1CMGA 3CS1A 4A4CA 3SG6A 2ZFDA 3NXAA 2CBLA 2NCOA 1LA3A 3PN7B 1YRTB 2WCFA 1KFUL 2G2BA 1SR6B 2QPTA 1JBAA 2AMIA 4JWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTR A;  3TUY B;  1QAS A;  1H8B A;  2M49 B;  1DJW A;  1DJY A;  2Y1N A;  1TNP A;  4HRE E;  1PSR A;  3SG3 A;  1QLK A;  2KI6 D;  5JJG A;  5CSF A;  3I5I B;  4XJK B;  1QVI Z;  1RRO A;  3PAT A;  1L2O C;  1A29 A;  2E30 A;  2LE9 B;  4MZJ A;  2H2K A;  5K89 A;  5GQQ C;  4UPG A;  4MSP A;  3PLF B;  2KFF A;  1OZS A;  1RWY A;  1ZAC A;  2Y4Q A;  4OVN F;  2MJW B;  1SCV A;  2M1U A;  2KNE A;  2EHB A;  1PVB A;  1F55 A;  4MRX A;  1CDL A;  2JT3 A;  2M0R A;  1ODB A;  3M0W A;  4C0K A;  1CMF A;  2AUC A;  2Y1M A;  2PAS A;  4MEW A;  1KSM A;  3KF9 A;  1QS7 A;  2BKI B;  4MZK A;  1OQP A;  2K61 A;  1WRL A;  1AJ4 A;  3DD4 A;  3E3R A;  1CLL A;  2JOJ A;  3IQO A;  4U8D A;  1QAT A;  3VGO A;  1NX2 A;  2KQY A;  2JQ6 A;  2I7A A;  5HKZ A;  4GPL B;  2BE6 A;  4PHJ A;  1RTP 1;  4C0L A;  1V1G A;  1EG3 A;  1CFC A;  5DKR A;  1UP5 A;  1ZFS A;  2Q4U A;  4USL A;  1BR4 B;  1UHH A;  4PE1 A;  2JTZ A;  1J1E A;  5HLO A;  2L4H A;  2FCD A;  1R6P A;  1YUU A;  1FI5 A;  1TCO B;  2OS8 C;  2ZND A;  3BOW B;  3FWC A;  1TNQ A;  2H61 A;  2L98 A;  2MAZ A;  3EVR A;  5I2L A;  3TDZ A;  2O5G A;  1DGU A;  1PK0 D;  1IWQ A;  1DJZ A;  3DF0 B;  1L7Z A;  2ZRS A;  3I5H C;  1S5G Y;  1SW8 A;  1KFX S;  1S6I A;  4DIR A;  2G9B A;  4PAL A;  1CLM A;  2LNK A;  4I5K A;  1HT9 A;  4A4B A;  3WHU B;  2LV7 A;  1AHR A;  1IKU A;  1YX8 A;  2EC6 C;  3DVE A;  1QIW A;  1IJ5 A;  3JTD B;  4HRG A;  1J7Q A;  1UHI A;  2LMV A;  1Y0V H;  1SRA A;  2L51 A;  2QAC A;  3LK1 A;  5HLV A;  3DF0 A;  4MVF A;  5JOL A;  5B8I B;  1XFX O;  2GV5 A;  2LAP A;  2NLN A;  2BCA A;  1DMO A;  4AQI A;  3KEV A;  1BT6 A;  4Q04 A;  1OMR A;  4YGA A;  2LAN A;  1AUI B;  2PAL A;  3KPX A;  1WDC B;  3I5G C;  1NSH A;  2BBM A;  2WND A;  1E8A A;  1Y6W A;  2HPS A;  2OTG C;  1DJI A;  1KK7 Y;  1FW4 A;  3A8R A;  4ORA B;  1NX0 A;  1UUR A;  1B7T Y;  3PM8 A;  4PHN A;  2L2E A;  1ALW A;  1WRK A;  1CFF A;  5CSJ A;  1ALV A;  1W7I B;  2KBI A;  2TN4 A;  5HYD A;  1K2H A;  3HCM A;  1CFD A;  2F3Y A;  2M8U A;  2KQ6 A;  1FI6 A;  4NQG A;  1XO5 A;  2CTN A;  4ICB A;  1S3P A;  1CM4 A;  1TOP A;  4DS7 A;  1GQM A;  1XFW O;  2HET A;  1YRU B;  2FJU B;  2KAX A;  4L9M A;  4MN0 A;  2KAY A;  2HQ8 A;  4TNC A;  1KQM B;  4PDZ A;  1M31 A;  1ZOT B;  4OR9 B;  3VRQ A;  2ZNE A;  1G33 A;  2M1K B;  5DKN A;  4CFQ A;  1K93 D;  1NYA A;  3I5F B;  5CPV A;  1NCX A;  4GUK A;  1H4B A;  3O2P A;  1NX1 A;  4CLN A;  3PSR A;  3PN7 C;  1J7R A;  3O4Y A;  1GJY A;  2PVB A;  2SAS A;  1SYM A;  1SR6 C;  1XYD A;  2M9G A;  1M46 A;  1F54 A;  5TNC A;  3AKB A;  4MBE A;  2F33 A;  4YBH B;  4NDC A;  3TUY C;  1SK6 D;  1K9K A;  2K7O A;  2LUC A;  1S1E A;  3H4S E;  2BCB A;  5CSI A;  1S5G Z;  2KFH A;  3DVK A;  1RK9 A;  4BY5 A;  1C7W A;  1K9P A;  1S36 A;  5AXI A;  1B47 A;  1KWO B;  1KK8 B;  1EH2 A;  3D0Y B;  3TS5 B;  1AP4 A;  3CR4 X;  5AFP A;  3EVV A;  1TRF A;  1CLB A;  1LKJ A;  2GGM A;  3I5I C;  1OMD A;  1KSO A;  2VRG A;  2LLS A;  1XK4 C;  1OE9 B;  1YR5 A;  4FQO A;  4CFR A;  2F3Z A;  1DVI A;  4C0J A;  1XFY O;  1ZUZ A;  1JUO A;  2M29 A;  4ZCU A;  1JFJ A;  2KYC A;  1KFU S;  4DUQ A;  2COL B;  1X02 A;  2CNP A;  1SY9 A;  3D0Y A;  1GGZ A;  1F71 A;  4YGE B;  2BCX A;  4BY4 A;  4YI8 A;  1IGV A;  3SG7 A;  1SMG A;  4YGD B;  3OB1 B;  1KK7 Z;  1MHO A;  1MXE A;  4IL1 A;  3TDI A;  3WHT B;  1B7T Z;  4I5L B;  1F8H A;  1OSA A;  2R2I A;  2JC2 A;  2JNX A;  1B4C A;  3ICB A;  3CR2 A;  3SIB A;  1JWD A;  1C07 A;  4P2Y B;  5BPJ A;  2NCP A;  1CKK A;  3AAK A;  1N2D A;  4N1F A;  1DF0 B;  2LM5 A;  1B1G A;  4DRW A;  3FWB A;  1NPQ A;  3OX5 A;  3SIA A;  1J1D A;  2MLF C;  2JT8 A;  3D10 A;  3EKH A;  1NCZ A;  1MWN A;  4JPZ B;  1IRJ A;  2BL0 B;  2F8P A;  1KFX L;  1UHN A;  4ZCV A;  5D7F A;  1K95 A;  2LHL A;  1DF0 A;  2KI6 C;  1HQV A;  1LIN A;  1R2U A;  2M7N A;  1DTL A;  1UUS A;  1F4O A;  1K9U A;  2LLT A;  2B1U A;  1WRZ A;  3FS7 A;  1A75 B;  1K90 D;  1XVJ A;  1XFU O;  2WC8 A;  1C7V A;  3C1V A;  2BEC A;  3BYA A;  2ZN9 A;  2LVI A;  1CDN A;  2L0P A;  1D1O A;  1PVA A;  2L4I A;  2ZN8 A;  4HRH A;  1KQV A;  1RJV A;  2KBM A;  5G08 A;  5I2O A;  2NXQ A;  1VRK A;  4YGC B;  3JTD C;  2CXJ A;  2WOR A;  3GK2 A;  3AAJ A;  1QXP A;  3JVT B;  4JQ0 D;  1CNP A;  1XA5 A;  2JRF A;  4QJ3 B;  2A4J A;  5D69 A;  2LP2 A;  1A75 A;  3CR5 X;  1SCM B;  4P5O E;  1BOD A;  3EKJ A;  1DT7 B;  2DOQ A;  4CID A;  3EK4 A;  2NZ0 A;  1QX2 A;  1NX3 A;  1SL7 A;  1WDC C;  3SG4 A;  5HKY A;  4GBA A;  1DGV A;  1A2X A;  1K96 A;  1NIW A;  3NSO A;  4OKH A;  1B9A A;  1YUR A;  1CFP A;  2MRD A;  4WQ2 A;  2K2F A;  2KI4 B;  3NSI A;  4AQJ A;  1B8R A;  1BOC A;  1SPY A;  2FOT A;  5IBW A;  4PE0 A;  1Y1X A;  1Y1A A;  3BQ3 A;  1AK8 A;  2OPO A;  1S26 D;  2ISD A;  1J7O A;  2PSR A;  2LVK A;  1SBJ A;  1MR8 A;  2LC5 A;  3OHM B;  4GGF A;  4GNK B;  1DJH A;  3DVM A;  3MSE B;  5J3X A;  1FBV A;  5AEQ A;  4GFT A;  4WRI A;  1BLQ A;  3LK0 A;  2IS9 A;  1EL4 A;  1KQM C;  2LMU A;  1Q80 A;  3BXK A;  1TN4 A;  2MBX A;  2SCP A;  2WCB A;  2I18 A;  4PE7 A;  5I8N A;  3I5F C;  1JF0 A;  5I2Q A;  2JUL A;  1IQ3 A;  2KFG A;  1BG1 A;  1CM1 A;  4CPV A;  1QV1 A;  4PHM A;  3WXA A;  2PRU A;  1NUB A;  3CLN A;  2CCM A;  3O78 A;  1PRW A;  5HKW A;  4HSZ A;  1J55 A;  4N1G A;  1QV0 A;  2WCE A;  1QIV A;  5PAL A;  4M2P A;  1WLZ A;  1JC2 A;  4ORC B;  1FF1 A;  2LLU A;  4FTG A;  4D1E A;  1NP8 A;  3WNX B;  2K7D A;  1F70 A;  1JF2 A;  4QJ5 B;  1S6C A;  3IF7 A;  2M3W A;  2KGB C;  2LCP A;  2LHI A;  3HX4 A;  4I5N B;  2BKH B;  2BE4 A;  1KWO C;  1KK8 C;  2AAO A;  4NDD A;  3TS5 C;  1N65 A;  1UHK A;  1CDP A;  1AJ5 A;  1YTZ C;  1QLS A;  2ZKM X;  1CB1 A;  1G8I A;  3BUN B;  3CTN A;  5ER5 A;  2JXC A;  2EGD A;  1WLM A;  1L2O B;  1MXL C;  3IQQ A;  2K2A A;  1TCF A;  1QX5 B;  5KU1 A;  4E68 A;  3VRR A;  1XFZ O;  5DKQ A;  2MLE C;  1MUX A;  1OOJ A;  1UWO A;  3SJS A;  1QTX A;  1NCY A;  3LLE A;  4YI9 A;  1KCY A;  1FPW A;  2F2O A;  1M63 B;  4N5X A;  4ETO A;  1SL8 A;  1QX7 A;  2E6W A;  1SL9 A;  2H61 C;  3VRO A;  2O60 A;  2M7L A;  3AKA A;  1J7P A;  4AOM A;  2LP3 A;  4YGB B;  4XJK A;  3QRX A;  5ER4 X;  2MHH A;  3VRN A;  1XK4 A;  2V53 A;  2KOT A;  2F2P A;  3A4U B;  2KDH A;  2KGR A;  4YRU A;  3EVU A;  4MRY A;  3OB2 B;  4GGN A;  3SG2 A;  2K8M B;  1YUS A;  1IJ6 A;  3DVJ A;  4M2Q A;  1UHJ A;  1MQ1 A;  3NSK A;  3FIA A;  1M39 A;  1V1F A;  2BL0 C;  2K0J A;  2L5X B;  2JXL A;  1PAL A;  1S6J A;  1JFK A;  2I2R E;  2KYF A;  1IH0 A;  3EK7 A;  1M45 A;  3GK4 X;  3SG5 A;  1G4Y R;  3RM1 A;  2OS8 B;  2KSP A;  3GK1 A;  5CSN A;  3BUW B;  3PFV A;  5F6T A;  1DJX A;  2LVV A;  3OP0 A;  1TNX A;  1JSA A;  1XFV O;  1BMO A;  1YX7 A;  2LUX A;  3I5H B;  1BR1 B;  2KAV A;  4MLW A;  3TDU A;  1GGW A;  3OX6 A;  1A4P A;  1MF8 B;  1F4Q A;  5AAN A;  3RLZ A;  1N0Y A;  1K8U A;  1EJ3 A;  1LXF C;  4MZL A;  1PSB A;  2EC6 B;  1QVI Y;  2L50 A;  1K94 A;  3GOF A;  2Q91 A;  3JVT C;  2FCE A;  3K21 A;  2GGZ A;  2HF5 A;  3BOW A;  1DJG A;  1SCM C;  2JNF A;  2JT0 A;  4NDB A;  4XYN A;  2D8N A;  3BUO B;  2K7C A;  1LA0 A;  1Y1U A;  4WQ3 A;  1CDM A;  1TIZ A;  3VRP A;  1U5I B;  4I5J A;  3KO0 A;  1YVH A;  2JTT A;  1SNL A;  2Y5I A;  4OV2 A;  4GGF C;  3I5G B;  1IG5 A;  4PHK A;  3TZ1 A;  5FYX A;  2OTG B;  3BUX B;  2BBN A;  1NWD A;  4OCI A;  3KHE A;  2P6B B;  2ZRT A;  3CWG A;  2WOS A;  3NSL A;  2KI4 C;  3PAL A;  5AER A;  1BU3 A;  1A03 A;  3EK8 A;  2MA2 A;  1TNW A;  4QJ4 B;  2KHN A;  1IQ5 A;  1OMV A;  1YVL A;  2JZI A;  1EG4 A;  1QJT A;  1U5I A;  4M2O A;  2HQW A;  2JPT A;  1YUT A;  4R1E A;  2LVJ A;  2M97 A;  1WY9 A;  1ZMZ A;  2JWW A;  3O6B A;  1TTX A;  4ORB B;  1AVS A;  1RFJ A;  3BUM B;  3LCP C;  4F0Z B;  1B8L A;  2RGI A;  2PMY A;  1EXR A;  1REC A;  5KSZ A;  1LVC D;  4PCW A;  2CT9 A;  4PE4 A;  2I94 A;  1B8C A;  1PUL A;  3CZT X;  1BJF A;  3ZNI A;  4GAO A;  3ZWH A;  2LMT A;  1BF5 A;  4DCK A;  2K7B A;  3CGA A;  3F45 A;  1OZO A;  1SKT A;  1W7J B;  2JU0 A;  3LL8 B;  5KTY A;  1CMG A;  3CS1 A;  4A4C A;  3SG6 A;  2ZFD A;  3NXA A;  2CBL A;  2NCO A;  1LA3 A;  3PN7 B;  1YRT B;  2WCF A;  1KFU L;  2G2B A;  1SR6 B;  2QPT A;  1JBA A;  2AMI A;  4JWQ A; 
#chains in the Genus database with same CATH topology
 1CTR A;  3TUY B;  1QAS A;  1H8B A;  2M49 B;  1DJW A;  1DJY A;  4F7F A;  2Y1N A;  1TNP A;  4HRE E;  1PSR A;  3SG3 A;  1QLK A;  2KI6 D;  1TUJ A;  2QEB A;  5JJG A;  5CSF A;  3I5I B;  4XJK B;  1QVI Z;  3PM2 A;  1RRO A;  3PAT A;  1L2O C;  1A29 A;  2E30 A;  2LE9 B;  4MZJ A;  2H2K A;  5K89 A;  5GQQ C;  4UPG A;  4MSP A;  1C3Z A;  3PLF B;  3QME A;  2KFF A;  3UO9 A;  2QDI A;  1OZS A;  1RWY A;  1ZAC A;  2Y4Q A;  4OVN F;  2MJW B;  1SCV A;  2M1U A;  2KNE A;  2EHB A;  1PVB A;  1F55 A;  4MRX A;  5FI2 A;  1CDL A;  2JT3 A;  2K60 A;  2M0R A;  1ODB A;  3B88 A;  3M0W A;  4C0K A;  1CMF A;  2WC6 A;  2AUC A;  2Y1M A;  2PAS A;  4MEW A;  1KSM A;  3KF9 A;  1QS7 A;  2BKI B;  4MZK A;  1OQP A;  2K61 A;  1WRL A;  1AJ4 A;  3DD4 A;  3E3R A;  1CLL A;  2JOJ A;  3IQO A;  3VB1 A;  4U8D A;  1QAT A;  3VGO A;  1NX2 A;  2KQY A;  2JQ6 A;  2I7A A;  5HKZ A;  4GPL B;  2BE6 A;  4PHJ A;  1RTP 1;  1W9Z A;  1V1G A;  1EG3 A;  4C0L A;  2ERB A;  1CFC A;  5DKR A;  1UP5 A;  1ZFS A;  2Q4U A;  4USL A;  1BR4 B;  1UHH A;  4PE1 A;  1QWV A;  2JTZ A;  5EL2 A;  1J1E A;  5HLO A;  2L4H A;  2FCD A;  1R6P A;  1YUU A;  3NGV A;  1TCO B;  1FI5 A;  4FQT A;  1DC1 A;  2OS8 C;  2ZND A;  3BOW B;  3FWC A;  1TNQ A;  2H61 A;  3CYZ A;  2L98 A;  2MAZ A;  3EVR A;  5I2L A;  3S0E A;  3TDZ A;  2O5G A;  1DGU A;  1PK0 D;  1T14 A;  1IWQ A;  1DJZ A;  3DF0 B;  1L7Z A;  2ZRS A;  3SS3 A;  3I5H C;  1S5G Y;  3S0F A;  2BNX A;  1SW8 A;  1KFX S;  1S6I A;  4DIR A;  2G9B A;  4PAL A;  1CLM A;  2LNK A;  4I5K A;  1HT9 A;  4A4B A;  2WCK A;  3WHU B;  2LV7 A;  1AHR A;  2WCM A;  1YX8 A;  2EC6 C;  1OW4 A;  1QIW A;  1IJ5 A;  3DVE A;  3JTD B;  4HRG A;  1UHI A;  2LMV A;  1Y0V H;  1SRA A;  2L51 A;  1IIO A;  3K1E A;  2QAC A;  3LK1 A;  5HLV A;  3DF0 A;  4MVF A;  5JOL A;  3B7A A;  1XFX O;  2GV5 A;  2LAP A;  2NLN A;  2BCA A;  5B8I B;  1DMO A;  5D3O A;  4AQI A;  3KEV A;  1BT6 A;  4Q04 A;  1OMR A;  3S0G A;  4YGA A;  2LAN A;  1AUI B;  2PAL A;  3B6X A;  3KPX A;  1WDC B;  3I5G C;  1NSH A;  2BBM A;  1SSE B;  2WND A;  1E8A A;  1Y6W A;  3IVT A;  2HPS A;  2OTG C;  1DJI A;  3BFB A;  1KK7 Y;  1FW4 A;  3A8R A;  4ORA B;  1NX0 A;  1UUR A;  1B7T Y;  3PM8 A;  4PHN A;  2L2E A;  4PT1 A;  2PQL A;  1ALW A;  1WRK A;  4KYN A;  1CFF A;  5CSJ A;  3SS4 A;  1ALV A;  1W7I B;  2KBI A;  2TN4 A;  1DEK A;  5HYD A;  1K2H A;  4OZD A;  2QEV A;  3HCM A;  1CFD A;  2F3Y A;  2M8U A;  2KQ6 A;  1FI6 A;  1ORG A;  4NQG A;  1XO5 A;  2CTN A;  4ICB A;  1S3P A;  1CM4 A;  1TOP A;  4DS7 A;  2L2C A;  3S0A A;  1GQM A;  1XFW O;  2HET A;  1YRU B;  2FJU B;  2KAX A;  4L9M A;  4MN0 A;  2KAY A;  2QEH A;  2HQ8 A;  4TNC A;  1KQM B;  3D74 A;  4PDZ A;  1OOG A;  1M31 A;  1ZOT B;  4OR9 B;  3VRQ A;  2GTE A;  3RZS A;  2ZNE A;  1G33 A;  2M1K B;  5DKN A;  4CFQ A;  1K93 D;  1NYA A;  3I5F B;  4INW A;  5CPV A;  1NCX A;  2WC5 A;  4GUK A;  1H4B A;  3O2P A;  1NX1 A;  4CLN A;  3PSR A;  3PN7 C;  1J7R A;  3O4Y A;  1GJY A;  2PVB A;  2SAS A;  3FE8 A;  1SYM A;  1SR6 C;  4JKT A;  1XYD A;  2M9G A;  4JD9 A;  1M46 A;  1F54 A;  5TNC A;  3AKB A;  4MBE A;  2F33 A;  2L5Y A;  4YBH B;  4NDC A;  3TUY C;  3BJH A;  1SK6 D;  1K9K A;  2BAP A;  2K7O A;  2LUC A;  1S1E A;  3H4S E;  2BCB A;  5CSI A;  1S5G Z;  2KFH A;  3DVK A;  1RK9 A;  4BY5 A;  1C7W A;  1K9P A;  1S36 A;  5AXI A;  1B47 A;  1KWO B;  1KK8 B;  1EH2 A;  3D0Y B;  3TS5 B;  1AP4 A;  3CR4 X;  5AFP A;  3EVV A;  1TRF A;  3R1P A;  1LKJ A;  2GGM A;  3I5I C;  1OMD A;  3OGN A;  1KSO A;  2VRG A;  1CLB A;  2LLS A;  1XK4 C;  1OE9 B;  1YR5 A;  4FQO A;  4CFR A;  2F3Z A;  1DVI A;  4C0J A;  2H8V A;  3EG5 B;  1XFY O;  1ZUZ A;  1JUO A;  2M29 A;  4ZCU A;  1JFJ A;  2KYC A;  1KFU S;  4DUQ A;  2COL B;  3NHT A;  1X02 A;  2CNP A;  1SY9 A;  3D0Y A;  1GGZ A;  1TUZ A;  1TWO A;  4YGE B;  1IKU A;  1F71 A;  2BCX A;  4BY4 A;  4YI8 A;  1IGV A;  3SG7 A;  1SMG A;  4YGD B;  3OB1 B;  1KK7 Z;  1MHO A;  1MXE A;  4IL1 A;  3TDI A;  3WHT B;  1B7T Z;  4I5L B;  1F8H A;  1OSA A;  2R2I A;  2JC2 A;  2JNX A;  1B4C A;  3ICB A;  3CR2 A;  3SIB A;  1JWD A;  1C07 A;  4P2Y B;  5BPJ A;  2NCP A;  1CKK A;  3AAK A;  1N2D A;  4N1F A;  1DF0 B;  2LM5 A;  3SS5 A;  1B1G A;  4DRW A;  3FWB A;  1NPQ A;  3OX5 A;  3SIA A;  1J1D A;  2MLF C;  2JT8 A;  3D10 A;  3DYE A;  3EKH A;  1NCZ A;  1MWN A;  4JPZ B;  1IRJ A;  2BL0 B;  2F8P A;  1KFX L;  1UHN A;  4ZCV A;  5D7F A;  1K95 A;  2LHL A;  1DF0 A;  2KI6 C;  1HQV A;  1LIN A;  1R2U A;  2M7N A;  1DTL A;  1UUS A;  1F4O A;  3B87 A;  1K9U A;  3D73 A;  2LLT A;  2B1U A;  2KLE A;  1WRZ A;  3FS7 A;  3FE6 A;  1A75 B;  1K90 D;  3O4X A;  1XVJ A;  1XFU O;  2WC8 A;  1C7V A;  3C1V A;  2BEC A;  3BYA A;  2ZN9 A;  2LVI A;  1CDN A;  2L0P A;  1D1O A;  1PVA A;  2L4I A;  2ZN8 A;  4HRH A;  1KQV A;  1DEL A;  1RJV A;  2KBM A;  5G08 A;  5I2O A;  2NXQ A;  4INX A;  1VRK A;  4YGC B;  3JTD C;  2CXJ A;  2WOR A;  3GK2 A;  3AAJ A;  1QXP A;  3JVT B;  4JQ0 D;  1CNP A;  1XA5 A;  2JRF A;  4QJ3 B;  2A4J A;  5D69 A;  2LP2 A;  1A75 A;  3CR5 X;  1SCM B;  4P5O E;  1BOD A;  3EKJ A;  2KPH A;  1DT7 B;  2DOQ A;  4CID A;  3EK4 A;  2NZ0 A;  1QX2 A;  1NX3 A;  1SL7 A;  1WDC C;  3SG4 A;  5HKY A;  4GBA A;  1DGV A;  1A2X A;  1K96 A;  1NIW A;  3NSO A;  3R1O A;  4OKH A;  1B9A A;  1YUR A;  1CFP A;  2MRD A;  4WQ2 A;  2K2F A;  2KI4 B;  3NSI A;  4AQJ A;  1B8R A;  1BOC A;  1SPY A;  3FE9 A;  1P28 A;  2FOT A;  2YGU A;  5IBW A;  4PE0 A;  1Y1X A;  1Y1A A;  3BQ3 A;  1AK8 A;  2OPO A;  1S26 D;  2ISD A;  1J7O A;  2PSR A;  2LVK A;  1SBJ A;  1MR8 A;  2LC5 A;  3OHM B;  4GGF A;  4GNK B;  1DJH A;  3DVM A;  3MSE B;  5J3X A;  1FBV A;  5AEQ A;  4GFT A;  4WRI A;  1BLQ A;  3LK0 A;  2IS9 A;  1EL4 A;  1KQM C;  5FI7 A;  2LMU A;  1Q80 A;  3BXK A;  1TN4 A;  2MBX A;  2SCP A;  2WCB A;  2I18 A;  4PE7 A;  5I8N A;  3I5F C;  1JF0 A;  5I2Q A;  2JUL A;  1IQ3 A;  2KFG A;  1BG1 A;  1CM1 A;  4CPV A;  1QV1 A;  4PHM A;  3WXA A;  2PRU A;  1DQE A;  1NUB A;  3CLN A;  2CCM A;  3O78 A;  1PRW A;  5HKW A;  4HSZ A;  1J55 A;  4N1G A;  2KLD A;  1XFR A;  1QV0 A;  2WCE A;  1QIV A;  2WCH A;  5PAL A;  4M2P A;  1LS8 A;  1WLZ A;  1JC2 A;  3CDN A;  4ORC B;  2QEO A;  1FF1 A;  2LLU A;  4FTG A;  4D1E A;  1NP8 A;  3WNX B;  2K7D A;  1F70 A;  1JF2 A;  3R1V A;  4QJ5 B;  3Q8I A;  1S6C A;  3IF7 A;  3UNW A;  2M3W A;  2KGB C;  2LCP A;  2LHI A;  3HX4 A;  3BFH A;  4I5N B;  2BE4 A;  2BKH B;  1KWO C;  1KK8 C;  2AAO A;  4NDD A;  3TS5 C;  1N65 A;  1UHK A;  1CDP A;  1AJ5 A;  1YTZ C;  1QLS A;  2ZKM X;  1CB1 A;  3OBV A;  1G8I A;  3BUN B;  3CTN A;  3L4L A;  5ER5 A;  2JXC A;  2EGD A;  1WLM A;  1L2O B;  1MXL C;  3CZ2 A;  2WCL A;  2K2A A;  1TCF A;  3IQQ A;  1QX5 B;  2FJY A;  5KU1 A;  4E68 A;  3VRR A;  1XFZ O;  5DKQ A;  2MLE C;  1MUX A;  1OOJ A;  1UWO A;  3SJS A;  1QTX A;  1NCY A;  3LLE A;  4YI9 A;  1KCY A;  1FPW A;  3CZ1 A;  2F2O A;  1M63 B;  4N5X A;  4ETO A;  1SL8 A;  1Z4H A;  1QX7 A;  2E6W A;  1SL9 A;  2H61 C;  3VRO A;  1Z2C B;  2O60 A;  3N7H A;  3AKA A;  2M7L A;  4AOM A;  2LP3 A;  1J7P A;  4YGB B;  4XJK A;  3D78 A;  3QRX A;  5ER4 X;  2MHH A;  3VRN A;  1XK4 A;  2V53 A;  2KOT A;  2F2P A;  3A4U B;  2KDH A;  2KGR A;  4YRU A;  3EVU A;  4MRY A;  3OB2 B;  4GGN A;  3SG2 A;  2K8M B;  5I94 A;  1YUS A;  3PJI A;  1IJ6 A;  3DVJ A;  4M2Q A;  1UHJ A;  5DIC A;  1MQ1 A;  3NSK A;  3FIA A;  1M39 A;  1V1F A;  2BL0 C;  2K0J A;  2L5X B;  2JXL A;  1PAL A;  1GM0 A;  1S6J A;  1JFK A;  2I2R E;  2KYF A;  1IH0 A;  3EK7 A;  1M45 A;  3GK4 X;  3SG5 A;  1G4Y R;  3RM1 A;  2OS8 B;  2KSP A;  3GK1 A;  5CSN A;  3BUW B;  3PFV A;  3R72 A;  5F6T A;  3NHI A;  1DJX A;  2LVV A;  3L4A A;  3OP0 A;  3BFA A;  1TNX A;  1JSA A;  3DZT A;  1XFV O;  1BMO A;  1YX7 A;  2LUX A;  3I5H B;  1BR1 B;  2KAV A;  4MLW A;  5FI6 A;  3TDU A;  3OX6 A;  1GGW A;  1A4P A;  1MF8 B;  1F4Q A;  4IJ7 A;  3L47 A;  2PYQ A;  5AAN A;  1N0Y A;  3RLZ A;  1K8U A;  1EJ3 A;  1LXF C;  4MZL A;  1PSB A;  2EC6 B;  1QVI Y;  2L50 A;  1K94 A;  3GOF A;  2Q91 A;  3JVT C;  2FCE A;  3K21 A;  2GGZ A;  2HF5 A;  3BOW A;  1DJG A;  1SCM C;  2JNF A;  2JT0 A;  4NDB A;  4XYN A;  2D8N A;  3BUO B;  3D77 A;  3DXL A;  1J7Q A;  2K7C A;  1LA0 A;  1Y1U A;  2P71 A;  4WQ3 A;  1CDM A;  1TIZ A;  3VRP A;  1U5I B;  3CZ0 A;  3DY9 A;  3KO0 A;  4I5J A;  1YVH A;  2JTT A;  1SNL A;  2Y5I A;  3CAB A;  3S0B A;  4OV2 A;  4GGF C;  3I5G B;  1IG5 A;  4PHK A;  3TZ1 A;  5FYX A;  2OTG B;  3BUX B;  2BBN A;  1NWD A;  4OCI A;  3KHE A;  2P6B B;  2ZRT A;  3CWG A;  2WOS A;  3NSL A;  2KI4 C;  3PAL A;  5AER A;  1BU3 A;  1A03 A;  3EK8 A;  2MA2 A;  1TNW A;  4QJ4 B;  2KHN A;  1IQ5 A;  1OMV A;  1YVL A;  2JZI A;  1EG4 A;  1QJT A;  1U5I A;  4M2O A;  2HQW A;  2JPT A;  1YUT A;  4R1E A;  2LVJ A;  2M97 A;  1OOI X;  1WY9 A;  1ZMZ A;  2JWW A;  3O6B A;  1TTX A;  4ORB B;  2P70 A;  1OOF A;  1AVS A;  1RFJ A;  3BUM B;  3LCP C;  4F0Z B;  1B8L A;  3V2L A;  2RGI A;  2PMY A;  1EXR A;  1REC A;  5KSZ A;  1LVC D;  4PCW A;  2CT9 A;  4PE4 A;  2I94 A;  3S0D A;  1B8C A;  1PUL A;  3B86 A;  1BJF A;  1OOH A;  3CZT X;  4GAO A;  3ZNI A;  2LMT A;  3ZWH A;  4DCK A;  1BF5 A;  2K7B A;  3CGA A;  3D75 A;  3F45 A;  1OZO A;  1SKT A;  2WCJ A;  1W7J B;  2JU0 A;  3LL8 B;  5KTY A;  1CMG A;  3CS1 A;  4A4C A;  3SG6 A;  3D76 A;  2ZFD A;  3NXA A;  1C3Y A;  2CBL A;  2NCO A;  1LA3 A;  3PN7 B;  2JPO A;  5HL1 A;  1YRT B;  2WCF A;  1KFU L;  2G2B A;  1SR6 B;  2QPT A;  1JBA A;  2AMI A;  4JWQ A; 
#chains in the Genus database with same CATH homology
 1CTR A;  3TUY B;  1QAS A;  1H8B A;  2M49 B;  1DJW A;  1DJY A;  2Y1N A;  1TNP A;  4HRE E;  1PSR A;  3SG3 A;  1QLK A;  2KI6 D;  5JJG A;  5CSF A;  3I5I B;  4XJK B;  1QVI Z;  1RRO A;  3PAT A;  1L2O C;  1A29 A;  2E30 A;  2LE9 B;  4MZJ A;  2H2K A;  5K89 A;  5GQQ C;  4UPG A;  4MSP A;  3PLF B;  2KFF A;  1OZS A;  1RWY A;  1ZAC A;  2Y4Q A;  4OVN F;  2MJW B;  1SCV A;  2M1U A;  2KNE A;  2EHB A;  1PVB A;  1F55 A;  4MRX A;  1CDL A;  2JT3 A;  2M0R A;  1ODB A;  3M0W A;  4C0K A;  1CMF A;  2AUC A;  2Y1M A;  2PAS A;  4MEW A;  1KSM A;  3KF9 A;  1QS7 A;  2BKI B;  4MZK A;  1OQP A;  2K61 A;  1WRL A;  1AJ4 A;  3DD4 A;  3E3R A;  1CLL A;  2JOJ A;  3IQO A;  4U8D A;  1QAT A;  3VGO A;  1NX2 A;  2KQY A;  2JQ6 A;  2I7A A;  5HKZ A;  4GPL B;  2BE6 A;  4PHJ A;  1RTP 1;  4C0L A;  1V1G A;  1EG3 A;  1CFC A;  5DKR A;  1UP5 A;  1ZFS A;  2Q4U A;  4USL A;  1BR4 B;  1UHH A;  4PE1 A;  2JTZ A;  1J1E A;  5HLO A;  2L4H A;  2FCD A;  1R6P A;  1YUU A;  1FI5 A;  1TCO B;  2OS8 C;  2ZND A;  3BOW B;  3FWC A;  1TNQ A;  2H61 A;  2L98 A;  2MAZ A;  3EVR A;  5I2L A;  3TDZ A;  2O5G A;  1DGU A;  1PK0 D;  1IWQ A;  1DJZ A;  3DF0 B;  1L7Z A;  2ZRS A;  3I5H C;  1S5G Y;  1SW8 A;  1KFX S;  1S6I A;  4DIR A;  2G9B A;  4PAL A;  1CLM A;  2LNK A;  4I5K A;  1HT9 A;  4A4B A;  3WHU B;  2LV7 A;  1AHR A;  1IKU A;  1YX8 A;  2EC6 C;  3DVE A;  1QIW A;  1IJ5 A;  3JTD B;  4HRG A;  1J7Q A;  1UHI A;  2LMV A;  1Y0V H;  1SRA A;  2L51 A;  2QAC A;  3LK1 A;  5HLV A;  3DF0 A;  4MVF A;  5JOL A;  5B8I B;  1XFX O;  2GV5 A;  2LAP A;  2NLN A;  2BCA A;  1DMO A;  4AQI A;  3KEV A;  1BT6 A;  4Q04 A;  1OMR A;  4YGA A;  2LAN A;  1AUI B;  2PAL A;  3KPX A;  1WDC B;  3I5G C;  1NSH A;  2BBM A;  2WND A;  1E8A A;  1Y6W A;  2HPS A;  2OTG C;  1DJI A;  1KK7 Y;  1FW4 A;  3A8R A;  4ORA B;  1NX0 A;  1UUR A;  1B7T Y;  3PM8 A;  4PHN A;  2L2E A;  1ALW A;  1WRK A;  1CFF A;  5CSJ A;  1ALV A;  1W7I B;  2KBI A;  2TN4 A;  5HYD A;  1K2H A;  3HCM A;  1CFD A;  2F3Y A;  2M8U A;  2KQ6 A;  1FI6 A;  4NQG A;  1XO5 A;  2CTN A;  4ICB A;  1S3P A;  1CM4 A;  1TOP A;  4DS7 A;  1GQM A;  1XFW O;  2HET A;  1YRU B;  2FJU B;  2KAX A;  4L9M A;  4MN0 A;  2KAY A;  2HQ8 A;  4TNC A;  1KQM B;  4PDZ A;  1M31 A;  1ZOT B;  4OR9 B;  3VRQ A;  2ZNE A;  1G33 A;  2M1K B;  5DKN A;  4CFQ A;  1K93 D;  1NYA A;  3I5F B;  5CPV A;  1NCX A;  4GUK A;  1H4B A;  3O2P A;  1NX1 A;  4CLN A;  3PSR A;  3PN7 C;  1J7R A;  3O4Y A;  1GJY A;  2PVB A;  2SAS A;  1SYM A;  1SR6 C;  1XYD A;  2M9G A;  1M46 A;  1F54 A;  5TNC A;  3AKB A;  4MBE A;  2F33 A;  4YBH B;  4NDC A;  3TUY C;  1SK6 D;  1K9K A;  2K7O A;  2LUC A;  1S1E A;  3H4S E;  2BCB A;  5CSI A;  1S5G Z;  2KFH A;  3DVK A;  1RK9 A;  4BY5 A;  1C7W A;  1K9P A;  1S36 A;  5AXI A;  1B47 A;  1KWO B;  1KK8 B;  1EH2 A;  3D0Y B;  3TS5 B;  1AP4 A;  3CR4 X;  5AFP A;  3EVV A;  1TRF A;  1CLB A;  1LKJ A;  2GGM A;  3I5I C;  1OMD A;  1KSO A;  2VRG A;  2LLS A;  1XK4 C;  1OE9 B;  1YR5 A;  4FQO A;  4CFR A;  2F3Z A;  1DVI A;  4C0J A;  1XFY O;  1ZUZ A;  1JUO A;  2M29 A;  4ZCU A;  1JFJ A;  2KYC A;  1KFU S;  4DUQ A;  2COL B;  1X02 A;  2CNP A;  1SY9 A;  3D0Y A;  1GGZ A;  1F71 A;  4YGE B;  2BCX A;  4BY4 A;  4YI8 A;  1IGV A;  3SG7 A;  1SMG A;  4YGD B;  3OB1 B;  1KK7 Z;  1MHO A;  1MXE A;  4IL1 A;  3TDI A;  3WHT B;  1B7T Z;  4I5L B;  1F8H A;  1OSA A;  2R2I A;  2JC2 A;  2JNX A;  1B4C A;  3ICB A;  3CR2 A;  3SIB A;  1JWD A;  1C07 A;  4P2Y B;  5BPJ A;  2NCP A;  1CKK A;  3AAK A;  1N2D A;  4N1F A;  1DF0 B;  2LM5 A;  1B1G A;  4DRW A;  3FWB A;  1NPQ A;  3OX5 A;  3SIA A;  1J1D A;  2MLF C;  2JT8 A;  3D10 A;  3EKH A;  1NCZ A;  1MWN A;  4JPZ B;  1IRJ A;  2BL0 B;  2F8P A;  1KFX L;  1UHN A;  4ZCV A;  5D7F A;  1K95 A;  2LHL A;  1DF0 A;  2KI6 C;  1HQV A;  1LIN A;  1R2U A;  2M7N A;  1DTL A;  1UUS A;  1F4O A;  1K9U A;  2LLT A;  2B1U A;  1WRZ A;  3FS7 A;  1A75 B;  1K90 D;  1XVJ A;  1XFU O;  2WC8 A;  1C7V A;  3C1V A;  2BEC A;  3BYA A;  2ZN9 A;  2LVI A;  1CDN A;  2L0P A;  1D1O A;  1PVA A;  2L4I A;  2ZN8 A;  4HRH A;  1KQV A;  1RJV A;  2KBM A;  5G08 A;  5I2O A;  2NXQ A;  1VRK A;  4YGC B;  3JTD C;  2CXJ A;  2WOR A;  3GK2 A;  3AAJ A;  1QXP A;  3JVT B;  4JQ0 D;  1CNP A;  1XA5 A;  2JRF A;  4QJ3 B;  2A4J A;  5D69 A;  2LP2 A;  1A75 A;  3CR5 X;  1SCM B;  4P5O E;  1BOD A;  3EKJ A;  1DT7 B;  2DOQ A;  4CID A;  3EK4 A;  2NZ0 A;  1QX2 A;  1NX3 A;  1SL7 A;  1WDC C;  3SG4 A;  5HKY A;  4GBA A;  1DGV A;  1A2X A;  1K96 A;  1NIW A;  3NSO A;  4OKH A;  1B9A A;  1YUR A;  1CFP A;  2MRD A;  4WQ2 A;  2K2F A;  2KI4 B;  3NSI A;  4AQJ A;  1B8R A;  1BOC A;  1SPY A;  2FOT A;  5IBW A;  4PE0 A;  1Y1X A;  1Y1A A;  3BQ3 A;  1AK8 A;  2OPO A;  1S26 D;  2ISD A;  1J7O A;  2PSR A;  2LVK A;  1SBJ A;  1MR8 A;  2LC5 A;  3OHM B;  4GGF A;  4GNK B;  1DJH A;  3DVM A;  3MSE B;  5J3X A;  1FBV A;  5AEQ A;  4GFT A;  4WRI A;  1BLQ A;  3LK0 A;  2IS9 A;  1EL4 A;  1KQM C;  2LMU A;  1Q80 A;  3BXK A;  1TN4 A;  2MBX A;  2SCP A;  2WCB A;  2I18 A;  4PE7 A;  5I8N A;  3I5F C;  1JF0 A;  5I2Q A;  2JUL A;  1IQ3 A;  2KFG A;  1BG1 A;  1CM1 A;  4CPV A;  1QV1 A;  4PHM A;  3WXA A;  2PRU A;  1NUB A;  3CLN A;  2CCM A;  3O78 A;  1PRW A;  5HKW A;  4HSZ A;  1J55 A;  4N1G A;  1QV0 A;  2WCE A;  1QIV A;  5PAL A;  4M2P A;  1WLZ A;  1JC2 A;  4ORC B;  1FF1 A;  2LLU A;  4FTG A;  4D1E A;  1NP8 A;  3WNX B;  2K7D A;  1F70 A;  1JF2 A;  4QJ5 B;  1S6C A;  3IF7 A;  2M3W A;  2KGB C;  2LCP A;  2LHI A;  3HX4 A;  4I5N B;  2BKH B;  2BE4 A;  1KWO C;  1KK8 C;  2AAO A;  4NDD A;  3TS5 C;  1N65 A;  1UHK A;  1CDP A;  1AJ5 A;  1YTZ C;  1QLS A;  2ZKM X;  1CB1 A;  1G8I A;  3BUN B;  3CTN A;  5ER5 A;  2JXC A;  2EGD A;  1WLM A;  1L2O B;  1MXL C;  3IQQ A;  2K2A A;  1TCF A;  1QX5 B;  5KU1 A;  4E68 A;  3VRR A;  1XFZ O;  5DKQ A;  2MLE C;  1MUX A;  1OOJ A;  1UWO A;  3SJS A;  1QTX A;  1NCY A;  3LLE A;  4YI9 A;  1KCY A;  1FPW A;  2F2O A;  1M63 B;  4N5X A;  4ETO A;  1SL8 A;  1QX7 A;  2E6W A;  1SL9 A;  2H61 C;  3VRO A;  2O60 A;  2M7L A;  3AKA A;  1J7P A;  4AOM A;  2LP3 A;  4YGB B;  4XJK A;  3QRX A;  5ER4 X;  2MHH A;  3VRN A;  1XK4 A;  2V53 A;  2KOT A;  2F2P A;  3A4U B;  2KDH A;  2KGR A;  4YRU A;  3EVU A;  4MRY A;  3OB2 B;  4GGN A;  3SG2 A;  2K8M B;  1YUS A;  1IJ6 A;  3DVJ A;  4M2Q A;  1UHJ A;  1MQ1 A;  3NSK A;  3FIA A;  1M39 A;  1V1F A;  2BL0 C;  2K0J A;  2L5X B;  2JXL A;  1PAL A;  1S6J A;  1JFK A;  2I2R E;  2KYF A;  1IH0 A;  3EK7 A;  1M45 A;  3GK4 X;  3SG5 A;  1G4Y R;  3RM1 A;  2OS8 B;  2KSP A;  3GK1 A;  5CSN A;  3BUW B;  3PFV A;  5F6T A;  1DJX A;  2LVV A;  3OP0 A;  1TNX A;  1JSA A;  1XFV O;  1BMO A;  1YX7 A;  2LUX A;  3I5H B;  1BR1 B;  2KAV A;  4MLW A;  3TDU A;  1GGW A;  3OX6 A;  1A4P A;  1MF8 B;  1F4Q A;  5AAN A;  3RLZ A;  1N0Y A;  1K8U A;  1EJ3 A;  1LXF C;  4MZL A;  1PSB A;  2EC6 B;  1QVI Y;  2L50 A;  1K94 A;  3GOF A;  2Q91 A;  3JVT C;  2FCE A;  3K21 A;  2GGZ A;  2HF5 A;  3BOW A;  1DJG A;  1SCM C;  2JNF A;  2JT0 A;  4NDB A;  4XYN A;  2D8N A;  3BUO B;  2K7C A;  1LA0 A;  1Y1U A;  4WQ3 A;  1CDM A;  1TIZ A;  3VRP A;  1U5I B;  4I5J A;  3KO0 A;  1YVH A;  2JTT A;  1SNL A;  2Y5I A;  4OV2 A;  4GGF C;  3I5G B;  1IG5 A;  4PHK A;  3TZ1 A;  5FYX A;  2OTG B;  3BUX B;  2BBN A;  1NWD A;  4OCI A;  3KHE A;  2P6B B;  2ZRT A;  3CWG A;  2WOS A;  3NSL A;  2KI4 C;  3PAL A;  5AER A;  1BU3 A;  1A03 A;  3EK8 A;  2MA2 A;  1TNW A;  4QJ4 B;  2KHN A;  1IQ5 A;  1OMV A;  1YVL A;  2JZI A;  1EG4 A;  1QJT A;  1U5I A;  4M2O A;  2HQW A;  2JPT A;  1YUT A;  4R1E A;  2LVJ A;  2M97 A;  1WY9 A;  1ZMZ A;  2JWW A;  3O6B A;  1TTX A;  4ORB B;  1AVS A;  1RFJ A;  3BUM B;  3LCP C;  4F0Z B;  1B8L A;  2RGI A;  2PMY A;  1EXR A;  1REC A;  5KSZ A;  1LVC D;  4PCW A;  2CT9 A;  4PE4 A;  2I94 A;  1B8C A;  1PUL A;  3CZT X;  1BJF A;  3ZNI A;  4GAO A;  3ZWH A;  2LMT A;  1BF5 A;  4DCK A;  2K7B A;  3CGA A;  3F45 A;  1OZO A;  1SKT A;  1W7J B;  2JU0 A;  3LL8 B;  5KTY A;  1CMG A;  3CS1 A;  4A4C A;  3SG6 A;  2ZFD A;  3NXA A;  2CBL A;  2NCO A;  1LA3 A;  3PN7 B;  1YRT B;  2WCF A;  1KFU L;  2G2B A;  1SR6 B;  2QPT A;  1JBA A;  2AMI A;  4JWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...