1R6PA

Nmr structure of the n-terminal domain of trout cardiac troponin c at 7 c
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
MNDIYKAAVEQLTDEQKNEFKAAFDIFIQDAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords troponin C
publication title Effect of temperature on the structure of trout troponin C
pubmed doi rcsb
source organism Oncorhynchus mykiss
molecule tags Metal binding protein
total genus 22
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2003-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1r6pA00
2I2RE 1QVIZ 1S36A 1FF1A 4AQJA 1KFXS 2L2EA 4HRHA 3VROA 4I5LB 2JXLA 1OOJA 4NQGA 2WCEA 1TOPA 2KAXA 1SW8A 2FCDA 2MA2A 2MHHA 3CLNA 3NSKA 5DKRA 3E3RA 5G08A 4DS7A 1S5GZ 1J7PA 1UP5A 3BOWA 2AMIA 1UHJA 5I8NA 3CS1A 1F4OA 4CFRA 1OMVA 4BY5A 3BXKA 1JC2A 2L50A 4MN0A 3PALA 2AAOA 4PE1A 3IF7A 1H4BA 2RGIA 1L2OB 1PULA 1QJTA 4F0ZB 1BR1B 1XYDA 5FYXA 1SCMB 2MLEC 2LP3A 5CSJA 1KK7Y 2MRDA 4Q04A 2ZKMX 2K2AA 2K8MB 2KGBC 1QVIY 1K9PA 2BL0C 2CTNA 2O5GA 1YX7A 2ZRTA 5TNCA 3BUOB 3NSOA 1YRUB 1MWNA 1S5GY 1G8IA 2KFHA 4PCWA 3VRRA 1BODA 2LVIA 1TNXA 4ORBB 4A4CA 3OB2B 3O2PA 5D7FA 1DF0A 2KGRA 1BMOA 3DVKA 4HREE 4PHKA 1RTP1 3BUXB 4GGNA 1SL8A 3LLEA 2LMVA 1AJ5A 1LKJA 3NSLA 1IRJA 1V1FA 3PFVA 3KO0A 1S1EA 2LANA 1J55A 3I5IC 4HRGA 1SYMA 5DKQA 2ISDA 1H8BA 2ZRSA 1AK8A 1YRTB 2EHBA 3DD4A 1CKKA 1UHHA 2GGZA 3ZWHA 4MLWA 2QACA 2EC6C 2KDHA 3I5GB 2CNPA 1JFJA 2M1KB 1CNPA 2AUCA 2F33A 1CDMA 2ZN9A 2BKIB 2KFFA 1PRWA 2G9BA 3DF0A 4AQIA 1R2UA 3EKHA 4CFQA 2JNFA 2KOTA 2O60A 3DVMA 2CBLA 1MUXA 3I5FB 3TS5C 2JTZA 3TZ1A 1W7JB 4MZLA 1B7TZ 3AKBA 1TCFA 4MEWA 1LA3A 1XO5A 1SRAA 1ODBA 1OMRA 1K94A 1UURA 3I5HB 2TN4A 1G33A 4CPVA 1EG3A 5PALA 1CFFA 1NP8A 1SCMC 3HCMA 2PMYA 4MZJA 3C1VA 5IBWA 1CTRA 1HT9A 2KHNA 4PE4A 2BCXA 1SCVA 5KSZA 1JSAA 3LL8B 1QLSA 3FWBA 5HLOA 2M97A 1Y6WA 1NUBA 1DJYA 2A4JA 3AAKA 4E68A 3GK2A 1AUIB 1UUSA 1LA0A 1JF2A 4I5KA 2OPOA 5KU1A 1M45A 4M2QA 1QASA 1IGVA 1S26D 3BUNB 1KCYA 5AXIA 1B7TY 1CLMA 3EK8A 1IH0A 2LC5A 1QIWA 2KBMA 2Y5IA 1J7RA 2M49B 3GK4X 4JQ0D 2JTTA 3SIAA 4MRYA 4TNCA 4OVNF 1K95A 1QXPA 3WHTB 3DVEA 1A75B 1XK4C 1ZOTB 1MQ1A 1CDLA 4NDDA 2JT3A 3LK0A 2I18A 1CM1A 1LVCD 2F3ZA 1AJ4A 1KFXL 3I5GC 2PALA 4R1EA 2Y1NA 5CSFA 4CLNA 5F6TA 1YTZC 4P2YB 1C07A 3A8RA 4PHNA 3CZTX 2JT8A 3EKJA 1PALA 3VRNA 1DF0B 1KSMA 1OE9B 1XFZO 4NDCA 2K2FA 4P5OE 4YI9A 1XVJA 4PDZA 3SJSA 1QIVA 4HSZA 4GUKA 1B8LA 3O6BA 1M63B 4MSPA 4C0LA 1SPYA 4CIDA 2JT0A 1RWYA 1RROA 1NX3A 2K7OA 2L0PA 1YUSA 3BUWB 2LMUA 2LNKA 1K9KA 4YGEB 1FI5A 1BLQA 4M2PA 4XYNA 2WOSA 1FI6A 5I2OA 2JXCA 2JOJA 2MJWB 1TTXA 4QJ5B 4N1GA 5CSNA 2Q91A 1WDCC 3OHMB 3MSEB 1V1GA 4GPLB 5HKYA 1TIZA 2BE4A 1F71A 4N1FA 3EVVA 1K9UA 1CMFA 3DF0B 4ETOA 2M8UA 1A75A 4ZCUA 1CLLA 5AEQA 4PE7A 1QV1A 1DJIA 2BCBA 1K2HA 1C7WA 1QX2A 2WNDA 1IKUA 2KYCA 1XFVO 3KPXA 3EVUA 2M1UA 1K96A 3CR5X 1EL4A 2FJUB 1RFJA 3PLFB 3IQOA 5HLVA 4N5XA 2K7CA 1L7ZA 2M7NA 3SIBA 4I5NB 1TN4A 1S6JA 3BYAA 1CM4A 1NX1A 1QATA 4WQ2A 3F45A 2LLSA 1AP4A 4I5JA 4OCIA 3HX4A 1IQ3A 1B4CA 5K89A 1DGVA 5AANA 1DJHA 2LVJA 2ZFDA 4GGFA 2NLNA 3PN7B 2K61A 1SR6C 2OS8C 1EH2A 2ZN8A 1KK8C 3TUYC 2L51A 1S3PA 1PSRA 1WLMA 2BBMA 1PVBA 1W7IB 2HF5A 2V53A 1NSHA 2KI6D 2GGMA 2LMTA 2NXQA 2LAPA 1SKTA 5J3XA 2B1UA 1JF0A 2ZNEA 1CFDA 3GK1A 1B47A 1IG5A 1NCYA 4WRIA 1C7VA 3O4YA 2KAYA 1DVIA 1WY9A 3KEVA 2CT9A 1YVHA 5JJGA 2K7DA 1NWDA 1N0YA 1QX7A 2NCOA 2KI4B 2LVKA 1L2OC 5CPVA 2COLB 5HKWA 2SASA 1Y1AA 2KAVA 4USLA 3AKAA 1QLKA 2LHIA 2F2OA 3O78A 4A4BA 2KNEA 1SNLA 2I94A 4OV2A 1IWQA 2KSPA 1BOCA 3WHUB 2OTGB 1BT6A 2PASA 3LCPC 4C0JA 5ER5A 3NSIA 3VRPA 2HPSA 1SL7A 1TNWA 1XFXO 1UHIA 1XFYO 1J7QA 2E30A 3CTNA 1A03A 1CDPA 3RLZA 1B8RA 1SL9A 3AAJA 3H4SE 2L4IA 1XFUO 2SCPA 1CFCA 3PSRA 2JC2A 4YGAA 4QJ4B 1J1DA 4U8DA 1HQVA 3PN7C 4FQOA 1N2DA 3WNXB 1EG4A 2LE9B 3BUMB 4DUQA 3TDZA 1MXLC 1TNPA 1WRKA 3K21A 2FCEA 2Y1MA 4YBHB 5I2QA 2PRUA 1QV0A 2IS9A 1J7OA 2Q4UA 4GAOA 1YVLA 1KQMB 4L9MA 1GJYA 2BL0B 2CXJA 4OKHA 1NX2A 1UHKA 1EXRA 4BY4A 2KBIA 2H2KA 3EVRA 1FW4A 3NXAA 3I5FC 1SK6D 1MXEA 1Y1XA 4MRXA 4YI8A 3GOFA 1NIWA 2LM5A 1KWOB 5D69A 3SG2A 2NZ0A 1U5IB 1MHOA 2KI4C 4GFTA 3I5HC 3CWGA 3IQQA 1N65A 1BR4B 3JTDB 1CMGA 1GQMA 4MVFA 1XA5A 1CB1A 2BKHB 1RJVA 1RECA 4PE0A 3A4UB 1S6CA 2WCBA 4PHMA 1X02A 2BCAA 1QS7A 4DRWA 4DIRA 2OTGC 2DOQA 2LV7A 1F54A 3CGAA 4PALA 3D10A 1UHNA 3CR2A 3WXAA 3OX5A 1KFUS 1GGZA 1NCXA 2M0RA 2EC6B 1ALVA 1VRKA 2L4HA 2JNXA 2NCPA 3BQ3A 2WORA 1R6PA 1MR8A 3TDUA 2M3WA 1K8UA 1DMOA 1DJWA 4IL1A 1F55A 1YURA 3TS5B 1WRZA 2JZIA 2GV5A 1YX8A 1ZUZA 2BBNA 1EJ3A 4ICBA 4QJ3B 1Q80A 5DKNA 3OP0A 1F8HA 1OQPA 1NYAA 2MBXA 1TCOB 5JOLA 2WCFA 2LUXA 3RM1A 2KI6C 1IJ5A 4GNKB 1DJGA 3KHEA 2WC8A 1U5IA 1F4QA 1KQMC 2M29A 1CLBA 1M39A 2F3YA 3SG3A 1G4YR 1GGWA 2KQ6A 1FPWA 4MBEA 1UWOA 4YRUA 1K93D 4ORAB 4D1EA 1PK0D 1KSOA 1KWOC 1WRLA 1FBVA 1DJZA 2R2IA 5CSIA 1DT7B 4GGFC 1A4PA 2M7LA 1ZMZA 1OZOA 3JTDC 5HYDA 2LP2A 2M9GA 3DVJA 1OSAA 2LLTA 3FIAA 1B9AA 1LINA 5AERA 3JVTB 4AOMA 4YGBB 1M31A 3LK1A 4MZKA 1BF5A 1D1OA 4DCKA 2P6BB 3FS7A 3OB1B 1TNQA 3ZNIA 1DGUA 1B8CA 1MF8B 3OX6A 3SG5A 2H61A 2I7AA 3SG6A 4YGDB 2BECA 1PSBA 2JRFA 3CR4X 1NPQA 3TDIA 1XFWO 2KQYA 2HQWA 3QRXA 1CDNA 1DJXA 1ZFSA 1AHRA 4JPZB 1LXFC 2QPTA 3D0YB 1B1GA 3FWCA 1ZACA 4NDBA 1Y1UA 2H61C 1A2XA 1J1EA 2FOTA 3SG7A 1S6IA 5GQQC 2L5XB 4XJKB 1CFPA 1JBAA 1SY9A 1SMGA 2HQ8A 4YGCB 1JUOA 4WQ3A 1YR5A 5I2LA 1QTXA 2JQ6A 1NCZA 1IJ6A 1DTLA 1SBJA 2Y4QA 1M46A 5ER4X 1KQVA 4PHJA 1IQ5A 2CCMA 4JWQA 3EK4A 2KFGA 1WDCB 2F8PA 2F2PA 3M0WA 2JU0A 1AVSA 2ZNDA 4OR9B 1BU3A 2LCPA 1ALWA 1PVAA 2LLUA 2EGDA 1XK4A 3BOWB 3VRQA 1K90D 2MLFC 2BE6A 3KF9A 1BG1A 2LHLA 1Y0VH 2MAZA 5AFPA 5HKZA 3PATA 2G2BA 3EK7A 4GBAA 2D8NA 3JVTC 4FTGA 2K0JA 1JFKA 5B8IB 5KTYA 2PSRA 2KYFA 4ORCB 1TRFA 1OMDA 2JPTA 1NX0A 2JWWA 2LVVA 1QX5B 3PM8A 4ZCVA 1KFUL 2HETA 3D0YA 3SG4A 4C0KA 3ICBA 1BJFA 4XJKA 4UPGA 1OZSA 2E6WA 1YUTA 1SR6B 2L98A 2OS8B 2LUCA 1E8AA 1RK9A 2PVBA 1KK8B 3TUYB 1WLZA 2JULA 3I5IB 4M2OA 2VRGA 5BPJA 1A29A 3VGOA 1KK7Z 1YUUA 1JWDA 2K7BA 1F70A
chains in the Genus database with same CATH superfamily
2I2RE 2WCHA 1QVIZ 1S36A 3CZ0A 1FF1A 4AQJA 1KFXS 2L2EA 4HRHA 3VROA 4I5LB 2JXLA 1OOJA 4NQGA 2WCEA 1TOPA 2KAXA 1SW8A 2FCDA 2MA2A 2MHHA 3CLNA 3NSKA 5DKRA 3E3RA 5G08A 4DS7A 1S5GZ 1J7PA 1UP5A 3BOWA 2AMIA 1UHJA 5I8NA 3CS1A 1F4OA 3BFAA 4JKTA 1OMVA 4BY5A 4CFRA 3BXKA 3PM2A 2L50A 4MN0A 3PALA 2AAOA 1JC2A 4PE1A 3IF7A 1H4BA 2RGIA 1L2OB 1PULA 1QJTA 4OZDA 4F0ZB 1BR1B 1XYDA 5FYXA 1SCMB 2MLEC 2LP3A 5CSJA 1KK7Y 2MRDA 4Q04A 2ZKMX 2K2AA 2K8MB 2KGBC 1QVIY 1K9PA 2BL0C 2CTNA 2O5GA 1YX7A 2ZRTA 5TNCA 3BUOB 3NSOA 1YRUB 1MWNA 1S5GY 1G8IA 2KFHA 4PCWA 5FI2A 3VRRA 1BODA 2LVIA 1DQEA 1TNXA 3FE6A 4ORBB 1Z2CB 4A4CA 3OB2B 3O2PA 5D7FA 1DF0A 2KGRA 1BMOA 3DVKA 4HREE 4PHKA 1OOFA 1RTP1 3BUXB 3D73A 4GGNA 3CABA 1SL8A 3LLEA 2LMVA 1AJ5A 1LKJA 3NSLA 1IRJA 3L4AA 1V1FA 3PFVA 2JPOA 1S1EA 2LANA 3KO0A 1J55A 3L47A 3I5IC 1T14A 4HRGA 1SYMA 5DKQA 2ISDA 1H8BA 2ZRSA 1AK8A 1YRTB 2EHBA 3DD4A 1CKKA 1UHHA 2GGZA 3ZWHA 4MLWA 2QACA 2EC6C 2KDHA 3I5GB 2CNPA 1JFJA 2M1KB 1CNPA 2AUCA 2F33A 1CDMA 2ZN9A 2BKIB 2KFFA 3L4LA 1PRWA 2G9BA 3DF0A 4AQIA 1R2UA 3EKHA 5EL2A 4CFQA 2JNFA 2KOTA 2O60A 3DVMA 2CBLA 1MUXA 3I5FB 3TS5C 2JTZA 3TZ1A 1W7JB 4MZLA 1B7TZ 3AKBA 1TCFA 4MEWA 1LA3A 1XO5A 1SRAA 1ODBA 1OMRA 1K94A 1UURA 3I5HB 3FE9A 2TN4A 1G33A 4CPVA 1EG3A 5PALA 3B88A 1CFFA 1NP8A 1SCMC 3HCMA 2ERBA 2PMYA 4MZJA 3C1VA 1SSEB 5IBWA 1CTRA 1HT9A 2KHNA 4INWA 5FI6A 4PE4A 2BCXA 1SCVA 5KSZA 1JSAA 3LL8B 1QLSA 3FWBA 5HLOA 2M97A 1Y6WA 1NUBA 2KPHA 1DJYA 3S0AA 2A4JA 3AAKA 2BAPA 1Z4HA 4E68A 3GK2A 1AUIB 1UUSA 1LA0A 1JF2A 4I5KA 2OPOA 5KU1A 1M45A 4M2QA 1QASA 1IGVA 1S26D 3BUNB 3NHTA 1KCYA 5AXIA 1B7TY 1CLMA 3EK8A 1IH0A 2LC5A 1QIWA 2KBMA 1OW4A 2Y5IA 1J7RA 2M49B 3GK4X 4JQ0D 2JTTA 3SIAA 4MRYA 2YGUA 3NHIA 4TNCA 4OVNF 1K95A 1QXPA 3WHTB 1IIOA 3DVEA 1A75B 1XK4C 3OGNA 1ZOTB 1MQ1A 1CDLA 4NDDA 2JT3A 3LK0A 3D76A 2I18A 1CM1A 1LVCD 2F3ZA 1AJ4A 1KFXL 3I5GC 4JD9A 2PALA 4KYNA 4R1EA 3S0BA 1QWVA 2Y1NA 5CSFA 4CLNA 5F6TA 1YTZC 4P2YB 1C07A 3A8RA 1XFRA 4PHNA 3CZTX 2JT8A 3EKJA 1PALA 3VRNA 1DF0B 1KSMA 1OE9B 1XFZO 2WCKA 4NDCA 2K2FA 4P5OE 4YI9A 1XVJA 4PDZA 3SJSA 1QIVA 4HSZA 4GUKA 3D75A 1B8LA 3CZ1A 3O6BA 1M63B 4MSPA 4C0LA 1SPYA 4CIDA 2JT0A 1RWYA 1RROA 1NX3A 2K7OA 2L0PA 1YUSA 3BUWB 2LMUA 2LNKA 1K9KA 4YGEB 1FI5A 1TUZA 1BLQA 3SS4A 4M2PA 4XYNA 2WOSA 1FI6A 3BJHA 5I2OA 2JXCA 2JOJA 2MJWB 1TTXA 4QJ5B 4N1GA 5CSNA 2Q91A 1WDCC 3OHMB 3MSEB 1V1GA 4GPLB 5HKYA 1TIZA 2BE4A 1F71A 4N1FA 3EVVA 1K9UA 1CMFA 3DF0B 1P28A 2PQLA 2M8UA 1A75A 4ZCUA 1CLLA 4ETOA 5AEQA 4PE7A 1QV1A 1DJIA 2BCBA 1K2HA 1C7WA 1QX2A 2WNDA 2QEVA 1IKUA 2KYCA 1XFVO 2WCJA 3KPXA 3EVUA 2M1UA 1K96A 3CR5X 1EL4A 2FJUB 1RFJA 2FJYA 3PLFB 3IQOA 5HLVA 4N5XA 2K7CA 1L7ZA 2M7NA 3SIBA 4I5NB 1TN4A 1S6JA 3BYAA 1CM4A 1NX1A 1QATA 4WQ2A 3F45A 2LLSA 3IVTA 1AP4A 4I5JA 2KLEA 4OCIA 3HX4A 1IQ3A 1B4CA 2P70A 1DGVA 5AANA 5K89A 1DJHA 2LVJA 2ZFDA 3K1EA 2NLNA 3PN7B 2K61A 4GGFA 1SR6C 2OS8C 3VB1A 1EH2A 2ZN8A 1KK8C 3TUYC 2L51A 1S3PA 1PSRA 1WLMA 2BBMA 1PVBA 1W7IB 2HF5A 2V53A 1NSHA 2KI6D 3SS5A 2GGMA 2LMTA 2NXQA 2K60A 2LAPA 1SKTA 5J3XA 2B1UA 1DEKA 1JF0A 2ZNEA 1CFDA 3GK1A 1B47A 1IG5A 1NCYA 4WRIA 2QEBA 1C7VA 3O4YA 2KAYA 1WY9A 1DVIA 3R1PA 3V2LA 1DELA 3KEVA 3B87A 5D3OA 2CT9A 1YVHA 2WC6A 2K7DA 5JJGA 1NWDA 1N0YA 2L5YA 1QX7A 3FE8A 2NCOA 3BFHA 2KI4B 2LVKA 1L2OC 5CPVA 2COLB 5HKWA 3RZSA 2SASA 1Y1AA 2KAVA 4USLA 3AKAA 1QLKA 2LHIA 2F2OA 3EG5B 3O78A 4A4BA 2KNEA 1SNLA 2I94A 4OV2A 1IWQA 2KSPA 1BOCA 2WC5A 3WHUB 2OTGB 1BT6A 2PASA 3LCPC 4C0JA 2H8VA 4FQTA 5ER5A 3NSIA 3VRPA 2HPSA 1SL7A 1TNWA 1XFXO 1UHIA 1XFYO 1J7QA 2E30A 3CTNA 1A03A 1CDPA 3QMEA 3RLZA 1B8RA 1SL9A 3AAJA 3H4SE 2L4IA 1XFUO 3PJIA 2SCPA 1CFCA 3PSRA 2JC2A 4YGAA 4QJ4B 1J1DA 4U8DA 1HQVA 2P71A 3PN7C 4FQOA 1N2DA 3WNXB 1EG4A 2LE9B 3BUMB 4DUQA 3TDZA 1MXLC 1TNPA 1WRKA 3K21A 2FCEA 2Y1MA 1OOHA 4YBHB 5I2QA 2PRUA 1QV0A 2IS9A 3B86A 1J7OA 2Q4UA 3CZ2A 2QEOA 4GAOA 1YVLA 1KQMB 4L9MA 1GJYA 3SS3A 2BL0B 2CXJA 4OKHA 1NX2A 1UHKA 1EXRA 4BY4A 2KBIA 2H2KA 3EVRA 1TUJA 1FW4A 4IJ7A 3NXAA 2GTEA 3I5FC 1SK6D 1MXEA 1Y1XA 4MRXA 4YI8A 3GOFA 1NIWA 4PT1A 2LM5A 5FI7A 1KWOB 5D69A 3SG2A 2NZ0A 1U5IB 1MHOA 2KI4C 3DZTA 4GFTA 3I5HC 3CWGA 3IQQA 1N65A 1BR4B 3JTDB 5HL1A 1CMGA 1GQMA 1OOGA 1XA5A 4MVFA 1CB1A 2BKHB 5I94A 1RJVA 3S0GA 1RECA 4PE0A 3A4UB 1S6CA 2WCBA 4PHMA 1X02A 2BCAA 1QS7A 4DRWA 4DIRA 2OTGC 2DOQA 2LV7A 1F54A 5DICA 3CGAA 3R1OA 1GM0A 4PALA 3D10A 1UHNA 3CR2A 3WXAA 3OX5A 1KFUS 1GGZA 3DY9A 1NCXA 2M0RA 2EC6B 1ALVA 1VRKA 3DXLA 2L4HA 2JNXA 2NCPA 3BQ3A 2WORA 1R6PA 1OOIX 1MR8A 3Q8IA 3TDUA 2M3WA 1K8UA 1DMOA 1DJWA 4IL1A 1F55A 1YURA 3B7AA 3TS5B 1ORGA 1WRZA 2JZIA 2GV5A 1YX8A 1ZUZA 1TWOA 2BBNA 1EJ3A 3D74A 4ICBA 1Q80A 4QJ3B 5DKNA 3OP0A 4F7FA 1OQPA 1NYAA 2PYQA 3R72A 2MBXA 1C3YA 1F8HA 3DYEA 1TCOB 5JOLA 2WCFA 2LUXA 3RM1A 2KI6C 1IJ5A 4GNKB 1DJGA 3KHEA 2WC8A 1U5IA 1F4QA 1KQMC 2M29A 1CLBA 1M39A 2F3YA 3SG3A 3D77A 1G4YR 1GGWA 2KQ6A 1FPWA 4MBEA 3S0EA 1UWOA 4YRUA 1K93D 4ORAB 4D1EA 1PK0D 1KSOA 3UNWA 1KWOC 1WRLA 1FBVA 1DJZA 2R2IA 5CSIA 1DT7B 4GGFC 1A4PA 2M7LA 1ZMZA 1OZOA 3JTDC 5HYDA 3OBVA 3O4XA 2LP2A 2M9GA 3DVJA 1OSAA 2LLTA 3FIAA 1B9AA 1LINA 5AERA 3JVTB 4AOMA 4YGBB 1M31A 3LK1A 4MZKA 1BF5A 1D1OA 4DCKA 2P6BB 3FS7A 3OB1B 1TNQA 3ZNIA 3S0DA 1DGUA 1B8CA 1MF8B 3OX6A 3SG5A 2BNXA 2H61A 2I7AA 3SG6A 4YGDB 2WCMA 2BECA 1PSBA 2JRFA 3CR4X 3CYZA 1NPQA 3TDIA 1XFWO 2KQYA 2HQWA 3QRXA 1CDNA 1DJXA 1ZFSA 1AHRA 4JPZB 1LXFC 2QPTA 3BFBA 3D0YB 1B1GA 3FWCA 1ZACA 4NDBA 1Y1UA 2H61C 1A2XA 1J1EA 2FOTA 3CDNA 3SG7A 1S6IA 5GQQC 2L5XB 4XJKB 1CFPA 1JBAA 1SY9A 1SMGA 2HQ8A 4YGCB 1JUOA 4WQ3A 1YR5A 5I2LA 1QTXA 3D78A 2JQ6A 1NCZA 1IJ6A 1DTLA 1SBJA 2Y4QA 1M46A 5ER4X 1KQVA 2L2CA 4PHJA 1IQ5A 2CCMA 3S0FA 4JWQA 1LS8A 2KFGA 1WDCB 2F8PA 2F2PA 3EK4A 3M0WA 2JU0A 1AVSA 2ZNDA 4OR9B 1DC1A 1BU3A 2LCPA 1ALWA 1C3ZA 1PVAA 2LLUA 2EGDA 1XK4A 3BOWB 3VRQA 1K90D 2MLFC 2BE6A 3KF9A 1BG1A 2LHLA 1Y0VH 2MAZA 2QEHA 5AFPA 5HKZA 2WCLA 3PATA 2G2BA 3EK7A 4GBAA 2D8NA 3JVTC 4FTGA 2K0JA 1JFKA 5B8IB 5KTYA 2PSRA 2KYFA 3NGVA 4ORCB 1TRFA 1OMDA 2JPTA 1NX0A 2JWWA 2LVVA 1QX5B 3PM8A 4ZCVA 1KFUL 2HETA 3UO9A 3D0YA 3N7HA 3SG4A 4C0KA 2KLDA 3ICBA 1BJFA 4XJKA 4UPGA 2QDIA 3B6XA 1OZSA 2E6WA 1YUTA 1SR6B 2L98A 2OS8B 2LUCA 1E8AA 1RK9A 2PVBA 1KK8B 3TUYB 1WLZA 2JULA 3I5IB 4INXA 4M2OA 1W9ZA 2VRGA 5BPJA 3R1VA 1A29A 3VGOA 1KK7Z 1YUUA 1JWDA 2K7BA 1F70A
chains in the Genus database with same CATH topology
2I2RE 1QVIZ 1S36A 1FF1A 4AQJA 1KFXS 2L2EA 4HRHA 3VROA 4I5LB 2JXLA 1OOJA 4NQGA 2WCEA 1TOPA 2KAXA 1SW8A 2FCDA 2MA2A 2MHHA 3CLNA 3NSKA 5DKRA 3E3RA 5G08A 4DS7A 1S5GZ 1J7PA 1UP5A 3BOWA 2AMIA 1UHJA 5I8NA 3CS1A 1F4OA 4CFRA 1OMVA 4BY5A 3BXKA 1JC2A 2L50A 4MN0A 3PALA 2AAOA 4PE1A 3IF7A 1H4BA 2RGIA 1L2OB 1PULA 1QJTA 4F0ZB 1BR1B 1XYDA 5FYXA 1SCMB 2MLEC 2LP3A 5CSJA 1KK7Y 2MRDA 4Q04A 2ZKMX 2K2AA 2K8MB 2KGBC 1QVIY 1K9PA 2BL0C 2CTNA 2O5GA 1YX7A 2ZRTA 5TNCA 3BUOB 3NSOA 1YRUB 1MWNA 1S5GY 1G8IA 2KFHA 4PCWA 3VRRA 1BODA 2LVIA 1TNXA 4ORBB 4A4CA 3OB2B 3O2PA 5D7FA 1DF0A 2KGRA 1BMOA 3DVKA 4HREE 4PHKA 1RTP1 3BUXB 4GGNA 1SL8A 3LLEA 2LMVA 1AJ5A 1LKJA 3NSLA 1IRJA 1V1FA 3PFVA 3KO0A 1S1EA 2LANA 1J55A 3I5IC 4HRGA 1SYMA 5DKQA 2ISDA 1H8BA 2ZRSA 1AK8A 1YRTB 2EHBA 3DD4A 1CKKA 1UHHA 2GGZA 3ZWHA 4MLWA 2QACA 2EC6C 2KDHA 3I5GB 2CNPA 1JFJA 2M1KB 1CNPA 2AUCA 2F33A 1CDMA 2ZN9A 2BKIB 2KFFA 1PRWA 2G9BA 3DF0A 4AQIA 1R2UA 3EKHA 4CFQA 2JNFA 2KOTA 2O60A 3DVMA 2CBLA 1MUXA 3I5FB 3TS5C 2JTZA 3TZ1A 1W7JB 4MZLA 1B7TZ 3AKBA 1TCFA 4MEWA 1LA3A 1XO5A 1SRAA 1ODBA 1OMRA 1K94A 1UURA 3I5HB 2TN4A 1G33A 4CPVA 1EG3A 5PALA 1CFFA 1NP8A 1SCMC 3HCMA 2PMYA 4MZJA 3C1VA 5IBWA 1CTRA 1HT9A 2KHNA 4PE4A 2BCXA 1SCVA 5KSZA 1JSAA 3LL8B 1QLSA 3FWBA 5HLOA 2M97A 1Y6WA 1NUBA 1DJYA 2A4JA 3AAKA 4E68A 3GK2A 1AUIB 1UUSA 1LA0A 1JF2A 4I5KA 2OPOA 5KU1A 1M45A 4M2QA 1QASA 1IGVA 1S26D 3BUNB 1KCYA 5AXIA 1B7TY 1CLMA 3EK8A 1IH0A 2LC5A 1QIWA 2KBMA 2Y5IA 1J7RA 2M49B 3GK4X 4JQ0D 2JTTA 3SIAA 4MRYA 4TNCA 4OVNF 1K95A 1QXPA 3WHTB 3DVEA 1A75B 1XK4C 1ZOTB 1MQ1A 1CDLA 4NDDA 2JT3A 3LK0A 2I18A 1CM1A 1LVCD 2F3ZA 1AJ4A 1KFXL 3I5GC 2PALA 4R1EA 2Y1NA 5CSFA 4CLNA 5F6TA 1YTZC 4P2YB 1C07A 3A8RA 4PHNA 3CZTX 2JT8A 3EKJA 1PALA 3VRNA 1DF0B 1KSMA 1OE9B 1XFZO 4NDCA 2K2FA 4P5OE 4YI9A 1XVJA 4PDZA 3SJSA 1QIVA 4HSZA 4GUKA 1B8LA 3O6BA 1M63B 4MSPA 4C0LA 1SPYA 4CIDA 2JT0A 1RWYA 1RROA 1NX3A 2K7OA 2L0PA 1YUSA 3BUWB 2LMUA 2LNKA 1K9KA 4YGEB 1FI5A 1BLQA 4M2PA 4XYNA 2WOSA 1FI6A 5I2OA 2JXCA 2JOJA 2MJWB 1TTXA 4QJ5B 4N1GA 5CSNA 2Q91A 1WDCC 3OHMB 3MSEB 1V1GA 4GPLB 5HKYA 1TIZA 2BE4A 1F71A 4N1FA 3EVVA 1K9UA 1CMFA 3DF0B 4ETOA 2M8UA 1A75A 4ZCUA 1CLLA 5AEQA 4PE7A 1QV1A 1DJIA 2BCBA 1K2HA 1C7WA 1QX2A 2WNDA 1IKUA 2KYCA 1XFVO 3KPXA 3EVUA 2M1UA 1K96A 3CR5X 1EL4A 2FJUB 1RFJA 3PLFB 3IQOA 5HLVA 4N5XA 2K7CA 1L7ZA 2M7NA 3SIBA 4I5NB 1TN4A 1S6JA 3BYAA 1CM4A 1NX1A 1QATA 4WQ2A 3F45A 2LLSA 1AP4A 4I5JA 4OCIA 3HX4A 1IQ3A 1B4CA 5K89A 1DGVA 5AANA 1DJHA 2LVJA 2ZFDA 4GGFA 2NLNA 3PN7B 2K61A 1SR6C 2OS8C 1EH2A 2ZN8A 1KK8C 3TUYC 2L51A 1S3PA 1PSRA 1WLMA 2BBMA 1PVBA 1W7IB 2HF5A 2V53A 1NSHA 2KI6D 2GGMA 2LMTA 2NXQA 2LAPA 1SKTA 5J3XA 2B1UA 1JF0A 2ZNEA 1CFDA 3GK1A 1B47A 1IG5A 1NCYA 4WRIA 1C7VA 3O4YA 2KAYA 1DVIA 1WY9A 3KEVA 2CT9A 1YVHA 5JJGA 2K7DA 1NWDA 1N0YA 1QX7A 2NCOA 2KI4B 2LVKA 1L2OC 5CPVA 2COLB 5HKWA 2SASA 1Y1AA 2KAVA 4USLA 3AKAA 1QLKA 2LHIA 2F2OA 3O78A 4A4BA 2KNEA 1SNLA 2I94A 4OV2A 1IWQA 2KSPA 1BOCA 3WHUB 2OTGB 1BT6A 2PASA 3LCPC 4C0JA 5ER5A 3NSIA 3VRPA 2HPSA 1SL7A 1TNWA 1XFXO 1UHIA 1XFYO 1J7QA 2E30A 3CTNA 1A03A 1CDPA 3RLZA 1B8RA 1SL9A 3AAJA 3H4SE 2L4IA 1XFUO 2SCPA 1CFCA 3PSRA 2JC2A 4YGAA 4QJ4B 1J1DA 4U8DA 1HQVA 3PN7C 4FQOA 1N2DA 3WNXB 1EG4A 2LE9B 3BUMB 4DUQA 3TDZA 1MXLC 1TNPA 1WRKA 3K21A 2FCEA 2Y1MA 4YBHB 5I2QA 2PRUA 1QV0A 2IS9A 1J7OA 2Q4UA 4GAOA 1YVLA 1KQMB 4L9MA 1GJYA 2BL0B 2CXJA 4OKHA 1NX2A 1UHKA 1EXRA 4BY4A 2KBIA 2H2KA 3EVRA 1FW4A 3NXAA 3I5FC 1SK6D 1MXEA 1Y1XA 4MRXA 4YI8A 3GOFA 1NIWA 2LM5A 1KWOB 5D69A 3SG2A 2NZ0A 1U5IB 1MHOA 2KI4C 4GFTA 3I5HC 3CWGA 3IQQA 1N65A 1BR4B 3JTDB 1CMGA 1GQMA 4MVFA 1XA5A 1CB1A 2BKHB 1RJVA 1RECA 4PE0A 3A4UB 1S6CA 2WCBA 4PHMA 1X02A 2BCAA 1QS7A 4DRWA 4DIRA 2OTGC 2DOQA 2LV7A 1F54A 3CGAA 4PALA 3D10A 1UHNA 3CR2A 3WXAA 3OX5A 1KFUS 1GGZA 1NCXA 2M0RA 2EC6B 1ALVA 1VRKA 2L4HA 2JNXA 2NCPA 3BQ3A 2WORA 1R6PA 1MR8A 3TDUA 2M3WA 1K8UA 1DMOA 1DJWA 4IL1A 1F55A 1YURA 3TS5B 1WRZA 2JZIA 2GV5A 1YX8A 1ZUZA 2BBNA 1EJ3A 4ICBA 4QJ3B 1Q80A 5DKNA 3OP0A 1F8HA 1OQPA 1NYAA 2MBXA 1TCOB 5JOLA 2WCFA 2LUXA 3RM1A 2KI6C 1IJ5A 4GNKB 1DJGA 3KHEA 2WC8A 1U5IA 1F4QA 1KQMC 2M29A 1CLBA 1M39A 2F3YA 3SG3A 1G4YR 1GGWA 2KQ6A 1FPWA 4MBEA 1UWOA 4YRUA 1K93D 4ORAB 4D1EA 1PK0D 1KSOA 1KWOC 1WRLA 1FBVA 1DJZA 2R2IA 5CSIA 1DT7B 4GGFC 1A4PA 2M7LA 1ZMZA 1OZOA 3JTDC 5HYDA 2LP2A 2M9GA 3DVJA 1OSAA 2LLTA 3FIAA 1B9AA 1LINA 5AERA 3JVTB 4AOMA 4YGBB 1M31A 3LK1A 4MZKA 1BF5A 1D1OA 4DCKA 2P6BB 3FS7A 3OB1B 1TNQA 3ZNIA 1DGUA 1B8CA 1MF8B 3OX6A 3SG5A 2H61A 2I7AA 3SG6A 4YGDB 2BECA 1PSBA 2JRFA 3CR4X 1NPQA 3TDIA 1XFWO 2KQYA 2HQWA 3QRXA 1CDNA 1DJXA 1ZFSA 1AHRA 4JPZB 1LXFC 2QPTA 3D0YB 1B1GA 3FWCA 1ZACA 4NDBA 1Y1UA 2H61C 1A2XA 1J1EA 2FOTA 3SG7A 1S6IA 5GQQC 2L5XB 4XJKB 1CFPA 1JBAA 1SY9A 1SMGA 2HQ8A 4YGCB 1JUOA 4WQ3A 1YR5A 5I2LA 1QTXA 2JQ6A 1NCZA 1IJ6A 1DTLA 1SBJA 2Y4QA 1M46A 5ER4X 1KQVA 4PHJA 1IQ5A 2CCMA 4JWQA 3EK4A 2KFGA 1WDCB 2F8PA 2F2PA 3M0WA 2JU0A 1AVSA 2ZNDA 4OR9B 1BU3A 2LCPA 1ALWA 1PVAA 2LLUA 2EGDA 1XK4A 3BOWB 3VRQA 1K90D 2MLFC 2BE6A 3KF9A 1BG1A 2LHLA 1Y0VH 2MAZA 5AFPA 5HKZA 3PATA 2G2BA 3EK7A 4GBAA 2D8NA 3JVTC 4FTGA 2K0JA 1JFKA 5B8IB 5KTYA 2PSRA 2KYFA 4ORCB 1TRFA 1OMDA 2JPTA 1NX0A 2JWWA 2LVVA 1QX5B 3PM8A 4ZCVA 1KFUL 2HETA 3D0YA 3SG4A 4C0KA 3ICBA 1BJFA 4XJKA 4UPGA 1OZSA 2E6WA 1YUTA 1SR6B 2L98A 2OS8B 2LUCA 1E8AA 1RK9A 2PVBA 1KK8B 3TUYB 1WLZA 2JULA 3I5IB 4M2OA 2VRGA 5BPJA 1A29A 3VGOA 1KK7Z 1YUUA 1JWDA 2K7BA 1F70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2R E;  1QVI Z;  1S36 A;  1FF1 A;  4AQJ A;  1KFX S;  2L2E A;  4HRH A;  3VRO A;  4I5L B;  2JXL A;  1OOJ A;  4NQG A;  2WCE A;  1TOP A;  2KAX A;  1SW8 A;  2FCD A;  2MA2 A;  2MHH A;  3CLN A;  3NSK A;  5DKR A;  3E3R A;  5G08 A;  4DS7 A;  1S5G Z;  1J7P A;  1UP5 A;  3BOW A;  2AMI A;  1UHJ A;  5I8N A;  3CS1 A;  1F4O A;  4CFR A;  1OMV A;  4BY5 A;  3BXK A;  1JC2 A;  2L50 A;  4MN0 A;  3PAL A;  2AAO A;  4PE1 A;  3IF7 A;  1H4B A;  2RGI A;  1L2O B;  1PUL A;  1QJT A;  4F0Z B;  1BR1 B;  1XYD A;  5FYX A;  1SCM B;  2MLE C;  2LP3 A;  5CSJ A;  1KK7 Y;  2MRD A;  4Q04 A;  2ZKM X;  2K2A A;  2K8M B;  2KGB C;  1QVI Y;  1K9P A;  2BL0 C;  2CTN A;  2O5G A;  1YX7 A;  2ZRT A;  5TNC A;  3BUO B;  3NSO A;  1YRU B;  1MWN A;  1S5G Y;  1G8I A;  2KFH A;  4PCW A;  3VRR A;  1BOD A;  2LVI A;  1TNX A;  4ORB B;  4A4C A;  3OB2 B;  3O2P A;  5D7F A;  1DF0 A;  2KGR A;  1BMO A;  3DVK A;  4HRE E;  4PHK A;  1RTP 1;  3BUX B;  4GGN A;  1SL8 A;  3LLE A;  2LMV A;  1AJ5 A;  1LKJ A;  3NSL A;  1IRJ A;  1V1F A;  3PFV A;  3KO0 A;  1S1E A;  2LAN A;  1J55 A;  3I5I C;  4HRG A;  1SYM A;  5DKQ A;  2ISD A;  1H8B A;  2ZRS A;  1AK8 A;  1YRT B;  2EHB A;  3DD4 A;  1CKK A;  1UHH A;  2GGZ A;  3ZWH A;  4MLW A;  2QAC A;  2EC6 C;  2KDH A;  3I5G B;  2CNP A;  1JFJ A;  2M1K B;  1CNP A;  2AUC A;  2F33 A;  1CDM A;  2ZN9 A;  2BKI B;  2KFF A;  1PRW A;  2G9B A;  3DF0 A;  4AQI A;  1R2U A;  3EKH A;  4CFQ A;  2JNF A;  2KOT A;  2O60 A;  3DVM A;  2CBL A;  1MUX A;  3I5F B;  3TS5 C;  2JTZ A;  3TZ1 A;  1W7J B;  4MZL A;  1B7T Z;  3AKB A;  1TCF A;  4MEW A;  1LA3 A;  1XO5 A;  1SRA A;  1ODB A;  1OMR A;  1K94 A;  1UUR A;  3I5H B;  2TN4 A;  1G33 A;  4CPV A;  1EG3 A;  5PAL A;  1CFF A;  1NP8 A;  1SCM C;  3HCM A;  2PMY A;  4MZJ A;  3C1V A;  5IBW A;  1CTR A;  1HT9 A;  2KHN A;  4PE4 A;  2BCX A;  1SCV A;  5KSZ A;  1JSA A;  3LL8 B;  1QLS A;  3FWB A;  5HLO A;  2M97 A;  1Y6W A;  1NUB A;  1DJY A;  2A4J A;  3AAK A;  4E68 A;  3GK2 A;  1AUI B;  1UUS A;  1LA0 A;  1JF2 A;  4I5K A;  2OPO A;  5KU1 A;  1M45 A;  4M2Q A;  1QAS A;  1IGV A;  1S26 D;  3BUN B;  1KCY A;  5AXI A;  1B7T Y;  1CLM A;  3EK8 A;  1IH0 A;  2LC5 A;  1QIW A;  2KBM A;  2Y5I A;  1J7R A;  2M49 B;  3GK4 X;  4JQ0 D;  2JTT A;  3SIA A;  4MRY A;  4TNC A;  4OVN F;  1K95 A;  1QXP A;  3WHT B;  3DVE A;  1A75 B;  1XK4 C;  1ZOT B;  1MQ1 A;  1CDL A;  4NDD A;  2JT3 A;  3LK0 A;  2I18 A;  1CM1 A;  1LVC D;  2F3Z A;  1AJ4 A;  1KFX L;  3I5G C;  2PAL A;  4R1E A;  2Y1N A;  5CSF A;  4CLN A;  5F6T A;  1YTZ C;  4P2Y B;  1C07 A;  3A8R A;  4PHN A;  3CZT X;  2JT8 A;  3EKJ A;  1PAL A;  3VRN A;  1DF0 B;  1KSM A;  1OE9 B;  1XFZ O;  4NDC A;  2K2F A;  4P5O E;  4YI9 A;  1XVJ A;  4PDZ A;  3SJS A;  1QIV A;  4HSZ A;  4GUK A;  1B8L A;  3O6B A;  1M63 B;  4MSP A;  4C0L A;  1SPY A;  4CID A;  2JT0 A;  1RWY A;  1RRO A;  1NX3 A;  2K7O A;  2L0P A;  1YUS A;  3BUW B;  2LMU A;  2LNK A;  1K9K A;  4YGE B;  1FI5 A;  1BLQ A;  4M2P A;  4XYN A;  2WOS A;  1FI6 A;  5I2O A;  2JXC A;  2JOJ A;  2MJW B;  1TTX A;  4QJ5 B;  4N1G A;  5CSN A;  2Q91 A;  1WDC C;  3OHM B;  3MSE B;  1V1G A;  4GPL B;  5HKY A;  1TIZ A;  2BE4 A;  1F71 A;  4N1F A;  3EVV A;  1K9U A;  1CMF A;  3DF0 B;  4ETO A;  2M8U A;  1A75 A;  4ZCU A;  1CLL A;  5AEQ A;  4PE7 A;  1QV1 A;  1DJI A;  2BCB A;  1K2H A;  1C7W A;  1QX2 A;  2WND A;  1IKU A;  2KYC A;  1XFV O;  3KPX A;  3EVU A;  2M1U A;  1K96 A;  3CR5 X;  1EL4 A;  2FJU B;  1RFJ A;  3PLF B;  3IQO A;  5HLV A;  4N5X A;  2K7C A;  1L7Z A;  2M7N A;  3SIB A;  4I5N B;  1TN4 A;  1S6J A;  3BYA A;  1CM4 A;  1NX1 A;  1QAT A;  4WQ2 A;  3F45 A;  2LLS A;  1AP4 A;  4I5J A;  4OCI A;  3HX4 A;  1IQ3 A;  1B4C A;  5K89 A;  1DGV A;  5AAN A;  1DJH A;  2LVJ A;  2ZFD A;  4GGF A;  2NLN A;  3PN7 B;  2K61 A;  1SR6 C;  2OS8 C;  1EH2 A;  2ZN8 A;  1KK8 C;  3TUY C;  2L51 A;  1S3P A;  1PSR A;  1WLM A;  2BBM A;  1PVB A;  1W7I B;  2HF5 A;  2V53 A;  1NSH A;  2KI6 D;  2GGM A;  2LMT A;  2NXQ A;  2LAP A;  1SKT A;  5J3X A;  2B1U A;  1JF0 A;  2ZNE A;  1CFD A;  3GK1 A;  1B47 A;  1IG5 A;  1NCY A;  4WRI A;  1C7V A;  3O4Y A;  2KAY A;  1DVI A;  1WY9 A;  3KEV A;  2CT9 A;  1YVH A;  5JJG A;  2K7D A;  1NWD A;  1N0Y A;  1QX7 A;  2NCO A;  2KI4 B;  2LVK A;  1L2O C;  5CPV A;  2COL B;  5HKW A;  2SAS A;  1Y1A A;  2KAV A;  4USL A;  3AKA A;  1QLK A;  2LHI A;  2F2O A;  3O78 A;  4A4B A;  2KNE A;  1SNL A;  2I94 A;  4OV2 A;  1IWQ A;  2KSP A;  1BOC A;  3WHU B;  2OTG B;  1BT6 A;  2PAS A;  3LCP C;  4C0J A;  5ER5 A;  3NSI A;  3VRP A;  2HPS A;  1SL7 A;  1TNW A;  1XFX O;  1UHI A;  1XFY O;  1J7Q A;  2E30 A;  3CTN A;  1A03 A;  1CDP A;  3RLZ A;  1B8R A;  1SL9 A;  3AAJ A;  3H4S E;  2L4I A;  1XFU O;  2SCP A;  1CFC A;  3PSR A;  2JC2 A;  4YGA A;  4QJ4 B;  1J1D A;  4U8D A;  1HQV A;  3PN7 C;  4FQO A;  1N2D A;  3WNX B;  1EG4 A;  2LE9 B;  3BUM B;  4DUQ A;  3TDZ A;  1MXL C;  1TNP A;  1WRK A;  3K21 A;  2FCE A;  2Y1M A;  4YBH B;  5I2Q A;  2PRU A;  1QV0 A;  2IS9 A;  1J7O A;  2Q4U A;  4GAO A;  1YVL A;  1KQM B;  4L9M A;  1GJY A;  2BL0 B;  2CXJ A;  4OKH A;  1NX2 A;  1UHK A;  1EXR A;  4BY4 A;  2KBI A;  2H2K A;  3EVR A;  1FW4 A;  3NXA A;  3I5F C;  1SK6 D;  1MXE A;  1Y1X A;  4MRX A;  4YI8 A;  3GOF A;  1NIW A;  2LM5 A;  1KWO B;  5D69 A;  3SG2 A;  2NZ0 A;  1U5I B;  1MHO A;  2KI4 C;  4GFT A;  3I5H C;  3CWG A;  3IQQ A;  1N65 A;  1BR4 B;  3JTD B;  1CMG A;  1GQM A;  4MVF A;  1XA5 A;  1CB1 A;  2BKH B;  1RJV A;  1REC A;  4PE0 A;  3A4U B;  1S6C A;  2WCB A;  4PHM A;  1X02 A;  2BCA A;  1QS7 A;  4DRW A;  4DIR A;  2OTG C;  2DOQ A;  2LV7 A;  1F54 A;  3CGA A;  4PAL A;  3D10 A;  1UHN A;  3CR2 A;  3WXA A;  3OX5 A;  1KFU S;  1GGZ A;  1NCX A;  2M0R A;  2EC6 B;  1ALV A;  1VRK A;  2L4H A;  2JNX A;  2NCP A;  3BQ3 A;  2WOR A;  1R6P A;  1MR8 A;  3TDU A;  2M3W A;  1K8U A;  1DMO A;  1DJW A;  4IL1 A;  1F55 A;  1YUR A;  3TS5 B;  1WRZ A;  2JZI A;  2GV5 A;  1YX8 A;  1ZUZ A;  2BBN A;  1EJ3 A;  4ICB A;  4QJ3 B;  1Q80 A;  5DKN A;  3OP0 A;  1F8H A;  1OQP A;  1NYA A;  2MBX A;  1TCO B;  5JOL A;  2WCF A;  2LUX A;  3RM1 A;  2KI6 C;  1IJ5 A;  4GNK B;  1DJG A;  3KHE A;  2WC8 A;  1U5I A;  1F4Q A;  1KQM C;  2M29 A;  1CLB A;  1M39 A;  2F3Y A;  3SG3 A;  1G4Y R;  1GGW A;  2KQ6 A;  1FPW A;  4MBE A;  1UWO A;  4YRU A;  1K93 D;  4ORA B;  4D1E A;  1PK0 D;  1KSO A;  1KWO C;  1WRL A;  1FBV A;  1DJZ A;  2R2I A;  5CSI A;  1DT7 B;  4GGF C;  1A4P A;  2M7L A;  1ZMZ A;  1OZO A;  3JTD C;  5HYD A;  2LP2 A;  2M9G A;  3DVJ A;  1OSA A;  2LLT A;  3FIA A;  1B9A A;  1LIN A;  5AER A;  3JVT B;  4AOM A;  4YGB B;  1M31 A;  3LK1 A;  4MZK A;  1BF5 A;  1D1O A;  4DCK A;  2P6B B;  3FS7 A;  3OB1 B;  1TNQ A;  3ZNI A;  1DGU A;  1B8C A;  1MF8 B;  3OX6 A;  3SG5 A;  2H61 A;  2I7A A;  3SG6 A;  4YGD B;  2BEC A;  1PSB A;  2JRF A;  3CR4 X;  1NPQ A;  3TDI A;  1XFW O;  2KQY A;  2HQW A;  3QRX A;  1CDN A;  1DJX A;  1ZFS A;  1AHR A;  4JPZ B;  1LXF C;  2QPT A;  3D0Y B;  1B1G A;  3FWC A;  1ZAC A;  4NDB A;  1Y1U A;  2H61 C;  1A2X A;  1J1E A;  2FOT A;  3SG7 A;  1S6I A;  5GQQ C;  2L5X B;  4XJK B;  1CFP A;  1JBA A;  1SY9 A;  1SMG A;  2HQ8 A;  4YGC B;  1JUO A;  4WQ3 A;  1YR5 A;  5I2L A;  1QTX A;  2JQ6 A;  1NCZ A;  1IJ6 A;  1DTL A;  1SBJ A;  2Y4Q A;  1M46 A;  5ER4 X;  1KQV A;  4PHJ A;  1IQ5 A;  2CCM A;  4JWQ A;  3EK4 A;  2KFG A;  1WDC B;  2F8P A;  2F2P A;  3M0W A;  2JU0 A;  1AVS A;  2ZND A;  4OR9 B;  1BU3 A;  2LCP A;  1ALW A;  1PVA A;  2LLU A;  2EGD A;  1XK4 A;  3BOW B;  3VRQ A;  1K90 D;  2MLF C;  2BE6 A;  3KF9 A;  1BG1 A;  2LHL A;  1Y0V H;  2MAZ A;  5AFP A;  5HKZ A;  3PAT A;  2G2B A;  3EK7 A;  4GBA A;  2D8N A;  3JVT C;  4FTG A;  2K0J A;  1JFK A;  5B8I B;  5KTY A;  2PSR A;  2KYF A;  4ORC B;  1TRF A;  1OMD A;  2JPT A;  1NX0 A;  2JWW A;  2LVV A;  1QX5 B;  3PM8 A;  4ZCV A;  1KFU L;  2HET A;  3D0Y A;  3SG4 A;  4C0K A;  3ICB A;  1BJF A;  4XJK A;  4UPG A;  1OZS A;  2E6W A;  1YUT A;  1SR6 B;  2L98 A;  2OS8 B;  2LUC A;  1E8A A;  1RK9 A;  2PVB A;  1KK8 B;  3TUY B;  1WLZ A;  2JUL A;  3I5I B;  4M2O A;  2VRG A;  5BPJ A;  1A29 A;  3VGO A;  1KK7 Z;  1YUU A;  1JWD A;  2K7B A;  1F70 A; 
#chains in the Genus database with same CATH topology
 2I2R E;  2WCH A;  1QVI Z;  1S36 A;  3CZ0 A;  1FF1 A;  4AQJ A;  1KFX S;  2L2E A;  4HRH A;  3VRO A;  4I5L B;  2JXL A;  1OOJ A;  4NQG A;  2WCE A;  1TOP A;  2KAX A;  1SW8 A;  2FCD A;  2MA2 A;  2MHH A;  3CLN A;  3NSK A;  5DKR A;  3E3R A;  5G08 A;  4DS7 A;  1S5G Z;  1J7P A;  1UP5 A;  3BOW A;  2AMI A;  1UHJ A;  5I8N A;  3CS1 A;  1F4O A;  3BFA A;  4JKT A;  1OMV A;  4BY5 A;  4CFR A;  3BXK A;  3PM2 A;  2L50 A;  4MN0 A;  3PAL A;  2AAO A;  1JC2 A;  4PE1 A;  3IF7 A;  1H4B A;  2RGI A;  1L2O B;  1PUL A;  1QJT A;  4OZD A;  4F0Z B;  1BR1 B;  1XYD A;  5FYX A;  1SCM B;  2MLE C;  2LP3 A;  5CSJ A;  1KK7 Y;  2MRD A;  4Q04 A;  2ZKM X;  2K2A A;  2K8M B;  2KGB C;  1QVI Y;  1K9P A;  2BL0 C;  2CTN A;  2O5G A;  1YX7 A;  2ZRT A;  5TNC A;  3BUO B;  3NSO A;  1YRU B;  1MWN A;  1S5G Y;  1G8I A;  2KFH A;  4PCW A;  5FI2 A;  3VRR A;  1BOD A;  2LVI A;  1DQE A;  1TNX A;  3FE6 A;  4ORB B;  1Z2C B;  4A4C A;  3OB2 B;  3O2P A;  5D7F A;  1DF0 A;  2KGR A;  1BMO A;  3DVK A;  4HRE E;  4PHK A;  1OOF A;  1RTP 1;  3BUX B;  3D73 A;  4GGN A;  3CAB A;  1SL8 A;  3LLE A;  2LMV A;  1AJ5 A;  1LKJ A;  3NSL A;  1IRJ A;  3L4A A;  1V1F A;  3PFV A;  2JPO A;  1S1E A;  2LAN A;  3KO0 A;  1J55 A;  3L47 A;  3I5I C;  1T14 A;  4HRG A;  1SYM A;  5DKQ A;  2ISD A;  1H8B A;  2ZRS A;  1AK8 A;  1YRT B;  2EHB A;  3DD4 A;  1CKK A;  1UHH A;  2GGZ A;  3ZWH A;  4MLW A;  2QAC A;  2EC6 C;  2KDH A;  3I5G B;  2CNP A;  1JFJ A;  2M1K B;  1CNP A;  2AUC A;  2F33 A;  1CDM A;  2ZN9 A;  2BKI B;  2KFF A;  3L4L A;  1PRW A;  2G9B A;  3DF0 A;  4AQI A;  1R2U A;  3EKH A;  5EL2 A;  4CFQ A;  2JNF A;  2KOT A;  2O60 A;  3DVM A;  2CBL A;  1MUX A;  3I5F B;  3TS5 C;  2JTZ A;  3TZ1 A;  1W7J B;  4MZL A;  1B7T Z;  3AKB A;  1TCF A;  4MEW A;  1LA3 A;  1XO5 A;  1SRA A;  1ODB A;  1OMR A;  1K94 A;  1UUR A;  3I5H B;  3FE9 A;  2TN4 A;  1G33 A;  4CPV A;  1EG3 A;  5PAL A;  3B88 A;  1CFF A;  1NP8 A;  1SCM C;  3HCM A;  2ERB A;  2PMY A;  4MZJ A;  3C1V A;  1SSE B;  5IBW A;  1CTR A;  1HT9 A;  2KHN A;  4INW A;  5FI6 A;  4PE4 A;  2BCX A;  1SCV A;  5KSZ A;  1JSA A;  3LL8 B;  1QLS A;  3FWB A;  5HLO A;  2M97 A;  1Y6W A;  1NUB A;  2KPH A;  1DJY A;  3S0A A;  2A4J A;  3AAK A;  2BAP A;  1Z4H A;  4E68 A;  3GK2 A;  1AUI B;  1UUS A;  1LA0 A;  1JF2 A;  4I5K A;  2OPO A;  5KU1 A;  1M45 A;  4M2Q A;  1QAS A;  1IGV A;  1S26 D;  3BUN B;  3NHT A;  1KCY A;  5AXI A;  1B7T Y;  1CLM A;  3EK8 A;  1IH0 A;  2LC5 A;  1QIW A;  2KBM A;  1OW4 A;  2Y5I A;  1J7R A;  2M49 B;  3GK4 X;  4JQ0 D;  2JTT A;  3SIA A;  4MRY A;  2YGU A;  3NHI A;  4TNC A;  4OVN F;  1K95 A;  1QXP A;  3WHT B;  1IIO A;  3DVE A;  1A75 B;  1XK4 C;  3OGN A;  1ZOT B;  1MQ1 A;  1CDL A;  4NDD A;  2JT3 A;  3LK0 A;  3D76 A;  2I18 A;  1CM1 A;  1LVC D;  2F3Z A;  1AJ4 A;  1KFX L;  3I5G C;  4JD9 A;  2PAL A;  4KYN A;  4R1E A;  3S0B A;  1QWV A;  2Y1N A;  5CSF A;  4CLN A;  5F6T A;  1YTZ C;  4P2Y B;  1C07 A;  3A8R A;  1XFR A;  4PHN A;  3CZT X;  2JT8 A;  3EKJ A;  1PAL A;  3VRN A;  1DF0 B;  1KSM A;  1OE9 B;  1XFZ O;  2WCK A;  4NDC A;  2K2F A;  4P5O E;  4YI9 A;  1XVJ A;  4PDZ A;  3SJS A;  1QIV A;  4HSZ A;  4GUK A;  3D75 A;  1B8L A;  3CZ1 A;  3O6B A;  1M63 B;  4MSP A;  4C0L A;  1SPY A;  4CID A;  2JT0 A;  1RWY A;  1RRO A;  1NX3 A;  2K7O A;  2L0P A;  1YUS A;  3BUW B;  2LMU A;  2LNK A;  1K9K A;  4YGE B;  1FI5 A;  1TUZ A;  1BLQ A;  3SS4 A;  4M2P A;  4XYN A;  2WOS A;  1FI6 A;  3BJH A;  5I2O A;  2JXC A;  2JOJ A;  2MJW B;  1TTX A;  4QJ5 B;  4N1G A;  5CSN A;  2Q91 A;  1WDC C;  3OHM B;  3MSE B;  1V1G A;  4GPL B;  5HKY A;  1TIZ A;  2BE4 A;  1F71 A;  4N1F A;  3EVV A;  1K9U A;  1CMF A;  3DF0 B;  1P28 A;  2PQL A;  2M8U A;  1A75 A;  4ZCU A;  1CLL A;  4ETO A;  5AEQ A;  4PE7 A;  1QV1 A;  1DJI A;  2BCB A;  1K2H A;  1C7W A;  1QX2 A;  2WND A;  2QEV A;  1IKU A;  2KYC A;  1XFV O;  2WCJ A;  3KPX A;  3EVU A;  2M1U A;  1K96 A;  3CR5 X;  1EL4 A;  2FJU B;  1RFJ A;  2FJY A;  3PLF B;  3IQO A;  5HLV A;  4N5X A;  2K7C A;  1L7Z A;  2M7N A;  3SIB A;  4I5N B;  1TN4 A;  1S6J A;  3BYA A;  1CM4 A;  1NX1 A;  1QAT A;  4WQ2 A;  3F45 A;  2LLS A;  3IVT A;  1AP4 A;  4I5J A;  2KLE A;  4OCI A;  3HX4 A;  1IQ3 A;  1B4C A;  2P70 A;  1DGV A;  5AAN A;  5K89 A;  1DJH A;  2LVJ A;  2ZFD A;  3K1E A;  2NLN A;  3PN7 B;  2K61 A;  4GGF A;  1SR6 C;  2OS8 C;  3VB1 A;  1EH2 A;  2ZN8 A;  1KK8 C;  3TUY C;  2L51 A;  1S3P A;  1PSR A;  1WLM A;  2BBM A;  1PVB A;  1W7I B;  2HF5 A;  2V53 A;  1NSH A;  2KI6 D;  3SS5 A;  2GGM A;  2LMT A;  2NXQ A;  2K60 A;  2LAP A;  1SKT A;  5J3X A;  2B1U A;  1DEK A;  1JF0 A;  2ZNE A;  1CFD A;  3GK1 A;  1B47 A;  1IG5 A;  1NCY A;  4WRI A;  2QEB A;  1C7V A;  3O4Y A;  2KAY A;  1WY9 A;  1DVI A;  3R1P A;  3V2L A;  1DEL A;  3KEV A;  3B87 A;  5D3O A;  2CT9 A;  1YVH A;  2WC6 A;  2K7D A;  5JJG A;  1NWD A;  1N0Y A;  2L5Y A;  1QX7 A;  3FE8 A;  2NCO A;  3BFH A;  2KI4 B;  2LVK A;  1L2O C;  5CPV A;  2COL B;  5HKW A;  3RZS A;  2SAS A;  1Y1A A;  2KAV A;  4USL A;  3AKA A;  1QLK A;  2LHI A;  2F2O A;  3EG5 B;  3O78 A;  4A4B A;  2KNE A;  1SNL A;  2I94 A;  4OV2 A;  1IWQ A;  2KSP A;  1BOC A;  2WC5 A;  3WHU B;  2OTG B;  1BT6 A;  2PAS A;  3LCP C;  4C0J A;  2H8V A;  4FQT A;  5ER5 A;  3NSI A;  3VRP A;  2HPS A;  1SL7 A;  1TNW A;  1XFX O;  1UHI A;  1XFY O;  1J7Q A;  2E30 A;  3CTN A;  1A03 A;  1CDP A;  3QME A;  3RLZ A;  1B8R A;  1SL9 A;  3AAJ A;  3H4S E;  2L4I A;  1XFU O;  3PJI A;  2SCP A;  1CFC A;  3PSR A;  2JC2 A;  4YGA A;  4QJ4 B;  1J1D A;  4U8D A;  1HQV A;  2P71 A;  3PN7 C;  4FQO A;  1N2D A;  3WNX B;  1EG4 A;  2LE9 B;  3BUM B;  4DUQ A;  3TDZ A;  1MXL C;  1TNP A;  1WRK A;  3K21 A;  2FCE A;  2Y1M A;  1OOH A;  4YBH B;  5I2Q A;  2PRU A;  1QV0 A;  2IS9 A;  3B86 A;  1J7O A;  2Q4U A;  3CZ2 A;  2QEO A;  4GAO A;  1YVL A;  1KQM B;  4L9M A;  1GJY A;  3SS3 A;  2BL0 B;  2CXJ A;  4OKH A;  1NX2 A;  1UHK A;  1EXR A;  4BY4 A;  2KBI A;  2H2K A;  3EVR A;  1TUJ A;  1FW4 A;  4IJ7 A;  3NXA A;  2GTE A;  3I5F C;  1SK6 D;  1MXE A;  1Y1X A;  4MRX A;  4YI8 A;  3GOF A;  1NIW A;  4PT1 A;  2LM5 A;  5FI7 A;  1KWO B;  5D69 A;  3SG2 A;  2NZ0 A;  1U5I B;  1MHO A;  2KI4 C;  3DZT A;  4GFT A;  3I5H C;  3CWG A;  3IQQ A;  1N65 A;  1BR4 B;  3JTD B;  5HL1 A;  1CMG A;  1GQM A;  1OOG A;  1XA5 A;  4MVF A;  1CB1 A;  2BKH B;  5I94 A;  1RJV A;  3S0G A;  1REC A;  4PE0 A;  3A4U B;  1S6C A;  2WCB A;  4PHM A;  1X02 A;  2BCA A;  1QS7 A;  4DRW A;  4DIR A;  2OTG C;  2DOQ A;  2LV7 A;  1F54 A;  5DIC A;  3CGA A;  3R1O A;  1GM0 A;  4PAL A;  3D10 A;  1UHN A;  3CR2 A;  3WXA A;  3OX5 A;  1KFU S;  1GGZ A;  3DY9 A;  1NCX A;  2M0R A;  2EC6 B;  1ALV A;  1VRK A;  3DXL A;  2L4H A;  2JNX A;  2NCP A;  3BQ3 A;  2WOR A;  1R6P A;  1OOI X;  1MR8 A;  3Q8I A;  3TDU A;  2M3W A;  1K8U A;  1DMO A;  1DJW A;  4IL1 A;  1F55 A;  1YUR A;  3B7A A;  3TS5 B;  1ORG A;  1WRZ A;  2JZI A;  2GV5 A;  1YX8 A;  1ZUZ A;  1TWO A;  2BBN A;  1EJ3 A;  3D74 A;  4ICB A;  1Q80 A;  4QJ3 B;  5DKN A;  3OP0 A;  4F7F A;  1OQP A;  1NYA A;  2PYQ A;  3R72 A;  2MBX A;  1C3Y A;  1F8H A;  3DYE A;  1TCO B;  5JOL A;  2WCF A;  2LUX A;  3RM1 A;  2KI6 C;  1IJ5 A;  4GNK B;  1DJG A;  3KHE A;  2WC8 A;  1U5I A;  1F4Q A;  1KQM C;  2M29 A;  1CLB A;  1M39 A;  2F3Y A;  3SG3 A;  3D77 A;  1G4Y R;  1GGW A;  2KQ6 A;  1FPW A;  4MBE A;  3S0E A;  1UWO A;  4YRU A;  1K93 D;  4ORA B;  4D1E A;  1PK0 D;  1KSO A;  3UNW A;  1KWO C;  1WRL A;  1FBV A;  1DJZ A;  2R2I A;  5CSI A;  1DT7 B;  4GGF C;  1A4P A;  2M7L A;  1ZMZ A;  1OZO A;  3JTD C;  5HYD A;  3OBV A;  3O4X A;  2LP2 A;  2M9G A;  3DVJ A;  1OSA A;  2LLT A;  3FIA A;  1B9A A;  1LIN A;  5AER A;  3JVT B;  4AOM A;  4YGB B;  1M31 A;  3LK1 A;  4MZK A;  1BF5 A;  1D1O A;  4DCK A;  2P6B B;  3FS7 A;  3OB1 B;  1TNQ A;  3ZNI A;  3S0D A;  1DGU A;  1B8C A;  1MF8 B;  3OX6 A;  3SG5 A;  2BNX A;  2H61 A;  2I7A A;  3SG6 A;  4YGD B;  2WCM A;  2BEC A;  1PSB A;  2JRF A;  3CR4 X;  3CYZ A;  1NPQ A;  3TDI A;  1XFW O;  2KQY A;  2HQW A;  3QRX A;  1CDN A;  1DJX A;  1ZFS A;  1AHR A;  4JPZ B;  1LXF C;  2QPT A;  3BFB A;  3D0Y B;  1B1G A;  3FWC A;  1ZAC A;  4NDB A;  1Y1U A;  2H61 C;  1A2X A;  1J1E A;  2FOT A;  3CDN A;  3SG7 A;  1S6I A;  5GQQ C;  2L5X B;  4XJK B;  1CFP A;  1JBA A;  1SY9 A;  1SMG A;  2HQ8 A;  4YGC B;  1JUO A;  4WQ3 A;  1YR5 A;  5I2L A;  1QTX A;  3D78 A;  2JQ6 A;  1NCZ A;  1IJ6 A;  1DTL A;  1SBJ A;  2Y4Q A;  1M46 A;  5ER4 X;  1KQV A;  2L2C A;  4PHJ A;  1IQ5 A;  2CCM A;  3S0F A;  4JWQ A;  1LS8 A;  2KFG A;  1WDC B;  2F8P A;  2F2P A;  3EK4 A;  3M0W A;  2JU0 A;  1AVS A;  2ZND A;  4OR9 B;  1DC1 A;  1BU3 A;  2LCP A;  1ALW A;  1C3Z A;  1PVA A;  2LLU A;  2EGD A;  1XK4 A;  3BOW B;  3VRQ A;  1K90 D;  2MLF C;  2BE6 A;  3KF9 A;  1BG1 A;  2LHL A;  1Y0V H;  2MAZ A;  2QEH A;  5AFP A;  5HKZ A;  2WCL A;  3PAT A;  2G2B A;  3EK7 A;  4GBA A;  2D8N A;  3JVT C;  4FTG A;  2K0J A;  1JFK A;  5B8I B;  5KTY A;  2PSR A;  2KYF A;  3NGV A;  4ORC B;  1TRF A;  1OMD A;  2JPT A;  1NX0 A;  2JWW A;  2LVV A;  1QX5 B;  3PM8 A;  4ZCV A;  1KFU L;  2HET A;  3UO9 A;  3D0Y A;  3N7H A;  3SG4 A;  4C0K A;  2KLD A;  3ICB A;  1BJF A;  4XJK A;  4UPG A;  2QDI A;  3B6X A;  1OZS A;  2E6W A;  1YUT A;  1SR6 B;  2L98 A;  2OS8 B;  2LUC A;  1E8A A;  1RK9 A;  2PVB A;  1KK8 B;  3TUY B;  1WLZ A;  2JUL A;  3I5I B;  4INX A;  4M2O A;  1W9Z A;  2VRG A;  5BPJ A;  3R1V A;  1A29 A;  3VGO A;  1KK7 Z;  1YUU A;  1JWD A;  2K7B A;  1F70 A; 
#chains in the Genus database with same CATH homology
 2I2R E;  1QVI Z;  1S36 A;  1FF1 A;  4AQJ A;  1KFX S;  2L2E A;  4HRH A;  3VRO A;  4I5L B;  2JXL A;  1OOJ A;  4NQG A;  2WCE A;  1TOP A;  2KAX A;  1SW8 A;  2FCD A;  2MA2 A;  2MHH A;  3CLN A;  3NSK A;  5DKR A;  3E3R A;  5G08 A;  4DS7 A;  1S5G Z;  1J7P A;  1UP5 A;  3BOW A;  2AMI A;  1UHJ A;  5I8N A;  3CS1 A;  1F4O A;  4CFR A;  1OMV A;  4BY5 A;  3BXK A;  1JC2 A;  2L50 A;  4MN0 A;  3PAL A;  2AAO A;  4PE1 A;  3IF7 A;  1H4B A;  2RGI A;  1L2O B;  1PUL A;  1QJT A;  4F0Z B;  1BR1 B;  1XYD A;  5FYX A;  1SCM B;  2MLE C;  2LP3 A;  5CSJ A;  1KK7 Y;  2MRD A;  4Q04 A;  2ZKM X;  2K2A A;  2K8M B;  2KGB C;  1QVI Y;  1K9P A;  2BL0 C;  2CTN A;  2O5G A;  1YX7 A;  2ZRT A;  5TNC A;  3BUO B;  3NSO A;  1YRU B;  1MWN A;  1S5G Y;  1G8I A;  2KFH A;  4PCW A;  3VRR A;  1BOD A;  2LVI A;  1TNX A;  4ORB B;  4A4C A;  3OB2 B;  3O2P A;  5D7F A;  1DF0 A;  2KGR A;  1BMO A;  3DVK A;  4HRE E;  4PHK A;  1RTP 1;  3BUX B;  4GGN A;  1SL8 A;  3LLE A;  2LMV A;  1AJ5 A;  1LKJ A;  3NSL A;  1IRJ A;  1V1F A;  3PFV A;  3KO0 A;  1S1E A;  2LAN A;  1J55 A;  3I5I C;  4HRG A;  1SYM A;  5DKQ A;  2ISD A;  1H8B A;  2ZRS A;  1AK8 A;  1YRT B;  2EHB A;  3DD4 A;  1CKK A;  1UHH A;  2GGZ A;  3ZWH A;  4MLW A;  2QAC A;  2EC6 C;  2KDH A;  3I5G B;  2CNP A;  1JFJ A;  2M1K B;  1CNP A;  2AUC A;  2F33 A;  1CDM A;  2ZN9 A;  2BKI B;  2KFF A;  1PRW A;  2G9B A;  3DF0 A;  4AQI A;  1R2U A;  3EKH A;  4CFQ A;  2JNF A;  2KOT A;  2O60 A;  3DVM A;  2CBL A;  1MUX A;  3I5F B;  3TS5 C;  2JTZ A;  3TZ1 A;  1W7J B;  4MZL A;  1B7T Z;  3AKB A;  1TCF A;  4MEW A;  1LA3 A;  1XO5 A;  1SRA A;  1ODB A;  1OMR A;  1K94 A;  1UUR A;  3I5H B;  2TN4 A;  1G33 A;  4CPV A;  1EG3 A;  5PAL A;  1CFF A;  1NP8 A;  1SCM C;  3HCM A;  2PMY A;  4MZJ A;  3C1V A;  5IBW A;  1CTR A;  1HT9 A;  2KHN A;  4PE4 A;  2BCX A;  1SCV A;  5KSZ A;  1JSA A;  3LL8 B;  1QLS A;  3FWB A;  5HLO A;  2M97 A;  1Y6W A;  1NUB A;  1DJY A;  2A4J A;  3AAK A;  4E68 A;  3GK2 A;  1AUI B;  1UUS A;  1LA0 A;  1JF2 A;  4I5K A;  2OPO A;  5KU1 A;  1M45 A;  4M2Q A;  1QAS A;  1IGV A;  1S26 D;  3BUN B;  1KCY A;  5AXI A;  1B7T Y;  1CLM A;  3EK8 A;  1IH0 A;  2LC5 A;  1QIW A;  2KBM A;  2Y5I A;  1J7R A;  2M49 B;  3GK4 X;  4JQ0 D;  2JTT A;  3SIA A;  4MRY A;  4TNC A;  4OVN F;  1K95 A;  1QXP A;  3WHT B;  3DVE A;  1A75 B;  1XK4 C;  1ZOT B;  1MQ1 A;  1CDL A;  4NDD A;  2JT3 A;  3LK0 A;  2I18 A;  1CM1 A;  1LVC D;  2F3Z A;  1AJ4 A;  1KFX L;  3I5G C;  2PAL A;  4R1E A;  2Y1N A;  5CSF A;  4CLN A;  5F6T A;  1YTZ C;  4P2Y B;  1C07 A;  3A8R A;  4PHN A;  3CZT X;  2JT8 A;  3EKJ A;  1PAL A;  3VRN A;  1DF0 B;  1KSM A;  1OE9 B;  1XFZ O;  4NDC A;  2K2F A;  4P5O E;  4YI9 A;  1XVJ A;  4PDZ A;  3SJS A;  1QIV A;  4HSZ A;  4GUK A;  1B8L A;  3O6B A;  1M63 B;  4MSP A;  4C0L A;  1SPY A;  4CID A;  2JT0 A;  1RWY A;  1RRO A;  1NX3 A;  2K7O A;  2L0P A;  1YUS A;  3BUW B;  2LMU A;  2LNK A;  1K9K A;  4YGE B;  1FI5 A;  1BLQ A;  4M2P A;  4XYN A;  2WOS A;  1FI6 A;  5I2O A;  2JXC A;  2JOJ A;  2MJW B;  1TTX A;  4QJ5 B;  4N1G A;  5CSN A;  2Q91 A;  1WDC C;  3OHM B;  3MSE B;  1V1G A;  4GPL B;  5HKY A;  1TIZ A;  2BE4 A;  1F71 A;  4N1F A;  3EVV A;  1K9U A;  1CMF A;  3DF0 B;  4ETO A;  2M8U A;  1A75 A;  4ZCU A;  1CLL A;  5AEQ A;  4PE7 A;  1QV1 A;  1DJI A;  2BCB A;  1K2H A;  1C7W A;  1QX2 A;  2WND A;  1IKU A;  2KYC A;  1XFV O;  3KPX A;  3EVU A;  2M1U A;  1K96 A;  3CR5 X;  1EL4 A;  2FJU B;  1RFJ A;  3PLF B;  3IQO A;  5HLV A;  4N5X A;  2K7C A;  1L7Z A;  2M7N A;  3SIB A;  4I5N B;  1TN4 A;  1S6J A;  3BYA A;  1CM4 A;  1NX1 A;  1QAT A;  4WQ2 A;  3F45 A;  2LLS A;  1AP4 A;  4I5J A;  4OCI A;  3HX4 A;  1IQ3 A;  1B4C A;  5K89 A;  1DGV A;  5AAN A;  1DJH A;  2LVJ A;  2ZFD A;  4GGF A;  2NLN A;  3PN7 B;  2K61 A;  1SR6 C;  2OS8 C;  1EH2 A;  2ZN8 A;  1KK8 C;  3TUY C;  2L51 A;  1S3P A;  1PSR A;  1WLM A;  2BBM A;  1PVB A;  1W7I B;  2HF5 A;  2V53 A;  1NSH A;  2KI6 D;  2GGM A;  2LMT A;  2NXQ A;  2LAP A;  1SKT A;  5J3X A;  2B1U A;  1JF0 A;  2ZNE A;  1CFD A;  3GK1 A;  1B47 A;  1IG5 A;  1NCY A;  4WRI A;  1C7V A;  3O4Y A;  2KAY A;  1DVI A;  1WY9 A;  3KEV A;  2CT9 A;  1YVH A;  5JJG A;  2K7D A;  1NWD A;  1N0Y A;  1QX7 A;  2NCO A;  2KI4 B;  2LVK A;  1L2O C;  5CPV A;  2COL B;  5HKW A;  2SAS A;  1Y1A A;  2KAV A;  4USL A;  3AKA A;  1QLK A;  2LHI A;  2F2O A;  3O78 A;  4A4B A;  2KNE A;  1SNL A;  2I94 A;  4OV2 A;  1IWQ A;  2KSP A;  1BOC A;  3WHU B;  2OTG B;  1BT6 A;  2PAS A;  3LCP C;  4C0J A;  5ER5 A;  3NSI A;  3VRP A;  2HPS A;  1SL7 A;  1TNW A;  1XFX O;  1UHI A;  1XFY O;  1J7Q A;  2E30 A;  3CTN A;  1A03 A;  1CDP A;  3RLZ A;  1B8R A;  1SL9 A;  3AAJ A;  3H4S E;  2L4I A;  1XFU O;  2SCP A;  1CFC A;  3PSR A;  2JC2 A;  4YGA A;  4QJ4 B;  1J1D A;  4U8D A;  1HQV A;  3PN7 C;  4FQO A;  1N2D A;  3WNX B;  1EG4 A;  2LE9 B;  3BUM B;  4DUQ A;  3TDZ A;  1MXL C;  1TNP A;  1WRK A;  3K21 A;  2FCE A;  2Y1M A;  4YBH B;  5I2Q A;  2PRU A;  1QV0 A;  2IS9 A;  1J7O A;  2Q4U A;  4GAO A;  1YVL A;  1KQM B;  4L9M A;  1GJY A;  2BL0 B;  2CXJ A;  4OKH A;  1NX2 A;  1UHK A;  1EXR A;  4BY4 A;  2KBI A;  2H2K A;  3EVR A;  1FW4 A;  3NXA A;  3I5F C;  1SK6 D;  1MXE A;  1Y1X A;  4MRX A;  4YI8 A;  3GOF A;  1NIW A;  2LM5 A;  1KWO B;  5D69 A;  3SG2 A;  2NZ0 A;  1U5I B;  1MHO A;  2KI4 C;  4GFT A;  3I5H C;  3CWG A;  3IQQ A;  1N65 A;  1BR4 B;  3JTD B;  1CMG A;  1GQM A;  4MVF A;  1XA5 A;  1CB1 A;  2BKH B;  1RJV A;  1REC A;  4PE0 A;  3A4U B;  1S6C A;  2WCB A;  4PHM A;  1X02 A;  2BCA A;  1QS7 A;  4DRW A;  4DIR A;  2OTG C;  2DOQ A;  2LV7 A;  1F54 A;  3CGA A;  4PAL A;  3D10 A;  1UHN A;  3CR2 A;  3WXA A;  3OX5 A;  1KFU S;  1GGZ A;  1NCX A;  2M0R A;  2EC6 B;  1ALV A;  1VRK A;  2L4H A;  2JNX A;  2NCP A;  3BQ3 A;  2WOR A;  1R6P A;  1MR8 A;  3TDU A;  2M3W A;  1K8U A;  1DMO A;  1DJW A;  4IL1 A;  1F55 A;  1YUR A;  3TS5 B;  1WRZ A;  2JZI A;  2GV5 A;  1YX8 A;  1ZUZ A;  2BBN A;  1EJ3 A;  4ICB A;  4QJ3 B;  1Q80 A;  5DKN A;  3OP0 A;  1F8H A;  1OQP A;  1NYA A;  2MBX A;  1TCO B;  5JOL A;  2WCF A;  2LUX A;  3RM1 A;  2KI6 C;  1IJ5 A;  4GNK B;  1DJG A;  3KHE A;  2WC8 A;  1U5I A;  1F4Q A;  1KQM C;  2M29 A;  1CLB A;  1M39 A;  2F3Y A;  3SG3 A;  1G4Y R;  1GGW A;  2KQ6 A;  1FPW A;  4MBE A;  1UWO A;  4YRU A;  1K93 D;  4ORA B;  4D1E A;  1PK0 D;  1KSO A;  1KWO C;  1WRL A;  1FBV A;  1DJZ A;  2R2I A;  5CSI A;  1DT7 B;  4GGF C;  1A4P A;  2M7L A;  1ZMZ A;  1OZO A;  3JTD C;  5HYD A;  2LP2 A;  2M9G A;  3DVJ A;  1OSA A;  2LLT A;  3FIA A;  1B9A A;  1LIN A;  5AER A;  3JVT B;  4AOM A;  4YGB B;  1M31 A;  3LK1 A;  4MZK A;  1BF5 A;  1D1O A;  4DCK A;  2P6B B;  3FS7 A;  3OB1 B;  1TNQ A;  3ZNI A;  1DGU A;  1B8C A;  1MF8 B;  3OX6 A;  3SG5 A;  2H61 A;  2I7A A;  3SG6 A;  4YGD B;  2BEC A;  1PSB A;  2JRF A;  3CR4 X;  1NPQ A;  3TDI A;  1XFW O;  2KQY A;  2HQW A;  3QRX A;  1CDN A;  1DJX A;  1ZFS A;  1AHR A;  4JPZ B;  1LXF C;  2QPT A;  3D0Y B;  1B1G A;  3FWC A;  1ZAC A;  4NDB A;  1Y1U A;  2H61 C;  1A2X A;  1J1E A;  2FOT A;  3SG7 A;  1S6I A;  5GQQ C;  2L5X B;  4XJK B;  1CFP A;  1JBA A;  1SY9 A;  1SMG A;  2HQ8 A;  4YGC B;  1JUO A;  4WQ3 A;  1YR5 A;  5I2L A;  1QTX A;  2JQ6 A;  1NCZ A;  1IJ6 A;  1DTL A;  1SBJ A;  2Y4Q A;  1M46 A;  5ER4 X;  1KQV A;  4PHJ A;  1IQ5 A;  2CCM A;  4JWQ A;  3EK4 A;  2KFG A;  1WDC B;  2F8P A;  2F2P A;  3M0W A;  2JU0 A;  1AVS A;  2ZND A;  4OR9 B;  1BU3 A;  2LCP A;  1ALW A;  1PVA A;  2LLU A;  2EGD A;  1XK4 A;  3BOW B;  3VRQ A;  1K90 D;  2MLF C;  2BE6 A;  3KF9 A;  1BG1 A;  2LHL A;  1Y0V H;  2MAZ A;  5AFP A;  5HKZ A;  3PAT A;  2G2B A;  3EK7 A;  4GBA A;  2D8N A;  3JVT C;  4FTG A;  2K0J A;  1JFK A;  5B8I B;  5KTY A;  2PSR A;  2KYF A;  4ORC B;  1TRF A;  1OMD A;  2JPT A;  1NX0 A;  2JWW A;  2LVV A;  1QX5 B;  3PM8 A;  4ZCV A;  1KFU L;  2HET A;  3D0Y A;  3SG4 A;  4C0K A;  3ICB A;  1BJF A;  4XJK A;  4UPG A;  1OZS A;  2E6W A;  1YUT A;  1SR6 B;  2L98 A;  2OS8 B;  2LUC A;  1E8A A;  1RK9 A;  2PVB A;  1KK8 B;  3TUY B;  1WLZ A;  2JUL A;  3I5I B;  4M2O A;  2VRG A;  5BPJ A;  1A29 A;  3VGO A;  1KK7 Z;  1YUU A;  1JWD A;  2K7B A;  1F70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...