4YBHB

Crystal structure of the human rage ectodomain (vc1c2 fragment) in complex with human s100a6
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Advanced glycosylation end product-specific receptor
publication title The Structure of the RAGE:S100A6 Complex Reveals a Unique Mode of Homodimerization for S100 Proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ybhB00
4MLWA 2LLTA 1U5IA 1QJTA 3E3RA 1DVIA 4PALA 2PALA 1DT7B 2LV7A 2LM5A 2M7NA 2LVJA 3O78A 1K93D 1BT6A 4GFTA 4XJKA 2K8MB 5B8IB 1FPWA 4PHNA 4YGDB 1A4PA 2BL0C 1CNPA 1ZOTB 3BOWB 3WHTB 1K9PA 2MBXA 4QJ3B 1VRKA 2CCMA 2KQ6A 1NP8A 1SL8A 1QX2A 3D0YB 3VRRA 3GK1A 4IL1A 2JPTA 1MF8B 5CSJA 4ZCVA 1DJZA 2E6WA 1NSHA 4OVNF 1CDMA 1IGVA 4N5XA 3NSIA 1YTZC 2NZ0A 1KCYA 2OS8C 2VRGA 2WCFA 1KK8B 2LNKA 3DD4A 5AANA 2JTTA 3CR4X 4R1EA 2DOQA 1KSOA 1DJGA 1WLMA 4M2QA 1CFPA 4MRYA 1DTLA 2AAOA 1GQMA 4BY4A 1R6PA 4DUQA 1OMVA 1SCMB 1B7TZ 1KFUL 2FOTA 2GGZA 2KYCA 2L0PA 2LHLA 3GOFA 1JSAA 2M0RA 1GGWA 2LHIA 1SNLA 1CDNA 1MQ1A 1QIVA 2CNPA 1QLKA 2F3ZA 2BCXA 1L7ZA 3ZNIA 2F33A 2KSPA 5DKRA 3OP0A 2E30A 1SRAA 1ZACA 3KF9A 4DS7A 1FF1A 2K7CA 1WY9A 1DJYA 3DF0B 2K7BA 3OB2B 1IQ5A 2Y1MA 4YGCB 1NYAA 3O2PA 1J7OA 1CB1A 3ZWHA 1M45A 2OTGB 1LVCD 2LC5A 1BR1B 1PSRA 1RJVA 4WQ3A 5HLVA 1SCMC 4ORAB 1AUIB 1F54A 1K8UA 1Y1XA 1KK7Z 1UHHA 1G4YR 5DKQA 2K0JA 2H61A 2BKHB 2IS9A 2R2IA 2ISDA 4C0LA 1IQ3A 4ETOA 2M3WA 2ZRSA 2L50A 1NCYA 3SG5A 1BJFA 2G9BA 4DIRA 1OE9B 4ZCUA 3KEVA 2PASA 1KFUS 1PVBA 4CPVA 1N0YA 2M1KB 1LA3A 1EG3A 3EK4A 2EC6B 1YRUB 1CFDA 2Y4QA 1CMGA 4ICBA 4D1EA 4PHMA 4TNCA 2LVIA 2HQWA 5ER4X 4MVFA 3H4SE 4MSPA 5HKYA 2CXJA 4PCWA 4Q04A 2Q4UA 2OTGC 1WDCB 3OX5A 2LVVA 2ZRTA 4L9MA 3SJSA 4E68A 5CSNA 1SL9A 4YRUA 1J7RA 1ODBA 1S36A 4HREE 1F70A 1MHOA 1IKUA 3HCMA 3DVKA 1F8HA 1A75B 3OB1B 3LCPC 1B1GA 2OPOA 3GK2A 3I5GB 2M1UA 2CT9A 1XK4A 1UHKA 1KK7Y 2TN4A 2H2KA 5ER5A 3BYAA 2MJWB 1TN4A 1GGZA 2I94A 2MLEC 1F55A 2BBNA 1QATA 2BL0B 1MWNA 2LE9B 4ORBB 3SIAA 3FWBA 4JPZB 4YGEB 3JTDB 2PRUA 2HETA 1WDCC 1AJ4A 1CTRA 3SG2A 1AHRA 1C7WA 1QS7A 2K2AA 2JNXA 2MAZA 1SBJA 4YI8A 2MA2A 4AOMA 2ZN8A 1D1OA 2OS8B 1M46A 3EK8A 3MSEB 1A2XA 2BECA 4PE1A 2JWWA 2JU0A 1RK9A 3I5GC 1DF0A 2O60A 5TNCA 5AFPA 2I2RE 3NSOA 1PRWA 2AUCA 2HQ8A 1N2DA 1Y0VH 1TOPA 3FWCA 1CDPA 1K96A 1LKJA 2O5GA 2NCPA 2JQ6A 1AVSA 3M0WA 1YUSA 3DVMA 4OCIA 2WCBA 3JTDC 3QRXA 1OMDA 4ORCB 1U5IB 4CIDA 3I5HC 2Q91A 3TS5B 1RFJA 2K2FA 1SCVA 4XJKB 3I5FC 1BG1A 1NIWA 4BY5A 2L4HA 3IF7A 1B8RA 3LK1A 4GNKB 5HLOA 4UPGA 1YX8A 2CBLA 3RM1A 1K9KA 3CLNA 2EHBA 2L5XB 1RTP1 2LMUA 1SW8A 5BPJA 1JBAA 3SG3A 1M63B 2WORA 3PFVA 2L51A 3TUYC 1KSMA 4DCKA 4N1FA 1MXEA 3CWGA 1V1GA 1TNPA 4OV2A 1XO5A 5G08A 2ZN9A 4QJ4B 1LXFC 2KI6C 4PE4A 1WRKA 1W7JB 1WLZA 2AMIA 2Y1NA 3AKAA 4PHKA 1IJ5A 2KFFA 2QACA 1TCFA 2KAYA 2Y5IA 3SG4A 3TS5C 4FTGA 2I7AA 1PSBA 3AAJA 1J7PA 1M31A 1IWQA 1BODA 2L4IA 4F0ZB 1R2UA 2KDHA 1IRJA 1QV0A 2HF5A 5CSIA 4A4CA 2BE6A 4JQ0D 1CLLA 2JNFA 2M9GA 1XFYO 5FYXA 1AK8A 1AP4A 3KPXA 3WHUB 2WOSA 1UUSA 1F4QA 4GGFA 1YVHA 1S6IA 2F3YA 1YURA 4GPLB 4P2YB 1X02A 1HT9A 4AQIA 3ICBA 4NDDA 1NX1A 4PDZA 1J1EA 1H8BA 1UWOA 1K9UA 4I5KA 4I5NB 3CR5X 2M7LA 2KFHA 1EXRA 1DGUA 3TDIA 1AJ5A 3LK0A 1EJ3A 4FQOA 4MZKA 1K94A 1MUXA 1N65A 1J1DA 1B47A 3KO0A 4NDCA 4U8DA 1SPYA 3HX4A 2K7DA 1B9AA 4YBHB 3GK4X 1NX3A 1OZSA 1DJWA 1PVAA 1QXPA 2LANA 4USLA 5I2OA 1FBVA 3I5IB 2KNEA 5AERA 1YUUA 2ZNEA 1QX7A 3EVUA 3VRNA 1XFZO 3EVVA 1SK6D 1LINA 1KFXS 1CLBA 1XYDA 1TNWA 2F8PA 2MRDA 4AQJA 2H61C 1XVJA 1TCOB 1G8IA 1S6CA 1Y1UA 1CLMA 1YUTA 4GUKA 4P5OE 2KFGA 1CM4A 1SKTA 1SR6C 4GAOA 2PSRA 3SIBA 3TZ1A 2COLB 5KSZA 1CMFA 1JF0A 3D10A 2I18A 1NPQA 1QVIZ 1BU3A 3I5HB 2JRFA 3NSLA 2KI6D 1DJHA 2JZIA 1TNQA 2M49B 2QPTA 3I5FB 1NCXA 2LAPA 1CFFA 1B8LA 1IG5A 2MHHA 5I2QA 2LCPA 2KYFA 1KQMB 1K90D 1DMOA 4MZLA 3WNXB 1CDLA 1TRFA 4HRGA 3I5IC 1BLQA 1K2HA 1WRZA 5HKWA 2KBIA 2KBMA 1YVLA 1OMRA 2D8NA 3TUYB 5KTYA 2KAVA 3A4UB 5CPVA 1PULA 2JTZA 3LL8B 4A4BA 1B8CA 2BKIB 2LUCA 3NSKA 3VRPA 3BUXB 2JULA 1L2OB 1JWDA 1F4OA 1K95A 3BUNB 1EL4A 3BOWA 4MZJA 1XK4C 2LMVA 1FI6A 1W7IB 2LLUA 1UURA 2PMYA 3D0YA 4I5JA 2EGDA 5JOLA 1FI5A 1TIZA 3BUWB 2CTNA 2WNDA 3O6BA 2JT3A 1YR5A 2PVBA 4GGNA 5AXIA 2JT0A 2MLFC 5I8NA 1QVIY 3CS1A 3DVJA 1J55A 1KQMC 1OQPA 4NQGA 3CGAA 1ALVA 1BR4B 1CM1A 2P6BB 4OR9B 1S5GZ 1OSAA 4PHJA 3CZTX 4M2OA 2BCAA 3F45A 4QJ5B 2M29A 1XFWO 5D69A 1IJ6A 1HQVA 3A8RA 3OHMB 1SYMA 1UHNA 2ZFDA 3PM8A 1L2OC 5KU1A 1CKKA 3FIAA 3IQOA 4C0KA 2KAXA 1M39A 4N1GA 3KHEA 1UHJA 1EH2A 4C0JA 1A29A 2G2BA 2LMTA 1BF5A 1WRLA 1EG4A 4M2PA 2NCOA 2JOJA 2RGIA 1BOCA 1NWDA 5F6TA 1Q80A 3FS7A 2K61A 1KWOB 1OOJA 1SMGA 3DF0A 3EK7A 4MRXA 2F2OA 3DVEA 1FW4A 3EKJA 4YI9A 3PATA 1QIWA 1TTXA 3SG7A 5IBWA 2M8UA 1S6JA 3CTNA 2WC8A 4HRHA 3O4YA 5DKNA 1XFVO 2FCDA 5I2LA 1GJYA 2F2PA 5CSFA 2KGRA 1RECA 2JXLA 3CR2A 1V1FA 1KFXL 1ZMZA 1QX5B 1LA0A 4WRIA 5HYDA 5PALA 3JVTB 2M97A 4MN0A 1QLSA 4WQ2A 2A4JA 2NXQA 2LP3A 3LLEA 1KK8C 5J3XA 2KGBC 2JC2A 4YGBB 2K7OA 3PSRA 1S5GY 3RLZA 4CLNA 3PN7B 2V53A 2JT8A 3VROA 3VRQA 3WXAA 1SR6B 1CFCA 1QTXA 1H4BA 4OKHA 1S1EA 5HKZA 1S3PA 1KWOC 3PALA 1A03A 2NLNA 3BUMB 2LUXA 1E8AA 1YX7A 1C07A 1Y1AA 1JFKA 2L98A 1OZOA 2L2EA 2LP2A 4YGAA 1C7VA 3TDZA 1B7TY 1RROA 3AKBA 1TNXA 3AAKA 2SASA 3NXAA 4HSZA 1SL7A 2KI4B 1B4CA 3IQQA 4JWQA 1XFXO 2FJUB 1DJXA 2BCBA 2KQYA 1F71A 2B1UA 3EVRA 2GGMA 2ZKMX 3JVTC 4PE0A 1NX2A 5D7FA 1JUOA 1A75A 3C1VA 4XYNA 3BQ3A 3PN7C 1PALA 4CFRA 4CFQA 4PE7A 1ZFSA 1PK0D 1S26D 3EKHA 4NDBA 3VGOA 2ZNDA 2GV5A 4MBEA 1IH0A 4GBAA 5K89A 1J7QA 1ALWA 3K21A 4GGFC 2KOTA 1JC2A 1NCZA 1XFUO 1UHIA 4MEWA 2BE4A 1DJIA 1KQVA 3PLFB 3OX6A 2EC6C 1NX0A 2KI4C 1MR8A 3BUOB 2WCEA 1G33A 4I5LB 2BBMA 2FCEA 1UP5A 5AEQA 1NUBA 1MXLC 1QV1A 1BMOA 1RWYA 2HPSA 5GQQC 1QASA 4DRWA 1YRTB 3TDUA 1DGVA 2LLSA 2KHNA 1ZUZA 1Y6WA 3SG6A 5JJGA 2JXCA 1DF0B 1SY9A 1JF2A 2SCPA 2LVKA 1JFJA 1XA5A 3BXKA
chains in the Genus database with same CATH superfamily
4MLWA 2LLTA 1U5IA 1QJTA 3E3RA 1DVIA 4PALA 2PALA 1DT7B 2LV7A 2LM5A 2M7NA 2LVJA 3O78A 1K93D 1BT6A 1Z4HA 4GFTA 2K8MB 4XJKA 5B8IB 1FPWA 4PHNA 4YGDB 1A4PA 2BL0C 1CNPA 1ZOTB 3BOWB 3WHTB 1K9PA 2MBXA 4QJ3B 1VRKA 2CCMA 2GTEA 2KQ6A 1NP8A 3CABA 1SL8A 1QX2A 3D0YB 3VRRA 3GK1A 5FI6A 4IL1A 2JPTA 1MF8B 5CSJA 4ZCVA 3BFHA 1DJZA 2E6WA 1NSHA 4OVNF 1CDMA 1IGVA 4N5XA 3NSIA 1YTZC 2NZ0A 3D78A 2OS8C 2VRGA 2WCFA 1KK8B 2LNKA 2PQLA 3DD4A 2JTTA 3CR4X 3CYZA 2DOQA 1KSOA 1DJGA 1WLMA 4M2QA 4PDZA 4R1EA 1CFPA 4MRYA 1DTLA 2AAOA 1GQMA 4BY4A 1R6PA 4DUQA 1OMVA 1SCMB 1B7TZ 1KFUL 2FOTA 2GGZA 2KYCA 2L0PA 2LHLA 3GOFA 1JSAA 2M0RA 1GGWA 2LHIA 1SNLA 4IJ7A 1CDNA 1MQ1A 1QIVA 2CNPA 1QLKA 2F3ZA 2BCXA 3NGVA 2WC6A 1L7ZA 3V2LA 3ZNIA 2F33A 2KSPA 4P5OE 5DKRA 3OP0A 2E30A 1SRAA 1ZACA 3KF9A 4DS7A 3SS3A 1FF1A 2K7CA 1WY9A 1DJYA 3DF0B 1CKKA 2K7BA 3OB2B 1IQ5A 2Y1MA 4YGCB 1NYAA 3O2PA 1J7OA 1CB1A 3ZWHA 1M45A 2OTGB 1LVCD 2LC5A 1BR1B 1PSRA 1RJVA 4WQ3A 5HLVA 1SCMC 2P71A 4ORAB 1AUIB 1F54A 1K8UA 1Y1XA 1KK7Z 1UHHA 1G4YR 5DKQA 2K0JA 2H61A 2BKHB 2IS9A 2R2IA 2ISDA 4C0LA 1IQ3A 4ETOA 2M3WA 2ZRSA 2L50A 1NCYA 3SG5A 1BJFA 2G9BA 4DIRA 1OE9B 4ZCUA 3KEVA 2PASA 1KFUS 1PVBA 1DQEA 4CPVA 1N0YA 2M1KB 1LA3A 1EG3A 4F7FA 3EK4A 3D76A 4INWA 2EC6B 1YRUB 1CFDA 2KLDA 2Y4QA 4ICBA 4D1EA 1CMGA 4PHMA 4TNCA 2LVIA 2HQWA 5ER4X 3SS4A 2P70A 2QDIA 3H4SE 4MSPA 4MVFA 5HKYA 2CXJA 4PCWA 4Q04A 1XFRA 2Q4UA 2OTGC 1WDCB 3OX5A 1OW4A 2LVVA 2ZRTA 4L9MA 3SJSA 2QEOA 4E68A 5CSNA 1SL9A 4YRUA 1J7RA 1ODBA 1S36A 4HREE 1F70A 1MHOA 1IKUA 3HCMA 3R1PA 3DVKA 1F8HA 3B86A 1A75B 3OB1B 3D74A 3LCPC 1B1GA 2OPOA 3GK2A 3I5GB 2M1UA 2CT9A 1XK4A 1UHKA 1KK7Y 2TN4A 3L4AA 2H2KA 5ER5A 3BYAA 2MJWB 1TN4A 3RZSA 1GGZA 2I94A 2MLEC 1F55A 1TWOA 2BBNA 1QATA 2BL0B 1MWNA 2LE9B 4ORBB 1OOFA 1GM0A 3SIAA 3FE8A 3FWBA 4JPZB 4YGEB 3B6XA 3JTDB 2PRUA 2HETA 1WDCC 1AJ4A 1CTRA 3SG2A 1AHRA 1C7WA 1QS7A 2K2AA 2JNXA 2MAZA 1SBJA 4YI8A 2MA2A 4AOMA 2ZN8A 1D1OA 2OS8B 1M46A 3EK8A 3MSEB 3UNWA 1A2XA 2BECA 2ERBA 4PE1A 2JWWA 2JU0A 1RK9A 1P28A 3I5GC 3NHTA 1DF0A 3S0AA 2O60A 3BJHA 5TNCA 2L2CA 2WCHA 5AFPA 2I2RE 3NSOA 1PRWA 2AUCA 2HQ8A 3K1EA 1N2DA 1Y0VH 1TOPA 3FWCA 1H8BA 1CDPA 1K96A 1LKJA 2O5GA 2NCPA 2JQ6A 1AVSA 3FE9A 3M0WA 3BFBA 1YUSA 3D77A 3R1VA 1KCYA 3DVMA 4OCIA 2WCBA 3JTDC 3QRXA 1OMDA 4ORCB 1U5IB 4CIDA 3I5HC 2Q91A 3TS5B 1RFJA 2K2FA 1SCVA 4XJKB 3I5FC 1BG1A 1NIWA 3S0DA 2L4HA 4BY5A 3IF7A 1B8RA 3LK1A 4GNKB 5HLOA 3CDNA 1YX8A 4UPGA 2CBLA 3RM1A 3R72A 1K9KA 3CLNA 2EHBA 2L5XB 1RTP1 2LMUA 1SW8A 5BPJA 5D3OA 1JBAA 3SG3A 1M63B 2WORA 3PFVA 2L51A 3OGNA 3TUYC 1KSMA 4DCKA 3CZ0A 5KU1A 4N1FA 1MXEA 3CWGA 1V1GA 1TNPA 4OV2A 1XO5A 3B88A 5G08A 2ZN9A 4QJ4B 1LXFC 2KI6C 4PE4A 1WRKA 1W7JB 1WLZA 2AMIA 2Y1NA 3AKAA 4PHKA 1IJ5A 2KFFA 2QACA 1TCFA 2KAYA 2Y5IA 3SG4A 3TS5C 4FTGA 2I7AA 1PSBA 3DY9A 3AAJA 1J7PA 1M31A 1IWQA 1BODA 2BNXA 2L4IA 4F0ZB 1R2UA 2KDHA 1IRJA 1QV0A 1TUJA 1C3ZA 2HF5A 5CSIA 4A4CA 2BE6A 3NHIA 4JQ0D 1CLLA 2JNFA 2M9GA 1XFYO 5FYXA 1AK8A 1AP4A 3KPXA 2WCLA 3WHUB 1TUZA 2WOSA 1OOGA 1UUSA 1F4QA 4GGFA 1YVHA 1S6IA 2F3YA 1OOIX 1YURA 4GPLB 4P2YB 1X02A 1HT9A 4AQIA 3ICBA 3S0BA 4NDDA 1NX1A 3EG5B 1J1EA 3PJIA 2QEHA 1UWOA 1K9UA 2WC5A 3BFAA 4I5KA 4I5NB 1DC1A 3CR5X 2M7LA 2KFHA 1EXRA 1DGUA 3TDIA 1AJ5A 3LK0A 1EJ3A 3B7AA 4FQOA 4MZKA 1K94A 1MUXA 1N65A 1J1DA 1B47A 3KO0A 4NDCA 4U8DA 2WCKA 1SPYA 3IVTA 1SSEB 3HX4A 2K7DA 1B9AA 4YBHB 3GK4X 1NX3A 1OZSA 1DJWA 2KPHA 3B87A 4JD9A 5DICA 3D75A 1PVAA 1QXPA 2LANA 4USLA 5I2OA 1FBVA 3I5IB 1QWVA 2KNEA 1YUUA 2ZNEA 1QX7A 3EVUA 3VRNA 1XFZO 3EVVA 5AERA 1SK6D 1LINA 1KFXS 1CLBA 1DELA 1IIOA 1XYDA 1TNWA 2F8PA 2MRDA 4AQJA 2H61C 1XVJA 1TCOB 1G8IA 1S6CA 1Y1UA 1CLMA 1YUTA 4GUKA 4INXA 2KFGA 1CM4A 1SKTA 1SR6C 4GAOA 2PSRA 3SIBA 3TZ1A 2FJYA 5I94A 2COLB 3Q8IA 5KSZA 1CMFA 1JF0A 3O4XA 3D10A 2I18A 1NPQA 1QVIZ 1BU3A 3I5HB 2JRFA 3NSLA 2KI6D 1DJHA 2JZIA 1TNQA 2M49B 2QPTA 3I5FB 1NCXA 3L47A 2LAPA 1CFFA 1B8LA 4OZDA 1IG5A 2MHHA 5I2QA 2LCPA 2KYFA 2K60A 1KQMB 1K90D 1DMOA 4MZLA 3WNXB 1CDLA 1TRFA 1LS8A 4HRGA 3I5IC 1BLQA 1K2HA 1WRZA 5HKWA 1T14A 2KBIA 2KBMA 3L4LA 1YVLA 1OMRA 2D8NA 3TUYB 5KTYA 2KAVA 3A4UB 5CPVA 1PULA 2JTZA 3LL8B 4A4BA 5HL1A 1B8CA 2BKIB 2LUCA 3NSKA 3VRPA 3BUXB 2JULA 1L2OB 1JWDA 1F4OA 1K95A 3BUNB 1EL4A 3BOWA 4MZJA 1XK4C 2LMVA 1FI6A 5FI7A 1W7IB 2LLUA 1UURA 2PMYA 3R1OA 3D0YA 4I5JA 2EGDA 5JOLA 1FI5A 1TIZA 3BUWB 2CTNA 2WNDA 3O6BA 2JT3A 1YR5A 2PVBA 4GGNA 5AXIA 2JT0A 2MLFC 5I8NA 1OOHA 1QVIY 3CS1A 3DVJA 1J55A 1KQMC 1OQPA 4NQGA 3CGAA 3UO9A 1ALVA 2L5YA 1BR4B 3VB1A 1CM1A 2P6BB 4OR9B 1S5GZ 1OSAA 4PHJA 3CZTX 4M2OA 2BCAA 3F45A 4QJ5B 2M29A 1XFWO 2BAPA 5D69A 1IJ6A 1HQVA 3A8RA 3OHMB 1SYMA 1UHNA 2ZFDA 3PM8A 1L2OC 5AANA 3SS5A 2WCJA 3FIAA 3IQOA 4C0KA 2KAXA 3CZ1A 1M39A 3QMEA 4N1GA 3KHEA 1UHJA 1EH2A 4C0JA 1A29A 2G2BA 2LMTA 3DXLA 1BF5A 1WRLA 1EG4A 4M2PA 2NCOA 1C3YA 3S0GA 2JOJA 2RGIA 1BOCA 1NWDA 5F6TA 1Z2CB 1Q80A 3FS7A 2K61A 1KWOB 1OOJA 1SMGA 3DF0A 3EK7A 4MRXA 2F2OA 3DVEA 1FW4A 3EKJA 4YI9A 3PATA 1QIWA 1TTXA 3SG7A 5IBWA 2M8UA 1S6JA 3CTNA 2WC8A 4HRHA 3O4YA 5DKNA 1XFVO 2FCDA 3PM2A 5I2LA 1GJYA 2F2PA 5CSFA 2KGRA 1RECA 2JXLA 3CR2A 1V1FA 1KFXL 1ZMZA 4KYNA 1QX5B 1LA0A 3DZTA 4WRIA 5HYDA 5PALA 3JVTB 2M97A 4MN0A 2JPOA 1QLSA 4WQ2A 2A4JA 2NXQA 2LP3A 3LLEA 1KK8C 5J3XA 2KGBC 2JC2A 4YGBB 1W9ZA 2K7OA 3PSRA 1S5GY 3RLZA 4CLNA 3CZ2A 3PN7B 3FE6A 2V53A 2QEBA 2JT8A 3VROA 3VRQA 3WXAA 1SR6B 1CFCA 1QTXA 2PYQA 1H4BA 4OKHA 3D73A 5EL2A 1S1EA 5HKZA 1S3PA 1KWOC 3PALA 1A03A 2NLNA 3BUMB 2LUXA 4JKTA 1E8AA 1YX7A 1C07A 1Y1AA 1JFKA 2L98A 1OZOA 2L2EA 2LP2A 2YGUA 4YGAA 1C7VA 3TDZA 1B7TY 1RROA 3AKBA 1TNXA 3AAKA 2SASA 3NXAA 4HSZA 1SL7A 2KI4B 3N7HA 1B4CA 3IQQA 4JWQA 1XFXO 2FJUB 1DJXA 2BCBA 1DEKA 2KQYA 1F71A 2B1UA 1ORGA 3EVRA 2GGMA 2H8VA 2ZKMX 3JVTC 4PE0A 1NX2A 5D7FA 1JUOA 1A75A 3C1VA 4XYNA 3BQ3A 3PN7C 1PALA 4CFRA 4CFQA 4PE7A 1ZFSA 1PK0D 1S26D 3EKHA 4NDBA 2QEVA 2ZNDA 3VGOA 4FQTA 2GV5A 4MBEA 3S0FA 1IH0A 4GBAA 5K89A 1J7QA 1ALWA 3K21A 4GGFC 2KOTA 1JC2A 3S0EA 1NCZA 1XFUO 1UHIA 4MEWA 2BE4A 1DJIA 1KQVA 3PLFB 3OX6A 2EC6C 1NX0A 2KI4C 1MR8A 3BUOB 2WCEA 1G33A 3OBVA 3DYEA 2BBMA 4I5LB 2FCEA 1UP5A 5AEQA 1NUBA 1MXLC 1QV1A 1BMOA 1RWYA 2HPSA 2KLEA 1QASA 5GQQC 4DRWA 1YRTB 3TDUA 1DGVA 4PT1A 5FI2A 2LLSA 2KHNA 1ZUZA 1Y6WA 3SG6A 5JJGA 2JXCA 1DF0B 1SY9A 1JF2A 2SCPA 2LVKA 1JFJA 2WCMA 1XA5A 3BXKA
chains in the Genus database with same CATH topology
4MLWA 2LLTA 1U5IA 1QJTA 3E3RA 1DVIA 4PALA 2PALA 1DT7B 2LV7A 2LM5A 2M7NA 2LVJA 3O78A 1K93D 1BT6A 4GFTA 4XJKA 2K8MB 5B8IB 1FPWA 4PHNA 4YGDB 1A4PA 2BL0C 1CNPA 1ZOTB 3BOWB 3WHTB 1K9PA 2MBXA 4QJ3B 1VRKA 2CCMA 2KQ6A 1NP8A 1SL8A 1QX2A 3D0YB 3VRRA 3GK1A 4IL1A 2JPTA 1MF8B 5CSJA 4ZCVA 1DJZA 2E6WA 1NSHA 4OVNF 1CDMA 1IGVA 4N5XA 3NSIA 1YTZC 2NZ0A 1KCYA 2OS8C 2VRGA 2WCFA 1KK8B 2LNKA 3DD4A 5AANA 2JTTA 3CR4X 4R1EA 2DOQA 1KSOA 1DJGA 1WLMA 4M2QA 1CFPA 4MRYA 1DTLA 2AAOA 1GQMA 4BY4A 1R6PA 4DUQA 1OMVA 1SCMB 1B7TZ 1KFUL 2FOTA 2GGZA 2KYCA 2L0PA 2LHLA 3GOFA 1JSAA 2M0RA 1GGWA 2LHIA 1SNLA 1CDNA 1MQ1A 1QIVA 2CNPA 1QLKA 2F3ZA 2BCXA 1L7ZA 3ZNIA 2F33A 2KSPA 5DKRA 3OP0A 2E30A 1SRAA 1ZACA 3KF9A 4DS7A 1FF1A 2K7CA 1WY9A 1DJYA 3DF0B 2K7BA 3OB2B 1IQ5A 2Y1MA 4YGCB 1NYAA 3O2PA 1J7OA 1CB1A 3ZWHA 1M45A 2OTGB 1LVCD 2LC5A 1BR1B 1PSRA 1RJVA 4WQ3A 5HLVA 1SCMC 4ORAB 1AUIB 1F54A 1K8UA 1Y1XA 1KK7Z 1UHHA 1G4YR 5DKQA 2K0JA 2H61A 2BKHB 2IS9A 2R2IA 2ISDA 4C0LA 1IQ3A 4ETOA 2M3WA 2ZRSA 2L50A 1NCYA 3SG5A 1BJFA 2G9BA 4DIRA 1OE9B 4ZCUA 3KEVA 2PASA 1KFUS 1PVBA 4CPVA 1N0YA 2M1KB 1LA3A 1EG3A 3EK4A 2EC6B 1YRUB 1CFDA 2Y4QA 1CMGA 4ICBA 4D1EA 4PHMA 4TNCA 2LVIA 2HQWA 5ER4X 4MVFA 3H4SE 4MSPA 5HKYA 2CXJA 4PCWA 4Q04A 2Q4UA 2OTGC 1WDCB 3OX5A 2LVVA 2ZRTA 4L9MA 3SJSA 4E68A 5CSNA 1SL9A 4YRUA 1J7RA 1ODBA 1S36A 4HREE 1F70A 1MHOA 1IKUA 3HCMA 3DVKA 1F8HA 1A75B 3OB1B 3LCPC 1B1GA 2OPOA 3GK2A 3I5GB 2M1UA 2CT9A 1XK4A 1UHKA 1KK7Y 2TN4A 2H2KA 5ER5A 3BYAA 2MJWB 1TN4A 1GGZA 2I94A 2MLEC 1F55A 2BBNA 1QATA 2BL0B 1MWNA 2LE9B 4ORBB 3SIAA 3FWBA 4JPZB 4YGEB 3JTDB 2PRUA 2HETA 1WDCC 1AJ4A 1CTRA 3SG2A 1AHRA 1C7WA 1QS7A 2K2AA 2JNXA 2MAZA 1SBJA 4YI8A 2MA2A 4AOMA 2ZN8A 1D1OA 2OS8B 1M46A 3EK8A 3MSEB 1A2XA 2BECA 4PE1A 2JWWA 2JU0A 1RK9A 3I5GC 1DF0A 2O60A 5TNCA 5AFPA 2I2RE 3NSOA 1PRWA 2AUCA 2HQ8A 1N2DA 1Y0VH 1TOPA 3FWCA 1CDPA 1K96A 1LKJA 2O5GA 2NCPA 2JQ6A 1AVSA 3M0WA 1YUSA 3DVMA 4OCIA 2WCBA 3JTDC 3QRXA 1OMDA 4ORCB 1U5IB 4CIDA 3I5HC 2Q91A 3TS5B 1RFJA 2K2FA 1SCVA 4XJKB 3I5FC 1BG1A 1NIWA 4BY5A 2L4HA 3IF7A 1B8RA 3LK1A 4GNKB 5HLOA 4UPGA 1YX8A 2CBLA 3RM1A 1K9KA 3CLNA 2EHBA 2L5XB 1RTP1 2LMUA 1SW8A 5BPJA 1JBAA 3SG3A 1M63B 2WORA 3PFVA 2L51A 3TUYC 1KSMA 4DCKA 4N1FA 1MXEA 3CWGA 1V1GA 1TNPA 4OV2A 1XO5A 5G08A 2ZN9A 4QJ4B 1LXFC 2KI6C 4PE4A 1WRKA 1W7JB 1WLZA 2AMIA 2Y1NA 3AKAA 4PHKA 1IJ5A 2KFFA 2QACA 1TCFA 2KAYA 2Y5IA 3SG4A 3TS5C 4FTGA 2I7AA 1PSBA 3AAJA 1J7PA 1M31A 1IWQA 1BODA 2L4IA 4F0ZB 1R2UA 2KDHA 1IRJA 1QV0A 2HF5A 5CSIA 4A4CA 2BE6A 4JQ0D 1CLLA 2JNFA 2M9GA 1XFYO 5FYXA 1AK8A 1AP4A 3KPXA 3WHUB 2WOSA 1UUSA 1F4QA 4GGFA 1YVHA 1S6IA 2F3YA 1YURA 4GPLB 4P2YB 1X02A 1HT9A 4AQIA 3ICBA 4NDDA 1NX1A 4PDZA 1J1EA 1H8BA 1UWOA 1K9UA 4I5KA 4I5NB 3CR5X 2M7LA 2KFHA 1EXRA 1DGUA 3TDIA 1AJ5A 3LK0A 1EJ3A 4FQOA 4MZKA 1K94A 1MUXA 1N65A 1J1DA 1B47A 3KO0A 4NDCA 4U8DA 1SPYA 3HX4A 2K7DA 1B9AA 4YBHB 3GK4X 1NX3A 1OZSA 1DJWA 1PVAA 1QXPA 2LANA 4USLA 5I2OA 1FBVA 3I5IB 2KNEA 5AERA 1YUUA 2ZNEA 1QX7A 3EVUA 3VRNA 1XFZO 3EVVA 1SK6D 1LINA 1KFXS 1CLBA 1XYDA 1TNWA 2F8PA 2MRDA 4AQJA 2H61C 1XVJA 1TCOB 1G8IA 1S6CA 1Y1UA 1CLMA 1YUTA 4GUKA 4P5OE 2KFGA 1CM4A 1SKTA 1SR6C 4GAOA 2PSRA 3SIBA 3TZ1A 2COLB 5KSZA 1CMFA 1JF0A 3D10A 2I18A 1NPQA 1QVIZ 1BU3A 3I5HB 2JRFA 3NSLA 2KI6D 1DJHA 2JZIA 1TNQA 2M49B 2QPTA 3I5FB 1NCXA 2LAPA 1CFFA 1B8LA 1IG5A 2MHHA 5I2QA 2LCPA 2KYFA 1KQMB 1K90D 1DMOA 4MZLA 3WNXB 1CDLA 1TRFA 4HRGA 3I5IC 1BLQA 1K2HA 1WRZA 5HKWA 2KBIA 2KBMA 1YVLA 1OMRA 2D8NA 3TUYB 5KTYA 2KAVA 3A4UB 5CPVA 1PULA 2JTZA 3LL8B 4A4BA 1B8CA 2BKIB 2LUCA 3NSKA 3VRPA 3BUXB 2JULA 1L2OB 1JWDA 1F4OA 1K95A 3BUNB 1EL4A 3BOWA 4MZJA 1XK4C 2LMVA 1FI6A 1W7IB 2LLUA 1UURA 2PMYA 3D0YA 4I5JA 2EGDA 5JOLA 1FI5A 1TIZA 3BUWB 2CTNA 2WNDA 3O6BA 2JT3A 1YR5A 2PVBA 4GGNA 5AXIA 2JT0A 2MLFC 5I8NA 1QVIY 3CS1A 3DVJA 1J55A 1KQMC 1OQPA 4NQGA 3CGAA 1ALVA 1BR4B 1CM1A 2P6BB 4OR9B 1S5GZ 1OSAA 4PHJA 3CZTX 4M2OA 2BCAA 3F45A 4QJ5B 2M29A 1XFWO 5D69A 1IJ6A 1HQVA 3A8RA 3OHMB 1SYMA 1UHNA 2ZFDA 3PM8A 1L2OC 5KU1A 1CKKA 3FIAA 3IQOA 4C0KA 2KAXA 1M39A 4N1GA 3KHEA 1UHJA 1EH2A 4C0JA 1A29A 2G2BA 2LMTA 1BF5A 1WRLA 1EG4A 4M2PA 2NCOA 2JOJA 2RGIA 1BOCA 1NWDA 5F6TA 1Q80A 3FS7A 2K61A 1KWOB 1OOJA 1SMGA 3DF0A 3EK7A 4MRXA 2F2OA 3DVEA 1FW4A 3EKJA 4YI9A 3PATA 1QIWA 1TTXA 3SG7A 5IBWA 2M8UA 1S6JA 3CTNA 2WC8A 4HRHA 3O4YA 5DKNA 1XFVO 2FCDA 5I2LA 1GJYA 2F2PA 5CSFA 2KGRA 1RECA 2JXLA 3CR2A 1V1FA 1KFXL 1ZMZA 1QX5B 1LA0A 4WRIA 5HYDA 5PALA 3JVTB 2M97A 4MN0A 1QLSA 4WQ2A 2A4JA 2NXQA 2LP3A 3LLEA 1KK8C 5J3XA 2KGBC 2JC2A 4YGBB 2K7OA 3PSRA 1S5GY 3RLZA 4CLNA 3PN7B 2V53A 2JT8A 3VROA 3VRQA 3WXAA 1SR6B 1CFCA 1QTXA 1H4BA 4OKHA 1S1EA 5HKZA 1S3PA 1KWOC 3PALA 1A03A 2NLNA 3BUMB 2LUXA 1E8AA 1YX7A 1C07A 1Y1AA 1JFKA 2L98A 1OZOA 2L2EA 2LP2A 4YGAA 1C7VA 3TDZA 1B7TY 1RROA 3AKBA 1TNXA 3AAKA 2SASA 3NXAA 4HSZA 1SL7A 2KI4B 1B4CA 3IQQA 4JWQA 1XFXO 2FJUB 1DJXA 2BCBA 2KQYA 1F71A 2B1UA 3EVRA 2GGMA 2ZKMX 3JVTC 4PE0A 1NX2A 5D7FA 1JUOA 1A75A 3C1VA 4XYNA 3BQ3A 3PN7C 1PALA 4CFRA 4CFQA 4PE7A 1ZFSA 1PK0D 1S26D 3EKHA 4NDBA 3VGOA 2ZNDA 2GV5A 4MBEA 1IH0A 4GBAA 5K89A 1J7QA 1ALWA 3K21A 4GGFC 2KOTA 1JC2A 1NCZA 1XFUO 1UHIA 4MEWA 2BE4A 1DJIA 1KQVA 3PLFB 3OX6A 2EC6C 1NX0A 2KI4C 1MR8A 3BUOB 2WCEA 1G33A 4I5LB 2BBMA 2FCEA 1UP5A 5AEQA 1NUBA 1MXLC 1QV1A 1BMOA 1RWYA 2HPSA 5GQQC 1QASA 4DRWA 1YRTB 3TDUA 1DGVA 2LLSA 2KHNA 1ZUZA 1Y6WA 3SG6A 5JJGA 2JXCA 1DF0B 1SY9A 1JF2A 2SCPA 2LVKA 1JFJA 1XA5A 3BXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MLW A;  2LLT A;  1U5I A;  1QJT A;  3E3R A;  1DVI A;  4PAL A;  2PAL A;  1DT7 B;  2LV7 A;  2LM5 A;  2M7N A;  2LVJ A;  3O78 A;  1K93 D;  1BT6 A;  4GFT A;  4XJK A;  2K8M B;  5B8I B;  1FPW A;  4PHN A;  4YGD B;  1A4P A;  2BL0 C;  1CNP A;  1ZOT B;  3BOW B;  3WHT B;  1K9P A;  2MBX A;  4QJ3 B;  1VRK A;  2CCM A;  2KQ6 A;  1NP8 A;  1SL8 A;  1QX2 A;  3D0Y B;  3VRR A;  3GK1 A;  4IL1 A;  2JPT A;  1MF8 B;  5CSJ A;  4ZCV A;  1DJZ A;  2E6W A;  1NSH A;  4OVN F;  1CDM A;  1IGV A;  4N5X A;  3NSI A;  1YTZ C;  2NZ0 A;  1KCY A;  2OS8 C;  2VRG A;  2WCF A;  1KK8 B;  2LNK A;  3DD4 A;  5AAN A;  2JTT A;  3CR4 X;  4R1E A;  2DOQ A;  1KSO A;  1DJG A;  1WLM A;  4M2Q A;  1CFP A;  4MRY A;  1DTL A;  2AAO A;  1GQM A;  4BY4 A;  1R6P A;  4DUQ A;  1OMV A;  1SCM B;  1B7T Z;  1KFU L;  2FOT A;  2GGZ A;  2KYC A;  2L0P A;  2LHL A;  3GOF A;  1JSA A;  2M0R A;  1GGW A;  2LHI A;  1SNL A;  1CDN A;  1MQ1 A;  1QIV A;  2CNP A;  1QLK A;  2F3Z A;  2BCX A;  1L7Z A;  3ZNI A;  2F33 A;  2KSP A;  5DKR A;  3OP0 A;  2E30 A;  1SRA A;  1ZAC A;  3KF9 A;  4DS7 A;  1FF1 A;  2K7C A;  1WY9 A;  1DJY A;  3DF0 B;  2K7B A;  3OB2 B;  1IQ5 A;  2Y1M A;  4YGC B;  1NYA A;  3O2P A;  1J7O A;  1CB1 A;  3ZWH A;  1M45 A;  2OTG B;  1LVC D;  2LC5 A;  1BR1 B;  1PSR A;  1RJV A;  4WQ3 A;  5HLV A;  1SCM C;  4ORA B;  1AUI B;  1F54 A;  1K8U A;  1Y1X A;  1KK7 Z;  1UHH A;  1G4Y R;  5DKQ A;  2K0J A;  2H61 A;  2BKH B;  2IS9 A;  2R2I A;  2ISD A;  4C0L A;  1IQ3 A;  4ETO A;  2M3W A;  2ZRS A;  2L50 A;  1NCY A;  3SG5 A;  1BJF A;  2G9B A;  4DIR A;  1OE9 B;  4ZCU A;  3KEV A;  2PAS A;  1KFU S;  1PVB A;  4CPV A;  1N0Y A;  2M1K B;  1LA3 A;  1EG3 A;  3EK4 A;  2EC6 B;  1YRU B;  1CFD A;  2Y4Q A;  1CMG A;  4ICB A;  4D1E A;  4PHM A;  4TNC A;  2LVI A;  2HQW A;  5ER4 X;  4MVF A;  3H4S E;  4MSP A;  5HKY A;  2CXJ A;  4PCW A;  4Q04 A;  2Q4U A;  2OTG C;  1WDC B;  3OX5 A;  2LVV A;  2ZRT A;  4L9M A;  3SJS A;  4E68 A;  5CSN A;  1SL9 A;  4YRU A;  1J7R A;  1ODB A;  1S36 A;  4HRE E;  1F70 A;  1MHO A;  1IKU A;  3HCM A;  3DVK A;  1F8H A;  1A75 B;  3OB1 B;  3LCP C;  1B1G A;  2OPO A;  3GK2 A;  3I5G B;  2M1U A;  2CT9 A;  1XK4 A;  1UHK A;  1KK7 Y;  2TN4 A;  2H2K A;  5ER5 A;  3BYA A;  2MJW B;  1TN4 A;  1GGZ A;  2I94 A;  2MLE C;  1F55 A;  2BBN A;  1QAT A;  2BL0 B;  1MWN A;  2LE9 B;  4ORB B;  3SIA A;  3FWB A;  4JPZ B;  4YGE B;  3JTD B;  2PRU A;  2HET A;  1WDC C;  1AJ4 A;  1CTR A;  3SG2 A;  1AHR A;  1C7W A;  1QS7 A;  2K2A A;  2JNX A;  2MAZ A;  1SBJ A;  4YI8 A;  2MA2 A;  4AOM A;  2ZN8 A;  1D1O A;  2OS8 B;  1M46 A;  3EK8 A;  3MSE B;  1A2X A;  2BEC A;  4PE1 A;  2JWW A;  2JU0 A;  1RK9 A;  3I5G C;  1DF0 A;  2O60 A;  5TNC A;  5AFP A;  2I2R E;  3NSO A;  1PRW A;  2AUC A;  2HQ8 A;  1N2D A;  1Y0V H;  1TOP A;  3FWC A;  1CDP A;  1K96 A;  1LKJ A;  2O5G A;  2NCP A;  2JQ6 A;  1AVS A;  3M0W A;  1YUS A;  3DVM A;  4OCI A;  2WCB A;  3JTD C;  3QRX A;  1OMD A;  4ORC B;  1U5I B;  4CID A;  3I5H C;  2Q91 A;  3TS5 B;  1RFJ A;  2K2F A;  1SCV A;  4XJK B;  3I5F C;  1BG1 A;  1NIW A;  4BY5 A;  2L4H A;  3IF7 A;  1B8R A;  3LK1 A;  4GNK B;  5HLO A;  4UPG A;  1YX8 A;  2CBL A;  3RM1 A;  1K9K A;  3CLN A;  2EHB A;  2L5X B;  1RTP 1;  2LMU A;  1SW8 A;  5BPJ A;  1JBA A;  3SG3 A;  1M63 B;  2WOR A;  3PFV A;  2L51 A;  3TUY C;  1KSM A;  4DCK A;  4N1F A;  1MXE A;  3CWG A;  1V1G A;  1TNP A;  4OV2 A;  1XO5 A;  5G08 A;  2ZN9 A;  4QJ4 B;  1LXF C;  2KI6 C;  4PE4 A;  1WRK A;  1W7J B;  1WLZ A;  2AMI A;  2Y1N A;  3AKA A;  4PHK A;  1IJ5 A;  2KFF A;  2QAC A;  1TCF A;  2KAY A;  2Y5I A;  3SG4 A;  3TS5 C;  4FTG A;  2I7A A;  1PSB A;  3AAJ A;  1J7P A;  1M31 A;  1IWQ A;  1BOD A;  2L4I A;  4F0Z B;  1R2U A;  2KDH A;  1IRJ A;  1QV0 A;  2HF5 A;  5CSI A;  4A4C A;  2BE6 A;  4JQ0 D;  1CLL A;  2JNF A;  2M9G A;  1XFY O;  5FYX A;  1AK8 A;  1AP4 A;  3KPX A;  3WHU B;  2WOS A;  1UUS A;  1F4Q A;  4GGF A;  1YVH A;  1S6I A;  2F3Y A;  1YUR A;  4GPL B;  4P2Y B;  1X02 A;  1HT9 A;  4AQI A;  3ICB A;  4NDD A;  1NX1 A;  4PDZ A;  1J1E A;  1H8B A;  1UWO A;  1K9U A;  4I5K A;  4I5N B;  3CR5 X;  2M7L A;  2KFH A;  1EXR A;  1DGU A;  3TDI A;  1AJ5 A;  3LK0 A;  1EJ3 A;  4FQO A;  4MZK A;  1K94 A;  1MUX A;  1N65 A;  1J1D A;  1B47 A;  3KO0 A;  4NDC A;  4U8D A;  1SPY A;  3HX4 A;  2K7D A;  1B9A A;  4YBH B;  3GK4 X;  1NX3 A;  1OZS A;  1DJW A;  1PVA A;  1QXP A;  2LAN A;  4USL A;  5I2O A;  1FBV A;  3I5I B;  2KNE A;  5AER A;  1YUU A;  2ZNE A;  1QX7 A;  3EVU A;  3VRN A;  1XFZ O;  3EVV A;  1SK6 D;  1LIN A;  1KFX S;  1CLB A;  1XYD A;  1TNW A;  2F8P A;  2MRD A;  4AQJ A;  2H61 C;  1XVJ A;  1TCO B;  1G8I A;  1S6C A;  1Y1U A;  1CLM A;  1YUT A;  4GUK A;  4P5O E;  2KFG A;  1CM4 A;  1SKT A;  1SR6 C;  4GAO A;  2PSR A;  3SIB A;  3TZ1 A;  2COL B;  5KSZ A;  1CMF A;  1JF0 A;  3D10 A;  2I18 A;  1NPQ A;  1QVI Z;  1BU3 A;  3I5H B;  2JRF A;  3NSL A;  2KI6 D;  1DJH A;  2JZI A;  1TNQ A;  2M49 B;  2QPT A;  3I5F B;  1NCX A;  2LAP A;  1CFF A;  1B8L A;  1IG5 A;  2MHH A;  5I2Q A;  2LCP A;  2KYF A;  1KQM B;  1K90 D;  1DMO A;  4MZL A;  3WNX B;  1CDL A;  1TRF A;  4HRG A;  3I5I C;  1BLQ A;  1K2H A;  1WRZ A;  5HKW A;  2KBI A;  2KBM A;  1YVL A;  1OMR A;  2D8N A;  3TUY B;  5KTY A;  2KAV A;  3A4U B;  5CPV A;  1PUL A;  2JTZ A;  3LL8 B;  4A4B A;  1B8C A;  2BKI B;  2LUC A;  3NSK A;  3VRP A;  3BUX B;  2JUL A;  1L2O B;  1JWD A;  1F4O A;  1K95 A;  3BUN B;  1EL4 A;  3BOW A;  4MZJ A;  1XK4 C;  2LMV A;  1FI6 A;  1W7I B;  2LLU A;  1UUR A;  2PMY A;  3D0Y A;  4I5J A;  2EGD A;  5JOL A;  1FI5 A;  1TIZ A;  3BUW B;  2CTN A;  2WND A;  3O6B A;  2JT3 A;  1YR5 A;  2PVB A;  4GGN A;  5AXI A;  2JT0 A;  2MLF C;  5I8N A;  1QVI Y;  3CS1 A;  3DVJ A;  1J55 A;  1KQM C;  1OQP A;  4NQG A;  3CGA A;  1ALV A;  1BR4 B;  1CM1 A;  2P6B B;  4OR9 B;  1S5G Z;  1OSA A;  4PHJ A;  3CZT X;  4M2O A;  2BCA A;  3F45 A;  4QJ5 B;  2M29 A;  1XFW O;  5D69 A;  1IJ6 A;  1HQV A;  3A8R A;  3OHM B;  1SYM A;  1UHN A;  2ZFD A;  3PM8 A;  1L2O C;  5KU1 A;  1CKK A;  3FIA A;  3IQO A;  4C0K A;  2KAX A;  1M39 A;  4N1G A;  3KHE A;  1UHJ A;  1EH2 A;  4C0J A;  1A29 A;  2G2B A;  2LMT A;  1BF5 A;  1WRL A;  1EG4 A;  4M2P A;  2NCO A;  2JOJ A;  2RGI A;  1BOC A;  1NWD A;  5F6T A;  1Q80 A;  3FS7 A;  2K61 A;  1KWO B;  1OOJ A;  1SMG A;  3DF0 A;  3EK7 A;  4MRX A;  2F2O A;  3DVE A;  1FW4 A;  3EKJ A;  4YI9 A;  3PAT A;  1QIW A;  1TTX A;  3SG7 A;  5IBW A;  2M8U A;  1S6J A;  3CTN A;  2WC8 A;  4HRH A;  3O4Y A;  5DKN A;  1XFV O;  2FCD A;  5I2L A;  1GJY A;  2F2P A;  5CSF A;  2KGR A;  1REC A;  2JXL A;  3CR2 A;  1V1F A;  1KFX L;  1ZMZ A;  1QX5 B;  1LA0 A;  4WRI A;  5HYD A;  5PAL A;  3JVT B;  2M97 A;  4MN0 A;  1QLS A;  4WQ2 A;  2A4J A;  2NXQ A;  2LP3 A;  3LLE A;  1KK8 C;  5J3X A;  2KGB C;  2JC2 A;  4YGB B;  2K7O A;  3PSR A;  1S5G Y;  3RLZ A;  4CLN A;  3PN7 B;  2V53 A;  2JT8 A;  3VRO A;  3VRQ A;  3WXA A;  1SR6 B;  1CFC A;  1QTX A;  1H4B A;  4OKH A;  1S1E A;  5HKZ A;  1S3P A;  1KWO C;  3PAL A;  1A03 A;  2NLN A;  3BUM B;  2LUX A;  1E8A A;  1YX7 A;  1C07 A;  1Y1A A;  1JFK A;  2L98 A;  1OZO A;  2L2E A;  2LP2 A;  4YGA A;  1C7V A;  3TDZ A;  1B7T Y;  1RRO A;  3AKB A;  1TNX A;  3AAK A;  2SAS A;  3NXA A;  4HSZ A;  1SL7 A;  2KI4 B;  1B4C A;  3IQQ A;  4JWQ A;  1XFX O;  2FJU B;  1DJX A;  2BCB A;  2KQY A;  1F71 A;  2B1U A;  3EVR A;  2GGM A;  2ZKM X;  3JVT C;  4PE0 A;  1NX2 A;  5D7F A;  1JUO A;  1A75 A;  3C1V A;  4XYN A;  3BQ3 A;  3PN7 C;  1PAL A;  4CFR A;  4CFQ A;  4PE7 A;  1ZFS A;  1PK0 D;  1S26 D;  3EKH A;  4NDB A;  3VGO A;  2ZND A;  2GV5 A;  4MBE A;  1IH0 A;  4GBA A;  5K89 A;  1J7Q A;  1ALW A;  3K21 A;  4GGF C;  2KOT A;  1JC2 A;  1NCZ A;  1XFU O;  1UHI A;  4MEW A;  2BE4 A;  1DJI A;  1KQV A;  3PLF B;  3OX6 A;  2EC6 C;  1NX0 A;  2KI4 C;  1MR8 A;  3BUO B;  2WCE A;  1G33 A;  4I5L B;  2BBM A;  2FCE A;  1UP5 A;  5AEQ A;  1NUB A;  1MXL C;  1QV1 A;  1BMO A;  1RWY A;  2HPS A;  5GQQ C;  1QAS A;  4DRW A;  1YRT B;  3TDU A;  1DGV A;  2LLS A;  2KHN A;  1ZUZ A;  1Y6W A;  3SG6 A;  5JJG A;  2JXC A;  1DF0 B;  1SY9 A;  1JF2 A;  2SCP A;  2LVK A;  1JFJ A;  1XA5 A;  3BXK A; 
#chains in the Genus database with same CATH topology
 4MLW A;  2LLT A;  1U5I A;  1QJT A;  3E3R A;  1DVI A;  4PAL A;  2PAL A;  1DT7 B;  2LV7 A;  2LM5 A;  2M7N A;  2LVJ A;  3O78 A;  1K93 D;  1BT6 A;  1Z4H A;  4GFT A;  2K8M B;  4XJK A;  5B8I B;  1FPW A;  4PHN A;  4YGD B;  1A4P A;  2BL0 C;  1CNP A;  1ZOT B;  3BOW B;  3WHT B;  1K9P A;  2MBX A;  4QJ3 B;  1VRK A;  2CCM A;  2GTE A;  2KQ6 A;  1NP8 A;  3CAB A;  1SL8 A;  1QX2 A;  3D0Y B;  3VRR A;  3GK1 A;  5FI6 A;  4IL1 A;  2JPT A;  1MF8 B;  5CSJ A;  4ZCV A;  3BFH A;  1DJZ A;  2E6W A;  1NSH A;  4OVN F;  1CDM A;  1IGV A;  4N5X A;  3NSI A;  1YTZ C;  2NZ0 A;  3D78 A;  2OS8 C;  2VRG A;  2WCF A;  1KK8 B;  2LNK A;  2PQL A;  3DD4 A;  2JTT A;  3CR4 X;  3CYZ A;  2DOQ A;  1KSO A;  1DJG A;  1WLM A;  4M2Q A;  4PDZ A;  4R1E A;  1CFP A;  4MRY A;  1DTL A;  2AAO A;  1GQM A;  4BY4 A;  1R6P A;  4DUQ A;  1OMV A;  1SCM B;  1B7T Z;  1KFU L;  2FOT A;  2GGZ A;  2KYC A;  2L0P A;  2LHL A;  3GOF A;  1JSA A;  2M0R A;  1GGW A;  2LHI A;  1SNL A;  4IJ7 A;  1CDN A;  1MQ1 A;  1QIV A;  2CNP A;  1QLK A;  2F3Z A;  2BCX A;  3NGV A;  2WC6 A;  1L7Z A;  3V2L A;  3ZNI A;  2F33 A;  2KSP A;  4P5O E;  5DKR A;  3OP0 A;  2E30 A;  1SRA A;  1ZAC A;  3KF9 A;  4DS7 A;  3SS3 A;  1FF1 A;  2K7C A;  1WY9 A;  1DJY A;  3DF0 B;  1CKK A;  2K7B A;  3OB2 B;  1IQ5 A;  2Y1M A;  4YGC B;  1NYA A;  3O2P A;  1J7O A;  1CB1 A;  3ZWH A;  1M45 A;  2OTG B;  1LVC D;  2LC5 A;  1BR1 B;  1PSR A;  1RJV A;  4WQ3 A;  5HLV A;  1SCM C;  2P71 A;  4ORA B;  1AUI B;  1F54 A;  1K8U A;  1Y1X A;  1KK7 Z;  1UHH A;  1G4Y R;  5DKQ A;  2K0J A;  2H61 A;  2BKH B;  2IS9 A;  2R2I A;  2ISD A;  4C0L A;  1IQ3 A;  4ETO A;  2M3W A;  2ZRS A;  2L50 A;  1NCY A;  3SG5 A;  1BJF A;  2G9B A;  4DIR A;  1OE9 B;  4ZCU A;  3KEV A;  2PAS A;  1KFU S;  1PVB A;  1DQE A;  4CPV A;  1N0Y A;  2M1K B;  1LA3 A;  1EG3 A;  4F7F A;  3EK4 A;  3D76 A;  4INW A;  2EC6 B;  1YRU B;  1CFD A;  2KLD A;  2Y4Q A;  4ICB A;  4D1E A;  1CMG A;  4PHM A;  4TNC A;  2LVI A;  2HQW A;  5ER4 X;  3SS4 A;  2P70 A;  2QDI A;  3H4S E;  4MSP A;  4MVF A;  5HKY A;  2CXJ A;  4PCW A;  4Q04 A;  1XFR A;  2Q4U A;  2OTG C;  1WDC B;  3OX5 A;  1OW4 A;  2LVV A;  2ZRT A;  4L9M A;  3SJS A;  2QEO A;  4E68 A;  5CSN A;  1SL9 A;  4YRU A;  1J7R A;  1ODB A;  1S36 A;  4HRE E;  1F70 A;  1MHO A;  1IKU A;  3HCM A;  3R1P A;  3DVK A;  1F8H A;  3B86 A;  1A75 B;  3OB1 B;  3D74 A;  3LCP C;  1B1G A;  2OPO A;  3GK2 A;  3I5G B;  2M1U A;  2CT9 A;  1XK4 A;  1UHK A;  1KK7 Y;  2TN4 A;  3L4A A;  2H2K A;  5ER5 A;  3BYA A;  2MJW B;  1TN4 A;  3RZS A;  1GGZ A;  2I94 A;  2MLE C;  1F55 A;  1TWO A;  2BBN A;  1QAT A;  2BL0 B;  1MWN A;  2LE9 B;  4ORB B;  1OOF A;  1GM0 A;  3SIA A;  3FE8 A;  3FWB A;  4JPZ B;  4YGE B;  3B6X A;  3JTD B;  2PRU A;  2HET A;  1WDC C;  1AJ4 A;  1CTR A;  3SG2 A;  1AHR A;  1C7W A;  1QS7 A;  2K2A A;  2JNX A;  2MAZ A;  1SBJ A;  4YI8 A;  2MA2 A;  4AOM A;  2ZN8 A;  1D1O A;  2OS8 B;  1M46 A;  3EK8 A;  3MSE B;  3UNW A;  1A2X A;  2BEC A;  2ERB A;  4PE1 A;  2JWW A;  2JU0 A;  1RK9 A;  1P28 A;  3I5G C;  3NHT A;  1DF0 A;  3S0A A;  2O60 A;  3BJH A;  5TNC A;  2L2C A;  2WCH A;  5AFP A;  2I2R E;  3NSO A;  1PRW A;  2AUC A;  2HQ8 A;  3K1E A;  1N2D A;  1Y0V H;  1TOP A;  3FWC A;  1H8B A;  1CDP A;  1K96 A;  1LKJ A;  2O5G A;  2NCP A;  2JQ6 A;  1AVS A;  3FE9 A;  3M0W A;  3BFB A;  1YUS A;  3D77 A;  3R1V A;  1KCY A;  3DVM A;  4OCI A;  2WCB A;  3JTD C;  3QRX A;  1OMD A;  4ORC B;  1U5I B;  4CID A;  3I5H C;  2Q91 A;  3TS5 B;  1RFJ A;  2K2F A;  1SCV A;  4XJK B;  3I5F C;  1BG1 A;  1NIW A;  3S0D A;  2L4H A;  4BY5 A;  3IF7 A;  1B8R A;  3LK1 A;  4GNK B;  5HLO A;  3CDN A;  1YX8 A;  4UPG A;  2CBL A;  3RM1 A;  3R72 A;  1K9K A;  3CLN A;  2EHB A;  2L5X B;  1RTP 1;  2LMU A;  1SW8 A;  5BPJ A;  5D3O A;  1JBA A;  3SG3 A;  1M63 B;  2WOR A;  3PFV A;  2L51 A;  3OGN A;  3TUY C;  1KSM A;  4DCK A;  3CZ0 A;  5KU1 A;  4N1F A;  1MXE A;  3CWG A;  1V1G A;  1TNP A;  4OV2 A;  1XO5 A;  3B88 A;  5G08 A;  2ZN9 A;  4QJ4 B;  1LXF C;  2KI6 C;  4PE4 A;  1WRK A;  1W7J B;  1WLZ A;  2AMI A;  2Y1N A;  3AKA A;  4PHK A;  1IJ5 A;  2KFF A;  2QAC A;  1TCF A;  2KAY A;  2Y5I A;  3SG4 A;  3TS5 C;  4FTG A;  2I7A A;  1PSB A;  3DY9 A;  3AAJ A;  1J7P A;  1M31 A;  1IWQ A;  1BOD A;  2BNX A;  2L4I A;  4F0Z B;  1R2U A;  2KDH A;  1IRJ A;  1QV0 A;  1TUJ A;  1C3Z A;  2HF5 A;  5CSI A;  4A4C A;  2BE6 A;  3NHI A;  4JQ0 D;  1CLL A;  2JNF A;  2M9G A;  1XFY O;  5FYX A;  1AK8 A;  1AP4 A;  3KPX A;  2WCL A;  3WHU B;  1TUZ A;  2WOS A;  1OOG A;  1UUS A;  1F4Q A;  4GGF A;  1YVH A;  1S6I A;  2F3Y A;  1OOI X;  1YUR A;  4GPL B;  4P2Y B;  1X02 A;  1HT9 A;  4AQI A;  3ICB A;  3S0B A;  4NDD A;  1NX1 A;  3EG5 B;  1J1E A;  3PJI A;  2QEH A;  1UWO A;  1K9U A;  2WC5 A;  3BFA A;  4I5K A;  4I5N B;  1DC1 A;  3CR5 X;  2M7L A;  2KFH A;  1EXR A;  1DGU A;  3TDI A;  1AJ5 A;  3LK0 A;  1EJ3 A;  3B7A A;  4FQO A;  4MZK A;  1K94 A;  1MUX A;  1N65 A;  1J1D A;  1B47 A;  3KO0 A;  4NDC A;  4U8D A;  2WCK A;  1SPY A;  3IVT A;  1SSE B;  3HX4 A;  2K7D A;  1B9A A;  4YBH B;  3GK4 X;  1NX3 A;  1OZS A;  1DJW A;  2KPH A;  3B87 A;  4JD9 A;  5DIC A;  3D75 A;  1PVA A;  1QXP A;  2LAN A;  4USL A;  5I2O A;  1FBV A;  3I5I B;  1QWV A;  2KNE A;  1YUU A;  2ZNE A;  1QX7 A;  3EVU A;  3VRN A;  1XFZ O;  3EVV A;  5AER A;  1SK6 D;  1LIN A;  1KFX S;  1CLB A;  1DEL A;  1IIO A;  1XYD A;  1TNW A;  2F8P A;  2MRD A;  4AQJ A;  2H61 C;  1XVJ A;  1TCO B;  1G8I A;  1S6C A;  1Y1U A;  1CLM A;  1YUT A;  4GUK A;  4INX A;  2KFG A;  1CM4 A;  1SKT A;  1SR6 C;  4GAO A;  2PSR A;  3SIB A;  3TZ1 A;  2FJY A;  5I94 A;  2COL B;  3Q8I A;  5KSZ A;  1CMF A;  1JF0 A;  3O4X A;  3D10 A;  2I18 A;  1NPQ A;  1QVI Z;  1BU3 A;  3I5H B;  2JRF A;  3NSL A;  2KI6 D;  1DJH A;  2JZI A;  1TNQ A;  2M49 B;  2QPT A;  3I5F B;  1NCX A;  3L47 A;  2LAP A;  1CFF A;  1B8L A;  4OZD A;  1IG5 A;  2MHH A;  5I2Q A;  2LCP A;  2KYF A;  2K60 A;  1KQM B;  1K90 D;  1DMO A;  4MZL A;  3WNX B;  1CDL A;  1TRF A;  1LS8 A;  4HRG A;  3I5I C;  1BLQ A;  1K2H A;  1WRZ A;  5HKW A;  1T14 A;  2KBI A;  2KBM A;  3L4L A;  1YVL A;  1OMR A;  2D8N A;  3TUY B;  5KTY A;  2KAV A;  3A4U B;  5CPV A;  1PUL A;  2JTZ A;  3LL8 B;  4A4B A;  5HL1 A;  1B8C A;  2BKI B;  2LUC A;  3NSK A;  3VRP A;  3BUX B;  2JUL A;  1L2O B;  1JWD A;  1F4O A;  1K95 A;  3BUN B;  1EL4 A;  3BOW A;  4MZJ A;  1XK4 C;  2LMV A;  1FI6 A;  5FI7 A;  1W7I B;  2LLU A;  1UUR A;  2PMY A;  3R1O A;  3D0Y A;  4I5J A;  2EGD A;  5JOL A;  1FI5 A;  1TIZ A;  3BUW B;  2CTN A;  2WND A;  3O6B A;  2JT3 A;  1YR5 A;  2PVB A;  4GGN A;  5AXI A;  2JT0 A;  2MLF C;  5I8N A;  1OOH A;  1QVI Y;  3CS1 A;  3DVJ A;  1J55 A;  1KQM C;  1OQP A;  4NQG A;  3CGA A;  3UO9 A;  1ALV A;  2L5Y A;  1BR4 B;  3VB1 A;  1CM1 A;  2P6B B;  4OR9 B;  1S5G Z;  1OSA A;  4PHJ A;  3CZT X;  4M2O A;  2BCA A;  3F45 A;  4QJ5 B;  2M29 A;  1XFW O;  2BAP A;  5D69 A;  1IJ6 A;  1HQV A;  3A8R A;  3OHM B;  1SYM A;  1UHN A;  2ZFD A;  3PM8 A;  1L2O C;  5AAN A;  3SS5 A;  2WCJ A;  3FIA A;  3IQO A;  4C0K A;  2KAX A;  3CZ1 A;  1M39 A;  3QME A;  4N1G A;  3KHE A;  1UHJ A;  1EH2 A;  4C0J A;  1A29 A;  2G2B A;  2LMT A;  3DXL A;  1BF5 A;  1WRL A;  1EG4 A;  4M2P A;  2NCO A;  1C3Y A;  3S0G A;  2JOJ A;  2RGI A;  1BOC A;  1NWD A;  5F6T A;  1Z2C B;  1Q80 A;  3FS7 A;  2K61 A;  1KWO B;  1OOJ A;  1SMG A;  3DF0 A;  3EK7 A;  4MRX A;  2F2O A;  3DVE A;  1FW4 A;  3EKJ A;  4YI9 A;  3PAT A;  1QIW A;  1TTX A;  3SG7 A;  5IBW A;  2M8U A;  1S6J A;  3CTN A;  2WC8 A;  4HRH A;  3O4Y A;  5DKN A;  1XFV O;  2FCD A;  3PM2 A;  5I2L A;  1GJY A;  2F2P A;  5CSF A;  2KGR A;  1REC A;  2JXL A;  3CR2 A;  1V1F A;  1KFX L;  1ZMZ A;  4KYN A;  1QX5 B;  1LA0 A;  3DZT A;  4WRI A;  5HYD A;  5PAL A;  3JVT B;  2M97 A;  4MN0 A;  2JPO A;  1QLS A;  4WQ2 A;  2A4J A;  2NXQ A;  2LP3 A;  3LLE A;  1KK8 C;  5J3X A;  2KGB C;  2JC2 A;  4YGB B;  1W9Z A;  2K7O A;  3PSR A;  1S5G Y;  3RLZ A;  4CLN A;  3CZ2 A;  3PN7 B;  3FE6 A;  2V53 A;  2QEB A;  2JT8 A;  3VRO A;  3VRQ A;  3WXA A;  1SR6 B;  1CFC A;  1QTX A;  2PYQ A;  1H4B A;  4OKH A;  3D73 A;  5EL2 A;  1S1E A;  5HKZ A;  1S3P A;  1KWO C;  3PAL A;  1A03 A;  2NLN A;  3BUM B;  2LUX A;  4JKT A;  1E8A A;  1YX7 A;  1C07 A;  1Y1A A;  1JFK A;  2L98 A;  1OZO A;  2L2E A;  2LP2 A;  2YGU A;  4YGA A;  1C7V A;  3TDZ A;  1B7T Y;  1RRO A;  3AKB A;  1TNX A;  3AAK A;  2SAS A;  3NXA A;  4HSZ A;  1SL7 A;  2KI4 B;  3N7H A;  1B4C A;  3IQQ A;  4JWQ A;  1XFX O;  2FJU B;  1DJX A;  2BCB A;  1DEK A;  2KQY A;  1F71 A;  2B1U A;  1ORG A;  3EVR A;  2GGM A;  2H8V A;  2ZKM X;  3JVT C;  4PE0 A;  1NX2 A;  5D7F A;  1JUO A;  1A75 A;  3C1V A;  4XYN A;  3BQ3 A;  3PN7 C;  1PAL A;  4CFR A;  4CFQ A;  4PE7 A;  1ZFS A;  1PK0 D;  1S26 D;  3EKH A;  4NDB A;  2QEV A;  2ZND A;  3VGO A;  4FQT A;  2GV5 A;  4MBE A;  3S0F A;  1IH0 A;  4GBA A;  5K89 A;  1J7Q A;  1ALW A;  3K21 A;  4GGF C;  2KOT A;  1JC2 A;  3S0E A;  1NCZ A;  1XFU O;  1UHI A;  4MEW A;  2BE4 A;  1DJI A;  1KQV A;  3PLF B;  3OX6 A;  2EC6 C;  1NX0 A;  2KI4 C;  1MR8 A;  3BUO B;  2WCE A;  1G33 A;  3OBV A;  3DYE A;  2BBM A;  4I5L B;  2FCE A;  1UP5 A;  5AEQ A;  1NUB A;  1MXL C;  1QV1 A;  1BMO A;  1RWY A;  2HPS A;  2KLE A;  1QAS A;  5GQQ C;  4DRW A;  1YRT B;  3TDU A;  1DGV A;  4PT1 A;  5FI2 A;  2LLS A;  2KHN A;  1ZUZ A;  1Y6W A;  3SG6 A;  5JJG A;  2JXC A;  1DF0 B;  1SY9 A;  1JF2 A;  2SCP A;  2LVK A;  1JFJ A;  2WCM A;  1XA5 A;  3BXK A; 
#chains in the Genus database with same CATH homology
 4MLW A;  2LLT A;  1U5I A;  1QJT A;  3E3R A;  1DVI A;  4PAL A;  2PAL A;  1DT7 B;  2LV7 A;  2LM5 A;  2M7N A;  2LVJ A;  3O78 A;  1K93 D;  1BT6 A;  4GFT A;  4XJK A;  2K8M B;  5B8I B;  1FPW A;  4PHN A;  4YGD B;  1A4P A;  2BL0 C;  1CNP A;  1ZOT B;  3BOW B;  3WHT B;  1K9P A;  2MBX A;  4QJ3 B;  1VRK A;  2CCM A;  2KQ6 A;  1NP8 A;  1SL8 A;  1QX2 A;  3D0Y B;  3VRR A;  3GK1 A;  4IL1 A;  2JPT A;  1MF8 B;  5CSJ A;  4ZCV A;  1DJZ A;  2E6W A;  1NSH A;  4OVN F;  1CDM A;  1IGV A;  4N5X A;  3NSI A;  1YTZ C;  2NZ0 A;  1KCY A;  2OS8 C;  2VRG A;  2WCF A;  1KK8 B;  2LNK A;  3DD4 A;  5AAN A;  2JTT A;  3CR4 X;  4R1E A;  2DOQ A;  1KSO A;  1DJG A;  1WLM A;  4M2Q A;  1CFP A;  4MRY A;  1DTL A;  2AAO A;  1GQM A;  4BY4 A;  1R6P A;  4DUQ A;  1OMV A;  1SCM B;  1B7T Z;  1KFU L;  2FOT A;  2GGZ A;  2KYC A;  2L0P A;  2LHL A;  3GOF A;  1JSA A;  2M0R A;  1GGW A;  2LHI A;  1SNL A;  1CDN A;  1MQ1 A;  1QIV A;  2CNP A;  1QLK A;  2F3Z A;  2BCX A;  1L7Z A;  3ZNI A;  2F33 A;  2KSP A;  5DKR A;  3OP0 A;  2E30 A;  1SRA A;  1ZAC A;  3KF9 A;  4DS7 A;  1FF1 A;  2K7C A;  1WY9 A;  1DJY A;  3DF0 B;  2K7B A;  3OB2 B;  1IQ5 A;  2Y1M A;  4YGC B;  1NYA A;  3O2P A;  1J7O A;  1CB1 A;  3ZWH A;  1M45 A;  2OTG B;  1LVC D;  2LC5 A;  1BR1 B;  1PSR A;  1RJV A;  4WQ3 A;  5HLV A;  1SCM C;  4ORA B;  1AUI B;  1F54 A;  1K8U A;  1Y1X A;  1KK7 Z;  1UHH A;  1G4Y R;  5DKQ A;  2K0J A;  2H61 A;  2BKH B;  2IS9 A;  2R2I A;  2ISD A;  4C0L A;  1IQ3 A;  4ETO A;  2M3W A;  2ZRS A;  2L50 A;  1NCY A;  3SG5 A;  1BJF A;  2G9B A;  4DIR A;  1OE9 B;  4ZCU A;  3KEV A;  2PAS A;  1KFU S;  1PVB A;  4CPV A;  1N0Y A;  2M1K B;  1LA3 A;  1EG3 A;  3EK4 A;  2EC6 B;  1YRU B;  1CFD A;  2Y4Q A;  1CMG A;  4ICB A;  4D1E A;  4PHM A;  4TNC A;  2LVI A;  2HQW A;  5ER4 X;  4MVF A;  3H4S E;  4MSP A;  5HKY A;  2CXJ A;  4PCW A;  4Q04 A;  2Q4U A;  2OTG C;  1WDC B;  3OX5 A;  2LVV A;  2ZRT A;  4L9M A;  3SJS A;  4E68 A;  5CSN A;  1SL9 A;  4YRU A;  1J7R A;  1ODB A;  1S36 A;  4HRE E;  1F70 A;  1MHO A;  1IKU A;  3HCM A;  3DVK A;  1F8H A;  1A75 B;  3OB1 B;  3LCP C;  1B1G A;  2OPO A;  3GK2 A;  3I5G B;  2M1U A;  2CT9 A;  1XK4 A;  1UHK A;  1KK7 Y;  2TN4 A;  2H2K A;  5ER5 A;  3BYA A;  2MJW B;  1TN4 A;  1GGZ A;  2I94 A;  2MLE C;  1F55 A;  2BBN A;  1QAT A;  2BL0 B;  1MWN A;  2LE9 B;  4ORB B;  3SIA A;  3FWB A;  4JPZ B;  4YGE B;  3JTD B;  2PRU A;  2HET A;  1WDC C;  1AJ4 A;  1CTR A;  3SG2 A;  1AHR A;  1C7W A;  1QS7 A;  2K2A A;  2JNX A;  2MAZ A;  1SBJ A;  4YI8 A;  2MA2 A;  4AOM A;  2ZN8 A;  1D1O A;  2OS8 B;  1M46 A;  3EK8 A;  3MSE B;  1A2X A;  2BEC A;  4PE1 A;  2JWW A;  2JU0 A;  1RK9 A;  3I5G C;  1DF0 A;  2O60 A;  5TNC A;  5AFP A;  2I2R E;  3NSO A;  1PRW A;  2AUC A;  2HQ8 A;  1N2D A;  1Y0V H;  1TOP A;  3FWC A;  1CDP A;  1K96 A;  1LKJ A;  2O5G A;  2NCP A;  2JQ6 A;  1AVS A;  3M0W A;  1YUS A;  3DVM A;  4OCI A;  2WCB A;  3JTD C;  3QRX A;  1OMD A;  4ORC B;  1U5I B;  4CID A;  3I5H C;  2Q91 A;  3TS5 B;  1RFJ A;  2K2F A;  1SCV A;  4XJK B;  3I5F C;  1BG1 A;  1NIW A;  4BY5 A;  2L4H A;  3IF7 A;  1B8R A;  3LK1 A;  4GNK B;  5HLO A;  4UPG A;  1YX8 A;  2CBL A;  3RM1 A;  1K9K A;  3CLN A;  2EHB A;  2L5X B;  1RTP 1;  2LMU A;  1SW8 A;  5BPJ A;  1JBA A;  3SG3 A;  1M63 B;  2WOR A;  3PFV A;  2L51 A;  3TUY C;  1KSM A;  4DCK A;  4N1F A;  1MXE A;  3CWG A;  1V1G A;  1TNP A;  4OV2 A;  1XO5 A;  5G08 A;  2ZN9 A;  4QJ4 B;  1LXF C;  2KI6 C;  4PE4 A;  1WRK A;  1W7J B;  1WLZ A;  2AMI A;  2Y1N A;  3AKA A;  4PHK A;  1IJ5 A;  2KFF A;  2QAC A;  1TCF A;  2KAY A;  2Y5I A;  3SG4 A;  3TS5 C;  4FTG A;  2I7A A;  1PSB A;  3AAJ A;  1J7P A;  1M31 A;  1IWQ A;  1BOD A;  2L4I A;  4F0Z B;  1R2U A;  2KDH A;  1IRJ A;  1QV0 A;  2HF5 A;  5CSI A;  4A4C A;  2BE6 A;  4JQ0 D;  1CLL A;  2JNF A;  2M9G A;  1XFY O;  5FYX A;  1AK8 A;  1AP4 A;  3KPX A;  3WHU B;  2WOS A;  1UUS A;  1F4Q A;  4GGF A;  1YVH A;  1S6I A;  2F3Y A;  1YUR A;  4GPL B;  4P2Y B;  1X02 A;  1HT9 A;  4AQI A;  3ICB A;  4NDD A;  1NX1 A;  4PDZ A;  1J1E A;  1H8B A;  1UWO A;  1K9U A;  4I5K A;  4I5N B;  3CR5 X;  2M7L A;  2KFH A;  1EXR A;  1DGU A;  3TDI A;  1AJ5 A;  3LK0 A;  1EJ3 A;  4FQO A;  4MZK A;  1K94 A;  1MUX A;  1N65 A;  1J1D A;  1B47 A;  3KO0 A;  4NDC A;  4U8D A;  1SPY A;  3HX4 A;  2K7D A;  1B9A A;  4YBH B;  3GK4 X;  1NX3 A;  1OZS A;  1DJW A;  1PVA A;  1QXP A;  2LAN A;  4USL A;  5I2O A;  1FBV A;  3I5I B;  2KNE A;  5AER A;  1YUU A;  2ZNE A;  1QX7 A;  3EVU A;  3VRN A;  1XFZ O;  3EVV A;  1SK6 D;  1LIN A;  1KFX S;  1CLB A;  1XYD A;  1TNW A;  2F8P A;  2MRD A;  4AQJ A;  2H61 C;  1XVJ A;  1TCO B;  1G8I A;  1S6C A;  1Y1U A;  1CLM A;  1YUT A;  4GUK A;  4P5O E;  2KFG A;  1CM4 A;  1SKT A;  1SR6 C;  4GAO A;  2PSR A;  3SIB A;  3TZ1 A;  2COL B;  5KSZ A;  1CMF A;  1JF0 A;  3D10 A;  2I18 A;  1NPQ A;  1QVI Z;  1BU3 A;  3I5H B;  2JRF A;  3NSL A;  2KI6 D;  1DJH A;  2JZI A;  1TNQ A;  2M49 B;  2QPT A;  3I5F B;  1NCX A;  2LAP A;  1CFF A;  1B8L A;  1IG5 A;  2MHH A;  5I2Q A;  2LCP A;  2KYF A;  1KQM B;  1K90 D;  1DMO A;  4MZL A;  3WNX B;  1CDL A;  1TRF A;  4HRG A;  3I5I C;  1BLQ A;  1K2H A;  1WRZ A;  5HKW A;  2KBI A;  2KBM A;  1YVL A;  1OMR A;  2D8N A;  3TUY B;  5KTY A;  2KAV A;  3A4U B;  5CPV A;  1PUL A;  2JTZ A;  3LL8 B;  4A4B A;  1B8C A;  2BKI B;  2LUC A;  3NSK A;  3VRP A;  3BUX B;  2JUL A;  1L2O B;  1JWD A;  1F4O A;  1K95 A;  3BUN B;  1EL4 A;  3BOW A;  4MZJ A;  1XK4 C;  2LMV A;  1FI6 A;  1W7I B;  2LLU A;  1UUR A;  2PMY A;  3D0Y A;  4I5J A;  2EGD A;  5JOL A;  1FI5 A;  1TIZ A;  3BUW B;  2CTN A;  2WND A;  3O6B A;  2JT3 A;  1YR5 A;  2PVB A;  4GGN A;  5AXI A;  2JT0 A;  2MLF C;  5I8N A;  1QVI Y;  3CS1 A;  3DVJ A;  1J55 A;  1KQM C;  1OQP A;  4NQG A;  3CGA A;  1ALV A;  1BR4 B;  1CM1 A;  2P6B B;  4OR9 B;  1S5G Z;  1OSA A;  4PHJ A;  3CZT X;  4M2O A;  2BCA A;  3F45 A;  4QJ5 B;  2M29 A;  1XFW O;  5D69 A;  1IJ6 A;  1HQV A;  3A8R A;  3OHM B;  1SYM A;  1UHN A;  2ZFD A;  3PM8 A;  1L2O C;  5KU1 A;  1CKK A;  3FIA A;  3IQO A;  4C0K A;  2KAX A;  1M39 A;  4N1G A;  3KHE A;  1UHJ A;  1EH2 A;  4C0J A;  1A29 A;  2G2B A;  2LMT A;  1BF5 A;  1WRL A;  1EG4 A;  4M2P A;  2NCO A;  2JOJ A;  2RGI A;  1BOC A;  1NWD A;  5F6T A;  1Q80 A;  3FS7 A;  2K61 A;  1KWO B;  1OOJ A;  1SMG A;  3DF0 A;  3EK7 A;  4MRX A;  2F2O A;  3DVE A;  1FW4 A;  3EKJ A;  4YI9 A;  3PAT A;  1QIW A;  1TTX A;  3SG7 A;  5IBW A;  2M8U A;  1S6J A;  3CTN A;  2WC8 A;  4HRH A;  3O4Y A;  5DKN A;  1XFV O;  2FCD A;  5I2L A;  1GJY A;  2F2P A;  5CSF A;  2KGR A;  1REC A;  2JXL A;  3CR2 A;  1V1F A;  1KFX L;  1ZMZ A;  1QX5 B;  1LA0 A;  4WRI A;  5HYD A;  5PAL A;  3JVT B;  2M97 A;  4MN0 A;  1QLS A;  4WQ2 A;  2A4J A;  2NXQ A;  2LP3 A;  3LLE A;  1KK8 C;  5J3X A;  2KGB C;  2JC2 A;  4YGB B;  2K7O A;  3PSR A;  1S5G Y;  3RLZ A;  4CLN A;  3PN7 B;  2V53 A;  2JT8 A;  3VRO A;  3VRQ A;  3WXA A;  1SR6 B;  1CFC A;  1QTX A;  1H4B A;  4OKH A;  1S1E A;  5HKZ A;  1S3P A;  1KWO C;  3PAL A;  1A03 A;  2NLN A;  3BUM B;  2LUX A;  1E8A A;  1YX7 A;  1C07 A;  1Y1A A;  1JFK A;  2L98 A;  1OZO A;  2L2E A;  2LP2 A;  4YGA A;  1C7V A;  3TDZ A;  1B7T Y;  1RRO A;  3AKB A;  1TNX A;  3AAK A;  2SAS A;  3NXA A;  4HSZ A;  1SL7 A;  2KI4 B;  1B4C A;  3IQQ A;  4JWQ A;  1XFX O;  2FJU B;  1DJX A;  2BCB A;  2KQY A;  1F71 A;  2B1U A;  3EVR A;  2GGM A;  2ZKM X;  3JVT C;  4PE0 A;  1NX2 A;  5D7F A;  1JUO A;  1A75 A;  3C1V A;  4XYN A;  3BQ3 A;  3PN7 C;  1PAL A;  4CFR A;  4CFQ A;  4PE7 A;  1ZFS A;  1PK0 D;  1S26 D;  3EKH A;  4NDB A;  3VGO A;  2ZND A;  2GV5 A;  4MBE A;  1IH0 A;  4GBA A;  5K89 A;  1J7Q A;  1ALW A;  3K21 A;  4GGF C;  2KOT A;  1JC2 A;  1NCZ A;  1XFU O;  1UHI A;  4MEW A;  2BE4 A;  1DJI A;  1KQV A;  3PLF B;  3OX6 A;  2EC6 C;  1NX0 A;  2KI4 C;  1MR8 A;  3BUO B;  2WCE A;  1G33 A;  4I5L B;  2BBM A;  2FCE A;  1UP5 A;  5AEQ A;  1NUB A;  1MXL C;  1QV1 A;  1BMO A;  1RWY A;  2HPS A;  5GQQ C;  1QAS A;  4DRW A;  1YRT B;  3TDU A;  1DGV A;  2LLS A;  2KHN A;  1ZUZ A;  1Y6W A;  3SG6 A;  5JJG A;  2JXC A;  1DF0 B;  1SY9 A;  1JF2 A;  2SCP A;  2LVK A;  1JFJ A;  1XA5 A;  3BXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...