4YBHB

Crystal structure of the human rage ectodomain (vc1c2 fragment) in complex with human s100a6
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the RAGE:S100A6 Complex Reveals a Unique Mode of Homodimerization for S100 Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Advanced glycosylation end product-specific receptor
total genus 33
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ybhB00
3AKAA 2K0JA 1NX2A 2BBMA 5G08A 1A75A 4NQGA 4M2QA 2MHHA 1RFJA 1OQPA 2L98A 1TCFA 2ZNEA 1GGZA 2NZ0A 5AEQA 1HT9A 2KBIA 4XJKB 2LVIA 4AOMA 1JSAA 2M49B 1K8UA 1N2DA 5ER5A 1YX8A 1JF2A 1XK4A 1XYDA 1PVAA 2KNEA 4YGDB 1M31A 1ZOTB 4DRWA 4MBEA 3TDZA 1YURA 2OPOA 2PVBA 4XJKA 4GFTA 4ORBB 4PHJA 1RK9A 2JWWA 1OE9B 3CS1A 2MJWB 2QACA 1J55A 2WCEA 1YUTA 1NCZA 2I2RE 1R2UA 2BBNA 2M29A 1LA3A 2EC6C 2BCXA 4U8DA 1EG4A 5I2LA 1SMGA 2KAXA 1A4PA 2JZIA 2KQYA 1UHKA 1IH0A 1OMVA 1SY9A 4UPGA 1C07A 5I8NA 3I5FB 4NDCA 2D8NA 1S36A 1S5GZ 2M97A 3LLEA 1KFUL 1QX7A 3OP0A 2JQ6A 4HREE 1IJ6A 3SIBA 1K2HA 1NUBA 1FI5A 1QIWA 4YBHB 2HF5A 4PE4A 4MRXA 3TS5C 1V1GA 2Q4UA 2LUXA 1S6IA 2GGZA 1C7VA 2BE4A 1IJ5A 5J3XA 3FWCA 4QJ4B 1AJ4A 1LVCD 3VGOA 1EH2A 2OTGB 3NSLA 4FQOA 1WY9A 4NDDA 5K89A 2LC5A 2Y5IA 4ICBA 4TNCA 3PN7C 2SCPA 3WNXB 4CLNA 1F70A 1DGVA 1K95A 1DT7B 1QXPA 3A4UB 2GGMA 2SASA 1BF5A 1XFWO 1AHRA 3O78A 3MSEB 1CTRA 1XFYO 4OVNF 2DOQA 2FJUB 2ZNDA 1J1EA 3KHEA 4YRUA 3OX5A 1YRTB 1WRKA 2Q91A 4BY5A 1S6JA 4YI9A 2LVJA 1SCVA 1CMFA 1TRFA 1L2OC 4GUKA 1DJZA 1KSMA 1TNQA 5DKRA 1MWNA 5AXIA 1ODBA 3I5HB 2LUCA 3HX4A 3CLNA 3PALA 4MZJA 3BUNB 1QV1A 2JRFA 2JXLA 3AAJA 3BQ3A 1MUXA 1NWDA 2JU0A 1QASA 1XFUO 3EK7A 1EL4A 2E6WA 1KQMB 3IQOA 2WCFA 3O2PA 4GGFA 4CFQA 1K96A 1F71A 2FCDA 2KYCA 1YVLA 4PALA 3WXAA 5B8IB 1JBAA 1KWOC 2JNXA 3EKHA 1J7RA 2I7AA 1JF0A 2JTZA 1SR6C 1NX0A 3BUWB 4PDZA 3TDIA 3HCMA 3TDUA 4OCIA 1TIZA 1K94A 5KTYA 3I5IC 1A03A 1MHOA 3PFVA 5HKYA 1KK7Z 3ZNIA 1J7OA 2HPSA 4L9MA 3NSOA 5JOLA 3NSKA 4JQ0D 4F0ZB 2F2OA 2LMUA 3PATA 4OV2A 1QVIZ 1E8AA 1UP5A 1XFZO 2L0PA 3WHUB 5CPVA 1QX2A 1WDCB 1A2XA 5HKZA 2AAOA 2F8PA 3KO0A 3SIAA 4D1EA 1YTZC 2ZRTA 1SK6D 4WQ3A 1CFPA 2LCPA 1UHIA 1LKJA 2WORA 4GNKB 4A4BA 2F2PA 2ZRSA 3NXAA 1FI6A 4PE7A 2FOTA 4ZCUA 1IGVA 1UURA 4PCWA 2L50A 1IQ5A 1CDMA 1K9PA 1TCOB 3I5GC 5HKWA 1B8LA 1F54A 4PHNA 2CBLA 3JVTB 4GAOA 1EG3A 1PSBA 1YR5A 3BUMB 1TOPA 3BOWB 3VRPA 1OZOA 3F45A 3DF0A 4OR9B 1B9AA 1S6CA 3GK4X 2KFGA 1MXLC 2V53A 4MLWA 1M45A 2WC8A 4P2YB 1G4YR 2M9GA 1PVBA 1G33A 2MLEC 1QS7A 1KFUS 1QIVA 2Y4QA 1B8RA 5CSJA 3VRQA 3SG2A 2L5XB 2MLFC 3SG3A 5HLVA 1Y0VH 1CFDA 2HETA 1TN4A 5IBWA 2BCBA 1SKTA 2LE9B 3TUYB 2F3ZA 1YUUA 3KF9A 4PHKA 4R1EA 1QATA 1B8CA 1WLMA 2CNPA 3NSIA 2KBMA 2GV5A 4PE1A 3FIAA 1B7TY 3BXKA 1OMRA 1RTP1 2CCMA 4OKHA 2H61A 1WRZA 4A4CA 2I18A 1LA0A 3QRXA 4YGAA 2OS8B 1BG1A 1DJWA 2ZFDA 3I5FC 4WQ2A 4DS7A 1TNPA 2KI4B 2BE6A 2MBXA 1H4BA 3JTDB 2OTGC 3GK2A 2E30A 2JTTA 1DJYA 2KOTA 3AAKA 2LHIA 4YGCB 1CKKA 2COLB 1A75B 4M2PA 1XFXO 1PULA 3ZWHA 5PALA 2Y1NA 2PASA 1UHHA 1C7WA 3SG6A 1U5IA 1B1GA 1RECA 1F55A 1CDPA 4GGNA 5D7FA 5AFPA 4QJ5B 1ZUZA 1XA5A 1SNLA 2HQWA 2M0RA 3OHMB 1CDNA 2BCAA 1CB1A 4YGBB 1SRAA 1K93D 1NPQA 2PRUA 2WOSA 4GBAA 5AERA 1SBJA 4USLA 3CR2A 2NCPA 1SCMC 3D0YB 3FS7A 2M1UA 3GOFA 2F3YA 1PRWA 1DVIA 3KPXA 4CFRA 4WRIA 2ISDA 3CWGA 5BPJA 3FWBA 3CTNA 1KFXL 2KHNA 1NSHA 2JXCA 2K7CA 2AUCA 1SL9A 4DCKA 1A29A 1SYMA 4HSZA 4NDBA 1JC2A 3EK4A 2K8MB 2KI6C 3EK8A 3IF7A 2LMTA 2KI6D 2PALA 3ICBA 2B1UA 4ETOA 2VRGA 1UUSA 1CM4A 2TN4A 1OSAA 5ER4X 5CSFA 5TNCA 2AMIA 2H61C 1KFXS 1CNPA 2O5GA 3I5IB 1K9UA 5HYDA 2NLNA 2M1KB 2MAZA 4BY4A 2K2AA 1KWOB 1CM1A 2KFHA 1J7QA 1NX3A 1DJXA 1MXEA 1TNWA 1YRUB 4DIRA 1KCYA 2BL0B 2PSRA 4MEWA 1S3PA 2JT0A 1UHJA 1PALA 1BODA 2MA2A 2LLSA 4AQJA 4I5LB 4IL1A 1DGUA 4GPLB 1SPYA 2LVVA 1NYAA 1PSRA 4P5OE 2EC6B 2ZN9A 1CLLA 4MVFA 1KK8B 1V1FA 1WRLA 2BKHB 2I94A 1Y1AA 1Y1XA 1F4QA 3SG4A 1QLSA 4I5JA 3M0WA 5HLOA 2JOJA 2H2KA 1XVJA 3VROA 4C0JA 1N0YA 1R6PA 1DTLA 2K7BA 3TS5B 1M46A 3SJSA 2ZN8A 2CXJA 3WHTB 1CDLA 4CPVA 3DD4A 2L4HA 1B4CA 5KU1A 1B7TZ 3OX6A 1AVSA 2MRDA 1IRJA 3PM8A 2JT8A 3KEVA 3SG5A 5I2QA 1YVHA 4N1FA 2ZKMX 4MSPA 4CIDA 1QJTA 1DMOA 1XFVO 1XO5A 3EVRA 3GK1A 3PN7B 3I5GB 1JFJA 1LINA 3DVKA 1CMGA 1OZSA 2M8UA 1S26D 5F6TA 1K9KA 1SW8A 1X02A 3K21A 4XYNA 4MZKA 1RJVA 1MQ1A 1Q80A 2BL0C 1LXFC 1W7JB 2A4JA 3EVVA 1DF0A 3LK1A 3AKBA 1J1DA 1AK8A 3CR5X 2LLUA 2K7DA 3RLZA 1L7ZA 2KSPA 1KSOA 4C0LA 1L2OB 1IQ3A 1NCYA 1OOJA 2LLTA 1AP4A 2KAYA 2G9BA 5FYXA 2L51A 1B47A 3EVUA 4N5XA 1GQMA 1ALWA 5CSIA 4ZCVA 3TUYC 2JULA 5D69A 3LK0A 4HRGA 3E3RA 4GGFC 1F8HA 5CSNA 4FTGA 1D1OA 1UHNA 1Y6WA 2KQ6A 5I2OA 2BECA 3PLFB 2K61A 1CFCA 2LP3A 1DF0B 4I5KA 5GQQC 2OS8C 5KSZA 1QX5B 1ALVA 1U5IB 2WNDA 3OB2B 2QPTA 2RGIA 3SG7A 1CLBA 2FCEA 1S1EA 2KGBC 1J7PA 4MZLA 2L4IA 1FPWA 2G2BA 2L2EA 1BT6A 2K7OA 2R2IA 2KDHA 2JNFA 3D10A 5AANA 1SL7A 3BUXB 3CGAA 1DJHA 1KK7Y 1K90D 3O6BA 2LM5A 4ORAB 4PE0A 1GJYA 4AQIA 2WCBA 2LAPA 1WLZA 2Y1MA 2F33A 2P6BB 3DVMA 1BR4B 3RM1A 1N65A 1TNXA 2LNKA 3CR4X 3D0YA 1BU3A 4QJ3B 2NCOA 3BYAA 3VRRA 1QLKA 1KQVA 1NIWA 4C0KA 2LV7A 4MRYA 1OMDA 3JVTC 1SCMB 4YI8A 5DKQA 2HQ8A 2JC2A 1JWDA 3H4SE 5JJGA 1RWYA 3LL8B 1NP8A 4MN0A 2KFFA 2BKIB 2LHLA 1CFFA 2JT3A 2KAVA 2LVKA 1ZMZA 1EXRA 2EGDA 1CLMA 2M3WA 4M2OA 1PK0D 1FF1A 1JUOA 1ZACA 1GGWA 4Q04A 1W7IB 3O4YA 1G8IA 4ORCB 1IKUA 3IQQA 3C1VA 1DJIA 1IWQA 2LMVA 1DJGA 2NXQA 1VRKA 1ZFSA 2M7NA 1FBVA 1NX1A 1FW4A 2CTNA 4N1GA 2PMYA 1Y1UA 3TZ1A 1BR1B 3A8RA 4JPZB 1KQMC 1YUSA 4DUQA 1NCXA 1F4OA 3LCPC 2EHBA 1UWOA 2M7LA 1H8BA 1YX7A 3I5HC 1QTXA 2LANA 3VRNA 1MR8A 1QVIY 1SR6B 1BLQA 4I5NB 4YGEB 3OB1B 1XK4C 1KK8C 3DVEA 3CZTX 3EKJA 2K2FA 4JWQA 1EJ3A 2KI4C 3DF0B 1M63B 3JTDC 3BOWA 1BJFA 2CT9A 2IS9A 2O60A 4PHMA 1IG5A 5DKNA 1MF8B 1SL8A 2KYFA 2LP2A 1AUIB 1BOCA 4E68A 1S5GY 1WDCC 3DVJA 1TTXA 4HRHA 3PSRA 1QV0A 2KGRA 1RROA 3BUOB 1AJ5A 2JPTA 1BMOA 1HQVA 1JFKA 1M39A
chains in the Genus database with same CATH superfamily
4JD9A 3AKAA 3DY9A 1IIOA 2K0JA 1NX2A 2BBMA 5G08A 1A75A 1TUZA 4NQGA 4M2QA 2MHHA 1RFJA 1OQPA 2L98A 1TCFA 2QEHA 1GGZA 2ZNEA 2NZ0A 5AEQA 1HT9A 4F7FA 2KBIA 4XJKB 2LVIA 4AOMA 3D74A 1JSAA 2M49B 1K8UA 1N2DA 2WCKA 1W9ZA 5ER5A 1YX8A 1JF2A 1XK4A 1XYDA 1PVAA 2KNEA 4YGDB 1M31A 1ZOTB 4DRWA 3IVTA 4MBEA 3TDZA 1YURA 2OPOA 2PVBA 4XJKA 4GFTA 4ORBB 4PHJA 1RK9A 2GTEA 1OE9B 2JWWA 2MJWB 2QACA 3B87A 3CS1A 1J55A 2WCEA 1YUTA 1NCZA 2I2RE 3B6XA 1OOFA 1R2UA 2BBNA 2M29A 1LA3A 2EC6C 2BCXA 5HL1A 4U8DA 1EG4A 5I2LA 1SMGA 2KAXA 1A4PA 3VB1A 2JZIA 2KQYA 1UHKA 1IH0A 1OMVA 1SY9A 4UPGA 1C07A 5I8NA 3I5FB 4NDCA 2D8NA 1S36A 1S5GZ 2M97A 2PYQA 3LLEA 1KFUL 1QX7A 3OP0A 2JQ6A 4HREE 1IJ6A 3SIBA 3N7HA 1LS8A 1K2HA 1NUBA 1FI5A 1QIWA 4YBHB 2HF5A 4PE4A 4MRXA 3TS5C 1V1GA 2Q4UA 2LUXA 1S6IA 3R1PA 2GGZA 1C7VA 2BE4A 1IJ5A 3R1VA 5DICA 3FWCA 5J3XA 3D76A 4QJ4B 1AJ4A 1LVCD 3VGOA 1EH2A 2OTGB 3NSLA 4FQOA 1WY9A 1Z2CB 4NDDA 5K89A 2LC5A 2Y5IA 4ICBA 4TNCA 3B86A 3PN7C 2SCPA 3WNXB 1P28A 4CLNA 1F70A 1DGVA 1K95A 1DT7B 1QXPA 3A4UB 2GGMA 2JPOA 3CZ2A 3OGNA 2SASA 4PT1A 1BF5A 1XFWO 1AHRA 3O78A 3MSEB 1CTRA 3D77A 1XFYO 4OVNF 2DOQA 2FJUB 3S0AA 2ZNDA 1J1EA 3KHEA 4YRUA 3OX5A 3BFHA 1YRTB 1WRKA 2Q91A 4BY5A 1S6JA 4YI9A 2LVJA 1SCVA 1CMFA 1TRFA 1L2OC 4GUKA 1DJZA 1KSMA 1TNQA 5DKRA 1MWNA 5AXIA 1ODBA 3I5HB 2LUCA 3HX4A 3CLNA 3PALA 4MZJA 3BUNB 1QV1A 2JRFA 2JXLA 3AAJA 3BQ3A 1MUXA 1NWDA 2JU0A 1QASA 1XFUO 3EK7A 3NHIA 3S0FA 1EL4A 2E6WA 1KQMB 3IQOA 2WCFA 3O2PA 4GGFA 4CFQA 1K96A 3NHTA 2FCDA 1F71A 2KYCA 1YVLA 4PALA 3WXAA 5B8IB 1JBAA 1KWOC 2JNXA 1DEKA 3EKHA 1J7RA 2I7AA 3L47A 1JF0A 2JTZA 1SR6C 1NX0A 3DXLA 3BUWB 4PDZA 3TDIA 3HCMA 3TDUA 4OCIA 1TIZA 1K94A 5KTYA 3I5IC 1A03A 1MHOA 1OOGA 3PFVA 5HKYA 1KK7Z 2WC5A 3ZNIA 1J7OA 2HPSA 4L9MA 5FI2A 3NSOA 5JOLA 3NSKA 4JQ0D 4F0ZB 2F2OA 2LMUA 3PATA 5I94A 4OV2A 1QVIZ 1E8AA 1UP5A 1XFZO 2L0PA 3WHUB 5CPVA 1QX2A 1WDCB 1A2XA 5HKZA 1C3ZA 2AAOA 2F8PA 3KO0A 3SIAA 1YTZC 2ZRTA 1SK6D 4WQ3A 4D1EA 1CFPA 2LCPA 1UHIA 1LKJA 2QEVA 3S0EA 2WORA 4GAOA 1XFRA 4GNKB 4A4BA 2F2PA 2ZRSA 3NXAA 1FI6A 4PE7A 2FOTA 2H8VA 4ZCUA 1DELA 1IGVA 1UURA 4PCWA 3OBVA 2L50A 1IQ5A 3CDNA 1CDMA 1K9PA 3Q8IA 1TCOB 3I5GC 5HKWA 1B8LA 1F54A 4PHNA 1OOIX 2CBLA 3JVTB 4FQTA 1EG3A 1PSBA 1YR5A 3BUMB 1TOPA 3BOWB 3L4AA 1OZOA 3F45A 3VRPA 3DF0A 4OR9B 1B9AA 1S6CA 3GK4X 2KFGA 1MXLC 2V53A 3PJIA 4MLWA 1M45A 2WC8A 4P2YB 1G4YR 2M9GA 1PVBA 1G33A 2MLEC 2FJYA 2WCMA 1QS7A 2L2CA 3B88A 1H4BA 1KFUS 1QIVA 1QWVA 2Y4QA 3SS4A 1B8RA 5CSJA 3VRQA 2WCHA 3SG2A 2L5XB 2MLFC 3SG3A 5HLVA 1Y0VH 1CFDA 2HETA 1TN4A 5IBWA 2BCBA 1SKTA 2LE9B 2WCJA 3TUYB 2F3ZA 1YUUA 3KF9A 4PHKA 4R1EA 1QATA 1B8CA 1WLMA 2CNPA 3FE9A 3NSIA 2KBMA 2GV5A 4PE1A 3FIAA 4JKTA 1B7TY 3BXKA 1OMRA 1RTP1 3D78A 2CCMA 4OKHA 2H61A 1WRZA 1GM0A 4A4CA 2I18A 1LA0A 3QRXA 1TWOA 2OS8B 4YGAA 1BG1A 1DJWA 2ZFDA 3I5FC 4INXA 4WQ2A 1TNPA 2KI4B 2BE6A 2MBXA 3S0DA 3JTDB 4DS7A 2OTGC 3GK2A 2E30A 2JTTA 1DJYA 2KOTA 3AAKA 2LHIA 4YGCB 1CKKA 3CZ1A 2COLB 3CABA 1A75B 4M2PA 1XFXO 1PULA 3R72A 3ZWHA 5PALA 2Y1NA 2PASA 1UHHA 1C7WA 3SG6A 1U5IA 1B1GA 1RECA 1F55A 1CDPA 4GGNA 5D7FA 5AFPA 4QJ5B 1ZUZA 3BFBA 1XA5A 1SNLA 1T14A 2HQWA 2PQLA 3UNWA 2M0RA 3OHMB 1CDNA 2BCAA 1CB1A 4YGBB 3NGVA 1SRAA 1K93D 1NPQA 2KPHA 2PRUA 2WOSA 4GBAA 5AERA 1SBJA 4USLA 3CR2A 2NCPA 1SCMC 3D0YB 3FS7A 3SS5A 3O4XA 2KLEA 2M1UA 3GOFA 2F3YA 1PRWA 1DVIA 3KPXA 4CFRA 4WRIA 2ISDA 3CWGA 3D75A 5BPJA 3FWBA 3CTNA 1KFXL 2KHNA 1NSHA 2JXCA 2K7CA 4OZDA 2AUCA 1SL9A 4DCKA 1A29A 1SYMA 4HSZA 4NDBA 3QMEA 3EK4A 2K8MB 2KI6C 3EK8A 3IF7A 1OW4A 2LMTA 2KI6D 2PALA 3ICBA 2B1UA 4ETOA 2VRGA 1UUSA 1CM4A 2TN4A 1OSAA 5ER4X 5CSFA 5TNCA 2AMIA 3K1EA 2H61C 1KFXS 1CNPA 2ERBA 2O5GA 2QDIA 3I5IB 1K9UA 5HYDA 2NLNA 2M1KB 2MAZA 4BY4A 3V2LA 2K2AA 1KWOB 1CM1A 2KFHA 1J7QA 1Z4HA 1NX3A 1DJXA 1MXEA 1TNWA 1YRUB 4DIRA 1GGWA 1KCYA 2BL0B 2PSRA 4MEWA 1S3PA 2JT0A 1UHJA 1PALA 1BODA 2MA2A 2LLSA 4AQJA 4I5LB 4IL1A 1DGUA 4GPLB 1SPYA 2LVVA 1NYAA 1PSRA 4P5OE 2EC6B 2ZN9A 1CLLA 4MVFA 1KK8B 3D73A 1V1FA 1WRLA 2BKHB 2I94A 1Y1AA 1Y1XA 1F4QA 3SG4A 1QLSA 4I5JA 3M0WA 3L4LA 5HLOA 2JOJA 2H2KA 1XVJA 3VROA 4C0JA 1N0YA 1R6PA 1DTLA 2K7BA 3TS5B 1M46A 3SJSA 2ZN8A 2CXJA 3WHTB 1CDLA 4CPVA 3DD4A 2L4HA 1B4CA 5KU1A 1B7TZ 3OX6A 1AVSA 2MRDA 1IRJA 3PM8A 2JT8A 3KEVA 3SG5A 4IJ7A 5I2QA 1YVHA 4INWA 4N1FA 2ZKMX 3CYZA 4MSPA 4CIDA 1QJTA 1DMOA 1XFVO 1XO5A 3EVRA 3GK1A 3PN7B 3I5GB 5D3OA 1LINA 3DVKA 3DYEA 1CMGA 1JFJA 1OZSA 2M8UA 1S26D 5F6TA 1K9KA 1SW8A 1X02A 3K21A 4XYNA 4MZKA 1RJVA 1MQ1A 1Q80A 2BL0C 1LXFC 1W7JB 2A4JA 1SSEB 3EVVA 1DF0A 3LK1A 2P71A 1J1DA 3AKBA 3CR5X 3R1OA 1AK8A 2LLUA 2K7DA 3B7AA 3RLZA 1L7ZA 2KSPA 1KSOA 4C0LA 1ORGA 1L2OB 1IQ3A 1NCYA 1OOJA 2LLTA 1AP4A 2KAYA 2G9BA 5FYXA 2L51A 1B47A 3EVUA 4N5XA 1GQMA 1ALWA 5CSIA 4ZCVA 3TUYC 2JULA 5D69A 2P70A 1C3YA 3LK0A 4HRGA 3E3RA 4GGFC 1F8HA 5CSNA 4FTGA 1OOHA 1D1OA 1UHNA 1Y6WA 2KQ6A 5I2OA 2BECA 3PLFB 2K61A 1CFCA 2LP3A 2WC6A 1DF0B 4I5KA 5GQQC 2OS8C 5KSZA 1QX5B 1ALVA 2L5YA 3BFAA 1U5IB 2WNDA 3OB2B 2QPTA 2RGIA 3S0GA 3SG7A 2FCEA 1CLBA 1S1EA 2KGBC 1J7PA 4MZLA 2L4IA 1FPWA 2K60A 2G2BA 2L2EA 1BT6A 2K7OA 2R2IA 2KDHA 2JNFA 3D10A 5AANA 1SL7A 3BUXB 3CGAA 3EG5B 1DJHA 1KK7Y 1K90D 3O6BA 2LM5A 4ORAB 4PE0A 1GJYA 4AQIA 2WCBA 2LAPA 1WLZA 2Y1MA 2F33A 2P6BB 3PM2A 3DVMA 1BR4B 3RM1A 1N65A 2BNXA 3CZ0A 1TNXA 2LNKA 3CR4X 3D0YA 1BU3A 1TUJA 4QJ3B 2NCOA 3BYAA 3VRRA 1QLKA 3S0BA 1KQVA 1NIWA 4C0KA 2LV7A 4MRYA 1OMDA 3JVTC 1SCMB 4YI8A 5DKQA 2HQ8A 2JC2A 3DZTA 1JWDA 3H4SE 5JJGA 5FI6A 1RWYA 1DQEA 2QEBA 3LL8B 1NP8A 4MN0A 2KFFA 2KLDA 2BKIB 2LHLA 1CFFA 2JT3A 2KAVA 2LVKA 3RZSA 5FI7A 1ZMZA 1EXRA 2EGDA 1CLMA 2M3WA 4M2OA 1PK0D 1FF1A 1JUOA 1ZACA 2YGUA 4Q04A 1W7IB 3O4YA 1G8IA 3BJHA 4ORCB 3UO9A 1IKUA 3IQQA 3C1VA 1DJIA 1IWQA 2LMVA 1DJGA 2NXQA 1VRKA 1ZFSA 2M7NA 1FBVA 2WCLA 1NX1A 1FW4A 2CTNA 4N1GA 2PMYA 1Y1UA 3TZ1A 1BR1B 3A8RA 2QEOA 4JPZB 1KQMC 1YUSA 4DUQA 1NCXA 1F4OA 3LCPC 1JC2A 2EHBA 1UWOA 2M7LA 1H8BA 1YX7A 3I5HC 1QTXA 2LANA 5EL2A 3VRNA 1DC1A 1MR8A 1QVIY 1SR6B 1BLQA 4I5NB 4YGEB 4KYNA 3OB1B 1XK4C 1KK8C 3DVEA 3CZTX 3EKJA 3SS3A 2K2FA 4JWQA 1EJ3A 2KI4C 3DF0B 1M63B 3JTDC 3BOWA 1BJFA 2CT9A 2IS9A 2O60A 4PHMA 1IG5A 3FE6A 5DKNA 1MF8B 1SL8A 2KYFA 2BAPA 2LP2A 1AUIB 1BOCA 4E68A 1S5GY 1WDCC 3DVJA 1TTXA 4HRHA 3PSRA 1QV0A 2KGRA 1RROA 3BUOB 1AJ5A 2JPTA 1BMOA 1HQVA 3FE8A 1JFKA 1M39A
chains in the Genus database with same CATH topology
3AKAA 2K0JA 1NX2A 2BBMA 5G08A 1A75A 4NQGA 4M2QA 2MHHA 1RFJA 1OQPA 2L98A 1TCFA 2ZNEA 1GGZA 2NZ0A 5AEQA 1HT9A 2KBIA 4XJKB 2LVIA 4AOMA 1JSAA 2M49B 1K8UA 1N2DA 5ER5A 1YX8A 1JF2A 1XK4A 1XYDA 1PVAA 2KNEA 4YGDB 1M31A 1ZOTB 4DRWA 4MBEA 3TDZA 1YURA 2OPOA 2PVBA 4XJKA 4GFTA 4ORBB 4PHJA 1RK9A 2JWWA 1OE9B 3CS1A 2MJWB 2QACA 1J55A 2WCEA 1YUTA 1NCZA 2I2RE 1R2UA 2BBNA 2M29A 1LA3A 2EC6C 2BCXA 4U8DA 1EG4A 5I2LA 1SMGA 2KAXA 1A4PA 2JZIA 2KQYA 1UHKA 1IH0A 1OMVA 1SY9A 4UPGA 1C07A 5I8NA 3I5FB 4NDCA 2D8NA 1S36A 1S5GZ 2M97A 3LLEA 1KFUL 1QX7A 3OP0A 2JQ6A 4HREE 1IJ6A 3SIBA 1K2HA 1NUBA 1FI5A 1QIWA 4YBHB 2HF5A 4PE4A 4MRXA 3TS5C 1V1GA 2Q4UA 2LUXA 1S6IA 2GGZA 1C7VA 2BE4A 1IJ5A 5J3XA 3FWCA 4QJ4B 1AJ4A 1LVCD 3VGOA 1EH2A 2OTGB 3NSLA 4FQOA 1WY9A 4NDDA 5K89A 2LC5A 2Y5IA 4ICBA 4TNCA 3PN7C 2SCPA 3WNXB 4CLNA 1F70A 1DGVA 1K95A 1DT7B 1QXPA 3A4UB 2GGMA 2SASA 1BF5A 1XFWO 1AHRA 3O78A 3MSEB 1CTRA 1XFYO 4OVNF 2DOQA 2FJUB 2ZNDA 1J1EA 3KHEA 4YRUA 3OX5A 1YRTB 1WRKA 2Q91A 4BY5A 1S6JA 4YI9A 2LVJA 1SCVA 1CMFA 1TRFA 1L2OC 4GUKA 1DJZA 1KSMA 1TNQA 5DKRA 1MWNA 5AXIA 1ODBA 3I5HB 2LUCA 3HX4A 3CLNA 3PALA 4MZJA 3BUNB 1QV1A 2JRFA 2JXLA 3AAJA 3BQ3A 1MUXA 1NWDA 2JU0A 1QASA 1XFUO 3EK7A 1EL4A 2E6WA 1KQMB 3IQOA 2WCFA 3O2PA 4GGFA 4CFQA 1K96A 1F71A 2FCDA 2KYCA 1YVLA 4PALA 3WXAA 5B8IB 1JBAA 1KWOC 2JNXA 3EKHA 1J7RA 2I7AA 1JF0A 2JTZA 1SR6C 1NX0A 3BUWB 4PDZA 3TDIA 3HCMA 3TDUA 4OCIA 1TIZA 1K94A 5KTYA 3I5IC 1A03A 1MHOA 3PFVA 5HKYA 1KK7Z 3ZNIA 1J7OA 2HPSA 4L9MA 3NSOA 5JOLA 3NSKA 4JQ0D 4F0ZB 2F2OA 2LMUA 3PATA 4OV2A 1QVIZ 1E8AA 1UP5A 1XFZO 2L0PA 3WHUB 5CPVA 1QX2A 1WDCB 1A2XA 5HKZA 2AAOA 2F8PA 3KO0A 3SIAA 4D1EA 1YTZC 2ZRTA 1SK6D 4WQ3A 1CFPA 2LCPA 1UHIA 1LKJA 2WORA 4GNKB 4A4BA 2F2PA 2ZRSA 3NXAA 1FI6A 4PE7A 2FOTA 4ZCUA 1IGVA 1UURA 4PCWA 2L50A 1IQ5A 1CDMA 1K9PA 1TCOB 3I5GC 5HKWA 1B8LA 1F54A 4PHNA 2CBLA 3JVTB 4GAOA 1EG3A 1PSBA 1YR5A 3BUMB 1TOPA 3BOWB 3VRPA 1OZOA 3F45A 3DF0A 4OR9B 1B9AA 1S6CA 3GK4X 2KFGA 1MXLC 2V53A 4MLWA 1M45A 2WC8A 4P2YB 1G4YR 2M9GA 1PVBA 1G33A 2MLEC 1QS7A 1KFUS 1QIVA 2Y4QA 1B8RA 5CSJA 3VRQA 3SG2A 2L5XB 2MLFC 3SG3A 5HLVA 1Y0VH 1CFDA 2HETA 1TN4A 5IBWA 2BCBA 1SKTA 2LE9B 3TUYB 2F3ZA 1YUUA 3KF9A 4PHKA 4R1EA 1QATA 1B8CA 1WLMA 2CNPA 3NSIA 2KBMA 2GV5A 4PE1A 3FIAA 1B7TY 3BXKA 1OMRA 1RTP1 2CCMA 4OKHA 2H61A 1WRZA 4A4CA 2I18A 1LA0A 3QRXA 4YGAA 2OS8B 1BG1A 1DJWA 2ZFDA 3I5FC 4WQ2A 4DS7A 1TNPA 2KI4B 2BE6A 2MBXA 1H4BA 3JTDB 2OTGC 3GK2A 2E30A 2JTTA 1DJYA 2KOTA 3AAKA 2LHIA 4YGCB 1CKKA 2COLB 1A75B 4M2PA 1XFXO 1PULA 3ZWHA 5PALA 2Y1NA 2PASA 1UHHA 1C7WA 3SG6A 1U5IA 1B1GA 1RECA 1F55A 1CDPA 4GGNA 5D7FA 5AFPA 4QJ5B 1ZUZA 1XA5A 1SNLA 2HQWA 2M0RA 3OHMB 1CDNA 2BCAA 1CB1A 4YGBB 1SRAA 1K93D 1NPQA 2PRUA 2WOSA 4GBAA 5AERA 1SBJA 4USLA 3CR2A 2NCPA 1SCMC 3D0YB 3FS7A 2M1UA 3GOFA 2F3YA 1PRWA 1DVIA 3KPXA 4CFRA 4WRIA 2ISDA 3CWGA 5BPJA 3FWBA 3CTNA 1KFXL 2KHNA 1NSHA 2JXCA 2K7CA 2AUCA 1SL9A 4DCKA 1A29A 1SYMA 4HSZA 4NDBA 1JC2A 3EK4A 2K8MB 2KI6C 3EK8A 3IF7A 2LMTA 2KI6D 2PALA 3ICBA 2B1UA 4ETOA 2VRGA 1UUSA 1CM4A 2TN4A 1OSAA 5ER4X 5CSFA 5TNCA 2AMIA 2H61C 1KFXS 1CNPA 2O5GA 3I5IB 1K9UA 5HYDA 2NLNA 2M1KB 2MAZA 4BY4A 2K2AA 1KWOB 1CM1A 2KFHA 1J7QA 1NX3A 1DJXA 1MXEA 1TNWA 1YRUB 4DIRA 1KCYA 2BL0B 2PSRA 4MEWA 1S3PA 2JT0A 1UHJA 1PALA 1BODA 2MA2A 2LLSA 4AQJA 4I5LB 4IL1A 1DGUA 4GPLB 1SPYA 2LVVA 1NYAA 1PSRA 4P5OE 2EC6B 2ZN9A 1CLLA 4MVFA 1KK8B 1V1FA 1WRLA 2BKHB 2I94A 1Y1AA 1Y1XA 1F4QA 3SG4A 1QLSA 4I5JA 3M0WA 5HLOA 2JOJA 2H2KA 1XVJA 3VROA 4C0JA 1N0YA 1R6PA 1DTLA 2K7BA 3TS5B 1M46A 3SJSA 2ZN8A 2CXJA 3WHTB 1CDLA 4CPVA 3DD4A 2L4HA 1B4CA 5KU1A 1B7TZ 3OX6A 1AVSA 2MRDA 1IRJA 3PM8A 2JT8A 3KEVA 3SG5A 5I2QA 1YVHA 4N1FA 2ZKMX 4MSPA 4CIDA 1QJTA 1DMOA 1XFVO 1XO5A 3EVRA 3GK1A 3PN7B 3I5GB 1JFJA 1LINA 3DVKA 1CMGA 1OZSA 2M8UA 1S26D 5F6TA 1K9KA 1SW8A 1X02A 3K21A 4XYNA 4MZKA 1RJVA 1MQ1A 1Q80A 2BL0C 1LXFC 1W7JB 2A4JA 3EVVA 1DF0A 3LK1A 3AKBA 1J1DA 1AK8A 3CR5X 2LLUA 2K7DA 3RLZA 1L7ZA 2KSPA 1KSOA 4C0LA 1L2OB 1IQ3A 1NCYA 1OOJA 2LLTA 1AP4A 2KAYA 2G9BA 5FYXA 2L51A 1B47A 3EVUA 4N5XA 1GQMA 1ALWA 5CSIA 4ZCVA 3TUYC 2JULA 5D69A 3LK0A 4HRGA 3E3RA 4GGFC 1F8HA 5CSNA 4FTGA 1D1OA 1UHNA 1Y6WA 2KQ6A 5I2OA 2BECA 3PLFB 2K61A 1CFCA 2LP3A 1DF0B 4I5KA 5GQQC 2OS8C 5KSZA 1QX5B 1ALVA 1U5IB 2WNDA 3OB2B 2QPTA 2RGIA 3SG7A 1CLBA 2FCEA 1S1EA 2KGBC 1J7PA 4MZLA 2L4IA 1FPWA 2G2BA 2L2EA 1BT6A 2K7OA 2R2IA 2KDHA 2JNFA 3D10A 5AANA 1SL7A 3BUXB 3CGAA 1DJHA 1KK7Y 1K90D 3O6BA 2LM5A 4ORAB 4PE0A 1GJYA 4AQIA 2WCBA 2LAPA 1WLZA 2Y1MA 2F33A 2P6BB 3DVMA 1BR4B 3RM1A 1N65A 1TNXA 2LNKA 3CR4X 3D0YA 1BU3A 4QJ3B 2NCOA 3BYAA 3VRRA 1QLKA 1KQVA 1NIWA 4C0KA 2LV7A 4MRYA 1OMDA 3JVTC 1SCMB 4YI8A 5DKQA 2HQ8A 2JC2A 1JWDA 3H4SE 5JJGA 1RWYA 3LL8B 1NP8A 4MN0A 2KFFA 2BKIB 2LHLA 1CFFA 2JT3A 2KAVA 2LVKA 1ZMZA 1EXRA 2EGDA 1CLMA 2M3WA 4M2OA 1PK0D 1FF1A 1JUOA 1ZACA 1GGWA 4Q04A 1W7IB 3O4YA 1G8IA 4ORCB 1IKUA 3IQQA 3C1VA 1DJIA 1IWQA 2LMVA 1DJGA 2NXQA 1VRKA 1ZFSA 2M7NA 1FBVA 1NX1A 1FW4A 2CTNA 4N1GA 2PMYA 1Y1UA 3TZ1A 1BR1B 3A8RA 4JPZB 1KQMC 1YUSA 4DUQA 1NCXA 1F4OA 3LCPC 2EHBA 1UWOA 2M7LA 1H8BA 1YX7A 3I5HC 1QTXA 2LANA 3VRNA 1MR8A 1QVIY 1SR6B 1BLQA 4I5NB 4YGEB 3OB1B 1XK4C 1KK8C 3DVEA 3CZTX 3EKJA 2K2FA 4JWQA 1EJ3A 2KI4C 3DF0B 1M63B 3JTDC 3BOWA 1BJFA 2CT9A 2IS9A 2O60A 4PHMA 1IG5A 5DKNA 1MF8B 1SL8A 2KYFA 2LP2A 1AUIB 1BOCA 4E68A 1S5GY 1WDCC 3DVJA 1TTXA 4HRHA 3PSRA 1QV0A 2KGRA 1RROA 3BUOB 1AJ5A 2JPTA 1BMOA 1HQVA 1JFKA 1M39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AKA A;  2K0J A;  1NX2 A;  2BBM A;  5G08 A;  1A75 A;  4NQG A;  4M2Q A;  2MHH A;  1RFJ A;  1OQP A;  2L98 A;  1TCF A;  2ZNE A;  1GGZ A;  2NZ0 A;  5AEQ A;  1HT9 A;  2KBI A;  4XJK B;  2LVI A;  4AOM A;  1JSA A;  2M49 B;  1K8U A;  1N2D A;  5ER5 A;  1YX8 A;  1JF2 A;  1XK4 A;  1XYD A;  1PVA A;  2KNE A;  4YGD B;  1M31 A;  1ZOT B;  4DRW A;  4MBE A;  3TDZ A;  1YUR A;  2OPO A;  2PVB A;  4XJK A;  4GFT A;  4ORB B;  4PHJ A;  1RK9 A;  2JWW A;  1OE9 B;  3CS1 A;  2MJW B;  2QAC A;  1J55 A;  2WCE A;  1YUT A;  1NCZ A;  2I2R E;  1R2U A;  2BBN A;  2M29 A;  1LA3 A;  2EC6 C;  2BCX A;  4U8D A;  1EG4 A;  5I2L A;  1SMG A;  2KAX A;  1A4P A;  2JZI A;  2KQY A;  1UHK A;  1IH0 A;  1OMV A;  1SY9 A;  4UPG A;  1C07 A;  5I8N A;  3I5F B;  4NDC A;  2D8N A;  1S36 A;  1S5G Z;  2M97 A;  3LLE A;  1KFU L;  1QX7 A;  3OP0 A;  2JQ6 A;  4HRE E;  1IJ6 A;  3SIB A;  1K2H A;  1NUB A;  1FI5 A;  1QIW A;  4YBH B;  2HF5 A;  4PE4 A;  4MRX A;  3TS5 C;  1V1G A;  2Q4U A;  2LUX A;  1S6I A;  2GGZ A;  1C7V A;  2BE4 A;  1IJ5 A;  5J3X A;  3FWC A;  4QJ4 B;  1AJ4 A;  1LVC D;  3VGO A;  1EH2 A;  2OTG B;  3NSL A;  4FQO A;  1WY9 A;  4NDD A;  5K89 A;  2LC5 A;  2Y5I A;  4ICB A;  4TNC A;  3PN7 C;  2SCP A;  3WNX B;  4CLN A;  1F70 A;  1DGV A;  1K95 A;  1DT7 B;  1QXP A;  3A4U B;  2GGM A;  2SAS A;  1BF5 A;  1XFW O;  1AHR A;  3O78 A;  3MSE B;  1CTR A;  1XFY O;  4OVN F;  2DOQ A;  2FJU B;  2ZND A;  1J1E A;  3KHE A;  4YRU A;  3OX5 A;  1YRT B;  1WRK A;  2Q91 A;  4BY5 A;  1S6J A;  4YI9 A;  2LVJ A;  1SCV A;  1CMF A;  1TRF A;  1L2O C;  4GUK A;  1DJZ A;  1KSM A;  1TNQ A;  5DKR A;  1MWN A;  5AXI A;  1ODB A;  3I5H B;  2LUC A;  3HX4 A;  3CLN A;  3PAL A;  4MZJ A;  3BUN B;  1QV1 A;  2JRF A;  2JXL A;  3AAJ A;  3BQ3 A;  1MUX A;  1NWD A;  2JU0 A;  1QAS A;  1XFU O;  3EK7 A;  1EL4 A;  2E6W A;  1KQM B;  3IQO A;  2WCF A;  3O2P A;  4GGF A;  4CFQ A;  1K96 A;  1F71 A;  2FCD A;  2KYC A;  1YVL A;  4PAL A;  3WXA A;  5B8I B;  1JBA A;  1KWO C;  2JNX A;  3EKH A;  1J7R A;  2I7A A;  1JF0 A;  2JTZ A;  1SR6 C;  1NX0 A;  3BUW B;  4PDZ A;  3TDI A;  3HCM A;  3TDU A;  4OCI A;  1TIZ A;  1K94 A;  5KTY A;  3I5I C;  1A03 A;  1MHO A;  3PFV A;  5HKY A;  1KK7 Z;  3ZNI A;  1J7O A;  2HPS A;  4L9M A;  3NSO A;  5JOL A;  3NSK A;  4JQ0 D;  4F0Z B;  2F2O A;  2LMU A;  3PAT A;  4OV2 A;  1QVI Z;  1E8A A;  1UP5 A;  1XFZ O;  2L0P A;  3WHU B;  5CPV A;  1QX2 A;  1WDC B;  1A2X A;  5HKZ A;  2AAO A;  2F8P A;  3KO0 A;  3SIA A;  4D1E A;  1YTZ C;  2ZRT A;  1SK6 D;  4WQ3 A;  1CFP A;  2LCP A;  1UHI A;  1LKJ A;  2WOR A;  4GNK B;  4A4B A;  2F2P A;  2ZRS A;  3NXA A;  1FI6 A;  4PE7 A;  2FOT A;  4ZCU A;  1IGV A;  1UUR A;  4PCW A;  2L50 A;  1IQ5 A;  1CDM A;  1K9P A;  1TCO B;  3I5G C;  5HKW A;  1B8L A;  1F54 A;  4PHN A;  2CBL A;  3JVT B;  4GAO A;  1EG3 A;  1PSB A;  1YR5 A;  3BUM B;  1TOP A;  3BOW B;  3VRP A;  1OZO A;  3F45 A;  3DF0 A;  4OR9 B;  1B9A A;  1S6C A;  3GK4 X;  2KFG A;  1MXL C;  2V53 A;  4MLW A;  1M45 A;  2WC8 A;  4P2Y B;  1G4Y R;  2M9G A;  1PVB A;  1G33 A;  2MLE C;  1QS7 A;  1KFU S;  1QIV A;  2Y4Q A;  1B8R A;  5CSJ A;  3VRQ A;  3SG2 A;  2L5X B;  2MLF C;  3SG3 A;  5HLV A;  1Y0V H;  1CFD A;  2HET A;  1TN4 A;  5IBW A;  2BCB A;  1SKT A;  2LE9 B;  3TUY B;  2F3Z A;  1YUU A;  3KF9 A;  4PHK A;  4R1E A;  1QAT A;  1B8C A;  1WLM A;  2CNP A;  3NSI A;  2KBM A;  2GV5 A;  4PE1 A;  3FIA A;  1B7T Y;  3BXK A;  1OMR A;  1RTP 1;  2CCM A;  4OKH A;  2H61 A;  1WRZ A;  4A4C A;  2I18 A;  1LA0 A;  3QRX A;  4YGA A;  2OS8 B;  1BG1 A;  1DJW A;  2ZFD A;  3I5F C;  4WQ2 A;  4DS7 A;  1TNP A;  2KI4 B;  2BE6 A;  2MBX A;  1H4B A;  3JTD B;  2OTG C;  3GK2 A;  2E30 A;  2JTT A;  1DJY A;  2KOT A;  3AAK A;  2LHI A;  4YGC B;  1CKK A;  2COL B;  1A75 B;  4M2P A;  1XFX O;  1PUL A;  3ZWH A;  5PAL A;  2Y1N A;  2PAS A;  1UHH A;  1C7W A;  3SG6 A;  1U5I A;  1B1G A;  1REC A;  1F55 A;  1CDP A;  4GGN A;  5D7F A;  5AFP A;  4QJ5 B;  1ZUZ A;  1XA5 A;  1SNL A;  2HQW A;  2M0R A;  3OHM B;  1CDN A;  2BCA A;  1CB1 A;  4YGB B;  1SRA A;  1K93 D;  1NPQ A;  2PRU A;  2WOS A;  4GBA A;  5AER A;  1SBJ A;  4USL A;  3CR2 A;  2NCP A;  1SCM C;  3D0Y B;  3FS7 A;  2M1U A;  3GOF A;  2F3Y A;  1PRW A;  1DVI A;  3KPX A;  4CFR A;  4WRI A;  2ISD A;  3CWG A;  5BPJ A;  3FWB A;  3CTN A;  1KFX L;  2KHN A;  1NSH A;  2JXC A;  2K7C A;  2AUC A;  1SL9 A;  4DCK A;  1A29 A;  1SYM A;  4HSZ A;  4NDB A;  1JC2 A;  3EK4 A;  2K8M B;  2KI6 C;  3EK8 A;  3IF7 A;  2LMT A;  2KI6 D;  2PAL A;  3ICB A;  2B1U A;  4ETO A;  2VRG A;  1UUS A;  1CM4 A;  2TN4 A;  1OSA A;  5ER4 X;  5CSF A;  5TNC A;  2AMI A;  2H61 C;  1KFX S;  1CNP A;  2O5G A;  3I5I B;  1K9U A;  5HYD A;  2NLN A;  2M1K B;  2MAZ A;  4BY4 A;  2K2A A;  1KWO B;  1CM1 A;  2KFH A;  1J7Q A;  1NX3 A;  1DJX A;  1MXE A;  1TNW A;  1YRU B;  4DIR A;  1KCY A;  2BL0 B;  2PSR A;  4MEW A;  1S3P A;  2JT0 A;  1UHJ A;  1PAL A;  1BOD A;  2MA2 A;  2LLS A;  4AQJ A;  4I5L B;  4IL1 A;  1DGU A;  4GPL B;  1SPY A;  2LVV A;  1NYA A;  1PSR A;  4P5O E;  2EC6 B;  2ZN9 A;  1CLL A;  4MVF A;  1KK8 B;  1V1F A;  1WRL A;  2BKH B;  2I94 A;  1Y1A A;  1Y1X A;  1F4Q A;  3SG4 A;  1QLS A;  4I5J A;  3M0W A;  5HLO A;  2JOJ A;  2H2K A;  1XVJ A;  3VRO A;  4C0J A;  1N0Y A;  1R6P A;  1DTL A;  2K7B A;  3TS5 B;  1M46 A;  3SJS A;  2ZN8 A;  2CXJ A;  3WHT B;  1CDL A;  4CPV A;  3DD4 A;  2L4H A;  1B4C A;  5KU1 A;  1B7T Z;  3OX6 A;  1AVS A;  2MRD A;  1IRJ A;  3PM8 A;  2JT8 A;  3KEV A;  3SG5 A;  5I2Q A;  1YVH A;  4N1F A;  2ZKM X;  4MSP A;  4CID A;  1QJT A;  1DMO A;  1XFV O;  1XO5 A;  3EVR A;  3GK1 A;  3PN7 B;  3I5G B;  1JFJ A;  1LIN A;  3DVK A;  1CMG A;  1OZS A;  2M8U A;  1S26 D;  5F6T A;  1K9K A;  1SW8 A;  1X02 A;  3K21 A;  4XYN A;  4MZK A;  1RJV A;  1MQ1 A;  1Q80 A;  2BL0 C;  1LXF C;  1W7J B;  2A4J A;  3EVV A;  1DF0 A;  3LK1 A;  3AKB A;  1J1D A;  1AK8 A;  3CR5 X;  2LLU A;  2K7D A;  3RLZ A;  1L7Z A;  2KSP A;  1KSO A;  4C0L A;  1L2O B;  1IQ3 A;  1NCY A;  1OOJ A;  2LLT A;  1AP4 A;  2KAY A;  2G9B A;  5FYX A;  2L51 A;  1B47 A;  3EVU A;  4N5X A;  1GQM A;  1ALW A;  5CSI A;  4ZCV A;  3TUY C;  2JUL A;  5D69 A;  3LK0 A;  4HRG A;  3E3R A;  4GGF C;  1F8H A;  5CSN A;  4FTG A;  1D1O A;  1UHN A;  1Y6W A;  2KQ6 A;  5I2O A;  2BEC A;  3PLF B;  2K61 A;  1CFC A;  2LP3 A;  1DF0 B;  4I5K A;  5GQQ C;  2OS8 C;  5KSZ A;  1QX5 B;  1ALV A;  1U5I B;  2WND A;  3OB2 B;  2QPT A;  2RGI A;  3SG7 A;  1CLB A;  2FCE A;  1S1E A;  2KGB C;  1J7P A;  4MZL A;  2L4I A;  1FPW A;  2G2B A;  2L2E A;  1BT6 A;  2K7O A;  2R2I A;  2KDH A;  2JNF A;  3D10 A;  5AAN A;  1SL7 A;  3BUX B;  3CGA A;  1DJH A;  1KK7 Y;  1K90 D;  3O6B A;  2LM5 A;  4ORA B;  4PE0 A;  1GJY A;  4AQI A;  2WCB A;  2LAP A;  1WLZ A;  2Y1M A;  2F33 A;  2P6B B;  3DVM A;  1BR4 B;  3RM1 A;  1N65 A;  1TNX A;  2LNK A;  3CR4 X;  3D0Y A;  1BU3 A;  4QJ3 B;  2NCO A;  3BYA A;  3VRR A;  1QLK A;  1KQV A;  1NIW A;  4C0K A;  2LV7 A;  4MRY A;  1OMD A;  3JVT C;  1SCM B;  4YI8 A;  5DKQ A;  2HQ8 A;  2JC2 A;  1JWD A;  3H4S E;  5JJG A;  1RWY A;  3LL8 B;  1NP8 A;  4MN0 A;  2KFF A;  2BKI B;  2LHL A;  1CFF A;  2JT3 A;  2KAV A;  2LVK A;  1ZMZ A;  1EXR A;  2EGD A;  1CLM A;  2M3W A;  4M2O A;  1PK0 D;  1FF1 A;  1JUO A;  1ZAC A;  1GGW A;  4Q04 A;  1W7I B;  3O4Y A;  1G8I A;  4ORC B;  1IKU A;  3IQQ A;  3C1V A;  1DJI A;  1IWQ A;  2LMV A;  1DJG A;  2NXQ A;  1VRK A;  1ZFS A;  2M7N A;  1FBV A;  1NX1 A;  1FW4 A;  2CTN A;  4N1G A;  2PMY A;  1Y1U A;  3TZ1 A;  1BR1 B;  3A8R A;  4JPZ B;  1KQM C;  1YUS A;  4DUQ A;  1NCX A;  1F4O A;  3LCP C;  2EHB A;  1UWO A;  2M7L A;  1H8B A;  1YX7 A;  3I5H C;  1QTX A;  2LAN A;  3VRN A;  1MR8 A;  1QVI Y;  1SR6 B;  1BLQ A;  4I5N B;  4YGE B;  3OB1 B;  1XK4 C;  1KK8 C;  3DVE A;  3CZT X;  3EKJ A;  2K2F A;  4JWQ A;  1EJ3 A;  2KI4 C;  3DF0 B;  1M63 B;  3JTD C;  3BOW A;  1BJF A;  2CT9 A;  2IS9 A;  2O60 A;  4PHM A;  1IG5 A;  5DKN A;  1MF8 B;  1SL8 A;  2KYF A;  2LP2 A;  1AUI B;  1BOC A;  4E68 A;  1S5G Y;  1WDC C;  3DVJ A;  1TTX A;  4HRH A;  3PSR A;  1QV0 A;  2KGR A;  1RRO A;  3BUO B;  1AJ5 A;  2JPT A;  1BMO A;  1HQV A;  1JFK A;  1M39 A; 
#chains in the Genus database with same CATH topology
 4JD9 A;  3AKA A;  3DY9 A;  1IIO A;  2K0J A;  1NX2 A;  2BBM A;  5G08 A;  1A75 A;  1TUZ A;  4NQG A;  4M2Q A;  2MHH A;  1RFJ A;  1OQP A;  2L98 A;  1TCF A;  2QEH A;  1GGZ A;  2ZNE A;  2NZ0 A;  5AEQ A;  1HT9 A;  4F7F A;  2KBI A;  4XJK B;  2LVI A;  4AOM A;  3D74 A;  1JSA A;  2M49 B;  1K8U A;  1N2D A;  2WCK A;  1W9Z A;  5ER5 A;  1YX8 A;  1JF2 A;  1XK4 A;  1XYD A;  1PVA A;  2KNE A;  4YGD B;  1M31 A;  1ZOT B;  4DRW A;  3IVT A;  4MBE A;  3TDZ A;  1YUR A;  2OPO A;  2PVB A;  4XJK A;  4GFT A;  4ORB B;  4PHJ A;  1RK9 A;  2GTE A;  1OE9 B;  2JWW A;  2MJW B;  2QAC A;  3B87 A;  3CS1 A;  1J55 A;  2WCE A;  1YUT A;  1NCZ A;  2I2R E;  3B6X A;  1OOF A;  1R2U A;  2BBN A;  2M29 A;  1LA3 A;  2EC6 C;  2BCX A;  5HL1 A;  4U8D A;  1EG4 A;  5I2L A;  1SMG A;  2KAX A;  1A4P A;  3VB1 A;  2JZI A;  2KQY A;  1UHK A;  1IH0 A;  1OMV A;  1SY9 A;  4UPG A;  1C07 A;  5I8N A;  3I5F B;  4NDC A;  2D8N A;  1S36 A;  1S5G Z;  2M97 A;  2PYQ A;  3LLE A;  1KFU L;  1QX7 A;  3OP0 A;  2JQ6 A;  4HRE E;  1IJ6 A;  3SIB A;  3N7H A;  1LS8 A;  1K2H A;  1NUB A;  1FI5 A;  1QIW A;  4YBH B;  2HF5 A;  4PE4 A;  4MRX A;  3TS5 C;  1V1G A;  2Q4U A;  2LUX A;  1S6I A;  3R1P A;  2GGZ A;  1C7V A;  2BE4 A;  1IJ5 A;  3R1V A;  5DIC A;  3FWC A;  5J3X A;  3D76 A;  4QJ4 B;  1AJ4 A;  1LVC D;  3VGO A;  1EH2 A;  2OTG B;  3NSL A;  4FQO A;  1WY9 A;  1Z2C B;  4NDD A;  5K89 A;  2LC5 A;  2Y5I A;  4ICB A;  4TNC A;  3B86 A;  3PN7 C;  2SCP A;  3WNX B;  1P28 A;  4CLN A;  1F70 A;  1DGV A;  1K95 A;  1DT7 B;  1QXP A;  3A4U B;  2GGM A;  2JPO A;  3CZ2 A;  3OGN A;  2SAS A;  4PT1 A;  1BF5 A;  1XFW O;  1AHR A;  3O78 A;  3MSE B;  1CTR A;  3D77 A;  1XFY O;  4OVN F;  2DOQ A;  2FJU B;  3S0A A;  2ZND A;  1J1E A;  3KHE A;  4YRU A;  3OX5 A;  3BFH A;  1YRT B;  1WRK A;  2Q91 A;  4BY5 A;  1S6J A;  4YI9 A;  2LVJ A;  1SCV A;  1CMF A;  1TRF A;  1L2O C;  4GUK A;  1DJZ A;  1KSM A;  1TNQ A;  5DKR A;  1MWN A;  5AXI A;  1ODB A;  3I5H B;  2LUC A;  3HX4 A;  3CLN A;  3PAL A;  4MZJ A;  3BUN B;  1QV1 A;  2JRF A;  2JXL A;  3AAJ A;  3BQ3 A;  1MUX A;  1NWD A;  2JU0 A;  1QAS A;  1XFU O;  3EK7 A;  3NHI A;  3S0F A;  1EL4 A;  2E6W A;  1KQM B;  3IQO A;  2WCF A;  3O2P A;  4GGF A;  4CFQ A;  1K96 A;  3NHT A;  2FCD A;  1F71 A;  2KYC A;  1YVL A;  4PAL A;  3WXA A;  5B8I B;  1JBA A;  1KWO C;  2JNX A;  1DEK A;  3EKH A;  1J7R A;  2I7A A;  3L47 A;  1JF0 A;  2JTZ A;  1SR6 C;  1NX0 A;  3DXL A;  3BUW B;  4PDZ A;  3TDI A;  3HCM A;  3TDU A;  4OCI A;  1TIZ A;  1K94 A;  5KTY A;  3I5I C;  1A03 A;  1MHO A;  1OOG A;  3PFV A;  5HKY A;  1KK7 Z;  2WC5 A;  3ZNI A;  1J7O A;  2HPS A;  4L9M A;  5FI2 A;  3NSO A;  5JOL A;  3NSK A;  4JQ0 D;  4F0Z B;  2F2O A;  2LMU A;  3PAT A;  5I94 A;  4OV2 A;  1QVI Z;  1E8A A;  1UP5 A;  1XFZ O;  2L0P A;  3WHU B;  5CPV A;  1QX2 A;  1WDC B;  1A2X A;  5HKZ A;  1C3Z A;  2AAO A;  2F8P A;  3KO0 A;  3SIA A;  1YTZ C;  2ZRT A;  1SK6 D;  4WQ3 A;  4D1E A;  1CFP A;  2LCP A;  1UHI A;  1LKJ A;  2QEV A;  3S0E A;  2WOR A;  4GAO A;  1XFR A;  4GNK B;  4A4B A;  2F2P A;  2ZRS A;  3NXA A;  1FI6 A;  4PE7 A;  2FOT A;  2H8V A;  4ZCU A;  1DEL A;  1IGV A;  1UUR A;  4PCW A;  3OBV A;  2L50 A;  1IQ5 A;  3CDN A;  1CDM A;  1K9P A;  3Q8I A;  1TCO B;  3I5G C;  5HKW A;  1B8L A;  1F54 A;  4PHN A;  1OOI X;  2CBL A;  3JVT B;  4FQT A;  1EG3 A;  1PSB A;  1YR5 A;  3BUM B;  1TOP A;  3BOW B;  3L4A A;  1OZO A;  3F45 A;  3VRP A;  3DF0 A;  4OR9 B;  1B9A A;  1S6C A;  3GK4 X;  2KFG A;  1MXL C;  2V53 A;  3PJI A;  4MLW A;  1M45 A;  2WC8 A;  4P2Y B;  1G4Y R;  2M9G A;  1PVB A;  1G33 A;  2MLE C;  2FJY A;  2WCM A;  1QS7 A;  2L2C A;  3B88 A;  1H4B A;  1KFU S;  1QIV A;  1QWV A;  2Y4Q A;  3SS4 A;  1B8R A;  5CSJ A;  3VRQ A;  2WCH A;  3SG2 A;  2L5X B;  2MLF C;  3SG3 A;  5HLV A;  1Y0V H;  1CFD A;  2HET A;  1TN4 A;  5IBW A;  2BCB A;  1SKT A;  2LE9 B;  2WCJ A;  3TUY B;  2F3Z A;  1YUU A;  3KF9 A;  4PHK A;  4R1E A;  1QAT A;  1B8C A;  1WLM A;  2CNP A;  3FE9 A;  3NSI A;  2KBM A;  2GV5 A;  4PE1 A;  3FIA A;  4JKT A;  1B7T Y;  3BXK A;  1OMR A;  1RTP 1;  3D78 A;  2CCM A;  4OKH A;  2H61 A;  1WRZ A;  1GM0 A;  4A4C A;  2I18 A;  1LA0 A;  3QRX A;  1TWO A;  2OS8 B;  4YGA A;  1BG1 A;  1DJW A;  2ZFD A;  3I5F C;  4INX A;  4WQ2 A;  1TNP A;  2KI4 B;  2BE6 A;  2MBX A;  3S0D A;  3JTD B;  4DS7 A;  2OTG C;  3GK2 A;  2E30 A;  2JTT A;  1DJY A;  2KOT A;  3AAK A;  2LHI A;  4YGC B;  1CKK A;  3CZ1 A;  2COL B;  3CAB A;  1A75 B;  4M2P A;  1XFX O;  1PUL A;  3R72 A;  3ZWH A;  5PAL A;  2Y1N A;  2PAS A;  1UHH A;  1C7W A;  3SG6 A;  1U5I A;  1B1G A;  1REC A;  1F55 A;  1CDP A;  4GGN A;  5D7F A;  5AFP A;  4QJ5 B;  1ZUZ A;  3BFB A;  1XA5 A;  1SNL A;  1T14 A;  2HQW A;  2PQL A;  3UNW A;  2M0R A;  3OHM B;  1CDN A;  2BCA A;  1CB1 A;  4YGB B;  3NGV A;  1SRA A;  1K93 D;  1NPQ A;  2KPH A;  2PRU A;  2WOS A;  4GBA A;  5AER A;  1SBJ A;  4USL A;  3CR2 A;  2NCP A;  1SCM C;  3D0Y B;  3FS7 A;  3SS5 A;  3O4X A;  2KLE A;  2M1U A;  3GOF A;  2F3Y A;  1PRW A;  1DVI A;  3KPX A;  4CFR A;  4WRI A;  2ISD A;  3CWG A;  3D75 A;  5BPJ A;  3FWB A;  3CTN A;  1KFX L;  2KHN A;  1NSH A;  2JXC A;  2K7C A;  4OZD A;  2AUC A;  1SL9 A;  4DCK A;  1A29 A;  1SYM A;  4HSZ A;  4NDB A;  3QME A;  3EK4 A;  2K8M B;  2KI6 C;  3EK8 A;  3IF7 A;  1OW4 A;  2LMT A;  2KI6 D;  2PAL A;  3ICB A;  2B1U A;  4ETO A;  2VRG A;  1UUS A;  1CM4 A;  2TN4 A;  1OSA A;  5ER4 X;  5CSF A;  5TNC A;  2AMI A;  3K1E A;  2H61 C;  1KFX S;  1CNP A;  2ERB A;  2O5G A;  2QDI A;  3I5I B;  1K9U A;  5HYD A;  2NLN A;  2M1K B;  2MAZ A;  4BY4 A;  3V2L A;  2K2A A;  1KWO B;  1CM1 A;  2KFH A;  1J7Q A;  1Z4H A;  1NX3 A;  1DJX A;  1MXE A;  1TNW A;  1YRU B;  4DIR A;  1GGW A;  1KCY A;  2BL0 B;  2PSR A;  4MEW A;  1S3P A;  2JT0 A;  1UHJ A;  1PAL A;  1BOD A;  2MA2 A;  2LLS A;  4AQJ A;  4I5L B;  4IL1 A;  1DGU A;  4GPL B;  1SPY A;  2LVV A;  1NYA A;  1PSR A;  4P5O E;  2EC6 B;  2ZN9 A;  1CLL A;  4MVF A;  1KK8 B;  3D73 A;  1V1F A;  1WRL A;  2BKH B;  2I94 A;  1Y1A A;  1Y1X A;  1F4Q A;  3SG4 A;  1QLS A;  4I5J A;  3M0W A;  3L4L A;  5HLO A;  2JOJ A;  2H2K A;  1XVJ A;  3VRO A;  4C0J A;  1N0Y A;  1R6P A;  1DTL A;  2K7B A;  3TS5 B;  1M46 A;  3SJS A;  2ZN8 A;  2CXJ A;  3WHT B;  1CDL A;  4CPV A;  3DD4 A;  2L4H A;  1B4C A;  5KU1 A;  1B7T Z;  3OX6 A;  1AVS A;  2MRD A;  1IRJ A;  3PM8 A;  2JT8 A;  3KEV A;  3SG5 A;  4IJ7 A;  5I2Q A;  1YVH A;  4INW A;  4N1F A;  2ZKM X;  3CYZ A;  4MSP A;  4CID A;  1QJT A;  1DMO A;  1XFV O;  1XO5 A;  3EVR A;  3GK1 A;  3PN7 B;  3I5G B;  5D3O A;  1LIN A;  3DVK A;  3DYE A;  1CMG A;  1JFJ A;  1OZS A;  2M8U A;  1S26 D;  5F6T A;  1K9K A;  1SW8 A;  1X02 A;  3K21 A;  4XYN A;  4MZK A;  1RJV A;  1MQ1 A;  1Q80 A;  2BL0 C;  1LXF C;  1W7J B;  2A4J A;  1SSE B;  3EVV A;  1DF0 A;  3LK1 A;  2P71 A;  1J1D A;  3AKB A;  3CR5 X;  3R1O A;  1AK8 A;  2LLU A;  2K7D A;  3B7A A;  3RLZ A;  1L7Z A;  2KSP A;  1KSO A;  4C0L A;  1ORG A;  1L2O B;  1IQ3 A;  1NCY A;  1OOJ A;  2LLT A;  1AP4 A;  2KAY A;  2G9B A;  5FYX A;  2L51 A;  1B47 A;  3EVU A;  4N5X A;  1GQM A;  1ALW A;  5CSI A;  4ZCV A;  3TUY C;  2JUL A;  5D69 A;  2P70 A;  1C3Y A;  3LK0 A;  4HRG A;  3E3R A;  4GGF C;  1F8H A;  5CSN A;  4FTG A;  1OOH A;  1D1O A;  1UHN A;  1Y6W A;  2KQ6 A;  5I2O A;  2BEC A;  3PLF B;  2K61 A;  1CFC A;  2LP3 A;  2WC6 A;  1DF0 B;  4I5K A;  5GQQ C;  2OS8 C;  5KSZ A;  1QX5 B;  1ALV A;  2L5Y A;  3BFA A;  1U5I B;  2WND A;  3OB2 B;  2QPT A;  2RGI A;  3S0G A;  3SG7 A;  2FCE A;  1CLB A;  1S1E A;  2KGB C;  1J7P A;  4MZL A;  2L4I A;  1FPW A;  2K60 A;  2G2B A;  2L2E A;  1BT6 A;  2K7O A;  2R2I A;  2KDH A;  2JNF A;  3D10 A;  5AAN A;  1SL7 A;  3BUX B;  3CGA A;  3EG5 B;  1DJH A;  1KK7 Y;  1K90 D;  3O6B A;  2LM5 A;  4ORA B;  4PE0 A;  1GJY A;  4AQI A;  2WCB A;  2LAP A;  1WLZ A;  2Y1M A;  2F33 A;  2P6B B;  3PM2 A;  3DVM A;  1BR4 B;  3RM1 A;  1N65 A;  2BNX A;  3CZ0 A;  1TNX A;  2LNK A;  3CR4 X;  3D0Y A;  1BU3 A;  1TUJ A;  4QJ3 B;  2NCO A;  3BYA A;  3VRR A;  1QLK A;  3S0B A;  1KQV A;  1NIW A;  4C0K A;  2LV7 A;  4MRY A;  1OMD A;  3JVT C;  1SCM B;  4YI8 A;  5DKQ A;  2HQ8 A;  2JC2 A;  3DZT A;  1JWD A;  3H4S E;  5JJG A;  5FI6 A;  1RWY A;  1DQE A;  2QEB A;  3LL8 B;  1NP8 A;  4MN0 A;  2KFF A;  2KLD A;  2BKI B;  2LHL A;  1CFF A;  2JT3 A;  2KAV A;  2LVK A;  3RZS A;  5FI7 A;  1ZMZ A;  1EXR A;  2EGD A;  1CLM A;  2M3W A;  4M2O A;  1PK0 D;  1FF1 A;  1JUO A;  1ZAC A;  2YGU A;  4Q04 A;  1W7I B;  3O4Y A;  1G8I A;  3BJH A;  4ORC B;  3UO9 A;  1IKU A;  3IQQ A;  3C1V A;  1DJI A;  1IWQ A;  2LMV A;  1DJG A;  2NXQ A;  1VRK A;  1ZFS A;  2M7N A;  1FBV A;  2WCL A;  1NX1 A;  1FW4 A;  2CTN A;  4N1G A;  2PMY A;  1Y1U A;  3TZ1 A;  1BR1 B;  3A8R A;  2QEO A;  4JPZ B;  1KQM C;  1YUS A;  4DUQ A;  1NCX A;  1F4O A;  3LCP C;  1JC2 A;  2EHB A;  1UWO A;  2M7L A;  1H8B A;  1YX7 A;  3I5H C;  1QTX A;  2LAN A;  5EL2 A;  3VRN A;  1DC1 A;  1MR8 A;  1QVI Y;  1SR6 B;  1BLQ A;  4I5N B;  4YGE B;  4KYN A;  3OB1 B;  1XK4 C;  1KK8 C;  3DVE A;  3CZT X;  3EKJ A;  3SS3 A;  2K2F A;  4JWQ A;  1EJ3 A;  2KI4 C;  3DF0 B;  1M63 B;  3JTD C;  3BOW A;  1BJF A;  2CT9 A;  2IS9 A;  2O60 A;  4PHM A;  1IG5 A;  3FE6 A;  5DKN A;  1MF8 B;  1SL8 A;  2KYF A;  2BAP A;  2LP2 A;  1AUI B;  1BOC A;  4E68 A;  1S5G Y;  1WDC C;  3DVJ A;  1TTX A;  4HRH A;  3PSR A;  1QV0 A;  2KGR A;  1RRO A;  3BUO B;  1AJ5 A;  2JPT A;  1BMO A;  1HQV A;  3FE8 A;  1JFK A;  1M39 A; 
#chains in the Genus database with same CATH homology
 3AKA A;  2K0J A;  1NX2 A;  2BBM A;  5G08 A;  1A75 A;  4NQG A;  4M2Q A;  2MHH A;  1RFJ A;  1OQP A;  2L98 A;  1TCF A;  2ZNE A;  1GGZ A;  2NZ0 A;  5AEQ A;  1HT9 A;  2KBI A;  4XJK B;  2LVI A;  4AOM A;  1JSA A;  2M49 B;  1K8U A;  1N2D A;  5ER5 A;  1YX8 A;  1JF2 A;  1XK4 A;  1XYD A;  1PVA A;  2KNE A;  4YGD B;  1M31 A;  1ZOT B;  4DRW A;  4MBE A;  3TDZ A;  1YUR A;  2OPO A;  2PVB A;  4XJK A;  4GFT A;  4ORB B;  4PHJ A;  1RK9 A;  2JWW A;  1OE9 B;  3CS1 A;  2MJW B;  2QAC A;  1J55 A;  2WCE A;  1YUT A;  1NCZ A;  2I2R E;  1R2U A;  2BBN A;  2M29 A;  1LA3 A;  2EC6 C;  2BCX A;  4U8D A;  1EG4 A;  5I2L A;  1SMG A;  2KAX A;  1A4P A;  2JZI A;  2KQY A;  1UHK A;  1IH0 A;  1OMV A;  1SY9 A;  4UPG A;  1C07 A;  5I8N A;  3I5F B;  4NDC A;  2D8N A;  1S36 A;  1S5G Z;  2M97 A;  3LLE A;  1KFU L;  1QX7 A;  3OP0 A;  2JQ6 A;  4HRE E;  1IJ6 A;  3SIB A;  1K2H A;  1NUB A;  1FI5 A;  1QIW A;  4YBH B;  2HF5 A;  4PE4 A;  4MRX A;  3TS5 C;  1V1G A;  2Q4U A;  2LUX A;  1S6I A;  2GGZ A;  1C7V A;  2BE4 A;  1IJ5 A;  5J3X A;  3FWC A;  4QJ4 B;  1AJ4 A;  1LVC D;  3VGO A;  1EH2 A;  2OTG B;  3NSL A;  4FQO A;  1WY9 A;  4NDD A;  5K89 A;  2LC5 A;  2Y5I A;  4ICB A;  4TNC A;  3PN7 C;  2SCP A;  3WNX B;  4CLN A;  1F70 A;  1DGV A;  1K95 A;  1DT7 B;  1QXP A;  3A4U B;  2GGM A;  2SAS A;  1BF5 A;  1XFW O;  1AHR A;  3O78 A;  3MSE B;  1CTR A;  1XFY O;  4OVN F;  2DOQ A;  2FJU B;  2ZND A;  1J1E A;  3KHE A;  4YRU A;  3OX5 A;  1YRT B;  1WRK A;  2Q91 A;  4BY5 A;  1S6J A;  4YI9 A;  2LVJ A;  1SCV A;  1CMF A;  1TRF A;  1L2O C;  4GUK A;  1DJZ A;  1KSM A;  1TNQ A;  5DKR A;  1MWN A;  5AXI A;  1ODB A;  3I5H B;  2LUC A;  3HX4 A;  3CLN A;  3PAL A;  4MZJ A;  3BUN B;  1QV1 A;  2JRF A;  2JXL A;  3AAJ A;  3BQ3 A;  1MUX A;  1NWD A;  2JU0 A;  1QAS A;  1XFU O;  3EK7 A;  1EL4 A;  2E6W A;  1KQM B;  3IQO A;  2WCF A;  3O2P A;  4GGF A;  4CFQ A;  1K96 A;  1F71 A;  2FCD A;  2KYC A;  1YVL A;  4PAL A;  3WXA A;  5B8I B;  1JBA A;  1KWO C;  2JNX A;  3EKH A;  1J7R A;  2I7A A;  1JF0 A;  2JTZ A;  1SR6 C;  1NX0 A;  3BUW B;  4PDZ A;  3TDI A;  3HCM A;  3TDU A;  4OCI A;  1TIZ A;  1K94 A;  5KTY A;  3I5I C;  1A03 A;  1MHO A;  3PFV A;  5HKY A;  1KK7 Z;  3ZNI A;  1J7O A;  2HPS A;  4L9M A;  3NSO A;  5JOL A;  3NSK A;  4JQ0 D;  4F0Z B;  2F2O A;  2LMU A;  3PAT A;  4OV2 A;  1QVI Z;  1E8A A;  1UP5 A;  1XFZ O;  2L0P A;  3WHU B;  5CPV A;  1QX2 A;  1WDC B;  1A2X A;  5HKZ A;  2AAO A;  2F8P A;  3KO0 A;  3SIA A;  4D1E A;  1YTZ C;  2ZRT A;  1SK6 D;  4WQ3 A;  1CFP A;  2LCP A;  1UHI A;  1LKJ A;  2WOR A;  4GNK B;  4A4B A;  2F2P A;  2ZRS A;  3NXA A;  1FI6 A;  4PE7 A;  2FOT A;  4ZCU A;  1IGV A;  1UUR A;  4PCW A;  2L50 A;  1IQ5 A;  1CDM A;  1K9P A;  1TCO B;  3I5G C;  5HKW A;  1B8L A;  1F54 A;  4PHN A;  2CBL A;  3JVT B;  4GAO A;  1EG3 A;  1PSB A;  1YR5 A;  3BUM B;  1TOP A;  3BOW B;  3VRP A;  1OZO A;  3F45 A;  3DF0 A;  4OR9 B;  1B9A A;  1S6C A;  3GK4 X;  2KFG A;  1MXL C;  2V53 A;  4MLW A;  1M45 A;  2WC8 A;  4P2Y B;  1G4Y R;  2M9G A;  1PVB A;  1G33 A;  2MLE C;  1QS7 A;  1KFU S;  1QIV A;  2Y4Q A;  1B8R A;  5CSJ A;  3VRQ A;  3SG2 A;  2L5X B;  2MLF C;  3SG3 A;  5HLV A;  1Y0V H;  1CFD A;  2HET A;  1TN4 A;  5IBW A;  2BCB A;  1SKT A;  2LE9 B;  3TUY B;  2F3Z A;  1YUU A;  3KF9 A;  4PHK A;  4R1E A;  1QAT A;  1B8C A;  1WLM A;  2CNP A;  3NSI A;  2KBM A;  2GV5 A;  4PE1 A;  3FIA A;  1B7T Y;  3BXK A;  1OMR A;  1RTP 1;  2CCM A;  4OKH A;  2H61 A;  1WRZ A;  4A4C A;  2I18 A;  1LA0 A;  3QRX A;  4YGA A;  2OS8 B;  1BG1 A;  1DJW A;  2ZFD A;  3I5F C;  4WQ2 A;  4DS7 A;  1TNP A;  2KI4 B;  2BE6 A;  2MBX A;  1H4B A;  3JTD B;  2OTG C;  3GK2 A;  2E30 A;  2JTT A;  1DJY A;  2KOT A;  3AAK A;  2LHI A;  4YGC B;  1CKK A;  2COL B;  1A75 B;  4M2P A;  1XFX O;  1PUL A;  3ZWH A;  5PAL A;  2Y1N A;  2PAS A;  1UHH A;  1C7W A;  3SG6 A;  1U5I A;  1B1G A;  1REC A;  1F55 A;  1CDP A;  4GGN A;  5D7F A;  5AFP A;  4QJ5 B;  1ZUZ A;  1XA5 A;  1SNL A;  2HQW A;  2M0R A;  3OHM B;  1CDN A;  2BCA A;  1CB1 A;  4YGB B;  1SRA A;  1K93 D;  1NPQ A;  2PRU A;  2WOS A;  4GBA A;  5AER A;  1SBJ A;  4USL A;  3CR2 A;  2NCP A;  1SCM C;  3D0Y B;  3FS7 A;  2M1U A;  3GOF A;  2F3Y A;  1PRW A;  1DVI A;  3KPX A;  4CFR A;  4WRI A;  2ISD A;  3CWG A;  5BPJ A;  3FWB A;  3CTN A;  1KFX L;  2KHN A;  1NSH A;  2JXC A;  2K7C A;  2AUC A;  1SL9 A;  4DCK A;  1A29 A;  1SYM A;  4HSZ A;  4NDB A;  1JC2 A;  3EK4 A;  2K8M B;  2KI6 C;  3EK8 A;  3IF7 A;  2LMT A;  2KI6 D;  2PAL A;  3ICB A;  2B1U A;  4ETO A;  2VRG A;  1UUS A;  1CM4 A;  2TN4 A;  1OSA A;  5ER4 X;  5CSF A;  5TNC A;  2AMI A;  2H61 C;  1KFX S;  1CNP A;  2O5G A;  3I5I B;  1K9U A;  5HYD A;  2NLN A;  2M1K B;  2MAZ A;  4BY4 A;  2K2A A;  1KWO B;  1CM1 A;  2KFH A;  1J7Q A;  1NX3 A;  1DJX A;  1MXE A;  1TNW A;  1YRU B;  4DIR A;  1KCY A;  2BL0 B;  2PSR A;  4MEW A;  1S3P A;  2JT0 A;  1UHJ A;  1PAL A;  1BOD A;  2MA2 A;  2LLS A;  4AQJ A;  4I5L B;  4IL1 A;  1DGU A;  4GPL B;  1SPY A;  2LVV A;  1NYA A;  1PSR A;  4P5O E;  2EC6 B;  2ZN9 A;  1CLL A;  4MVF A;  1KK8 B;  1V1F A;  1WRL A;  2BKH B;  2I94 A;  1Y1A A;  1Y1X A;  1F4Q A;  3SG4 A;  1QLS A;  4I5J A;  3M0W A;  5HLO A;  2JOJ A;  2H2K A;  1XVJ A;  3VRO A;  4C0J A;  1N0Y A;  1R6P A;  1DTL A;  2K7B A;  3TS5 B;  1M46 A;  3SJS A;  2ZN8 A;  2CXJ A;  3WHT B;  1CDL A;  4CPV A;  3DD4 A;  2L4H A;  1B4C A;  5KU1 A;  1B7T Z;  3OX6 A;  1AVS A;  2MRD A;  1IRJ A;  3PM8 A;  2JT8 A;  3KEV A;  3SG5 A;  5I2Q A;  1YVH A;  4N1F A;  2ZKM X;  4MSP A;  4CID A;  1QJT A;  1DMO A;  1XFV O;  1XO5 A;  3EVR A;  3GK1 A;  3PN7 B;  3I5G B;  1JFJ A;  1LIN A;  3DVK A;  1CMG A;  1OZS A;  2M8U A;  1S26 D;  5F6T A;  1K9K A;  1SW8 A;  1X02 A;  3K21 A;  4XYN A;  4MZK A;  1RJV A;  1MQ1 A;  1Q80 A;  2BL0 C;  1LXF C;  1W7J B;  2A4J A;  3EVV A;  1DF0 A;  3LK1 A;  3AKB A;  1J1D A;  1AK8 A;  3CR5 X;  2LLU A;  2K7D A;  3RLZ A;  1L7Z A;  2KSP A;  1KSO A;  4C0L A;  1L2O B;  1IQ3 A;  1NCY A;  1OOJ A;  2LLT A;  1AP4 A;  2KAY A;  2G9B A;  5FYX A;  2L51 A;  1B47 A;  3EVU A;  4N5X A;  1GQM A;  1ALW A;  5CSI A;  4ZCV A;  3TUY C;  2JUL A;  5D69 A;  3LK0 A;  4HRG A;  3E3R A;  4GGF C;  1F8H A;  5CSN A;  4FTG A;  1D1O A;  1UHN A;  1Y6W A;  2KQ6 A;  5I2O A;  2BEC A;  3PLF B;  2K61 A;  1CFC A;  2LP3 A;  1DF0 B;  4I5K A;  5GQQ C;  2OS8 C;  5KSZ A;  1QX5 B;  1ALV A;  1U5I B;  2WND A;  3OB2 B;  2QPT A;  2RGI A;  3SG7 A;  1CLB A;  2FCE A;  1S1E A;  2KGB C;  1J7P A;  4MZL A;  2L4I A;  1FPW A;  2G2B A;  2L2E A;  1BT6 A;  2K7O A;  2R2I A;  2KDH A;  2JNF A;  3D10 A;  5AAN A;  1SL7 A;  3BUX B;  3CGA A;  1DJH A;  1KK7 Y;  1K90 D;  3O6B A;  2LM5 A;  4ORA B;  4PE0 A;  1GJY A;  4AQI A;  2WCB A;  2LAP A;  1WLZ A;  2Y1M A;  2F33 A;  2P6B B;  3DVM A;  1BR4 B;  3RM1 A;  1N65 A;  1TNX A;  2LNK A;  3CR4 X;  3D0Y A;  1BU3 A;  4QJ3 B;  2NCO A;  3BYA A;  3VRR A;  1QLK A;  1KQV A;  1NIW A;  4C0K A;  2LV7 A;  4MRY A;  1OMD A;  3JVT C;  1SCM B;  4YI8 A;  5DKQ A;  2HQ8 A;  2JC2 A;  1JWD A;  3H4S E;  5JJG A;  1RWY A;  3LL8 B;  1NP8 A;  4MN0 A;  2KFF A;  2BKI B;  2LHL A;  1CFF A;  2JT3 A;  2KAV A;  2LVK A;  1ZMZ A;  1EXR A;  2EGD A;  1CLM A;  2M3W A;  4M2O A;  1PK0 D;  1FF1 A;  1JUO A;  1ZAC A;  1GGW A;  4Q04 A;  1W7I B;  3O4Y A;  1G8I A;  4ORC B;  1IKU A;  3IQQ A;  3C1V A;  1DJI A;  1IWQ A;  2LMV A;  1DJG A;  2NXQ A;  1VRK A;  1ZFS A;  2M7N A;  1FBV A;  1NX1 A;  1FW4 A;  2CTN A;  4N1G A;  2PMY A;  1Y1U A;  3TZ1 A;  1BR1 B;  3A8R A;  4JPZ B;  1KQM C;  1YUS A;  4DUQ A;  1NCX A;  1F4O A;  3LCP C;  2EHB A;  1UWO A;  2M7L A;  1H8B A;  1YX7 A;  3I5H C;  1QTX A;  2LAN A;  3VRN A;  1MR8 A;  1QVI Y;  1SR6 B;  1BLQ A;  4I5N B;  4YGE B;  3OB1 B;  1XK4 C;  1KK8 C;  3DVE A;  3CZT X;  3EKJ A;  2K2F A;  4JWQ A;  1EJ3 A;  2KI4 C;  3DF0 B;  1M63 B;  3JTD C;  3BOW A;  1BJF A;  2CT9 A;  2IS9 A;  2O60 A;  4PHM A;  1IG5 A;  5DKN A;  1MF8 B;  1SL8 A;  2KYF A;  2LP2 A;  1AUI B;  1BOC A;  4E68 A;  1S5G Y;  1WDC C;  3DVJ A;  1TTX A;  4HRH A;  3PSR A;  1QV0 A;  2KGR A;  1RRO A;  3BUO B;  1AJ5 A;  2JPT A;  1BMO A;  1HQV A;  1JFK A;  1M39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...