1R6PA

Nmr structure of the n-terminal domain of trout cardiac troponin c at 7 c
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
MNDIYKAAVEQLTDEQKNEFKAAFDIFIQDAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords troponin C
publication title Effect of temperature on the structure of trout troponin C
pubmed doi rcsb
source organism Oncorhynchus mykiss
total genus 22
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2003-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1r6pA00
1K96A 3DVJA 1J7QA 1OMRA 3HCMA 4YGBB 4OKHA 1XVJA 3KO0A 3VRPA 2QACA 4GNKB 3PN7C 2ISDA 2FOTA 1CB1A 1JSAA 3O6BA 1CM1A 1WDCC 2JNXA 4PE4A 4HRHA 3TS5C 2JT3A 3SG6A 4P5OE 1LVCD 1NUBA 2AUCA 1IKUA 1QS7A 1SCMC 1YTZC 2H61A 4XJKA 4ORAB 2SASA 4ETOA 2JC2A 1TNWA 4F0ZB 4HSZA 2RGIA 4QJ5B 5TNCA 1JC2A 1TNXA 2L4HA 2WNDA 1SPYA 1WRKA 1KK8C 2M3WA 1TNQA 2KFGA 2L5XB 1TTXA 2LUXA 3EKJA 3RM1A 2LHIA 2M9GA 1ZFSA 2JTZA 3EK4A 2I18A 4MVFA 1ZUZA 1YVHA 2LCPA 2EHBA 2M1KB 1B8RA 1FBVA 1HT9A 1XFZO 1BJFA 2WCFA 1BOCA 1NX1A 2LV7A 1L2OB 1BU3A 2Y1NA 3I5FB 3BUWB 5ER4X 2JNFA 2ZKMX 5AANA 1L7ZA 3I5GC 5PALA 2R2IA 1K9PA 3PM8A 4C0LA 1FPWA 4GUKA 4YI8A 2Q4UA 4YGDB 1DJGA 3DD4A 2OPOA 2WC8A 1DJIA 1LXFC 5B8IB 1NSHA 1PSRA 2BECA 1B4CA 1KFUS 1QATA 2M7NA 1BLQA 1OSAA 4M2OA 1FI6A 4AOMA 1JBAA 1YURA 3LK0A 4CLNA 1F55A 1CDPA 1NYAA 2HQWA 4GPLB 4PHMA 1TIZA 3SIAA 1B8CA 1HQVA 3PLFB 1XYDA 2WCEA 4AQJA 1DJWA 2CTNA 1BODA 5CSIA 2KGBC 1WRZA 2KI4B 2ZN9A 1G33A 1WRLA 3ZNIA 1MUXA 1K9KA 2BCBA 5F6TA 4DCKA 3CR2A 1QX7A 4HRGA 3DVMA 1PVAA 1V1FA 2P6BB 3GOFA 4ICBA 1S6IA 3WHUB 1ODBA 1YRUB 1ZOTB 1UP5A 1XFUO 1VRKA 3BUMB 1JFJA 1Y1AA 1X02A 1DVIA 1L2OC 1TN4A 3I5FC 1AP4A 2KHNA 4GGFC 1SK6D 2KBMA 2HPSA 2LM5A 1ZACA 1E8AA 4UPGA 5IBWA 1UHIA 4GFTA 1A4PA 1XA5A 1YUTA 4ORBB 1DJYA 5AXIA 5HLVA 1F70A 1F8HA 2M1UA 1PK0D 1KSOA 1XO5A 2KOTA 1LKJA 2HETA 3E3RA 4I5JA 4OV2A 3CZTX 2KFFA 4MZLA 4N5XA 4U8DA 3M0WA 2LP2A 4YGCB 1QTXA 4CFRA 2PRUA 1JF2A 5JOLA 4JPZB 4MZJA 3TZ1A 1QVIY 1KFUL 2JOJA 3KPXA 4N1GA 2BBNA 2QPTA 1K93D 2K7OA 2V53A 2LMUA 2I2RE 2KI6D 1YRTB 3KF9A 1KQVA 1IQ3A 2NCPA 4MSPA 1TNPA 1OMDA 2K0JA 2AAOA 3CTNA 2JU0A 1NX2A 3JTDB 4XJKB 5HKYA 2PSRA 2LAPA 3AKAA 1A03A 3AAJA 1XFYO 1PVBA 2I7AA 3K21A 2PASA 3SG3A 2KFHA 3OX5A 2A4JA 4PE0A 2K2FA 2CNPA 2JQ6A 3D0YB 3DVEA 5I2LA 2LMTA 2GV5A 2F2PA 5AFPA 2M29A 1GJYA 2LANA 3SIBA 3DF0A 4TNCA 3EK7A 5D7FA 1S1EA 1U5IA 2SCPA 1KSMA 2M0RA 4YRUA 1CMGA 1SL8A 1IH0A 3FWBA 3OB2B 1CLBA 3TDZA 1UUSA 1Y1UA 2KI6C 1QIWA 1IQ5A 1BR1B 1LA0A 1KK7Z 2BE4A 1CDMA 1AHRA 2FCDA 1WLMA 3O78A 2GGZA 3D0YA 1NCYA 3BUXB 1CFDA 3CLNA 2JRFA 1AK8A 3VRRA 3TDUA 2CCMA 3FWCA 1CKKA 1CFPA 1MR8A 2Q91A 1KQMB 1YVLA 1M39A 2OTGB 3BUOB 5DKNA 1V1GA 1UHHA 1XFVO 4MRYA 4GAOA 1IG5A 2MRDA 1RFJA 3LL8B 4N1FA 2BL0B 3BQ3A 2H61C 1QLKA 2M8UA 3JTDC 1F71A 5I2QA 1DGVA 1B8LA 3QRXA 4WQ2A 3CS1A 2KYFA 1QIVA 5CPVA 3IQOA 1MXLC 1NIWA 2LHLA 2Y5IA 5KTYA 1IJ5A 2JT0A 1DJHA 1S6CA 4JWQA 1MQ1A 4OR9B 5CSFA 1QVIZ 1B1GA 1OZSA 2LLTA 5K89A 3MSEB 2L2EA 2L98A 1K9UA 4WQ3A 4DIRA 1NCZA 1GGWA 1N2DA 2PALA 2JULA 3WNXB 4I5LB 2O60A 1K8UA 2D8NA 1XK4A 3VRNA 2LC5A 4FTGA 2F8PA 2LNKA 1PSBA 1SNLA 3LK1A 5AEQA 2WORA 1ALVA 1Y0VH 1WY9A 4WRIA 1KK7Y 4YGEB 4P2YB 1UURA 2ZN8A 1UHKA 1QJTA 2ZRTA 1EL4A 2GGMA 5DKQA 4I5NB 1B9AA 1CLLA 2MBXA 2CT9A 1OMVA 4E68A 1SRAA 4ZCVA 1DTLA 3D10A 2G9BA 3IF7A 3NXAA 1H4BA 1FF1A 1R6PA 2OTGC 1AJ4A 1YX7A 1B7TZ 1NP8A 2NZ0A 2KDHA 5CSNA 1S6JA 2BL0C 2F2OA 1SW8A 1J7PA 1M63B 1PRWA 1N65A 3AAKA 4DRWA 1AVSA 5JJGA 3LCPC 2AMIA 4MBEA 3ICBA 1KWOB 1CTRA 3O2PA 3PFVA 3NSLA 2LE9B 2KAXA 1Y6WA 3O4YA 4PHJA 2NXQA 3DVKA 5I8NA 1UHJA 3GK1A 5HYDA 4ZCUA 1TCOB 3BYAA 1DJZA 2KYCA 1NCXA 1RJVA 2Y4QA 1BG1A 1MF8B 1WDCB 4YBHB 4NDCA 2NCOA 3TS5B 1CDNA 1NX3A 1J1DA 3DF0B 3SG7A 3SG2A 2COLB 1RK9A 4MLWA 1RWYA 1U5IB 2KI4C 2F33A 1WLZA 3OB1B 1FI5A 5J3XA 1MXEA 4PCWA 1J7RA 4A4BA 5KU1A 2CBLA 1DMOA 1S5GZ 3NSOA 2TN4A 2JT8A 4Q04A 1QASA 3FIAA 4GGNA 1R2UA 3FS7A 3AKBA 3I5IB 4OVNF 4D1EA 1EXRA 4M2PA 2KAYA 2KQ6A 2O5GA 4PALA 2DOQA 3GK4X 1W7JB 4BY4A 1NWDA 2EGDA 2M97A 1A75A 2ZNEA 4GBAA 4XYNA 4AQIA 1B7TY 1GGZA 1G8IA 1BT6A 5G08A 2LVKA 3EVUA 2M49B 5AERA 2L51A 2EC6B 2MHHA 4NQGA 1FW4A 2KQYA 4NDDA 2JTTA 2K2AA 1DF0A 2IS9A 1KWOC 2WOSA 3CR5X 4QJ3B 1F4OA 1GQMA 5HLOA 2KNEA 4USLA 2MLFC 3I5GB 1F4QA 1YUUA 2LMVA 4CIDA 1YR5A 3BOWA 1OOJA 1JFKA 2M7LA 1OQPA 1YUSA 2ZRSA 2JWWA 2ZFDA 2BE6A 1SCVA 1BMOA 2L4IA 1SMGA 1JF0A 1SL9A 2K7BA 2F3ZA 3LLEA 5DKRA 1LINA 2KSPA 1DJXA 1K90D 1MWNA 3BXKA 1ZMZA 3OHMB 3A8RA 1AJ5A 2K7DA 1MHOA 2CXJA 2OS8B 1UHNA 1S5GY 5ER5A 2JXLA 2K7CA 1IJ6A 3I5IC 3A4UB 3F45A 1NX0A 4PHNA 3WXAA 2E30A 1CNPA 1M31A 3VROA 1TRFA 4PDZA 2BCAA 1JUOA 1F54A 1B47A 2JZIA 3HX4A 3VGOA 3PALA 2MA2A 1EG4A 4NDBA 2KGRA 4IL1A 2H2KA 1IWQA 1OZOA 2G2BA 5CSJA 2LLUA 2EC6C 4MN0A 3JVTB 4M2QA 2LVJA 2E6WA 1SBJA 1N0YA 1IGVA 1KFXS 4I5KA 1A29A 1IRJA 1AUIB 2KAVA 2L0PA 3KHEA 3CGAA 5FYXA 3OX6A 4L9MA 2LLSA 3PSRA 2PVBA 1BF5A 3TUYB 1K94A 4PE7A 1TCFA 3EKHA 2FCEA 1K95A 2KBIA 2LUCA 1SY9A 1EG3A 1DT7B 4DUQA 2NLNA 1ALWA 2ZNDA 5HKWA 1KQMC 3PATA 1DGUA 4MRXA 1S36A 5BPJA 1M45A 3TDIA 4GGFA 5I2OA 1QX5B 1S26D 3I5HB 4ORCB 1CFCA 1XFWO 5D69A 4DS7A 4R1EA 2BKHB 2HF5A 3WHTB 1SR6B 1UWOA 4FQOA 2OS8C 4HREE 3EVRA 1XK4C 3NSIA 2FJUB 2LVIA 2K8MB 1QX2A 1QV0A 1RECA 2VRGA 1Y1XA 1H8BA 1EJ3A 1SKTA 1YX8A 4JQ0D 2MAZA 1RROA 4YGAA 4C0JA 4CFQA 1S3PA 3ZWHA 1CLMA 3GK2A 3BUNB 3H4SE 4PHKA 3SJSA 1J1EA 3SG4A 2MLEC 3PN7B 1CFFA 1J7OA 1KCYA 2JXCA 3JVTC 1C7WA 1CDLA 3CWGA 1RTP1 3RLZA 1EH2A 1W7IB 3EK8A 4A4CA 1QLSA 2L50A 1A75B 2B1UA 2MJWB 2LVVA 2WCBA 2BBMA 1SYMA 3SG5A 1SL7A 1C7VA 3C1VA 3IQQA 4PE1A 1CMFA 1XFXO 1KFXL 2K61A 4YI9A 2JPTA 1SCMB 4C0KA 1QXPA 3TUYC 1A2XA 1TOPA 4OCIA 1OE9B 2BCXA 3VRQA 1DF0B 4MEWA 4CPVA 1D1OA 1JWDA 4MZKA 5KSZA 1C07A 3NSKA 1Q80A 1KK8B 1NPQA 2BKIB 2HQ8A 5GQQC 5HKZA 3BOWB 1PALA 3EVVA 1CM4A 3KEVA 3I5HC 2LP3A 1PULA 2I94A 1BR4B 4BY5A 1LA3A 3CR4X 1SR6C 2Y1MA 1QV1A 4QJ4B 1K2HA 1G4YR 2PMYA 1J55A 3OP0A 2F3YA 1M46A
chains in the Genus database with same CATH superfamily
1K96A 3DVJA 1J7QA 1OMRA 3HCMA 4YGBB 4OKHA 1XVJA 3KO0A 3VRPA 2QACA 3DYEA 4GNKB 3PN7C 2ISDA 2FOTA 3S0EA 1CB1A 1JSAA 3O6BA 1CM1A 1WDCC 2JNXA 3QMEA 4PE4A 4HRHA 3TS5C 1IIOA 2JT3A 3SG6A 4INXA 4P5OE 4OZDA 1LVCD 1NUBA 2AUCA 1IKUA 1TUZA 1QS7A 3DXLA 1SCMC 1YTZC 2H61A 4XJKA 4ORAB 2SASA 4ETOA 2JC2A 1TNWA 3B86A 4HSZA 4F0ZB 2RGIA 4QJ5B 3IVTA 3BJHA 5TNCA 1JC2A 1TNXA 2L4HA 2QEBA 2WNDA 1SPYA 1WRKA 1KK8C 2M3WA 1TNQA 2KFGA 2L5XB 1TTXA 2LUXA 3B87A 3EKJA 3RM1A 2LHIA 1DELA 2M9GA 1ZFSA 2JTZA 3BFBA 3EK4A 2I18A 4MVFA 1ZUZA 1YVHA 2LCPA 2EHBA 2M1KB 1B8RA 1FBVA 1HT9A 1XFZO 1BJFA 2WCFA 1BOCA 1NX1A 2LV7A 1L2OB 1BU3A 1W9ZA 3S0GA 2Y1NA 3I5FB 3BUWB 5ER4X 2JNFA 2ZKMX 5AANA 1L7ZA 3L4LA 3I5GC 5PALA 1OW4A 1K9PA 1QWVA 2R2IA 3PM8A 4C0LA 4GUKA 4JKTA 4YI8A 1FPWA 2Q4UA 4YGDB 1DJGA 3DD4A 2OPOA 2WC8A 1DJIA 1LXFC 5B8IB 1NSHA 1PSRA 2BECA 1B4CA 1KFUS 1QATA 2M7NA 3VB1A 1BLQA 1OSAA 4M2OA 1FI6A 4AOMA 1JBAA 1YURA 3LK0A 3K1EA 2QDIA 4CLNA 1F55A 3DY9A 1CDPA 1NYAA 2HQWA 1C3ZA 4GPLB 4PHMA 1TIZA 3SIAA 1B8CA 1HQVA 3PLFB 1XYDA 2WCEA 4AQJA 1DJWA 2CTNA 1BODA 5CSIA 2KGBC 1WRZA 3R1PA 2KI4B 2KPHA 2ZN9A 1G33A 1WRLA 3ZNIA 1MUXA 1K9KA 1P28A 2BCBA 5F6TA 3CR2A 3CZ2A 4DCKA 1QX7A 4HRGA 3DVMA 1PVAA 1V1FA 2P6BB 3GOFA 4ICBA 1LS8A 1S6IA 3WHUB 1ODBA 1YRUB 1ZOTB 1UP5A 1XFUO 1VRKA 3BUMB 1JFJA 1Y1AA 1X02A 1DVIA 1L2OC 1TN4A 3I5FC 1AP4A 2KHNA 4GGFC 1SK6D 2KBMA 5HL1A 4KYNA 2HPSA 2LM5A 1ZACA 1E8AA 2H8VA 4UPGA 2WCLA 1UHIA 3OGNA 4GFTA 1A4PA 1OOGA 1XA5A 4F7FA 1YUTA 4ORBB 1DJYA 5AXIA 5HLVA 1F70A 1F8HA 2M1UA 1PK0D 1KSOA 1XO5A 2KOTA 1LKJA 2HETA 3E3RA 4I5JA 4OV2A 3CZTX 2KFFA 4MZLA 4N5XA 4U8DA 3M0WA 2LP2A 4YGCB 1QTXA 4CFRA 2PRUA 2K60A 1JF2A 5JOLA 4JPZB 4MZJA 3TZ1A 1QVIY 1KFUL 2P70A 2JOJA 3KPXA 4N1GA 2BBNA 2QPTA 1K93D 2K7OA 2V53A 2LMUA 1C3YA 2I2RE 2KI6D 1YRTB 3KF9A 1KQVA 1IQ3A 2NCPA 4MSPA 1TNPA 1OMDA 2K0JA 1OOIX 2AAOA 3CTNA 2JU0A 1NX2A 3JTDB 4XJKB 5HKYA 2PSRA 2LAPA 3AKAA 1A03A 3AAJA 1XFYO 1PVBA 2I7AA 3K21A 2PASA 3SG3A 2KFHA 3OX5A 2A4JA 4PE0A 2K2FA 2CNPA 2JQ6A 3D0YB 3DVEA 5I2LA 2LMTA 2GV5A 5I94A 2F2PA 5AFPA 2M29A 1GJYA 2LANA 3SIBA 3DF0A 4TNCA 3D76A 3EK7A 3BFHA 5D7FA 1S1EA 3FE9A 1Z2CB 1U5IA 3B7AA 2SCPA 5FI7A 1KSMA 2M0RA 4YRUA 1CMGA 1SL8A 1IH0A 3FWBA 3OB2B 1CLBA 3TDZA 1UUSA 1Y1UA 3V2LA 2KI6C 1QIWA 1IQ5A 2BAPA 1BR1B 1LA0A 3L4AA 3D74A 1KK7Z 1SSEB 2BE4A 4JD9A 3CZ1A 1CDMA 1AHRA 2FCDA 1WLMA 3O78A 2GGZA 3D0YA 1NCYA 3BUXB 3N7HA 1CFDA 3CLNA 3S0DA 2JRFA 1AK8A 3VRRA 3TDUA 2CCMA 3FWCA 1CKKA 1CFPA 1MR8A 2Q91A 1KQMB 1YVLA 1M39A 2OTGB 3BUOB 5DKNA 1V1GA 3NGVA 1UHHA 1XFVO 4MRYA 4GAOA 1IG5A 2BNXA 2MRDA 1RFJA 3LL8B 4N1FA 2BL0B 3BQ3A 2H61C 4IJ7A 1QLKA 2M8UA 3JTDC 1F71A 5I2QA 1DGVA 1B8LA 3QRXA 4WQ2A 3CS1A 2KYFA 1QIVA 5CPVA 3NHTA 3IQOA 1DEKA 1MXLC 3L47A 5D3OA 1NIWA 2LHLA 2YGUA 2Y5IA 5KTYA 2PQLA 4PT1A 1IJ5A 2JT0A 1DJHA 1S6CA 4JWQA 1MQ1A 4OR9B 5CSFA 2WCHA 1QVIZ 1B1GA 1OZSA 2LLTA 5K89A 3MSEB 2L2EA 2L98A 1K9UA 4WQ3A 4DIRA 2FJYA 1NCZA 1GGWA 1N2DA 2PALA 2JULA 3WNXB 4I5LB 2O60A 1K8UA 2D8NA 1XK4A 3VRNA 2LC5A 4FTGA 2F8PA 2LNKA 1PSBA 1SNLA 3LK1A 5AEQA 2WORA 1ALVA 1Y0VH 1WY9A 2P71A 1KK7Y 4WRIA 4YGEB 4P2YB 1UURA 2ZN8A 2WC5A 1UHKA 1QJTA 2ZRTA 1EL4A 2GGMA 5EL2A 5DKQA 3S0BA 3R72A 4I5NB 1B9AA 1CLLA 2MBXA 2CT9A 1OMVA 4E68A 1DC1A 3B88A 1SRAA 4ZCVA 1DTLA 2KLEA 2G9BA 3D10A 3IF7A 3NXAA 1FF1A 1H4BA 1R6PA 2OTGC 3Q8IA 1AJ4A 1YX7A 1B7TZ 1NP8A 2NZ0A 2KDHA 2WC6A 5CSNA 1S6JA 2BL0C 1XFRA 1SW8A 2F2OA 1J7PA 1M63B 1PRWA 1N65A 1OOFA 3AAKA 4DRWA 1AVSA 5JJGA 3LCPC 2AMIA 4MBEA 3ICBA 1KWOB 1CTRA 3CDNA 3O2PA 3PFVA 2QEOA 3NSLA 2LE9B 2KAXA 1Y6WA 3O4YA 4PHJA 2NXQA 3DVKA 5I8NA 1UHJA 3GK1A 5HYDA 2GTEA 1TCOB 3BYAA 1DJZA 2KYCA 3D75A 1NCXA 1RJVA 4ZCUA 2Y4QA 1BG1A 3S0AA 1MF8B 1WDCB 4YBHB 4NDCA 3PJIA 2NCOA 3TS5B 1CDNA 1NX3A 1J1DA 3DF0B 3SG7A 3SG2A 4FQTA 2COLB 1RK9A 3O4XA 4MLWA 1RWYA 1U5IB 2KI4C 2F33A 1WLZA 3OB1B 1FI5A 5J3XA 1MXEA 4PCWA 1J7RA 4A4BA 5KU1A 2CBLA 1DMOA 1S5GZ 3NSOA 2TN4A 2JT8A 1TWOA 2WCKA 1TUJA 4Q04A 1QASA 3FIAA 4GGNA 1R2UA 3FS7A 3AKBA 2L2CA 3I5IB 4OVNF 4D1EA 1EXRA 4M2PA 2PYQA 3UO9A 2KAYA 2KQ6A 2O5GA 4INWA 2DOQA 4PALA 3GK4X 1W7JB 4BY4A 1NWDA 2EGDA 2M97A 1A75A 2ZNEA 4GBAA 4XYNA 1DQEA 1B7TY 1G8IA 1GGZA 4AQIA 3D77A 1BT6A 3CABA 2LVKA 3EVUA 2M49B 5G08A 2L51A 5AERA 2EC6B 2MHHA 4NQGA 1FW4A 2KQYA 3DZTA 4NDDA 2JTTA 2K2AA 1DF0A 2IS9A 1KWOC 2WOSA 3CR5X 4QJ3B 1F4OA 1GQMA 5HLOA 2KNEA 4USLA 2MLFC 3I5GB 1F4QA 1YUUA 2LMVA 4CIDA 1YR5A 3BOWA 1OOJA 1JFKA 2M7LA 1OQPA 1YUSA 2ZRSA 2JWWA 2ZFDA 2BE6A 1SCVA 1BMOA 2L4IA 1SMGA 1JF0A 1SL9A 2K7BA 2F3ZA 3LLEA 5DKRA 2WCMA 1LINA 2KSPA 1DJXA 3S0FA 3SS3A 1K90D 1MWNA 3BXKA 1ZMZA 3OHMB 3A8RA 1AJ5A 2K7DA 1MHOA 2CXJA 2OS8B 1UHNA 1S5GY 5ER5A 2JXLA 2K7CA 1IJ6A 1ORGA 3I5IC 3A4UB 3F45A 1NX0A 4PHNA 3WXAA 2E30A 1CNPA 1M31A 3D73A 3VROA 1TRFA 4PDZA 2BCAA 1JUOA 1F54A 1B47A 2JZIA 3HX4A 3VGOA 3PALA 2MA2A 2WCJA 1EG4A 4NDBA 2KGRA 3CYZA 4IL1A 2H2KA 1IWQA 1OZOA 2G2BA 5CSJA 2LLUA 2EC6C 4MN0A 3JVTB 4M2QA 2LVJA 2E6WA 1SBJA 1N0YA 1IGVA 3CZ0A 5FI6A 1KFXS 3SS4A 4I5KA 1A29A 5DICA 1IRJA 1AUIB 2KAVA 2L0PA 3KHEA 3CGAA 5FYXA 3OX6A 4L9MA 2LLSA 3PSRA 2PVBA 1BF5A 3BFAA 3TUYB 1GM0A 1K94A 3SS5A 3R1OA 3NHIA 4PE7A 1TCFA 3EKHA 2FCEA 1K95A 2KBIA 2LUCA 1SY9A 1EG3A 3RZSA 1DT7B 4DUQA 2NLNA 1ALWA 2ZNDA 1T14A 5HKWA 3EG5B 1KQMC 3PATA 1DGUA 4MRXA 1S36A 3UNWA 5BPJA 1M45A 3TDIA 4GGFA 5I2OA 1QX5B 1S26D 3I5HB 4ORCB 1CFCA 1XFWO 3FE8A 5D69A 4DS7A 4R1EA 2BKHB 2HF5A 3WHTB 1SR6B 1UWOA 2JPOA 2OS8C 4FQOA 3EVRA 4HREE 5FI2A 1XK4C 3NSIA 2FJUB 2LVIA 2K8MB 1QX2A 1QV0A 1RECA 2KLDA 2VRGA 1Y1XA 1H8BA 1EJ3A 1SKTA 1YX8A 4JQ0D 2MAZA 1RROA 4YGAA 4C0JA 1Z4HA 4CFQA 1S3PA 2L5YA 3ZWHA 1CLMA 3GK2A 3BUNB 3H4SE 4PHKA 3SJSA 1J1EA 3SG4A 1OOHA 2MLEC 3D78A 3PN7B 1CFFA 1J7OA 2JXCA 1KCYA 3JVTC 1C7WA 1CDLA 3CWGA 1RTP1 3OBVA 3RLZA 1W7IB 3PM2A 1EH2A 3EK8A 4A4CA 1QLSA 2L50A 1A75B 2B1UA 2MJWB 2LVVA 2WCBA 2BBMA 1SYMA 3SG5A 1SL7A 1C7VA 3C1VA 3IQQA 4PE1A 1CMFA 1XFXO 1KFXL 2K61A 4YI9A 2JPTA 1SCMB 4C0KA 1QXPA 3TUYC 1A2XA 5IBWA 1TOPA 4OCIA 1OE9B 2BCXA 3VRQA 1DF0B 4MEWA 4CPVA 1D1OA 1JWDA 4MZKA 3R1VA 5KSZA 1C07A 3NSKA 1Q80A 2QEVA 1KK8B 1NPQA 2BKIB 2HQ8A 3FE6A 5GQQC 5HKZA 3BOWB 1PALA 2ERBA 3EVVA 1CM4A 3KEVA 3I5HC 2LP3A 2QEHA 1PULA 2I94A 1BR4B 4BY5A 1LA3A 3CR4X 3B6XA 1SR6C 2Y1MA 1QV1A 4QJ4B 1K2HA 1G4YR 2PMYA 1J55A 3OP0A 2F3YA 1M46A
chains in the Genus database with same CATH topology
1K96A 3DVJA 1J7QA 1OMRA 3HCMA 4YGBB 4OKHA 1XVJA 3KO0A 3VRPA 2QACA 4GNKB 3PN7C 2ISDA 2FOTA 1CB1A 1JSAA 3O6BA 1CM1A 1WDCC 2JNXA 4PE4A 4HRHA 3TS5C 2JT3A 3SG6A 4P5OE 1LVCD 1NUBA 2AUCA 1IKUA 1QS7A 1SCMC 1YTZC 2H61A 4XJKA 4ORAB 2SASA 4ETOA 2JC2A 1TNWA 4F0ZB 4HSZA 2RGIA 4QJ5B 5TNCA 1JC2A 1TNXA 2L4HA 2WNDA 1SPYA 1WRKA 1KK8C 2M3WA 1TNQA 2KFGA 2L5XB 1TTXA 2LUXA 3EKJA 3RM1A 2LHIA 2M9GA 1ZFSA 2JTZA 3EK4A 2I18A 4MVFA 1ZUZA 1YVHA 2LCPA 2EHBA 2M1KB 1B8RA 1FBVA 1HT9A 1XFZO 1BJFA 2WCFA 1BOCA 1NX1A 2LV7A 1L2OB 1BU3A 2Y1NA 3I5FB 3BUWB 5ER4X 2JNFA 2ZKMX 5AANA 1L7ZA 3I5GC 5PALA 2R2IA 1K9PA 3PM8A 4C0LA 1FPWA 4GUKA 4YI8A 2Q4UA 4YGDB 1DJGA 3DD4A 2OPOA 2WC8A 1DJIA 1LXFC 5B8IB 1NSHA 1PSRA 2BECA 1B4CA 1KFUS 1QATA 2M7NA 1BLQA 1OSAA 4M2OA 1FI6A 4AOMA 1JBAA 1YURA 3LK0A 4CLNA 1F55A 1CDPA 1NYAA 2HQWA 4GPLB 4PHMA 1TIZA 3SIAA 1B8CA 1HQVA 3PLFB 1XYDA 2WCEA 4AQJA 1DJWA 2CTNA 1BODA 5CSIA 2KGBC 1WRZA 2KI4B 2ZN9A 1G33A 1WRLA 3ZNIA 1MUXA 1K9KA 2BCBA 5F6TA 4DCKA 3CR2A 1QX7A 4HRGA 3DVMA 1PVAA 1V1FA 2P6BB 3GOFA 4ICBA 1S6IA 3WHUB 1ODBA 1YRUB 1ZOTB 1UP5A 1XFUO 1VRKA 3BUMB 1JFJA 1Y1AA 1X02A 1DVIA 1L2OC 1TN4A 3I5FC 1AP4A 2KHNA 4GGFC 1SK6D 2KBMA 2HPSA 2LM5A 1ZACA 1E8AA 4UPGA 5IBWA 1UHIA 4GFTA 1A4PA 1XA5A 1YUTA 4ORBB 1DJYA 5AXIA 5HLVA 1F70A 1F8HA 2M1UA 1PK0D 1KSOA 1XO5A 2KOTA 1LKJA 2HETA 3E3RA 4I5JA 4OV2A 3CZTX 2KFFA 4MZLA 4N5XA 4U8DA 3M0WA 2LP2A 4YGCB 1QTXA 4CFRA 2PRUA 1JF2A 5JOLA 4JPZB 4MZJA 3TZ1A 1QVIY 1KFUL 2JOJA 3KPXA 4N1GA 2BBNA 2QPTA 1K93D 2K7OA 2V53A 2LMUA 2I2RE 2KI6D 1YRTB 3KF9A 1KQVA 1IQ3A 2NCPA 4MSPA 1TNPA 1OMDA 2K0JA 2AAOA 3CTNA 2JU0A 1NX2A 3JTDB 4XJKB 5HKYA 2PSRA 2LAPA 3AKAA 1A03A 3AAJA 1XFYO 1PVBA 2I7AA 3K21A 2PASA 3SG3A 2KFHA 3OX5A 2A4JA 4PE0A 2K2FA 2CNPA 2JQ6A 3D0YB 3DVEA 5I2LA 2LMTA 2GV5A 2F2PA 5AFPA 2M29A 1GJYA 2LANA 3SIBA 3DF0A 4TNCA 3EK7A 5D7FA 1S1EA 1U5IA 2SCPA 1KSMA 2M0RA 4YRUA 1CMGA 1SL8A 1IH0A 3FWBA 3OB2B 1CLBA 3TDZA 1UUSA 1Y1UA 2KI6C 1QIWA 1IQ5A 1BR1B 1LA0A 1KK7Z 2BE4A 1CDMA 1AHRA 2FCDA 1WLMA 3O78A 2GGZA 3D0YA 1NCYA 3BUXB 1CFDA 3CLNA 2JRFA 1AK8A 3VRRA 3TDUA 2CCMA 3FWCA 1CKKA 1CFPA 1MR8A 2Q91A 1KQMB 1YVLA 1M39A 2OTGB 3BUOB 5DKNA 1V1GA 1UHHA 1XFVO 4MRYA 4GAOA 1IG5A 2MRDA 1RFJA 3LL8B 4N1FA 2BL0B 3BQ3A 2H61C 1QLKA 2M8UA 3JTDC 1F71A 5I2QA 1DGVA 1B8LA 3QRXA 4WQ2A 3CS1A 2KYFA 1QIVA 5CPVA 3IQOA 1MXLC 1NIWA 2LHLA 2Y5IA 5KTYA 1IJ5A 2JT0A 1DJHA 1S6CA 4JWQA 1MQ1A 4OR9B 5CSFA 1QVIZ 1B1GA 1OZSA 2LLTA 5K89A 3MSEB 2L2EA 2L98A 1K9UA 4WQ3A 4DIRA 1NCZA 1GGWA 1N2DA 2PALA 2JULA 3WNXB 4I5LB 2O60A 1K8UA 2D8NA 1XK4A 3VRNA 2LC5A 4FTGA 2F8PA 2LNKA 1PSBA 1SNLA 3LK1A 5AEQA 2WORA 1ALVA 1Y0VH 1WY9A 4WRIA 1KK7Y 4YGEB 4P2YB 1UURA 2ZN8A 1UHKA 1QJTA 2ZRTA 1EL4A 2GGMA 5DKQA 4I5NB 1B9AA 1CLLA 2MBXA 2CT9A 1OMVA 4E68A 1SRAA 4ZCVA 1DTLA 3D10A 2G9BA 3IF7A 3NXAA 1H4BA 1FF1A 1R6PA 2OTGC 1AJ4A 1YX7A 1B7TZ 1NP8A 2NZ0A 2KDHA 5CSNA 1S6JA 2BL0C 2F2OA 1SW8A 1J7PA 1M63B 1PRWA 1N65A 3AAKA 4DRWA 1AVSA 5JJGA 3LCPC 2AMIA 4MBEA 3ICBA 1KWOB 1CTRA 3O2PA 3PFVA 3NSLA 2LE9B 2KAXA 1Y6WA 3O4YA 4PHJA 2NXQA 3DVKA 5I8NA 1UHJA 3GK1A 5HYDA 4ZCUA 1TCOB 3BYAA 1DJZA 2KYCA 1NCXA 1RJVA 2Y4QA 1BG1A 1MF8B 1WDCB 4YBHB 4NDCA 2NCOA 3TS5B 1CDNA 1NX3A 1J1DA 3DF0B 3SG7A 3SG2A 2COLB 1RK9A 4MLWA 1RWYA 1U5IB 2KI4C 2F33A 1WLZA 3OB1B 1FI5A 5J3XA 1MXEA 4PCWA 1J7RA 4A4BA 5KU1A 2CBLA 1DMOA 1S5GZ 3NSOA 2TN4A 2JT8A 4Q04A 1QASA 3FIAA 4GGNA 1R2UA 3FS7A 3AKBA 3I5IB 4OVNF 4D1EA 1EXRA 4M2PA 2KAYA 2KQ6A 2O5GA 4PALA 2DOQA 3GK4X 1W7JB 4BY4A 1NWDA 2EGDA 2M97A 1A75A 2ZNEA 4GBAA 4XYNA 4AQIA 1B7TY 1GGZA 1G8IA 1BT6A 5G08A 2LVKA 3EVUA 2M49B 5AERA 2L51A 2EC6B 2MHHA 4NQGA 1FW4A 2KQYA 4NDDA 2JTTA 2K2AA 1DF0A 2IS9A 1KWOC 2WOSA 3CR5X 4QJ3B 1F4OA 1GQMA 5HLOA 2KNEA 4USLA 2MLFC 3I5GB 1F4QA 1YUUA 2LMVA 4CIDA 1YR5A 3BOWA 1OOJA 1JFKA 2M7LA 1OQPA 1YUSA 2ZRSA 2JWWA 2ZFDA 2BE6A 1SCVA 1BMOA 2L4IA 1SMGA 1JF0A 1SL9A 2K7BA 2F3ZA 3LLEA 5DKRA 1LINA 2KSPA 1DJXA 1K90D 1MWNA 3BXKA 1ZMZA 3OHMB 3A8RA 1AJ5A 2K7DA 1MHOA 2CXJA 2OS8B 1UHNA 1S5GY 5ER5A 2JXLA 2K7CA 1IJ6A 3I5IC 3A4UB 3F45A 1NX0A 4PHNA 3WXAA 2E30A 1CNPA 1M31A 3VROA 1TRFA 4PDZA 2BCAA 1JUOA 1F54A 1B47A 2JZIA 3HX4A 3VGOA 3PALA 2MA2A 1EG4A 4NDBA 2KGRA 4IL1A 2H2KA 1IWQA 1OZOA 2G2BA 5CSJA 2LLUA 2EC6C 4MN0A 3JVTB 4M2QA 2LVJA 2E6WA 1SBJA 1N0YA 1IGVA 1KFXS 4I5KA 1A29A 1IRJA 1AUIB 2KAVA 2L0PA 3KHEA 3CGAA 5FYXA 3OX6A 4L9MA 2LLSA 3PSRA 2PVBA 1BF5A 3TUYB 1K94A 4PE7A 1TCFA 3EKHA 2FCEA 1K95A 2KBIA 2LUCA 1SY9A 1EG3A 1DT7B 4DUQA 2NLNA 1ALWA 2ZNDA 5HKWA 1KQMC 3PATA 1DGUA 4MRXA 1S36A 5BPJA 1M45A 3TDIA 4GGFA 5I2OA 1QX5B 1S26D 3I5HB 4ORCB 1CFCA 1XFWO 5D69A 4DS7A 4R1EA 2BKHB 2HF5A 3WHTB 1SR6B 1UWOA 4FQOA 2OS8C 4HREE 3EVRA 1XK4C 3NSIA 2FJUB 2LVIA 2K8MB 1QX2A 1QV0A 1RECA 2VRGA 1Y1XA 1H8BA 1EJ3A 1SKTA 1YX8A 4JQ0D 2MAZA 1RROA 4YGAA 4C0JA 4CFQA 1S3PA 3ZWHA 1CLMA 3GK2A 3BUNB 3H4SE 4PHKA 3SJSA 1J1EA 3SG4A 2MLEC 3PN7B 1CFFA 1J7OA 1KCYA 2JXCA 3JVTC 1C7WA 1CDLA 3CWGA 1RTP1 3RLZA 1EH2A 1W7IB 3EK8A 4A4CA 1QLSA 2L50A 1A75B 2B1UA 2MJWB 2LVVA 2WCBA 2BBMA 1SYMA 3SG5A 1SL7A 1C7VA 3C1VA 3IQQA 4PE1A 1CMFA 1XFXO 1KFXL 2K61A 4YI9A 2JPTA 1SCMB 4C0KA 1QXPA 3TUYC 1A2XA 1TOPA 4OCIA 1OE9B 2BCXA 3VRQA 1DF0B 4MEWA 4CPVA 1D1OA 1JWDA 4MZKA 5KSZA 1C07A 3NSKA 1Q80A 1KK8B 1NPQA 2BKIB 2HQ8A 5GQQC 5HKZA 3BOWB 1PALA 3EVVA 1CM4A 3KEVA 3I5HC 2LP3A 1PULA 2I94A 1BR4B 4BY5A 1LA3A 3CR4X 1SR6C 2Y1MA 1QV1A 4QJ4B 1K2HA 1G4YR 2PMYA 1J55A 3OP0A 2F3YA 1M46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K96 A;  3DVJ A;  1J7Q A;  1OMR A;  3HCM A;  4YGB B;  4OKH A;  1XVJ A;  3KO0 A;  3VRP A;  2QAC A;  4GNK B;  3PN7 C;  2ISD A;  2FOT A;  1CB1 A;  1JSA A;  3O6B A;  1CM1 A;  1WDC C;  2JNX A;  4PE4 A;  4HRH A;  3TS5 C;  2JT3 A;  3SG6 A;  4P5O E;  1LVC D;  1NUB A;  2AUC A;  1IKU A;  1QS7 A;  1SCM C;  1YTZ C;  2H61 A;  4XJK A;  4ORA B;  2SAS A;  4ETO A;  2JC2 A;  1TNW A;  4F0Z B;  4HSZ A;  2RGI A;  4QJ5 B;  5TNC A;  1JC2 A;  1TNX A;  2L4H A;  2WND A;  1SPY A;  1WRK A;  1KK8 C;  2M3W A;  1TNQ A;  2KFG A;  2L5X B;  1TTX A;  2LUX A;  3EKJ A;  3RM1 A;  2LHI A;  2M9G A;  1ZFS A;  2JTZ A;  3EK4 A;  2I18 A;  4MVF A;  1ZUZ A;  1YVH A;  2LCP A;  2EHB A;  2M1K B;  1B8R A;  1FBV A;  1HT9 A;  1XFZ O;  1BJF A;  2WCF A;  1BOC A;  1NX1 A;  2LV7 A;  1L2O B;  1BU3 A;  2Y1N A;  3I5F B;  3BUW B;  5ER4 X;  2JNF A;  2ZKM X;  5AAN A;  1L7Z A;  3I5G C;  5PAL A;  2R2I A;  1K9P A;  3PM8 A;  4C0L A;  1FPW A;  4GUK A;  4YI8 A;  2Q4U A;  4YGD B;  1DJG A;  3DD4 A;  2OPO A;  2WC8 A;  1DJI A;  1LXF C;  5B8I B;  1NSH A;  1PSR A;  2BEC A;  1B4C A;  1KFU S;  1QAT A;  2M7N A;  1BLQ A;  1OSA A;  4M2O A;  1FI6 A;  4AOM A;  1JBA A;  1YUR A;  3LK0 A;  4CLN A;  1F55 A;  1CDP A;  1NYA A;  2HQW A;  4GPL B;  4PHM A;  1TIZ A;  3SIA A;  1B8C A;  1HQV A;  3PLF B;  1XYD A;  2WCE A;  4AQJ A;  1DJW A;  2CTN A;  1BOD A;  5CSI A;  2KGB C;  1WRZ A;  2KI4 B;  2ZN9 A;  1G33 A;  1WRL A;  3ZNI A;  1MUX A;  1K9K A;  2BCB A;  5F6T A;  4DCK A;  3CR2 A;  1QX7 A;  4HRG A;  3DVM A;  1PVA A;  1V1F A;  2P6B B;  3GOF A;  4ICB A;  1S6I A;  3WHU B;  1ODB A;  1YRU B;  1ZOT B;  1UP5 A;  1XFU O;  1VRK A;  3BUM B;  1JFJ A;  1Y1A A;  1X02 A;  1DVI A;  1L2O C;  1TN4 A;  3I5F C;  1AP4 A;  2KHN A;  4GGF C;  1SK6 D;  2KBM A;  2HPS A;  2LM5 A;  1ZAC A;  1E8A A;  4UPG A;  5IBW A;  1UHI A;  4GFT A;  1A4P A;  1XA5 A;  1YUT A;  4ORB B;  1DJY A;  5AXI A;  5HLV A;  1F70 A;  1F8H A;  2M1U A;  1PK0 D;  1KSO A;  1XO5 A;  2KOT A;  1LKJ A;  2HET A;  3E3R A;  4I5J A;  4OV2 A;  3CZT X;  2KFF A;  4MZL A;  4N5X A;  4U8D A;  3M0W A;  2LP2 A;  4YGC B;  1QTX A;  4CFR A;  2PRU A;  1JF2 A;  5JOL A;  4JPZ B;  4MZJ A;  3TZ1 A;  1QVI Y;  1KFU L;  2JOJ A;  3KPX A;  4N1G A;  2BBN A;  2QPT A;  1K93 D;  2K7O A;  2V53 A;  2LMU A;  2I2R E;  2KI6 D;  1YRT B;  3KF9 A;  1KQV A;  1IQ3 A;  2NCP A;  4MSP A;  1TNP A;  1OMD A;  2K0J A;  2AAO A;  3CTN A;  2JU0 A;  1NX2 A;  3JTD B;  4XJK B;  5HKY A;  2PSR A;  2LAP A;  3AKA A;  1A03 A;  3AAJ A;  1XFY O;  1PVB A;  2I7A A;  3K21 A;  2PAS A;  3SG3 A;  2KFH A;  3OX5 A;  2A4J A;  4PE0 A;  2K2F A;  2CNP A;  2JQ6 A;  3D0Y B;  3DVE A;  5I2L A;  2LMT A;  2GV5 A;  2F2P A;  5AFP A;  2M29 A;  1GJY A;  2LAN A;  3SIB A;  3DF0 A;  4TNC A;  3EK7 A;  5D7F A;  1S1E A;  1U5I A;  2SCP A;  1KSM A;  2M0R A;  4YRU A;  1CMG A;  1SL8 A;  1IH0 A;  3FWB A;  3OB2 B;  1CLB A;  3TDZ A;  1UUS A;  1Y1U A;  2KI6 C;  1QIW A;  1IQ5 A;  1BR1 B;  1LA0 A;  1KK7 Z;  2BE4 A;  1CDM A;  1AHR A;  2FCD A;  1WLM A;  3O78 A;  2GGZ A;  3D0Y A;  1NCY A;  3BUX B;  1CFD A;  3CLN A;  2JRF A;  1AK8 A;  3VRR A;  3TDU A;  2CCM A;  3FWC A;  1CKK A;  1CFP A;  1MR8 A;  2Q91 A;  1KQM B;  1YVL A;  1M39 A;  2OTG B;  3BUO B;  5DKN A;  1V1G A;  1UHH A;  1XFV O;  4MRY A;  4GAO A;  1IG5 A;  2MRD A;  1RFJ A;  3LL8 B;  4N1F A;  2BL0 B;  3BQ3 A;  2H61 C;  1QLK A;  2M8U A;  3JTD C;  1F71 A;  5I2Q A;  1DGV A;  1B8L A;  3QRX A;  4WQ2 A;  3CS1 A;  2KYF A;  1QIV A;  5CPV A;  3IQO A;  1MXL C;  1NIW A;  2LHL A;  2Y5I A;  5KTY A;  1IJ5 A;  2JT0 A;  1DJH A;  1S6C A;  4JWQ A;  1MQ1 A;  4OR9 B;  5CSF A;  1QVI Z;  1B1G A;  1OZS A;  2LLT A;  5K89 A;  3MSE B;  2L2E A;  2L98 A;  1K9U A;  4WQ3 A;  4DIR A;  1NCZ A;  1GGW A;  1N2D A;  2PAL A;  2JUL A;  3WNX B;  4I5L B;  2O60 A;  1K8U A;  2D8N A;  1XK4 A;  3VRN A;  2LC5 A;  4FTG A;  2F8P A;  2LNK A;  1PSB A;  1SNL A;  3LK1 A;  5AEQ A;  2WOR A;  1ALV A;  1Y0V H;  1WY9 A;  4WRI A;  1KK7 Y;  4YGE B;  4P2Y B;  1UUR A;  2ZN8 A;  1UHK A;  1QJT A;  2ZRT A;  1EL4 A;  2GGM A;  5DKQ A;  4I5N B;  1B9A A;  1CLL A;  2MBX A;  2CT9 A;  1OMV A;  4E68 A;  1SRA A;  4ZCV A;  1DTL A;  3D10 A;  2G9B A;  3IF7 A;  3NXA A;  1H4B A;  1FF1 A;  1R6P A;  2OTG C;  1AJ4 A;  1YX7 A;  1B7T Z;  1NP8 A;  2NZ0 A;  2KDH A;  5CSN A;  1S6J A;  2BL0 C;  2F2O A;  1SW8 A;  1J7P A;  1M63 B;  1PRW A;  1N65 A;  3AAK A;  4DRW A;  1AVS A;  5JJG A;  3LCP C;  2AMI A;  4MBE A;  3ICB A;  1KWO B;  1CTR A;  3O2P A;  3PFV A;  3NSL A;  2LE9 B;  2KAX A;  1Y6W A;  3O4Y A;  4PHJ A;  2NXQ A;  3DVK A;  5I8N A;  1UHJ A;  3GK1 A;  5HYD A;  4ZCU A;  1TCO B;  3BYA A;  1DJZ A;  2KYC A;  1NCX A;  1RJV A;  2Y4Q A;  1BG1 A;  1MF8 B;  1WDC B;  4YBH B;  4NDC A;  2NCO A;  3TS5 B;  1CDN A;  1NX3 A;  1J1D A;  3DF0 B;  3SG7 A;  3SG2 A;  2COL B;  1RK9 A;  4MLW A;  1RWY A;  1U5I B;  2KI4 C;  2F33 A;  1WLZ A;  3OB1 B;  1FI5 A;  5J3X A;  1MXE A;  4PCW A;  1J7R A;  4A4B A;  5KU1 A;  2CBL A;  1DMO A;  1S5G Z;  3NSO A;  2TN4 A;  2JT8 A;  4Q04 A;  1QAS A;  3FIA A;  4GGN A;  1R2U A;  3FS7 A;  3AKB A;  3I5I B;  4OVN F;  4D1E A;  1EXR A;  4M2P A;  2KAY A;  2KQ6 A;  2O5G A;  4PAL A;  2DOQ A;  3GK4 X;  1W7J B;  4BY4 A;  1NWD A;  2EGD A;  2M97 A;  1A75 A;  2ZNE A;  4GBA A;  4XYN A;  4AQI A;  1B7T Y;  1GGZ A;  1G8I A;  1BT6 A;  5G08 A;  2LVK A;  3EVU A;  2M49 B;  5AER A;  2L51 A;  2EC6 B;  2MHH A;  4NQG A;  1FW4 A;  2KQY A;  4NDD A;  2JTT A;  2K2A A;  1DF0 A;  2IS9 A;  1KWO C;  2WOS A;  3CR5 X;  4QJ3 B;  1F4O A;  1GQM A;  5HLO A;  2KNE A;  4USL A;  2MLF C;  3I5G B;  1F4Q A;  1YUU A;  2LMV A;  4CID A;  1YR5 A;  3BOW A;  1OOJ A;  1JFK A;  2M7L A;  1OQP A;  1YUS A;  2ZRS A;  2JWW A;  2ZFD A;  2BE6 A;  1SCV A;  1BMO A;  2L4I A;  1SMG A;  1JF0 A;  1SL9 A;  2K7B A;  2F3Z A;  3LLE A;  5DKR A;  1LIN A;  2KSP A;  1DJX A;  1K90 D;  1MWN A;  3BXK A;  1ZMZ A;  3OHM B;  3A8R A;  1AJ5 A;  2K7D A;  1MHO A;  2CXJ A;  2OS8 B;  1UHN A;  1S5G Y;  5ER5 A;  2JXL A;  2K7C A;  1IJ6 A;  3I5I C;  3A4U B;  3F45 A;  1NX0 A;  4PHN A;  3WXA A;  2E30 A;  1CNP A;  1M31 A;  3VRO A;  1TRF A;  4PDZ A;  2BCA A;  1JUO A;  1F54 A;  1B47 A;  2JZI A;  3HX4 A;  3VGO A;  3PAL A;  2MA2 A;  1EG4 A;  4NDB A;  2KGR A;  4IL1 A;  2H2K A;  1IWQ A;  1OZO A;  2G2B A;  5CSJ A;  2LLU A;  2EC6 C;  4MN0 A;  3JVT B;  4M2Q A;  2LVJ A;  2E6W A;  1SBJ A;  1N0Y A;  1IGV A;  1KFX S;  4I5K A;  1A29 A;  1IRJ A;  1AUI B;  2KAV A;  2L0P A;  3KHE A;  3CGA A;  5FYX A;  3OX6 A;  4L9M A;  2LLS A;  3PSR A;  2PVB A;  1BF5 A;  3TUY B;  1K94 A;  4PE7 A;  1TCF A;  3EKH A;  2FCE A;  1K95 A;  2KBI A;  2LUC A;  1SY9 A;  1EG3 A;  1DT7 B;  4DUQ A;  2NLN A;  1ALW A;  2ZND A;  5HKW A;  1KQM C;  3PAT A;  1DGU A;  4MRX A;  1S36 A;  5BPJ A;  1M45 A;  3TDI A;  4GGF A;  5I2O A;  1QX5 B;  1S26 D;  3I5H B;  4ORC B;  1CFC A;  1XFW O;  5D69 A;  4DS7 A;  4R1E A;  2BKH B;  2HF5 A;  3WHT B;  1SR6 B;  1UWO A;  4FQO A;  2OS8 C;  4HRE E;  3EVR A;  1XK4 C;  3NSI A;  2FJU B;  2LVI A;  2K8M B;  1QX2 A;  1QV0 A;  1REC A;  2VRG A;  1Y1X A;  1H8B A;  1EJ3 A;  1SKT A;  1YX8 A;  4JQ0 D;  2MAZ A;  1RRO A;  4YGA A;  4C0J A;  4CFQ A;  1S3P A;  3ZWH A;  1CLM A;  3GK2 A;  3BUN B;  3H4S E;  4PHK A;  3SJS A;  1J1E A;  3SG4 A;  2MLE C;  3PN7 B;  1CFF A;  1J7O A;  1KCY A;  2JXC A;  3JVT C;  1C7W A;  1CDL A;  3CWG A;  1RTP 1;  3RLZ A;  1EH2 A;  1W7I B;  3EK8 A;  4A4C A;  1QLS A;  2L50 A;  1A75 B;  2B1U A;  2MJW B;  2LVV A;  2WCB A;  2BBM A;  1SYM A;  3SG5 A;  1SL7 A;  1C7V A;  3C1V A;  3IQQ A;  4PE1 A;  1CMF A;  1XFX O;  1KFX L;  2K61 A;  4YI9 A;  2JPT A;  1SCM B;  4C0K A;  1QXP A;  3TUY C;  1A2X A;  1TOP A;  4OCI A;  1OE9 B;  2BCX A;  3VRQ A;  1DF0 B;  4MEW A;  4CPV A;  1D1O A;  1JWD A;  4MZK A;  5KSZ A;  1C07 A;  3NSK A;  1Q80 A;  1KK8 B;  1NPQ A;  2BKI B;  2HQ8 A;  5GQQ C;  5HKZ A;  3BOW B;  1PAL A;  3EVV A;  1CM4 A;  3KEV A;  3I5H C;  2LP3 A;  1PUL A;  2I94 A;  1BR4 B;  4BY5 A;  1LA3 A;  3CR4 X;  1SR6 C;  2Y1M A;  1QV1 A;  4QJ4 B;  1K2H A;  1G4Y R;  2PMY A;  1J55 A;  3OP0 A;  2F3Y A;  1M46 A; 
#chains in the Genus database with same CATH topology
 1K96 A;  3DVJ A;  1J7Q A;  1OMR A;  3HCM A;  4YGB B;  4OKH A;  1XVJ A;  3KO0 A;  3VRP A;  2QAC A;  3DYE A;  4GNK B;  3PN7 C;  2ISD A;  2FOT A;  3S0E A;  1CB1 A;  1JSA A;  3O6B A;  1CM1 A;  1WDC C;  2JNX A;  3QME A;  4PE4 A;  4HRH A;  3TS5 C;  1IIO A;  2JT3 A;  3SG6 A;  4INX A;  4P5O E;  4OZD A;  1LVC D;  1NUB A;  2AUC A;  1IKU A;  1TUZ A;  1QS7 A;  3DXL A;  1SCM C;  1YTZ C;  2H61 A;  4XJK A;  4ORA B;  2SAS A;  4ETO A;  2JC2 A;  1TNW A;  3B86 A;  4HSZ A;  4F0Z B;  2RGI A;  4QJ5 B;  3IVT A;  3BJH A;  5TNC A;  1JC2 A;  1TNX A;  2L4H A;  2QEB A;  2WND A;  1SPY A;  1WRK A;  1KK8 C;  2M3W A;  1TNQ A;  2KFG A;  2L5X B;  1TTX A;  2LUX A;  3B87 A;  3EKJ A;  3RM1 A;  2LHI A;  1DEL A;  2M9G A;  1ZFS A;  2JTZ A;  3BFB A;  3EK4 A;  2I18 A;  4MVF A;  1ZUZ A;  1YVH A;  2LCP A;  2EHB A;  2M1K B;  1B8R A;  1FBV A;  1HT9 A;  1XFZ O;  1BJF A;  2WCF A;  1BOC A;  1NX1 A;  2LV7 A;  1L2O B;  1BU3 A;  1W9Z A;  3S0G A;  2Y1N A;  3I5F B;  3BUW B;  5ER4 X;  2JNF A;  2ZKM X;  5AAN A;  1L7Z A;  3L4L A;  3I5G C;  5PAL A;  1OW4 A;  1K9P A;  1QWV A;  2R2I A;  3PM8 A;  4C0L A;  4GUK A;  4JKT A;  4YI8 A;  1FPW A;  2Q4U A;  4YGD B;  1DJG A;  3DD4 A;  2OPO A;  2WC8 A;  1DJI A;  1LXF C;  5B8I B;  1NSH A;  1PSR A;  2BEC A;  1B4C A;  1KFU S;  1QAT A;  2M7N A;  3VB1 A;  1BLQ A;  1OSA A;  4M2O A;  1FI6 A;  4AOM A;  1JBA A;  1YUR A;  3LK0 A;  3K1E A;  2QDI A;  4CLN A;  1F55 A;  3DY9 A;  1CDP A;  1NYA A;  2HQW A;  1C3Z A;  4GPL B;  4PHM A;  1TIZ A;  3SIA A;  1B8C A;  1HQV A;  3PLF B;  1XYD A;  2WCE A;  4AQJ A;  1DJW A;  2CTN A;  1BOD A;  5CSI A;  2KGB C;  1WRZ A;  3R1P A;  2KI4 B;  2KPH A;  2ZN9 A;  1G33 A;  1WRL A;  3ZNI A;  1MUX A;  1K9K A;  1P28 A;  2BCB A;  5F6T A;  3CR2 A;  3CZ2 A;  4DCK A;  1QX7 A;  4HRG A;  3DVM A;  1PVA A;  1V1F A;  2P6B B;  3GOF A;  4ICB A;  1LS8 A;  1S6I A;  3WHU B;  1ODB A;  1YRU B;  1ZOT B;  1UP5 A;  1XFU O;  1VRK A;  3BUM B;  1JFJ A;  1Y1A A;  1X02 A;  1DVI A;  1L2O C;  1TN4 A;  3I5F C;  1AP4 A;  2KHN A;  4GGF C;  1SK6 D;  2KBM A;  5HL1 A;  4KYN A;  2HPS A;  2LM5 A;  1ZAC A;  1E8A A;  2H8V A;  4UPG A;  2WCL A;  1UHI A;  3OGN A;  4GFT A;  1A4P A;  1OOG A;  1XA5 A;  4F7F A;  1YUT A;  4ORB B;  1DJY A;  5AXI A;  5HLV A;  1F70 A;  1F8H A;  2M1U A;  1PK0 D;  1KSO A;  1XO5 A;  2KOT A;  1LKJ A;  2HET A;  3E3R A;  4I5J A;  4OV2 A;  3CZT X;  2KFF A;  4MZL A;  4N5X A;  4U8D A;  3M0W A;  2LP2 A;  4YGC B;  1QTX A;  4CFR A;  2PRU A;  2K60 A;  1JF2 A;  5JOL A;  4JPZ B;  4MZJ A;  3TZ1 A;  1QVI Y;  1KFU L;  2P70 A;  2JOJ A;  3KPX A;  4N1G A;  2BBN A;  2QPT A;  1K93 D;  2K7O A;  2V53 A;  2LMU A;  1C3Y A;  2I2R E;  2KI6 D;  1YRT B;  3KF9 A;  1KQV A;  1IQ3 A;  2NCP A;  4MSP A;  1TNP A;  1OMD A;  2K0J A;  1OOI X;  2AAO A;  3CTN A;  2JU0 A;  1NX2 A;  3JTD B;  4XJK B;  5HKY A;  2PSR A;  2LAP A;  3AKA A;  1A03 A;  3AAJ A;  1XFY O;  1PVB A;  2I7A A;  3K21 A;  2PAS A;  3SG3 A;  2KFH A;  3OX5 A;  2A4J A;  4PE0 A;  2K2F A;  2CNP A;  2JQ6 A;  3D0Y B;  3DVE A;  5I2L A;  2LMT A;  2GV5 A;  5I94 A;  2F2P A;  5AFP A;  2M29 A;  1GJY A;  2LAN A;  3SIB A;  3DF0 A;  4TNC A;  3D76 A;  3EK7 A;  3BFH A;  5D7F A;  1S1E A;  3FE9 A;  1Z2C B;  1U5I A;  3B7A A;  2SCP A;  5FI7 A;  1KSM A;  2M0R A;  4YRU A;  1CMG A;  1SL8 A;  1IH0 A;  3FWB A;  3OB2 B;  1CLB A;  3TDZ A;  1UUS A;  1Y1U A;  3V2L A;  2KI6 C;  1QIW A;  1IQ5 A;  2BAP A;  1BR1 B;  1LA0 A;  3L4A A;  3D74 A;  1KK7 Z;  1SSE B;  2BE4 A;  4JD9 A;  3CZ1 A;  1CDM A;  1AHR A;  2FCD A;  1WLM A;  3O78 A;  2GGZ A;  3D0Y A;  1NCY A;  3BUX B;  3N7H A;  1CFD A;  3CLN A;  3S0D A;  2JRF A;  1AK8 A;  3VRR A;  3TDU A;  2CCM A;  3FWC A;  1CKK A;  1CFP A;  1MR8 A;  2Q91 A;  1KQM B;  1YVL A;  1M39 A;  2OTG B;  3BUO B;  5DKN A;  1V1G A;  3NGV A;  1UHH A;  1XFV O;  4MRY A;  4GAO A;  1IG5 A;  2BNX A;  2MRD A;  1RFJ A;  3LL8 B;  4N1F A;  2BL0 B;  3BQ3 A;  2H61 C;  4IJ7 A;  1QLK A;  2M8U A;  3JTD C;  1F71 A;  5I2Q A;  1DGV A;  1B8L A;  3QRX A;  4WQ2 A;  3CS1 A;  2KYF A;  1QIV A;  5CPV A;  3NHT A;  3IQO A;  1DEK A;  1MXL C;  3L47 A;  5D3O A;  1NIW A;  2LHL A;  2YGU A;  2Y5I A;  5KTY A;  2PQL A;  4PT1 A;  1IJ5 A;  2JT0 A;  1DJH A;  1S6C A;  4JWQ A;  1MQ1 A;  4OR9 B;  5CSF A;  2WCH A;  1QVI Z;  1B1G A;  1OZS A;  2LLT A;  5K89 A;  3MSE B;  2L2E A;  2L98 A;  1K9U A;  4WQ3 A;  4DIR A;  2FJY A;  1NCZ A;  1GGW A;  1N2D A;  2PAL A;  2JUL A;  3WNX B;  4I5L B;  2O60 A;  1K8U A;  2D8N A;  1XK4 A;  3VRN A;  2LC5 A;  4FTG A;  2F8P A;  2LNK A;  1PSB A;  1SNL A;  3LK1 A;  5AEQ A;  2WOR A;  1ALV A;  1Y0V H;  1WY9 A;  2P71 A;  1KK7 Y;  4WRI A;  4YGE B;  4P2Y B;  1UUR A;  2ZN8 A;  2WC5 A;  1UHK A;  1QJT A;  2ZRT A;  1EL4 A;  2GGM A;  5EL2 A;  5DKQ A;  3S0B A;  3R72 A;  4I5N B;  1B9A A;  1CLL A;  2MBX A;  2CT9 A;  1OMV A;  4E68 A;  1DC1 A;  3B88 A;  1SRA A;  4ZCV A;  1DTL A;  2KLE A;  2G9B A;  3D10 A;  3IF7 A;  3NXA A;  1FF1 A;  1H4B A;  1R6P A;  2OTG C;  3Q8I A;  1AJ4 A;  1YX7 A;  1B7T Z;  1NP8 A;  2NZ0 A;  2KDH A;  2WC6 A;  5CSN A;  1S6J A;  2BL0 C;  1XFR A;  1SW8 A;  2F2O A;  1J7P A;  1M63 B;  1PRW A;  1N65 A;  1OOF A;  3AAK A;  4DRW A;  1AVS A;  5JJG A;  3LCP C;  2AMI A;  4MBE A;  3ICB A;  1KWO B;  1CTR A;  3CDN A;  3O2P A;  3PFV A;  2QEO A;  3NSL A;  2LE9 B;  2KAX A;  1Y6W A;  3O4Y A;  4PHJ A;  2NXQ A;  3DVK A;  5I8N A;  1UHJ A;  3GK1 A;  5HYD A;  2GTE A;  1TCO B;  3BYA A;  1DJZ A;  2KYC A;  3D75 A;  1NCX A;  1RJV A;  4ZCU A;  2Y4Q A;  1BG1 A;  3S0A A;  1MF8 B;  1WDC B;  4YBH B;  4NDC A;  3PJI A;  2NCO A;  3TS5 B;  1CDN A;  1NX3 A;  1J1D A;  3DF0 B;  3SG7 A;  3SG2 A;  4FQT A;  2COL B;  1RK9 A;  3O4X A;  4MLW A;  1RWY A;  1U5I B;  2KI4 C;  2F33 A;  1WLZ A;  3OB1 B;  1FI5 A;  5J3X A;  1MXE A;  4PCW A;  1J7R A;  4A4B A;  5KU1 A;  2CBL A;  1DMO A;  1S5G Z;  3NSO A;  2TN4 A;  2JT8 A;  1TWO A;  2WCK A;  1TUJ A;  4Q04 A;  1QAS A;  3FIA A;  4GGN A;  1R2U A;  3FS7 A;  3AKB A;  2L2C A;  3I5I B;  4OVN F;  4D1E A;  1EXR A;  4M2P A;  2PYQ A;  3UO9 A;  2KAY A;  2KQ6 A;  2O5G A;  4INW A;  2DOQ A;  4PAL A;  3GK4 X;  1W7J B;  4BY4 A;  1NWD A;  2EGD A;  2M97 A;  1A75 A;  2ZNE A;  4GBA A;  4XYN A;  1DQE A;  1B7T Y;  1G8I A;  1GGZ A;  4AQI A;  3D77 A;  1BT6 A;  3CAB A;  2LVK A;  3EVU A;  2M49 B;  5G08 A;  2L51 A;  5AER A;  2EC6 B;  2MHH A;  4NQG A;  1FW4 A;  2KQY A;  3DZT A;  4NDD A;  2JTT A;  2K2A A;  1DF0 A;  2IS9 A;  1KWO C;  2WOS A;  3CR5 X;  4QJ3 B;  1F4O A;  1GQM A;  5HLO A;  2KNE A;  4USL A;  2MLF C;  3I5G B;  1F4Q A;  1YUU A;  2LMV A;  4CID A;  1YR5 A;  3BOW A;  1OOJ A;  1JFK A;  2M7L A;  1OQP A;  1YUS A;  2ZRS A;  2JWW A;  2ZFD A;  2BE6 A;  1SCV A;  1BMO A;  2L4I A;  1SMG A;  1JF0 A;  1SL9 A;  2K7B A;  2F3Z A;  3LLE A;  5DKR A;  2WCM A;  1LIN A;  2KSP A;  1DJX A;  3S0F A;  3SS3 A;  1K90 D;  1MWN A;  3BXK A;  1ZMZ A;  3OHM B;  3A8R A;  1AJ5 A;  2K7D A;  1MHO A;  2CXJ A;  2OS8 B;  1UHN A;  1S5G Y;  5ER5 A;  2JXL A;  2K7C A;  1IJ6 A;  1ORG A;  3I5I C;  3A4U B;  3F45 A;  1NX0 A;  4PHN A;  3WXA A;  2E30 A;  1CNP A;  1M31 A;  3D73 A;  3VRO A;  1TRF A;  4PDZ A;  2BCA A;  1JUO A;  1F54 A;  1B47 A;  2JZI A;  3HX4 A;  3VGO A;  3PAL A;  2MA2 A;  2WCJ A;  1EG4 A;  4NDB A;  2KGR A;  3CYZ A;  4IL1 A;  2H2K A;  1IWQ A;  1OZO A;  2G2B A;  5CSJ A;  2LLU A;  2EC6 C;  4MN0 A;  3JVT B;  4M2Q A;  2LVJ A;  2E6W A;  1SBJ A;  1N0Y A;  1IGV A;  3CZ0 A;  5FI6 A;  1KFX S;  3SS4 A;  4I5K A;  1A29 A;  5DIC A;  1IRJ A;  1AUI B;  2KAV A;  2L0P A;  3KHE A;  3CGA A;  5FYX A;  3OX6 A;  4L9M A;  2LLS A;  3PSR A;  2PVB A;  1BF5 A;  3BFA A;  3TUY B;  1GM0 A;  1K94 A;  3SS5 A;  3R1O A;  3NHI A;  4PE7 A;  1TCF A;  3EKH A;  2FCE A;  1K95 A;  2KBI A;  2LUC A;  1SY9 A;  1EG3 A;  3RZS A;  1DT7 B;  4DUQ A;  2NLN A;  1ALW A;  2ZND A;  1T14 A;  5HKW A;  3EG5 B;  1KQM C;  3PAT A;  1DGU A;  4MRX A;  1S36 A;  3UNW A;  5BPJ A;  1M45 A;  3TDI A;  4GGF A;  5I2O A;  1QX5 B;  1S26 D;  3I5H B;  4ORC B;  1CFC A;  1XFW O;  3FE8 A;  5D69 A;  4DS7 A;  4R1E A;  2BKH B;  2HF5 A;  3WHT B;  1SR6 B;  1UWO A;  2JPO A;  2OS8 C;  4FQO A;  3EVR A;  4HRE E;  5FI2 A;  1XK4 C;  3NSI A;  2FJU B;  2LVI A;  2K8M B;  1QX2 A;  1QV0 A;  1REC A;  2KLD A;  2VRG A;  1Y1X A;  1H8B A;  1EJ3 A;  1SKT A;  1YX8 A;  4JQ0 D;  2MAZ A;  1RRO A;  4YGA A;  4C0J A;  1Z4H A;  4CFQ A;  1S3P A;  2L5Y A;  3ZWH A;  1CLM A;  3GK2 A;  3BUN B;  3H4S E;  4PHK A;  3SJS A;  1J1E A;  3SG4 A;  1OOH A;  2MLE C;  3D78 A;  3PN7 B;  1CFF A;  1J7O A;  2JXC A;  1KCY A;  3JVT C;  1C7W A;  1CDL A;  3CWG A;  1RTP 1;  3OBV A;  3RLZ A;  1W7I B;  3PM2 A;  1EH2 A;  3EK8 A;  4A4C A;  1QLS A;  2L50 A;  1A75 B;  2B1U A;  2MJW B;  2LVV A;  2WCB A;  2BBM A;  1SYM A;  3SG5 A;  1SL7 A;  1C7V A;  3C1V A;  3IQQ A;  4PE1 A;  1CMF A;  1XFX O;  1KFX L;  2K61 A;  4YI9 A;  2JPT A;  1SCM B;  4C0K A;  1QXP A;  3TUY C;  1A2X A;  5IBW A;  1TOP A;  4OCI A;  1OE9 B;  2BCX A;  3VRQ A;  1DF0 B;  4MEW A;  4CPV A;  1D1O A;  1JWD A;  4MZK A;  3R1V A;  5KSZ A;  1C07 A;  3NSK A;  1Q80 A;  2QEV A;  1KK8 B;  1NPQ A;  2BKI B;  2HQ8 A;  3FE6 A;  5GQQ C;  5HKZ A;  3BOW B;  1PAL A;  2ERB A;  3EVV A;  1CM4 A;  3KEV A;  3I5H C;  2LP3 A;  2QEH A;  1PUL A;  2I94 A;  1BR4 B;  4BY5 A;  1LA3 A;  3CR4 X;  3B6X A;  1SR6 C;  2Y1M A;  1QV1 A;  4QJ4 B;  1K2H A;  1G4Y R;  2PMY A;  1J55 A;  3OP0 A;  2F3Y A;  1M46 A; 
#chains in the Genus database with same CATH homology
 1K96 A;  3DVJ A;  1J7Q A;  1OMR A;  3HCM A;  4YGB B;  4OKH A;  1XVJ A;  3KO0 A;  3VRP A;  2QAC A;  4GNK B;  3PN7 C;  2ISD A;  2FOT A;  1CB1 A;  1JSA A;  3O6B A;  1CM1 A;  1WDC C;  2JNX A;  4PE4 A;  4HRH A;  3TS5 C;  2JT3 A;  3SG6 A;  4P5O E;  1LVC D;  1NUB A;  2AUC A;  1IKU A;  1QS7 A;  1SCM C;  1YTZ C;  2H61 A;  4XJK A;  4ORA B;  2SAS A;  4ETO A;  2JC2 A;  1TNW A;  4F0Z B;  4HSZ A;  2RGI A;  4QJ5 B;  5TNC A;  1JC2 A;  1TNX A;  2L4H A;  2WND A;  1SPY A;  1WRK A;  1KK8 C;  2M3W A;  1TNQ A;  2KFG A;  2L5X B;  1TTX A;  2LUX A;  3EKJ A;  3RM1 A;  2LHI A;  2M9G A;  1ZFS A;  2JTZ A;  3EK4 A;  2I18 A;  4MVF A;  1ZUZ A;  1YVH A;  2LCP A;  2EHB A;  2M1K B;  1B8R A;  1FBV A;  1HT9 A;  1XFZ O;  1BJF A;  2WCF A;  1BOC A;  1NX1 A;  2LV7 A;  1L2O B;  1BU3 A;  2Y1N A;  3I5F B;  3BUW B;  5ER4 X;  2JNF A;  2ZKM X;  5AAN A;  1L7Z A;  3I5G C;  5PAL A;  2R2I A;  1K9P A;  3PM8 A;  4C0L A;  1FPW A;  4GUK A;  4YI8 A;  2Q4U A;  4YGD B;  1DJG A;  3DD4 A;  2OPO A;  2WC8 A;  1DJI A;  1LXF C;  5B8I B;  1NSH A;  1PSR A;  2BEC A;  1B4C A;  1KFU S;  1QAT A;  2M7N A;  1BLQ A;  1OSA A;  4M2O A;  1FI6 A;  4AOM A;  1JBA A;  1YUR A;  3LK0 A;  4CLN A;  1F55 A;  1CDP A;  1NYA A;  2HQW A;  4GPL B;  4PHM A;  1TIZ A;  3SIA A;  1B8C A;  1HQV A;  3PLF B;  1XYD A;  2WCE A;  4AQJ A;  1DJW A;  2CTN A;  1BOD A;  5CSI A;  2KGB C;  1WRZ A;  2KI4 B;  2ZN9 A;  1G33 A;  1WRL A;  3ZNI A;  1MUX A;  1K9K A;  2BCB A;  5F6T A;  4DCK A;  3CR2 A;  1QX7 A;  4HRG A;  3DVM A;  1PVA A;  1V1F A;  2P6B B;  3GOF A;  4ICB A;  1S6I A;  3WHU B;  1ODB A;  1YRU B;  1ZOT B;  1UP5 A;  1XFU O;  1VRK A;  3BUM B;  1JFJ A;  1Y1A A;  1X02 A;  1DVI A;  1L2O C;  1TN4 A;  3I5F C;  1AP4 A;  2KHN A;  4GGF C;  1SK6 D;  2KBM A;  2HPS A;  2LM5 A;  1ZAC A;  1E8A A;  4UPG A;  5IBW A;  1UHI A;  4GFT A;  1A4P A;  1XA5 A;  1YUT A;  4ORB B;  1DJY A;  5AXI A;  5HLV A;  1F70 A;  1F8H A;  2M1U A;  1PK0 D;  1KSO A;  1XO5 A;  2KOT A;  1LKJ A;  2HET A;  3E3R A;  4I5J A;  4OV2 A;  3CZT X;  2KFF A;  4MZL A;  4N5X A;  4U8D A;  3M0W A;  2LP2 A;  4YGC B;  1QTX A;  4CFR A;  2PRU A;  1JF2 A;  5JOL A;  4JPZ B;  4MZJ A;  3TZ1 A;  1QVI Y;  1KFU L;  2JOJ A;  3KPX A;  4N1G A;  2BBN A;  2QPT A;  1K93 D;  2K7O A;  2V53 A;  2LMU A;  2I2R E;  2KI6 D;  1YRT B;  3KF9 A;  1KQV A;  1IQ3 A;  2NCP A;  4MSP A;  1TNP A;  1OMD A;  2K0J A;  2AAO A;  3CTN A;  2JU0 A;  1NX2 A;  3JTD B;  4XJK B;  5HKY A;  2PSR A;  2LAP A;  3AKA A;  1A03 A;  3AAJ A;  1XFY O;  1PVB A;  2I7A A;  3K21 A;  2PAS A;  3SG3 A;  2KFH A;  3OX5 A;  2A4J A;  4PE0 A;  2K2F A;  2CNP A;  2JQ6 A;  3D0Y B;  3DVE A;  5I2L A;  2LMT A;  2GV5 A;  2F2P A;  5AFP A;  2M29 A;  1GJY A;  2LAN A;  3SIB A;  3DF0 A;  4TNC A;  3EK7 A;  5D7F A;  1S1E A;  1U5I A;  2SCP A;  1KSM A;  2M0R A;  4YRU A;  1CMG A;  1SL8 A;  1IH0 A;  3FWB A;  3OB2 B;  1CLB A;  3TDZ A;  1UUS A;  1Y1U A;  2KI6 C;  1QIW A;  1IQ5 A;  1BR1 B;  1LA0 A;  1KK7 Z;  2BE4 A;  1CDM A;  1AHR A;  2FCD A;  1WLM A;  3O78 A;  2GGZ A;  3D0Y A;  1NCY A;  3BUX B;  1CFD A;  3CLN A;  2JRF A;  1AK8 A;  3VRR A;  3TDU A;  2CCM A;  3FWC A;  1CKK A;  1CFP A;  1MR8 A;  2Q91 A;  1KQM B;  1YVL A;  1M39 A;  2OTG B;  3BUO B;  5DKN A;  1V1G A;  1UHH A;  1XFV O;  4MRY A;  4GAO A;  1IG5 A;  2MRD A;  1RFJ A;  3LL8 B;  4N1F A;  2BL0 B;  3BQ3 A;  2H61 C;  1QLK A;  2M8U A;  3JTD C;  1F71 A;  5I2Q A;  1DGV A;  1B8L A;  3QRX A;  4WQ2 A;  3CS1 A;  2KYF A;  1QIV A;  5CPV A;  3IQO A;  1MXL C;  1NIW A;  2LHL A;  2Y5I A;  5KTY A;  1IJ5 A;  2JT0 A;  1DJH A;  1S6C A;  4JWQ A;  1MQ1 A;  4OR9 B;  5CSF A;  1QVI Z;  1B1G A;  1OZS A;  2LLT A;  5K89 A;  3MSE B;  2L2E A;  2L98 A;  1K9U A;  4WQ3 A;  4DIR A;  1NCZ A;  1GGW A;  1N2D A;  2PAL A;  2JUL A;  3WNX B;  4I5L B;  2O60 A;  1K8U A;  2D8N A;  1XK4 A;  3VRN A;  2LC5 A;  4FTG A;  2F8P A;  2LNK A;  1PSB A;  1SNL A;  3LK1 A;  5AEQ A;  2WOR A;  1ALV A;  1Y0V H;  1WY9 A;  4WRI A;  1KK7 Y;  4YGE B;  4P2Y B;  1UUR A;  2ZN8 A;  1UHK A;  1QJT A;  2ZRT A;  1EL4 A;  2GGM A;  5DKQ A;  4I5N B;  1B9A A;  1CLL A;  2MBX A;  2CT9 A;  1OMV A;  4E68 A;  1SRA A;  4ZCV A;  1DTL A;  3D10 A;  2G9B A;  3IF7 A;  3NXA A;  1H4B A;  1FF1 A;  1R6P A;  2OTG C;  1AJ4 A;  1YX7 A;  1B7T Z;  1NP8 A;  2NZ0 A;  2KDH A;  5CSN A;  1S6J A;  2BL0 C;  2F2O A;  1SW8 A;  1J7P A;  1M63 B;  1PRW A;  1N65 A;  3AAK A;  4DRW A;  1AVS A;  5JJG A;  3LCP C;  2AMI A;  4MBE A;  3ICB A;  1KWO B;  1CTR A;  3O2P A;  3PFV A;  3NSL A;  2LE9 B;  2KAX A;  1Y6W A;  3O4Y A;  4PHJ A;  2NXQ A;  3DVK A;  5I8N A;  1UHJ A;  3GK1 A;  5HYD A;  4ZCU A;  1TCO B;  3BYA A;  1DJZ A;  2KYC A;  1NCX A;  1RJV A;  2Y4Q A;  1BG1 A;  1MF8 B;  1WDC B;  4YBH B;  4NDC A;  2NCO A;  3TS5 B;  1CDN A;  1NX3 A;  1J1D A;  3DF0 B;  3SG7 A;  3SG2 A;  2COL B;  1RK9 A;  4MLW A;  1RWY A;  1U5I B;  2KI4 C;  2F33 A;  1WLZ A;  3OB1 B;  1FI5 A;  5J3X A;  1MXE A;  4PCW A;  1J7R A;  4A4B A;  5KU1 A;  2CBL A;  1DMO A;  1S5G Z;  3NSO A;  2TN4 A;  2JT8 A;  4Q04 A;  1QAS A;  3FIA A;  4GGN A;  1R2U A;  3FS7 A;  3AKB A;  3I5I B;  4OVN F;  4D1E A;  1EXR A;  4M2P A;  2KAY A;  2KQ6 A;  2O5G A;  4PAL A;  2DOQ A;  3GK4 X;  1W7J B;  4BY4 A;  1NWD A;  2EGD A;  2M97 A;  1A75 A;  2ZNE A;  4GBA A;  4XYN A;  4AQI A;  1B7T Y;  1GGZ A;  1G8I A;  1BT6 A;  5G08 A;  2LVK A;  3EVU A;  2M49 B;  5AER A;  2L51 A;  2EC6 B;  2MHH A;  4NQG A;  1FW4 A;  2KQY A;  4NDD A;  2JTT A;  2K2A A;  1DF0 A;  2IS9 A;  1KWO C;  2WOS A;  3CR5 X;  4QJ3 B;  1F4O A;  1GQM A;  5HLO A;  2KNE A;  4USL A;  2MLF C;  3I5G B;  1F4Q A;  1YUU A;  2LMV A;  4CID A;  1YR5 A;  3BOW A;  1OOJ A;  1JFK A;  2M7L A;  1OQP A;  1YUS A;  2ZRS A;  2JWW A;  2ZFD A;  2BE6 A;  1SCV A;  1BMO A;  2L4I A;  1SMG A;  1JF0 A;  1SL9 A;  2K7B A;  2F3Z A;  3LLE A;  5DKR A;  1LIN A;  2KSP A;  1DJX A;  1K90 D;  1MWN A;  3BXK A;  1ZMZ A;  3OHM B;  3A8R A;  1AJ5 A;  2K7D A;  1MHO A;  2CXJ A;  2OS8 B;  1UHN A;  1S5G Y;  5ER5 A;  2JXL A;  2K7C A;  1IJ6 A;  3I5I C;  3A4U B;  3F45 A;  1NX0 A;  4PHN A;  3WXA A;  2E30 A;  1CNP A;  1M31 A;  3VRO A;  1TRF A;  4PDZ A;  2BCA A;  1JUO A;  1F54 A;  1B47 A;  2JZI A;  3HX4 A;  3VGO A;  3PAL A;  2MA2 A;  1EG4 A;  4NDB A;  2KGR A;  4IL1 A;  2H2K A;  1IWQ A;  1OZO A;  2G2B A;  5CSJ A;  2LLU A;  2EC6 C;  4MN0 A;  3JVT B;  4M2Q A;  2LVJ A;  2E6W A;  1SBJ A;  1N0Y A;  1IGV A;  1KFX S;  4I5K A;  1A29 A;  1IRJ A;  1AUI B;  2KAV A;  2L0P A;  3KHE A;  3CGA A;  5FYX A;  3OX6 A;  4L9M A;  2LLS A;  3PSR A;  2PVB A;  1BF5 A;  3TUY B;  1K94 A;  4PE7 A;  1TCF A;  3EKH A;  2FCE A;  1K95 A;  2KBI A;  2LUC A;  1SY9 A;  1EG3 A;  1DT7 B;  4DUQ A;  2NLN A;  1ALW A;  2ZND A;  5HKW A;  1KQM C;  3PAT A;  1DGU A;  4MRX A;  1S36 A;  5BPJ A;  1M45 A;  3TDI A;  4GGF A;  5I2O A;  1QX5 B;  1S26 D;  3I5H B;  4ORC B;  1CFC A;  1XFW O;  5D69 A;  4DS7 A;  4R1E A;  2BKH B;  2HF5 A;  3WHT B;  1SR6 B;  1UWO A;  4FQO A;  2OS8 C;  4HRE E;  3EVR A;  1XK4 C;  3NSI A;  2FJU B;  2LVI A;  2K8M B;  1QX2 A;  1QV0 A;  1REC A;  2VRG A;  1Y1X A;  1H8B A;  1EJ3 A;  1SKT A;  1YX8 A;  4JQ0 D;  2MAZ A;  1RRO A;  4YGA A;  4C0J A;  4CFQ A;  1S3P A;  3ZWH A;  1CLM A;  3GK2 A;  3BUN B;  3H4S E;  4PHK A;  3SJS A;  1J1E A;  3SG4 A;  2MLE C;  3PN7 B;  1CFF A;  1J7O A;  1KCY A;  2JXC A;  3JVT C;  1C7W A;  1CDL A;  3CWG A;  1RTP 1;  3RLZ A;  1EH2 A;  1W7I B;  3EK8 A;  4A4C A;  1QLS A;  2L50 A;  1A75 B;  2B1U A;  2MJW B;  2LVV A;  2WCB A;  2BBM A;  1SYM A;  3SG5 A;  1SL7 A;  1C7V A;  3C1V A;  3IQQ A;  4PE1 A;  1CMF A;  1XFX O;  1KFX L;  2K61 A;  4YI9 A;  2JPT A;  1SCM B;  4C0K A;  1QXP A;  3TUY C;  1A2X A;  1TOP A;  4OCI A;  1OE9 B;  2BCX A;  3VRQ A;  1DF0 B;  4MEW A;  4CPV A;  1D1O A;  1JWD A;  4MZK A;  5KSZ A;  1C07 A;  3NSK A;  1Q80 A;  1KK8 B;  1NPQ A;  2BKI B;  2HQ8 A;  5GQQ C;  5HKZ A;  3BOW B;  1PAL A;  3EVV A;  1CM4 A;  3KEV A;  3I5H C;  2LP3 A;  1PUL A;  2I94 A;  1BR4 B;  4BY5 A;  1LA3 A;  3CR4 X;  1SR6 C;  2Y1M A;  1QV1 A;  4QJ4 B;  1K2H A;  1G4Y R;  2PMY A;  1J55 A;  3OP0 A;  2F3Y A;  1M46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...