2DOQA

Crystal structure of sfi1p/cdc31p complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
146
structure length
146
Chain Sequence
SELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 31
publication title Structural role of Sfi1p-centrin filaments in budding yeast spindle pole body duplication.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 39
structure length 146
sequence length 146
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2doqA01
3CLNA 5JOLA 3ZNIA 1RK9A 1NPQA 2L4HA 1U5IB 4AOMA 1QX2A 1S5GZ 4MRXA 3IF7A 1FBVA 3WHTB 1FI6A 2OPOA 4PDZA 3WNXB 1NCYA 5KSZA 2VRGA 3SG4A 5CSFA 2KFGA 1K9UA 2K2FA 4U8DA 1IJ5A 4YBHB 2LP2A 1J7OA 2K0JA 1QASA 3CGAA 1BF5A 2BBMA 3FWCA 1TTXA 1SBJA 1L7ZA 1LA3A 1OZOA 1PSRA 1XFWO 1B8RA 2KAYA 2P6BB 2Q91A 2WNDA 1N0YA 3LK1A 1NX0A 1IH0A 4CLNA 5DKNA 1KSMA 3NSLA 1KFUS 1M63B 2MBXA 3KEVA 3O6BA 1WLZA 1M31A 2D8NA 1FI5A 3FS7A 3OX6A 4XJKA 1UWOA 1OMDA 1OE9B 2F33A 2KBIA 1X02A 3KO0A 1CFCA 1AJ5A 3JVTB 4OCIA 1S26D 4M2PA 1U5IA 1WLMA 4CFQA 1KCYA 1J1DA 1K9KA 2BECA 2HQWA 3VGOA 3KPXA 2M0RA 4PE0A 3ZWHA 1DMOA 1K2HA 2COLB 1CLMA 1WY9A 1SK6D 2CT9A 2ZNEA 1SL8A 4R1EA 1F8HA 2A4JA 2H2KA 2JU0A 1W7JB 1EG3A 2M3WA 3PALA 1J7QA 2HQ8A 1TIZA 1YRUB 3DVEA 1GJYA 1G33A 2Y5IA 3VRNA 1CB1A 1NX1A 2M8UA 2MJWB 2LNKA 1XFZO 2LP3A 1TCFA 2O60A 4WQ2A 4BY5A 3PM8A 1M45A 4HRGA 2LLTA 5GQQC 1MWNA 5G08A 2M7LA 1CMGA 2M9GA 2KFHA 1DJWA 2L0PA 1CM1A 1VRKA 2I94A 2L51A 3CWGA 1F54A 2NLNA 1PULA 1L2OB 5AANA 1QV0A 3VRQA 1J7PA 3PFVA 2ZRSA 4PE4A 1QIVA 1M46A 2GV5A 1OMRA 1NIWA 2JNFA 1BU3A 1KFXS 1F70A 2JULA 1QX5B 1KQMB 1IRJA 5HKYA 2LVJA 4I5LB 2JTTA 2LANA 2JZIA 1LINA 2KAXA 1MXEA 3PATA 1TCOB 1UHHA 1TNWA 2I2RE 1BT6A 2E30A 3BUMB 1PSBA 4ZCUA 1JWDA 1UURA 2LC5A 3MSEB 1B8LA 2BE6A 2F2OA 2PRUA 1QXPA 1RROA 2LM5A 3GK2A 4GPLB 1ZMZA 1L2OC 1OQPA 4PHJA 1UHKA 1SR6B 2MHHA 3DVMA 3IQQA 2LLUA 5DKRA 1Y6WA 4NDCA 3EK4A 1MXLC 4I5NB 4DCKA 5BPJA 1NWDA 1DJZA 3PN7C 5KU1A 1Y1UA 1KQMC 5HKWA 1QLKA 2KNEA 4P5OE 1CMFA 1EJ3A 2M1KB 5ER4X 1QJTA 3OP0A 1CNPA 1K9PA 2NCPA 1K90D 1RWYA 2KGBC 1HT9A 1DJXA 5D69A 4GBAA 4FQOA 3AAKA 1C7VA 3BUXB 3WXAA 4AQJA 5IBWA 1GGZA 1R2UA 4GNKB 2EGDA 3SIAA 3KHEA 5AERA 1AVSA 1W7IB 4QJ4B 1WDCB 1ODBA 2JC2A 4L9MA 1NX3A 2KHNA 1GGWA 1HQVA 1SR6C 1UHNA 1OOJA 3HX4A 5J3XA 3SIBA 4I5JA 3CZTX 1MUXA 2KOTA 3BOWB 4XYNA 3D0YB 1AHRA 1A75B 2ZN8A 1BLQA 4YGCB 2AAOA 1SL7A 3ICBA 4ICBA 1KK8C 2ZRTA 4MRYA 1R6PA 2BE4A 5B8IB 4IL1A 1AK8A 3FWBA 3O2PA 1N2DA 4PHNA 1FF1A 2CCMA 3VROA 1DGVA 1S5GY 1IQ5A 1JFKA 2OTGC 1IGVA 3EVVA 4ZCVA 1JFJA 2R2IA 2CXJA 1QV1A 1WDCC 1XFXO 4C0KA 1QVIZ 1YUSA 4CIDA 2WCEA 2DOQA 1SMGA 1UP5A 1S6JA 1XO5A 1C7WA 2F3YA 3O4YA 3O78A 4I5KA 2NZ0A 1A29A 2JT3A 4JQ0D 2KGRA 1NCXA 2KI4C 1A4PA 4QJ5B 5I8NA 2L50A 3IQOA 2G2BA 2ZKMX 4NDDA 3BXKA 4MZKA 4PHMA 2MA2A 1PALA 2JXCA 1Q80A 3AKAA 3VRPA 3LCPC 2FCEA 1ZOTB 3I5HC 1YR5A 4HSZA 4ORCB 2F2PA 4ORAB 1OMVA 3BOWA 1AUIB 1K93D 1XVJA 3D0YA 3EVUA 1A75A 2E6WA 3C1VA 2BBNA 4GUKA 1TN4A 3I5FB 1SRAA 1BJFA 4QJ3B 4HREE 1G4YR 2FOTA 1UHJA 3HCMA 4DS7A 1SCMC 2QACA 3E3RA 1DJGA 1LVCD 5CSIA 1XFVO 1S3PA 2Q4UA 2LVIA 4N1GA 1JBAA 1KQVA 1CFDA 1EG4A 2LE9B 1XFUO 1WRLA 1CLBA 4OVNF 3LK0A 4MEWA 5HLOA 4DRWA 1OZSA 1FPWA 1A2XA 2JT0A 1YURA 4GGFC 2LCPA 1YRTB 2KAVA 4HRHA 3A4UB 3I5FC 1QTXA 2MRDA 1XK4C 2M1UA 3M0WA 2Y1NA 3NSIA 4YRUA 1B7TZ 5PALA 1NUBA 2BL0C 1XYDA 2FCDA 2K7OA 2LVKA 1IKUA 3EKJA 3KF9A 1SCVA 2L4IA 1F71A 1OSAA 2GGZA 2WCFA 1Y1AA 3BUOB 2PSRA 2LUXA 1JF2A 1UHIA 2LHIA 5K89A 3EK8A 4JWQA 4M2OA 3PN7B 1BMOA 4Q04A 1YX8A 2HF5A 2LVVA 2M7NA 1XFYO 3DF0B 3SG5A 4UPGA 3CR5X 2WORA 1QX7A 2LHLA 4OV2A 1JSAA 2LV7A 1SYMA 1BODA 2IS9A 1J7RA 2AUCA 5D7FA 4D1EA 1RECA 3WHUB 1XA5A 3BQ3A 1YUTA 1S6IA 4C0JA 2ZNDA 1GQMA 1YVHA 3I5GB 5CSJA 3TZ1A 1J55A 1KFUL 1SW8A 2PALA 1KK7Z 2EC6C 3H4SE 2PASA 3QRXA 3TS5B 1IWQA 4E68A 1ZFSA 1DGUA 3OB1B 2KYFA 2JT8A 2MLFC 1KWOC 1K96A 1KK8B 1CKKA 1LKJA 1V1GA 4MN0A 2LUCA 4CFRA 1FW4A 1SPYA 1ALWA 1QIWA 2FJUB 2OTGB 3CS1A 1B9AA 2LAPA 2MAZA 3TDUA 3DF0A 2JPTA 3TUYC 3I5GC 2AMIA 3EVRA 4CPVA 1DF0B 4YGDB 2K8MB 3DVKA 3CTNA 4YGEB 2JOJA 1YUUA 1N65A 3CR4X 1IJ6A 4TNCA 1QATA 2KI4B 2L98A 4N1FA 4YGAA 3K21A 3TS5C 4DIRA 1E8AA 2JXLA 1SNLA 1TRFA 2OS8C 1CDLA 1TNXA 1CDPA 2GGMA 4PALA 5AFPA 4JPZB 1DT7B 1V1FA 1H4BA 5I2LA 2CBLA 3I5HB 1IG5A 3D10A 4NDBA 5FYXA 4MZLA 3OHMB 1RFJA 2KDHA 1PRWA 1F4QA 5DKQA 2KI6D 1BOCA 4A4BA 2BCAA 5CSNA 3RM1A 1SCMB 2L2EA 2KSPA 1AJ4A 1SL9A 3NSOA 1QVIY 2CNPA 1YX7A 1NCZA 4YGBB 2ZFDA 2ISDA 4ETOA 1KFXL 5I2QA 1DF0A 1C07A 3LLEA 1DVIA 3NXAA 1CDNA 1CM4A 2EHBA 1B4CA 5HLVA 2BKHB 3A8RA 2M29A 3OB2B 2K7CA 1QS7A 2V53A 1DTLA 4PHKA 2SASA 1AP4A 4FTGA 4PE1A 2BL0B 3F45A 2JTZA 1YTZC 1CDMA 2LMVA 1WRZA 2LMUA 5AXIA 1F55A 4GGNA 3SG6A 2WC8A 1K94A 1Y0VH 4BY4A 2MLEC 2JRFA 1LA0A 1BG1A 2BCBA 1JC2A 3TDZA 3SG7A 5KTYA 3JTDB 3SJSA 1DJHA 2JWWA 4P2YB 1H8BA 3SG2A 2L5XB 1CFFA 3NSKA 1TOPA 4NQGA 1ZUZA 4ORBB 2Y4QA 2SCPA 1RTP1 1EL4A 4MSPA 3BYAA 5HYDA 2CTNA 2LLSA 1S1EA 2LMTA 3GOFA 4PE7A 1QLSA 1EXRA 2K7BA 2BKIB 3TDIA 2ZN9A 3SG3A 2KQ6A 2G9BA 4GGFA 1PVAA 1B7TY 2O5GA 1F4OA 1XK4A 3JTDC 3PSRA 3FIAA 2EC6B 1MHOA 1RJVA 3JVTC 1Y1XA 1JUOA 3BUWB 1MQ1A 1CLLA 4MVFA 2F3ZA 4AQIA 1IQ3A 4GAOA 1J1EA 2M49B 3GK1A 3RLZA 1KSOA 1KWOB 4N5XA 2I18A 2KBMA 3DD4A 5AEQA 3LL8B 4MBEA 1MF8B 4DUQA 5ER5A 1LXFC 1CTRA 2KFFA 1M39A 2NXQA 1PVBA 1YVLA 3GK4X 3TUYB 2K61A 1D1OA 2HPSA 5TNCA 2M97A 2QPTA 1TNQA 3PLFB 4USLA 4WQ3A 1NX2A 3AKBA 2Y1MA 2F8PA 2HETA 3I5IB 2TN4A 1NP8A 5HKZA 1CFPA 1NSHA 1MR8A 2K7DA 1B47A 3DVJA 2PVBA 2OS8B 3BUNB 3CR2A 1UUSA 1KK7Y 1K95A 4C0LA 4MZJA 1A03A 1BR1B 1B1GA 3AAJA 1DJIA 3EK7A 2WCBA 4A4CA 2BCXA 1DJYA 2JQ6A 2PMYA 4WRIA 3VRRA 4M2QA 1G8IA 5CPVA 5I2OA 4PCWA 5F6TA 2H61C 2JNXA 1EH2A 3I5IC 1ALVA 3OX5A 1B8CA 1JF0A 1PK0D 3EKHA 4OR9B 4MLWA 1ZACA 4F0ZB 2RGIA 2KI6C 2KQYA 1BR4B 1TNPA 2KYCA 4YI8A 2H61A 1SKTA 2I7AA 2B1UA 1NYAA 2NCOA 5JJGA 4GFTA 2K2AA 1S6CA 1WRKA 4XJKB 4OKHA 4YI9A 1K8UA 2WOSA 1S36A 1SY9A
chains in the Genus database with same CATH superfamily
3CLNA 5JOLA 3ZNIA 1RK9A 3B6XA 1NPQA 2BAPA 1U5IB 2L4HA 4AOMA 1QX2A 1S5GZ 4MRXA 3IF7A 1FBVA 3WHTB 1FI6A 2OPOA 4PDZA 3WNXB 1NCYA 5KSZA 2VRGA 3SG4A 5CSFA 2KFGA 1K9UA 2K2FA 4U8DA 3S0DA 1IJ5A 4YBHB 2LP2A 1J7OA 2K0JA 3RZSA 1QASA 3CGAA 1BF5A 2BBMA 3FWCA 1TTXA 1SBJA 3D74A 1L7ZA 1LA3A 1OZOA 1PSRA 1XFWO 1B8RA 2KAYA 2P6BB 2Q91A 3L4LA 2WNDA 1N0YA 2WCLA 3LK1A 1NX0A 1IH0A 1OOHA 4CLNA 5DKNA 1KSMA 3NSLA 1KFUS 1M63B 2MBXA 3KEVA 2KLEA 3O6BA 1WLZA 1M31A 2D8NA 2QEOA 1FI5A 3FS7A 3OX6A 3CZ0A 4XJKA 1C3YA 1UWOA 1OMDA 2WC5A 1OE9B 2F33A 2KBIA 1X02A 3KO0A 1CFCA 1AJ5A 3JVTB 4OCIA 1S26D 4M2PA 1U5IA 1WLMA 4CFQA 1KCYA 1J1DA 1K9KA 2BECA 2HQWA 3VGOA 3KPXA 2M0RA 4PE0A 3ZWHA 1DMOA 1K2HA 2COLB 1CLMA 1WY9A 1SK6D 2CT9A 2ZNEA 1SL8A 4R1EA 1F8HA 3BFAA 2A4JA 2H2KA 2JU0A 1W7JB 1EG3A 2M3WA 3PALA 1J7QA 2HQ8A 1TIZA 1YRUB 1OW4A 3D77A 3DVEA 1GJYA 1G33A 2Y5IA 3VRNA 1CB1A 1NX1A 2M8UA 3FE6A 2MJWB 2LNKA 1XFZO 2LP3A 1TCFA 2O60A 4WQ2A 4BY5A 3PM8A 1M45A 3DZTA 1TUZA 4HRGA 2LLTA 5GQQC 1MWNA 5G08A 2M7LA 1CMGA 5FI7A 2M9GA 2KFHA 3DXLA 2P70A 1DJWA 2L0PA 1CM1A 1VRKA 2I94A 2L51A 3CWGA 1F54A 2NLNA 1PULA 1L2OB 5AANA 1QV0A 3VRQA 1J7PA 1C3ZA 3PFVA 3R1VA 2ZRSA 4PE4A 1QIVA 1M46A 2KLDA 2GV5A 1OMRA 1NIWA 2JNFA 1BU3A 1KFXS 1F70A 2JULA 1QX5B 1KQMB 3CZ2A 3Q8IA 1IRJA 5HKYA 2LVJA 4I5LB 2JTTA 2LANA 3IVTA 2JPOA 2JZIA 1LINA 2KAXA 1MXEA 2PQLA 3PATA 1TCOB 1UHHA 1TNWA 2I2RE 1BT6A 2E30A 3BUMB 1PSBA 4ZCUA 1JWDA 1UURA 2LC5A 3L47A 3MSEB 1B8LA 2BE6A 2F2OA 2PRUA 1QXPA 1RROA 2LM5A 3GK2A 4GPLB 1ZMZA 1L2OC 1OQPA 4PHJA 1UHKA 1SR6B 2MHHA 3DVMA 3IQQA 2LLUA 3OGNA 1Y6WA 5DKRA 4NDCA 3EK4A 1MXLC 4I5NB 5FI2A 4DCKA 5BPJA 1NWDA 1DJZA 3PN7C 3CZ1A 1Y1UA 5KU1A 1KQMC 5HKWA 1QLKA 2KNEA 4P5OE 1CMFA 1EJ3A 2M1KB 5ER4X 1QJTA 3OP0A 1CNPA 1K9PA 2NCPA 1K90D 1RWYA 2KGBC 1HT9A 1DJXA 3B86A 5D69A 4GBAA 4FQOA 3AAKA 1C7VA 3BUXB 3WXAA 4AQJA 5IBWA 1GGZA 3DY9A 1R2UA 4GNKB 3UNWA 2EGDA 3SIAA 3KHEA 5AERA 1AVSA 1W7IB 4QJ4B 1WDCB 1ODBA 1SSEB 2JC2A 1NX3A 2KHNA 3O4XA 4L9MA 1GGWA 1HQVA 1SR6C 1UHNA 1OOJA 3HX4A 3N7HA 5J3XA 4I5JA 3CZTX 3SIBA 1MUXA 2KOTA 2FJYA 3BOWB 4XYNA 3D0YB 1AHRA 1A75B 2ZN8A 1BLQA 4YGCB 2AAOA 3D75A 1SL7A 3ICBA 4ICBA 1KK8C 2ZRTA 4MRYA 1R6PA 2BE4A 2BNXA 3K1EA 2L2CA 4IL1A 5B8IB 3FWBA 3O2PA 1N2DA 1AK8A 4PHNA 1FF1A 3FE8A 2CCMA 3VROA 1DGVA 1S5GY 1IQ5A 1JFKA 2OTGC 1IGVA 3EVVA 4ZCVA 1JFJA 2R2IA 2CXJA 3PM2A 1QV1A 1WDCC 1XFXO 3S0GA 4C0KA 1QVIZ 1YUSA 4CIDA 2WCEA 2DOQA 3CDNA 1SMGA 1UP5A 1S6JA 1XO5A 1C7WA 2F3YA 3O4YA 3O78A 4I5KA 2NZ0A 1A29A 2JT3A 4JQ0D 2KGRA 1NCXA 2KI4C 1A4PA 4QJ5B 5I8NA 2L50A 3IQOA 1XFRA 2G2BA 2L5YA 2ZKMX 4JKTA 3BXKA 4NDDA 2QEBA 4MZKA 4PHMA 2MA2A 1PALA 1QWVA 2JXCA 2ERBA 5D3OA 1Q80A 3AKAA 3S0AA 3VRPA 3LCPC 2FCEA 1ZOTB 1Z4HA 1YR5A 3I5HC 4HSZA 2F2PA 4ORCB 4ORAB 1OMVA 3SS3A 3BOWA 1AUIB 1K93D 1XVJA 3D0YA 3EVUA 1A75A 2E6WA 3C1VA 2BBNA 4GUKA 1TN4A 3I5FB 1SRAA 1BJFA 3NHTA 4QJ3B 4HREE 1Z2CB 1G4YR 2FOTA 1UHJA 3HCMA 3SS5A 4DS7A 1SCMC 2QACA 3E3RA 1OOIX 1DJGA 1LVCD 3R1PA 5CSIA 1XFVO 1S3PA 2Q4UA 2LVIA 4N1GA 1JBAA 3B88A 1KQVA 1CFDA 1EG4A 2LE9B 1XFUO 1WRLA 1CLBA 4OVNF 3LK0A 2WCHA 4MEWA 5HLOA 4DRWA 1OZSA 1FPWA 1A2XA 1GM0A 2JT0A 1YURA 4GGFC 2LCPA 1YRTB 2KAVA 4HRHA 3A4UB 3I5FC 1QTXA 1DELA 2MRDA 1XK4C 2M1UA 3M0WA 2Y1NA 3NSIA 4YRUA 1B7TZ 5PALA 1NUBA 2BL0C 3S0EA 1XYDA 2FCDA 2K7OA 2LVKA 1IKUA 3EKJA 3KF9A 1SCVA 2L4IA 1F71A 1OSAA 2GGZA 2WCFA 1Y1AA 3BUOB 2PSRA 2LUXA 1JF2A 1UHIA 2LHIA 5K89A 3EK8A 4JWQA 4M2OA 2QDIA 3PN7B 1BMOA 4Q04A 1YX8A 2HF5A 2LVVA 2M7NA 1XFYO 3DF0B 3SG5A 4UPGA 3CR5X 2WORA 1QX7A 2LHLA 4OV2A 5EL2A 1JSAA 2LV7A 1SYMA 1BODA 2IS9A 1J7RA 2AUCA 3CYZA 5D7FA 4D1EA 1RECA 3S0FA 1P28A 4PT1A 3WHUB 1XA5A 3BQ3A 2KPHA 1YUTA 1LS8A 1S6IA 3DYEA 3V2LA 4C0JA 2ZNDA 1GQMA 1YVHA 3I5GB 5CSJA 3TZ1A 1J55A 1KFUL 4JD9A 1SW8A 2PALA 5FI6A 1KK7Z 2EC6C 3H4SE 2PASA 3QRXA 3TS5B 1IWQA 4E68A 1ZFSA 1DGUA 3NGVA 3OB1B 1OOGA 2KYFA 2JT8A 2MLFC 1KWOC 1K96A 1KK8B 1CKKA 5DICA 1LKJA 1V1GA 4FQTA 4MN0A 2LUCA 4CFRA 3D73A 1FW4A 1SPYA 1ALWA 1QIWA 2FJUB 2OTGB 3CS1A 1B9AA 2LAPA 2MAZA 3TDUA 3DF0A 2JPTA 3TUYC 3I5GC 2AMIA 3EVRA 4CPVA 1DF0B 4YGDB 2K8MB 3DVKA 3CTNA 4YGEB 2JOJA 1YUUA 1OOFA 1N65A 3QMEA 3CR4X 1IJ6A 4TNCA 1QATA 2KI4B 2L98A 4N1FA 4YGAA 3K21A 3TS5C 4DIRA 1E8AA 2JXLA 3BFHA 1SNLA 1TRFA 3NHIA 2OS8C 1CDLA 1TNXA 1CDPA 2GGMA 3D78A 4PALA 4JPZB 5AFPA 1V1FA 5I94A 1DT7B 1H4BA 5I2LA 1DEKA 2CBLA 3I5HB 1IG5A 3D10A 4NDBA 5FYXA 2P71A 2H8VA 4MZLA 3OHMB 1RFJA 2QEVA 3OBVA 2KDHA 1PRWA 1F4QA 5DKQA 2KI6D 3R1OA 1BOCA 4A4BA 2BCAA 5CSNA 3B87A 3RM1A 1SCMB 1DC1A 3L4AA 2L2EA 2KSPA 1AJ4A 1SL9A 3NSOA 1QVIY 2CNPA 1YX7A 4OZDA 1NCZA 4YGBB 2ZFDA 2ISDA 4ETOA 1KFXL 5I2QA 1DF0A 1C07A 1TWOA 2GTEA 4F7FA 3LLEA 1DVIA 3NXAA 3R72A 1CDNA 1CM4A 2EHBA 1B4CA 5HLVA 2BKHB 3A8RA 2M29A 3B7AA 3BFBA 3OB2B 2K7CA 1QS7A 2V53A 1DTLA 4PHKA 2SASA 1AP4A 4FTGA 4PE1A 2BL0B 3F45A 2JTZA 1YTZC 1CDMA 2LMVA 1WRZA 2LMUA 2WC6A 5AXIA 1F55A 4GGNA 4KYNA 2WC8A 3SG6A 1K94A 1Y0VH 4BY4A 1TUJA 2MLEC 2JRFA 1LA0A 1BG1A 2BCBA 1JC2A 3TDZA 3SG7A 5KTYA 3JTDB 3SJSA 1DJHA 2JWWA 4IJ7A 4P2YB 1H8BA 3SG2A 2L5XB 1CFFA 3NSKA 1TOPA 4NQGA 1ZUZA 4ORBB 2Y4QA 2SCPA 1RTP1 1EL4A 4MSPA 3BYAA 1ORGA 5HYDA 2CTNA 2LLSA 2PYQA 3CABA 1S1EA 2LMTA 3GOFA 4PE7A 1QLSA 1EXRA 2K7BA 2YGUA 2BKIB 1T14A 3TDIA 2ZN9A 3SG3A 2KQ6A 2G9BA 4GGFA 1PVAA 1B7TY 3FE9A 2O5GA 1F4OA 1XK4A 3JTDC 3VB1A 3PSRA 3FIAA 2EC6B 1MHOA 1RJVA 3JVTC 1Y1XA 1JUOA 3BUWB 3EG5B 1MQ1A 1CLLA 4MVFA 2F3ZA 4AQIA 1IQ3A 4GAOA 1J1EA 2M49B 3GK1A 3RLZA 1KSOA 1KWOB 1W9ZA 4N5XA 2I18A 2KBMA 3DD4A 5AEQA 3LL8B 4MBEA 1MF8B 3UO9A 4DUQA 5ER5A 1LXFC 1CTRA 2KFFA 5HL1A 1IIOA 1M39A 2NXQA 1PVBA 1YVLA 3GK4X 3TUYB 2K61A 1D1OA 2HPSA 5TNCA 2M97A 2QPTA 1TNQA 4INWA 3PLFB 4USLA 4WQ3A 1NX2A 3AKBA 2Y1MA 2F8PA 2HETA 3I5IB 2TN4A 1NP8A 5HKZA 1CFPA 1NSHA 1MR8A 2K7DA 1B47A 3DVJA 2PVBA 3SS4A 2OS8B 3BUNB 3CR2A 1UUSA 1KK7Y 2K60A 1K95A 4C0LA 2QEHA 4MZJA 1A03A 1BR1B 1B1GA 1DQEA 3AAJA 4INXA 1DJIA 3EK7A 3S0BA 2WCBA 4A4CA 2BCXA 1DJYA 2JQ6A 2PMYA 4WRIA 3VRRA 4M2QA 1G8IA 5CPVA 5I2OA 4PCWA 5F6TA 2H61C 2JNXA 1EH2A 2WCMA 3I5IC 1ALVA 3OX5A 1B8CA 1JF0A 1PK0D 3EKHA 4OR9B 4MLWA 1ZACA 4F0ZB 2RGIA 2KI6C 2KQYA 1BR4B 3BJHA 1TNPA 2KYCA 4YI8A 2H61A 1SKTA 2I7AA 2WCJA 2B1UA 1NYAA 2NCOA 5JJGA 4GFTA 2K2AA 3D76A 1S6CA 1WRKA 4XJKB 2WCKA 4OKHA 4YI9A 1K8UA 2WOSA 1S36A 3PJIA 1SY9A
chains in the Genus database with same CATH topology
3CLNA 5JOLA 3ZNIA 1RK9A 1NPQA 2L4HA 1U5IB 4AOMA 1QX2A 1S5GZ 4MRXA 3IF7A 1FBVA 3WHTB 1FI6A 2OPOA 4PDZA 3WNXB 1NCYA 5KSZA 2VRGA 3SG4A 5CSFA 2KFGA 1K9UA 2K2FA 4U8DA 1IJ5A 4YBHB 2LP2A 1J7OA 2K0JA 1QASA 3CGAA 1BF5A 2BBMA 3FWCA 1TTXA 1SBJA 1L7ZA 1LA3A 1OZOA 1PSRA 1XFWO 1B8RA 2KAYA 2P6BB 2Q91A 2WNDA 1N0YA 3LK1A 1NX0A 1IH0A 4CLNA 5DKNA 1KSMA 3NSLA 1KFUS 1M63B 2MBXA 3KEVA 3O6BA 1WLZA 1M31A 2D8NA 1FI5A 3FS7A 3OX6A 4XJKA 1UWOA 1OMDA 1OE9B 2F33A 2KBIA 1X02A 3KO0A 1CFCA 1AJ5A 3JVTB 4OCIA 1S26D 4M2PA 1U5IA 1WLMA 4CFQA 1KCYA 1J1DA 1K9KA 2BECA 2HQWA 3VGOA 3KPXA 2M0RA 4PE0A 3ZWHA 1DMOA 1K2HA 2COLB 1CLMA 1WY9A 1SK6D 2CT9A 2ZNEA 1SL8A 4R1EA 1F8HA 2A4JA 2H2KA 2JU0A 1W7JB 1EG3A 2M3WA 3PALA 1J7QA 2HQ8A 1TIZA 1YRUB 3DVEA 1GJYA 1G33A 2Y5IA 3VRNA 1CB1A 1NX1A 2M8UA 2MJWB 2LNKA 1XFZO 2LP3A 1TCFA 2O60A 4WQ2A 4BY5A 3PM8A 1M45A 4HRGA 2LLTA 5GQQC 1MWNA 5G08A 2M7LA 1CMGA 2M9GA 2KFHA 1DJWA 2L0PA 1CM1A 1VRKA 2I94A 2L51A 3CWGA 1F54A 2NLNA 1PULA 1L2OB 5AANA 1QV0A 3VRQA 1J7PA 3PFVA 2ZRSA 4PE4A 1QIVA 1M46A 2GV5A 1OMRA 1NIWA 2JNFA 1BU3A 1KFXS 1F70A 2JULA 1QX5B 1KQMB 1IRJA 5HKYA 2LVJA 4I5LB 2JTTA 2LANA 2JZIA 1LINA 2KAXA 1MXEA 3PATA 1TCOB 1UHHA 1TNWA 2I2RE 1BT6A 2E30A 3BUMB 1PSBA 4ZCUA 1JWDA 1UURA 2LC5A 3MSEB 1B8LA 2BE6A 2F2OA 2PRUA 1QXPA 1RROA 2LM5A 3GK2A 4GPLB 1ZMZA 1L2OC 1OQPA 4PHJA 1UHKA 1SR6B 2MHHA 3DVMA 3IQQA 2LLUA 5DKRA 1Y6WA 4NDCA 3EK4A 1MXLC 4I5NB 4DCKA 5BPJA 1NWDA 1DJZA 3PN7C 5KU1A 1Y1UA 1KQMC 5HKWA 1QLKA 2KNEA 4P5OE 1CMFA 1EJ3A 2M1KB 5ER4X 1QJTA 3OP0A 1CNPA 1K9PA 2NCPA 1K90D 1RWYA 2KGBC 1HT9A 1DJXA 5D69A 4GBAA 4FQOA 3AAKA 1C7VA 3BUXB 3WXAA 4AQJA 5IBWA 1GGZA 1R2UA 4GNKB 2EGDA 3SIAA 3KHEA 5AERA 1AVSA 1W7IB 4QJ4B 1WDCB 1ODBA 2JC2A 4L9MA 1NX3A 2KHNA 1GGWA 1HQVA 1SR6C 1UHNA 1OOJA 3HX4A 5J3XA 3SIBA 4I5JA 3CZTX 1MUXA 2KOTA 3BOWB 4XYNA 3D0YB 1AHRA 1A75B 2ZN8A 1BLQA 4YGCB 2AAOA 1SL7A 3ICBA 4ICBA 1KK8C 2ZRTA 4MRYA 1R6PA 2BE4A 5B8IB 4IL1A 1AK8A 3FWBA 3O2PA 1N2DA 4PHNA 1FF1A 2CCMA 3VROA 1DGVA 1S5GY 1IQ5A 1JFKA 2OTGC 1IGVA 3EVVA 4ZCVA 1JFJA 2R2IA 2CXJA 1QV1A 1WDCC 1XFXO 4C0KA 1QVIZ 1YUSA 4CIDA 2WCEA 2DOQA 1SMGA 1UP5A 1S6JA 1XO5A 1C7WA 2F3YA 3O4YA 3O78A 4I5KA 2NZ0A 1A29A 2JT3A 4JQ0D 2KGRA 1NCXA 2KI4C 1A4PA 4QJ5B 5I8NA 2L50A 3IQOA 2G2BA 2ZKMX 4NDDA 3BXKA 4MZKA 4PHMA 2MA2A 1PALA 2JXCA 1Q80A 3AKAA 3VRPA 3LCPC 2FCEA 1ZOTB 3I5HC 1YR5A 4HSZA 4ORCB 2F2PA 4ORAB 1OMVA 3BOWA 1AUIB 1K93D 1XVJA 3D0YA 3EVUA 1A75A 2E6WA 3C1VA 2BBNA 4GUKA 1TN4A 3I5FB 1SRAA 1BJFA 4QJ3B 4HREE 1G4YR 2FOTA 1UHJA 3HCMA 4DS7A 1SCMC 2QACA 3E3RA 1DJGA 1LVCD 5CSIA 1XFVO 1S3PA 2Q4UA 2LVIA 4N1GA 1JBAA 1KQVA 1CFDA 1EG4A 2LE9B 1XFUO 1WRLA 1CLBA 4OVNF 3LK0A 4MEWA 5HLOA 4DRWA 1OZSA 1FPWA 1A2XA 2JT0A 1YURA 4GGFC 2LCPA 1YRTB 2KAVA 4HRHA 3A4UB 3I5FC 1QTXA 2MRDA 1XK4C 2M1UA 3M0WA 2Y1NA 3NSIA 4YRUA 1B7TZ 5PALA 1NUBA 2BL0C 1XYDA 2FCDA 2K7OA 2LVKA 1IKUA 3EKJA 3KF9A 1SCVA 2L4IA 1F71A 1OSAA 2GGZA 2WCFA 1Y1AA 3BUOB 2PSRA 2LUXA 1JF2A 1UHIA 2LHIA 5K89A 3EK8A 4JWQA 4M2OA 3PN7B 1BMOA 4Q04A 1YX8A 2HF5A 2LVVA 2M7NA 1XFYO 3DF0B 3SG5A 4UPGA 3CR5X 2WORA 1QX7A 2LHLA 4OV2A 1JSAA 2LV7A 1SYMA 1BODA 2IS9A 1J7RA 2AUCA 5D7FA 4D1EA 1RECA 3WHUB 1XA5A 3BQ3A 1YUTA 1S6IA 4C0JA 2ZNDA 1GQMA 1YVHA 3I5GB 5CSJA 3TZ1A 1J55A 1KFUL 1SW8A 2PALA 1KK7Z 2EC6C 3H4SE 2PASA 3QRXA 3TS5B 1IWQA 4E68A 1ZFSA 1DGUA 3OB1B 2KYFA 2JT8A 2MLFC 1KWOC 1K96A 1KK8B 1CKKA 1LKJA 1V1GA 4MN0A 2LUCA 4CFRA 1FW4A 1SPYA 1ALWA 1QIWA 2FJUB 2OTGB 3CS1A 1B9AA 2LAPA 2MAZA 3TDUA 3DF0A 2JPTA 3TUYC 3I5GC 2AMIA 3EVRA 4CPVA 1DF0B 4YGDB 2K8MB 3DVKA 3CTNA 4YGEB 2JOJA 1YUUA 1N65A 3CR4X 1IJ6A 4TNCA 1QATA 2KI4B 2L98A 4N1FA 4YGAA 3K21A 3TS5C 4DIRA 1E8AA 2JXLA 1SNLA 1TRFA 2OS8C 1CDLA 1TNXA 1CDPA 2GGMA 4PALA 5AFPA 4JPZB 1DT7B 1V1FA 1H4BA 5I2LA 2CBLA 3I5HB 1IG5A 3D10A 4NDBA 5FYXA 4MZLA 3OHMB 1RFJA 2KDHA 1PRWA 1F4QA 5DKQA 2KI6D 1BOCA 4A4BA 2BCAA 5CSNA 3RM1A 1SCMB 2L2EA 2KSPA 1AJ4A 1SL9A 3NSOA 1QVIY 2CNPA 1YX7A 1NCZA 4YGBB 2ZFDA 2ISDA 4ETOA 1KFXL 5I2QA 1DF0A 1C07A 3LLEA 1DVIA 3NXAA 1CDNA 1CM4A 2EHBA 1B4CA 5HLVA 2BKHB 3A8RA 2M29A 3OB2B 2K7CA 1QS7A 2V53A 1DTLA 4PHKA 2SASA 1AP4A 4FTGA 4PE1A 2BL0B 3F45A 2JTZA 1YTZC 1CDMA 2LMVA 1WRZA 2LMUA 5AXIA 1F55A 4GGNA 3SG6A 2WC8A 1K94A 1Y0VH 4BY4A 2MLEC 2JRFA 1LA0A 1BG1A 2BCBA 1JC2A 3TDZA 3SG7A 5KTYA 3JTDB 3SJSA 1DJHA 2JWWA 4P2YB 1H8BA 3SG2A 2L5XB 1CFFA 3NSKA 1TOPA 4NQGA 1ZUZA 4ORBB 2Y4QA 2SCPA 1RTP1 1EL4A 4MSPA 3BYAA 5HYDA 2CTNA 2LLSA 1S1EA 2LMTA 3GOFA 4PE7A 1QLSA 1EXRA 2K7BA 2BKIB 3TDIA 2ZN9A 3SG3A 2KQ6A 2G9BA 4GGFA 1PVAA 1B7TY 2O5GA 1F4OA 1XK4A 3JTDC 3PSRA 3FIAA 2EC6B 1MHOA 1RJVA 3JVTC 1Y1XA 1JUOA 3BUWB 1MQ1A 1CLLA 4MVFA 2F3ZA 4AQIA 1IQ3A 4GAOA 1J1EA 2M49B 3GK1A 3RLZA 1KSOA 1KWOB 4N5XA 2I18A 2KBMA 3DD4A 5AEQA 3LL8B 4MBEA 1MF8B 4DUQA 5ER5A 1LXFC 1CTRA 2KFFA 1M39A 2NXQA 1PVBA 1YVLA 3GK4X 3TUYB 2K61A 1D1OA 2HPSA 5TNCA 2M97A 2QPTA 1TNQA 3PLFB 4USLA 4WQ3A 1NX2A 3AKBA 2Y1MA 2F8PA 2HETA 3I5IB 2TN4A 1NP8A 5HKZA 1CFPA 1NSHA 1MR8A 2K7DA 1B47A 3DVJA 2PVBA 2OS8B 3BUNB 3CR2A 1UUSA 1KK7Y 1K95A 4C0LA 4MZJA 1A03A 1BR1B 1B1GA 3AAJA 1DJIA 3EK7A 2WCBA 4A4CA 2BCXA 1DJYA 2JQ6A 2PMYA 4WRIA 3VRRA 4M2QA 1G8IA 5CPVA 5I2OA 4PCWA 5F6TA 2H61C 2JNXA 1EH2A 3I5IC 1ALVA 3OX5A 1B8CA 1JF0A 1PK0D 3EKHA 4OR9B 4MLWA 1ZACA 4F0ZB 2RGIA 2KI6C 2KQYA 1BR4B 1TNPA 2KYCA 4YI8A 2H61A 1SKTA 2I7AA 2B1UA 1NYAA 2NCOA 5JJGA 4GFTA 2K2AA 1S6CA 1WRKA 4XJKB 4OKHA 4YI9A 1K8UA 2WOSA 1S36A 1SY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLN A;  5JOL A;  3ZNI A;  1RK9 A;  1NPQ A;  2L4H A;  1U5I B;  4AOM A;  1QX2 A;  1S5G Z;  4MRX A;  3IF7 A;  1FBV A;  3WHT B;  1FI6 A;  2OPO A;  4PDZ A;  3WNX B;  1NCY A;  5KSZ A;  2VRG A;  3SG4 A;  5CSF A;  2KFG A;  1K9U A;  2K2F A;  4U8D A;  1IJ5 A;  4YBH B;  2LP2 A;  1J7O A;  2K0J A;  1QAS A;  3CGA A;  1BF5 A;  2BBM A;  3FWC A;  1TTX A;  1SBJ A;  1L7Z A;  1LA3 A;  1OZO A;  1PSR A;  1XFW O;  1B8R A;  2KAY A;  2P6B B;  2Q91 A;  2WND A;  1N0Y A;  3LK1 A;  1NX0 A;  1IH0 A;  4CLN A;  5DKN A;  1KSM A;  3NSL A;  1KFU S;  1M63 B;  2MBX A;  3KEV A;  3O6B A;  1WLZ A;  1M31 A;  2D8N A;  1FI5 A;  3FS7 A;  3OX6 A;  4XJK A;  1UWO A;  1OMD A;  1OE9 B;  2F33 A;  2KBI A;  1X02 A;  3KO0 A;  1CFC A;  1AJ5 A;  3JVT B;  4OCI A;  1S26 D;  4M2P A;  1U5I A;  1WLM A;  4CFQ A;  1KCY A;  1J1D A;  1K9K A;  2BEC A;  2HQW A;  3VGO A;  3KPX A;  2M0R A;  4PE0 A;  3ZWH A;  1DMO A;  1K2H A;  2COL B;  1CLM A;  1WY9 A;  1SK6 D;  2CT9 A;  2ZNE A;  1SL8 A;  4R1E A;  1F8H A;  2A4J A;  2H2K A;  2JU0 A;  1W7J B;  1EG3 A;  2M3W A;  3PAL A;  1J7Q A;  2HQ8 A;  1TIZ A;  1YRU B;  3DVE A;  1GJY A;  1G33 A;  2Y5I A;  3VRN A;  1CB1 A;  1NX1 A;  2M8U A;  2MJW B;  2LNK A;  1XFZ O;  2LP3 A;  1TCF A;  2O60 A;  4WQ2 A;  4BY5 A;  3PM8 A;  1M45 A;  4HRG A;  2LLT A;  5GQQ C;  1MWN A;  5G08 A;  2M7L A;  1CMG A;  2M9G A;  2KFH A;  1DJW A;  2L0P A;  1CM1 A;  1VRK A;  2I94 A;  2L51 A;  3CWG A;  1F54 A;  2NLN A;  1PUL A;  1L2O B;  5AAN A;  1QV0 A;  3VRQ A;  1J7P A;  3PFV A;  2ZRS A;  4PE4 A;  1QIV A;  1M46 A;  2GV5 A;  1OMR A;  1NIW A;  2JNF A;  1BU3 A;  1KFX S;  1F70 A;  2JUL A;  1QX5 B;  1KQM B;  1IRJ A;  5HKY A;  2LVJ A;  4I5L B;  2JTT A;  2LAN A;  2JZI A;  1LIN A;  2KAX A;  1MXE A;  3PAT A;  1TCO B;  1UHH A;  1TNW A;  2I2R E;  1BT6 A;  2E30 A;  3BUM B;  1PSB A;  4ZCU A;  1JWD A;  1UUR A;  2LC5 A;  3MSE B;  1B8L A;  2BE6 A;  2F2O A;  2PRU A;  1QXP A;  1RRO A;  2LM5 A;  3GK2 A;  4GPL B;  1ZMZ A;  1L2O C;  1OQP A;  4PHJ A;  1UHK A;  1SR6 B;  2MHH A;  3DVM A;  3IQQ A;  2LLU A;  5DKR A;  1Y6W A;  4NDC A;  3EK4 A;  1MXL C;  4I5N B;  4DCK A;  5BPJ A;  1NWD A;  1DJZ A;  3PN7 C;  5KU1 A;  1Y1U A;  1KQM C;  5HKW A;  1QLK A;  2KNE A;  4P5O E;  1CMF A;  1EJ3 A;  2M1K B;  5ER4 X;  1QJT A;  3OP0 A;  1CNP A;  1K9P A;  2NCP A;  1K90 D;  1RWY A;  2KGB C;  1HT9 A;  1DJX A;  5D69 A;  4GBA A;  4FQO A;  3AAK A;  1C7V A;  3BUX B;  3WXA A;  4AQJ A;  5IBW A;  1GGZ A;  1R2U A;  4GNK B;  2EGD A;  3SIA A;  3KHE A;  5AER A;  1AVS A;  1W7I B;  4QJ4 B;  1WDC B;  1ODB A;  2JC2 A;  4L9M A;  1NX3 A;  2KHN A;  1GGW A;  1HQV A;  1SR6 C;  1UHN A;  1OOJ A;  3HX4 A;  5J3X A;  3SIB A;  4I5J A;  3CZT X;  1MUX A;  2KOT A;  3BOW B;  4XYN A;  3D0Y B;  1AHR A;  1A75 B;  2ZN8 A;  1BLQ A;  4YGC B;  2AAO A;  1SL7 A;  3ICB A;  4ICB A;  1KK8 C;  2ZRT A;  4MRY A;  1R6P A;  2BE4 A;  5B8I B;  4IL1 A;  1AK8 A;  3FWB A;  3O2P A;  1N2D A;  4PHN A;  1FF1 A;  2CCM A;  3VRO A;  1DGV A;  1S5G Y;  1IQ5 A;  1JFK A;  2OTG C;  1IGV A;  3EVV A;  4ZCV A;  1JFJ A;  2R2I A;  2CXJ A;  1QV1 A;  1WDC C;  1XFX O;  4C0K A;  1QVI Z;  1YUS A;  4CID A;  2WCE A;  2DOQ A;  1SMG A;  1UP5 A;  1S6J A;  1XO5 A;  1C7W A;  2F3Y A;  3O4Y A;  3O78 A;  4I5K A;  2NZ0 A;  1A29 A;  2JT3 A;  4JQ0 D;  2KGR A;  1NCX A;  2KI4 C;  1A4P A;  4QJ5 B;  5I8N A;  2L50 A;  3IQO A;  2G2B A;  2ZKM X;  4NDD A;  3BXK A;  4MZK A;  4PHM A;  2MA2 A;  1PAL A;  2JXC A;  1Q80 A;  3AKA A;  3VRP A;  3LCP C;  2FCE A;  1ZOT B;  3I5H C;  1YR5 A;  4HSZ A;  4ORC B;  2F2P A;  4ORA B;  1OMV A;  3BOW A;  1AUI B;  1K93 D;  1XVJ A;  3D0Y A;  3EVU A;  1A75 A;  2E6W A;  3C1V A;  2BBN A;  4GUK A;  1TN4 A;  3I5F B;  1SRA A;  1BJF A;  4QJ3 B;  4HRE E;  1G4Y R;  2FOT A;  1UHJ A;  3HCM A;  4DS7 A;  1SCM C;  2QAC A;  3E3R A;  1DJG A;  1LVC D;  5CSI A;  1XFV O;  1S3P A;  2Q4U A;  2LVI A;  4N1G A;  1JBA A;  1KQV A;  1CFD A;  1EG4 A;  2LE9 B;  1XFU O;  1WRL A;  1CLB A;  4OVN F;  3LK0 A;  4MEW A;  5HLO A;  4DRW A;  1OZS A;  1FPW A;  1A2X A;  2JT0 A;  1YUR A;  4GGF C;  2LCP A;  1YRT B;  2KAV A;  4HRH A;  3A4U B;  3I5F C;  1QTX A;  2MRD A;  1XK4 C;  2M1U A;  3M0W A;  2Y1N A;  3NSI A;  4YRU A;  1B7T Z;  5PAL A;  1NUB A;  2BL0 C;  1XYD A;  2FCD A;  2K7O A;  2LVK A;  1IKU A;  3EKJ A;  3KF9 A;  1SCV A;  2L4I A;  1F71 A;  1OSA A;  2GGZ A;  2WCF A;  1Y1A A;  3BUO B;  2PSR A;  2LUX A;  1JF2 A;  1UHI A;  2LHI A;  5K89 A;  3EK8 A;  4JWQ A;  4M2O A;  3PN7 B;  1BMO A;  4Q04 A;  1YX8 A;  2HF5 A;  2LVV A;  2M7N A;  1XFY O;  3DF0 B;  3SG5 A;  4UPG A;  3CR5 X;  2WOR A;  1QX7 A;  2LHL A;  4OV2 A;  1JSA A;  2LV7 A;  1SYM A;  1BOD A;  2IS9 A;  1J7R A;  2AUC A;  5D7F A;  4D1E A;  1REC A;  3WHU B;  1XA5 A;  3BQ3 A;  1YUT A;  1S6I A;  4C0J A;  2ZND A;  1GQM A;  1YVH A;  3I5G B;  5CSJ A;  3TZ1 A;  1J55 A;  1KFU L;  1SW8 A;  2PAL A;  1KK7 Z;  2EC6 C;  3H4S E;  2PAS A;  3QRX A;  3TS5 B;  1IWQ A;  4E68 A;  1ZFS A;  1DGU A;  3OB1 B;  2KYF A;  2JT8 A;  2MLF C;  1KWO C;  1K96 A;  1KK8 B;  1CKK A;  1LKJ A;  1V1G A;  4MN0 A;  2LUC A;  4CFR A;  1FW4 A;  1SPY A;  1ALW A;  1QIW A;  2FJU B;  2OTG B;  3CS1 A;  1B9A A;  2LAP A;  2MAZ A;  3TDU A;  3DF0 A;  2JPT A;  3TUY C;  3I5G C;  2AMI A;  3EVR A;  4CPV A;  1DF0 B;  4YGD B;  2K8M B;  3DVK A;  3CTN A;  4YGE B;  2JOJ A;  1YUU A;  1N65 A;  3CR4 X;  1IJ6 A;  4TNC A;  1QAT A;  2KI4 B;  2L98 A;  4N1F A;  4YGA A;  3K21 A;  3TS5 C;  4DIR A;  1E8A A;  2JXL A;  1SNL A;  1TRF A;  2OS8 C;  1CDL A;  1TNX A;  1CDP A;  2GGM A;  4PAL A;  5AFP A;  4JPZ B;  1DT7 B;  1V1F A;  1H4B A;  5I2L A;  2CBL A;  3I5H B;  1IG5 A;  3D10 A;  4NDB A;  5FYX A;  4MZL A;  3OHM B;  1RFJ A;  2KDH A;  1PRW A;  1F4Q A;  5DKQ A;  2KI6 D;  1BOC A;  4A4B A;  2BCA A;  5CSN A;  3RM1 A;  1SCM B;  2L2E A;  2KSP A;  1AJ4 A;  1SL9 A;  3NSO A;  1QVI Y;  2CNP A;  1YX7 A;  1NCZ A;  4YGB B;  2ZFD A;  2ISD A;  4ETO A;  1KFX L;  5I2Q A;  1DF0 A;  1C07 A;  3LLE A;  1DVI A;  3NXA A;  1CDN A;  1CM4 A;  2EHB A;  1B4C A;  5HLV A;  2BKH B;  3A8R A;  2M29 A;  3OB2 B;  2K7C A;  1QS7 A;  2V53 A;  1DTL A;  4PHK A;  2SAS A;  1AP4 A;  4FTG A;  4PE1 A;  2BL0 B;  3F45 A;  2JTZ A;  1YTZ C;  1CDM A;  2LMV A;  1WRZ A;  2LMU A;  5AXI A;  1F55 A;  4GGN A;  3SG6 A;  2WC8 A;  1K94 A;  1Y0V H;  4BY4 A;  2MLE C;  2JRF A;  1LA0 A;  1BG1 A;  2BCB A;  1JC2 A;  3TDZ A;  3SG7 A;  5KTY A;  3JTD B;  3SJS A;  1DJH A;  2JWW A;  4P2Y B;  1H8B A;  3SG2 A;  2L5X B;  1CFF A;  3NSK A;  1TOP A;  4NQG A;  1ZUZ A;  4ORB B;  2Y4Q A;  2SCP A;  1RTP 1;  1EL4 A;  4MSP A;  3BYA A;  5HYD A;  2CTN A;  2LLS A;  1S1E A;  2LMT A;  3GOF A;  4PE7 A;  1QLS A;  1EXR A;  2K7B A;  2BKI B;  3TDI A;  2ZN9 A;  3SG3 A;  2KQ6 A;  2G9B A;  4GGF A;  1PVA A;  1B7T Y;  2O5G A;  1F4O A;  1XK4 A;  3JTD C;  3PSR A;  3FIA A;  2EC6 B;  1MHO A;  1RJV A;  3JVT C;  1Y1X A;  1JUO A;  3BUW B;  1MQ1 A;  1CLL A;  4MVF A;  2F3Z A;  4AQI A;  1IQ3 A;  4GAO A;  1J1E A;  2M49 B;  3GK1 A;  3RLZ A;  1KSO A;  1KWO B;  4N5X A;  2I18 A;  2KBM A;  3DD4 A;  5AEQ A;  3LL8 B;  4MBE A;  1MF8 B;  4DUQ A;  5ER5 A;  1LXF C;  1CTR A;  2KFF A;  1M39 A;  2NXQ A;  1PVB A;  1YVL A;  3GK4 X;  3TUY B;  2K61 A;  1D1O A;  2HPS A;  5TNC A;  2M97 A;  2QPT A;  1TNQ A;  3PLF B;  4USL A;  4WQ3 A;  1NX2 A;  3AKB A;  2Y1M A;  2F8P A;  2HET A;  3I5I B;  2TN4 A;  1NP8 A;  5HKZ A;  1CFP A;  1NSH A;  1MR8 A;  2K7D A;  1B47 A;  3DVJ A;  2PVB A;  2OS8 B;  3BUN B;  3CR2 A;  1UUS A;  1KK7 Y;  1K95 A;  4C0L A;  4MZJ A;  1A03 A;  1BR1 B;  1B1G A;  3AAJ A;  1DJI A;  3EK7 A;  2WCB A;  4A4C A;  2BCX A;  1DJY A;  2JQ6 A;  2PMY A;  4WRI A;  3VRR A;  4M2Q A;  1G8I A;  5CPV A;  5I2O A;  4PCW A;  5F6T A;  2H61 C;  2JNX A;  1EH2 A;  3I5I C;  1ALV A;  3OX5 A;  1B8C A;  1JF0 A;  1PK0 D;  3EKH A;  4OR9 B;  4MLW A;  1ZAC A;  4F0Z B;  2RGI A;  2KI6 C;  2KQY A;  1BR4 B;  1TNP A;  2KYC A;  4YI8 A;  2H61 A;  1SKT A;  2I7A A;  2B1U A;  1NYA A;  2NCO A;  5JJG A;  4GFT A;  2K2A A;  1S6C A;  1WRK A;  4XJK B;  4OKH A;  4YI9 A;  1K8U A;  2WOS A;  1S36 A;  1SY9 A; 
#chains in the Genus database with same CATH topology
 3CLN A;  5JOL A;  3ZNI A;  1RK9 A;  3B6X A;  1NPQ A;  2BAP A;  1U5I B;  2L4H A;  4AOM A;  1QX2 A;  1S5G Z;  4MRX A;  3IF7 A;  1FBV A;  3WHT B;  1FI6 A;  2OPO A;  4PDZ A;  3WNX B;  1NCY A;  5KSZ A;  2VRG A;  3SG4 A;  5CSF A;  2KFG A;  1K9U A;  2K2F A;  4U8D A;  3S0D A;  1IJ5 A;  4YBH B;  2LP2 A;  1J7O A;  2K0J A;  3RZS A;  1QAS A;  3CGA A;  1BF5 A;  2BBM A;  3FWC A;  1TTX A;  1SBJ A;  3D74 A;  1L7Z A;  1LA3 A;  1OZO A;  1PSR A;  1XFW O;  1B8R A;  2KAY A;  2P6B B;  2Q91 A;  3L4L A;  2WND A;  1N0Y A;  2WCL A;  3LK1 A;  1NX0 A;  1IH0 A;  1OOH A;  4CLN A;  5DKN A;  1KSM A;  3NSL A;  1KFU S;  1M63 B;  2MBX A;  3KEV A;  2KLE A;  3O6B A;  1WLZ A;  1M31 A;  2D8N A;  2QEO A;  1FI5 A;  3FS7 A;  3OX6 A;  3CZ0 A;  4XJK A;  1C3Y A;  1UWO A;  1OMD A;  2WC5 A;  1OE9 B;  2F33 A;  2KBI A;  1X02 A;  3KO0 A;  1CFC A;  1AJ5 A;  3JVT B;  4OCI A;  1S26 D;  4M2P A;  1U5I A;  1WLM A;  4CFQ A;  1KCY A;  1J1D A;  1K9K A;  2BEC A;  2HQW A;  3VGO A;  3KPX A;  2M0R A;  4PE0 A;  3ZWH A;  1DMO A;  1K2H A;  2COL B;  1CLM A;  1WY9 A;  1SK6 D;  2CT9 A;  2ZNE A;  1SL8 A;  4R1E A;  1F8H A;  3BFA A;  2A4J A;  2H2K A;  2JU0 A;  1W7J B;  1EG3 A;  2M3W A;  3PAL A;  1J7Q A;  2HQ8 A;  1TIZ A;  1YRU B;  1OW4 A;  3D77 A;  3DVE A;  1GJY A;  1G33 A;  2Y5I A;  3VRN A;  1CB1 A;  1NX1 A;  2M8U A;  3FE6 A;  2MJW B;  2LNK A;  1XFZ O;  2LP3 A;  1TCF A;  2O60 A;  4WQ2 A;  4BY5 A;  3PM8 A;  1M45 A;  3DZT A;  1TUZ A;  4HRG A;  2LLT A;  5GQQ C;  1MWN A;  5G08 A;  2M7L A;  1CMG A;  5FI7 A;  2M9G A;  2KFH A;  3DXL A;  2P70 A;  1DJW A;  2L0P A;  1CM1 A;  1VRK A;  2I94 A;  2L51 A;  3CWG A;  1F54 A;  2NLN A;  1PUL A;  1L2O B;  5AAN A;  1QV0 A;  3VRQ A;  1J7P A;  1C3Z A;  3PFV A;  3R1V A;  2ZRS A;  4PE4 A;  1QIV A;  1M46 A;  2KLD A;  2GV5 A;  1OMR A;  1NIW A;  2JNF A;  1BU3 A;  1KFX S;  1F70 A;  2JUL A;  1QX5 B;  1KQM B;  3CZ2 A;  3Q8I A;  1IRJ A;  5HKY A;  2LVJ A;  4I5L B;  2JTT A;  2LAN A;  3IVT A;  2JPO A;  2JZI A;  1LIN A;  2KAX A;  1MXE A;  2PQL A;  3PAT A;  1TCO B;  1UHH A;  1TNW A;  2I2R E;  1BT6 A;  2E30 A;  3BUM B;  1PSB A;  4ZCU A;  1JWD A;  1UUR A;  2LC5 A;  3L47 A;  3MSE B;  1B8L A;  2BE6 A;  2F2O A;  2PRU A;  1QXP A;  1RRO A;  2LM5 A;  3GK2 A;  4GPL B;  1ZMZ A;  1L2O C;  1OQP A;  4PHJ A;  1UHK A;  1SR6 B;  2MHH A;  3DVM A;  3IQQ A;  2LLU A;  3OGN A;  1Y6W A;  5DKR A;  4NDC A;  3EK4 A;  1MXL C;  4I5N B;  5FI2 A;  4DCK A;  5BPJ A;  1NWD A;  1DJZ A;  3PN7 C;  3CZ1 A;  1Y1U A;  5KU1 A;  1KQM C;  5HKW A;  1QLK A;  2KNE A;  4P5O E;  1CMF A;  1EJ3 A;  2M1K B;  5ER4 X;  1QJT A;  3OP0 A;  1CNP A;  1K9P A;  2NCP A;  1K90 D;  1RWY A;  2KGB C;  1HT9 A;  1DJX A;  3B86 A;  5D69 A;  4GBA A;  4FQO A;  3AAK A;  1C7V A;  3BUX B;  3WXA A;  4AQJ A;  5IBW A;  1GGZ A;  3DY9 A;  1R2U A;  4GNK B;  3UNW A;  2EGD A;  3SIA A;  3KHE A;  5AER A;  1AVS A;  1W7I B;  4QJ4 B;  1WDC B;  1ODB A;  1SSE B;  2JC2 A;  1NX3 A;  2KHN A;  3O4X A;  4L9M A;  1GGW A;  1HQV A;  1SR6 C;  1UHN A;  1OOJ A;  3HX4 A;  3N7H A;  5J3X A;  4I5J A;  3CZT X;  3SIB A;  1MUX A;  2KOT A;  2FJY A;  3BOW B;  4XYN A;  3D0Y B;  1AHR A;  1A75 B;  2ZN8 A;  1BLQ A;  4YGC B;  2AAO A;  3D75 A;  1SL7 A;  3ICB A;  4ICB A;  1KK8 C;  2ZRT A;  4MRY A;  1R6P A;  2BE4 A;  2BNX A;  3K1E A;  2L2C A;  4IL1 A;  5B8I B;  3FWB A;  3O2P A;  1N2D A;  1AK8 A;  4PHN A;  1FF1 A;  3FE8 A;  2CCM A;  3VRO A;  1DGV A;  1S5G Y;  1IQ5 A;  1JFK A;  2OTG C;  1IGV A;  3EVV A;  4ZCV A;  1JFJ A;  2R2I A;  2CXJ A;  3PM2 A;  1QV1 A;  1WDC C;  1XFX O;  3S0G A;  4C0K A;  1QVI Z;  1YUS A;  4CID A;  2WCE A;  2DOQ A;  3CDN A;  1SMG A;  1UP5 A;  1S6J A;  1XO5 A;  1C7W A;  2F3Y A;  3O4Y A;  3O78 A;  4I5K A;  2NZ0 A;  1A29 A;  2JT3 A;  4JQ0 D;  2KGR A;  1NCX A;  2KI4 C;  1A4P A;  4QJ5 B;  5I8N A;  2L50 A;  3IQO A;  1XFR A;  2G2B A;  2L5Y A;  2ZKM X;  4JKT A;  3BXK A;  4NDD A;  2QEB A;  4MZK A;  4PHM A;  2MA2 A;  1PAL A;  1QWV A;  2JXC A;  2ERB A;  5D3O A;  1Q80 A;  3AKA A;  3S0A A;  3VRP A;  3LCP C;  2FCE A;  1ZOT B;  1Z4H A;  1YR5 A;  3I5H C;  4HSZ A;  2F2P A;  4ORC B;  4ORA B;  1OMV A;  3SS3 A;  3BOW A;  1AUI B;  1K93 D;  1XVJ A;  3D0Y A;  3EVU A;  1A75 A;  2E6W A;  3C1V A;  2BBN A;  4GUK A;  1TN4 A;  3I5F B;  1SRA A;  1BJF A;  3NHT A;  4QJ3 B;  4HRE E;  1Z2C B;  1G4Y R;  2FOT A;  1UHJ A;  3HCM A;  3SS5 A;  4DS7 A;  1SCM C;  2QAC A;  3E3R A;  1OOI X;  1DJG A;  1LVC D;  3R1P A;  5CSI A;  1XFV O;  1S3P A;  2Q4U A;  2LVI A;  4N1G A;  1JBA A;  3B88 A;  1KQV A;  1CFD A;  1EG4 A;  2LE9 B;  1XFU O;  1WRL A;  1CLB A;  4OVN F;  3LK0 A;  2WCH A;  4MEW A;  5HLO A;  4DRW A;  1OZS A;  1FPW A;  1A2X A;  1GM0 A;  2JT0 A;  1YUR A;  4GGF C;  2LCP A;  1YRT B;  2KAV A;  4HRH A;  3A4U B;  3I5F C;  1QTX A;  1DEL A;  2MRD A;  1XK4 C;  2M1U A;  3M0W A;  2Y1N A;  3NSI A;  4YRU A;  1B7T Z;  5PAL A;  1NUB A;  2BL0 C;  3S0E A;  1XYD A;  2FCD A;  2K7O A;  2LVK A;  1IKU A;  3EKJ A;  3KF9 A;  1SCV A;  2L4I A;  1F71 A;  1OSA A;  2GGZ A;  2WCF A;  1Y1A A;  3BUO B;  2PSR A;  2LUX A;  1JF2 A;  1UHI A;  2LHI A;  5K89 A;  3EK8 A;  4JWQ A;  4M2O A;  2QDI A;  3PN7 B;  1BMO A;  4Q04 A;  1YX8 A;  2HF5 A;  2LVV A;  2M7N A;  1XFY O;  3DF0 B;  3SG5 A;  4UPG A;  3CR5 X;  2WOR A;  1QX7 A;  2LHL A;  4OV2 A;  5EL2 A;  1JSA A;  2LV7 A;  1SYM A;  1BOD A;  2IS9 A;  1J7R A;  2AUC A;  3CYZ A;  5D7F A;  4D1E A;  1REC A;  3S0F A;  1P28 A;  4PT1 A;  3WHU B;  1XA5 A;  3BQ3 A;  2KPH A;  1YUT A;  1LS8 A;  1S6I A;  3DYE A;  3V2L A;  4C0J A;  2ZND A;  1GQM A;  1YVH A;  3I5G B;  5CSJ A;  3TZ1 A;  1J55 A;  1KFU L;  4JD9 A;  1SW8 A;  2PAL A;  5FI6 A;  1KK7 Z;  2EC6 C;  3H4S E;  2PAS A;  3QRX A;  3TS5 B;  1IWQ A;  4E68 A;  1ZFS A;  1DGU A;  3NGV A;  3OB1 B;  1OOG A;  2KYF A;  2JT8 A;  2MLF C;  1KWO C;  1K96 A;  1KK8 B;  1CKK A;  5DIC A;  1LKJ A;  1V1G A;  4FQT A;  4MN0 A;  2LUC A;  4CFR A;  3D73 A;  1FW4 A;  1SPY A;  1ALW A;  1QIW A;  2FJU B;  2OTG B;  3CS1 A;  1B9A A;  2LAP A;  2MAZ A;  3TDU A;  3DF0 A;  2JPT A;  3TUY C;  3I5G C;  2AMI A;  3EVR A;  4CPV A;  1DF0 B;  4YGD B;  2K8M B;  3DVK A;  3CTN A;  4YGE B;  2JOJ A;  1YUU A;  1OOF A;  1N65 A;  3QME A;  3CR4 X;  1IJ6 A;  4TNC A;  1QAT A;  2KI4 B;  2L98 A;  4N1F A;  4YGA A;  3K21 A;  3TS5 C;  4DIR A;  1E8A A;  2JXL A;  3BFH A;  1SNL A;  1TRF A;  3NHI A;  2OS8 C;  1CDL A;  1TNX A;  1CDP A;  2GGM A;  3D78 A;  4PAL A;  4JPZ B;  5AFP A;  1V1F A;  5I94 A;  1DT7 B;  1H4B A;  5I2L A;  1DEK A;  2CBL A;  3I5H B;  1IG5 A;  3D10 A;  4NDB A;  5FYX A;  2P71 A;  2H8V A;  4MZL A;  3OHM B;  1RFJ A;  2QEV A;  3OBV A;  2KDH A;  1PRW A;  1F4Q A;  5DKQ A;  2KI6 D;  3R1O A;  1BOC A;  4A4B A;  2BCA A;  5CSN A;  3B87 A;  3RM1 A;  1SCM B;  1DC1 A;  3L4A A;  2L2E A;  2KSP A;  1AJ4 A;  1SL9 A;  3NSO A;  1QVI Y;  2CNP A;  1YX7 A;  4OZD A;  1NCZ A;  4YGB B;  2ZFD A;  2ISD A;  4ETO A;  1KFX L;  5I2Q A;  1DF0 A;  1C07 A;  1TWO A;  2GTE A;  4F7F A;  3LLE A;  1DVI A;  3NXA A;  3R72 A;  1CDN A;  1CM4 A;  2EHB A;  1B4C A;  5HLV A;  2BKH B;  3A8R A;  2M29 A;  3B7A A;  3BFB A;  3OB2 B;  2K7C A;  1QS7 A;  2V53 A;  1DTL A;  4PHK A;  2SAS A;  1AP4 A;  4FTG A;  4PE1 A;  2BL0 B;  3F45 A;  2JTZ A;  1YTZ C;  1CDM A;  2LMV A;  1WRZ A;  2LMU A;  2WC6 A;  5AXI A;  1F55 A;  4GGN A;  4KYN A;  2WC8 A;  3SG6 A;  1K94 A;  1Y0V H;  4BY4 A;  1TUJ A;  2MLE C;  2JRF A;  1LA0 A;  1BG1 A;  2BCB A;  1JC2 A;  3TDZ A;  3SG7 A;  5KTY A;  3JTD B;  3SJS A;  1DJH A;  2JWW A;  4IJ7 A;  4P2Y B;  1H8B A;  3SG2 A;  2L5X B;  1CFF A;  3NSK A;  1TOP A;  4NQG A;  1ZUZ A;  4ORB B;  2Y4Q A;  2SCP A;  1RTP 1;  1EL4 A;  4MSP A;  3BYA A;  1ORG A;  5HYD A;  2CTN A;  2LLS A;  2PYQ A;  3CAB A;  1S1E A;  2LMT A;  3GOF A;  4PE7 A;  1QLS A;  1EXR A;  2K7B A;  2YGU A;  2BKI B;  1T14 A;  3TDI A;  2ZN9 A;  3SG3 A;  2KQ6 A;  2G9B A;  4GGF A;  1PVA A;  1B7T Y;  3FE9 A;  2O5G A;  1F4O A;  1XK4 A;  3JTD C;  3VB1 A;  3PSR A;  3FIA A;  2EC6 B;  1MHO A;  1RJV A;  3JVT C;  1Y1X A;  1JUO A;  3BUW B;  3EG5 B;  1MQ1 A;  1CLL A;  4MVF A;  2F3Z A;  4AQI A;  1IQ3 A;  4GAO A;  1J1E A;  2M49 B;  3GK1 A;  3RLZ A;  1KSO A;  1KWO B;  1W9Z A;  4N5X A;  2I18 A;  2KBM A;  3DD4 A;  5AEQ A;  3LL8 B;  4MBE A;  1MF8 B;  3UO9 A;  4DUQ A;  5ER5 A;  1LXF C;  1CTR A;  2KFF A;  5HL1 A;  1IIO A;  1M39 A;  2NXQ A;  1PVB A;  1YVL A;  3GK4 X;  3TUY B;  2K61 A;  1D1O A;  2HPS A;  5TNC A;  2M97 A;  2QPT A;  1TNQ A;  4INW A;  3PLF B;  4USL A;  4WQ3 A;  1NX2 A;  3AKB A;  2Y1M A;  2F8P A;  2HET A;  3I5I B;  2TN4 A;  1NP8 A;  5HKZ A;  1CFP A;  1NSH A;  1MR8 A;  2K7D A;  1B47 A;  3DVJ A;  2PVB A;  3SS4 A;  2OS8 B;  3BUN B;  3CR2 A;  1UUS A;  1KK7 Y;  2K60 A;  1K95 A;  4C0L A;  2QEH A;  4MZJ A;  1A03 A;  1BR1 B;  1B1G A;  1DQE A;  3AAJ A;  4INX A;  1DJI A;  3EK7 A;  3S0B A;  2WCB A;  4A4C A;  2BCX A;  1DJY A;  2JQ6 A;  2PMY A;  4WRI A;  3VRR A;  4M2Q A;  1G8I A;  5CPV A;  5I2O A;  4PCW A;  5F6T A;  2H61 C;  2JNX A;  1EH2 A;  2WCM A;  3I5I C;  1ALV A;  3OX5 A;  1B8C A;  1JF0 A;  1PK0 D;  3EKH A;  4OR9 B;  4MLW A;  1ZAC A;  4F0Z B;  2RGI A;  2KI6 C;  2KQY A;  1BR4 B;  3BJH A;  1TNP A;  2KYC A;  4YI8 A;  2H61 A;  1SKT A;  2I7A A;  2WCJ A;  2B1U A;  1NYA A;  2NCO A;  5JJG A;  4GFT A;  2K2A A;  3D76 A;  1S6C A;  1WRK A;  4XJK B;  2WCK A;  4OKH A;  4YI9 A;  1K8U A;  2WOS A;  1S36 A;  3PJI A;  1SY9 A; 
#chains in the Genus database with same CATH homology
 3CLN A;  5JOL A;  3ZNI A;  1RK9 A;  1NPQ A;  2L4H A;  1U5I B;  4AOM A;  1QX2 A;  1S5G Z;  4MRX A;  3IF7 A;  1FBV A;  3WHT B;  1FI6 A;  2OPO A;  4PDZ A;  3WNX B;  1NCY A;  5KSZ A;  2VRG A;  3SG4 A;  5CSF A;  2KFG A;  1K9U A;  2K2F A;  4U8D A;  1IJ5 A;  4YBH B;  2LP2 A;  1J7O A;  2K0J A;  1QAS A;  3CGA A;  1BF5 A;  2BBM A;  3FWC A;  1TTX A;  1SBJ A;  1L7Z A;  1LA3 A;  1OZO A;  1PSR A;  1XFW O;  1B8R A;  2KAY A;  2P6B B;  2Q91 A;  2WND A;  1N0Y A;  3LK1 A;  1NX0 A;  1IH0 A;  4CLN A;  5DKN A;  1KSM A;  3NSL A;  1KFU S;  1M63 B;  2MBX A;  3KEV A;  3O6B A;  1WLZ A;  1M31 A;  2D8N A;  1FI5 A;  3FS7 A;  3OX6 A;  4XJK A;  1UWO A;  1OMD A;  1OE9 B;  2F33 A;  2KBI A;  1X02 A;  3KO0 A;  1CFC A;  1AJ5 A;  3JVT B;  4OCI A;  1S26 D;  4M2P A;  1U5I A;  1WLM A;  4CFQ A;  1KCY A;  1J1D A;  1K9K A;  2BEC A;  2HQW A;  3VGO A;  3KPX A;  2M0R A;  4PE0 A;  3ZWH A;  1DMO A;  1K2H A;  2COL B;  1CLM A;  1WY9 A;  1SK6 D;  2CT9 A;  2ZNE A;  1SL8 A;  4R1E A;  1F8H A;  2A4J A;  2H2K A;  2JU0 A;  1W7J B;  1EG3 A;  2M3W A;  3PAL A;  1J7Q A;  2HQ8 A;  1TIZ A;  1YRU B;  3DVE A;  1GJY A;  1G33 A;  2Y5I A;  3VRN A;  1CB1 A;  1NX1 A;  2M8U A;  2MJW B;  2LNK A;  1XFZ O;  2LP3 A;  1TCF A;  2O60 A;  4WQ2 A;  4BY5 A;  3PM8 A;  1M45 A;  4HRG A;  2LLT A;  5GQQ C;  1MWN A;  5G08 A;  2M7L A;  1CMG A;  2M9G A;  2KFH A;  1DJW A;  2L0P A;  1CM1 A;  1VRK A;  2I94 A;  2L51 A;  3CWG A;  1F54 A;  2NLN A;  1PUL A;  1L2O B;  5AAN A;  1QV0 A;  3VRQ A;  1J7P A;  3PFV A;  2ZRS A;  4PE4 A;  1QIV A;  1M46 A;  2GV5 A;  1OMR A;  1NIW A;  2JNF A;  1BU3 A;  1KFX S;  1F70 A;  2JUL A;  1QX5 B;  1KQM B;  1IRJ A;  5HKY A;  2LVJ A;  4I5L B;  2JTT A;  2LAN A;  2JZI A;  1LIN A;  2KAX A;  1MXE A;  3PAT A;  1TCO B;  1UHH A;  1TNW A;  2I2R E;  1BT6 A;  2E30 A;  3BUM B;  1PSB A;  4ZCU A;  1JWD A;  1UUR A;  2LC5 A;  3MSE B;  1B8L A;  2BE6 A;  2F2O A;  2PRU A;  1QXP A;  1RRO A;  2LM5 A;  3GK2 A;  4GPL B;  1ZMZ A;  1L2O C;  1OQP A;  4PHJ A;  1UHK A;  1SR6 B;  2MHH A;  3DVM A;  3IQQ A;  2LLU A;  5DKR A;  1Y6W A;  4NDC A;  3EK4 A;  1MXL C;  4I5N B;  4DCK A;  5BPJ A;  1NWD A;  1DJZ A;  3PN7 C;  5KU1 A;  1Y1U A;  1KQM C;  5HKW A;  1QLK A;  2KNE A;  4P5O E;  1CMF A;  1EJ3 A;  2M1K B;  5ER4 X;  1QJT A;  3OP0 A;  1CNP A;  1K9P A;  2NCP A;  1K90 D;  1RWY A;  2KGB C;  1HT9 A;  1DJX A;  5D69 A;  4GBA A;  4FQO A;  3AAK A;  1C7V A;  3BUX B;  3WXA A;  4AQJ A;  5IBW A;  1GGZ A;  1R2U A;  4GNK B;  2EGD A;  3SIA A;  3KHE A;  5AER A;  1AVS A;  1W7I B;  4QJ4 B;  1WDC B;  1ODB A;  2JC2 A;  4L9M A;  1NX3 A;  2KHN A;  1GGW A;  1HQV A;  1SR6 C;  1UHN A;  1OOJ A;  3HX4 A;  5J3X A;  3SIB A;  4I5J A;  3CZT X;  1MUX A;  2KOT A;  3BOW B;  4XYN A;  3D0Y B;  1AHR A;  1A75 B;  2ZN8 A;  1BLQ A;  4YGC B;  2AAO A;  1SL7 A;  3ICB A;  4ICB A;  1KK8 C;  2ZRT A;  4MRY A;  1R6P A;  2BE4 A;  5B8I B;  4IL1 A;  1AK8 A;  3FWB A;  3O2P A;  1N2D A;  4PHN A;  1FF1 A;  2CCM A;  3VRO A;  1DGV A;  1S5G Y;  1IQ5 A;  1JFK A;  2OTG C;  1IGV A;  3EVV A;  4ZCV A;  1JFJ A;  2R2I A;  2CXJ A;  1QV1 A;  1WDC C;  1XFX O;  4C0K A;  1QVI Z;  1YUS A;  4CID A;  2WCE A;  2DOQ A;  1SMG A;  1UP5 A;  1S6J A;  1XO5 A;  1C7W A;  2F3Y A;  3O4Y A;  3O78 A;  4I5K A;  2NZ0 A;  1A29 A;  2JT3 A;  4JQ0 D;  2KGR A;  1NCX A;  2KI4 C;  1A4P A;  4QJ5 B;  5I8N A;  2L50 A;  3IQO A;  2G2B A;  2ZKM X;  4NDD A;  3BXK A;  4MZK A;  4PHM A;  2MA2 A;  1PAL A;  2JXC A;  1Q80 A;  3AKA A;  3VRP A;  3LCP C;  2FCE A;  1ZOT B;  3I5H C;  1YR5 A;  4HSZ A;  4ORC B;  2F2P A;  4ORA B;  1OMV A;  3BOW A;  1AUI B;  1K93 D;  1XVJ A;  3D0Y A;  3EVU A;  1A75 A;  2E6W A;  3C1V A;  2BBN A;  4GUK A;  1TN4 A;  3I5F B;  1SRA A;  1BJF A;  4QJ3 B;  4HRE E;  1G4Y R;  2FOT A;  1UHJ A;  3HCM A;  4DS7 A;  1SCM C;  2QAC A;  3E3R A;  1DJG A;  1LVC D;  5CSI A;  1XFV O;  1S3P A;  2Q4U A;  2LVI A;  4N1G A;  1JBA A;  1KQV A;  1CFD A;  1EG4 A;  2LE9 B;  1XFU O;  1WRL A;  1CLB A;  4OVN F;  3LK0 A;  4MEW A;  5HLO A;  4DRW A;  1OZS A;  1FPW A;  1A2X A;  2JT0 A;  1YUR A;  4GGF C;  2LCP A;  1YRT B;  2KAV A;  4HRH A;  3A4U B;  3I5F C;  1QTX A;  2MRD A;  1XK4 C;  2M1U A;  3M0W A;  2Y1N A;  3NSI A;  4YRU A;  1B7T Z;  5PAL A;  1NUB A;  2BL0 C;  1XYD A;  2FCD A;  2K7O A;  2LVK A;  1IKU A;  3EKJ A;  3KF9 A;  1SCV A;  2L4I A;  1F71 A;  1OSA A;  2GGZ A;  2WCF A;  1Y1A A;  3BUO B;  2PSR A;  2LUX A;  1JF2 A;  1UHI A;  2LHI A;  5K89 A;  3EK8 A;  4JWQ A;  4M2O A;  3PN7 B;  1BMO A;  4Q04 A;  1YX8 A;  2HF5 A;  2LVV A;  2M7N A;  1XFY O;  3DF0 B;  3SG5 A;  4UPG A;  3CR5 X;  2WOR A;  1QX7 A;  2LHL A;  4OV2 A;  1JSA A;  2LV7 A;  1SYM A;  1BOD A;  2IS9 A;  1J7R A;  2AUC A;  5D7F A;  4D1E A;  1REC A;  3WHU B;  1XA5 A;  3BQ3 A;  1YUT A;  1S6I A;  4C0J A;  2ZND A;  1GQM A;  1YVH A;  3I5G B;  5CSJ A;  3TZ1 A;  1J55 A;  1KFU L;  1SW8 A;  2PAL A;  1KK7 Z;  2EC6 C;  3H4S E;  2PAS A;  3QRX A;  3TS5 B;  1IWQ A;  4E68 A;  1ZFS A;  1DGU A;  3OB1 B;  2KYF A;  2JT8 A;  2MLF C;  1KWO C;  1K96 A;  1KK8 B;  1CKK A;  1LKJ A;  1V1G A;  4MN0 A;  2LUC A;  4CFR A;  1FW4 A;  1SPY A;  1ALW A;  1QIW A;  2FJU B;  2OTG B;  3CS1 A;  1B9A A;  2LAP A;  2MAZ A;  3TDU A;  3DF0 A;  2JPT A;  3TUY C;  3I5G C;  2AMI A;  3EVR A;  4CPV A;  1DF0 B;  4YGD B;  2K8M B;  3DVK A;  3CTN A;  4YGE B;  2JOJ A;  1YUU A;  1N65 A;  3CR4 X;  1IJ6 A;  4TNC A;  1QAT A;  2KI4 B;  2L98 A;  4N1F A;  4YGA A;  3K21 A;  3TS5 C;  4DIR A;  1E8A A;  2JXL A;  1SNL A;  1TRF A;  2OS8 C;  1CDL A;  1TNX A;  1CDP A;  2GGM A;  4PAL A;  5AFP A;  4JPZ B;  1DT7 B;  1V1F A;  1H4B A;  5I2L A;  2CBL A;  3I5H B;  1IG5 A;  3D10 A;  4NDB A;  5FYX A;  4MZL A;  3OHM B;  1RFJ A;  2KDH A;  1PRW A;  1F4Q A;  5DKQ A;  2KI6 D;  1BOC A;  4A4B A;  2BCA A;  5CSN A;  3RM1 A;  1SCM B;  2L2E A;  2KSP A;  1AJ4 A;  1SL9 A;  3NSO A;  1QVI Y;  2CNP A;  1YX7 A;  1NCZ A;  4YGB B;  2ZFD A;  2ISD A;  4ETO A;  1KFX L;  5I2Q A;  1DF0 A;  1C07 A;  3LLE A;  1DVI A;  3NXA A;  1CDN A;  1CM4 A;  2EHB A;  1B4C A;  5HLV A;  2BKH B;  3A8R A;  2M29 A;  3OB2 B;  2K7C A;  1QS7 A;  2V53 A;  1DTL A;  4PHK A;  2SAS A;  1AP4 A;  4FTG A;  4PE1 A;  2BL0 B;  3F45 A;  2JTZ A;  1YTZ C;  1CDM A;  2LMV A;  1WRZ A;  2LMU A;  5AXI A;  1F55 A;  4GGN A;  3SG6 A;  2WC8 A;  1K94 A;  1Y0V H;  4BY4 A;  2MLE C;  2JRF A;  1LA0 A;  1BG1 A;  2BCB A;  1JC2 A;  3TDZ A;  3SG7 A;  5KTY A;  3JTD B;  3SJS A;  1DJH A;  2JWW A;  4P2Y B;  1H8B A;  3SG2 A;  2L5X B;  1CFF A;  3NSK A;  1TOP A;  4NQG A;  1ZUZ A;  4ORB B;  2Y4Q A;  2SCP A;  1RTP 1;  1EL4 A;  4MSP A;  3BYA A;  5HYD A;  2CTN A;  2LLS A;  1S1E A;  2LMT A;  3GOF A;  4PE7 A;  1QLS A;  1EXR A;  2K7B A;  2BKI B;  3TDI A;  2ZN9 A;  3SG3 A;  2KQ6 A;  2G9B A;  4GGF A;  1PVA A;  1B7T Y;  2O5G A;  1F4O A;  1XK4 A;  3JTD C;  3PSR A;  3FIA A;  2EC6 B;  1MHO A;  1RJV A;  3JVT C;  1Y1X A;  1JUO A;  3BUW B;  1MQ1 A;  1CLL A;  4MVF A;  2F3Z A;  4AQI A;  1IQ3 A;  4GAO A;  1J1E A;  2M49 B;  3GK1 A;  3RLZ A;  1KSO A;  1KWO B;  4N5X A;  2I18 A;  2KBM A;  3DD4 A;  5AEQ A;  3LL8 B;  4MBE A;  1MF8 B;  4DUQ A;  5ER5 A;  1LXF C;  1CTR A;  2KFF A;  1M39 A;  2NXQ A;  1PVB A;  1YVL A;  3GK4 X;  3TUY B;  2K61 A;  1D1O A;  2HPS A;  5TNC A;  2M97 A;  2QPT A;  1TNQ A;  3PLF B;  4USL A;  4WQ3 A;  1NX2 A;  3AKB A;  2Y1M A;  2F8P A;  2HET A;  3I5I B;  2TN4 A;  1NP8 A;  5HKZ A;  1CFP A;  1NSH A;  1MR8 A;  2K7D A;  1B47 A;  3DVJ A;  2PVB A;  2OS8 B;  3BUN B;  3CR2 A;  1UUS A;  1KK7 Y;  1K95 A;  4C0L A;  4MZJ A;  1A03 A;  1BR1 B;  1B1G A;  3AAJ A;  1DJI A;  3EK7 A;  2WCB A;  4A4C A;  2BCX A;  1DJY A;  2JQ6 A;  2PMY A;  4WRI A;  3VRR A;  4M2Q A;  1G8I A;  5CPV A;  5I2O A;  4PCW A;  5F6T A;  2H61 C;  2JNX A;  1EH2 A;  3I5I C;  1ALV A;  3OX5 A;  1B8C A;  1JF0 A;  1PK0 D;  3EKH A;  4OR9 B;  4MLW A;  1ZAC A;  4F0Z B;  2RGI A;  2KI6 C;  2KQY A;  1BR4 B;  1TNP A;  2KYC A;  4YI8 A;  2H61 A;  1SKT A;  2I7A A;  2B1U A;  1NYA A;  2NCO A;  5JJG A;  4GFT A;  2K2A A;  1S6C A;  1WRK A;  4XJK B;  4OKH A;  4YI9 A;  1K8U A;  2WOS A;  1S36 A;  1SY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...