2DOQA

Crystal structure of sfi1p/cdc31p complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
146
structure length
146
Chain Sequence
SELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural role of Sfi1p-centrin filaments in budding yeast spindle pole body duplication.
pubmed doi rcsb
molecule keywords Cell division control protein 31
molecule tags Cell cycle
source organism Saccharomyces cerevisiae
total genus 39
structure length 146
sequence length 146
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2doqA01
1EG3A 1SRAA 1NX2A 2B1UA 2ZN9A 4MZLA 1J7PA 1AVSA 1DGVA 1PSBA 2BE4A 2LVJA 2LMUA 3HCMA 1BR4B 1CDMA 3M0WA 5I2LA 3TDUA 1CFFA 1C7WA 3EK4A 1NWDA 1YUTA 2GV5A 4M2PA 4R1EA 2KQYA 1YUSA 1F4OA 1EG4A 2H61C 3K21A 1B7TZ 1S6JA 1BG1A 1TOPA 4CLNA 5KU1A 1UWOA 1XFZO 1R6PA 1A29A 1ZOTB 1S1EA 3CLNA 4QJ5B 2OPOA 1WY9A 2MLFC 1JF2A 3DF0A 4A4BA 1PRWA 1LXFC 1TTXA 1JUOA 1KFXS 3EVVA 3RLZA 4U8DA 1CM4A 4I5NB 4I5LB 4FQOA 1AJ4A 4GGFA 1NCYA 2R2IA 1V1GA 2M97A 3KPXA 4ORCB 3ICBA 1H4BA 3PATA 4CIDA 4MEWA 5PALA 1FW4A 2I18A 1RWYA 2NCPA 2QPTA 2CT9A 2PMYA 3OB2B 1SBJA 1NX1A 5HKWA 1EL4A 2BCBA 4MZKA 3CR5X 4HRHA 4A4CA 2HF5A 2LMVA 4QJ4B 1SCMC 3O6BA 3O2PA 2ZRSA 4MRXA 4YGAA 1LVCD 3AKBA 2K0JA 3EVRA 4ZCVA 2ZNEA 1QXPA 2MBXA 1S3PA 1Y6WA 5ER5A 1B9AA 1N65A 1XFVO 2IS9A 1K95A 3O4YA 5I2OA 2KI6C 1F8HA 5J3XA 3PN7B 1OZOA 1C7VA 3I5FC 2FCDA 1KWOB 1CFPA 1U5IA 5HKYA 2Y5IA 3DF0B 1NX0A 1QX5B 2WCEA 2LUXA 2JNXA 2ISDA 4PALA 1IG5A 1XK4C 4MN0A 2JPTA 1BU3A 1RROA 2K7CA 4P5OE 4ZCUA 4C0JA 1JFJA 2EGDA 1TNQA 1OZSA 2ZFDA 4CPVA 2KQ6A 1J7RA 1TNWA 3I5GC 1MUXA 2LV7A 1Y1AA 3WNXB 1WRLA 4DIRA 4E68A 2HPSA 1QJTA 2BL0B 2FCEA 3IQOA 3BXKA 5FYXA 2M7LA 2M1UA 2P6BB 1TCOB 2K61A 1W7IB 4PHJA 1SL9A 1CKKA 3DVMA 4AQIA 3ZNIA 3KF9A 2L50A 1WDCC 2LAPA 5AXIA 2K2AA 2LCPA 1PK0D 1ZMZA 1U5IB 2HQ8A 1F55A 1KQVA 1WDCB 1B8RA 4CFQA 3KEVA 1IKUA 1CDPA 4NDCA 3PLFB 1QVIY 5I8NA 1SY9A 3PALA 4ETOA 3BUMB 1DVIA 4OKHA 1UHHA 2KI4C 4YI9A 1SKTA 1RFJA 2L4IA 2M7NA 3A8RA 4WRIA 1QLKA 1IQ3A 1CB1A 1NYAA 2ZNDA 1JFKA 3CGAA 2KI4B 1EJ3A 1KFXL 1QVIZ 1ODBA 1SL7A 3WHTB 2O60A 1QLSA 1KQMC 2KFHA 3D0YA 1LA0A 5CSFA 3VROA 1N2DA 1EH2A 1CMGA 3SG6A 3SG3A 1CMFA 1B7TY 1KQMB 1N0YA 3AAKA 4PE0A 3NSLA 4P2YB 1BR1B 1BJFA 3SG5A 1CDLA 1HQVA 3BYAA 1D1OA 2L2EA 1WLMA 1GGWA 3NSIA 2K7DA 1DJWA 1UP5A 2CCMA 4NDDA 4XJKA 3NXAA 1Y1UA 4OV2A 3TDZA 1CDNA 2BCXA 1XA5A 5AANA 5JOLA 4MZJA 3PM8A 2WCBA 4DCKA 3BOWA 2F3ZA 2BBNA 2KFFA 4M2QA 1UURA 4PDZA 5AEQA 5BPJA 2M29A 4PE7A 4HREE 4YBHB 2KHNA 2EC6B 4MRYA 3IF7A 4YGEB 3EKJA 4PCWA 3SG7A 1DT7B 1K9PA 1K94A 3OX6A 4GUKA 3SG4A 4IL1A 1RK9A 2VRGA 1AUIB 2CXJA 5G08A 4ORAB 3DVEA 1WRKA 2WORA 1E8AA 4GPLB 4I5JA 4WQ2A 4AOMA 3D0YB 3TDIA 2BKIB 1X02A 2FJUB 2SCPA 2K7BA 3KHEA 3JVTC 1YX7A 3GOFA 1AJ5A 1CFDA 1EXRA 4OR9B 2JU0A 1S6CA 2E30A 1Y0VH 3RM1A 2BE6A 2KGBC 2MJWB 3JVTB 2KAXA 1J1EA 1LKJA 1Y1XA 4XJKB 1B4CA 1QASA 3GK2A 2KFGA 4BY5A 2EHBA 2WCFA 3PN7C 2JQ6A 1UHNA 1CNPA 3DD4A 1KWOC 2PVBA 3BOWB 3ZWHA 2NXQA 2MLEC 5D69A 4GAOA 2JTTA 4GNKB 1QV0A 2JNFA 1HT9A 2BKHB 2LP2A 2LLUA 1SMGA 5D7FA 1MXEA 2Q4UA 2JT0A 1UUSA 4MSPA 3GK4X 1UHIA 1JF0A 1IWQA 2KNEA 3HX4A 2LHLA 1KK8B 4GGFC 5I2QA 4OVNF 4DUQA 3CS1A 2JC2A 2JT3A 1S5GY 3FWCA 1XVJA 3SG2A 2V53A 2OS8B 1ZACA 2CTNA 1K9KA 1FI6A 3LLEA 1ZFSA 1YURA 2KSPA 2BL0C 2G2BA 3OHMB 1DF0A 1A75A 4GGNA 1RECA 1KK7Y 1S5GZ 1MR8A 2I2RE 3I5HC 4YGBB 5KTYA 1MF8B 2BBMA 5B8IB 4QJ3B 2O5GA 1JSAA 1MQ1A 2CBLA 4UPGA 2M0RA 1QX7A 2A4JA 2Y1NA 1S26D 3F45A 3I5HB 4HSZA 2RGIA 1DGUA 1OOJA 1QV1A 1W7JB 3FS7A 1DJXA 1G4YR 1M63B 2Y1MA 1KK7Z 5CPVA 1H8BA 1DJIA 5CSIA 1V1FA 2E6WA 3CR2A 5ER4X 1TN4A 1CLMA 1TCFA 3I5IC 1K93D 1IJ6A 3EKHA 1IJ5A 2LP3A 1BMOA 2HETA 5HLVA 1TIZA 3JTDC 4ORBB 1DMOA 1UHKA 1ZUZA 2F2OA 2F33A 3I5IB 3TUYB 3VRQA 2L5XB 1KCYA 4JQ0D 1XYDA 1S36A 1S6IA 2PALA 1YRUB 2M1KB 5HKZA 2L0PA 2KI6D 3AKAA 3JTDB 1NP8A 5TNCA 2KYFA 1LA3A 1DF0B 1AP4A 1A75B 3NSKA 4I5KA 1LINA 1Q80A 1MXLC 2ZKMX 2GGMA 1L2OB 1WLZA 3DVKA 2PASA 3SIBA 1SR6B 4C0LA 1JWDA 3CZTX 1YVLA 1BLQA 1M45A 5K89A 1TNXA 1TNPA 2I94A 2K2FA 2JOJA 3CTNA 2AMIA 2LHIA 5AFPA 1KSOA 1J7QA 1F71A 5CSJA 2PRUA 2H61A 2K8MB 1SPYA 2M49B 3O78A 1NCZA 5DKNA 1IQ5A 3WXAA 1B47A 2COLB 3BUOB 3BUNB 3OB1B 1M39A 2AUCA 4YGDB 2H2KA 1XFWO 2M3WA 4GFTA 1YUUA 1K9UA 1NPQA 4JWQA 2FOTA 2EC6C 1NUBA 4MVFA 1MWNA 5HLOA 1KFUS 1L7ZA 2LC5A 2JXLA 2KYCA 4HRGA 2QACA 1M31A 2KBIA 4Q04A 1PVBA 2KAVA 3TS5B 2OTGB 4C0KA 1AHRA 2MA2A 1F54A 3KO0A 2JZIA 3DVJA 5F6TA 1YX8A 4MLWA 4XYNA 2LVVA 1J7OA 1OQPA 3FIAA 3OX5A 1M46A 4PHMA 5JJGA 1SK6D 1MHOA 3VRPA 2KAYA 3IQQA 1XO5A 2I7AA 3SIAA 2LVIA 3TZ1A 2SASA 1YTZC 3EVUA 3FWBA 1F4QA 3MSEB 1NSHA 1OMRA 4CFRA 1SW8A 3BQ3A 3NSOA 2LLTA 5IBWA 4AQJA 4PE1A 4PE4A 1R2UA 2TN4A 2F8PA 4PHKA 1B8CA 2ZN8A 1XFYO 4D1EA 2BCAA 1C07A 1FI5A 2LUCA 3D10A 1QIWA 1AK8A 4PHNA 1JBAA 1XK4A 2LANA 1WRZA 1SCVA 1KK8C 4NQGA 1A4PA 1G33A 2M9GA 1PSRA 1DJHA 4ICBA 3BUXB 2JWWA 1QX2A 3SJSA 2OS8C 2L51A 2KDHA 2MAZA 5DKRA 1GGZA 1K8UA 3WHUB 1K96A 1QTXA 1QATA 1J1DA 1K2HA 1A03A 2F2PA 2MHHA 2LLSA 4DRWA 1SCMB 1FF1A 5DKQA 1CLBA 3GK1A 3VRRA 2NZ0A 5HYDA 2MRDA 1RJVA 2JRFA 1BODA 1FPWA 1YVHA 3E3RA 2D8NA 1BF5A 1VRKA 2DOQA 1PVAA 3EK7A 1UHJA 1DTLA 4DS7A 2LNKA 1IGVA 3LK1A 3CWGA 4N1GA 2K7OA 2JULA 1RTP1 3I5FB 1ALVA 4WQ3A 1DJGA 1IH0A 1IRJA 3PSRA 1B8LA 2WC8A 2G9BA 1DJYA 5AERA 3BUWB 4N5XA 1ALWA 2LVKA 2CNPA 1PALA 2HQWA 1A2XA 2KBMA 2KGRA 2AAOA 4FTGA 3A4UB 4YI8A 2ZRTA 3VRNA 3TUYC 3I5GB 4M2OA 3H4SE 3EK8A 2JXCA 1YR5A 4MBEA 2WOSA 1KFUL 2GGZA 4JPZB 4NDBA 4USLA 4YRUA 5KSZA 1OSAA 1PULA 4GBAA 1KSMA 1OMDA 3QRXA 1DJZA 1G8IA 1QIVA 2L98A 5GQQC 1L2OC 1SL8A 1SYMA 1GQMA 4TNCA 1TRFA 3LK0A 1SR6C 2LM5A 1NX3A 2L4HA 2JT8A 1FBVA 1K90D 3PFVA 4BY4A 1CLLA 3C1VA 1F70A 4N1FA 1NCXA 2Q91A 1JC2A 1NIWA 1OE9B 4OCIA 2NCOA 2PSRA 1BOCA 1BT6A 1YRTB 2WNDA 1OMVA 4L9MA 1CFCA 2BECA 3AAJA 1CTRA 2M8UA 1GJYA 3CR4X 1B1GA 3LCPC 2LMTA 1SNLA 1QS7A 2F3YA 2LE9B 3LL8B 1XFUO 2Y4QA 4F0ZB 5CSNA 1XFXO 1J55A 4YGCB 3OP0A 3TS5C 2JTZA 2KOTA 2NLNA 2OTGC 1CM1A 3VGOA
chains in the Genus database with same CATH superfamily
1EG3A 1SRAA 1W9ZA 3S0FA 1NX2A 2B1UA 2ZN9A 4MZLA 1J7PA 1AVSA 1DGVA 5FI7A 1PSBA 2BE4A 2LVJA 2P71A 3NHIA 2LMUA 3HCMA 1BR4B 1CDMA 3M0WA 5I2LA 3TDUA 1CFFA 1C7WA 3EK4A 1NWDA 1YUTA 2GV5A 4M2PA 4R1EA 2KQYA 4JD9A 1YUSA 1F4OA 3NGVA 1EG4A 2H61C 3K21A 1B7TZ 1S6JA 1BG1A 1TOPA 4CLNA 5KU1A 1UWOA 3BFBA 1XFZO 1R6PA 1A29A 1ZOTB 2K60A 1S1EA 3CLNA 4QJ5B 2OPOA 1WY9A 2MLFC 1JF2A 3DF0A 1T14A 4A4BA 2YGUA 1PRWA 1LXFC 1TTXA 1JUOA 1KFXS 3EVVA 1XFRA 3RLZA 4U8DA 1CM4A 3V2LA 4I5NB 4I5LB 4FQOA 1AJ4A 1IIOA 4GGFA 1NCYA 2R2IA 1V1GA 2M97A 3KPXA 4ORCB 3ICBA 3UO9A 3PATA 1H4BA 4CIDA 4MEWA 5PALA 1FW4A 2I18A 3K1EA 2WCMA 3R1VA 1RWYA 2NCPA 2QPTA 2CT9A 2PMYA 3OB2B 1SBJA 1NX1A 5HKWA 1EL4A 2BCBA 4MZKA 3CR5X 4HRHA 3L4AA 4A4CA 2HF5A 2LMVA 4QJ4B 1SCMC 3O6BA 3O2PA 2ZRSA 4MRXA 4YGAA 1LVCD 3AKBA 2K0JA 3EVRA 4ZCVA 2ZNEA 1QXPA 2MBXA 1LS8A 1S3PA 1Y6WA 5ER5A 1B9AA 1N65A 1XFVO 2IS9A 1K95A 3O4YA 5I2OA 2KI6C 1F8HA 5J3XA 3PN7B 1OZOA 1C7VA 3I5FC 2FCDA 1KWOB 1CFPA 1U5IA 3R72A 2Y5IA 3DF0B 5HKYA 1NX0A 1QX5B 2WCEA 2LUXA 2JNXA 2ISDA 4PALA 2QEBA 1IG5A 1XK4C 4MN0A 3SS3A 2JPTA 1BU3A 1RROA 2K7CA 1QWVA 4P5OE 4ZCUA 3DYEA 4C0JA 1JFJA 2EGDA 3L47A 1TNQA 1OZSA 2ZFDA 4CPVA 5I94A 4PT1A 2KQ6A 1J7RA 1TNWA 3I5GC 1MUXA 2LV7A 1Y1AA 3WNXB 1WRLA 4DIRA 4E68A 2HPSA 1QJTA 2BL0B 2FCEA 3IQOA 3BXKA 5FYXA 2M7LA 2M1UA 2P6BB 2QDIA 1TCOB 2K61A 3DXLA 1W7IB 4PHJA 1SL9A 1CKKA 1SSEB 3DVMA 3S0EA 3QMEA 4AQIA 3ZNIA 3KF9A 1P28A 3DZTA 2L50A 1WDCC 2LAPA 5AXIA 2WCLA 1TUJA 2ERBA 2K2AA 1PK0D 2LCPA 3B88A 5FI2A 1ZMZA 1U5IB 2HQ8A 1F55A 1KQVA 1WDCB 1B8RA 4CFQA 3CZ2A 3KEVA 1IKUA 1CDPA 4NDCA 3PLFB 1QVIY 5I8NA 3S0BA 1SY9A 3PALA 4ETOA 3BUMB 1DVIA 4OZDA 4OKHA 1UHHA 2KI4C 4YI9A 1SKTA 1RFJA 2L4IA 2M7NA 3A8RA 4WRIA 1QLKA 1IQ3A 1CB1A 1NYAA 2ZNDA 1JFKA 3CGAA 2KI4B 1EJ3A 1KFXL 1QVIZ 1ODBA 1SL7A 3WHTB 3BJHA 2O60A 3BFHA 1QLSA 1KQMC 2KFHA 3D0YA 1LA0A 5CSFA 3VROA 1N2DA 1EH2A 4KYNA 3D77A 1CMGA 3SG6A 3SG3A 1CMFA 1B7TY 1KQMB 1N0YA 3AAKA 4PE0A 2WCHA 3NSLA 4P2YB 1BR1B 1BJFA 3SG5A 1CDLA 1HQVA 3BYAA 1D1OA 2L2EA 1WLMA 1GGWA 2WCKA 3NSIA 2K7DA 1DJWA 4FQTA 1UP5A 2CCMA 4NDDA 4XJKA 3NXAA 1Y1UA 4OV2A 3TDZA 1CDNA 2BCXA 1XA5A 3OBVA 5JOLA 5AANA 4MZJA 3PM8A 2PQLA 2WCBA 4DCKA 3BOWA 2F3ZA 2BBNA 2KFFA 2WCJA 1UURA 4M2QA 4PDZA 5AEQA 5BPJA 2M29A 4PE7A 4HREE 4YBHB 2KHNA 2EC6B 4MRYA 3IF7A 4YGEB 3EKJA 4PCWA 3SG7A 1DT7B 1K9PA 1OOGA 1K94A 3RZSA 3OX6A 4GUKA 3SG4A 4IL1A 1DEKA 1RK9A 2VRGA 1AUIB 2CXJA 5G08A 3S0GA 4ORAB 3DVEA 1WRKA 2WORA 3UNWA 1E8AA 4GPLB 4I5JA 1OOIX 4WQ2A 4AOMA 3D0YB 3TDIA 3DY9A 2BKIB 1X02A 2FJUB 3R1PA 2SCPA 2K7BA 3CABA 3JVTC 3KHEA 1YX7A 3GOFA 1AJ5A 1CFDA 1EXRA 4OR9B 2JU0A 1S6CA 2E30A 1Y0VH 3RM1A 3S0AA 2BE6A 2KGBC 2MJWB 3JVTB 2KAXA 1J1EA 1LKJA 1Y1XA 4XJKB 1B4CA 1QASA 3GK2A 2KFGA 4BY5A 2EHBA 2WCFA 3PN7C 3D76A 2JQ6A 1UHNA 2QEHA 1CNPA 1Z2CB 3B87A 3FE9A 3DD4A 1KWOC 2PVBA 3BOWB 3ZWHA 2NXQA 2MLEC 5D69A 4GAOA 2JTTA 4GNKB 1ORGA 1QV0A 2JNFA 1HT9A 2BKHB 2LP2A 2LLUA 1SMGA 5D7FA 1MXEA 2Q4UA 2JT0A 1UUSA 4MSPA 3GK4X 1UHIA 1JF0A 1IWQA 2KNEA 3HX4A 2LHLA 1KK8B 4GGFC 5I2QA 4OVNF 4DUQA 3CS1A 2JC2A 2JT3A 1S5GY 3FWCA 1XVJA 3SG2A 2V53A 4JKTA 2OS8B 1ZACA 2CTNA 1K9KA 1FI6A 1C3YA 3LLEA 1ZFSA 1YURA 2KLDA 2KSPA 2BL0C 2G2BA 3OHMB 3D74A 1DF0A 1A75A 4GGNA 1RECA 1KK7Y 1S5GZ 1MR8A 2I2RE 3I5HC 4YGBB 5KTYA 1MF8B 2BBMA 5B8IB 4QJ3B 2O5GA 1JSAA 1MQ1A 2CBLA 3B6XA 4UPGA 2M0RA 1QX7A 2A4JA 2KLEA 2Y1NA 1S26D 3F45A 3I5HB 3S0DA 4HSZA 2RGIA 1DGUA 1OOJA 1QV1A 1W7JB 3FS7A 1DJXA 3SS5A 1G4YR 1M63B 2Y1MA 1KK7Z 5CPVA 1H8BA 1DJIA 5CSIA 1V1FA 3O4XA 2E6WA 3R1OA 3CR2A 5ER4X 1TN4A 1CLMA 2WC6A 1TCFA 3D75A 3I5IC 1K93D 1IJ6A 3EKHA 1IJ5A 2LP3A 1BMOA 2HETA 5HLVA 1TIZA 1Z4HA 3JTDC 4ORBB 1DMOA 1UHKA 1ZUZA 2F2OA 2F33A 3I5IB 3IVTA 3TUYB 2L5XB 3VRQA 1KCYA 4JQ0D 1XYDA 1S36A 1S6IA 2PALA 1YRUB 2M1KB 5HKZA 2L0PA 2KI6D 3AKAA 3JTDB 1NP8A 5TNCA 2KYFA 1LA3A 1DF0B 1AP4A 1A75B 3NSKA 4I5KA 1LINA 3PM2A 1Q80A 1MXLC 2ZKMX 2GGMA 1L2OB 1WLZA 3DVKA 2PASA 3SIBA 1SR6B 4C0LA 1JWDA 3CZTX 1YVLA 2L2CA 1M45A 3CZ0A 1BLQA 5K89A 1TNXA 1TNPA 2I94A 2K2FA 2JOJA 3CTNA 2AMIA 2LHIA 5AFPA 1KSOA 1J7QA 1F71A 5CSJA 1TUZA 2H61A 2K8MB 2PRUA 1SPYA 2M49B 3O78A 1NCZA 5DKNA 4INWA 3SS4A 1IQ5A 3WXAA 1B47A 2COLB 2WC5A 3BUOB 3BUNB 3OB1B 1M39A 2AUCA 4YGDB 2H2KA 1XFWO 2M3WA 4GFTA 1YUUA 1K9UA 1NPQA 4JWQA 2FOTA 2EC6C 1NUBA 2QEOA 4MVFA 1MWNA 5HLOA 1KFUS 1L7ZA 2H8VA 2JXLA 2KYCA 2LC5A 4HRGA 2QACA 1M31A 2KBIA 4Q04A 2JPOA 1PVBA 2KAVA 3TS5B 2OTGB 4C0KA 1AHRA 2MA2A 1F54A 3KO0A 2JZIA 3DVJA 5F6TA 1YX8A 4MLWA 1GM0A 4XYNA 2LVVA 1J7OA 1OQPA 3FIAA 3OX5A 1M46A 4PHMA 3BFAA 1DQEA 1SK6D 3CYZA 5JJGA 1MHOA 3VRPA 2KAYA 3IQQA 1XO5A 2I7AA 3SIAA 2LVIA 3TZ1A 2SASA 1YTZC 3EVUA 3OGNA 3FE6A 3FWBA 1F4QA 3MSEB 1NSHA 3L4LA 1OMRA 4CFRA 1SW8A 3BQ3A 1DC1A 3NSOA 2LLTA 5IBWA 4AQJA 4PE1A 4PE4A 1R2UA 3VB1A 2TN4A 2F8PA 3D78A 4PHKA 1B8CA 2ZN8A 4IJ7A 1XFYO 4D1EA 2BCAA 1C07A 1FI5A 2LUCA 3D10A 1QIWA 1AK8A 4PHNA 1JBAA 1XK4A 2LANA 1WRZA 1SCVA 2KPHA 5FI6A 1KK8C 4NQGA 1A4PA 3PJIA 1G33A 2M9GA 1PSRA 1DJHA 4ICBA 3BUXB 2JWWA 1QX2A 3SJSA 2OS8C 2L51A 2KDHA 2MAZA 5DKRA 1GGZA 1K8UA 3WHUB 1K96A 2P70A 1QTXA 1QATA 1J1DA 1K2HA 1A03A 2F2PA 2MHHA 1OOHA 2LLSA 4DRWA 1SCMB 1FF1A 5DKQA 1CLBA 3GK1A 3VRRA 2NZ0A 5HYDA 2MRDA 1RJVA 2JRFA 1BODA 1FPWA 1YVHA 3E3RA 2BNXA 1DELA 2D8NA 1BF5A 1VRKA 2DOQA 1PVAA 3EK7A 1UHJA 3N7HA 5EL2A 1DTLA 3D73A 4DS7A 2LNKA 1IGVA 3LK1A 3CWGA 4N1GA 2K7OA 2JULA 2L5YA 1RTP1 3FE8A 1ALVA 3I5FB 2QEVA 4WQ3A 1DJGA 1IH0A 1IRJA 3PSRA 4INXA 1B8LA 2WC8A 3NHTA 2G9BA 1DJYA 5AERA 3BUWB 4N5XA 1ALWA 2GTEA 2LVKA 2CNPA 1PALA 2HQWA 5HL1A 1A2XA 2KBMA 2KGRA 2AAOA 4FTGA 3A4UB 4YI8A 2ZRTA 3VRNA 3TUYC 3Q8IA 3I5GB 2FJYA 4M2OA 3H4SE 3EK8A 2JXCA 1YR5A 3CDNA 4MBEA 2WOSA 1KFUL 2GGZA 4JPZB 4NDBA 1OW4A 5D3OA 4USLA 4YRUA 1TWOA 5KSZA 1OSAA 1PULA 1OOFA 4GBAA 1KSMA 1OMDA 3QRXA 1DJZA 1C3ZA 1G8IA 1QIVA 2L98A 5GQQC 1L2OC 1SL8A 1SYMA 1GQMA 4TNCA 1TRFA 3LK0A 1SR6C 2LM5A 1NX3A 2L4HA 3CZ1A 2JT8A 1FBVA 1K90D 3B7AA 3PFVA 1CLLA 2BAPA 4BY4A 3C1VA 1F70A 4N1FA 1NCXA 2Q91A 1JC2A 1NIWA 1OE9B 4OCIA 2NCOA 2PSRA 1BOCA 3B86A 1BT6A 1YRTB 2WNDA 1OMVA 2PYQA 4L9MA 1CFCA 2BECA 3AAJA 1CTRA 2M8UA 1GJYA 3CR4X 5DICA 1B1GA 3LCPC 2LMTA 1SNLA 1QS7A 2F3YA 2LE9B 3LL8B 1XFUO 2Y4QA 4F0ZB 4F7FA 5CSNA 1XFXO 1J55A 4YGCB 3OP0A 3TS5C 2JTZA 2KOTA 2NLNA 2OTGC 1CM1A 3VGOA 3EG5B
chains in the Genus database with same CATH topology
1EG3A 1SRAA 1NX2A 2B1UA 2ZN9A 4MZLA 1J7PA 1AVSA 1DGVA 1PSBA 2BE4A 2LVJA 2LMUA 3HCMA 1BR4B 1CDMA 3M0WA 5I2LA 3TDUA 1CFFA 1C7WA 3EK4A 1NWDA 1YUTA 2GV5A 4M2PA 4R1EA 2KQYA 1YUSA 1F4OA 1EG4A 2H61C 3K21A 1B7TZ 1S6JA 1BG1A 1TOPA 4CLNA 5KU1A 1UWOA 1XFZO 1R6PA 1A29A 1ZOTB 1S1EA 3CLNA 4QJ5B 2OPOA 1WY9A 2MLFC 1JF2A 3DF0A 4A4BA 1PRWA 1LXFC 1TTXA 1JUOA 1KFXS 3EVVA 3RLZA 4U8DA 1CM4A 4I5NB 4I5LB 4FQOA 1AJ4A 4GGFA 1NCYA 2R2IA 1V1GA 2M97A 3KPXA 4ORCB 3ICBA 1H4BA 3PATA 4CIDA 4MEWA 5PALA 1FW4A 2I18A 1RWYA 2NCPA 2QPTA 2CT9A 2PMYA 3OB2B 1SBJA 1NX1A 5HKWA 1EL4A 2BCBA 4MZKA 3CR5X 4HRHA 4A4CA 2HF5A 2LMVA 4QJ4B 1SCMC 3O6BA 3O2PA 2ZRSA 4MRXA 4YGAA 1LVCD 3AKBA 2K0JA 3EVRA 4ZCVA 2ZNEA 1QXPA 2MBXA 1S3PA 1Y6WA 5ER5A 1B9AA 1N65A 1XFVO 2IS9A 1K95A 3O4YA 5I2OA 2KI6C 1F8HA 5J3XA 3PN7B 1OZOA 1C7VA 3I5FC 2FCDA 1KWOB 1CFPA 1U5IA 5HKYA 2Y5IA 3DF0B 1NX0A 1QX5B 2WCEA 2LUXA 2JNXA 2ISDA 4PALA 1IG5A 1XK4C 4MN0A 2JPTA 1BU3A 1RROA 2K7CA 4P5OE 4ZCUA 4C0JA 1JFJA 2EGDA 1TNQA 1OZSA 2ZFDA 4CPVA 2KQ6A 1J7RA 1TNWA 3I5GC 1MUXA 2LV7A 1Y1AA 3WNXB 1WRLA 4DIRA 4E68A 2HPSA 1QJTA 2BL0B 2FCEA 3IQOA 3BXKA 5FYXA 2M7LA 2M1UA 2P6BB 1TCOB 2K61A 1W7IB 4PHJA 1SL9A 1CKKA 3DVMA 4AQIA 3ZNIA 3KF9A 2L50A 1WDCC 2LAPA 5AXIA 2K2AA 2LCPA 1PK0D 1ZMZA 1U5IB 2HQ8A 1F55A 1KQVA 1WDCB 1B8RA 4CFQA 3KEVA 1IKUA 1CDPA 4NDCA 3PLFB 1QVIY 5I8NA 1SY9A 3PALA 4ETOA 3BUMB 1DVIA 4OKHA 1UHHA 2KI4C 4YI9A 1SKTA 1RFJA 2L4IA 2M7NA 3A8RA 4WRIA 1QLKA 1IQ3A 1CB1A 1NYAA 2ZNDA 1JFKA 3CGAA 2KI4B 1EJ3A 1KFXL 1QVIZ 1ODBA 1SL7A 3WHTB 2O60A 1QLSA 1KQMC 2KFHA 3D0YA 1LA0A 5CSFA 3VROA 1N2DA 1EH2A 1CMGA 3SG6A 3SG3A 1CMFA 1B7TY 1KQMB 1N0YA 3AAKA 4PE0A 3NSLA 4P2YB 1BR1B 1BJFA 3SG5A 1CDLA 1HQVA 3BYAA 1D1OA 2L2EA 1WLMA 1GGWA 3NSIA 2K7DA 1DJWA 1UP5A 2CCMA 4NDDA 4XJKA 3NXAA 1Y1UA 4OV2A 3TDZA 1CDNA 2BCXA 1XA5A 5AANA 5JOLA 4MZJA 3PM8A 2WCBA 4DCKA 3BOWA 2F3ZA 2BBNA 2KFFA 4M2QA 1UURA 4PDZA 5AEQA 5BPJA 2M29A 4PE7A 4HREE 4YBHB 2KHNA 2EC6B 4MRYA 3IF7A 4YGEB 3EKJA 4PCWA 3SG7A 1DT7B 1K9PA 1K94A 3OX6A 4GUKA 3SG4A 4IL1A 1RK9A 2VRGA 1AUIB 2CXJA 5G08A 4ORAB 3DVEA 1WRKA 2WORA 1E8AA 4GPLB 4I5JA 4WQ2A 4AOMA 3D0YB 3TDIA 2BKIB 1X02A 2FJUB 2SCPA 2K7BA 3KHEA 3JVTC 1YX7A 3GOFA 1AJ5A 1CFDA 1EXRA 4OR9B 2JU0A 1S6CA 2E30A 1Y0VH 3RM1A 2BE6A 2KGBC 2MJWB 3JVTB 2KAXA 1J1EA 1LKJA 1Y1XA 4XJKB 1B4CA 1QASA 3GK2A 2KFGA 4BY5A 2EHBA 2WCFA 3PN7C 2JQ6A 1UHNA 1CNPA 3DD4A 1KWOC 2PVBA 3BOWB 3ZWHA 2NXQA 2MLEC 5D69A 4GAOA 2JTTA 4GNKB 1QV0A 2JNFA 1HT9A 2BKHB 2LP2A 2LLUA 1SMGA 5D7FA 1MXEA 2Q4UA 2JT0A 1UUSA 4MSPA 3GK4X 1UHIA 1JF0A 1IWQA 2KNEA 3HX4A 2LHLA 1KK8B 4GGFC 5I2QA 4OVNF 4DUQA 3CS1A 2JC2A 2JT3A 1S5GY 3FWCA 1XVJA 3SG2A 2V53A 2OS8B 1ZACA 2CTNA 1K9KA 1FI6A 3LLEA 1ZFSA 1YURA 2KSPA 2BL0C 2G2BA 3OHMB 1DF0A 1A75A 4GGNA 1RECA 1KK7Y 1S5GZ 1MR8A 2I2RE 3I5HC 4YGBB 5KTYA 1MF8B 2BBMA 5B8IB 4QJ3B 2O5GA 1JSAA 1MQ1A 2CBLA 4UPGA 2M0RA 1QX7A 2A4JA 2Y1NA 1S26D 3F45A 3I5HB 4HSZA 2RGIA 1DGUA 1OOJA 1QV1A 1W7JB 3FS7A 1DJXA 1G4YR 1M63B 2Y1MA 1KK7Z 5CPVA 1H8BA 1DJIA 5CSIA 1V1FA 2E6WA 3CR2A 5ER4X 1TN4A 1CLMA 1TCFA 3I5IC 1K93D 1IJ6A 3EKHA 1IJ5A 2LP3A 1BMOA 2HETA 5HLVA 1TIZA 3JTDC 4ORBB 1DMOA 1UHKA 1ZUZA 2F2OA 2F33A 3I5IB 3TUYB 3VRQA 2L5XB 1KCYA 4JQ0D 1XYDA 1S36A 1S6IA 2PALA 1YRUB 2M1KB 5HKZA 2L0PA 2KI6D 3AKAA 3JTDB 1NP8A 5TNCA 2KYFA 1LA3A 1DF0B 1AP4A 1A75B 3NSKA 4I5KA 1LINA 1Q80A 1MXLC 2ZKMX 2GGMA 1L2OB 1WLZA 3DVKA 2PASA 3SIBA 1SR6B 4C0LA 1JWDA 3CZTX 1YVLA 1BLQA 1M45A 5K89A 1TNXA 1TNPA 2I94A 2K2FA 2JOJA 3CTNA 2AMIA 2LHIA 5AFPA 1KSOA 1J7QA 1F71A 5CSJA 2PRUA 2H61A 2K8MB 1SPYA 2M49B 3O78A 1NCZA 5DKNA 1IQ5A 3WXAA 1B47A 2COLB 3BUOB 3BUNB 3OB1B 1M39A 2AUCA 4YGDB 2H2KA 1XFWO 2M3WA 4GFTA 1YUUA 1K9UA 1NPQA 4JWQA 2FOTA 2EC6C 1NUBA 4MVFA 1MWNA 5HLOA 1KFUS 1L7ZA 2LC5A 2JXLA 2KYCA 4HRGA 2QACA 1M31A 2KBIA 4Q04A 1PVBA 2KAVA 3TS5B 2OTGB 4C0KA 1AHRA 2MA2A 1F54A 3KO0A 2JZIA 3DVJA 5F6TA 1YX8A 4MLWA 4XYNA 2LVVA 1J7OA 1OQPA 3FIAA 3OX5A 1M46A 4PHMA 5JJGA 1SK6D 1MHOA 3VRPA 2KAYA 3IQQA 1XO5A 2I7AA 3SIAA 2LVIA 3TZ1A 2SASA 1YTZC 3EVUA 3FWBA 1F4QA 3MSEB 1NSHA 1OMRA 4CFRA 1SW8A 3BQ3A 3NSOA 2LLTA 5IBWA 4AQJA 4PE1A 4PE4A 1R2UA 2TN4A 2F8PA 4PHKA 1B8CA 2ZN8A 1XFYO 4D1EA 2BCAA 1C07A 1FI5A 2LUCA 3D10A 1QIWA 1AK8A 4PHNA 1JBAA 1XK4A 2LANA 1WRZA 1SCVA 1KK8C 4NQGA 1A4PA 1G33A 2M9GA 1PSRA 1DJHA 4ICBA 3BUXB 2JWWA 1QX2A 3SJSA 2OS8C 2L51A 2KDHA 2MAZA 5DKRA 1GGZA 1K8UA 3WHUB 1K96A 1QTXA 1QATA 1J1DA 1K2HA 1A03A 2F2PA 2MHHA 2LLSA 4DRWA 1SCMB 1FF1A 5DKQA 1CLBA 3GK1A 3VRRA 2NZ0A 5HYDA 2MRDA 1RJVA 2JRFA 1BODA 1FPWA 1YVHA 3E3RA 2D8NA 1BF5A 1VRKA 2DOQA 1PVAA 3EK7A 1UHJA 1DTLA 4DS7A 2LNKA 1IGVA 3LK1A 3CWGA 4N1GA 2K7OA 2JULA 1RTP1 3I5FB 1ALVA 4WQ3A 1DJGA 1IH0A 1IRJA 3PSRA 1B8LA 2WC8A 2G9BA 1DJYA 5AERA 3BUWB 4N5XA 1ALWA 2LVKA 2CNPA 1PALA 2HQWA 1A2XA 2KBMA 2KGRA 2AAOA 4FTGA 3A4UB 4YI8A 2ZRTA 3VRNA 3TUYC 3I5GB 4M2OA 3H4SE 3EK8A 2JXCA 1YR5A 4MBEA 2WOSA 1KFUL 2GGZA 4JPZB 4NDBA 4USLA 4YRUA 5KSZA 1OSAA 1PULA 4GBAA 1KSMA 1OMDA 3QRXA 1DJZA 1G8IA 1QIVA 2L98A 5GQQC 1L2OC 1SL8A 1SYMA 1GQMA 4TNCA 1TRFA 3LK0A 1SR6C 2LM5A 1NX3A 2L4HA 2JT8A 1FBVA 1K90D 3PFVA 4BY4A 1CLLA 3C1VA 1F70A 4N1FA 1NCXA 2Q91A 1JC2A 1NIWA 1OE9B 4OCIA 2NCOA 2PSRA 1BOCA 1BT6A 1YRTB 2WNDA 1OMVA 4L9MA 1CFCA 2BECA 3AAJA 1CTRA 2M8UA 1GJYA 3CR4X 1B1GA 3LCPC 2LMTA 1SNLA 1QS7A 2F3YA 2LE9B 3LL8B 1XFUO 2Y4QA 4F0ZB 5CSNA 1XFXO 1J55A 4YGCB 3OP0A 3TS5C 2JTZA 2KOTA 2NLNA 2OTGC 1CM1A 3VGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG3 A;  1SRA A;  1NX2 A;  2B1U A;  2ZN9 A;  4MZL A;  1J7P A;  1AVS A;  1DGV A;  1PSB A;  2BE4 A;  2LVJ A;  2LMU A;  3HCM A;  1BR4 B;  1CDM A;  3M0W A;  5I2L A;  3TDU A;  1CFF A;  1C7W A;  3EK4 A;  1NWD A;  1YUT A;  2GV5 A;  4M2P A;  4R1E A;  2KQY A;  1YUS A;  1F4O A;  1EG4 A;  2H61 C;  3K21 A;  1B7T Z;  1S6J A;  1BG1 A;  1TOP A;  4CLN A;  5KU1 A;  1UWO A;  1XFZ O;  1R6P A;  1A29 A;  1ZOT B;  1S1E A;  3CLN A;  4QJ5 B;  2OPO A;  1WY9 A;  2MLF C;  1JF2 A;  3DF0 A;  4A4B A;  1PRW A;  1LXF C;  1TTX A;  1JUO A;  1KFX S;  3EVV A;  3RLZ A;  4U8D A;  1CM4 A;  4I5N B;  4I5L B;  4FQO A;  1AJ4 A;  4GGF A;  1NCY A;  2R2I A;  1V1G A;  2M97 A;  3KPX A;  4ORC B;  3ICB A;  1H4B A;  3PAT A;  4CID A;  4MEW A;  5PAL A;  1FW4 A;  2I18 A;  1RWY A;  2NCP A;  2QPT A;  2CT9 A;  2PMY A;  3OB2 B;  1SBJ A;  1NX1 A;  5HKW A;  1EL4 A;  2BCB A;  4MZK A;  3CR5 X;  4HRH A;  4A4C A;  2HF5 A;  2LMV A;  4QJ4 B;  1SCM C;  3O6B A;  3O2P A;  2ZRS A;  4MRX A;  4YGA A;  1LVC D;  3AKB A;  2K0J A;  3EVR A;  4ZCV A;  2ZNE A;  1QXP A;  2MBX A;  1S3P A;  1Y6W A;  5ER5 A;  1B9A A;  1N65 A;  1XFV O;  2IS9 A;  1K95 A;  3O4Y A;  5I2O A;  2KI6 C;  1F8H A;  5J3X A;  3PN7 B;  1OZO A;  1C7V A;  3I5F C;  2FCD A;  1KWO B;  1CFP A;  1U5I A;  5HKY A;  2Y5I A;  3DF0 B;  1NX0 A;  1QX5 B;  2WCE A;  2LUX A;  2JNX A;  2ISD A;  4PAL A;  1IG5 A;  1XK4 C;  4MN0 A;  2JPT A;  1BU3 A;  1RRO A;  2K7C A;  4P5O E;  4ZCU A;  4C0J A;  1JFJ A;  2EGD A;  1TNQ A;  1OZS A;  2ZFD A;  4CPV A;  2KQ6 A;  1J7R A;  1TNW A;  3I5G C;  1MUX A;  2LV7 A;  1Y1A A;  3WNX B;  1WRL A;  4DIR A;  4E68 A;  2HPS A;  1QJT A;  2BL0 B;  2FCE A;  3IQO A;  3BXK A;  5FYX A;  2M7L A;  2M1U A;  2P6B B;  1TCO B;  2K61 A;  1W7I B;  4PHJ A;  1SL9 A;  1CKK A;  3DVM A;  4AQI A;  3ZNI A;  3KF9 A;  2L50 A;  1WDC C;  2LAP A;  5AXI A;  2K2A A;  2LCP A;  1PK0 D;  1ZMZ A;  1U5I B;  2HQ8 A;  1F55 A;  1KQV A;  1WDC B;  1B8R A;  4CFQ A;  3KEV A;  1IKU A;  1CDP A;  4NDC A;  3PLF B;  1QVI Y;  5I8N A;  1SY9 A;  3PAL A;  4ETO A;  3BUM B;  1DVI A;  4OKH A;  1UHH A;  2KI4 C;  4YI9 A;  1SKT A;  1RFJ A;  2L4I A;  2M7N A;  3A8R A;  4WRI A;  1QLK A;  1IQ3 A;  1CB1 A;  1NYA A;  2ZND A;  1JFK A;  3CGA A;  2KI4 B;  1EJ3 A;  1KFX L;  1QVI Z;  1ODB A;  1SL7 A;  3WHT B;  2O60 A;  1QLS A;  1KQM C;  2KFH A;  3D0Y A;  1LA0 A;  5CSF A;  3VRO A;  1N2D A;  1EH2 A;  1CMG A;  3SG6 A;  3SG3 A;  1CMF A;  1B7T Y;  1KQM B;  1N0Y A;  3AAK A;  4PE0 A;  3NSL A;  4P2Y B;  1BR1 B;  1BJF A;  3SG5 A;  1CDL A;  1HQV A;  3BYA A;  1D1O A;  2L2E A;  1WLM A;  1GGW A;  3NSI A;  2K7D A;  1DJW A;  1UP5 A;  2CCM A;  4NDD A;  4XJK A;  3NXA A;  1Y1U A;  4OV2 A;  3TDZ A;  1CDN A;  2BCX A;  1XA5 A;  5AAN A;  5JOL A;  4MZJ A;  3PM8 A;  2WCB A;  4DCK A;  3BOW A;  2F3Z A;  2BBN A;  2KFF A;  4M2Q A;  1UUR A;  4PDZ A;  5AEQ A;  5BPJ A;  2M29 A;  4PE7 A;  4HRE E;  4YBH B;  2KHN A;  2EC6 B;  4MRY A;  3IF7 A;  4YGE B;  3EKJ A;  4PCW A;  3SG7 A;  1DT7 B;  1K9P A;  1K94 A;  3OX6 A;  4GUK A;  3SG4 A;  4IL1 A;  1RK9 A;  2VRG A;  1AUI B;  2CXJ A;  5G08 A;  4ORA B;  3DVE A;  1WRK A;  2WOR A;  1E8A A;  4GPL B;  4I5J A;  4WQ2 A;  4AOM A;  3D0Y B;  3TDI A;  2BKI B;  1X02 A;  2FJU B;  2SCP A;  2K7B A;  3KHE A;  3JVT C;  1YX7 A;  3GOF A;  1AJ5 A;  1CFD A;  1EXR A;  4OR9 B;  2JU0 A;  1S6C A;  2E30 A;  1Y0V H;  3RM1 A;  2BE6 A;  2KGB C;  2MJW B;  3JVT B;  2KAX A;  1J1E A;  1LKJ A;  1Y1X A;  4XJK B;  1B4C A;  1QAS A;  3GK2 A;  2KFG A;  4BY5 A;  2EHB A;  2WCF A;  3PN7 C;  2JQ6 A;  1UHN A;  1CNP A;  3DD4 A;  1KWO C;  2PVB A;  3BOW B;  3ZWH A;  2NXQ A;  2MLE C;  5D69 A;  4GAO A;  2JTT A;  4GNK B;  1QV0 A;  2JNF A;  1HT9 A;  2BKH B;  2LP2 A;  2LLU A;  1SMG A;  5D7F A;  1MXE A;  2Q4U A;  2JT0 A;  1UUS A;  4MSP A;  3GK4 X;  1UHI A;  1JF0 A;  1IWQ A;  2KNE A;  3HX4 A;  2LHL A;  1KK8 B;  4GGF C;  5I2Q A;  4OVN F;  4DUQ A;  3CS1 A;  2JC2 A;  2JT3 A;  1S5G Y;  3FWC A;  1XVJ A;  3SG2 A;  2V53 A;  2OS8 B;  1ZAC A;  2CTN A;  1K9K A;  1FI6 A;  3LLE A;  1ZFS A;  1YUR A;  2KSP A;  2BL0 C;  2G2B A;  3OHM B;  1DF0 A;  1A75 A;  4GGN A;  1REC A;  1KK7 Y;  1S5G Z;  1MR8 A;  2I2R E;  3I5H C;  4YGB B;  5KTY A;  1MF8 B;  2BBM A;  5B8I B;  4QJ3 B;  2O5G A;  1JSA A;  1MQ1 A;  2CBL A;  4UPG A;  2M0R A;  1QX7 A;  2A4J A;  2Y1N A;  1S26 D;  3F45 A;  3I5H B;  4HSZ A;  2RGI A;  1DGU A;  1OOJ A;  1QV1 A;  1W7J B;  3FS7 A;  1DJX A;  1G4Y R;  1M63 B;  2Y1M A;  1KK7 Z;  5CPV A;  1H8B A;  1DJI A;  5CSI A;  1V1F A;  2E6W A;  3CR2 A;  5ER4 X;  1TN4 A;  1CLM A;  1TCF A;  3I5I C;  1K93 D;  1IJ6 A;  3EKH A;  1IJ5 A;  2LP3 A;  1BMO A;  2HET A;  5HLV A;  1TIZ A;  3JTD C;  4ORB B;  1DMO A;  1UHK A;  1ZUZ A;  2F2O A;  2F33 A;  3I5I B;  3TUY B;  3VRQ A;  2L5X B;  1KCY A;  4JQ0 D;  1XYD A;  1S36 A;  1S6I A;  2PAL A;  1YRU B;  2M1K B;  5HKZ A;  2L0P A;  2KI6 D;  3AKA A;  3JTD B;  1NP8 A;  5TNC A;  2KYF A;  1LA3 A;  1DF0 B;  1AP4 A;  1A75 B;  3NSK A;  4I5K A;  1LIN A;  1Q80 A;  1MXL C;  2ZKM X;  2GGM A;  1L2O B;  1WLZ A;  3DVK A;  2PAS A;  3SIB A;  1SR6 B;  4C0L A;  1JWD A;  3CZT X;  1YVL A;  1BLQ A;  1M45 A;  5K89 A;  1TNX A;  1TNP A;  2I94 A;  2K2F A;  2JOJ A;  3CTN A;  2AMI A;  2LHI A;  5AFP A;  1KSO A;  1J7Q A;  1F71 A;  5CSJ A;  2PRU A;  2H61 A;  2K8M B;  1SPY A;  2M49 B;  3O78 A;  1NCZ A;  5DKN A;  1IQ5 A;  3WXA A;  1B47 A;  2COL B;  3BUO B;  3BUN B;  3OB1 B;  1M39 A;  2AUC A;  4YGD B;  2H2K A;  1XFW O;  2M3W A;  4GFT A;  1YUU A;  1K9U A;  1NPQ A;  4JWQ A;  2FOT A;  2EC6 C;  1NUB A;  4MVF A;  1MWN A;  5HLO A;  1KFU S;  1L7Z A;  2LC5 A;  2JXL A;  2KYC A;  4HRG A;  2QAC A;  1M31 A;  2KBI A;  4Q04 A;  1PVB A;  2KAV A;  3TS5 B;  2OTG B;  4C0K A;  1AHR A;  2MA2 A;  1F54 A;  3KO0 A;  2JZI A;  3DVJ A;  5F6T A;  1YX8 A;  4MLW A;  4XYN A;  2LVV A;  1J7O A;  1OQP A;  3FIA A;  3OX5 A;  1M46 A;  4PHM A;  5JJG A;  1SK6 D;  1MHO A;  3VRP A;  2KAY A;  3IQQ A;  1XO5 A;  2I7A A;  3SIA A;  2LVI A;  3TZ1 A;  2SAS A;  1YTZ C;  3EVU A;  3FWB A;  1F4Q A;  3MSE B;  1NSH A;  1OMR A;  4CFR A;  1SW8 A;  3BQ3 A;  3NSO A;  2LLT A;  5IBW A;  4AQJ A;  4PE1 A;  4PE4 A;  1R2U A;  2TN4 A;  2F8P A;  4PHK A;  1B8C A;  2ZN8 A;  1XFY O;  4D1E A;  2BCA A;  1C07 A;  1FI5 A;  2LUC A;  3D10 A;  1QIW A;  1AK8 A;  4PHN A;  1JBA A;  1XK4 A;  2LAN A;  1WRZ A;  1SCV A;  1KK8 C;  4NQG A;  1A4P A;  1G33 A;  2M9G A;  1PSR A;  1DJH A;  4ICB A;  3BUX B;  2JWW A;  1QX2 A;  3SJS A;  2OS8 C;  2L51 A;  2KDH A;  2MAZ A;  5DKR A;  1GGZ A;  1K8U A;  3WHU B;  1K96 A;  1QTX A;  1QAT A;  1J1D A;  1K2H A;  1A03 A;  2F2P A;  2MHH A;  2LLS A;  4DRW A;  1SCM B;  1FF1 A;  5DKQ A;  1CLB A;  3GK1 A;  3VRR A;  2NZ0 A;  5HYD A;  2MRD A;  1RJV A;  2JRF A;  1BOD A;  1FPW A;  1YVH A;  3E3R A;  2D8N A;  1BF5 A;  1VRK A;  2DOQ A;  1PVA A;  3EK7 A;  1UHJ A;  1DTL A;  4DS7 A;  2LNK A;  1IGV A;  3LK1 A;  3CWG A;  4N1G A;  2K7O A;  2JUL A;  1RTP 1;  3I5F B;  1ALV A;  4WQ3 A;  1DJG A;  1IH0 A;  1IRJ A;  3PSR A;  1B8L A;  2WC8 A;  2G9B A;  1DJY A;  5AER A;  3BUW B;  4N5X A;  1ALW A;  2LVK A;  2CNP A;  1PAL A;  2HQW A;  1A2X A;  2KBM A;  2KGR A;  2AAO A;  4FTG A;  3A4U B;  4YI8 A;  2ZRT A;  3VRN A;  3TUY C;  3I5G B;  4M2O A;  3H4S E;  3EK8 A;  2JXC A;  1YR5 A;  4MBE A;  2WOS A;  1KFU L;  2GGZ A;  4JPZ B;  4NDB A;  4USL A;  4YRU A;  5KSZ A;  1OSA A;  1PUL A;  4GBA A;  1KSM A;  1OMD A;  3QRX A;  1DJZ A;  1G8I A;  1QIV A;  2L98 A;  5GQQ C;  1L2O C;  1SL8 A;  1SYM A;  1GQM A;  4TNC A;  1TRF A;  3LK0 A;  1SR6 C;  2LM5 A;  1NX3 A;  2L4H A;  2JT8 A;  1FBV A;  1K90 D;  3PFV A;  4BY4 A;  1CLL A;  3C1V A;  1F70 A;  4N1F A;  1NCX A;  2Q91 A;  1JC2 A;  1NIW A;  1OE9 B;  4OCI A;  2NCO A;  2PSR A;  1BOC A;  1BT6 A;  1YRT B;  2WND A;  1OMV A;  4L9M A;  1CFC A;  2BEC A;  3AAJ A;  1CTR A;  2M8U A;  1GJY A;  3CR4 X;  1B1G A;  3LCP C;  2LMT A;  1SNL A;  1QS7 A;  2F3Y A;  2LE9 B;  3LL8 B;  1XFU O;  2Y4Q A;  4F0Z B;  5CSN A;  1XFX O;  1J55 A;  4YGC B;  3OP0 A;  3TS5 C;  2JTZ A;  2KOT A;  2NLN A;  2OTG C;  1CM1 A;  3VGO A; 
#chains in the Genus database with same CATH topology
 1EG3 A;  1SRA A;  1W9Z A;  3S0F A;  1NX2 A;  2B1U A;  2ZN9 A;  4MZL A;  1J7P A;  1AVS A;  1DGV A;  5FI7 A;  1PSB A;  2BE4 A;  2LVJ A;  2P71 A;  3NHI A;  2LMU A;  3HCM A;  1BR4 B;  1CDM A;  3M0W A;  5I2L A;  3TDU A;  1CFF A;  1C7W A;  3EK4 A;  1NWD A;  1YUT A;  2GV5 A;  4M2P A;  4R1E A;  2KQY A;  4JD9 A;  1YUS A;  1F4O A;  3NGV A;  1EG4 A;  2H61 C;  3K21 A;  1B7T Z;  1S6J A;  1BG1 A;  1TOP A;  4CLN A;  5KU1 A;  1UWO A;  3BFB A;  1XFZ O;  1R6P A;  1A29 A;  1ZOT B;  2K60 A;  1S1E A;  3CLN A;  4QJ5 B;  2OPO A;  1WY9 A;  2MLF C;  1JF2 A;  3DF0 A;  1T14 A;  4A4B A;  2YGU A;  1PRW A;  1LXF C;  1TTX A;  1JUO A;  1KFX S;  3EVV A;  1XFR A;  3RLZ A;  4U8D A;  1CM4 A;  3V2L A;  4I5N B;  4I5L B;  4FQO A;  1AJ4 A;  1IIO A;  4GGF A;  1NCY A;  2R2I A;  1V1G A;  2M97 A;  3KPX A;  4ORC B;  3ICB A;  3UO9 A;  3PAT A;  1H4B A;  4CID A;  4MEW A;  5PAL A;  1FW4 A;  2I18 A;  3K1E A;  2WCM A;  3R1V A;  1RWY A;  2NCP A;  2QPT A;  2CT9 A;  2PMY A;  3OB2 B;  1SBJ A;  1NX1 A;  5HKW A;  1EL4 A;  2BCB A;  4MZK A;  3CR5 X;  4HRH A;  3L4A A;  4A4C A;  2HF5 A;  2LMV A;  4QJ4 B;  1SCM C;  3O6B A;  3O2P A;  2ZRS A;  4MRX A;  4YGA A;  1LVC D;  3AKB A;  2K0J A;  3EVR A;  4ZCV A;  2ZNE A;  1QXP A;  2MBX A;  1LS8 A;  1S3P A;  1Y6W A;  5ER5 A;  1B9A A;  1N65 A;  1XFV O;  2IS9 A;  1K95 A;  3O4Y A;  5I2O A;  2KI6 C;  1F8H A;  5J3X A;  3PN7 B;  1OZO A;  1C7V A;  3I5F C;  2FCD A;  1KWO B;  1CFP A;  1U5I A;  3R72 A;  2Y5I A;  3DF0 B;  5HKY A;  1NX0 A;  1QX5 B;  2WCE A;  2LUX A;  2JNX A;  2ISD A;  4PAL A;  2QEB A;  1IG5 A;  1XK4 C;  4MN0 A;  3SS3 A;  2JPT A;  1BU3 A;  1RRO A;  2K7C A;  1QWV A;  4P5O E;  4ZCU A;  3DYE A;  4C0J A;  1JFJ A;  2EGD A;  3L47 A;  1TNQ A;  1OZS A;  2ZFD A;  4CPV A;  5I94 A;  4PT1 A;  2KQ6 A;  1J7R A;  1TNW A;  3I5G C;  1MUX A;  2LV7 A;  1Y1A A;  3WNX B;  1WRL A;  4DIR A;  4E68 A;  2HPS A;  1QJT A;  2BL0 B;  2FCE A;  3IQO A;  3BXK A;  5FYX A;  2M7L A;  2M1U A;  2P6B B;  2QDI A;  1TCO B;  2K61 A;  3DXL A;  1W7I B;  4PHJ A;  1SL9 A;  1CKK A;  1SSE B;  3DVM A;  3S0E A;  3QME A;  4AQI A;  3ZNI A;  3KF9 A;  1P28 A;  3DZT A;  2L50 A;  1WDC C;  2LAP A;  5AXI A;  2WCL A;  1TUJ A;  2ERB A;  2K2A A;  1PK0 D;  2LCP A;  3B88 A;  5FI2 A;  1ZMZ A;  1U5I B;  2HQ8 A;  1F55 A;  1KQV A;  1WDC B;  1B8R A;  4CFQ A;  3CZ2 A;  3KEV A;  1IKU A;  1CDP A;  4NDC A;  3PLF B;  1QVI Y;  5I8N A;  3S0B A;  1SY9 A;  3PAL A;  4ETO A;  3BUM B;  1DVI A;  4OZD A;  4OKH A;  1UHH A;  2KI4 C;  4YI9 A;  1SKT A;  1RFJ A;  2L4I A;  2M7N A;  3A8R A;  4WRI A;  1QLK A;  1IQ3 A;  1CB1 A;  1NYA A;  2ZND A;  1JFK A;  3CGA A;  2KI4 B;  1EJ3 A;  1KFX L;  1QVI Z;  1ODB A;  1SL7 A;  3WHT B;  3BJH A;  2O60 A;  3BFH A;  1QLS A;  1KQM C;  2KFH A;  3D0Y A;  1LA0 A;  5CSF A;  3VRO A;  1N2D A;  1EH2 A;  4KYN A;  3D77 A;  1CMG A;  3SG6 A;  3SG3 A;  1CMF A;  1B7T Y;  1KQM B;  1N0Y A;  3AAK A;  4PE0 A;  2WCH A;  3NSL A;  4P2Y B;  1BR1 B;  1BJF A;  3SG5 A;  1CDL A;  1HQV A;  3BYA A;  1D1O A;  2L2E A;  1WLM A;  1GGW A;  2WCK A;  3NSI A;  2K7D A;  1DJW A;  4FQT A;  1UP5 A;  2CCM A;  4NDD A;  4XJK A;  3NXA A;  1Y1U A;  4OV2 A;  3TDZ A;  1CDN A;  2BCX A;  1XA5 A;  3OBV A;  5JOL A;  5AAN A;  4MZJ A;  3PM8 A;  2PQL A;  2WCB A;  4DCK A;  3BOW A;  2F3Z A;  2BBN A;  2KFF A;  2WCJ A;  1UUR A;  4M2Q A;  4PDZ A;  5AEQ A;  5BPJ A;  2M29 A;  4PE7 A;  4HRE E;  4YBH B;  2KHN A;  2EC6 B;  4MRY A;  3IF7 A;  4YGE B;  3EKJ A;  4PCW A;  3SG7 A;  1DT7 B;  1K9P A;  1OOG A;  1K94 A;  3RZS A;  3OX6 A;  4GUK A;  3SG4 A;  4IL1 A;  1DEK A;  1RK9 A;  2VRG A;  1AUI B;  2CXJ A;  5G08 A;  3S0G A;  4ORA B;  3DVE A;  1WRK A;  2WOR A;  3UNW A;  1E8A A;  4GPL B;  4I5J A;  1OOI X;  4WQ2 A;  4AOM A;  3D0Y B;  3TDI A;  3DY9 A;  2BKI B;  1X02 A;  2FJU B;  3R1P A;  2SCP A;  2K7B A;  3CAB A;  3JVT C;  3KHE A;  1YX7 A;  3GOF A;  1AJ5 A;  1CFD A;  1EXR A;  4OR9 B;  2JU0 A;  1S6C A;  2E30 A;  1Y0V H;  3RM1 A;  3S0A A;  2BE6 A;  2KGB C;  2MJW B;  3JVT B;  2KAX A;  1J1E A;  1LKJ A;  1Y1X A;  4XJK B;  1B4C A;  1QAS A;  3GK2 A;  2KFG A;  4BY5 A;  2EHB A;  2WCF A;  3PN7 C;  3D76 A;  2JQ6 A;  1UHN A;  2QEH A;  1CNP A;  1Z2C B;  3B87 A;  3FE9 A;  3DD4 A;  1KWO C;  2PVB A;  3BOW B;  3ZWH A;  2NXQ A;  2MLE C;  5D69 A;  4GAO A;  2JTT A;  4GNK B;  1ORG A;  1QV0 A;  2JNF A;  1HT9 A;  2BKH B;  2LP2 A;  2LLU A;  1SMG A;  5D7F A;  1MXE A;  2Q4U A;  2JT0 A;  1UUS A;  4MSP A;  3GK4 X;  1UHI A;  1JF0 A;  1IWQ A;  2KNE A;  3HX4 A;  2LHL A;  1KK8 B;  4GGF C;  5I2Q A;  4OVN F;  4DUQ A;  3CS1 A;  2JC2 A;  2JT3 A;  1S5G Y;  3FWC A;  1XVJ A;  3SG2 A;  2V53 A;  4JKT A;  2OS8 B;  1ZAC A;  2CTN A;  1K9K A;  1FI6 A;  1C3Y A;  3LLE A;  1ZFS A;  1YUR A;  2KLD A;  2KSP A;  2BL0 C;  2G2B A;  3OHM B;  3D74 A;  1DF0 A;  1A75 A;  4GGN A;  1REC A;  1KK7 Y;  1S5G Z;  1MR8 A;  2I2R E;  3I5H C;  4YGB B;  5KTY A;  1MF8 B;  2BBM A;  5B8I B;  4QJ3 B;  2O5G A;  1JSA A;  1MQ1 A;  2CBL A;  3B6X A;  4UPG A;  2M0R A;  1QX7 A;  2A4J A;  2KLE A;  2Y1N A;  1S26 D;  3F45 A;  3I5H B;  3S0D A;  4HSZ A;  2RGI A;  1DGU A;  1OOJ A;  1QV1 A;  1W7J B;  3FS7 A;  1DJX A;  3SS5 A;  1G4Y R;  1M63 B;  2Y1M A;  1KK7 Z;  5CPV A;  1H8B A;  1DJI A;  5CSI A;  1V1F A;  3O4X A;  2E6W A;  3R1O A;  3CR2 A;  5ER4 X;  1TN4 A;  1CLM A;  2WC6 A;  1TCF A;  3D75 A;  3I5I C;  1K93 D;  1IJ6 A;  3EKH A;  1IJ5 A;  2LP3 A;  1BMO A;  2HET A;  5HLV A;  1TIZ A;  1Z4H A;  3JTD C;  4ORB B;  1DMO A;  1UHK A;  1ZUZ A;  2F2O A;  2F33 A;  3I5I B;  3IVT A;  3TUY B;  2L5X B;  3VRQ A;  1KCY A;  4JQ0 D;  1XYD A;  1S36 A;  1S6I A;  2PAL A;  1YRU B;  2M1K B;  5HKZ A;  2L0P A;  2KI6 D;  3AKA A;  3JTD B;  1NP8 A;  5TNC A;  2KYF A;  1LA3 A;  1DF0 B;  1AP4 A;  1A75 B;  3NSK A;  4I5K A;  1LIN A;  3PM2 A;  1Q80 A;  1MXL C;  2ZKM X;  2GGM A;  1L2O B;  1WLZ A;  3DVK A;  2PAS A;  3SIB A;  1SR6 B;  4C0L A;  1JWD A;  3CZT X;  1YVL A;  2L2C A;  1M45 A;  3CZ0 A;  1BLQ A;  5K89 A;  1TNX A;  1TNP A;  2I94 A;  2K2F A;  2JOJ A;  3CTN A;  2AMI A;  2LHI A;  5AFP A;  1KSO A;  1J7Q A;  1F71 A;  5CSJ A;  1TUZ A;  2H61 A;  2K8M B;  2PRU A;  1SPY A;  2M49 B;  3O78 A;  1NCZ A;  5DKN A;  4INW A;  3SS4 A;  1IQ5 A;  3WXA A;  1B47 A;  2COL B;  2WC5 A;  3BUO B;  3BUN B;  3OB1 B;  1M39 A;  2AUC A;  4YGD B;  2H2K A;  1XFW O;  2M3W A;  4GFT A;  1YUU A;  1K9U A;  1NPQ A;  4JWQ A;  2FOT A;  2EC6 C;  1NUB A;  2QEO A;  4MVF A;  1MWN A;  5HLO A;  1KFU S;  1L7Z A;  2H8V A;  2JXL A;  2KYC A;  2LC5 A;  4HRG A;  2QAC A;  1M31 A;  2KBI A;  4Q04 A;  2JPO A;  1PVB A;  2KAV A;  3TS5 B;  2OTG B;  4C0K A;  1AHR A;  2MA2 A;  1F54 A;  3KO0 A;  2JZI A;  3DVJ A;  5F6T A;  1YX8 A;  4MLW A;  1GM0 A;  4XYN A;  2LVV A;  1J7O A;  1OQP A;  3FIA A;  3OX5 A;  1M46 A;  4PHM A;  3BFA A;  1DQE A;  1SK6 D;  3CYZ A;  5JJG A;  1MHO A;  3VRP A;  2KAY A;  3IQQ A;  1XO5 A;  2I7A A;  3SIA A;  2LVI A;  3TZ1 A;  2SAS A;  1YTZ C;  3EVU A;  3OGN A;  3FE6 A;  3FWB A;  1F4Q A;  3MSE B;  1NSH A;  3L4L A;  1OMR A;  4CFR A;  1SW8 A;  3BQ3 A;  1DC1 A;  3NSO A;  2LLT A;  5IBW A;  4AQJ A;  4PE1 A;  4PE4 A;  1R2U A;  3VB1 A;  2TN4 A;  2F8P A;  3D78 A;  4PHK A;  1B8C A;  2ZN8 A;  4IJ7 A;  1XFY O;  4D1E A;  2BCA A;  1C07 A;  1FI5 A;  2LUC A;  3D10 A;  1QIW A;  1AK8 A;  4PHN A;  1JBA A;  1XK4 A;  2LAN A;  1WRZ A;  1SCV A;  2KPH A;  5FI6 A;  1KK8 C;  4NQG A;  1A4P A;  3PJI A;  1G33 A;  2M9G A;  1PSR A;  1DJH A;  4ICB A;  3BUX B;  2JWW A;  1QX2 A;  3SJS A;  2OS8 C;  2L51 A;  2KDH A;  2MAZ A;  5DKR A;  1GGZ A;  1K8U A;  3WHU B;  1K96 A;  2P70 A;  1QTX A;  1QAT A;  1J1D A;  1K2H A;  1A03 A;  2F2P A;  2MHH A;  1OOH A;  2LLS A;  4DRW A;  1SCM B;  1FF1 A;  5DKQ A;  1CLB A;  3GK1 A;  3VRR A;  2NZ0 A;  5HYD A;  2MRD A;  1RJV A;  2JRF A;  1BOD A;  1FPW A;  1YVH A;  3E3R A;  2BNX A;  1DEL A;  2D8N A;  1BF5 A;  1VRK A;  2DOQ A;  1PVA A;  3EK7 A;  1UHJ A;  3N7H A;  5EL2 A;  1DTL A;  3D73 A;  4DS7 A;  2LNK A;  1IGV A;  3LK1 A;  3CWG A;  4N1G A;  2K7O A;  2JUL A;  2L5Y A;  1RTP 1;  3FE8 A;  1ALV A;  3I5F B;  2QEV A;  4WQ3 A;  1DJG A;  1IH0 A;  1IRJ A;  3PSR A;  4INX A;  1B8L A;  2WC8 A;  3NHT A;  2G9B A;  1DJY A;  5AER A;  3BUW B;  4N5X A;  1ALW A;  2GTE A;  2LVK A;  2CNP A;  1PAL A;  2HQW A;  5HL1 A;  1A2X A;  2KBM A;  2KGR A;  2AAO A;  4FTG A;  3A4U B;  4YI8 A;  2ZRT A;  3VRN A;  3TUY C;  3Q8I A;  3I5G B;  2FJY A;  4M2O A;  3H4S E;  3EK8 A;  2JXC A;  1YR5 A;  3CDN A;  4MBE A;  2WOS A;  1KFU L;  2GGZ A;  4JPZ B;  4NDB A;  1OW4 A;  5D3O A;  4USL A;  4YRU A;  1TWO A;  5KSZ A;  1OSA A;  1PUL A;  1OOF A;  4GBA A;  1KSM A;  1OMD A;  3QRX A;  1DJZ A;  1C3Z A;  1G8I A;  1QIV A;  2L98 A;  5GQQ C;  1L2O C;  1SL8 A;  1SYM A;  1GQM A;  4TNC A;  1TRF A;  3LK0 A;  1SR6 C;  2LM5 A;  1NX3 A;  2L4H A;  3CZ1 A;  2JT8 A;  1FBV A;  1K90 D;  3B7A A;  3PFV A;  1CLL A;  2BAP A;  4BY4 A;  3C1V A;  1F70 A;  4N1F A;  1NCX A;  2Q91 A;  1JC2 A;  1NIW A;  1OE9 B;  4OCI A;  2NCO A;  2PSR A;  1BOC A;  3B86 A;  1BT6 A;  1YRT B;  2WND A;  1OMV A;  2PYQ A;  4L9M A;  1CFC A;  2BEC A;  3AAJ A;  1CTR A;  2M8U A;  1GJY A;  3CR4 X;  5DIC A;  1B1G A;  3LCP C;  2LMT A;  1SNL A;  1QS7 A;  2F3Y A;  2LE9 B;  3LL8 B;  1XFU O;  2Y4Q A;  4F0Z B;  4F7F A;  5CSN A;  1XFX O;  1J55 A;  4YGC B;  3OP0 A;  3TS5 C;  2JTZ A;  2KOT A;  2NLN A;  2OTG C;  1CM1 A;  3VGO A;  3EG5 B; 
#chains in the Genus database with same CATH homology
 1EG3 A;  1SRA A;  1NX2 A;  2B1U A;  2ZN9 A;  4MZL A;  1J7P A;  1AVS A;  1DGV A;  1PSB A;  2BE4 A;  2LVJ A;  2LMU A;  3HCM A;  1BR4 B;  1CDM A;  3M0W A;  5I2L A;  3TDU A;  1CFF A;  1C7W A;  3EK4 A;  1NWD A;  1YUT A;  2GV5 A;  4M2P A;  4R1E A;  2KQY A;  1YUS A;  1F4O A;  1EG4 A;  2H61 C;  3K21 A;  1B7T Z;  1S6J A;  1BG1 A;  1TOP A;  4CLN A;  5KU1 A;  1UWO A;  1XFZ O;  1R6P A;  1A29 A;  1ZOT B;  1S1E A;  3CLN A;  4QJ5 B;  2OPO A;  1WY9 A;  2MLF C;  1JF2 A;  3DF0 A;  4A4B A;  1PRW A;  1LXF C;  1TTX A;  1JUO A;  1KFX S;  3EVV A;  3RLZ A;  4U8D A;  1CM4 A;  4I5N B;  4I5L B;  4FQO A;  1AJ4 A;  4GGF A;  1NCY A;  2R2I A;  1V1G A;  2M97 A;  3KPX A;  4ORC B;  3ICB A;  1H4B A;  3PAT A;  4CID A;  4MEW A;  5PAL A;  1FW4 A;  2I18 A;  1RWY A;  2NCP A;  2QPT A;  2CT9 A;  2PMY A;  3OB2 B;  1SBJ A;  1NX1 A;  5HKW A;  1EL4 A;  2BCB A;  4MZK A;  3CR5 X;  4HRH A;  4A4C A;  2HF5 A;  2LMV A;  4QJ4 B;  1SCM C;  3O6B A;  3O2P A;  2ZRS A;  4MRX A;  4YGA A;  1LVC D;  3AKB A;  2K0J A;  3EVR A;  4ZCV A;  2ZNE A;  1QXP A;  2MBX A;  1S3P A;  1Y6W A;  5ER5 A;  1B9A A;  1N65 A;  1XFV O;  2IS9 A;  1K95 A;  3O4Y A;  5I2O A;  2KI6 C;  1F8H A;  5J3X A;  3PN7 B;  1OZO A;  1C7V A;  3I5F C;  2FCD A;  1KWO B;  1CFP A;  1U5I A;  5HKY A;  2Y5I A;  3DF0 B;  1NX0 A;  1QX5 B;  2WCE A;  2LUX A;  2JNX A;  2ISD A;  4PAL A;  1IG5 A;  1XK4 C;  4MN0 A;  2JPT A;  1BU3 A;  1RRO A;  2K7C A;  4P5O E;  4ZCU A;  4C0J A;  1JFJ A;  2EGD A;  1TNQ A;  1OZS A;  2ZFD A;  4CPV A;  2KQ6 A;  1J7R A;  1TNW A;  3I5G C;  1MUX A;  2LV7 A;  1Y1A A;  3WNX B;  1WRL A;  4DIR A;  4E68 A;  2HPS A;  1QJT A;  2BL0 B;  2FCE A;  3IQO A;  3BXK A;  5FYX A;  2M7L A;  2M1U A;  2P6B B;  1TCO B;  2K61 A;  1W7I B;  4PHJ A;  1SL9 A;  1CKK A;  3DVM A;  4AQI A;  3ZNI A;  3KF9 A;  2L50 A;  1WDC C;  2LAP A;  5AXI A;  2K2A A;  2LCP A;  1PK0 D;  1ZMZ A;  1U5I B;  2HQ8 A;  1F55 A;  1KQV A;  1WDC B;  1B8R A;  4CFQ A;  3KEV A;  1IKU A;  1CDP A;  4NDC A;  3PLF B;  1QVI Y;  5I8N A;  1SY9 A;  3PAL A;  4ETO A;  3BUM B;  1DVI A;  4OKH A;  1UHH A;  2KI4 C;  4YI9 A;  1SKT A;  1RFJ A;  2L4I A;  2M7N A;  3A8R A;  4WRI A;  1QLK A;  1IQ3 A;  1CB1 A;  1NYA A;  2ZND A;  1JFK A;  3CGA A;  2KI4 B;  1EJ3 A;  1KFX L;  1QVI Z;  1ODB A;  1SL7 A;  3WHT B;  2O60 A;  1QLS A;  1KQM C;  2KFH A;  3D0Y A;  1LA0 A;  5CSF A;  3VRO A;  1N2D A;  1EH2 A;  1CMG A;  3SG6 A;  3SG3 A;  1CMF A;  1B7T Y;  1KQM B;  1N0Y A;  3AAK A;  4PE0 A;  3NSL A;  4P2Y B;  1BR1 B;  1BJF A;  3SG5 A;  1CDL A;  1HQV A;  3BYA A;  1D1O A;  2L2E A;  1WLM A;  1GGW A;  3NSI A;  2K7D A;  1DJW A;  1UP5 A;  2CCM A;  4NDD A;  4XJK A;  3NXA A;  1Y1U A;  4OV2 A;  3TDZ A;  1CDN A;  2BCX A;  1XA5 A;  5AAN A;  5JOL A;  4MZJ A;  3PM8 A;  2WCB A;  4DCK A;  3BOW A;  2F3Z A;  2BBN A;  2KFF A;  4M2Q A;  1UUR A;  4PDZ A;  5AEQ A;  5BPJ A;  2M29 A;  4PE7 A;  4HRE E;  4YBH B;  2KHN A;  2EC6 B;  4MRY A;  3IF7 A;  4YGE B;  3EKJ A;  4PCW A;  3SG7 A;  1DT7 B;  1K9P A;  1K94 A;  3OX6 A;  4GUK A;  3SG4 A;  4IL1 A;  1RK9 A;  2VRG A;  1AUI B;  2CXJ A;  5G08 A;  4ORA B;  3DVE A;  1WRK A;  2WOR A;  1E8A A;  4GPL B;  4I5J A;  4WQ2 A;  4AOM A;  3D0Y B;  3TDI A;  2BKI B;  1X02 A;  2FJU B;  2SCP A;  2K7B A;  3KHE A;  3JVT C;  1YX7 A;  3GOF A;  1AJ5 A;  1CFD A;  1EXR A;  4OR9 B;  2JU0 A;  1S6C A;  2E30 A;  1Y0V H;  3RM1 A;  2BE6 A;  2KGB C;  2MJW B;  3JVT B;  2KAX A;  1J1E A;  1LKJ A;  1Y1X A;  4XJK B;  1B4C A;  1QAS A;  3GK2 A;  2KFG A;  4BY5 A;  2EHB A;  2WCF A;  3PN7 C;  2JQ6 A;  1UHN A;  1CNP A;  3DD4 A;  1KWO C;  2PVB A;  3BOW B;  3ZWH A;  2NXQ A;  2MLE C;  5D69 A;  4GAO A;  2JTT A;  4GNK B;  1QV0 A;  2JNF A;  1HT9 A;  2BKH B;  2LP2 A;  2LLU A;  1SMG A;  5D7F A;  1MXE A;  2Q4U A;  2JT0 A;  1UUS A;  4MSP A;  3GK4 X;  1UHI A;  1JF0 A;  1IWQ A;  2KNE A;  3HX4 A;  2LHL A;  1KK8 B;  4GGF C;  5I2Q A;  4OVN F;  4DUQ A;  3CS1 A;  2JC2 A;  2JT3 A;  1S5G Y;  3FWC A;  1XVJ A;  3SG2 A;  2V53 A;  2OS8 B;  1ZAC A;  2CTN A;  1K9K A;  1FI6 A;  3LLE A;  1ZFS A;  1YUR A;  2KSP A;  2BL0 C;  2G2B A;  3OHM B;  1DF0 A;  1A75 A;  4GGN A;  1REC A;  1KK7 Y;  1S5G Z;  1MR8 A;  2I2R E;  3I5H C;  4YGB B;  5KTY A;  1MF8 B;  2BBM A;  5B8I B;  4QJ3 B;  2O5G A;  1JSA A;  1MQ1 A;  2CBL A;  4UPG A;  2M0R A;  1QX7 A;  2A4J A;  2Y1N A;  1S26 D;  3F45 A;  3I5H B;  4HSZ A;  2RGI A;  1DGU A;  1OOJ A;  1QV1 A;  1W7J B;  3FS7 A;  1DJX A;  1G4Y R;  1M63 B;  2Y1M A;  1KK7 Z;  5CPV A;  1H8B A;  1DJI A;  5CSI A;  1V1F A;  2E6W A;  3CR2 A;  5ER4 X;  1TN4 A;  1CLM A;  1TCF A;  3I5I C;  1K93 D;  1IJ6 A;  3EKH A;  1IJ5 A;  2LP3 A;  1BMO A;  2HET A;  5HLV A;  1TIZ A;  3JTD C;  4ORB B;  1DMO A;  1UHK A;  1ZUZ A;  2F2O A;  2F33 A;  3I5I B;  3TUY B;  3VRQ A;  2L5X B;  1KCY A;  4JQ0 D;  1XYD A;  1S36 A;  1S6I A;  2PAL A;  1YRU B;  2M1K B;  5HKZ A;  2L0P A;  2KI6 D;  3AKA A;  3JTD B;  1NP8 A;  5TNC A;  2KYF A;  1LA3 A;  1DF0 B;  1AP4 A;  1A75 B;  3NSK A;  4I5K A;  1LIN A;  1Q80 A;  1MXL C;  2ZKM X;  2GGM A;  1L2O B;  1WLZ A;  3DVK A;  2PAS A;  3SIB A;  1SR6 B;  4C0L A;  1JWD A;  3CZT X;  1YVL A;  1BLQ A;  1M45 A;  5K89 A;  1TNX A;  1TNP A;  2I94 A;  2K2F A;  2JOJ A;  3CTN A;  2AMI A;  2LHI A;  5AFP A;  1KSO A;  1J7Q A;  1F71 A;  5CSJ A;  2PRU A;  2H61 A;  2K8M B;  1SPY A;  2M49 B;  3O78 A;  1NCZ A;  5DKN A;  1IQ5 A;  3WXA A;  1B47 A;  2COL B;  3BUO B;  3BUN B;  3OB1 B;  1M39 A;  2AUC A;  4YGD B;  2H2K A;  1XFW O;  2M3W A;  4GFT A;  1YUU A;  1K9U A;  1NPQ A;  4JWQ A;  2FOT A;  2EC6 C;  1NUB A;  4MVF A;  1MWN A;  5HLO A;  1KFU S;  1L7Z A;  2LC5 A;  2JXL A;  2KYC A;  4HRG A;  2QAC A;  1M31 A;  2KBI A;  4Q04 A;  1PVB A;  2KAV A;  3TS5 B;  2OTG B;  4C0K A;  1AHR A;  2MA2 A;  1F54 A;  3KO0 A;  2JZI A;  3DVJ A;  5F6T A;  1YX8 A;  4MLW A;  4XYN A;  2LVV A;  1J7O A;  1OQP A;  3FIA A;  3OX5 A;  1M46 A;  4PHM A;  5JJG A;  1SK6 D;  1MHO A;  3VRP A;  2KAY A;  3IQQ A;  1XO5 A;  2I7A A;  3SIA A;  2LVI A;  3TZ1 A;  2SAS A;  1YTZ C;  3EVU A;  3FWB A;  1F4Q A;  3MSE B;  1NSH A;  1OMR A;  4CFR A;  1SW8 A;  3BQ3 A;  3NSO A;  2LLT A;  5IBW A;  4AQJ A;  4PE1 A;  4PE4 A;  1R2U A;  2TN4 A;  2F8P A;  4PHK A;  1B8C A;  2ZN8 A;  1XFY O;  4D1E A;  2BCA A;  1C07 A;  1FI5 A;  2LUC A;  3D10 A;  1QIW A;  1AK8 A;  4PHN A;  1JBA A;  1XK4 A;  2LAN A;  1WRZ A;  1SCV A;  1KK8 C;  4NQG A;  1A4P A;  1G33 A;  2M9G A;  1PSR A;  1DJH A;  4ICB A;  3BUX B;  2JWW A;  1QX2 A;  3SJS A;  2OS8 C;  2L51 A;  2KDH A;  2MAZ A;  5DKR A;  1GGZ A;  1K8U A;  3WHU B;  1K96 A;  1QTX A;  1QAT A;  1J1D A;  1K2H A;  1A03 A;  2F2P A;  2MHH A;  2LLS A;  4DRW A;  1SCM B;  1FF1 A;  5DKQ A;  1CLB A;  3GK1 A;  3VRR A;  2NZ0 A;  5HYD A;  2MRD A;  1RJV A;  2JRF A;  1BOD A;  1FPW A;  1YVH A;  3E3R A;  2D8N A;  1BF5 A;  1VRK A;  2DOQ A;  1PVA A;  3EK7 A;  1UHJ A;  1DTL A;  4DS7 A;  2LNK A;  1IGV A;  3LK1 A;  3CWG A;  4N1G A;  2K7O A;  2JUL A;  1RTP 1;  3I5F B;  1ALV A;  4WQ3 A;  1DJG A;  1IH0 A;  1IRJ A;  3PSR A;  1B8L A;  2WC8 A;  2G9B A;  1DJY A;  5AER A;  3BUW B;  4N5X A;  1ALW A;  2LVK A;  2CNP A;  1PAL A;  2HQW A;  1A2X A;  2KBM A;  2KGR A;  2AAO A;  4FTG A;  3A4U B;  4YI8 A;  2ZRT A;  3VRN A;  3TUY C;  3I5G B;  4M2O A;  3H4S E;  3EK8 A;  2JXC A;  1YR5 A;  4MBE A;  2WOS A;  1KFU L;  2GGZ A;  4JPZ B;  4NDB A;  4USL A;  4YRU A;  5KSZ A;  1OSA A;  1PUL A;  4GBA A;  1KSM A;  1OMD A;  3QRX A;  1DJZ A;  1G8I A;  1QIV A;  2L98 A;  5GQQ C;  1L2O C;  1SL8 A;  1SYM A;  1GQM A;  4TNC A;  1TRF A;  3LK0 A;  1SR6 C;  2LM5 A;  1NX3 A;  2L4H A;  2JT8 A;  1FBV A;  1K90 D;  3PFV A;  4BY4 A;  1CLL A;  3C1V A;  1F70 A;  4N1F A;  1NCX A;  2Q91 A;  1JC2 A;  1NIW A;  1OE9 B;  4OCI A;  2NCO A;  2PSR A;  1BOC A;  1BT6 A;  1YRT B;  2WND A;  1OMV A;  4L9M A;  1CFC A;  2BEC A;  3AAJ A;  1CTR A;  2M8U A;  1GJY A;  3CR4 X;  1B1G A;  3LCP C;  2LMT A;  1SNL A;  1QS7 A;  2F3Y A;  2LE9 B;  3LL8 B;  1XFU O;  2Y4Q A;  4F0Z B;  5CSN A;  1XFX O;  1J55 A;  4YGC B;  3OP0 A;  3TS5 C;  2JTZ A;  2KOT A;  2NLN A;  2OTG C;  1CM1 A;  3VGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...