2DOQA

Crystal structure of sfi1p/cdc31p complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
146
structure length
146
Chain Sequence
SELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 31
publication title Structural role of Sfi1p-centrin filaments in budding yeast spindle pole body duplication.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 39
structure length 146
sequence length 146
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2doqA01
1BMOA 1SMGA 1A4PA 3O4YA 1QLKA 1K8UA 1F4OA 3OX5A 1S1EA 3FS7A 3O2PA 4MZJA 5I2OA 1DJWA 1OMRA 3GK4X 1KFUS 3TDIA 3I5FC 4XJKA 5GQQC 4QJ5B 4CLNA 1FPWA 2M7LA 3VRRA 4C0LA 2LANA 3DVEA 3C1VA 4I5KA 2ISDA 2ZN9A 2CNPA 5D7FA 5AFPA 2BE4A 3PFVA 1AUIB 2JTTA 2GGMA 1Q80A 2JT8A 2LMVA 1SBJA 3LLEA 1CNPA 4AQJA 1ZACA 5DKNA 4ZCVA 2NCPA 3CLNA 1CMFA 1EXRA 1BR1B 2JPTA 2ZKMX 3A4UB 3NSOA 1N0YA 2KAXA 2BCXA 1B47A 1NX3A 1SCMC 1OZOA 4M2PA 4MEWA 3NSLA 1XO5A 2BL0B 1JF0A 1JBAA 1M46A 1NCZA 4YGAA 3SG4A 2Y1NA 1F4QA 3TDUA 2H61C 1XK4C 4ORBB 2M1UA 1CLMA 1A75B 3GK2A 3SG7A 4BY4A 5JOLA 5HKYA 2JWWA 1A29A 1IJ6A 2JRFA 3I5IB 1W7IB 1L7ZA 2LHIA 5JJGA 3VROA 1SL7A 3WNXB 3LCPC 4FQOA 3SG3A 5AANA 1CFFA 1RTP1 1EH2A 4OCIA 1K94A 4CFRA 3BOWB 1DJZA 2JT0A 2LMUA 1DF0A 3JTDB 3TUYB 2E6WA 1IG5A 1PALA 2F3ZA 2R2IA 2V53A 2FCEA 3QRXA 1BG1A 2LHLA 1C7VA 4ETOA 3ZNIA 1SW8A 4XYNA 3F45A 2ZNEA 1OQPA 2M8UA 1MR8A 1QLSA 1OMVA 1FF1A 1LKJA 2PALA 2K61A 4MBEA 1Y6WA 4PHKA 3DF0A 3VRQA 4DIRA 1KQMC 4NDCA 1CDMA 4GAOA 1GJYA 1QJTA 4GGFC 2MHHA 4NDDA 3NXAA 1OOJA 2G2BA 5PALA 2GV5A 2MA2A 1BLQA 3DVJA 1SRAA 3WHTB 4YRUA 1TOPA 4JWQA 1KFXS 3AAJA 2LLSA 1TCOB 1QIWA 5I2LA 1NWDA 3EKJA 3BUMB 4ICBA 1XFVO 2BBNA 2K7BA 2EGDA 2Q91A 3KPXA 2H61A 1XK4A 4QJ3B 2BKHB 2CBLA 2O60A 4NQGA 1F8HA 4Q04A 2LUXA 3WXAA 2LNKA 2ZRSA 2PASA 4A4CA 1J7PA 1NX1A 1TNXA 3CR2A 1CMGA 2JXLA 1MF8B 1Y0VH 3HX4A 3PATA 2PRUA 3SJSA 1JWDA 3KEVA 2L98A 1WLMA 1H8BA 2KGBC 1CB1A 1GQMA 1SK6D 1WLZA 1F54A 3PSRA 2M97A 1CFDA 1FI5A 1AP4A 1K90D 3OX6A 4N1GA 3BUNB 1SL9A 1RFJA 2LVKA 3BYAA 1XFWO 3OHMB 4GFTA 4I5LB 1TNQA 5I2QA 2KYCA 1UUSA 3PLFB 4PE7A 1M45A 1WRZA 3LK0A 2RGIA 1UHIA 1XYDA 1KK7Z 3BUXB 4MVFA 3DVMA 1NP8A 1RJVA 1LXFC 2BKIB 2JTZA 4GGFA 3VGOA 1DJIA 1IGVA 2DOQA 5KTYA 2LC5A 2WOSA 2L4IA 4M2QA 3A8RA 1PVBA 2WCFA 1IH0A 1AJ4A 1K9PA 1V1FA 1CKKA 1G4YR 2BCAA 3PN7B 3TZ1A 2VRGA 1K95A 1S6IA 3LL8B 4XJKB 3MSEB 1F71A 1HQVA 2JOJA 3EVRA 1RWYA 3SG2A 3IQOA 1L2OC 1QVIY 2K0JA 4YGDB 1YX7A 3I5GC 2E30A 1G33A 1KFUL 4PALA 2JNFA 2I2RE 1B4CA 5CSNA 1BU3A 1UWOA 3EKHA 1DJGA 2JULA 5BPJA 1QATA 2L0PA 3GK1A 1OE9B 2M7NA 3HCMA 3VRPA 4R1EA 1N65A 4HREE 2KOTA 1KWOC 1B8RA 1YRTB 4DUQA 1KQVA 4MN0A 2JU0A 1UHJA 4YI9A 3AKAA 2LVJA 1K9UA 4WQ3A 2KI6C 1CM4A 1HT9A 3CZTX 5FYXA 1J1EA 1WDCC 3BXKA 3JVTC 4PHMA 1EL4A 1TIZA 2OS8C 4PDZA 1F55A 1XA5A 1NUBA 3E3RA 3OP0A 2COLB 3CR5X 3I5HB 1H4BA 2ZRTA 2OTGB 2LAPA 3KHEA 1Y1XA 4HRHA 4PE1A 1F70A 2WCBA 5DKRA 5CSJA 1K2HA 1RK9A 1GGZA 2LLUA 1IKUA 1CFPA 1LA0A 2ZN8A 4GPLB 1DF0B 2AMIA 2LMTA 2F2PA 1TN4A 3OB1B 1B7TZ 4BY5A 1BT6A 1TNPA 2L4HA 3I5FB 1BOCA 1WY9A 1K9KA 2AAOA 1CDPA 2FOTA 1JUOA 1RECA 1KCYA 4M2OA 3OB2B 3CS1A 4ORAB 3DF0B 3D0YA 2KI6D 5KU1A 4YI8A 4UPGA 3D0YB 3EK8A 1S3PA 1ZUZA 2I7AA 5CPVA 1ALVA 1U5IA 5F6TA 2Q4UA 1K96A 1S5GY 1JFKA 5G08A 1TNWA 1DJXA 3RM1A 2KQYA 4MRYA 3EVVA 1Y1UA 1QX2A 1JC2A 1E8AA 1SCMB 1N2DA 1CTRA 1ZMZA 4FTGA 3ZWHA 2P6BB 4MZLA 3FWBA 1EG3A 1M31A 1NCXA 2PSRA 1ZFSA 5DKQA 3LK1A 3AAKA 1BODA 2MLFC 3CR4X 1PSRA 3O78A 1YURA 5HLOA 4PCWA 1DMOA 2G9BA 1JFJA 2F2OA 2KFFA 3FIAA 1NIWA 3O6BA 1NX2A 1J7RA 2K8MB 2JXCA 2LUCA 2I18A 3SIBA 2PVBA 4TNCA 4PE4A 4MSPA 1KK8C 2M29A 2WCEA 1J7QA 1EJ3A 3BQ3A 2BE6A 4GGNA 1UHNA 4YGBB 2KBMA 2KAYA 4HSZA 4WQ2A 2FJUB 3AKBA 2PMYA 1DVIA 2CCMA 1DJHA 5AERA 1IQ5A 4DCKA 1CDLA 3CGAA 2NXQA 1V1GA 1KQMB 2B1UA 2L2EA 2K2AA 2L50A 1DTLA 1M39A 2ZFDA 4IL1A 4U8DA 1S36A 5AXIA 4HRGA 2BCBA 1ALWA 5KSZA 2MJWB 1YVHA 2H2KA 4PHNA 2NCOA 3I5IC 2GGZA 1PSBA 3GOFA 1QASA 2HPSA 2KFHA 2LVVA 1CM1A 4N1FA 1BR4B 1TTXA 2KAVA 1YX8A 2WC8A 5TNCA 2LCPA 3TDZA 1A03A 2CT9A 4GUKA 2M1KB 3RLZA 3KO0A 1IJ5A 1PVAA 3JTDC 1BJFA 2MBXA 1XFYO 3TUYC 4MLWA 1TRFA 4WRIA 2O5GA 4C0JA 1IQ3A 1SYMA 2MLEC 2LE9B 4NDBA 4PE0A 3BUWB 2KSPA 4A4BA 2WORA 1NCYA 1A2XA 1YVLA 2K7OA 2K2FA 1RROA 1MUXA 2KQ6A 1R2UA 2BECA 4MZKA 4F0ZB 4YGEB 1G8IA 1SCVA 1SR6C 4OKHA 1DGUA 1KK8B 3D10A 4YGCB 1MXLC 1JF2A 4N5XA 3IF7A 3VRNA 1XFUO 2D8NA 2Y1MA 5D69A 3ICBA 1CLBA 2EC6C 2AUCA 4OVNF 2EHBA 1DT7B 3TS5C 4D1EA 2KHNA 1S6CA 2KBIA 2BBMA 2CTNA 2LLTA 3DVKA 2KDHA 2M0RA 1QX5B 1LA3A 1QX7A 1YTZC 1A75A 2HQWA 2K7CA 2KFGA 1NSHA 4AQIA 4ORCB 2KYFA 1ODBA 1PK0D 1SY9A 5HKZA 2JT3A 1QXPA 3CWGA 4P5OE 1R6PA 3M0WA 2SCPA 5HLVA 4DS7A 1WRLA 1UHKA 4GNKB 3KF9A 3EK7A 1DJYA 1OZSA 4GBAA 1L2OB 1XFXO 1YUTA 3I5GB 4C0KA 1FBVA 3BOWA 3IQQA 1B1GA 2M3WA 3BUOB 1BF5A 1NYAA 3SG5A 4I5JA 5ER4X 2L51A 1FW4A 2Y4QA 3DD4A 3EK4A 3SG6A 3WHUB 1B8LA 3NSKA 1QVIZ 1B8CA 4ZCUA 4E68A 4P2YB 1MHOA 1U5IB 4USLA 1KK7Y 1SNLA 1KWOB 1ZOTB 2KI4C 5K89A 4JPZB 1M63B 1C07A 4L9MA 1AJ5A 2LV7A 5HYDA 1DGVA 1AHRA 1MXEA 1YUSA 2JQ6A 4CPVA 4JQ0D 1IRJA 1WDCB 4YBHB 5CSFA 3JVTB 5I8NA 2JC2A 1D1OA 1SL8A 2LM5A 1J7OA 3PALA 1YUUA 1KFXL 1SR6B 1MWNA 2M49B 1QIVA 2OS8B 3PM8A 1CLLA 1TCFA 1OSAA 3PN7C 2M9GA 4PHJA 1S6JA 3SIAA 2KGRA 1JSAA 1X02A 2EC6B 4CFQA 1UP5A 3TS5B 1UHHA 1LINA 1AK8A 2CXJA 2SASA 2K7DA 1PULA 1VRKA 1QV1A 2F8PA 2JNXA 2HETA 1YR5A 2NZ0A 1QTXA 1EG4A 1K93D 1XVJA 2MAZA 4OV2A 1CDNA 2IS9A 5HKWA 4AOMA 4QJ4B 5B8IB 2Y5IA 1C7WA 1IWQA 1KSOA 4CIDA 2BL0C 1J1DA 1S26D 1QV0A 1LVCD 2QPTA 1WRKA 1KSMA 1FI6A 1XFZO 2L5XB 3NSIA 4I5NB 3K21A 2NLNA 5AEQA 1MQ1A 2HF5A 1YRUB 2F3YA 1PRWA 1CFCA 1UURA 2TN4A 1GGWA 2HQ8A 2OPOA 2QACA 2I94A 1W7JB 5J3XA 3FWCA 2F33A 4DRWA 1AVSA 1NX0A 4OR9B 2ZNDA 1B9AA 2LVIA 3I5HC 4MRXA 2OTGC 3CTNA 5CSIA 3EVUA 2KNEA 2A4JA 2KI4B 2WNDA 2FCDA 2LP2A 2LP3A 5IBWA 1Y1AA 5ER5A 1S5GZ 1SPYA 1J55A 1QS7A 1B7TY 2MRDA 3H4SE 2JZIA 1OMDA 1NPQA 1SKTA
chains in the Genus database with same CATH superfamily
1BMOA 1SMGA 1A4PA 3O4YA 1QLKA 1K8UA 1DQEA 1F4OA 3OX5A 1S1EA 3FS7A 3O2PA 4MZJA 5I2OA 1DJWA 1OMRA 3GK4X 1KFUS 3TDIA 3I5FC 4XJKA 5GQQC 4QJ5B 5HL1A 4CLNA 1FPWA 2M7LA 3VRRA 4C0LA 2LANA 5DICA 3DVEA 3DYEA 3C1VA 4I5KA 2ISDA 2ZN9A 2CNPA 5D7FA 5AFPA 2BE4A 3PFVA 3S0AA 1AUIB 2JTTA 2GGMA 1Q80A 2JT8A 2LMVA 1SBJA 3LLEA 3D78A 1CNPA 4AQJA 1ZACA 5DKNA 3D77A 4ZCVA 2NCPA 3CLNA 3R1PA 1CMFA 1EXRA 1BR1B 2JPTA 2ZKMX 3A4UB 3NSOA 3OGNA 1N0YA 2KAXA 2BCXA 1B47A 1NX3A 1SCMC 1OZOA 3DZTA 4M2PA 4MEWA 3NSLA 1XO5A 2BL0B 1JF0A 1JBAA 2QEBA 1M46A 1NCZA 4YGAA 3SG4A 3UNWA 2Y1NA 1F4QA 3TDUA 2H61C 3VB1A 1XK4C 2L5YA 2M1UA 1CLMA 1A75B 3GK2A 4ORBB 3SG7A 5JOLA 4BY4A 5HKYA 2JWWA 1A29A 3D76A 3V2LA 1IJ6A 2JRFA 3I5IB 1W7IB 1L7ZA 1XFRA 2LHIA 5JJGA 3VROA 1SL7A 3WNXB 3LCPC 4FQOA 3SG3A 5AANA 1CFFA 3Q8IA 1RTP1 1EH2A 4OCIA 1K94A 1LS8A 4CFRA 3BOWB 1DJZA 2JT0A 2LMUA 1DF0A 3JTDB 3TUYB 2E6WA 1IG5A 1PALA 2F3ZA 2R2IA 2V53A 2FCEA 3QRXA 1BG1A 2LHLA 1C7VA 4ETOA 3L4AA 1DELA 3ZNIA 1SW8A 4XYNA 3F45A 2ZNEA 1OQPA 2M8UA 1MR8A 1QLSA 1OMVA 3BFBA 4F7FA 1FF1A 1LKJA 2PALA 2K61A 3FE8A 4MBEA 1Y6WA 4PHKA 3DF0A 3VRQA 4DIRA 2ERBA 1KQMC 3B6XA 4NDCA 1CDMA 2P70A 4GAOA 1GJYA 1QJTA 4GGFC 2MHHA 4NDDA 3NXAA 1OOJA 2G2BA 5PALA 1GM0A 2GV5A 2MA2A 3R1VA 3DVJA 1BLQA 1TUJA 1SRAA 3WHTB 4YRUA 1TOPA 4JWQA 1KFXS 1Z2CB 2LLSA 3AAJA 1TCOB 1OOFA 1QIWA 5I2LA 1NWDA 3EKJA 3BUMB 4ICBA 1XFVO 2BBNA 2K7BA 2EGDA 2Q91A 2QDIA 3KPXA 2H61A 1XK4A 1TUZA 1OW4A 4QJ3B 2BKHB 2CBLA 2O60A 4NQGA 3R1OA 1F8HA 4Q04A 1OMDA 2LUXA 3DXLA 5D3OA 3WXAA 2LNKA 2ZRSA 2PASA 4A4CA 1J7PA 1NX1A 3K1EA 1TNXA 3CR2A 1CMGA 2JXLA 3L47A 3CYZA 3S0GA 1MF8B 1Y0VH 3HX4A 3PATA 2PRUA 3SJSA 1JWDA 3KEVA 2L98A 1WLMA 3FE6A 1H8BA 2KGBC 1CB1A 2H8VA 1GQMA 1SK6D 1WLZA 1F54A 3PSRA 2M97A 1CFDA 1FI5A 1AP4A 2PYQA 1K90D 3OX6A 4N1GA 3BUNB 1SL9A 3S0FA 1RFJA 2LVKA 3BYAA 1XFWO 3OHMB 4GFTA 4I5LB 1TNQA 5I2QA 2KYCA 1UUSA 3PLFB 4PE7A 1M45A 1WRZA 3LK0A 3EG5B 2RGIA 1UHIA 1XYDA 1KK7Z 3BUXB 4MVFA 3IVTA 3DVMA 1NP8A 1RJVA 1LXFC 2BKIB 2JTZA 4GGFA 3VGOA 5I94A 1DJIA 1IGVA 2DOQA 5KTYA 3CZ1A 2LC5A 2WOSA 2L4IA 4M2QA 3A8RA 1PVBA 2WCFA 1IH0A 1AJ4A 1K9PA 1V1FA 1C3ZA 1G4YR 2BCAA 2QEOA 3PN7B 3TZ1A 2VRGA 3R72A 1K95A 1S6IA 3LL8B 4XJKB 2WCLA 3MSEB 1F71A 1HQVA 2JOJA 3EVRA 5FI7A 1RWYA 3SG2A 3IQOA 1L2OC 1QVIY 2K0JA 4YGDB 1YX7A 3I5GC 2E30A 1G33A 1KFUL 4PALA 4OZDA 2JNFA 2I2RE 1B4CA 5CSNA 1BU3A 1UWOA 3EKHA 1DJGA 2JULA 5BPJA 1QATA 2L0PA 3GK1A 1OE9B 2M7NA 3HCMA 3VRPA 4R1EA 1N65A 4HREE 2KOTA 1KWOC 1B8RA 1YRTB 4DUQA 1KQVA 4MN0A 2JU0A 1UHJA 4YI9A 3AKAA 2LVJA 1K9UA 4WQ3A 2KI6C 1CM4A 1HT9A 3CZTX 5FYXA 1J1EA 1WDCC 3CZ0A 3BXKA 3JVTC 3FE9A 4PHMA 1EL4A 1TIZA 2OS8C 4PDZA 1F55A 1XA5A 1NUBA 3E3RA 3OP0A 4JKTA 2COLB 1OOGA 3CR5X 3I5HB 1H4BA 2ZRTA 2OTGB 2LAPA 3KHEA 5FI2A 1Y1XA 4HRHA 3S0DA 4PE1A 1F70A 2WCBA 5DKRA 5CSJA 1K2HA 1RK9A 2L2CA 1GGZA 2LLUA 1IKUA 1CFPA 1LA0A 2QEVA 2ZN8A 1DF0B 4GPLB 2AMIA 2FJYA 2LMTA 2F2PA 2QEHA 3CDNA 1TN4A 3OB1B 1B7TZ 4BY5A 1BT6A 1TNPA 2L4HA 3I5FB 1BOCA 1WY9A 1K9KA 2AAOA 1CDPA 1ORGA 2FOTA 1JUOA 1RECA 1KCYA 4M2OA 3OB2B 1CKKA 3CS1A 4ORAB 3DF0B 3D0YA 2KI6D 5KU1A 4YI8A 4UPGA 3D0YB 3EK8A 1S3PA 1ZUZA 2I7AA 5CPVA 1DEKA 1ALVA 1U5IA 5F6TA 2Q4UA 1K96A 1S5GY 1JFKA 5G08A 3B87A 1TNWA 1DJXA 3RM1A 4INXA 3BFAA 2KQYA 4MRYA 3EVVA 1Y1UA 1QX2A 1JC2A 1E8AA 1SCMB 1N2DA 1CTRA 1ZMZA 2KLDA 4FTGA 3ZWHA 2P6BB 4MZLA 3FWBA 1EG3A 1M31A 1NCXA 2PSRA 1ZFSA 2YGUA 3B7AA 5DKQA 5EL2A 3LK1A 3AAKA 1BODA 2MLFC 3CR4X 1PSRA 3O78A 2WCKA 1YURA 3O4XA 5HLOA 4PCWA 1DMOA 2G9BA 3D74A 2WC6A 3NHTA 1JFJA 2F2OA 1C3YA 2KFFA 3FIAA 1NIWA 3O6BA 1NX2A 1J7RA 2KLEA 2K8MB 2JXCA 2WCJA 2LUCA 2I18A 3SIBA 2PVBA 4TNCA 4PE4A 4MSPA 1KK8C 2M29A 2WCEA 1J7QA 1EJ3A 1P28A 3BQ3A 2BE6A 4GGNA 2K60A 1UHNA 4YGBB 1IIOA 2KBMA 2KAYA 3S0BA 4HSZA 4WQ2A 2FJUB 3AKBA 2PMYA 1DVIA 2CCMA 1DJHA 5AERA 1IQ5A 1TWOA 4DCKA 1CDLA 3CGAA 2NXQA 1V1GA 1KQMB 2B1UA 2L2EA 2K2AA 2L50A 2WCHA 3NGVA 1DTLA 1M39A 2ZFDA 4IL1A 4U8DA 1T14A 1S36A 5AXIA 4HRGA 2BCBA 1ALWA 3L4LA 5KSZA 2BAPA 2MJWB 1YVHA 2H2KA 4PHNA 2NCOA 3I5IC 2GGZA 1PSBA 3GOFA 1QASA 2HPSA 2KFHA 2LVVA 1CM1A 4N1FA 1BR4B 1TTXA 2BNXA 2KAVA 1YX8A 2WC8A 5TNCA 2LCPA 3TDZA 1A03A 2CT9A 4GUKA 2M1KB 3RLZA 3UO9A 3KO0A 1IJ5A 1PVAA 3OBVA 3JTDC 1BJFA 2MBXA 1XFYO 3TUYC 4INWA 3PJIA 4MLWA 1TRFA 2WCMA 4WRIA 2O5GA 4C0JA 3NHIA 1IQ3A 1SYMA 2MLEC 2LE9B 4NDBA 4PE0A 3SS3A 3BUWB 2KSPA 4A4BA 2WORA 1NCYA 1A2XA 1YVLA 2K7OA 2K2FA 1RROA 1MUXA 2KQ6A 1QWVA 1R2UA 2BECA 4MZKA 4F0ZB 4YGEB 1G8IA 1SCVA 1SR6C 4OKHA 1DGUA 1KK8B 3D10A 4YGCB 1MXLC 1JF2A 4N5XA 3IF7A 3VRNA 1XFUO 2D8NA 2Y1MA 5D69A 1OOHA 3ICBA 1CLBA 2EC6C 2AUCA 4OVNF 2EHBA 1DT7B 3TS5C 4D1EA 2KHNA 1S6CA 2KBIA 2BBMA 2CTNA 2LLTA 3DVKA 3S0EA 2KDHA 3QMEA 2M0RA 3RZSA 1QX5B 1LA3A 1QX7A 1YTZC 1A75A 2HQWA 2K7CA 2KFGA 1NSHA 4AQIA 4IJ7A 3D75A 2KYFA 4ORCB 1ODBA 1PK0D 1SY9A 5HKZA 2JT3A 1QXPA 3CWGA 1OOIX 1R6PA 3M0WA 2SCPA 4P5OE 5HLVA 4DS7A 1WRLA 1UHKA 3PM2A 4GNKB 3KF9A 3EK7A 1DJYA 1OZSA 4GBAA 1L2OB 1XFXO 1YUTA 3I5GB 4C0KA 1FBVA 3BOWA 3DY9A 3IQQA 1B1GA 2M3WA 3BUOB 1BF5A 1NYAA 3SG5A 4I5JA 5ER4X 2L51A 1FW4A 2Y4QA 3DD4A 3EK4A 3SG6A 3WHUB 1B8LA 3NSKA 1W9ZA 1QVIZ 1B8CA 4ZCUA 4E68A 2P71A 4P2YB 1MHOA 1U5IB 4USLA 1KK7Y 1SNLA 1Z4HA 3B88A 1KWOB 1ZOTB 3SS5A 2KI4C 5K89A 4JPZB 1M63B 1C07A 4L9MA 1AJ5A 2LV7A 5HYDA 1DGVA 1AHRA 1MXEA 1YUSA 2JQ6A 4CPVA 4JQ0D 1IRJA 1WDCB 4PT1A 4YBHB 5CSFA 3JVTB 5I8NA 2JC2A 1D1OA 1SL8A 2LM5A 1J7OA 3PALA 1YUUA 1KFXL 1SR6B 1MWNA 2M49B 1QIVA 2WC5A 2OS8B 3PM8A 1CLLA 1TCFA 1OSAA 3PN7C 2M9GA 4PHJA 1S6JA 3CZ2A 3SIAA 2GTEA 2KGRA 1X02A 2EC6B 1JSAA 4CFQA 1UP5A 3TS5B 1UHHA 1LINA 1AK8A 2CXJA 3SS4A 2SASA 2K7DA 1PULA 1VRKA 1QV1A 2F8PA 2JNXA 2HETA 1YR5A 2NZ0A 1QTXA 1EG4A 1K93D 1XVJA 2MAZA 3B86A 4OV2A 1CDNA 2IS9A 5HKWA 4AOMA 4JD9A 4KYNA 4QJ4B 5B8IB 2Y5IA 1C7WA 1IWQA 1KSOA 4CIDA 2BL0C 1J1DA 1S26D 1QV0A 1LVCD 2QPTA 1WRKA 1KSMA 1FI6A 1XFZO 2L5XB 3D73A 3NSIA 4I5NB 3K21A 2NLNA 3BJHA 5AEQA 2KPHA 1MQ1A 2HF5A 1YRUB 3BFHA 2F3YA 1PRWA 1CFCA 1UURA 2TN4A 1GGWA 2HQ8A 2OPOA 2QACA 2I94A 1W7JB 5J3XA 3FWCA 2JPOA 2F33A 4DRWA 1AVSA 1NX0A 2PQLA 4OR9B 2ZNDA 3CABA 1B9AA 2LVIA 3I5HC 4FQTA 2OTGC 3CTNA 4MRXA 3EVUA 5CSIA 5FI6A 2KNEA 1DC1A 2A4JA 2KI4B 2WNDA 2FCDA 2LP2A 2LP3A 5IBWA 1Y1AA 5ER5A 1S5GZ 1SPYA 1J55A 1QS7A 1B7TY 2MRDA 3H4SE 3N7HA 2JZIA 1SSEB 1NPQA 1SKTA
chains in the Genus database with same CATH topology
1BMOA 1SMGA 1A4PA 3O4YA 1QLKA 1K8UA 1F4OA 3OX5A 1S1EA 3FS7A 3O2PA 4MZJA 5I2OA 1DJWA 1OMRA 3GK4X 1KFUS 3TDIA 3I5FC 4XJKA 5GQQC 4QJ5B 4CLNA 1FPWA 2M7LA 3VRRA 4C0LA 2LANA 3DVEA 3C1VA 4I5KA 2ISDA 2ZN9A 2CNPA 5D7FA 5AFPA 2BE4A 3PFVA 1AUIB 2JTTA 2GGMA 1Q80A 2JT8A 2LMVA 1SBJA 3LLEA 1CNPA 4AQJA 1ZACA 5DKNA 4ZCVA 2NCPA 3CLNA 1CMFA 1EXRA 1BR1B 2JPTA 2ZKMX 3A4UB 3NSOA 1N0YA 2KAXA 2BCXA 1B47A 1NX3A 1SCMC 1OZOA 4M2PA 4MEWA 3NSLA 1XO5A 2BL0B 1JF0A 1JBAA 1M46A 1NCZA 4YGAA 3SG4A 2Y1NA 1F4QA 3TDUA 2H61C 1XK4C 4ORBB 2M1UA 1CLMA 1A75B 3GK2A 3SG7A 4BY4A 5JOLA 5HKYA 2JWWA 1A29A 1IJ6A 2JRFA 3I5IB 1W7IB 1L7ZA 2LHIA 5JJGA 3VROA 1SL7A 3WNXB 3LCPC 4FQOA 3SG3A 5AANA 1CFFA 1RTP1 1EH2A 4OCIA 1K94A 4CFRA 3BOWB 1DJZA 2JT0A 2LMUA 1DF0A 3JTDB 3TUYB 2E6WA 1IG5A 1PALA 2F3ZA 2R2IA 2V53A 2FCEA 3QRXA 1BG1A 2LHLA 1C7VA 4ETOA 3ZNIA 1SW8A 4XYNA 3F45A 2ZNEA 1OQPA 2M8UA 1MR8A 1QLSA 1OMVA 1FF1A 1LKJA 2PALA 2K61A 4MBEA 1Y6WA 4PHKA 3DF0A 3VRQA 4DIRA 1KQMC 4NDCA 1CDMA 4GAOA 1GJYA 1QJTA 4GGFC 2MHHA 4NDDA 3NXAA 1OOJA 2G2BA 5PALA 2GV5A 2MA2A 1BLQA 3DVJA 1SRAA 3WHTB 4YRUA 1TOPA 4JWQA 1KFXS 3AAJA 2LLSA 1TCOB 1QIWA 5I2LA 1NWDA 3EKJA 3BUMB 4ICBA 1XFVO 2BBNA 2K7BA 2EGDA 2Q91A 3KPXA 2H61A 1XK4A 4QJ3B 2BKHB 2CBLA 2O60A 4NQGA 1F8HA 4Q04A 2LUXA 3WXAA 2LNKA 2ZRSA 2PASA 4A4CA 1J7PA 1NX1A 1TNXA 3CR2A 1CMGA 2JXLA 1MF8B 1Y0VH 3HX4A 3PATA 2PRUA 3SJSA 1JWDA 3KEVA 2L98A 1WLMA 1H8BA 2KGBC 1CB1A 1GQMA 1SK6D 1WLZA 1F54A 3PSRA 2M97A 1CFDA 1FI5A 1AP4A 1K90D 3OX6A 4N1GA 3BUNB 1SL9A 1RFJA 2LVKA 3BYAA 1XFWO 3OHMB 4GFTA 4I5LB 1TNQA 5I2QA 2KYCA 1UUSA 3PLFB 4PE7A 1M45A 1WRZA 3LK0A 2RGIA 1UHIA 1XYDA 1KK7Z 3BUXB 4MVFA 3DVMA 1NP8A 1RJVA 1LXFC 2BKIB 2JTZA 4GGFA 3VGOA 1DJIA 1IGVA 2DOQA 5KTYA 2LC5A 2WOSA 2L4IA 4M2QA 3A8RA 1PVBA 2WCFA 1IH0A 1AJ4A 1K9PA 1V1FA 1CKKA 1G4YR 2BCAA 3PN7B 3TZ1A 2VRGA 1K95A 1S6IA 3LL8B 4XJKB 3MSEB 1F71A 1HQVA 2JOJA 3EVRA 1RWYA 3SG2A 3IQOA 1L2OC 1QVIY 2K0JA 4YGDB 1YX7A 3I5GC 2E30A 1G33A 1KFUL 4PALA 2JNFA 2I2RE 1B4CA 5CSNA 1BU3A 1UWOA 3EKHA 1DJGA 2JULA 5BPJA 1QATA 2L0PA 3GK1A 1OE9B 2M7NA 3HCMA 3VRPA 4R1EA 1N65A 4HREE 2KOTA 1KWOC 1B8RA 1YRTB 4DUQA 1KQVA 4MN0A 2JU0A 1UHJA 4YI9A 3AKAA 2LVJA 1K9UA 4WQ3A 2KI6C 1CM4A 1HT9A 3CZTX 5FYXA 1J1EA 1WDCC 3BXKA 3JVTC 4PHMA 1EL4A 1TIZA 2OS8C 4PDZA 1F55A 1XA5A 1NUBA 3E3RA 3OP0A 2COLB 3CR5X 3I5HB 1H4BA 2ZRTA 2OTGB 2LAPA 3KHEA 1Y1XA 4HRHA 4PE1A 1F70A 2WCBA 5DKRA 5CSJA 1K2HA 1RK9A 1GGZA 2LLUA 1IKUA 1CFPA 1LA0A 2ZN8A 4GPLB 1DF0B 2AMIA 2LMTA 2F2PA 1TN4A 3OB1B 1B7TZ 4BY5A 1BT6A 1TNPA 2L4HA 3I5FB 1BOCA 1WY9A 1K9KA 2AAOA 1CDPA 2FOTA 1JUOA 1RECA 1KCYA 4M2OA 3OB2B 3CS1A 4ORAB 3DF0B 3D0YA 2KI6D 5KU1A 4YI8A 4UPGA 3D0YB 3EK8A 1S3PA 1ZUZA 2I7AA 5CPVA 1ALVA 1U5IA 5F6TA 2Q4UA 1K96A 1S5GY 1JFKA 5G08A 1TNWA 1DJXA 3RM1A 2KQYA 4MRYA 3EVVA 1Y1UA 1QX2A 1JC2A 1E8AA 1SCMB 1N2DA 1CTRA 1ZMZA 4FTGA 3ZWHA 2P6BB 4MZLA 3FWBA 1EG3A 1M31A 1NCXA 2PSRA 1ZFSA 5DKQA 3LK1A 3AAKA 1BODA 2MLFC 3CR4X 1PSRA 3O78A 1YURA 5HLOA 4PCWA 1DMOA 2G9BA 1JFJA 2F2OA 2KFFA 3FIAA 1NIWA 3O6BA 1NX2A 1J7RA 2K8MB 2JXCA 2LUCA 2I18A 3SIBA 2PVBA 4TNCA 4PE4A 4MSPA 1KK8C 2M29A 2WCEA 1J7QA 1EJ3A 3BQ3A 2BE6A 4GGNA 1UHNA 4YGBB 2KBMA 2KAYA 4HSZA 4WQ2A 2FJUB 3AKBA 2PMYA 1DVIA 2CCMA 1DJHA 5AERA 1IQ5A 4DCKA 1CDLA 3CGAA 2NXQA 1V1GA 1KQMB 2B1UA 2L2EA 2K2AA 2L50A 1DTLA 1M39A 2ZFDA 4IL1A 4U8DA 1S36A 5AXIA 4HRGA 2BCBA 1ALWA 5KSZA 2MJWB 1YVHA 2H2KA 4PHNA 2NCOA 3I5IC 2GGZA 1PSBA 3GOFA 1QASA 2HPSA 2KFHA 2LVVA 1CM1A 4N1FA 1BR4B 1TTXA 2KAVA 1YX8A 2WC8A 5TNCA 2LCPA 3TDZA 1A03A 2CT9A 4GUKA 2M1KB 3RLZA 3KO0A 1IJ5A 1PVAA 3JTDC 1BJFA 2MBXA 1XFYO 3TUYC 4MLWA 1TRFA 4WRIA 2O5GA 4C0JA 1IQ3A 1SYMA 2MLEC 2LE9B 4NDBA 4PE0A 3BUWB 2KSPA 4A4BA 2WORA 1NCYA 1A2XA 1YVLA 2K7OA 2K2FA 1RROA 1MUXA 2KQ6A 1R2UA 2BECA 4MZKA 4F0ZB 4YGEB 1G8IA 1SCVA 1SR6C 4OKHA 1DGUA 1KK8B 3D10A 4YGCB 1MXLC 1JF2A 4N5XA 3IF7A 3VRNA 1XFUO 2D8NA 2Y1MA 5D69A 3ICBA 1CLBA 2EC6C 2AUCA 4OVNF 2EHBA 1DT7B 3TS5C 4D1EA 2KHNA 1S6CA 2KBIA 2BBMA 2CTNA 2LLTA 3DVKA 2KDHA 2M0RA 1QX5B 1LA3A 1QX7A 1YTZC 1A75A 2HQWA 2K7CA 2KFGA 1NSHA 4AQIA 4ORCB 2KYFA 1ODBA 1PK0D 1SY9A 5HKZA 2JT3A 1QXPA 3CWGA 4P5OE 1R6PA 3M0WA 2SCPA 5HLVA 4DS7A 1WRLA 1UHKA 4GNKB 3KF9A 3EK7A 1DJYA 1OZSA 4GBAA 1L2OB 1XFXO 1YUTA 3I5GB 4C0KA 1FBVA 3BOWA 3IQQA 1B1GA 2M3WA 3BUOB 1BF5A 1NYAA 3SG5A 4I5JA 5ER4X 2L51A 1FW4A 2Y4QA 3DD4A 3EK4A 3SG6A 3WHUB 1B8LA 3NSKA 1QVIZ 1B8CA 4ZCUA 4E68A 4P2YB 1MHOA 1U5IB 4USLA 1KK7Y 1SNLA 1KWOB 1ZOTB 2KI4C 5K89A 4JPZB 1M63B 1C07A 4L9MA 1AJ5A 2LV7A 5HYDA 1DGVA 1AHRA 1MXEA 1YUSA 2JQ6A 4CPVA 4JQ0D 1IRJA 1WDCB 4YBHB 5CSFA 3JVTB 5I8NA 2JC2A 1D1OA 1SL8A 2LM5A 1J7OA 3PALA 1YUUA 1KFXL 1SR6B 1MWNA 2M49B 1QIVA 2OS8B 3PM8A 1CLLA 1TCFA 1OSAA 3PN7C 2M9GA 4PHJA 1S6JA 3SIAA 2KGRA 1JSAA 1X02A 2EC6B 4CFQA 1UP5A 3TS5B 1UHHA 1LINA 1AK8A 2CXJA 2SASA 2K7DA 1PULA 1VRKA 1QV1A 2F8PA 2JNXA 2HETA 1YR5A 2NZ0A 1QTXA 1EG4A 1K93D 1XVJA 2MAZA 4OV2A 1CDNA 2IS9A 5HKWA 4AOMA 4QJ4B 5B8IB 2Y5IA 1C7WA 1IWQA 1KSOA 4CIDA 2BL0C 1J1DA 1S26D 1QV0A 1LVCD 2QPTA 1WRKA 1KSMA 1FI6A 1XFZO 2L5XB 3NSIA 4I5NB 3K21A 2NLNA 5AEQA 1MQ1A 2HF5A 1YRUB 2F3YA 1PRWA 1CFCA 1UURA 2TN4A 1GGWA 2HQ8A 2OPOA 2QACA 2I94A 1W7JB 5J3XA 3FWCA 2F33A 4DRWA 1AVSA 1NX0A 4OR9B 2ZNDA 1B9AA 2LVIA 3I5HC 4MRXA 2OTGC 3CTNA 5CSIA 3EVUA 2KNEA 2A4JA 2KI4B 2WNDA 2FCDA 2LP2A 2LP3A 5IBWA 1Y1AA 5ER5A 1S5GZ 1SPYA 1J55A 1QS7A 1B7TY 2MRDA 3H4SE 2JZIA 1OMDA 1NPQA 1SKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMO A;  1SMG A;  1A4P A;  3O4Y A;  1QLK A;  1K8U A;  1F4O A;  3OX5 A;  1S1E A;  3FS7 A;  3O2P A;  4MZJ A;  5I2O A;  1DJW A;  1OMR A;  3GK4 X;  1KFU S;  3TDI A;  3I5F C;  4XJK A;  5GQQ C;  4QJ5 B;  4CLN A;  1FPW A;  2M7L A;  3VRR A;  4C0L A;  2LAN A;  3DVE A;  3C1V A;  4I5K A;  2ISD A;  2ZN9 A;  2CNP A;  5D7F A;  5AFP A;  2BE4 A;  3PFV A;  1AUI B;  2JTT A;  2GGM A;  1Q80 A;  2JT8 A;  2LMV A;  1SBJ A;  3LLE A;  1CNP A;  4AQJ A;  1ZAC A;  5DKN A;  4ZCV A;  2NCP A;  3CLN A;  1CMF A;  1EXR A;  1BR1 B;  2JPT A;  2ZKM X;  3A4U B;  3NSO A;  1N0Y A;  2KAX A;  2BCX A;  1B47 A;  1NX3 A;  1SCM C;  1OZO A;  4M2P A;  4MEW A;  3NSL A;  1XO5 A;  2BL0 B;  1JF0 A;  1JBA A;  1M46 A;  1NCZ A;  4YGA A;  3SG4 A;  2Y1N A;  1F4Q A;  3TDU A;  2H61 C;  1XK4 C;  4ORB B;  2M1U A;  1CLM A;  1A75 B;  3GK2 A;  3SG7 A;  4BY4 A;  5JOL A;  5HKY A;  2JWW A;  1A29 A;  1IJ6 A;  2JRF A;  3I5I B;  1W7I B;  1L7Z A;  2LHI A;  5JJG A;  3VRO A;  1SL7 A;  3WNX B;  3LCP C;  4FQO A;  3SG3 A;  5AAN A;  1CFF A;  1RTP 1;  1EH2 A;  4OCI A;  1K94 A;  4CFR A;  3BOW B;  1DJZ A;  2JT0 A;  2LMU A;  1DF0 A;  3JTD B;  3TUY B;  2E6W A;  1IG5 A;  1PAL A;  2F3Z A;  2R2I A;  2V53 A;  2FCE A;  3QRX A;  1BG1 A;  2LHL A;  1C7V A;  4ETO A;  3ZNI A;  1SW8 A;  4XYN A;  3F45 A;  2ZNE A;  1OQP A;  2M8U A;  1MR8 A;  1QLS A;  1OMV A;  1FF1 A;  1LKJ A;  2PAL A;  2K61 A;  4MBE A;  1Y6W A;  4PHK A;  3DF0 A;  3VRQ A;  4DIR A;  1KQM C;  4NDC A;  1CDM A;  4GAO A;  1GJY A;  1QJT A;  4GGF C;  2MHH A;  4NDD A;  3NXA A;  1OOJ A;  2G2B A;  5PAL A;  2GV5 A;  2MA2 A;  1BLQ A;  3DVJ A;  1SRA A;  3WHT B;  4YRU A;  1TOP A;  4JWQ A;  1KFX S;  3AAJ A;  2LLS A;  1TCO B;  1QIW A;  5I2L A;  1NWD A;  3EKJ A;  3BUM B;  4ICB A;  1XFV O;  2BBN A;  2K7B A;  2EGD A;  2Q91 A;  3KPX A;  2H61 A;  1XK4 A;  4QJ3 B;  2BKH B;  2CBL A;  2O60 A;  4NQG A;  1F8H A;  4Q04 A;  2LUX A;  3WXA A;  2LNK A;  2ZRS A;  2PAS A;  4A4C A;  1J7P A;  1NX1 A;  1TNX A;  3CR2 A;  1CMG A;  2JXL A;  1MF8 B;  1Y0V H;  3HX4 A;  3PAT A;  2PRU A;  3SJS A;  1JWD A;  3KEV A;  2L98 A;  1WLM A;  1H8B A;  2KGB C;  1CB1 A;  1GQM A;  1SK6 D;  1WLZ A;  1F54 A;  3PSR A;  2M97 A;  1CFD A;  1FI5 A;  1AP4 A;  1K90 D;  3OX6 A;  4N1G A;  3BUN B;  1SL9 A;  1RFJ A;  2LVK A;  3BYA A;  1XFW O;  3OHM B;  4GFT A;  4I5L B;  1TNQ A;  5I2Q A;  2KYC A;  1UUS A;  3PLF B;  4PE7 A;  1M45 A;  1WRZ A;  3LK0 A;  2RGI A;  1UHI A;  1XYD A;  1KK7 Z;  3BUX B;  4MVF A;  3DVM A;  1NP8 A;  1RJV A;  1LXF C;  2BKI B;  2JTZ A;  4GGF A;  3VGO A;  1DJI A;  1IGV A;  2DOQ A;  5KTY A;  2LC5 A;  2WOS A;  2L4I A;  4M2Q A;  3A8R A;  1PVB A;  2WCF A;  1IH0 A;  1AJ4 A;  1K9P A;  1V1F A;  1CKK A;  1G4Y R;  2BCA A;  3PN7 B;  3TZ1 A;  2VRG A;  1K95 A;  1S6I A;  3LL8 B;  4XJK B;  3MSE B;  1F71 A;  1HQV A;  2JOJ A;  3EVR A;  1RWY A;  3SG2 A;  3IQO A;  1L2O C;  1QVI Y;  2K0J A;  4YGD B;  1YX7 A;  3I5G C;  2E30 A;  1G33 A;  1KFU L;  4PAL A;  2JNF A;  2I2R E;  1B4C A;  5CSN A;  1BU3 A;  1UWO A;  3EKH A;  1DJG A;  2JUL A;  5BPJ A;  1QAT A;  2L0P A;  3GK1 A;  1OE9 B;  2M7N A;  3HCM A;  3VRP A;  4R1E A;  1N65 A;  4HRE E;  2KOT A;  1KWO C;  1B8R A;  1YRT B;  4DUQ A;  1KQV A;  4MN0 A;  2JU0 A;  1UHJ A;  4YI9 A;  3AKA A;  2LVJ A;  1K9U A;  4WQ3 A;  2KI6 C;  1CM4 A;  1HT9 A;  3CZT X;  5FYX A;  1J1E A;  1WDC C;  3BXK A;  3JVT C;  4PHM A;  1EL4 A;  1TIZ A;  2OS8 C;  4PDZ A;  1F55 A;  1XA5 A;  1NUB A;  3E3R A;  3OP0 A;  2COL B;  3CR5 X;  3I5H B;  1H4B A;  2ZRT A;  2OTG B;  2LAP A;  3KHE A;  1Y1X A;  4HRH A;  4PE1 A;  1F70 A;  2WCB A;  5DKR A;  5CSJ A;  1K2H A;  1RK9 A;  1GGZ A;  2LLU A;  1IKU A;  1CFP A;  1LA0 A;  2ZN8 A;  4GPL B;  1DF0 B;  2AMI A;  2LMT A;  2F2P A;  1TN4 A;  3OB1 B;  1B7T Z;  4BY5 A;  1BT6 A;  1TNP A;  2L4H A;  3I5F B;  1BOC A;  1WY9 A;  1K9K A;  2AAO A;  1CDP A;  2FOT A;  1JUO A;  1REC A;  1KCY A;  4M2O A;  3OB2 B;  3CS1 A;  4ORA B;  3DF0 B;  3D0Y A;  2KI6 D;  5KU1 A;  4YI8 A;  4UPG A;  3D0Y B;  3EK8 A;  1S3P A;  1ZUZ A;  2I7A A;  5CPV A;  1ALV A;  1U5I A;  5F6T A;  2Q4U A;  1K96 A;  1S5G Y;  1JFK A;  5G08 A;  1TNW A;  1DJX A;  3RM1 A;  2KQY A;  4MRY A;  3EVV A;  1Y1U A;  1QX2 A;  1JC2 A;  1E8A A;  1SCM B;  1N2D A;  1CTR A;  1ZMZ A;  4FTG A;  3ZWH A;  2P6B B;  4MZL A;  3FWB A;  1EG3 A;  1M31 A;  1NCX A;  2PSR A;  1ZFS A;  5DKQ A;  3LK1 A;  3AAK A;  1BOD A;  2MLF C;  3CR4 X;  1PSR A;  3O78 A;  1YUR A;  5HLO A;  4PCW A;  1DMO A;  2G9B A;  1JFJ A;  2F2O A;  2KFF A;  3FIA A;  1NIW A;  3O6B A;  1NX2 A;  1J7R A;  2K8M B;  2JXC A;  2LUC A;  2I18 A;  3SIB A;  2PVB A;  4TNC A;  4PE4 A;  4MSP A;  1KK8 C;  2M29 A;  2WCE A;  1J7Q A;  1EJ3 A;  3BQ3 A;  2BE6 A;  4GGN A;  1UHN A;  4YGB B;  2KBM A;  2KAY A;  4HSZ A;  4WQ2 A;  2FJU B;  3AKB A;  2PMY A;  1DVI A;  2CCM A;  1DJH A;  5AER A;  1IQ5 A;  4DCK A;  1CDL A;  3CGA A;  2NXQ A;  1V1G A;  1KQM B;  2B1U A;  2L2E A;  2K2A A;  2L50 A;  1DTL A;  1M39 A;  2ZFD A;  4IL1 A;  4U8D A;  1S36 A;  5AXI A;  4HRG A;  2BCB A;  1ALW A;  5KSZ A;  2MJW B;  1YVH A;  2H2K A;  4PHN A;  2NCO A;  3I5I C;  2GGZ A;  1PSB A;  3GOF A;  1QAS A;  2HPS A;  2KFH A;  2LVV A;  1CM1 A;  4N1F A;  1BR4 B;  1TTX A;  2KAV A;  1YX8 A;  2WC8 A;  5TNC A;  2LCP A;  3TDZ A;  1A03 A;  2CT9 A;  4GUK A;  2M1K B;  3RLZ A;  3KO0 A;  1IJ5 A;  1PVA A;  3JTD C;  1BJF A;  2MBX A;  1XFY O;  3TUY C;  4MLW A;  1TRF A;  4WRI A;  2O5G A;  4C0J A;  1IQ3 A;  1SYM A;  2MLE C;  2LE9 B;  4NDB A;  4PE0 A;  3BUW B;  2KSP A;  4A4B A;  2WOR A;  1NCY A;  1A2X A;  1YVL A;  2K7O A;  2K2F A;  1RRO A;  1MUX A;  2KQ6 A;  1R2U A;  2BEC A;  4MZK A;  4F0Z B;  4YGE B;  1G8I A;  1SCV A;  1SR6 C;  4OKH A;  1DGU A;  1KK8 B;  3D10 A;  4YGC B;  1MXL C;  1JF2 A;  4N5X A;  3IF7 A;  3VRN A;  1XFU O;  2D8N A;  2Y1M A;  5D69 A;  3ICB A;  1CLB A;  2EC6 C;  2AUC A;  4OVN F;  2EHB A;  1DT7 B;  3TS5 C;  4D1E A;  2KHN A;  1S6C A;  2KBI A;  2BBM A;  2CTN A;  2LLT A;  3DVK A;  2KDH A;  2M0R A;  1QX5 B;  1LA3 A;  1QX7 A;  1YTZ C;  1A75 A;  2HQW A;  2K7C A;  2KFG A;  1NSH A;  4AQI A;  4ORC B;  2KYF A;  1ODB A;  1PK0 D;  1SY9 A;  5HKZ A;  2JT3 A;  1QXP A;  3CWG A;  4P5O E;  1R6P A;  3M0W A;  2SCP A;  5HLV A;  4DS7 A;  1WRL A;  1UHK A;  4GNK B;  3KF9 A;  3EK7 A;  1DJY A;  1OZS A;  4GBA A;  1L2O B;  1XFX O;  1YUT A;  3I5G B;  4C0K A;  1FBV A;  3BOW A;  3IQQ A;  1B1G A;  2M3W A;  3BUO B;  1BF5 A;  1NYA A;  3SG5 A;  4I5J A;  5ER4 X;  2L51 A;  1FW4 A;  2Y4Q A;  3DD4 A;  3EK4 A;  3SG6 A;  3WHU B;  1B8L A;  3NSK A;  1QVI Z;  1B8C A;  4ZCU A;  4E68 A;  4P2Y B;  1MHO A;  1U5I B;  4USL A;  1KK7 Y;  1SNL A;  1KWO B;  1ZOT B;  2KI4 C;  5K89 A;  4JPZ B;  1M63 B;  1C07 A;  4L9M A;  1AJ5 A;  2LV7 A;  5HYD A;  1DGV A;  1AHR A;  1MXE A;  1YUS A;  2JQ6 A;  4CPV A;  4JQ0 D;  1IRJ A;  1WDC B;  4YBH B;  5CSF A;  3JVT B;  5I8N A;  2JC2 A;  1D1O A;  1SL8 A;  2LM5 A;  1J7O A;  3PAL A;  1YUU A;  1KFX L;  1SR6 B;  1MWN A;  2M49 B;  1QIV A;  2OS8 B;  3PM8 A;  1CLL A;  1TCF A;  1OSA A;  3PN7 C;  2M9G A;  4PHJ A;  1S6J A;  3SIA A;  2KGR A;  1JSA A;  1X02 A;  2EC6 B;  4CFQ A;  1UP5 A;  3TS5 B;  1UHH A;  1LIN A;  1AK8 A;  2CXJ A;  2SAS A;  2K7D A;  1PUL A;  1VRK A;  1QV1 A;  2F8P A;  2JNX A;  2HET A;  1YR5 A;  2NZ0 A;  1QTX A;  1EG4 A;  1K93 D;  1XVJ A;  2MAZ A;  4OV2 A;  1CDN A;  2IS9 A;  5HKW A;  4AOM A;  4QJ4 B;  5B8I B;  2Y5I A;  1C7W A;  1IWQ A;  1KSO A;  4CID A;  2BL0 C;  1J1D A;  1S26 D;  1QV0 A;  1LVC D;  2QPT A;  1WRK A;  1KSM A;  1FI6 A;  1XFZ O;  2L5X B;  3NSI A;  4I5N B;  3K21 A;  2NLN A;  5AEQ A;  1MQ1 A;  2HF5 A;  1YRU B;  2F3Y A;  1PRW A;  1CFC A;  1UUR A;  2TN4 A;  1GGW A;  2HQ8 A;  2OPO A;  2QAC A;  2I94 A;  1W7J B;  5J3X A;  3FWC A;  2F33 A;  4DRW A;  1AVS A;  1NX0 A;  4OR9 B;  2ZND A;  1B9A A;  2LVI A;  3I5H C;  4MRX A;  2OTG C;  3CTN A;  5CSI A;  3EVU A;  2KNE A;  2A4J A;  2KI4 B;  2WND A;  2FCD A;  2LP2 A;  2LP3 A;  5IBW A;  1Y1A A;  5ER5 A;  1S5G Z;  1SPY A;  1J55 A;  1QS7 A;  1B7T Y;  2MRD A;  3H4S E;  2JZI A;  1OMD A;  1NPQ A;  1SKT A; 
#chains in the Genus database with same CATH topology
 1BMO A;  1SMG A;  1A4P A;  3O4Y A;  1QLK A;  1K8U A;  1DQE A;  1F4O A;  3OX5 A;  1S1E A;  3FS7 A;  3O2P A;  4MZJ A;  5I2O A;  1DJW A;  1OMR A;  3GK4 X;  1KFU S;  3TDI A;  3I5F C;  4XJK A;  5GQQ C;  4QJ5 B;  5HL1 A;  4CLN A;  1FPW A;  2M7L A;  3VRR A;  4C0L A;  2LAN A;  5DIC A;  3DVE A;  3DYE A;  3C1V A;  4I5K A;  2ISD A;  2ZN9 A;  2CNP A;  5D7F A;  5AFP A;  2BE4 A;  3PFV A;  3S0A A;  1AUI B;  2JTT A;  2GGM A;  1Q80 A;  2JT8 A;  2LMV A;  1SBJ A;  3LLE A;  3D78 A;  1CNP A;  4AQJ A;  1ZAC A;  5DKN A;  3D77 A;  4ZCV A;  2NCP A;  3CLN A;  3R1P A;  1CMF A;  1EXR A;  1BR1 B;  2JPT A;  2ZKM X;  3A4U B;  3NSO A;  3OGN A;  1N0Y A;  2KAX A;  2BCX A;  1B47 A;  1NX3 A;  1SCM C;  1OZO A;  3DZT A;  4M2P A;  4MEW A;  3NSL A;  1XO5 A;  2BL0 B;  1JF0 A;  1JBA A;  2QEB A;  1M46 A;  1NCZ A;  4YGA A;  3SG4 A;  3UNW A;  2Y1N A;  1F4Q A;  3TDU A;  2H61 C;  3VB1 A;  1XK4 C;  2L5Y A;  2M1U A;  1CLM A;  1A75 B;  3GK2 A;  4ORB B;  3SG7 A;  5JOL A;  4BY4 A;  5HKY A;  2JWW A;  1A29 A;  3D76 A;  3V2L A;  1IJ6 A;  2JRF A;  3I5I B;  1W7I B;  1L7Z A;  1XFR A;  2LHI A;  5JJG A;  3VRO A;  1SL7 A;  3WNX B;  3LCP C;  4FQO A;  3SG3 A;  5AAN A;  1CFF A;  3Q8I A;  1RTP 1;  1EH2 A;  4OCI A;  1K94 A;  1LS8 A;  4CFR A;  3BOW B;  1DJZ A;  2JT0 A;  2LMU A;  1DF0 A;  3JTD B;  3TUY B;  2E6W A;  1IG5 A;  1PAL A;  2F3Z A;  2R2I A;  2V53 A;  2FCE A;  3QRX A;  1BG1 A;  2LHL A;  1C7V A;  4ETO A;  3L4A A;  1DEL A;  3ZNI A;  1SW8 A;  4XYN A;  3F45 A;  2ZNE A;  1OQP A;  2M8U A;  1MR8 A;  1QLS A;  1OMV A;  3BFB A;  4F7F A;  1FF1 A;  1LKJ A;  2PAL A;  2K61 A;  3FE8 A;  4MBE A;  1Y6W A;  4PHK A;  3DF0 A;  3VRQ A;  4DIR A;  2ERB A;  1KQM C;  3B6X A;  4NDC A;  1CDM A;  2P70 A;  4GAO A;  1GJY A;  1QJT A;  4GGF C;  2MHH A;  4NDD A;  3NXA A;  1OOJ A;  2G2B A;  5PAL A;  1GM0 A;  2GV5 A;  2MA2 A;  3R1V A;  3DVJ A;  1BLQ A;  1TUJ A;  1SRA A;  3WHT B;  4YRU A;  1TOP A;  4JWQ A;  1KFX S;  1Z2C B;  2LLS A;  3AAJ A;  1TCO B;  1OOF A;  1QIW A;  5I2L A;  1NWD A;  3EKJ A;  3BUM B;  4ICB A;  1XFV O;  2BBN A;  2K7B A;  2EGD A;  2Q91 A;  2QDI A;  3KPX A;  2H61 A;  1XK4 A;  1TUZ A;  1OW4 A;  4QJ3 B;  2BKH B;  2CBL A;  2O60 A;  4NQG A;  3R1O A;  1F8H A;  4Q04 A;  1OMD A;  2LUX A;  3DXL A;  5D3O A;  3WXA A;  2LNK A;  2ZRS A;  2PAS A;  4A4C A;  1J7P A;  1NX1 A;  3K1E A;  1TNX A;  3CR2 A;  1CMG A;  2JXL A;  3L47 A;  3CYZ A;  3S0G A;  1MF8 B;  1Y0V H;  3HX4 A;  3PAT A;  2PRU A;  3SJS A;  1JWD A;  3KEV A;  2L98 A;  1WLM A;  3FE6 A;  1H8B A;  2KGB C;  1CB1 A;  2H8V A;  1GQM A;  1SK6 D;  1WLZ A;  1F54 A;  3PSR A;  2M97 A;  1CFD A;  1FI5 A;  1AP4 A;  2PYQ A;  1K90 D;  3OX6 A;  4N1G A;  3BUN B;  1SL9 A;  3S0F A;  1RFJ A;  2LVK A;  3BYA A;  1XFW O;  3OHM B;  4GFT A;  4I5L B;  1TNQ A;  5I2Q A;  2KYC A;  1UUS A;  3PLF B;  4PE7 A;  1M45 A;  1WRZ A;  3LK0 A;  3EG5 B;  2RGI A;  1UHI A;  1XYD A;  1KK7 Z;  3BUX B;  4MVF A;  3IVT A;  3DVM A;  1NP8 A;  1RJV A;  1LXF C;  2BKI B;  2JTZ A;  4GGF A;  3VGO A;  5I94 A;  1DJI A;  1IGV A;  2DOQ A;  5KTY A;  3CZ1 A;  2LC5 A;  2WOS A;  2L4I A;  4M2Q A;  3A8R A;  1PVB A;  2WCF A;  1IH0 A;  1AJ4 A;  1K9P A;  1V1F A;  1C3Z A;  1G4Y R;  2BCA A;  2QEO A;  3PN7 B;  3TZ1 A;  2VRG A;  3R72 A;  1K95 A;  1S6I A;  3LL8 B;  4XJK B;  2WCL A;  3MSE B;  1F71 A;  1HQV A;  2JOJ A;  3EVR A;  5FI7 A;  1RWY A;  3SG2 A;  3IQO A;  1L2O C;  1QVI Y;  2K0J A;  4YGD B;  1YX7 A;  3I5G C;  2E30 A;  1G33 A;  1KFU L;  4PAL A;  4OZD A;  2JNF A;  2I2R E;  1B4C A;  5CSN A;  1BU3 A;  1UWO A;  3EKH A;  1DJG A;  2JUL A;  5BPJ A;  1QAT A;  2L0P A;  3GK1 A;  1OE9 B;  2M7N A;  3HCM A;  3VRP A;  4R1E A;  1N65 A;  4HRE E;  2KOT A;  1KWO C;  1B8R A;  1YRT B;  4DUQ A;  1KQV A;  4MN0 A;  2JU0 A;  1UHJ A;  4YI9 A;  3AKA A;  2LVJ A;  1K9U A;  4WQ3 A;  2KI6 C;  1CM4 A;  1HT9 A;  3CZT X;  5FYX A;  1J1E A;  1WDC C;  3CZ0 A;  3BXK A;  3JVT C;  3FE9 A;  4PHM A;  1EL4 A;  1TIZ A;  2OS8 C;  4PDZ A;  1F55 A;  1XA5 A;  1NUB A;  3E3R A;  3OP0 A;  4JKT A;  2COL B;  1OOG A;  3CR5 X;  3I5H B;  1H4B A;  2ZRT A;  2OTG B;  2LAP A;  3KHE A;  5FI2 A;  1Y1X A;  4HRH A;  3S0D A;  4PE1 A;  1F70 A;  2WCB A;  5DKR A;  5CSJ A;  1K2H A;  1RK9 A;  2L2C A;  1GGZ A;  2LLU A;  1IKU A;  1CFP A;  1LA0 A;  2QEV A;  2ZN8 A;  1DF0 B;  4GPL B;  2AMI A;  2FJY A;  2LMT A;  2F2P A;  2QEH A;  3CDN A;  1TN4 A;  3OB1 B;  1B7T Z;  4BY5 A;  1BT6 A;  1TNP A;  2L4H A;  3I5F B;  1BOC A;  1WY9 A;  1K9K A;  2AAO A;  1CDP A;  1ORG A;  2FOT A;  1JUO A;  1REC A;  1KCY A;  4M2O A;  3OB2 B;  1CKK A;  3CS1 A;  4ORA B;  3DF0 B;  3D0Y A;  2KI6 D;  5KU1 A;  4YI8 A;  4UPG A;  3D0Y B;  3EK8 A;  1S3P A;  1ZUZ A;  2I7A A;  5CPV A;  1DEK A;  1ALV A;  1U5I A;  5F6T A;  2Q4U A;  1K96 A;  1S5G Y;  1JFK A;  5G08 A;  3B87 A;  1TNW A;  1DJX A;  3RM1 A;  4INX A;  3BFA A;  2KQY A;  4MRY A;  3EVV A;  1Y1U A;  1QX2 A;  1JC2 A;  1E8A A;  1SCM B;  1N2D A;  1CTR A;  1ZMZ A;  2KLD A;  4FTG A;  3ZWH A;  2P6B B;  4MZL A;  3FWB A;  1EG3 A;  1M31 A;  1NCX A;  2PSR A;  1ZFS A;  2YGU A;  3B7A A;  5DKQ A;  5EL2 A;  3LK1 A;  3AAK A;  1BOD A;  2MLF C;  3CR4 X;  1PSR A;  3O78 A;  2WCK A;  1YUR A;  3O4X A;  5HLO A;  4PCW A;  1DMO A;  2G9B A;  3D74 A;  2WC6 A;  3NHT A;  1JFJ A;  2F2O A;  1C3Y A;  2KFF A;  3FIA A;  1NIW A;  3O6B A;  1NX2 A;  1J7R A;  2KLE A;  2K8M B;  2JXC A;  2WCJ A;  2LUC A;  2I18 A;  3SIB A;  2PVB A;  4TNC A;  4PE4 A;  4MSP A;  1KK8 C;  2M29 A;  2WCE A;  1J7Q A;  1EJ3 A;  1P28 A;  3BQ3 A;  2BE6 A;  4GGN A;  2K60 A;  1UHN A;  4YGB B;  1IIO A;  2KBM A;  2KAY A;  3S0B A;  4HSZ A;  4WQ2 A;  2FJU B;  3AKB A;  2PMY A;  1DVI A;  2CCM A;  1DJH A;  5AER A;  1IQ5 A;  1TWO A;  4DCK A;  1CDL A;  3CGA A;  2NXQ A;  1V1G A;  1KQM B;  2B1U A;  2L2E A;  2K2A A;  2L50 A;  2WCH A;  3NGV A;  1DTL A;  1M39 A;  2ZFD A;  4IL1 A;  4U8D A;  1T14 A;  1S36 A;  5AXI A;  4HRG A;  2BCB A;  1ALW A;  3L4L A;  5KSZ A;  2BAP A;  2MJW B;  1YVH A;  2H2K A;  4PHN A;  2NCO A;  3I5I C;  2GGZ A;  1PSB A;  3GOF A;  1QAS A;  2HPS A;  2KFH A;  2LVV A;  1CM1 A;  4N1F A;  1BR4 B;  1TTX A;  2BNX A;  2KAV A;  1YX8 A;  2WC8 A;  5TNC A;  2LCP A;  3TDZ A;  1A03 A;  2CT9 A;  4GUK A;  2M1K B;  3RLZ A;  3UO9 A;  3KO0 A;  1IJ5 A;  1PVA A;  3OBV A;  3JTD C;  1BJF A;  2MBX A;  1XFY O;  3TUY C;  4INW A;  3PJI A;  4MLW A;  1TRF A;  2WCM A;  4WRI A;  2O5G A;  4C0J A;  3NHI A;  1IQ3 A;  1SYM A;  2MLE C;  2LE9 B;  4NDB A;  4PE0 A;  3SS3 A;  3BUW B;  2KSP A;  4A4B A;  2WOR A;  1NCY A;  1A2X A;  1YVL A;  2K7O A;  2K2F A;  1RRO A;  1MUX A;  2KQ6 A;  1QWV A;  1R2U A;  2BEC A;  4MZK A;  4F0Z B;  4YGE B;  1G8I A;  1SCV A;  1SR6 C;  4OKH A;  1DGU A;  1KK8 B;  3D10 A;  4YGC B;  1MXL C;  1JF2 A;  4N5X A;  3IF7 A;  3VRN A;  1XFU O;  2D8N A;  2Y1M A;  5D69 A;  1OOH A;  3ICB A;  1CLB A;  2EC6 C;  2AUC A;  4OVN F;  2EHB A;  1DT7 B;  3TS5 C;  4D1E A;  2KHN A;  1S6C A;  2KBI A;  2BBM A;  2CTN A;  2LLT A;  3DVK A;  3S0E A;  2KDH A;  3QME A;  2M0R A;  3RZS A;  1QX5 B;  1LA3 A;  1QX7 A;  1YTZ C;  1A75 A;  2HQW A;  2K7C A;  2KFG A;  1NSH A;  4AQI A;  4IJ7 A;  3D75 A;  2KYF A;  4ORC B;  1ODB A;  1PK0 D;  1SY9 A;  5HKZ A;  2JT3 A;  1QXP A;  3CWG A;  1OOI X;  1R6P A;  3M0W A;  2SCP A;  4P5O E;  5HLV A;  4DS7 A;  1WRL A;  1UHK A;  3PM2 A;  4GNK B;  3KF9 A;  3EK7 A;  1DJY A;  1OZS A;  4GBA A;  1L2O B;  1XFX O;  1YUT A;  3I5G B;  4C0K A;  1FBV A;  3BOW A;  3DY9 A;  3IQQ A;  1B1G A;  2M3W A;  3BUO B;  1BF5 A;  1NYA A;  3SG5 A;  4I5J A;  5ER4 X;  2L51 A;  1FW4 A;  2Y4Q A;  3DD4 A;  3EK4 A;  3SG6 A;  3WHU B;  1B8L A;  3NSK A;  1W9Z A;  1QVI Z;  1B8C A;  4ZCU A;  4E68 A;  2P71 A;  4P2Y B;  1MHO A;  1U5I B;  4USL A;  1KK7 Y;  1SNL A;  1Z4H A;  3B88 A;  1KWO B;  1ZOT B;  3SS5 A;  2KI4 C;  5K89 A;  4JPZ B;  1M63 B;  1C07 A;  4L9M A;  1AJ5 A;  2LV7 A;  5HYD A;  1DGV A;  1AHR A;  1MXE A;  1YUS A;  2JQ6 A;  4CPV A;  4JQ0 D;  1IRJ A;  1WDC B;  4PT1 A;  4YBH B;  5CSF A;  3JVT B;  5I8N A;  2JC2 A;  1D1O A;  1SL8 A;  2LM5 A;  1J7O A;  3PAL A;  1YUU A;  1KFX L;  1SR6 B;  1MWN A;  2M49 B;  1QIV A;  2WC5 A;  2OS8 B;  3PM8 A;  1CLL A;  1TCF A;  1OSA A;  3PN7 C;  2M9G A;  4PHJ A;  1S6J A;  3CZ2 A;  3SIA A;  2GTE A;  2KGR A;  1X02 A;  2EC6 B;  1JSA A;  4CFQ A;  1UP5 A;  3TS5 B;  1UHH A;  1LIN A;  1AK8 A;  2CXJ A;  3SS4 A;  2SAS A;  2K7D A;  1PUL A;  1VRK A;  1QV1 A;  2F8P A;  2JNX A;  2HET A;  1YR5 A;  2NZ0 A;  1QTX A;  1EG4 A;  1K93 D;  1XVJ A;  2MAZ A;  3B86 A;  4OV2 A;  1CDN A;  2IS9 A;  5HKW A;  4AOM A;  4JD9 A;  4KYN A;  4QJ4 B;  5B8I B;  2Y5I A;  1C7W A;  1IWQ A;  1KSO A;  4CID A;  2BL0 C;  1J1D A;  1S26 D;  1QV0 A;  1LVC D;  2QPT A;  1WRK A;  1KSM A;  1FI6 A;  1XFZ O;  2L5X B;  3D73 A;  3NSI A;  4I5N B;  3K21 A;  2NLN A;  3BJH A;  5AEQ A;  2KPH A;  1MQ1 A;  2HF5 A;  1YRU B;  3BFH A;  2F3Y A;  1PRW A;  1CFC A;  1UUR A;  2TN4 A;  1GGW A;  2HQ8 A;  2OPO A;  2QAC A;  2I94 A;  1W7J B;  5J3X A;  3FWC A;  2JPO A;  2F33 A;  4DRW A;  1AVS A;  1NX0 A;  2PQL A;  4OR9 B;  2ZND A;  3CAB A;  1B9A A;  2LVI A;  3I5H C;  4FQT A;  2OTG C;  3CTN A;  4MRX A;  3EVU A;  5CSI A;  5FI6 A;  2KNE A;  1DC1 A;  2A4J A;  2KI4 B;  2WND A;  2FCD A;  2LP2 A;  2LP3 A;  5IBW A;  1Y1A A;  5ER5 A;  1S5G Z;  1SPY A;  1J55 A;  1QS7 A;  1B7T Y;  2MRD A;  3H4S E;  3N7H A;  2JZI A;  1SSE B;  1NPQ A;  1SKT A; 
#chains in the Genus database with same CATH homology
 1BMO A;  1SMG A;  1A4P A;  3O4Y A;  1QLK A;  1K8U A;  1F4O A;  3OX5 A;  1S1E A;  3FS7 A;  3O2P A;  4MZJ A;  5I2O A;  1DJW A;  1OMR A;  3GK4 X;  1KFU S;  3TDI A;  3I5F C;  4XJK A;  5GQQ C;  4QJ5 B;  4CLN A;  1FPW A;  2M7L A;  3VRR A;  4C0L A;  2LAN A;  3DVE A;  3C1V A;  4I5K A;  2ISD A;  2ZN9 A;  2CNP A;  5D7F A;  5AFP A;  2BE4 A;  3PFV A;  1AUI B;  2JTT A;  2GGM A;  1Q80 A;  2JT8 A;  2LMV A;  1SBJ A;  3LLE A;  1CNP A;  4AQJ A;  1ZAC A;  5DKN A;  4ZCV A;  2NCP A;  3CLN A;  1CMF A;  1EXR A;  1BR1 B;  2JPT A;  2ZKM X;  3A4U B;  3NSO A;  1N0Y A;  2KAX A;  2BCX A;  1B47 A;  1NX3 A;  1SCM C;  1OZO A;  4M2P A;  4MEW A;  3NSL A;  1XO5 A;  2BL0 B;  1JF0 A;  1JBA A;  1M46 A;  1NCZ A;  4YGA A;  3SG4 A;  2Y1N A;  1F4Q A;  3TDU A;  2H61 C;  1XK4 C;  4ORB B;  2M1U A;  1CLM A;  1A75 B;  3GK2 A;  3SG7 A;  4BY4 A;  5JOL A;  5HKY A;  2JWW A;  1A29 A;  1IJ6 A;  2JRF A;  3I5I B;  1W7I B;  1L7Z A;  2LHI A;  5JJG A;  3VRO A;  1SL7 A;  3WNX B;  3LCP C;  4FQO A;  3SG3 A;  5AAN A;  1CFF A;  1RTP 1;  1EH2 A;  4OCI A;  1K94 A;  4CFR A;  3BOW B;  1DJZ A;  2JT0 A;  2LMU A;  1DF0 A;  3JTD B;  3TUY B;  2E6W A;  1IG5 A;  1PAL A;  2F3Z A;  2R2I A;  2V53 A;  2FCE A;  3QRX A;  1BG1 A;  2LHL A;  1C7V A;  4ETO A;  3ZNI A;  1SW8 A;  4XYN A;  3F45 A;  2ZNE A;  1OQP A;  2M8U A;  1MR8 A;  1QLS A;  1OMV A;  1FF1 A;  1LKJ A;  2PAL A;  2K61 A;  4MBE A;  1Y6W A;  4PHK A;  3DF0 A;  3VRQ A;  4DIR A;  1KQM C;  4NDC A;  1CDM A;  4GAO A;  1GJY A;  1QJT A;  4GGF C;  2MHH A;  4NDD A;  3NXA A;  1OOJ A;  2G2B A;  5PAL A;  2GV5 A;  2MA2 A;  1BLQ A;  3DVJ A;  1SRA A;  3WHT B;  4YRU A;  1TOP A;  4JWQ A;  1KFX S;  3AAJ A;  2LLS A;  1TCO B;  1QIW A;  5I2L A;  1NWD A;  3EKJ A;  3BUM B;  4ICB A;  1XFV O;  2BBN A;  2K7B A;  2EGD A;  2Q91 A;  3KPX A;  2H61 A;  1XK4 A;  4QJ3 B;  2BKH B;  2CBL A;  2O60 A;  4NQG A;  1F8H A;  4Q04 A;  2LUX A;  3WXA A;  2LNK A;  2ZRS A;  2PAS A;  4A4C A;  1J7P A;  1NX1 A;  1TNX A;  3CR2 A;  1CMG A;  2JXL A;  1MF8 B;  1Y0V H;  3HX4 A;  3PAT A;  2PRU A;  3SJS A;  1JWD A;  3KEV A;  2L98 A;  1WLM A;  1H8B A;  2KGB C;  1CB1 A;  1GQM A;  1SK6 D;  1WLZ A;  1F54 A;  3PSR A;  2M97 A;  1CFD A;  1FI5 A;  1AP4 A;  1K90 D;  3OX6 A;  4N1G A;  3BUN B;  1SL9 A;  1RFJ A;  2LVK A;  3BYA A;  1XFW O;  3OHM B;  4GFT A;  4I5L B;  1TNQ A;  5I2Q A;  2KYC A;  1UUS A;  3PLF B;  4PE7 A;  1M45 A;  1WRZ A;  3LK0 A;  2RGI A;  1UHI A;  1XYD A;  1KK7 Z;  3BUX B;  4MVF A;  3DVM A;  1NP8 A;  1RJV A;  1LXF C;  2BKI B;  2JTZ A;  4GGF A;  3VGO A;  1DJI A;  1IGV A;  2DOQ A;  5KTY A;  2LC5 A;  2WOS A;  2L4I A;  4M2Q A;  3A8R A;  1PVB A;  2WCF A;  1IH0 A;  1AJ4 A;  1K9P A;  1V1F A;  1CKK A;  1G4Y R;  2BCA A;  3PN7 B;  3TZ1 A;  2VRG A;  1K95 A;  1S6I A;  3LL8 B;  4XJK B;  3MSE B;  1F71 A;  1HQV A;  2JOJ A;  3EVR A;  1RWY A;  3SG2 A;  3IQO A;  1L2O C;  1QVI Y;  2K0J A;  4YGD B;  1YX7 A;  3I5G C;  2E30 A;  1G33 A;  1KFU L;  4PAL A;  2JNF A;  2I2R E;  1B4C A;  5CSN A;  1BU3 A;  1UWO A;  3EKH A;  1DJG A;  2JUL A;  5BPJ A;  1QAT A;  2L0P A;  3GK1 A;  1OE9 B;  2M7N A;  3HCM A;  3VRP A;  4R1E A;  1N65 A;  4HRE E;  2KOT A;  1KWO C;  1B8R A;  1YRT B;  4DUQ A;  1KQV A;  4MN0 A;  2JU0 A;  1UHJ A;  4YI9 A;  3AKA A;  2LVJ A;  1K9U A;  4WQ3 A;  2KI6 C;  1CM4 A;  1HT9 A;  3CZT X;  5FYX A;  1J1E A;  1WDC C;  3BXK A;  3JVT C;  4PHM A;  1EL4 A;  1TIZ A;  2OS8 C;  4PDZ A;  1F55 A;  1XA5 A;  1NUB A;  3E3R A;  3OP0 A;  2COL B;  3CR5 X;  3I5H B;  1H4B A;  2ZRT A;  2OTG B;  2LAP A;  3KHE A;  1Y1X A;  4HRH A;  4PE1 A;  1F70 A;  2WCB A;  5DKR A;  5CSJ A;  1K2H A;  1RK9 A;  1GGZ A;  2LLU A;  1IKU A;  1CFP A;  1LA0 A;  2ZN8 A;  4GPL B;  1DF0 B;  2AMI A;  2LMT A;  2F2P A;  1TN4 A;  3OB1 B;  1B7T Z;  4BY5 A;  1BT6 A;  1TNP A;  2L4H A;  3I5F B;  1BOC A;  1WY9 A;  1K9K A;  2AAO A;  1CDP A;  2FOT A;  1JUO A;  1REC A;  1KCY A;  4M2O A;  3OB2 B;  3CS1 A;  4ORA B;  3DF0 B;  3D0Y A;  2KI6 D;  5KU1 A;  4YI8 A;  4UPG A;  3D0Y B;  3EK8 A;  1S3P A;  1ZUZ A;  2I7A A;  5CPV A;  1ALV A;  1U5I A;  5F6T A;  2Q4U A;  1K96 A;  1S5G Y;  1JFK A;  5G08 A;  1TNW A;  1DJX A;  3RM1 A;  2KQY A;  4MRY A;  3EVV A;  1Y1U A;  1QX2 A;  1JC2 A;  1E8A A;  1SCM B;  1N2D A;  1CTR A;  1ZMZ A;  4FTG A;  3ZWH A;  2P6B B;  4MZL A;  3FWB A;  1EG3 A;  1M31 A;  1NCX A;  2PSR A;  1ZFS A;  5DKQ A;  3LK1 A;  3AAK A;  1BOD A;  2MLF C;  3CR4 X;  1PSR A;  3O78 A;  1YUR A;  5HLO A;  4PCW A;  1DMO A;  2G9B A;  1JFJ A;  2F2O A;  2KFF A;  3FIA A;  1NIW A;  3O6B A;  1NX2 A;  1J7R A;  2K8M B;  2JXC A;  2LUC A;  2I18 A;  3SIB A;  2PVB A;  4TNC A;  4PE4 A;  4MSP A;  1KK8 C;  2M29 A;  2WCE A;  1J7Q A;  1EJ3 A;  3BQ3 A;  2BE6 A;  4GGN A;  1UHN A;  4YGB B;  2KBM A;  2KAY A;  4HSZ A;  4WQ2 A;  2FJU B;  3AKB A;  2PMY A;  1DVI A;  2CCM A;  1DJH A;  5AER A;  1IQ5 A;  4DCK A;  1CDL A;  3CGA A;  2NXQ A;  1V1G A;  1KQM B;  2B1U A;  2L2E A;  2K2A A;  2L50 A;  1DTL A;  1M39 A;  2ZFD A;  4IL1 A;  4U8D A;  1S36 A;  5AXI A;  4HRG A;  2BCB A;  1ALW A;  5KSZ A;  2MJW B;  1YVH A;  2H2K A;  4PHN A;  2NCO A;  3I5I C;  2GGZ A;  1PSB A;  3GOF A;  1QAS A;  2HPS A;  2KFH A;  2LVV A;  1CM1 A;  4N1F A;  1BR4 B;  1TTX A;  2KAV A;  1YX8 A;  2WC8 A;  5TNC A;  2LCP A;  3TDZ A;  1A03 A;  2CT9 A;  4GUK A;  2M1K B;  3RLZ A;  3KO0 A;  1IJ5 A;  1PVA A;  3JTD C;  1BJF A;  2MBX A;  1XFY O;  3TUY C;  4MLW A;  1TRF A;  4WRI A;  2O5G A;  4C0J A;  1IQ3 A;  1SYM A;  2MLE C;  2LE9 B;  4NDB A;  4PE0 A;  3BUW B;  2KSP A;  4A4B A;  2WOR A;  1NCY A;  1A2X A;  1YVL A;  2K7O A;  2K2F A;  1RRO A;  1MUX A;  2KQ6 A;  1R2U A;  2BEC A;  4MZK A;  4F0Z B;  4YGE B;  1G8I A;  1SCV A;  1SR6 C;  4OKH A;  1DGU A;  1KK8 B;  3D10 A;  4YGC B;  1MXL C;  1JF2 A;  4N5X A;  3IF7 A;  3VRN A;  1XFU O;  2D8N A;  2Y1M A;  5D69 A;  3ICB A;  1CLB A;  2EC6 C;  2AUC A;  4OVN F;  2EHB A;  1DT7 B;  3TS5 C;  4D1E A;  2KHN A;  1S6C A;  2KBI A;  2BBM A;  2CTN A;  2LLT A;  3DVK A;  2KDH A;  2M0R A;  1QX5 B;  1LA3 A;  1QX7 A;  1YTZ C;  1A75 A;  2HQW A;  2K7C A;  2KFG A;  1NSH A;  4AQI A;  4ORC B;  2KYF A;  1ODB A;  1PK0 D;  1SY9 A;  5HKZ A;  2JT3 A;  1QXP A;  3CWG A;  4P5O E;  1R6P A;  3M0W A;  2SCP A;  5HLV A;  4DS7 A;  1WRL A;  1UHK A;  4GNK B;  3KF9 A;  3EK7 A;  1DJY A;  1OZS A;  4GBA A;  1L2O B;  1XFX O;  1YUT A;  3I5G B;  4C0K A;  1FBV A;  3BOW A;  3IQQ A;  1B1G A;  2M3W A;  3BUO B;  1BF5 A;  1NYA A;  3SG5 A;  4I5J A;  5ER4 X;  2L51 A;  1FW4 A;  2Y4Q A;  3DD4 A;  3EK4 A;  3SG6 A;  3WHU B;  1B8L A;  3NSK A;  1QVI Z;  1B8C A;  4ZCU A;  4E68 A;  4P2Y B;  1MHO A;  1U5I B;  4USL A;  1KK7 Y;  1SNL A;  1KWO B;  1ZOT B;  2KI4 C;  5K89 A;  4JPZ B;  1M63 B;  1C07 A;  4L9M A;  1AJ5 A;  2LV7 A;  5HYD A;  1DGV A;  1AHR A;  1MXE A;  1YUS A;  2JQ6 A;  4CPV A;  4JQ0 D;  1IRJ A;  1WDC B;  4YBH B;  5CSF A;  3JVT B;  5I8N A;  2JC2 A;  1D1O A;  1SL8 A;  2LM5 A;  1J7O A;  3PAL A;  1YUU A;  1KFX L;  1SR6 B;  1MWN A;  2M49 B;  1QIV A;  2OS8 B;  3PM8 A;  1CLL A;  1TCF A;  1OSA A;  3PN7 C;  2M9G A;  4PHJ A;  1S6J A;  3SIA A;  2KGR A;  1JSA A;  1X02 A;  2EC6 B;  4CFQ A;  1UP5 A;  3TS5 B;  1UHH A;  1LIN A;  1AK8 A;  2CXJ A;  2SAS A;  2K7D A;  1PUL A;  1VRK A;  1QV1 A;  2F8P A;  2JNX A;  2HET A;  1YR5 A;  2NZ0 A;  1QTX A;  1EG4 A;  1K93 D;  1XVJ A;  2MAZ A;  4OV2 A;  1CDN A;  2IS9 A;  5HKW A;  4AOM A;  4QJ4 B;  5B8I B;  2Y5I A;  1C7W A;  1IWQ A;  1KSO A;  4CID A;  2BL0 C;  1J1D A;  1S26 D;  1QV0 A;  1LVC D;  2QPT A;  1WRK A;  1KSM A;  1FI6 A;  1XFZ O;  2L5X B;  3NSI A;  4I5N B;  3K21 A;  2NLN A;  5AEQ A;  1MQ1 A;  2HF5 A;  1YRU B;  2F3Y A;  1PRW A;  1CFC A;  1UUR A;  2TN4 A;  1GGW A;  2HQ8 A;  2OPO A;  2QAC A;  2I94 A;  1W7J B;  5J3X A;  3FWC A;  2F33 A;  4DRW A;  1AVS A;  1NX0 A;  4OR9 B;  2ZND A;  1B9A A;  2LVI A;  3I5H C;  4MRX A;  2OTG C;  3CTN A;  5CSI A;  3EVU A;  2KNE A;  2A4J A;  2KI4 B;  2WND A;  2FCD A;  2LP2 A;  2LP3 A;  5IBW A;  1Y1A A;  5ER5 A;  1S5G Z;  1SPY A;  1J55 A;  1QS7 A;  1B7T Y;  2MRD A;  3H4S E;  2JZI A;  1OMD A;  1NPQ A;  1SKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...