4YBHB

Crystal structure of the human rage ectodomain (vc1c2 fragment) in complex with human s100a6
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
b'ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title The Structure of the RAGE:S100A6 Complex Reveals a Unique Mode of Homodimerization for S100 Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 33
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ybhB00
1AK8A 5TNCA 2LVJA 2M97A 3LCPC 4HSZA 5I2LA 2JT8A 4QJ3B 1ALVA 2RGIA 5BPJA 3M0WA 2I18A 2MJWB 1JWDA 3SG2A 2JXLA 1OOJA 3PSRA 4MLWA 1DT7B 1KWOB 1B8LA 4PHJA 2MHHA 2BECA 4DRWA 5CPVA 5HKWA 3FS7A 1AUIB 1KFXS 4JQ0D 2Q4UA 5HLOA 4YGEB 3O2PA 3KHEA 4YGAA 5HKYA 2K7CA 4GBAA 2GGZA 3HX4A 1H4BA 4F0ZB 1K90D 1OQPA 4GGFC 4MZJA 4MZLA 4MN0A 2ISDA 3TDUA 1KWOC 4M2OA 4MEWA 1Y6WA 1AVSA 4ORCB 1WY9A 1L2OB 2NCPA 2F3YA 1F70A 1SPYA 1SY9A 1OZOA 3AAKA 4OV2A 1SBJA 1XO5A 3FIAA 4XJKB 2KDHA 4GNKB 4C0KA 1DGUA 3DVKA 2LUCA 3EK4A 1C7WA 1XFZO 1CLMA 1F54A 2LVKA 1NIWA 3BUXB 2PRUA 1R6PA 4CPVA 2CT9A 1CDPA 4HRHA 1EJ3A 1TTXA 2KHNA 1UUSA 4I5NB 1L2OC 1QIVA 1ZACA 4PDZA 5I8NA 1PRWA 1W7IB 3CS1A 4GUKA 2AUCA 1UHJA 2LLTA 2QACA 4A4CA 1UP5A 2LAPA 3CR2A 1K8UA 4PALA 2EC6B 2JULA 5J3XA 1G33A 1M46A 1TOPA 2BL0B 2KQ6A 5CSNA 1SCMB 1JFKA 4ICBA 4YGDB 2WCEA 1FW4A 3I5HB 3EK8A 2K2FA 1G4YR 3D0YB 3VGOA 2TN4A 2L2EA 1QV0A 3ZWHA 1S6CA 3KO0A 2HQ8A 1WRKA 2IS9A 3NSKA 4WRIA 1CM1A 3JTDB 5AANA 5I2OA 1HT9A 3EVVA 1BMOA 1YVHA 2BKHB 3AKAA 2EC6C 2COLB 2LANA 4NDBA 4ZCUA 1A4PA 4E68A 4L9MA 2BL0C 4CFRA 3VRPA 4DCKA 1SCMC 3TZ1A 5HLVA 1M63B 1NCXA 3WNXB 4PHNA 4GPLB 3I5HC 1FF1A 1QX7A 2M3WA 1JF2A 2JT0A 2KI4B 2K0JA 2M1KB 1CFPA 2KYCA 1LINA 1DTLA 3JTDC 5AFPA 2I2RE 1RFJA 1TN4A 2ZN9A 1FI5A 1LKJA 3CR4X 2HQWA 2I94A 3GK1A 3H4SE 1DMOA 2H61A 1CKKA 1BODA 1TNQA 3LK0A 4GFTA 1S5GZ 1K2HA 3CR5X 1GJYA 3FWBA 1LVCD 1TCFA 1NX1A 1AJ5A 1YX7A 1PSBA 3BUMB 2K7DA 2KQYA 1UHNA 2KI4C 1K9KA 4JPZB 1SR6B 2R2IA 2ZRSA 4ZCVA 1QV1A 1CB1A 2L5XB 1N0YA 3OHMB 2L0PA 5DKNA 3CTNA 2H61C 3BUWB 3A8RA 4MRYA 5ER5A 1N2DA 1BOCA 3BXKA 1TNPA 2AMIA 1R2UA 3DF0B 2E30A 1YRUB 2L50A 3OX5A 5HKZA 4MZKA 2K7BA 4DS7A 4M2QA 3QRXA 5PALA 2B1UA 1SR6C 3K21A 1CDLA 1YRTB 2F8PA 2HETA 4YGCB 1SK6D 2MBXA 1HQVA 1Y1UA 2KFGA 1SNLA 1LXFC 1WRZA 4MSPA 2WC8A 2ZN8A 3VRQA 1TRFA 1NYAA 1S1EA 1ALWA 5AEQA 2LHIA 1RTP1 3SG5A 2V53A 3FWCA 1JUOA 3BQ3A 3RLZA 1GGWA 1EL4A 1B1GA 1F4OA 1S5GY 2H2KA 2MAZA 1MXLC 2E6WA 4P2YB 3OB1B 1JSAA 2BCBA 1QX5B 2M7NA 1KFXL 1PVBA 1CM4A 1TCOB 1JBAA 1OMDA 2L4IA 2WCBA 4N5XA 1KSMA 2HF5A 2K2AA 4HRGA 5FYXA 2M7LA 3ZNIA 1KSOA 2PSRA 4WQ2A 2BE6A 2LNKA 1ZOTB 1BJFA 1C07A 1AHRA 4PE1A 1DJXA 1SMGA 4YGBB 1B8RA 1XK4A 4MVFA 1CMGA 3TS5B 2MLFC 1K96A 1SYMA 2BBMA 3RM1A 1B7TZ 3D10A 4YI9A 2OPOA 1KK8C 1NCYA 1SL8A 2JQ6A 2SASA 4PHMA 1OMVA 4MRXA 5CSFA 1RWYA 1CMFA 2M49B 3HCMA 2F3ZA 2KGRA 2ZNEA 2VRGA 4CIDA 1XK4C 1KQMC 2Q91A 1QTXA 1NUBA 3SG4A 3TS5C 3BUOB 4IL1A 5D69A 2CXJA 2KAYA 1PK0D 1OSAA 5DKQA 2JWWA 2K8MB 4USLA 4NQGA 1DJHA 1J55A 1DJYA 1L7ZA 1M31A 1ZUZA 1UURA 1ODBA 1A75A 2PALA 1CFCA 5F6TA 3JVTB 1SRAA 2BBNA 1IWQA 1YVLA 2OS8B 1CFFA 3A4UB 2WCFA 1V1GA 1UHHA 4GGNA 4CLNA 3PLFB 2KOTA 3AKBA 1CDMA 1F4QA 1QASA 1DJIA 2SCPA 2MLEC 4XYNA 1XVJA 4FTGA 1CNPA 1DJGA 3SIBA 4I5JA 1MUXA 1XA5A 2G2BA 3BOWA 2F2PA 2LMUA 4BY4A 1H8BA 1YURA 4PE7A 1RROA 2KFHA 2JRFA 2JTZA 1B7TY 2PMYA 3JVTC 1DJWA 3SG3A 1IKUA 1SW8A 2OS8C 1RK9A 3NSOA 2M8UA 2O60A 2F2OA 4QJ4B 3TDZA 1F8HA 1MF8B 2JT3A 5KTYA 4ETOA 1S26D 1KK7Z 3TDIA 2KI6C 2KAVA 4FQOA 5AERA 2CCMA 3I5GC 1XFXO 2F33A 2FCDA 1A2XA 3KPXA 3DVMA 1UHKA 2LE9B 1EG4A 3IQOA 2HPSA 2NXQA 2ZFDA 1QJTA 1CTRA 1M39A 1MQ1A 2KI6D 1PVAA 4GAOA 1BR4B 1JC2A 1JFJA 2LLUA 2PVBA 3NXAA 1BG1A 2WOSA 1KFUS 1SKTA 4C0JA 1EH2A 1OZSA 2P6BB 1E8AA 4CFQA 3NSLA 3DVEA 1VRKA 3O4YA 3PFVA 1QLKA 3LL8B 4OR9B 4PCWA 3VRNA 1IG5A 2K61A 1NSHA 3KEVA 5JJGA 3NSIA 1WLZA 1OE9B 1NCZA 1SCVA 3O78A 5JOLA 4TNCA 2JXCA 2DOQA 2BKIB 3KF9A 2L4HA 3F45A 4MBEA 3EKJA 2K7OA 1J7OA 1Q80A 1F55A 1AJ4A 1KK7Y 4UPGA 1SL7A 4U8DA 2LM5A 2LVVA 3PALA 2M1UA 1B4CA 1PULA 1TNXA 2FJUB 4I5KA 1K94A 1M45A 3PN7B 3VROA 1MHOA 1TIZA 3E3RA 3WHTB 2KBMA 3DD4A 3WXAA 3EKHA 2JC2A 2OTGB 3EVUA 3TUYB 1Y1AA 5K89A 2LVIA 4GGFA 1KK8B 1B8CA 2CTNA 4PE0A 3VRRA 1OMRA 3AAJA 1PSRA 1QS7A 1QXPA 1BR1B 3PN7C 1NX0A 1Y0VH 1KQMB 4BY5A 2ZKMX 2I7AA 2PASA 5KSZA 2OTGC 1K95A 3SG6A 3TUYC 4N1FA 1S3PA 1XFUO 1NP8A 2Y4QA 4R1EA 1A03A 3GK4X 4HREE 4PE4A 2O5GA 3GK2A 2D8NA 1DF0B 1DF0A 4OCIA 3CLNA 2AAOA 1QVIZ 1WRLA 2CNPA 2KSPA 4AQJA 1B47A 3PATA 1MR8A 2EGDA 4AOMA 3GOFA 2BCXA 1CDNA 2EHBA 4XJKA 1WDCB 2LP2A 1J1DA 1MWNA 1LA3A 1CLBA 2L51A 2LMVA 4YRUA 5HYDA 1IQ3A 1K9PA 1QIWA 1XYDA 1NX3A 1A75B 1YUSA 1YUUA 3WHUB 1RJVA 1A29A 2LLSA 4AQIA 1FPWA 1NX2A 1IJ6A 1LA0A 4C0LA 1WLMA 4ORBB 2JOJA 2M29A 1YTZC 4NDDA 3EK7A 2BCAA 2LP3A 2JU0A 5B8IB 2LUXA 3ICBA 1WDCC 1BF5A 3CZTX 1XFYO 3I5FB 2KNEA 2KYFA 1BU3A 1S36A 3BOWB 3IF7A 1J7RA 4P5OE 5CSJA 3I5GB 5ER4X 1PALA 3LLEA 4Q04A 2KGBC 1J7QA 2L98A 1J1EA 1S6IA 1XFVO 2KFFA 2MRDA 1ZFSA 1J7PA 1QATA 2ZRTA 3SG7A 1C7VA 2A4JA 2BE4A 2WORA 5IBWA 1RECA 3D0YA 5I2QA 1CLLA 2GGMA 2NLNA 1AP4A 4DIRA 1YX8A 1EXRA 5KU1A 2ZNDA 2JNFA 3I5FC 1QVIY 1XFWO 2LHLA 2M9GA 1Y1XA 2WNDA 3DVJA 1IJ5A 5D7FA 1NPQA 1UWOA 5G08A 4D1EA 4WQ3A 1G8IA 1K9UA 2NCOA 1SL9A 4OKHA 4N1GA 3IQQA 1QLSA 1S6JA 1IH0A 1K93D 1BLQA 2FCEA 2FOTA 1B9AA 2GV5A 1KCYA 1YR5A 4YI8A 1MXEA 4ORAB 3OX6A 1X02A 1V1FA 2Y1MA 2QPTA 3EVRA 2KAXA 1EG3A 2LCPA 3MSEB 4I5LB 3PM8A 3BYAA 2LC5A 2MA2A 1TNWA 1D1OA 1GQMA 2Y1NA 3OB2B 4YBHB 2NZ0A 2Y5IA 1DJZA 1KFUL 1JF0A 3C1VA 3I5IB 4A4BA 1IGVA 1GGZA 1UHIA 2JTTA 2JZIA 4M2PA 4PHKA 1FI6A 3SIAA 2JNXA 1NWDA 3CWGA 5AXIA 1CFDA 1ZMZA 1FBVA 5CSIA 3OP0A 1QX2A 5DKRA 5GQQC 1KQVA 2LMTA 2KBIA 4DUQA 3DF0A 3SJSA 1IRJA 1YUTA 4JWQA 1U5IB 1U5IA 3I5IC 4NDCA 2JPTA 1F71A 2LV7A 4OVNF 1DVIA 1BT6A 2M0RA 4QJ5B 3CGAA 3LK1A 2CBLA 1N65A 3BUNB 1IQ5A 2G9BA 3O6BA 1W7JB 1DGVA
chains in the Genus database with same CATH superfamily
1AK8A 5TNCA 3DY9A 2LVJA 2M97A 3LCPC 1Z4HA 4HSZA 5I2LA 2JT8A 4QJ3B 1ALVA 2RGIA 5BPJA 3M0WA 2I18A 2MJWB 1JWDA 3SG2A 2JXLA 1OOJA 3PSRA 4MLWA 3BFBA 1DT7B 1KWOB 1B8LA 4PHJA 2MHHA 2BECA 4DRWA 5CPVA 5HKWA 2P70A 3SS4A 3FS7A 1AUIB 1KFXS 4JQ0D 2Q4UA 5HLOA 3PM2A 4YGEB 3O2PA 3KHEA 1OOGA 4YGAA 2K7CA 4GBAA 5HKYA 2GGZA 3HX4A 1H4BA 1TUJA 4F0ZB 1K90D 1OQPA 4GGFC 4MZJA 4MZLA 4MN0A 2ISDA 3CYZA 3TDUA 1KWOC 4M2OA 4MEWA 1Y6WA 1AVSA 4OZDA 4ORCB 1P28A 1WY9A 1L2OB 2NCPA 3B6XA 2F3YA 3S0EA 1F70A 1SPYA 1SY9A 1C3ZA 1OZOA 3AAKA 1QWVA 4OV2A 1SBJA 1XO5A 1C3YA 3FIAA 4XJKB 2KDHA 4GNKB 4C0KA 1DGUA 3DVKA 2LUCA 3EK4A 1C7WA 1XFZO 1TUZA 1CLMA 1F54A 2LVKA 1NIWA 3BUXB 2PRUA 1R6PA 4CPVA 2CT9A 1CDPA 4HRHA 1EJ3A 1TTXA 2KHNA 1UUSA 4I5NB 1L2OC 1QIVA 1ZACA 4PDZA 5I8NA 1PRWA 5I94A 1W7IB 3CS1A 4GUKA 1GM0A 2AUCA 1UHJA 2LLTA 3B87A 2QACA 4A4CA 1UP5A 2LAPA 3CR2A 1K8UA 4PALA 2EC6B 2JULA 3FE6A 5J3XA 1G33A 1M46A 1TOPA 2BL0B 2KQ6A 5CSNA 1SCMB 1Z2CB 1JFKA 1SSEB 2PQLA 4ICBA 4YGDB 2WCEA 1FW4A 3I5HB 5EL2A 3EK8A 2K2FA 1G4YR 3D0YB 3VGOA 2TN4A 2L2EA 1QV0A 3ZWHA 1S6CA 3KO0A 2HQ8A 1WRKA 2IS9A 3NSKA 4WRIA 1CM1A 3JTDB 5AANA 5I2OA 1HT9A 3EVVA 1BMOA 1YVHA 2BKHB 3AKAA 2EC6C 2COLB 2LANA 4NDBA 4ZCUA 1A4PA 4E68A 3K1EA 4L9MA 2BL0C 4CFRA 3VRPA 4DCKA 1SCMC 3TZ1A 5HLVA 1M63B 1NCXA 3DZTA 3WNXB 4PHNA 3B86A 4GPLB 3IVTA 3I5HC 1FF1A 1QX7A 2M3WA 1JF2A 2GTEA 2JT0A 4INXA 3OBVA 2BAPA 2KI4B 2K0JA 2M1KB 3V2LA 1CFPA 2KYCA 1LINA 1DTLA 3JTDC 5AFPA 2I2RE 1RFJA 1TN4A 2ZN9A 1FI5A 1LKJA 3CR4X 2HQWA 3D76A 1IIOA 2I94A 3S0FA 3GK1A 3H4SE 1OOFA 1DMOA 2H61A 1CKKA 1BODA 1TNQA 3LK0A 4GFTA 1S5GZ 1K2HA 3CR5X 1GJYA 3FWBA 1LVCD 1TCFA 1NX1A 1AJ5A 1YX7A 1PSBA 3BUMB 2K7DA 2KQYA 3NHIA 1UHNA 2KI4C 1K9KA 4JPZB 1SR6B 2R2IA 4KYNA 2ZRSA 4ZCVA 3S0GA 1QV1A 2PYQA 1CB1A 2L5XB 1N0YA 2L2CA 2L0PA 3OHMB 5DKNA 3CTNA 2H61C 3BUWB 3A8RA 4MRYA 5ER5A 1N2DA 1BOCA 2WCJA 3BXKA 1TNPA 2AMIA 1R2UA 3DF0B 2E30A 1YRUB 2L50A 3OX5A 3QMEA 5HKZA 4MZKA 2K7BA 4DS7A 4M2QA 3QRXA 5PALA 2B1UA 1SR6C 3K21A 1CDLA 1YRTB 2F8PA 2HETA 3R1PA 1SK6D 4YGCB 2MBXA 1HQVA 1Y1UA 2KFGA 4JD9A 1SNLA 2QEVA 1LXFC 1WRZA 4MSPA 2WC8A 2ZN8A 3VRQA 1TRFA 1NYAA 1S1EA 1ALWA 5AEQA 2LHIA 1RTP1 3R1OA 3SG5A 2V53A 3FWCA 1JUOA 3BQ3A 5D3OA 3CDNA 3RLZA 4INWA 1EL4A 1B1GA 1GGWA 1F4OA 1S5GY 2H2KA 2MAZA 1MXLC 2E6WA 4P2YB 3OB1B 1JSAA 4PT1A 2BCBA 3UO9A 1QX5B 2K60A 1KFXL 1PVBA 2M7NA 1CM4A 1TCOB 3N7HA 1JBAA 1OMDA 2YGUA 3Q8IA 2L4IA 2WCBA 4N5XA 1KSMA 1W9ZA 2HF5A 2K2AA 4HRGA 5FYXA 2M7LA 3ZNIA 1KSOA 2PSRA 4WQ2A 2BE6A 2LNKA 1ZOTB 2KLDA 1BJFA 1C07A 1AHRA 4PE1A 1DJXA 1SMGA 4YGBB 1B8RA 1XK4A 4MVFA 3OGNA 1CMGA 3TS5B 2MLFC 1K96A 1SYMA 2BBMA 3RM1A 1B7TZ 3D10A 2L5YA 4YI9A 2OPOA 3S0BA 1KK8C 1NCYA 1SL8A 2JQ6A 2SASA 4PHMA 1OMVA 4MRXA 5CSFA 5FI7A 3FE9A 1RWYA 3EG5B 2M49B 3HCMA 1CMFA 2F3ZA 2KGRA 2ZNEA 2VRGA 4CIDA 1XK4C 1KQMC 2Q91A 1QTXA 1NUBA 3SG4A 3TS5C 3BUOB 4IL1A 5D69A 2CXJA 2KAYA 1PK0D 1OSAA 3NGVA 5DKQA 2JWWA 2K8MB 4USLA 4NQGA 1DJHA 1J55A 1DJYA 3O4XA 1DELA 1L7ZA 1M31A 1ZUZA 1UURA 1ODBA 3D75A 1A75A 3L4LA 2PALA 1CFCA 5F6TA 3JVTB 1SRAA 3S0DA 2BBNA 1IWQA 1YVLA 2OS8B 3D77A 1CFFA 3A4UB 2WCFA 1V1GA 1UHHA 4GGNA 4CLNA 3PLFB 2KOTA 3AKBA 1CDMA 1F4QA 1QASA 1DJIA 2SCPA 2MLEC 4XYNA 1XVJA 4FTGA 1CNPA 1DJGA 3SIBA 4I5JA 1MUXA 1XA5A 2G2BA 3BOWA 2F2PA 2LMUA 4BY4A 1H8BA 2WCMA 1YURA 4PE7A 1RROA 2KFHA 2JRFA 2JTZA 1B7TY 2PMYA 3JVTC 1DJWA 3SG3A 1IKUA 1SW8A 2OS8C 3D78A 1RK9A 3NSOA 2M8UA 2O60A 2F2OA 4QJ4B 3TDZA 1F8HA 3BFHA 1MF8B 2JT3A 3FE8A 5KTYA 4ETOA 1S26D 1KK7Z 2KLEA 2KI6C 2KAVA 4FQOA 3TDIA 5AERA 2CCMA 3I5GC 3BFAA 1XFXO 2F33A 1T14A 1A2XA 2FCDA 3KPXA 5HL1A 3DVMA 1UHKA 2LE9B 1EG4A 3IQOA 2HPSA 2WCLA 2NXQA 2ZFDA 1ORGA 1QJTA 1CTRA 1TWOA 3SS5A 1M39A 1MQ1A 3CABA 2KI6D 2WC5A 1PVAA 4GAOA 1BR4B 3SS3A 1JC2A 1JFJA 2LLUA 2PVBA 3NXAA 1BG1A 2WOSA 1KFUS 1SKTA 4C0JA 1EH2A 1OZSA 2P6BB 1E8AA 4CFQA 3NSLA 3DVEA 1VRKA 3O4YA 3PFVA 1QLKA 3LL8B 4OR9B 4PCWA 3VRNA 3RZSA 1IG5A 2K61A 3NHTA 1NSHA 3KEVA 5JJGA 3NSIA 1WLZA 1OE9B 1NCZA 1SCVA 3O78A 5JOLA 4TNCA 2JXCA 3VB1A 2DOQA 2BKIB 3BJHA 3KF9A 2L4HA 3F45A 4MBEA 3EKJA 2K7OA 1J7OA 1Q80A 3L47A 1F55A 1AJ4A 3UNWA 1KK7Y 4UPGA 1SL7A 4U8DA 2LM5A 2LVVA 3PALA 2M1UA 1B4CA 1PULA 1TNXA 2FJUB 4I5KA 1K94A 1M45A 3PN7B 3VROA 2WC6A 1MHOA 1TIZA 3E3RA 3WHTB 2KBMA 3DD4A 3WXAA 3EKHA 2JC2A 2OTGB 3EVUA 3TUYB 1DC1A 1Y1AA 5K89A 2LVIA 2WCHA 4GGFA 1KK8B 1B8CA 2CTNA 4PE0A 3VRRA 2FJYA 2JPOA 1OMRA 3AAJA 1PSRA 1QS7A 1QXPA 1BR1B 3PN7C 5FI6A 1NX0A 1Y0VH 1KQMB 4BY5A 2H8VA 2ZKMX 2I7AA 1OW4A 2PASA 5KSZA 3CZ0A 2OTGC 1K95A 3B88A 3SG6A 4N1FA 1S3PA 3TUYC 1XFUO 1NP8A 2Y4QA 4R1EA 1A03A 3GK4X 4HREE 4PE4A 2O5GA 3GK2A 2D8NA 1DF0B 1DF0A 4OCIA 3CLNA 1XFRA 2AAOA 2QEOA 1QVIZ 1WRLA 2CNPA 3B7AA 3CZ2A 2KSPA 3PJIA 4AQJA 1B47A 2BNXA 3PATA 1MR8A 2EGDA 4AOMA 3GOFA 2BCXA 2ERBA 1CDNA 2EHBA 3L4AA 4XJKA 1WDCB 2LP2A 2P71A 1J1DA 1MWNA 1LA3A 1CLBA 2QEHA 2L51A 2LMVA 4YRUA 3D74A 5HYDA 1IQ3A 1K9PA 1QIWA 1XYDA 1NX3A 1A75B 1YUSA 1YUUA 3WHUB 1RJVA 1A29A 2LLSA 4AQIA 1FPWA 1NX2A 3R1VA 1IJ6A 1LA0A 4C0LA 1WLMA 4ORBB 2JOJA 2M29A 1YTZC 4NDDA 3EK7A 2KPHA 2BCAA 2LP3A 2JU0A 3D73A 5B8IB 2LUXA 3ICBA 1WDCC 3DYEA 1BF5A 3CZTX 5DICA 1XFYO 3I5FB 2KNEA 2KYFA 1BU3A 1S36A 3BOWB 3IF7A 1J7RA 4P5OE 5CSJA 3I5GB 4JKTA 5ER4X 1PALA 3LLEA 4Q04A 2KGBC 1J7QA 2L98A 1J1EA 1S6IA 1XFVO 2KFFA 2MRDA 1ZFSA 1J7PA 1QATA 2QDIA 2ZRTA 3SG7A 1C7VA 2A4JA 2BE4A 2WORA 1LS8A 5IBWA 1RECA 3D0YA 4FQTA 5I2QA 1CLLA 2GGMA 3CZ1A 2NLNA 1AP4A 4DIRA 1YX8A 1EXRA 5KU1A 2ZNDA 2JNFA 4IJ7A 5FI2A 3I5FC 1QVIY 1XFWO 2LHLA 2M9GA 1Y1XA 2WNDA 3DVJA 1IJ5A 5D7FA 1NPQA 1UWOA 5G08A 4D1EA 4WQ3A 1G8IA 1K9UA 2QEBA 1OOHA 2NCOA 1SL9A 2WCKA 4OKHA 4N1GA 3IQQA 1QLSA 1S6JA 3R72A 1IH0A 1OOIX 1K93D 1BLQA 2FCEA 4F7FA 2FOTA 1B9AA 2GV5A 1KCYA 1YR5A 4YI8A 1MXEA 4ORAB 3OX6A 1X02A 1V1FA 2Y1MA 1DEKA 2QPTA 3EVRA 2KAXA 1EG3A 2LCPA 3MSEB 4I5LB 3PM8A 3BYAA 2LC5A 2MA2A 1TNWA 1D1OA 1GQMA 2Y1NA 3OB2B 4YBHB 2NZ0A 2Y5IA 1DJZA 1KFUL 1JF0A 3C1VA 3I5IB 4A4BA 1IGVA 1GGZA 1UHIA 2JTTA 2JZIA 3DXLA 4M2PA 4PHKA 1FI6A 3SIAA 2JNXA 1NWDA 3CWGA 5AXIA 1CFDA 1ZMZA 1FBVA 5CSIA 3S0AA 3OP0A 1QX2A 5DKRA 5GQQC 1KQVA 2LMTA 2KBIA 4DUQA 3DF0A 3SJSA 1IRJA 1YUTA 4JWQA 1U5IB 1U5IA 3I5IC 4NDCA 2JPTA 1F71A 2LV7A 4OVNF 1DVIA 1BT6A 1DQEA 2M0RA 3CGAA 4QJ5B 3LK1A 2CBLA 1N65A 3BUNB 1IQ5A 2G9BA 3O6BA 1W7JB 1DGVA
chains in the Genus database with same CATH topology
1AK8A 5TNCA 2LVJA 2M97A 3LCPC 4HSZA 5I2LA 2JT8A 4QJ3B 1ALVA 2RGIA 5BPJA 3M0WA 2I18A 2MJWB 1JWDA 3SG2A 2JXLA 1OOJA 3PSRA 4MLWA 1DT7B 1KWOB 1B8LA 4PHJA 2MHHA 2BECA 4DRWA 5CPVA 5HKWA 3FS7A 1AUIB 1KFXS 4JQ0D 2Q4UA 5HLOA 4YGEB 3O2PA 3KHEA 4YGAA 5HKYA 2K7CA 4GBAA 2GGZA 3HX4A 1H4BA 4F0ZB 1K90D 1OQPA 4GGFC 4MZJA 4MZLA 4MN0A 2ISDA 3TDUA 1KWOC 4M2OA 4MEWA 1Y6WA 1AVSA 4ORCB 1WY9A 1L2OB 2NCPA 2F3YA 1F70A 1SPYA 1SY9A 1OZOA 3AAKA 4OV2A 1SBJA 1XO5A 3FIAA 4XJKB 2KDHA 4GNKB 4C0KA 1DGUA 3DVKA 2LUCA 3EK4A 1C7WA 1XFZO 1CLMA 1F54A 2LVKA 1NIWA 3BUXB 2PRUA 1R6PA 4CPVA 2CT9A 1CDPA 4HRHA 1EJ3A 1TTXA 2KHNA 1UUSA 4I5NB 1L2OC 1QIVA 1ZACA 4PDZA 5I8NA 1PRWA 1W7IB 3CS1A 4GUKA 2AUCA 1UHJA 2LLTA 2QACA 4A4CA 1UP5A 2LAPA 3CR2A 1K8UA 4PALA 2EC6B 2JULA 5J3XA 1G33A 1M46A 1TOPA 2BL0B 2KQ6A 5CSNA 1SCMB 1JFKA 4ICBA 4YGDB 2WCEA 1FW4A 3I5HB 3EK8A 2K2FA 1G4YR 3D0YB 3VGOA 2TN4A 2L2EA 1QV0A 3ZWHA 1S6CA 3KO0A 2HQ8A 1WRKA 2IS9A 3NSKA 4WRIA 1CM1A 3JTDB 5AANA 5I2OA 1HT9A 3EVVA 1BMOA 1YVHA 2BKHB 3AKAA 2EC6C 2COLB 2LANA 4NDBA 4ZCUA 1A4PA 4E68A 4L9MA 2BL0C 4CFRA 3VRPA 4DCKA 1SCMC 3TZ1A 5HLVA 1M63B 1NCXA 3WNXB 4PHNA 4GPLB 3I5HC 1FF1A 1QX7A 2M3WA 1JF2A 2JT0A 2KI4B 2K0JA 2M1KB 1CFPA 2KYCA 1LINA 1DTLA 3JTDC 5AFPA 2I2RE 1RFJA 1TN4A 2ZN9A 1FI5A 1LKJA 3CR4X 2HQWA 2I94A 3GK1A 3H4SE 1DMOA 2H61A 1CKKA 1BODA 1TNQA 3LK0A 4GFTA 1S5GZ 1K2HA 3CR5X 1GJYA 3FWBA 1LVCD 1TCFA 1NX1A 1AJ5A 1YX7A 1PSBA 3BUMB 2K7DA 2KQYA 1UHNA 2KI4C 1K9KA 4JPZB 1SR6B 2R2IA 2ZRSA 4ZCVA 1QV1A 1CB1A 2L5XB 1N0YA 3OHMB 2L0PA 5DKNA 3CTNA 2H61C 3BUWB 3A8RA 4MRYA 5ER5A 1N2DA 1BOCA 3BXKA 1TNPA 2AMIA 1R2UA 3DF0B 2E30A 1YRUB 2L50A 3OX5A 5HKZA 4MZKA 2K7BA 4DS7A 4M2QA 3QRXA 5PALA 2B1UA 1SR6C 3K21A 1CDLA 1YRTB 2F8PA 2HETA 4YGCB 1SK6D 2MBXA 1HQVA 1Y1UA 2KFGA 1SNLA 1LXFC 1WRZA 4MSPA 2WC8A 2ZN8A 3VRQA 1TRFA 1NYAA 1S1EA 1ALWA 5AEQA 2LHIA 1RTP1 3SG5A 2V53A 3FWCA 1JUOA 3BQ3A 3RLZA 1GGWA 1EL4A 1B1GA 1F4OA 1S5GY 2H2KA 2MAZA 1MXLC 2E6WA 4P2YB 3OB1B 1JSAA 2BCBA 1QX5B 2M7NA 1KFXL 1PVBA 1CM4A 1TCOB 1JBAA 1OMDA 2L4IA 2WCBA 4N5XA 1KSMA 2HF5A 2K2AA 4HRGA 5FYXA 2M7LA 3ZNIA 1KSOA 2PSRA 4WQ2A 2BE6A 2LNKA 1ZOTB 1BJFA 1C07A 1AHRA 4PE1A 1DJXA 1SMGA 4YGBB 1B8RA 1XK4A 4MVFA 1CMGA 3TS5B 2MLFC 1K96A 1SYMA 2BBMA 3RM1A 1B7TZ 3D10A 4YI9A 2OPOA 1KK8C 1NCYA 1SL8A 2JQ6A 2SASA 4PHMA 1OMVA 4MRXA 5CSFA 1RWYA 1CMFA 2M49B 3HCMA 2F3ZA 2KGRA 2ZNEA 2VRGA 4CIDA 1XK4C 1KQMC 2Q91A 1QTXA 1NUBA 3SG4A 3TS5C 3BUOB 4IL1A 5D69A 2CXJA 2KAYA 1PK0D 1OSAA 5DKQA 2JWWA 2K8MB 4USLA 4NQGA 1DJHA 1J55A 1DJYA 1L7ZA 1M31A 1ZUZA 1UURA 1ODBA 1A75A 2PALA 1CFCA 5F6TA 3JVTB 1SRAA 2BBNA 1IWQA 1YVLA 2OS8B 1CFFA 3A4UB 2WCFA 1V1GA 1UHHA 4GGNA 4CLNA 3PLFB 2KOTA 3AKBA 1CDMA 1F4QA 1QASA 1DJIA 2SCPA 2MLEC 4XYNA 1XVJA 4FTGA 1CNPA 1DJGA 3SIBA 4I5JA 1MUXA 1XA5A 2G2BA 3BOWA 2F2PA 2LMUA 4BY4A 1H8BA 1YURA 4PE7A 1RROA 2KFHA 2JRFA 2JTZA 1B7TY 2PMYA 3JVTC 1DJWA 3SG3A 1IKUA 1SW8A 2OS8C 1RK9A 3NSOA 2M8UA 2O60A 2F2OA 4QJ4B 3TDZA 1F8HA 1MF8B 2JT3A 5KTYA 4ETOA 1S26D 1KK7Z 3TDIA 2KI6C 2KAVA 4FQOA 5AERA 2CCMA 3I5GC 1XFXO 2F33A 2FCDA 1A2XA 3KPXA 3DVMA 1UHKA 2LE9B 1EG4A 3IQOA 2HPSA 2NXQA 2ZFDA 1QJTA 1CTRA 1M39A 1MQ1A 2KI6D 1PVAA 4GAOA 1BR4B 1JC2A 1JFJA 2LLUA 2PVBA 3NXAA 1BG1A 2WOSA 1KFUS 1SKTA 4C0JA 1EH2A 1OZSA 2P6BB 1E8AA 4CFQA 3NSLA 3DVEA 1VRKA 3O4YA 3PFVA 1QLKA 3LL8B 4OR9B 4PCWA 3VRNA 1IG5A 2K61A 1NSHA 3KEVA 5JJGA 3NSIA 1WLZA 1OE9B 1NCZA 1SCVA 3O78A 5JOLA 4TNCA 2JXCA 2DOQA 2BKIB 3KF9A 2L4HA 3F45A 4MBEA 3EKJA 2K7OA 1J7OA 1Q80A 1F55A 1AJ4A 1KK7Y 4UPGA 1SL7A 4U8DA 2LM5A 2LVVA 3PALA 2M1UA 1B4CA 1PULA 1TNXA 2FJUB 4I5KA 1K94A 1M45A 3PN7B 3VROA 1MHOA 1TIZA 3E3RA 3WHTB 2KBMA 3DD4A 3WXAA 3EKHA 2JC2A 2OTGB 3EVUA 3TUYB 1Y1AA 5K89A 2LVIA 4GGFA 1KK8B 1B8CA 2CTNA 4PE0A 3VRRA 1OMRA 3AAJA 1PSRA 1QS7A 1QXPA 1BR1B 3PN7C 1NX0A 1Y0VH 1KQMB 4BY5A 2ZKMX 2I7AA 2PASA 5KSZA 2OTGC 1K95A 3SG6A 3TUYC 4N1FA 1S3PA 1XFUO 1NP8A 2Y4QA 4R1EA 1A03A 3GK4X 4HREE 4PE4A 2O5GA 3GK2A 2D8NA 1DF0B 1DF0A 4OCIA 3CLNA 2AAOA 1QVIZ 1WRLA 2CNPA 2KSPA 4AQJA 1B47A 3PATA 1MR8A 2EGDA 4AOMA 3GOFA 2BCXA 1CDNA 2EHBA 4XJKA 1WDCB 2LP2A 1J1DA 1MWNA 1LA3A 1CLBA 2L51A 2LMVA 4YRUA 5HYDA 1IQ3A 1K9PA 1QIWA 1XYDA 1NX3A 1A75B 1YUSA 1YUUA 3WHUB 1RJVA 1A29A 2LLSA 4AQIA 1FPWA 1NX2A 1IJ6A 1LA0A 4C0LA 1WLMA 4ORBB 2JOJA 2M29A 1YTZC 4NDDA 3EK7A 2BCAA 2LP3A 2JU0A 5B8IB 2LUXA 3ICBA 1WDCC 1BF5A 3CZTX 1XFYO 3I5FB 2KNEA 2KYFA 1BU3A 1S36A 3BOWB 3IF7A 1J7RA 4P5OE 5CSJA 3I5GB 5ER4X 1PALA 3LLEA 4Q04A 2KGBC 1J7QA 2L98A 1J1EA 1S6IA 1XFVO 2KFFA 2MRDA 1ZFSA 1J7PA 1QATA 2ZRTA 3SG7A 1C7VA 2A4JA 2BE4A 2WORA 5IBWA 1RECA 3D0YA 5I2QA 1CLLA 2GGMA 2NLNA 1AP4A 4DIRA 1YX8A 1EXRA 5KU1A 2ZNDA 2JNFA 3I5FC 1QVIY 1XFWO 2LHLA 2M9GA 1Y1XA 2WNDA 3DVJA 1IJ5A 5D7FA 1NPQA 1UWOA 5G08A 4D1EA 4WQ3A 1G8IA 1K9UA 2NCOA 1SL9A 4OKHA 4N1GA 3IQQA 1QLSA 1S6JA 1IH0A 1K93D 1BLQA 2FCEA 2FOTA 1B9AA 2GV5A 1KCYA 1YR5A 4YI8A 1MXEA 4ORAB 3OX6A 1X02A 1V1FA 2Y1MA 2QPTA 3EVRA 2KAXA 1EG3A 2LCPA 3MSEB 4I5LB 3PM8A 3BYAA 2LC5A 2MA2A 1TNWA 1D1OA 1GQMA 2Y1NA 3OB2B 4YBHB 2NZ0A 2Y5IA 1DJZA 1KFUL 1JF0A 3C1VA 3I5IB 4A4BA 1IGVA 1GGZA 1UHIA 2JTTA 2JZIA 4M2PA 4PHKA 1FI6A 3SIAA 2JNXA 1NWDA 3CWGA 5AXIA 1CFDA 1ZMZA 1FBVA 5CSIA 3OP0A 1QX2A 5DKRA 5GQQC 1KQVA 2LMTA 2KBIA 4DUQA 3DF0A 3SJSA 1IRJA 1YUTA 4JWQA 1U5IB 1U5IA 3I5IC 4NDCA 2JPTA 1F71A 2LV7A 4OVNF 1DVIA 1BT6A 2M0RA 4QJ5B 3CGAA 3LK1A 2CBLA 1N65A 3BUNB 1IQ5A 2G9BA 3O6BA 1W7JB 1DGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AK8 A;  5TNC A;  2LVJ A;  2M97 A;  3LCP C;  4HSZ A;  5I2L A;  2JT8 A;  4QJ3 B;  1ALV A;  2RGI A;  5BPJ A;  3M0W A;  2I18 A;  2MJW B;  1JWD A;  3SG2 A;  2JXL A;  1OOJ A;  3PSR A;  4MLW A;  1DT7 B;  1KWO B;  1B8L A;  4PHJ A;  2MHH A;  2BEC A;  4DRW A;  5CPV A;  5HKW A;  3FS7 A;  1AUI B;  1KFX S;  4JQ0 D;  2Q4U A;  5HLO A;  4YGE B;  3O2P A;  3KHE A;  4YGA A;  5HKY A;  2K7C A;  4GBA A;  2GGZ A;  3HX4 A;  1H4B A;  4F0Z B;  1K90 D;  1OQP A;  4GGF C;  4MZJ A;  4MZL A;  4MN0 A;  2ISD A;  3TDU A;  1KWO C;  4M2O A;  4MEW A;  1Y6W A;  1AVS A;  4ORC B;  1WY9 A;  1L2O B;  2NCP A;  2F3Y A;  1F70 A;  1SPY A;  1SY9 A;  1OZO A;  3AAK A;  4OV2 A;  1SBJ A;  1XO5 A;  3FIA A;  4XJK B;  2KDH A;  4GNK B;  4C0K A;  1DGU A;  3DVK A;  2LUC A;  3EK4 A;  1C7W A;  1XFZ O;  1CLM A;  1F54 A;  2LVK A;  1NIW A;  3BUX B;  2PRU A;  1R6P A;  4CPV A;  2CT9 A;  1CDP A;  4HRH A;  1EJ3 A;  1TTX A;  2KHN A;  1UUS A;  4I5N B;  1L2O C;  1QIV A;  1ZAC A;  4PDZ A;  5I8N A;  1PRW A;  1W7I B;  3CS1 A;  4GUK A;  2AUC A;  1UHJ A;  2LLT A;  2QAC A;  4A4C A;  1UP5 A;  2LAP A;  3CR2 A;  1K8U A;  4PAL A;  2EC6 B;  2JUL A;  5J3X A;  1G33 A;  1M46 A;  1TOP A;  2BL0 B;  2KQ6 A;  5CSN A;  1SCM B;  1JFK A;  4ICB A;  4YGD B;  2WCE A;  1FW4 A;  3I5H B;  3EK8 A;  2K2F A;  1G4Y R;  3D0Y B;  3VGO A;  2TN4 A;  2L2E A;  1QV0 A;  3ZWH A;  1S6C A;  3KO0 A;  2HQ8 A;  1WRK A;  2IS9 A;  3NSK A;  4WRI A;  1CM1 A;  3JTD B;  5AAN A;  5I2O A;  1HT9 A;  3EVV A;  1BMO A;  1YVH A;  2BKH B;  3AKA A;  2EC6 C;  2COL B;  2LAN A;  4NDB A;  4ZCU A;  1A4P A;  4E68 A;  4L9M A;  2BL0 C;  4CFR A;  3VRP A;  4DCK A;  1SCM C;  3TZ1 A;  5HLV A;  1M63 B;  1NCX A;  3WNX B;  4PHN A;  4GPL B;  3I5H C;  1FF1 A;  1QX7 A;  2M3W A;  1JF2 A;  2JT0 A;  2KI4 B;  2K0J A;  2M1K B;  1CFP A;  2KYC A;  1LIN A;  1DTL A;  3JTD C;  5AFP A;  2I2R E;  1RFJ A;  1TN4 A;  2ZN9 A;  1FI5 A;  1LKJ A;  3CR4 X;  2HQW A;  2I94 A;  3GK1 A;  3H4S E;  1DMO A;  2H61 A;  1CKK A;  1BOD A;  1TNQ A;  3LK0 A;  4GFT A;  1S5G Z;  1K2H A;  3CR5 X;  1GJY A;  3FWB A;  1LVC D;  1TCF A;  1NX1 A;  1AJ5 A;  1YX7 A;  1PSB A;  3BUM B;  2K7D A;  2KQY A;  1UHN A;  2KI4 C;  1K9K A;  4JPZ B;  1SR6 B;  2R2I A;  2ZRS A;  4ZCV A;  1QV1 A;  1CB1 A;  2L5X B;  1N0Y A;  3OHM B;  2L0P A;  5DKN A;  3CTN A;  2H61 C;  3BUW B;  3A8R A;  4MRY A;  5ER5 A;  1N2D A;  1BOC A;  3BXK A;  1TNP A;  2AMI A;  1R2U A;  3DF0 B;  2E30 A;  1YRU B;  2L50 A;  3OX5 A;  5HKZ A;  4MZK A;  2K7B A;  4DS7 A;  4M2Q A;  3QRX A;  5PAL A;  2B1U A;  1SR6 C;  3K21 A;  1CDL A;  1YRT B;  2F8P A;  2HET A;  4YGC B;  1SK6 D;  2MBX A;  1HQV A;  1Y1U A;  2KFG A;  1SNL A;  1LXF C;  1WRZ A;  4MSP A;  2WC8 A;  2ZN8 A;  3VRQ A;  1TRF A;  1NYA A;  1S1E A;  1ALW A;  5AEQ A;  2LHI A;  1RTP 1;  3SG5 A;  2V53 A;  3FWC A;  1JUO A;  3BQ3 A;  3RLZ A;  1GGW A;  1EL4 A;  1B1G A;  1F4O A;  1S5G Y;  2H2K A;  2MAZ A;  1MXL C;  2E6W A;  4P2Y B;  3OB1 B;  1JSA A;  2BCB A;  1QX5 B;  2M7N A;  1KFX L;  1PVB A;  1CM4 A;  1TCO B;  1JBA A;  1OMD A;  2L4I A;  2WCB A;  4N5X A;  1KSM A;  2HF5 A;  2K2A A;  4HRG A;  5FYX A;  2M7L A;  3ZNI A;  1KSO A;  2PSR A;  4WQ2 A;  2BE6 A;  2LNK A;  1ZOT B;  1BJF A;  1C07 A;  1AHR A;  4PE1 A;  1DJX A;  1SMG A;  4YGB B;  1B8R A;  1XK4 A;  4MVF A;  1CMG A;  3TS5 B;  2MLF C;  1K96 A;  1SYM A;  2BBM A;  3RM1 A;  1B7T Z;  3D10 A;  4YI9 A;  2OPO A;  1KK8 C;  1NCY A;  1SL8 A;  2JQ6 A;  2SAS A;  4PHM A;  1OMV A;  4MRX A;  5CSF A;  1RWY A;  1CMF A;  2M49 B;  3HCM A;  2F3Z A;  2KGR A;  2ZNE A;  2VRG A;  4CID A;  1XK4 C;  1KQM C;  2Q91 A;  1QTX A;  1NUB A;  3SG4 A;  3TS5 C;  3BUO B;  4IL1 A;  5D69 A;  2CXJ A;  2KAY A;  1PK0 D;  1OSA A;  5DKQ A;  2JWW A;  2K8M B;  4USL A;  4NQG A;  1DJH A;  1J55 A;  1DJY A;  1L7Z A;  1M31 A;  1ZUZ A;  1UUR A;  1ODB A;  1A75 A;  2PAL A;  1CFC A;  5F6T A;  3JVT B;  1SRA A;  2BBN A;  1IWQ A;  1YVL A;  2OS8 B;  1CFF A;  3A4U B;  2WCF A;  1V1G A;  1UHH A;  4GGN A;  4CLN A;  3PLF B;  2KOT A;  3AKB A;  1CDM A;  1F4Q A;  1QAS A;  1DJI A;  2SCP A;  2MLE C;  4XYN A;  1XVJ A;  4FTG A;  1CNP A;  1DJG A;  3SIB A;  4I5J A;  1MUX A;  1XA5 A;  2G2B A;  3BOW A;  2F2P A;  2LMU A;  4BY4 A;  1H8B A;  1YUR A;  4PE7 A;  1RRO A;  2KFH A;  2JRF A;  2JTZ A;  1B7T Y;  2PMY A;  3JVT C;  1DJW A;  3SG3 A;  1IKU A;  1SW8 A;  2OS8 C;  1RK9 A;  3NSO A;  2M8U A;  2O60 A;  2F2O A;  4QJ4 B;  3TDZ A;  1F8H A;  1MF8 B;  2JT3 A;  5KTY A;  4ETO A;  1S26 D;  1KK7 Z;  3TDI A;  2KI6 C;  2KAV A;  4FQO A;  5AER A;  2CCM A;  3I5G C;  1XFX O;  2F33 A;  2FCD A;  1A2X A;  3KPX A;  3DVM A;  1UHK A;  2LE9 B;  1EG4 A;  3IQO A;  2HPS A;  2NXQ A;  2ZFD A;  1QJT A;  1CTR A;  1M39 A;  1MQ1 A;  2KI6 D;  1PVA A;  4GAO A;  1BR4 B;  1JC2 A;  1JFJ A;  2LLU A;  2PVB A;  3NXA A;  1BG1 A;  2WOS A;  1KFU S;  1SKT A;  4C0J A;  1EH2 A;  1OZS A;  2P6B B;  1E8A A;  4CFQ A;  3NSL A;  3DVE A;  1VRK A;  3O4Y A;  3PFV A;  1QLK A;  3LL8 B;  4OR9 B;  4PCW A;  3VRN A;  1IG5 A;  2K61 A;  1NSH A;  3KEV A;  5JJG A;  3NSI A;  1WLZ A;  1OE9 B;  1NCZ A;  1SCV A;  3O78 A;  5JOL A;  4TNC A;  2JXC A;  2DOQ A;  2BKI B;  3KF9 A;  2L4H A;  3F45 A;  4MBE A;  3EKJ A;  2K7O A;  1J7O A;  1Q80 A;  1F55 A;  1AJ4 A;  1KK7 Y;  4UPG A;  1SL7 A;  4U8D A;  2LM5 A;  2LVV A;  3PAL A;  2M1U A;  1B4C A;  1PUL A;  1TNX A;  2FJU B;  4I5K A;  1K94 A;  1M45 A;  3PN7 B;  3VRO A;  1MHO A;  1TIZ A;  3E3R A;  3WHT B;  2KBM A;  3DD4 A;  3WXA A;  3EKH A;  2JC2 A;  2OTG B;  3EVU A;  3TUY B;  1Y1A A;  5K89 A;  2LVI A;  4GGF A;  1KK8 B;  1B8C A;  2CTN A;  4PE0 A;  3VRR A;  1OMR A;  3AAJ A;  1PSR A;  1QS7 A;  1QXP A;  1BR1 B;  3PN7 C;  1NX0 A;  1Y0V H;  1KQM B;  4BY5 A;  2ZKM X;  2I7A A;  2PAS A;  5KSZ A;  2OTG C;  1K95 A;  3SG6 A;  3TUY C;  4N1F A;  1S3P A;  1XFU O;  1NP8 A;  2Y4Q A;  4R1E A;  1A03 A;  3GK4 X;  4HRE E;  4PE4 A;  2O5G A;  3GK2 A;  2D8N A;  1DF0 B;  1DF0 A;  4OCI A;  3CLN A;  2AAO A;  1QVI Z;  1WRL A;  2CNP A;  2KSP A;  4AQJ A;  1B47 A;  3PAT A;  1MR8 A;  2EGD A;  4AOM A;  3GOF A;  2BCX A;  1CDN A;  2EHB A;  4XJK A;  1WDC B;  2LP2 A;  1J1D A;  1MWN A;  1LA3 A;  1CLB A;  2L51 A;  2LMV A;  4YRU A;  5HYD A;  1IQ3 A;  1K9P A;  1QIW A;  1XYD A;  1NX3 A;  1A75 B;  1YUS A;  1YUU A;  3WHU B;  1RJV A;  1A29 A;  2LLS A;  4AQI A;  1FPW A;  1NX2 A;  1IJ6 A;  1LA0 A;  4C0L A;  1WLM A;  4ORB B;  2JOJ A;  2M29 A;  1YTZ C;  4NDD A;  3EK7 A;  2BCA A;  2LP3 A;  2JU0 A;  5B8I B;  2LUX A;  3ICB A;  1WDC C;  1BF5 A;  3CZT X;  1XFY O;  3I5F B;  2KNE A;  2KYF A;  1BU3 A;  1S36 A;  3BOW B;  3IF7 A;  1J7R A;  4P5O E;  5CSJ A;  3I5G B;  5ER4 X;  1PAL A;  3LLE A;  4Q04 A;  2KGB C;  1J7Q A;  2L98 A;  1J1E A;  1S6I A;  1XFV O;  2KFF A;  2MRD A;  1ZFS A;  1J7P A;  1QAT A;  2ZRT A;  3SG7 A;  1C7V A;  2A4J A;  2BE4 A;  2WOR A;  5IBW A;  1REC A;  3D0Y A;  5I2Q A;  1CLL A;  2GGM A;  2NLN A;  1AP4 A;  4DIR A;  1YX8 A;  1EXR A;  5KU1 A;  2ZND A;  2JNF A;  3I5F C;  1QVI Y;  1XFW O;  2LHL A;  2M9G A;  1Y1X A;  2WND A;  3DVJ A;  1IJ5 A;  5D7F A;  1NPQ A;  1UWO A;  5G08 A;  4D1E A;  4WQ3 A;  1G8I A;  1K9U A;  2NCO A;  1SL9 A;  4OKH A;  4N1G A;  3IQQ A;  1QLS A;  1S6J A;  1IH0 A;  1K93 D;  1BLQ A;  2FCE A;  2FOT A;  1B9A A;  2GV5 A;  1KCY A;  1YR5 A;  4YI8 A;  1MXE A;  4ORA B;  3OX6 A;  1X02 A;  1V1F A;  2Y1M A;  2QPT A;  3EVR A;  2KAX A;  1EG3 A;  2LCP A;  3MSE B;  4I5L B;  3PM8 A;  3BYA A;  2LC5 A;  2MA2 A;  1TNW A;  1D1O A;  1GQM A;  2Y1N A;  3OB2 B;  4YBH B;  2NZ0 A;  2Y5I A;  1DJZ A;  1KFU L;  1JF0 A;  3C1V A;  3I5I B;  4A4B A;  1IGV A;  1GGZ A;  1UHI A;  2JTT A;  2JZI A;  4M2P A;  4PHK A;  1FI6 A;  3SIA A;  2JNX A;  1NWD A;  3CWG A;  5AXI A;  1CFD A;  1ZMZ A;  1FBV A;  5CSI A;  3OP0 A;  1QX2 A;  5DKR A;  5GQQ C;  1KQV A;  2LMT A;  2KBI A;  4DUQ A;  3DF0 A;  3SJS A;  1IRJ A;  1YUT A;  4JWQ A;  1U5I B;  1U5I A;  3I5I C;  4NDC A;  2JPT A;  1F71 A;  2LV7 A;  4OVN F;  1DVI A;  1BT6 A;  2M0R A;  4QJ5 B;  3CGA A;  3LK1 A;  2CBL A;  1N65 A;  3BUN B;  1IQ5 A;  2G9B A;  3O6B A;  1W7J B;  1DGV A; 
#chains in the Genus database with same CATH topology
 1AK8 A;  5TNC A;  3DY9 A;  2LVJ A;  2M97 A;  3LCP C;  1Z4H A;  4HSZ A;  5I2L A;  2JT8 A;  4QJ3 B;  1ALV A;  2RGI A;  5BPJ A;  3M0W A;  2I18 A;  2MJW B;  1JWD A;  3SG2 A;  2JXL A;  1OOJ A;  3PSR A;  4MLW A;  3BFB A;  1DT7 B;  1KWO B;  1B8L A;  4PHJ A;  2MHH A;  2BEC A;  4DRW A;  5CPV A;  5HKW A;  2P70 A;  3SS4 A;  3FS7 A;  1AUI B;  1KFX S;  4JQ0 D;  2Q4U A;  5HLO A;  3PM2 A;  4YGE B;  3O2P A;  3KHE A;  1OOG A;  4YGA A;  2K7C A;  4GBA A;  5HKY A;  2GGZ A;  3HX4 A;  1H4B A;  1TUJ A;  4F0Z B;  1K90 D;  1OQP A;  4GGF C;  4MZJ A;  4MZL A;  4MN0 A;  2ISD A;  3CYZ A;  3TDU A;  1KWO C;  4M2O A;  4MEW A;  1Y6W A;  1AVS A;  4OZD A;  4ORC B;  1P28 A;  1WY9 A;  1L2O B;  2NCP A;  3B6X A;  2F3Y A;  3S0E A;  1F70 A;  1SPY A;  1SY9 A;  1C3Z A;  1OZO A;  3AAK A;  1QWV A;  4OV2 A;  1SBJ A;  1XO5 A;  1C3Y A;  3FIA A;  4XJK B;  2KDH A;  4GNK B;  4C0K A;  1DGU A;  3DVK A;  2LUC A;  3EK4 A;  1C7W A;  1XFZ O;  1TUZ A;  1CLM A;  1F54 A;  2LVK A;  1NIW A;  3BUX B;  2PRU A;  1R6P A;  4CPV A;  2CT9 A;  1CDP A;  4HRH A;  1EJ3 A;  1TTX A;  2KHN A;  1UUS A;  4I5N B;  1L2O C;  1QIV A;  1ZAC A;  4PDZ A;  5I8N A;  1PRW A;  5I94 A;  1W7I B;  3CS1 A;  4GUK A;  1GM0 A;  2AUC A;  1UHJ A;  2LLT A;  3B87 A;  2QAC A;  4A4C A;  1UP5 A;  2LAP A;  3CR2 A;  1K8U A;  4PAL A;  2EC6 B;  2JUL A;  3FE6 A;  5J3X A;  1G33 A;  1M46 A;  1TOP A;  2BL0 B;  2KQ6 A;  5CSN A;  1SCM B;  1Z2C B;  1JFK A;  1SSE B;  2PQL A;  4ICB A;  4YGD B;  2WCE A;  1FW4 A;  3I5H B;  5EL2 A;  3EK8 A;  2K2F A;  1G4Y R;  3D0Y B;  3VGO A;  2TN4 A;  2L2E A;  1QV0 A;  3ZWH A;  1S6C A;  3KO0 A;  2HQ8 A;  1WRK A;  2IS9 A;  3NSK A;  4WRI A;  1CM1 A;  3JTD B;  5AAN A;  5I2O A;  1HT9 A;  3EVV A;  1BMO A;  1YVH A;  2BKH B;  3AKA A;  2EC6 C;  2COL B;  2LAN A;  4NDB A;  4ZCU A;  1A4P A;  4E68 A;  3K1E A;  4L9M A;  2BL0 C;  4CFR A;  3VRP A;  4DCK A;  1SCM C;  3TZ1 A;  5HLV A;  1M63 B;  1NCX A;  3DZT A;  3WNX B;  4PHN A;  3B86 A;  4GPL B;  3IVT A;  3I5H C;  1FF1 A;  1QX7 A;  2M3W A;  1JF2 A;  2GTE A;  2JT0 A;  4INX A;  3OBV A;  2BAP A;  2KI4 B;  2K0J A;  2M1K B;  3V2L A;  1CFP A;  2KYC A;  1LIN A;  1DTL A;  3JTD C;  5AFP A;  2I2R E;  1RFJ A;  1TN4 A;  2ZN9 A;  1FI5 A;  1LKJ A;  3CR4 X;  2HQW A;  3D76 A;  1IIO A;  2I94 A;  3S0F A;  3GK1 A;  3H4S E;  1OOF A;  1DMO A;  2H61 A;  1CKK A;  1BOD A;  1TNQ A;  3LK0 A;  4GFT A;  1S5G Z;  1K2H A;  3CR5 X;  1GJY A;  3FWB A;  1LVC D;  1TCF A;  1NX1 A;  1AJ5 A;  1YX7 A;  1PSB A;  3BUM B;  2K7D A;  2KQY A;  3NHI A;  1UHN A;  2KI4 C;  1K9K A;  4JPZ B;  1SR6 B;  2R2I A;  4KYN A;  2ZRS A;  4ZCV A;  3S0G A;  1QV1 A;  2PYQ A;  1CB1 A;  2L5X B;  1N0Y A;  2L2C A;  2L0P A;  3OHM B;  5DKN A;  3CTN A;  2H61 C;  3BUW B;  3A8R A;  4MRY A;  5ER5 A;  1N2D A;  1BOC A;  2WCJ A;  3BXK A;  1TNP A;  2AMI A;  1R2U A;  3DF0 B;  2E30 A;  1YRU B;  2L50 A;  3OX5 A;  3QME A;  5HKZ A;  4MZK A;  2K7B A;  4DS7 A;  4M2Q A;  3QRX A;  5PAL A;  2B1U A;  1SR6 C;  3K21 A;  1CDL A;  1YRT B;  2F8P A;  2HET A;  3R1P A;  1SK6 D;  4YGC B;  2MBX A;  1HQV A;  1Y1U A;  2KFG A;  4JD9 A;  1SNL A;  2QEV A;  1LXF C;  1WRZ A;  4MSP A;  2WC8 A;  2ZN8 A;  3VRQ A;  1TRF A;  1NYA A;  1S1E A;  1ALW A;  5AEQ A;  2LHI A;  1RTP 1;  3R1O A;  3SG5 A;  2V53 A;  3FWC A;  1JUO A;  3BQ3 A;  5D3O A;  3CDN A;  3RLZ A;  4INW A;  1EL4 A;  1B1G A;  1GGW A;  1F4O A;  1S5G Y;  2H2K A;  2MAZ A;  1MXL C;  2E6W A;  4P2Y B;  3OB1 B;  1JSA A;  4PT1 A;  2BCB A;  3UO9 A;  1QX5 B;  2K60 A;  1KFX L;  1PVB A;  2M7N A;  1CM4 A;  1TCO B;  3N7H A;  1JBA A;  1OMD A;  2YGU A;  3Q8I A;  2L4I A;  2WCB A;  4N5X A;  1KSM A;  1W9Z A;  2HF5 A;  2K2A A;  4HRG A;  5FYX A;  2M7L A;  3ZNI A;  1KSO A;  2PSR A;  4WQ2 A;  2BE6 A;  2LNK A;  1ZOT B;  2KLD A;  1BJF A;  1C07 A;  1AHR A;  4PE1 A;  1DJX A;  1SMG A;  4YGB B;  1B8R A;  1XK4 A;  4MVF A;  3OGN A;  1CMG A;  3TS5 B;  2MLF C;  1K96 A;  1SYM A;  2BBM A;  3RM1 A;  1B7T Z;  3D10 A;  2L5Y A;  4YI9 A;  2OPO A;  3S0B A;  1KK8 C;  1NCY A;  1SL8 A;  2JQ6 A;  2SAS A;  4PHM A;  1OMV A;  4MRX A;  5CSF A;  5FI7 A;  3FE9 A;  1RWY A;  3EG5 B;  2M49 B;  3HCM A;  1CMF A;  2F3Z A;  2KGR A;  2ZNE A;  2VRG A;  4CID A;  1XK4 C;  1KQM C;  2Q91 A;  1QTX A;  1NUB A;  3SG4 A;  3TS5 C;  3BUO B;  4IL1 A;  5D69 A;  2CXJ A;  2KAY A;  1PK0 D;  1OSA A;  3NGV A;  5DKQ A;  2JWW A;  2K8M B;  4USL A;  4NQG A;  1DJH A;  1J55 A;  1DJY A;  3O4X A;  1DEL A;  1L7Z A;  1M31 A;  1ZUZ A;  1UUR A;  1ODB A;  3D75 A;  1A75 A;  3L4L A;  2PAL A;  1CFC A;  5F6T A;  3JVT B;  1SRA A;  3S0D A;  2BBN A;  1IWQ A;  1YVL A;  2OS8 B;  3D77 A;  1CFF A;  3A4U B;  2WCF A;  1V1G A;  1UHH A;  4GGN A;  4CLN A;  3PLF B;  2KOT A;  3AKB A;  1CDM A;  1F4Q A;  1QAS A;  1DJI A;  2SCP A;  2MLE C;  4XYN A;  1XVJ A;  4FTG A;  1CNP A;  1DJG A;  3SIB A;  4I5J A;  1MUX A;  1XA5 A;  2G2B A;  3BOW A;  2F2P A;  2LMU A;  4BY4 A;  1H8B A;  2WCM A;  1YUR A;  4PE7 A;  1RRO A;  2KFH A;  2JRF A;  2JTZ A;  1B7T Y;  2PMY A;  3JVT C;  1DJW A;  3SG3 A;  1IKU A;  1SW8 A;  2OS8 C;  3D78 A;  1RK9 A;  3NSO A;  2M8U A;  2O60 A;  2F2O A;  4QJ4 B;  3TDZ A;  1F8H A;  3BFH A;  1MF8 B;  2JT3 A;  3FE8 A;  5KTY A;  4ETO A;  1S26 D;  1KK7 Z;  2KLE A;  2KI6 C;  2KAV A;  4FQO A;  3TDI A;  5AER A;  2CCM A;  3I5G C;  3BFA A;  1XFX O;  2F33 A;  1T14 A;  1A2X A;  2FCD A;  3KPX A;  5HL1 A;  3DVM A;  1UHK A;  2LE9 B;  1EG4 A;  3IQO A;  2HPS A;  2WCL A;  2NXQ A;  2ZFD A;  1ORG A;  1QJT A;  1CTR A;  1TWO A;  3SS5 A;  1M39 A;  1MQ1 A;  3CAB A;  2KI6 D;  2WC5 A;  1PVA A;  4GAO A;  1BR4 B;  3SS3 A;  1JC2 A;  1JFJ A;  2LLU A;  2PVB A;  3NXA A;  1BG1 A;  2WOS A;  1KFU S;  1SKT A;  4C0J A;  1EH2 A;  1OZS A;  2P6B B;  1E8A A;  4CFQ A;  3NSL A;  3DVE A;  1VRK A;  3O4Y A;  3PFV A;  1QLK A;  3LL8 B;  4OR9 B;  4PCW A;  3VRN A;  3RZS A;  1IG5 A;  2K61 A;  3NHT A;  1NSH A;  3KEV A;  5JJG A;  3NSI A;  1WLZ A;  1OE9 B;  1NCZ A;  1SCV A;  3O78 A;  5JOL A;  4TNC A;  2JXC A;  3VB1 A;  2DOQ A;  2BKI B;  3BJH A;  3KF9 A;  2L4H A;  3F45 A;  4MBE A;  3EKJ A;  2K7O A;  1J7O A;  1Q80 A;  3L47 A;  1F55 A;  1AJ4 A;  3UNW A;  1KK7 Y;  4UPG A;  1SL7 A;  4U8D A;  2LM5 A;  2LVV A;  3PAL A;  2M1U A;  1B4C A;  1PUL A;  1TNX A;  2FJU B;  4I5K A;  1K94 A;  1M45 A;  3PN7 B;  3VRO A;  2WC6 A;  1MHO A;  1TIZ A;  3E3R A;  3WHT B;  2KBM A;  3DD4 A;  3WXA A;  3EKH A;  2JC2 A;  2OTG B;  3EVU A;  3TUY B;  1DC1 A;  1Y1A A;  5K89 A;  2LVI A;  2WCH A;  4GGF A;  1KK8 B;  1B8C A;  2CTN A;  4PE0 A;  3VRR A;  2FJY A;  2JPO A;  1OMR A;  3AAJ A;  1PSR A;  1QS7 A;  1QXP A;  1BR1 B;  3PN7 C;  5FI6 A;  1NX0 A;  1Y0V H;  1KQM B;  4BY5 A;  2H8V A;  2ZKM X;  2I7A A;  1OW4 A;  2PAS A;  5KSZ A;  3CZ0 A;  2OTG C;  1K95 A;  3B88 A;  3SG6 A;  4N1F A;  1S3P A;  3TUY C;  1XFU O;  1NP8 A;  2Y4Q A;  4R1E A;  1A03 A;  3GK4 X;  4HRE E;  4PE4 A;  2O5G A;  3GK2 A;  2D8N A;  1DF0 B;  1DF0 A;  4OCI A;  3CLN A;  1XFR A;  2AAO A;  2QEO A;  1QVI Z;  1WRL A;  2CNP A;  3B7A A;  3CZ2 A;  2KSP A;  3PJI A;  4AQJ A;  1B47 A;  2BNX A;  3PAT A;  1MR8 A;  2EGD A;  4AOM A;  3GOF A;  2BCX A;  2ERB A;  1CDN A;  2EHB A;  3L4A A;  4XJK A;  1WDC B;  2LP2 A;  2P71 A;  1J1D A;  1MWN A;  1LA3 A;  1CLB A;  2QEH A;  2L51 A;  2LMV A;  4YRU A;  3D74 A;  5HYD A;  1IQ3 A;  1K9P A;  1QIW A;  1XYD A;  1NX3 A;  1A75 B;  1YUS A;  1YUU A;  3WHU B;  1RJV A;  1A29 A;  2LLS A;  4AQI A;  1FPW A;  1NX2 A;  3R1V A;  1IJ6 A;  1LA0 A;  4C0L A;  1WLM A;  4ORB B;  2JOJ A;  2M29 A;  1YTZ C;  4NDD A;  3EK7 A;  2KPH A;  2BCA A;  2LP3 A;  2JU0 A;  3D73 A;  5B8I B;  2LUX A;  3ICB A;  1WDC C;  3DYE A;  1BF5 A;  3CZT X;  5DIC A;  1XFY O;  3I5F B;  2KNE A;  2KYF A;  1BU3 A;  1S36 A;  3BOW B;  3IF7 A;  1J7R A;  4P5O E;  5CSJ A;  3I5G B;  4JKT A;  5ER4 X;  1PAL A;  3LLE A;  4Q04 A;  2KGB C;  1J7Q A;  2L98 A;  1J1E A;  1S6I A;  1XFV O;  2KFF A;  2MRD A;  1ZFS A;  1J7P A;  1QAT A;  2QDI A;  2ZRT A;  3SG7 A;  1C7V A;  2A4J A;  2BE4 A;  2WOR A;  1LS8 A;  5IBW A;  1REC A;  3D0Y A;  4FQT A;  5I2Q A;  1CLL A;  2GGM A;  3CZ1 A;  2NLN A;  1AP4 A;  4DIR A;  1YX8 A;  1EXR A;  5KU1 A;  2ZND A;  2JNF A;  4IJ7 A;  5FI2 A;  3I5F C;  1QVI Y;  1XFW O;  2LHL A;  2M9G A;  1Y1X A;  2WND A;  3DVJ A;  1IJ5 A;  5D7F A;  1NPQ A;  1UWO A;  5G08 A;  4D1E A;  4WQ3 A;  1G8I A;  1K9U A;  2QEB A;  1OOH A;  2NCO A;  1SL9 A;  2WCK A;  4OKH A;  4N1G A;  3IQQ A;  1QLS A;  1S6J A;  3R72 A;  1IH0 A;  1OOI X;  1K93 D;  1BLQ A;  2FCE A;  4F7F A;  2FOT A;  1B9A A;  2GV5 A;  1KCY A;  1YR5 A;  4YI8 A;  1MXE A;  4ORA B;  3OX6 A;  1X02 A;  1V1F A;  2Y1M A;  1DEK A;  2QPT A;  3EVR A;  2KAX A;  1EG3 A;  2LCP A;  3MSE B;  4I5L B;  3PM8 A;  3BYA A;  2LC5 A;  2MA2 A;  1TNW A;  1D1O A;  1GQM A;  2Y1N A;  3OB2 B;  4YBH B;  2NZ0 A;  2Y5I A;  1DJZ A;  1KFU L;  1JF0 A;  3C1V A;  3I5I B;  4A4B A;  1IGV A;  1GGZ A;  1UHI A;  2JTT A;  2JZI A;  3DXL A;  4M2P A;  4PHK A;  1FI6 A;  3SIA A;  2JNX A;  1NWD A;  3CWG A;  5AXI A;  1CFD A;  1ZMZ A;  1FBV A;  5CSI A;  3S0A A;  3OP0 A;  1QX2 A;  5DKR A;  5GQQ C;  1KQV A;  2LMT A;  2KBI A;  4DUQ A;  3DF0 A;  3SJS A;  1IRJ A;  1YUT A;  4JWQ A;  1U5I B;  1U5I A;  3I5I C;  4NDC A;  2JPT A;  1F71 A;  2LV7 A;  4OVN F;  1DVI A;  1BT6 A;  1DQE A;  2M0R A;  3CGA A;  4QJ5 B;  3LK1 A;  2CBL A;  1N65 A;  3BUN B;  1IQ5 A;  2G9B A;  3O6B A;  1W7J B;  1DGV A; 
#chains in the Genus database with same CATH homology
 1AK8 A;  5TNC A;  2LVJ A;  2M97 A;  3LCP C;  4HSZ A;  5I2L A;  2JT8 A;  4QJ3 B;  1ALV A;  2RGI A;  5BPJ A;  3M0W A;  2I18 A;  2MJW B;  1JWD A;  3SG2 A;  2JXL A;  1OOJ A;  3PSR A;  4MLW A;  1DT7 B;  1KWO B;  1B8L A;  4PHJ A;  2MHH A;  2BEC A;  4DRW A;  5CPV A;  5HKW A;  3FS7 A;  1AUI B;  1KFX S;  4JQ0 D;  2Q4U A;  5HLO A;  4YGE B;  3O2P A;  3KHE A;  4YGA A;  5HKY A;  2K7C A;  4GBA A;  2GGZ A;  3HX4 A;  1H4B A;  4F0Z B;  1K90 D;  1OQP A;  4GGF C;  4MZJ A;  4MZL A;  4MN0 A;  2ISD A;  3TDU A;  1KWO C;  4M2O A;  4MEW A;  1Y6W A;  1AVS A;  4ORC B;  1WY9 A;  1L2O B;  2NCP A;  2F3Y A;  1F70 A;  1SPY A;  1SY9 A;  1OZO A;  3AAK A;  4OV2 A;  1SBJ A;  1XO5 A;  3FIA A;  4XJK B;  2KDH A;  4GNK B;  4C0K A;  1DGU A;  3DVK A;  2LUC A;  3EK4 A;  1C7W A;  1XFZ O;  1CLM A;  1F54 A;  2LVK A;  1NIW A;  3BUX B;  2PRU A;  1R6P A;  4CPV A;  2CT9 A;  1CDP A;  4HRH A;  1EJ3 A;  1TTX A;  2KHN A;  1UUS A;  4I5N B;  1L2O C;  1QIV A;  1ZAC A;  4PDZ A;  5I8N A;  1PRW A;  1W7I B;  3CS1 A;  4GUK A;  2AUC A;  1UHJ A;  2LLT A;  2QAC A;  4A4C A;  1UP5 A;  2LAP A;  3CR2 A;  1K8U A;  4PAL A;  2EC6 B;  2JUL A;  5J3X A;  1G33 A;  1M46 A;  1TOP A;  2BL0 B;  2KQ6 A;  5CSN A;  1SCM B;  1JFK A;  4ICB A;  4YGD B;  2WCE A;  1FW4 A;  3I5H B;  3EK8 A;  2K2F A;  1G4Y R;  3D0Y B;  3VGO A;  2TN4 A;  2L2E A;  1QV0 A;  3ZWH A;  1S6C A;  3KO0 A;  2HQ8 A;  1WRK A;  2IS9 A;  3NSK A;  4WRI A;  1CM1 A;  3JTD B;  5AAN A;  5I2O A;  1HT9 A;  3EVV A;  1BMO A;  1YVH A;  2BKH B;  3AKA A;  2EC6 C;  2COL B;  2LAN A;  4NDB A;  4ZCU A;  1A4P A;  4E68 A;  4L9M A;  2BL0 C;  4CFR A;  3VRP A;  4DCK A;  1SCM C;  3TZ1 A;  5HLV A;  1M63 B;  1NCX A;  3WNX B;  4PHN A;  4GPL B;  3I5H C;  1FF1 A;  1QX7 A;  2M3W A;  1JF2 A;  2JT0 A;  2KI4 B;  2K0J A;  2M1K B;  1CFP A;  2KYC A;  1LIN A;  1DTL A;  3JTD C;  5AFP A;  2I2R E;  1RFJ A;  1TN4 A;  2ZN9 A;  1FI5 A;  1LKJ A;  3CR4 X;  2HQW A;  2I94 A;  3GK1 A;  3H4S E;  1DMO A;  2H61 A;  1CKK A;  1BOD A;  1TNQ A;  3LK0 A;  4GFT A;  1S5G Z;  1K2H A;  3CR5 X;  1GJY A;  3FWB A;  1LVC D;  1TCF A;  1NX1 A;  1AJ5 A;  1YX7 A;  1PSB A;  3BUM B;  2K7D A;  2KQY A;  1UHN A;  2KI4 C;  1K9K A;  4JPZ B;  1SR6 B;  2R2I A;  2ZRS A;  4ZCV A;  1QV1 A;  1CB1 A;  2L5X B;  1N0Y A;  3OHM B;  2L0P A;  5DKN A;  3CTN A;  2H61 C;  3BUW B;  3A8R A;  4MRY A;  5ER5 A;  1N2D A;  1BOC A;  3BXK A;  1TNP A;  2AMI A;  1R2U A;  3DF0 B;  2E30 A;  1YRU B;  2L50 A;  3OX5 A;  5HKZ A;  4MZK A;  2K7B A;  4DS7 A;  4M2Q A;  3QRX A;  5PAL A;  2B1U A;  1SR6 C;  3K21 A;  1CDL A;  1YRT B;  2F8P A;  2HET A;  4YGC B;  1SK6 D;  2MBX A;  1HQV A;  1Y1U A;  2KFG A;  1SNL A;  1LXF C;  1WRZ A;  4MSP A;  2WC8 A;  2ZN8 A;  3VRQ A;  1TRF A;  1NYA A;  1S1E A;  1ALW A;  5AEQ A;  2LHI A;  1RTP 1;  3SG5 A;  2V53 A;  3FWC A;  1JUO A;  3BQ3 A;  3RLZ A;  1GGW A;  1EL4 A;  1B1G A;  1F4O A;  1S5G Y;  2H2K A;  2MAZ A;  1MXL C;  2E6W A;  4P2Y B;  3OB1 B;  1JSA A;  2BCB A;  1QX5 B;  2M7N A;  1KFX L;  1PVB A;  1CM4 A;  1TCO B;  1JBA A;  1OMD A;  2L4I A;  2WCB A;  4N5X A;  1KSM A;  2HF5 A;  2K2A A;  4HRG A;  5FYX A;  2M7L A;  3ZNI A;  1KSO A;  2PSR A;  4WQ2 A;  2BE6 A;  2LNK A;  1ZOT B;  1BJF A;  1C07 A;  1AHR A;  4PE1 A;  1DJX A;  1SMG A;  4YGB B;  1B8R A;  1XK4 A;  4MVF A;  1CMG A;  3TS5 B;  2MLF C;  1K96 A;  1SYM A;  2BBM A;  3RM1 A;  1B7T Z;  3D10 A;  4YI9 A;  2OPO A;  1KK8 C;  1NCY A;  1SL8 A;  2JQ6 A;  2SAS A;  4PHM A;  1OMV A;  4MRX A;  5CSF A;  1RWY A;  1CMF A;  2M49 B;  3HCM A;  2F3Z A;  2KGR A;  2ZNE A;  2VRG A;  4CID A;  1XK4 C;  1KQM C;  2Q91 A;  1QTX A;  1NUB A;  3SG4 A;  3TS5 C;  3BUO B;  4IL1 A;  5D69 A;  2CXJ A;  2KAY A;  1PK0 D;  1OSA A;  5DKQ A;  2JWW A;  2K8M B;  4USL A;  4NQG A;  1DJH A;  1J55 A;  1DJY A;  1L7Z A;  1M31 A;  1ZUZ A;  1UUR A;  1ODB A;  1A75 A;  2PAL A;  1CFC A;  5F6T A;  3JVT B;  1SRA A;  2BBN A;  1IWQ A;  1YVL A;  2OS8 B;  1CFF A;  3A4U B;  2WCF A;  1V1G A;  1UHH A;  4GGN A;  4CLN A;  3PLF B;  2KOT A;  3AKB A;  1CDM A;  1F4Q A;  1QAS A;  1DJI A;  2SCP A;  2MLE C;  4XYN A;  1XVJ A;  4FTG A;  1CNP A;  1DJG A;  3SIB A;  4I5J A;  1MUX A;  1XA5 A;  2G2B A;  3BOW A;  2F2P A;  2LMU A;  4BY4 A;  1H8B A;  1YUR A;  4PE7 A;  1RRO A;  2KFH A;  2JRF A;  2JTZ A;  1B7T Y;  2PMY A;  3JVT C;  1DJW A;  3SG3 A;  1IKU A;  1SW8 A;  2OS8 C;  1RK9 A;  3NSO A;  2M8U A;  2O60 A;  2F2O A;  4QJ4 B;  3TDZ A;  1F8H A;  1MF8 B;  2JT3 A;  5KTY A;  4ETO A;  1S26 D;  1KK7 Z;  3TDI A;  2KI6 C;  2KAV A;  4FQO A;  5AER A;  2CCM A;  3I5G C;  1XFX O;  2F33 A;  2FCD A;  1A2X A;  3KPX A;  3DVM A;  1UHK A;  2LE9 B;  1EG4 A;  3IQO A;  2HPS A;  2NXQ A;  2ZFD A;  1QJT A;  1CTR A;  1M39 A;  1MQ1 A;  2KI6 D;  1PVA A;  4GAO A;  1BR4 B;  1JC2 A;  1JFJ A;  2LLU A;  2PVB A;  3NXA A;  1BG1 A;  2WOS A;  1KFU S;  1SKT A;  4C0J A;  1EH2 A;  1OZS A;  2P6B B;  1E8A A;  4CFQ A;  3NSL A;  3DVE A;  1VRK A;  3O4Y A;  3PFV A;  1QLK A;  3LL8 B;  4OR9 B;  4PCW A;  3VRN A;  1IG5 A;  2K61 A;  1NSH A;  3KEV A;  5JJG A;  3NSI A;  1WLZ A;  1OE9 B;  1NCZ A;  1SCV A;  3O78 A;  5JOL A;  4TNC A;  2JXC A;  2DOQ A;  2BKI B;  3KF9 A;  2L4H A;  3F45 A;  4MBE A;  3EKJ A;  2K7O A;  1J7O A;  1Q80 A;  1F55 A;  1AJ4 A;  1KK7 Y;  4UPG A;  1SL7 A;  4U8D A;  2LM5 A;  2LVV A;  3PAL A;  2M1U A;  1B4C A;  1PUL A;  1TNX A;  2FJU B;  4I5K A;  1K94 A;  1M45 A;  3PN7 B;  3VRO A;  1MHO A;  1TIZ A;  3E3R A;  3WHT B;  2KBM A;  3DD4 A;  3WXA A;  3EKH A;  2JC2 A;  2OTG B;  3EVU A;  3TUY B;  1Y1A A;  5K89 A;  2LVI A;  4GGF A;  1KK8 B;  1B8C A;  2CTN A;  4PE0 A;  3VRR A;  1OMR A;  3AAJ A;  1PSR A;  1QS7 A;  1QXP A;  1BR1 B;  3PN7 C;  1NX0 A;  1Y0V H;  1KQM B;  4BY5 A;  2ZKM X;  2I7A A;  2PAS A;  5KSZ A;  2OTG C;  1K95 A;  3SG6 A;  3TUY C;  4N1F A;  1S3P A;  1XFU O;  1NP8 A;  2Y4Q A;  4R1E A;  1A03 A;  3GK4 X;  4HRE E;  4PE4 A;  2O5G A;  3GK2 A;  2D8N A;  1DF0 B;  1DF0 A;  4OCI A;  3CLN A;  2AAO A;  1QVI Z;  1WRL A;  2CNP A;  2KSP A;  4AQJ A;  1B47 A;  3PAT A;  1MR8 A;  2EGD A;  4AOM A;  3GOF A;  2BCX A;  1CDN A;  2EHB A;  4XJK A;  1WDC B;  2LP2 A;  1J1D A;  1MWN A;  1LA3 A;  1CLB A;  2L51 A;  2LMV A;  4YRU A;  5HYD A;  1IQ3 A;  1K9P A;  1QIW A;  1XYD A;  1NX3 A;  1A75 B;  1YUS A;  1YUU A;  3WHU B;  1RJV A;  1A29 A;  2LLS A;  4AQI A;  1FPW A;  1NX2 A;  1IJ6 A;  1LA0 A;  4C0L A;  1WLM A;  4ORB B;  2JOJ A;  2M29 A;  1YTZ C;  4NDD A;  3EK7 A;  2BCA A;  2LP3 A;  2JU0 A;  5B8I B;  2LUX A;  3ICB A;  1WDC C;  1BF5 A;  3CZT X;  1XFY O;  3I5F B;  2KNE A;  2KYF A;  1BU3 A;  1S36 A;  3BOW B;  3IF7 A;  1J7R A;  4P5O E;  5CSJ A;  3I5G B;  5ER4 X;  1PAL A;  3LLE A;  4Q04 A;  2KGB C;  1J7Q A;  2L98 A;  1J1E A;  1S6I A;  1XFV O;  2KFF A;  2MRD A;  1ZFS A;  1J7P A;  1QAT A;  2ZRT A;  3SG7 A;  1C7V A;  2A4J A;  2BE4 A;  2WOR A;  5IBW A;  1REC A;  3D0Y A;  5I2Q A;  1CLL A;  2GGM A;  2NLN A;  1AP4 A;  4DIR A;  1YX8 A;  1EXR A;  5KU1 A;  2ZND A;  2JNF A;  3I5F C;  1QVI Y;  1XFW O;  2LHL A;  2M9G A;  1Y1X A;  2WND A;  3DVJ A;  1IJ5 A;  5D7F A;  1NPQ A;  1UWO A;  5G08 A;  4D1E A;  4WQ3 A;  1G8I A;  1K9U A;  2NCO A;  1SL9 A;  4OKH A;  4N1G A;  3IQQ A;  1QLS A;  1S6J A;  1IH0 A;  1K93 D;  1BLQ A;  2FCE A;  2FOT A;  1B9A A;  2GV5 A;  1KCY A;  1YR5 A;  4YI8 A;  1MXE A;  4ORA B;  3OX6 A;  1X02 A;  1V1F A;  2Y1M A;  2QPT A;  3EVR A;  2KAX A;  1EG3 A;  2LCP A;  3MSE B;  4I5L B;  3PM8 A;  3BYA A;  2LC5 A;  2MA2 A;  1TNW A;  1D1O A;  1GQM A;  2Y1N A;  3OB2 B;  4YBH B;  2NZ0 A;  2Y5I A;  1DJZ A;  1KFU L;  1JF0 A;  3C1V A;  3I5I B;  4A4B A;  1IGV A;  1GGZ A;  1UHI A;  2JTT A;  2JZI A;  4M2P A;  4PHK A;  1FI6 A;  3SIA A;  2JNX A;  1NWD A;  3CWG A;  5AXI A;  1CFD A;  1ZMZ A;  1FBV A;  5CSI A;  3OP0 A;  1QX2 A;  5DKR A;  5GQQ C;  1KQV A;  2LMT A;  2KBI A;  4DUQ A;  3DF0 A;  3SJS A;  1IRJ A;  1YUT A;  4JWQ A;  1U5I B;  1U5I A;  3I5I C;  4NDC A;  2JPT A;  1F71 A;  2LV7 A;  4OVN F;  1DVI A;  1BT6 A;  2M0R A;  4QJ5 B;  3CGA A;  3LK1 A;  2CBL A;  1N65 A;  3BUN B;  1IQ5 A;  2G9B A;  3O6B A;  1W7J B;  1DGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...