3DVMA

Crystal structure of ca2+/cam-cav2.1 iq domain complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
140
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 46
structure length 140
sequence length 143
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dvmA00
5K89A 3M0WA 5CSJA 2WNDA 1YX8A 3DF0B 3BUWB 1G4YR 1WLMA 4NQGA 3EK7A 1BODA 2JC2A 2H61A 2AAOA 1YX7A 2BL0C 2K7CA 3WHTB 1DF0A 1JFJA 2F3YA 1V1FA 1TCFA 3EKJA 2ZKMX 3NXAA 2L50A 1B8LA 4CPVA 2NLNA 1SMGA 1SW8A 3I5FC 3LK1A 4JQ0D 1IGVA 2M1KB 3PLFB 1KFUL 5I8NA 2L2EA 2JXCA 1KSOA 2KFHA 1CKKA 4CLNA 1GJYA 1WRKA 4CFQA 1KFUS 5HKZA 1CMFA 1WLZA 3DVJA 1IQ3A 3SG3A 1EG4A 1EL4A 2IS9A 1SPYA 1KK8B 4FTGA 4MZJA 1IH0A 1TN4A 5DKNA 2ZN8A 1TNXA 2AUCA 1CLBA 2Y1MA 3QRXA 4BY4A 3OHMB 4DS7A 4DRWA 3PN7B 3KHEA 1SCMC 3O4YA 1IRJA 1YURA 1AK8A 1KQVA 1UHHA 3GK4X 5JJGA 4NDCA 1NYAA 3WXAA 1B4CA 1B7TZ 1K8UA 1IQ5A 3D10A 2OTGB 5HLVA 1KWOC 2PALA 1TNWA 1DJZA 1SR6B 2F33A 1PSRA 1OQPA 3CS1A 1LA0A 3I5GC 2FCDA 2KI4B 4L9MA 2OS8B 1YTZC 1CB1A 3CWGA 4PHKA 2KBMA 3JVTB 1MHOA 1QVIY 2HQ8A 4USLA 1PVAA 2I18A 4MVFA 4WQ3A 1HQVA 1DJYA 2F2PA 4A4BA 4HSZA 1CDMA 2JNXA 2LHLA 2BECA 1PK0D 3WHUB 2LLTA 1K96A 1C7VA 2MHHA 1Y1UA 2K61A 2FOTA 1Y6WA 2QACA 4YGCB 4PE4A 2PMYA 1MQ1A 1ZUZA 1F54A 2JNFA 1MUXA 2G2BA 4WQ2A 1XFVO 2PRUA 1IJ6A 1CM4A 1XFXO 1QLKA 1RJVA 1TNPA 1S1EA 4ORAB 5B8IB 1YUTA 1BR1B 2MLFC 2I7AA 4GFTA 1ZMZA 3BQ3A 3TDZA 5AERA 2JT8A 3EKHA 3I5IB 1KQMC 5GQQC 1R6PA 4MRYA 1RWYA 3HX4A 5KSZA 2R2IA 1ALWA 2LMTA 1LA3A 4GNKB 5PALA 4BY5A 1UP5A 1NWDA 4D1EA 5DKRA 1J7QA 3OX6A 3PALA 5I2LA 1CMGA 3I5HB 1S26D 1BMOA 1XO5A 1JF2A 1R2UA 1K94A 2KNEA 1FI6A 2KAYA 3HCMA 1QXPA 2LVIA 3AKAA 1JSAA 2KFFA 1K90D 3CR4X 4WRIA 1DJHA 1TIZA 3E3RA 1NCZA 1XK4A 1L2OB 1LKJA 1PVBA 1MR8A 1WDCB 2BCAA 3D0YB 3SJSA 2KQYA 3TDIA 5AXIA 1CDPA 1D1OA 1E8AA 2LLSA 4MRXA 5I2OA 2M9GA 3FWCA 2KYFA 2GV5A 1CDNA 1PALA 4HRGA 5HYDA 5F6TA 3BUNB 2Y4QA 1WRLA 2P6BB 4IL1A 3GK2A 5CPVA 4C0KA 1KCYA 1F4QA 2K8MB 4YBHB 3AKBA 4YGEB 1EJ3A 1S5GY 2K2AA 2WC8A 3F45A 4PCWA 4ZCUA 3KF9A 3VGOA 2PSRA 1UHNA 5D7FA 1DGVA 1ALVA 3DF0A 3DVMA 4PE7A 1FW4A 2L98A 3BUOB 1ZOTB 4MSPA 5J3XA 1OMVA 1J7RA 3LCPC 2NCOA 4XYNA 2NCPA 4QJ4B 4I5JA 3BXKA 2ZRTA 2KFGA 1UHKA 4ZCVA 5HKYA 4PALA 3VRNA 1F70A 1J1DA 2LANA 4TNCA 2LP2A 1FBVA 1QLSA 2BL0B 5AANA 1B8CA 1F4OA 1Y0VH 4GGFA 2SASA 1W7JB 1N0YA 2ZNEA 4PDZA 2JOJA 1PULA 4NDDA 2M97A 2ZRSA 1J7OA 1OZSA 4PHJA 4UPGA 1J7PA 2FJUB 2BCXA 4PHMA 2E30A 2L5XB 4NDBA 2LC5A 1DJIA 3CR5X 1IG5A 1YRUB 1TNQA 2MLEC 1BT6A 1KK8C 1H8BA 1JWDA 2COLB 1B8RA 2G9BA 3BYAA 3ZWHA 2LAPA 3BOWB 2EC6B 1EH2A 2B1UA 1UHIA 3BOWA 1QV1A 3EK8A 3PN7C 1SCMB 1TCOB 5D69A 4N5XA 3TUYB 1EXRA 1CM1A 1QASA 4N1FA 4MZLA 1QVIZ 3KO0A 1JF0A 3O78A 3RM1A 1N65A 3NSKA 1RFJA 3PM8A 1KWOB 1J55A 2JT0A 3CZTX 3DVEA 3GOFA 2HETA 2K7OA 2CCMA 1TOPA 2KAVA 3I5GB 1BLQA 1S6CA 1ZACA 2KI4C 4C0JA 2M7LA 2OS8C 1CFFA 2LCPA 1KK7Z 4CIDA 1NSHA 1DJXA 3JVTC 4Q04A 1AVSA 1B7TY 1QX5B 2L4HA 1QX2A 4FQOA 4M2PA 1DMOA 3K21A 2LHIA 1N2DA 4PE1A 3RLZA 2KQ6A 5ER4X 2LP3A 3OB2B 1MF8B 4PE0A 2BKHB 4YGBB 5G08A 2JTZA 1OOJA 2EGDA 3EK4A 5CSNA 1BG1A 4OVNF 5DKQA 3ZNIA 2F8PA 1NP8A 2QPTA 1J1EA 1QIVA 1S36A 3EVVA 5JOLA 1F55A 5AFPA 1SL8A 3OP0A 3VRRA 1K95A 2EHBA 1U5IB 2KAXA 1DJGA 1ZFSA 4DIRA 4ETOA 4ORCB 2M1UA 1A75B 1M31A 2MJWB 4MEWA 3TDUA 1UWOA 2WCBA 1FF1A 3WNXB 2LVVA 3C1VA 2CTNA 2M7NA 4XJKB 2Y5IA 3I5IC 3FWBA 3DD4A 4DUQA 1F71A 1XFZO 1BF5A 4A4CA 1B9AA 4HREE 1M46A 3PFVA 1NX1A 2K0JA 1OMRA 1K9PA 2BE6A 3VROA 3OB1B 2BBMA 3OX5A 1CTRA 5KU1A 1NX0A 3VRPA 3I5HC 1XA5A 1DT7B 1CNPA 2VRGA 1NCXA 2KYCA 4F0ZB 1A29A 3D0YA 4YGAA 2KGRA 4GUKA 1BR4B 1CLLA 3IQOA 1XK4C 2KGBC 1XFWO 2LMUA 1NX3A 4MBEA 2JPTA 1AJ5A 3IF7A 4CFRA 2JRFA 4E68A 3JTDB 1K2HA 1WDCC 1QIWA 2DOQA 2LV7A 1CFCA 1HT9A 1NX2A 2ZFDA 3O6BA 2MA2A 3CTNA 2D8NA 1AP4A 1SNLA 3LLEA 3CLNA 3TS5B 5IBWA 2RGIA 4ICBA 2JTTA 2KDHA 4I5KA 1KSMA 1SL7A 4U8DA 2O60A 1ODBA 2I2RE 2M3WA 2E6WA 1SYMA 1RROA 4N1GA 3SG2A 2L4IA 1GQMA 2O5GA 1QS7A 3KEVA 4DCKA 1YUUA 1SY9A 1A2XA 2L0PA 2H61C 4P5OE 1M45A 1SBJA 3SG5A 1NUBA 3MSEB 2A4JA 2WCEA 4MN0A 1DVIA 2KHNA 1MXLC 1KFXL 2F2OA 2LUXA 3GK1A 4AOMA 1JUOA 2KSPA 1UURA 2NZ0A 2PASA 1KFXS 2GGMA 1DF0B 3I5FB 1K9UA 2ZN9A 5I2QA 4GGFC 4OCIA 1AUIB 1OMDA 4JWQA 3LK0A 1QV0A 1A4PA 2KI6D 1QTXA 4GAOA 2K7BA 1CLMA 1DJWA 3EVUA 3NSIA 1LXFC 1G8IA 4GPLB 2LUCA 1IJ5A 3A4UB 2PVBA 4QJ3B 3AAKA 1XVJA 1SKTA 4M2OA 4JPZB 1UHJA 1X02A 1RECA 1SCVA 1XFYO 5CSFA 1CFDA 3FIAA 2JQ6A 1FI5A 5HKWA 4MZKA 4GGNA 1EG3A 1SK6D 3TZ1A 2JU0A 1B47A 1SL9A 3SIBA 1M63B 2EC6C 2OTGC 3ICBA 2K7DA 2WCFA 1IWQA 1K9KA 4HRHA 2CBLA 1SR6C 2LVJA 1BJFA 2LVKA 3KPXA 1Q80A 2Q91A 2M29A 3TUYC 1NIWA 1RK9A 2CNPA 2KOTA 4P2YB 3O2PA 1AJ4A 1TRFA 2BCBA 5HLOA 1B1GA 1FPWA 4AQIA 2LMVA 3SG6A 3EVRA 4C0LA 2M8UA 2NXQA 1UUSA 1TTXA 2M0RA 1PRWA 2V53A 2KBIA 1DGUA 2OPOA 5TNCA 1QJTA 2MAZA 2K2FA 3IQQA 1OSAA 4PHNA 2LM5A 1L7ZA 2TN4A 3FS7A 1YUSA 2BBNA 1XFUO 4YI9A 1JBAA 2JXLA 2BKIB 1CDLA 4QJ5B 2JT3A 1GGZA 2WORA 2M49B 3PATA 4R1EA 3CGAA 3PSRA 1V1GA 1JC2A 4MLWA 1KK7Y 1U5IA 1OZOA 2H2KA 2LLUA 4ORBB 2ISDA 2CXJA 1A75A 2Q4UA 1MWNA 1QX7A 1S6IA 1VRKA 1KQMB 3VRQA 4YRUA 2WOSA 4XJKA 1NCYA 3DVKA 2ZNDA 1PSBA 2CT9A 1NPQA 1M39A 2HF5A 2JZIA 1F8HA 2SCPA 1Y1AA 4I5LB 1H4BA 1C7WA 3BUXB 4AQJA 1W7IB 1YVHA 2Y1NA 2LNKA 4I5NB 3CR2A 1GGWA 2BE4A 1LVCD 2JWWA 1YRTB 1A03A 1IKUA 1K93D 1YR5A 1CFPA 5ER5A 1AHRA 1C07A 3SG4A 1G33A 1L2OC 3BUMB 1DTLA 1OE9B 1S5GZ 1BOCA 2LE9B 3AAJA 3NSOA 2AMIA 1WRZA 2L51A 3SIAA 3A8RA 5KTYA 1RTP1 1YVLA 4OR9B 5BPJA 3NSLA 3SG7A 3JTDC 1QATA 2HPSA 1S3PA 4YGDB 1BU3A 2F3ZA 3H4SE 4OKHA 1MXEA 1SRAA 2HQWA 2JULA 2KI6C 4M2QA 2GGZA 4GBAA 1Y1XA 1LINA 2I94A 4YI8A 5CSIA 2FCEA 3TS5C 1S6JA 2MBXA 1JFKA 4OV2A 2MRDA 1XYDA 3LL8B 5AEQA 5FYXA 1WY9A
chains in the Genus database with same CATH superfamily
5K89A 3M0WA 5CSJA 2WNDA 1YX8A 1Z4HA 3PM2A 3DF0B 3BUWB 1G4YR 1WLMA 4NQGA 3EK7A 4PT1A 1BODA 2JC2A 2H61A 2AAOA 1YX7A 2BL0C 2K7CA 3WHTB 1DF0A 1JFJA 2F3YA 1V1FA 2QEOA 1TCFA 3EKJA 2ZKMX 3NXAA 2L50A 1B8LA 4CPVA 3S0EA 2PQLA 2NLNA 1SMGA 1SW8A 3I5FC 3LK1A 4JQ0D 1IGVA 2M1KB 3PLFB 1KFUL 5I8NA 2L2EA 2JXCA 1KSOA 2KFHA 1CKKA 4CLNA 1GJYA 1WRKA 4CFQA 3NHIA 1KFUS 5HKZA 1CMFA 3D78A 3S0AA 1WLZA 3DVJA 1IQ3A 3O4XA 3SG3A 1EG4A 1EL4A 2IS9A 1SPYA 1KK8B 3CZ0A 4FTGA 3NGVA 4MZJA 1IH0A 1TN4A 5DKNA 2ZN8A 1TNXA 2AUCA 1CLBA 2Y1MA 2FJYA 3QRXA 4BY4A 3OHMB 4DS7A 1DELA 5DICA 4DRWA 3PJIA 3PN7B 3KHEA 1SCMC 3O4YA 1IRJA 1YURA 1AK8A 1KQVA 1UHHA 3GK4X 3OBVA 5JJGA 4NDCA 1NYAA 3WXAA 1B4CA 1B7TZ 1K8UA 1IQ5A 3D10A 2OTGB 5EL2A 3R1PA 5HLVA 1KWOC 2PALA 1TNWA 3B87A 1DJZA 1SR6B 2F33A 1PSRA 3D73A 1OQPA 3B88A 3CS1A 1LA0A 3I5GC 3N7HA 2FCDA 3BJHA 2KI4B 4L9MA 2OS8B 1YTZC 1CB1A 3CWGA 4PHKA 2KBMA 3JVTB 1MHOA 1QVIY 2HQ8A 4USLA 1PVAA 2GTEA 2I18A 4MVFA 4WQ3A 1HQVA 1DJYA 2F2PA 4A4BA 4HSZA 1CDMA 2JNXA 2LHLA 4FQTA 4KYNA 2BECA 1PK0D 3WHUB 2LLTA 1K96A 1C7VA 2MHHA 1Y1UA 2K61A 2FOTA 1Y6WA 2QACA 4YGCB 4PE4A 2PMYA 1MQ1A 1ZUZA 1F54A 2JNFA 1MUXA 2G2BA 4WQ2A 1XFVO 2PRUA 1IJ6A 1CM4A 1XFXO 1QLKA 1Z2CB 1RJVA 1TNPA 1S1EA 4ORAB 5B8IB 1YUTA 1BR1B 2MLFC 2I7AA 4GFTA 1ZMZA 3BQ3A 3TDZA 5AERA 2JT8A 3EKHA 3I5IB 1KQMC 5GQQC 1R6PA 4MRYA 1RWYA 3HX4A 5KSZA 3L4AA 2R2IA 1ALWA 2LMTA 1LA3A 4GNKB 5PALA 3S0BA 1UP5A 1NWDA 4BY5A 4D1EA 2QEHA 5DKRA 1J7QA 3OX6A 3PALA 5I2LA 1CMGA 3I5HB 1S26D 1BMOA 1XO5A 1JF2A 1R2UA 1K94A 2KNEA 1FI6A 2KAYA 3HCMA 1QXPA 2LVIA 3AKAA 1JSAA 2KFFA 1K90D 3CR4X 4WRIA 1DJHA 1TIZA 3E3RA 1NCZA 1XK4A 1L2OB 1LKJA 1PVBA 1MR8A 1QWVA 1WDCB 2BCAA 3D0YB 3SJSA 2KQYA 3TDIA 5AXIA 1CDPA 1D1OA 1E8AA 2LLSA 1W9ZA 4MRXA 5I2OA 2M9GA 3FWCA 2KYFA 2GV5A 1CDNA 1PALA 3L47A 4HRGA 5HYDA 5F6TA 3VB1A 3BUNB 2Y4QA 3R1OA 1WRLA 2P6BB 3DYEA 3GK2A 4IL1A 5CPVA 1OOHA 3R1VA 4C0KA 1KCYA 1F4QA 2K8MB 4YBHB 3AKBA 3QMEA 4YGEB 1EJ3A 1S5GY 2K2AA 2WC8A 3F45A 4PCWA 3CZ1A 4ZCUA 5I94A 3KF9A 3VGOA 3SS4A 2PSRA 1UHNA 5D7FA 1DGVA 1ALVA 3DF0A 3OGNA 3DVMA 2PYQA 4PE7A 1FW4A 2L98A 3BUOB 1ZOTB 4MSPA 5J3XA 3RZSA 1OMVA 1J7RA 3LCPC 2NCOA 4XYNA 2NCPA 4QJ4B 4I5JA 3BXKA 2ZRTA 2KFGA 1UHKA 5FI6A 4ZCVA 5HKYA 4JKTA 4PALA 3VRNA 1F70A 1J1DA 2LANA 4TNCA 2LP2A 1LS8A 1FBVA 1QLSA 2BL0B 5AANA 1B8CA 1F4OA 1Y0VH 4GGFA 2SASA 2JPOA 1W7JB 1N0YA 2ZNEA 4PDZA 2JOJA 2K60A 1PULA 4NDDA 2M97A 2ZRSA 1J7OA 1OZSA 4PHJA 4UPGA 1J7PA 2FJUB 2BCXA 4PHMA 3S0GA 2E30A 2L5XB 4NDBA 2LC5A 1DJIA 1OOIX 1IG5A 3CR5X 1YRUB 1TNQA 2MLEC 1DQEA 1BT6A 1KK8C 1H8BA 1JWDA 2COLB 1B8RA 1P28A 4INXA 2G9BA 3BYAA 3NHTA 3ZWHA 2LAPA 3BOWB 2QEVA 2EC6B 1EH2A 2B1UA 1UHIA 2WCHA 1QV1A 2QEBA 3BOWA 1SCMB 3EK8A 3PN7C 1TCOB 5D69A 4N5XA 3TUYB 1EXRA 1CM1A 1QASA 4N1FA 4MZLA 1QVIZ 3KO0A 1JF0A 3O78A 3RM1A 1N65A 3NSKA 1RFJA 3PM8A 1KWOB 1J55A 3UO9A 2JT0A 3BFAA 3FE9A 3CZTX 3DVEA 3GOFA 2HETA 2K7OA 2CCMA 1TOPA 2KAVA 3I5GB 1BLQA 1S6CA 3V2LA 1ZACA 2KI4C 4C0JA 2M7LA 2OS8C 1CFFA 2LCPA 1KK7Z 4CIDA 1NSHA 1DJXA 3JVTC 4Q04A 3BFBA 1AVSA 1B7TY 1QX5B 2L4HA 1QX2A 4FQOA 4M2PA 1DMOA 3K21A 2LHIA 1N2DA 4PE1A 3RLZA 2KQ6A 5ER4X 2LP3A 3OB2B 1MF8B 4PE0A 2BKHB 4YGBB 5G08A 3D77A 2JTZA 1OOJA 2EGDA 3EK4A 5CSNA 1BG1A 4OVNF 5DKQA 3ZNIA 2F8PA 1NP8A 2QPTA 1J1EA 1QIVA 1S36A 3EVVA 5JOLA 1F55A 5AFPA 1SL8A 3OP0A 3VRRA 1K95A 2EHBA 1U5IB 2KAXA 1XFRA 3CYZA 1DJGA 1ZFSA 4DIRA 4ETOA 4ORCB 2M1UA 1A75B 1M31A 2MJWB 4MEWA 5FI7A 1UWOA 3TDUA 2YGUA 2WCBA 1FF1A 3WNXB 2LVVA 3C1VA 2CTNA 2M7NA 3FE8A 4XJKB 2Y5IA 3I5IC 3FWBA 3DD4A 3S0FA 2P71A 4DUQA 3L4LA 1XFZO 1F71A 1BF5A 4A4CA 1B9AA 4HREE 1M46A 3PFVA 1NX1A 2K0JA 1OMRA 4F7FA 1K9PA 2BE6A 3VROA 5HL1A 3OB1B 2BBMA 3OX5A 1CTRA 5KU1A 1NX0A 3VRPA 3I5HC 1XA5A 1DT7B 1CNPA 2VRGA 1NCXA 2KYCA 4F0ZB 1A29A 3D0YA 4YGAA 2KGRA 4GUKA 1BR4B 1CLLA 3IQOA 1XK4C 2WCKA 2KGBC 1XFWO 2LMUA 1NX3A 3DXLA 2JPTA 1AJ5A 3IF7A 4MBEA 2JRFA 4CFRA 3JTDB 1K2HA 1WDCC 1QIWA 2DOQA 2LV7A 1CFCA 1OW4A 1HT9A 1NX2A 2ZFDA 3D74A 2MA2A 3CTNA 2D8NA 3O6BA 1AP4A 1SNLA 3LLEA 4INWA 3CLNA 3CDNA 3TS5B 2RGIA 4ICBA 5IBWA 2JTTA 2KDHA 4I5KA 1KSMA 1SL7A 3DY9A 4U8DA 2O60A 3SS3A 1ODBA 2I2RE 2M3WA 3DZTA 2E6WA 1SYMA 2KLEA 1RROA 4N1GA 2BAPA 3SG2A 2L4IA 1GQMA 2O5GA 1QS7A 3KEVA 2QDIA 1YUUA 4DCKA 1SY9A 1A2XA 2L0PA 2H61C 4E68A 4P5OE 1M45A 2ERBA 1SBJA 3SG5A 1NUBA 3MSEB 2A4JA 5FI2A 2WCEA 4MN0A 3S0DA 1DVIA 2KHNA 2WCMA 1MXLC 1KFXL 2F2OA 2LUXA 3GK1A 4AOMA 1JUOA 2KSPA 3UNWA 3B6XA 1C3YA 1UURA 2NZ0A 2PASA 1KFXS 2GGMA 1DF0B 3I5FB 1K9UA 2ZN9A 5I2QA 4GGFC 1T14A 4OCIA 1AUIB 4JD9A 1OMDA 4JWQA 3LK0A 2L2CA 1QV0A 1A4PA 2KI6D 3EG5B 1QTXA 4GAOA 2K7BA 1CLMA 1DJWA 3EVUA 3NSIA 1LXFC 1G8IA 4GPLB 2LUCA 1IJ5A 3A4UB 2PVBA 4QJ3B 3AAKA 2BNXA 1XVJA 1SKTA 4M2OA 2WCLA 4JPZB 1UHJA 1X02A 1RECA 1SCVA 1XFYO 5CSFA 1CFDA 3FIAA 2JQ6A 1FI5A 5HKWA 4MZKA 4GGNA 1EG3A 1SK6D 3TZ1A 2H8VA 2JU0A 1B47A 1SL9A 3SIBA 1M63B 2EC6C 2OTGC 3ICBA 2K7DA 2WCFA 1IWQA 1K9KA 4HRHA 2CBLA 1SR6C 2LVJA 1BJFA 2LVKA 3KPXA 1Q80A 3FE6A 3R72A 2Q91A 2M29A 1IIOA 3TUYC 1NIWA 1RK9A 2CNPA 2KOTA 2WC5A 4P2YB 4IJ7A 3O2PA 1AJ4A 1TRFA 2BCBA 3IVTA 5HLOA 4OZDA 1B1GA 1FPWA 4AQIA 2LMVA 3SG6A 3EVRA 4C0LA 2M8UA 5D3OA 2NXQA 1UUSA 1TTXA 2M0RA 1PRWA 2V53A 2KBIA 1DGUA 2OPOA 5TNCA 1QJTA 2MAZA 1DC1A 2K2FA 3IQQA 1OSAA 4PHNA 2LM5A 1L7ZA 2TN4A 3FS7A 1TUZA 1YUSA 2BBNA 1XFUO 4YI9A 1JBAA 2JXLA 2BKIB 1CDLA 3D75A 4QJ5B 2JT3A 1GGZA 2WORA 2M49B 3PATA 4R1EA 3CGAA 3PSRA 3CABA 1V1GA 1JC2A 4MLWA 1KK7Y 1U5IA 1OZOA 2H2KA 2LLUA 4ORBB 2KPHA 2ISDA 2CXJA 1A75A 2Q4UA 1TUJA 3B86A 1MWNA 1QX7A 1S6IA 1VRKA 1KQMB 3VRQA 4YRUA 2WOSA 4XJKA 3D76A 1NCYA 2WC6A 3DVKA 2ZNDA 1PSBA 2CT9A 3BFHA 1NPQA 1ORGA 1M39A 2HF5A 2JZIA 1F8HA 2SCPA 1Y1AA 3Q8IA 4I5LB 1DEKA 1H4BA 1C7WA 3BUXB 4AQJA 1W7IB 1GM0A 1C3ZA 1YVHA 2Y1NA 2LNKA 4I5NB 2WCJA 3CR2A 1GGWA 2BE4A 1LVCD 2JWWA 1YRTB 2KLDA 1A03A 1K93D 1YR5A 1IKUA 1CFPA 5ER5A 1AHRA 1C07A 3SG4A 1G33A 1L2OC 3BUMB 1DTLA 1OE9B 1S5GZ 1BOCA 2LE9B 3AAJA 3NSOA 2AMIA 2L5YA 1WRZA 3SS5A 2L51A 3B7AA 2P70A 3A8RA 3CZ2A 3SIAA 1OOGA 5KTYA 1YVLA 1RTP1 4OR9B 5BPJA 1TWOA 3NSLA 3SG7A 3JTDC 1QATA 1SSEB 1S3PA 2HPSA 1BU3A 4YGDB 2F3ZA 3H4SE 4OKHA 1MXEA 1SRAA 2HQWA 2JULA 2KI6C 4M2QA 2GGZA 4GBAA 1OOFA 1Y1XA 1LINA 2I94A 4YI8A 5CSIA 2FCEA 3TS5C 1S6JA 2MBXA 1JFKA 4OV2A 2MRDA 1XYDA 3LL8B 5AEQA 5FYXA 1WY9A 3K1EA
chains in the Genus database with same CATH topology
5K89A 3M0WA 5CSJA 2WNDA 1YX8A 3DF0B 3BUWB 1G4YR 1WLMA 4NQGA 3EK7A 1BODA 2JC2A 2H61A 2AAOA 1YX7A 2BL0C 2K7CA 3WHTB 1DF0A 1JFJA 2F3YA 1V1FA 1TCFA 3EKJA 2ZKMX 3NXAA 2L50A 1B8LA 4CPVA 2NLNA 1SMGA 1SW8A 3I5FC 3LK1A 4JQ0D 1IGVA 2M1KB 3PLFB 1KFUL 5I8NA 2L2EA 2JXCA 1KSOA 2KFHA 1CKKA 4CLNA 1GJYA 1WRKA 4CFQA 1KFUS 5HKZA 1CMFA 1WLZA 3DVJA 1IQ3A 3SG3A 1EG4A 1EL4A 2IS9A 1SPYA 1KK8B 4FTGA 4MZJA 1IH0A 1TN4A 5DKNA 2ZN8A 1TNXA 2AUCA 1CLBA 2Y1MA 3QRXA 4BY4A 3OHMB 4DS7A 4DRWA 3PN7B 3KHEA 1SCMC 3O4YA 1IRJA 1YURA 1AK8A 1KQVA 1UHHA 3GK4X 5JJGA 4NDCA 1NYAA 3WXAA 1B4CA 1B7TZ 1K8UA 1IQ5A 3D10A 2OTGB 5HLVA 1KWOC 2PALA 1TNWA 1DJZA 1SR6B 2F33A 1PSRA 1OQPA 3CS1A 1LA0A 3I5GC 2FCDA 2KI4B 4L9MA 2OS8B 1YTZC 1CB1A 3CWGA 4PHKA 2KBMA 3JVTB 1MHOA 1QVIY 2HQ8A 4USLA 1PVAA 2I18A 4MVFA 4WQ3A 1HQVA 1DJYA 2F2PA 4A4BA 4HSZA 1CDMA 2JNXA 2LHLA 2BECA 1PK0D 3WHUB 2LLTA 1K96A 1C7VA 2MHHA 1Y1UA 2K61A 2FOTA 1Y6WA 2QACA 4YGCB 4PE4A 2PMYA 1MQ1A 1ZUZA 1F54A 2JNFA 1MUXA 2G2BA 4WQ2A 1XFVO 2PRUA 1IJ6A 1CM4A 1XFXO 1QLKA 1RJVA 1TNPA 1S1EA 4ORAB 5B8IB 1YUTA 1BR1B 2MLFC 2I7AA 4GFTA 1ZMZA 3BQ3A 3TDZA 5AERA 2JT8A 3EKHA 3I5IB 1KQMC 5GQQC 1R6PA 4MRYA 1RWYA 3HX4A 5KSZA 2R2IA 1ALWA 2LMTA 1LA3A 4GNKB 5PALA 4BY5A 1UP5A 1NWDA 4D1EA 5DKRA 1J7QA 3OX6A 3PALA 5I2LA 1CMGA 3I5HB 1S26D 1BMOA 1XO5A 1JF2A 1R2UA 1K94A 2KNEA 1FI6A 2KAYA 3HCMA 1QXPA 2LVIA 3AKAA 1JSAA 2KFFA 1K90D 3CR4X 4WRIA 1DJHA 1TIZA 3E3RA 1NCZA 1XK4A 1L2OB 1LKJA 1PVBA 1MR8A 1WDCB 2BCAA 3D0YB 3SJSA 2KQYA 3TDIA 5AXIA 1CDPA 1D1OA 1E8AA 2LLSA 4MRXA 5I2OA 2M9GA 3FWCA 2KYFA 2GV5A 1CDNA 1PALA 4HRGA 5HYDA 5F6TA 3BUNB 2Y4QA 1WRLA 2P6BB 4IL1A 3GK2A 5CPVA 4C0KA 1KCYA 1F4QA 2K8MB 4YBHB 3AKBA 4YGEB 1EJ3A 1S5GY 2K2AA 2WC8A 3F45A 4PCWA 4ZCUA 3KF9A 3VGOA 2PSRA 1UHNA 5D7FA 1DGVA 1ALVA 3DF0A 3DVMA 4PE7A 1FW4A 2L98A 3BUOB 1ZOTB 4MSPA 5J3XA 1OMVA 1J7RA 3LCPC 2NCOA 4XYNA 2NCPA 4QJ4B 4I5JA 3BXKA 2ZRTA 2KFGA 1UHKA 4ZCVA 5HKYA 4PALA 3VRNA 1F70A 1J1DA 2LANA 4TNCA 2LP2A 1FBVA 1QLSA 2BL0B 5AANA 1B8CA 1F4OA 1Y0VH 4GGFA 2SASA 1W7JB 1N0YA 2ZNEA 4PDZA 2JOJA 1PULA 4NDDA 2M97A 2ZRSA 1J7OA 1OZSA 4PHJA 4UPGA 1J7PA 2FJUB 2BCXA 4PHMA 2E30A 2L5XB 4NDBA 2LC5A 1DJIA 3CR5X 1IG5A 1YRUB 1TNQA 2MLEC 1BT6A 1KK8C 1H8BA 1JWDA 2COLB 1B8RA 2G9BA 3BYAA 3ZWHA 2LAPA 3BOWB 2EC6B 1EH2A 2B1UA 1UHIA 3BOWA 1QV1A 3EK8A 3PN7C 1SCMB 1TCOB 5D69A 4N5XA 3TUYB 1EXRA 1CM1A 1QASA 4N1FA 4MZLA 1QVIZ 3KO0A 1JF0A 3O78A 3RM1A 1N65A 3NSKA 1RFJA 3PM8A 1KWOB 1J55A 2JT0A 3CZTX 3DVEA 3GOFA 2HETA 2K7OA 2CCMA 1TOPA 2KAVA 3I5GB 1BLQA 1S6CA 1ZACA 2KI4C 4C0JA 2M7LA 2OS8C 1CFFA 2LCPA 1KK7Z 4CIDA 1NSHA 1DJXA 3JVTC 4Q04A 1AVSA 1B7TY 1QX5B 2L4HA 1QX2A 4FQOA 4M2PA 1DMOA 3K21A 2LHIA 1N2DA 4PE1A 3RLZA 2KQ6A 5ER4X 2LP3A 3OB2B 1MF8B 4PE0A 2BKHB 4YGBB 5G08A 2JTZA 1OOJA 2EGDA 3EK4A 5CSNA 1BG1A 4OVNF 5DKQA 3ZNIA 2F8PA 1NP8A 2QPTA 1J1EA 1QIVA 1S36A 3EVVA 5JOLA 1F55A 5AFPA 1SL8A 3OP0A 3VRRA 1K95A 2EHBA 1U5IB 2KAXA 1DJGA 1ZFSA 4DIRA 4ETOA 4ORCB 2M1UA 1A75B 1M31A 2MJWB 4MEWA 3TDUA 1UWOA 2WCBA 1FF1A 3WNXB 2LVVA 3C1VA 2CTNA 2M7NA 4XJKB 2Y5IA 3I5IC 3FWBA 3DD4A 4DUQA 1F71A 1XFZO 1BF5A 4A4CA 1B9AA 4HREE 1M46A 3PFVA 1NX1A 2K0JA 1OMRA 1K9PA 2BE6A 3VROA 3OB1B 2BBMA 3OX5A 1CTRA 5KU1A 1NX0A 3VRPA 3I5HC 1XA5A 1DT7B 1CNPA 2VRGA 1NCXA 2KYCA 4F0ZB 1A29A 3D0YA 4YGAA 2KGRA 4GUKA 1BR4B 1CLLA 3IQOA 1XK4C 2KGBC 1XFWO 2LMUA 1NX3A 4MBEA 2JPTA 1AJ5A 3IF7A 4CFRA 2JRFA 4E68A 3JTDB 1K2HA 1WDCC 1QIWA 2DOQA 2LV7A 1CFCA 1HT9A 1NX2A 2ZFDA 3O6BA 2MA2A 3CTNA 2D8NA 1AP4A 1SNLA 3LLEA 3CLNA 3TS5B 5IBWA 2RGIA 4ICBA 2JTTA 2KDHA 4I5KA 1KSMA 1SL7A 4U8DA 2O60A 1ODBA 2I2RE 2M3WA 2E6WA 1SYMA 1RROA 4N1GA 3SG2A 2L4IA 1GQMA 2O5GA 1QS7A 3KEVA 4DCKA 1YUUA 1SY9A 1A2XA 2L0PA 2H61C 4P5OE 1M45A 1SBJA 3SG5A 1NUBA 3MSEB 2A4JA 2WCEA 4MN0A 1DVIA 2KHNA 1MXLC 1KFXL 2F2OA 2LUXA 3GK1A 4AOMA 1JUOA 2KSPA 1UURA 2NZ0A 2PASA 1KFXS 2GGMA 1DF0B 3I5FB 1K9UA 2ZN9A 5I2QA 4GGFC 4OCIA 1AUIB 1OMDA 4JWQA 3LK0A 1QV0A 1A4PA 2KI6D 1QTXA 4GAOA 2K7BA 1CLMA 1DJWA 3EVUA 3NSIA 1LXFC 1G8IA 4GPLB 2LUCA 1IJ5A 3A4UB 2PVBA 4QJ3B 3AAKA 1XVJA 1SKTA 4M2OA 4JPZB 1UHJA 1X02A 1RECA 1SCVA 1XFYO 5CSFA 1CFDA 3FIAA 2JQ6A 1FI5A 5HKWA 4MZKA 4GGNA 1EG3A 1SK6D 3TZ1A 2JU0A 1B47A 1SL9A 3SIBA 1M63B 2EC6C 2OTGC 3ICBA 2K7DA 2WCFA 1IWQA 1K9KA 4HRHA 2CBLA 1SR6C 2LVJA 1BJFA 2LVKA 3KPXA 1Q80A 2Q91A 2M29A 3TUYC 1NIWA 1RK9A 2CNPA 2KOTA 4P2YB 3O2PA 1AJ4A 1TRFA 2BCBA 5HLOA 1B1GA 1FPWA 4AQIA 2LMVA 3SG6A 3EVRA 4C0LA 2M8UA 2NXQA 1UUSA 1TTXA 2M0RA 1PRWA 2V53A 2KBIA 1DGUA 2OPOA 5TNCA 1QJTA 2MAZA 2K2FA 3IQQA 1OSAA 4PHNA 2LM5A 1L7ZA 2TN4A 3FS7A 1YUSA 2BBNA 1XFUO 4YI9A 1JBAA 2JXLA 2BKIB 1CDLA 4QJ5B 2JT3A 1GGZA 2WORA 2M49B 3PATA 4R1EA 3CGAA 3PSRA 1V1GA 1JC2A 4MLWA 1KK7Y 1U5IA 1OZOA 2H2KA 2LLUA 4ORBB 2ISDA 2CXJA 1A75A 2Q4UA 1MWNA 1QX7A 1S6IA 1VRKA 1KQMB 3VRQA 4YRUA 2WOSA 4XJKA 1NCYA 3DVKA 2ZNDA 1PSBA 2CT9A 1NPQA 1M39A 2HF5A 2JZIA 1F8HA 2SCPA 1Y1AA 4I5LB 1H4BA 1C7WA 3BUXB 4AQJA 1W7IB 1YVHA 2Y1NA 2LNKA 4I5NB 3CR2A 1GGWA 2BE4A 1LVCD 2JWWA 1YRTB 1A03A 1IKUA 1K93D 1YR5A 1CFPA 5ER5A 1AHRA 1C07A 3SG4A 1G33A 1L2OC 3BUMB 1DTLA 1OE9B 1S5GZ 1BOCA 2LE9B 3AAJA 3NSOA 2AMIA 1WRZA 2L51A 3SIAA 3A8RA 5KTYA 1RTP1 1YVLA 4OR9B 5BPJA 3NSLA 3SG7A 3JTDC 1QATA 2HPSA 1S3PA 4YGDB 1BU3A 2F3ZA 3H4SE 4OKHA 1MXEA 1SRAA 2HQWA 2JULA 2KI6C 4M2QA 2GGZA 4GBAA 1Y1XA 1LINA 2I94A 4YI8A 5CSIA 2FCEA 3TS5C 1S6JA 2MBXA 1JFKA 4OV2A 2MRDA 1XYDA 3LL8B 5AEQA 5FYXA 1WY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K89 A;  3M0W A;  5CSJ A;  2WND A;  1YX8 A;  3DF0 B;  3BUW B;  1G4Y R;  1WLM A;  4NQG A;  3EK7 A;  1BOD A;  2JC2 A;  2H61 A;  2AAO A;  1YX7 A;  2BL0 C;  2K7C A;  3WHT B;  1DF0 A;  1JFJ A;  2F3Y A;  1V1F A;  1TCF A;  3EKJ A;  2ZKM X;  3NXA A;  2L50 A;  1B8L A;  4CPV A;  2NLN A;  1SMG A;  1SW8 A;  3I5F C;  3LK1 A;  4JQ0 D;  1IGV A;  2M1K B;  3PLF B;  1KFU L;  5I8N A;  2L2E A;  2JXC A;  1KSO A;  2KFH A;  1CKK A;  4CLN A;  1GJY A;  1WRK A;  4CFQ A;  1KFU S;  5HKZ A;  1CMF A;  1WLZ A;  3DVJ A;  1IQ3 A;  3SG3 A;  1EG4 A;  1EL4 A;  2IS9 A;  1SPY A;  1KK8 B;  4FTG A;  4MZJ A;  1IH0 A;  1TN4 A;  5DKN A;  2ZN8 A;  1TNX A;  2AUC A;  1CLB A;  2Y1M A;  3QRX A;  4BY4 A;  3OHM B;  4DS7 A;  4DRW A;  3PN7 B;  3KHE A;  1SCM C;  3O4Y A;  1IRJ A;  1YUR A;  1AK8 A;  1KQV A;  1UHH A;  3GK4 X;  5JJG A;  4NDC A;  1NYA A;  3WXA A;  1B4C A;  1B7T Z;  1K8U A;  1IQ5 A;  3D10 A;  2OTG B;  5HLV A;  1KWO C;  2PAL A;  1TNW A;  1DJZ A;  1SR6 B;  2F33 A;  1PSR A;  1OQP A;  3CS1 A;  1LA0 A;  3I5G C;  2FCD A;  2KI4 B;  4L9M A;  2OS8 B;  1YTZ C;  1CB1 A;  3CWG A;  4PHK A;  2KBM A;  3JVT B;  1MHO A;  1QVI Y;  2HQ8 A;  4USL A;  1PVA A;  2I18 A;  4MVF A;  4WQ3 A;  1HQV A;  1DJY A;  2F2P A;  4A4B A;  4HSZ A;  1CDM A;  2JNX A;  2LHL A;  2BEC A;  1PK0 D;  3WHU B;  2LLT A;  1K96 A;  1C7V A;  2MHH A;  1Y1U A;  2K61 A;  2FOT A;  1Y6W A;  2QAC A;  4YGC B;  4PE4 A;  2PMY A;  1MQ1 A;  1ZUZ A;  1F54 A;  2JNF A;  1MUX A;  2G2B A;  4WQ2 A;  1XFV O;  2PRU A;  1IJ6 A;  1CM4 A;  1XFX O;  1QLK A;  1RJV A;  1TNP A;  1S1E A;  4ORA B;  5B8I B;  1YUT A;  1BR1 B;  2MLF C;  2I7A A;  4GFT A;  1ZMZ A;  3BQ3 A;  3TDZ A;  5AER A;  2JT8 A;  3EKH A;  3I5I B;  1KQM C;  5GQQ C;  1R6P A;  4MRY A;  1RWY A;  3HX4 A;  5KSZ A;  2R2I A;  1ALW A;  2LMT A;  1LA3 A;  4GNK B;  5PAL A;  4BY5 A;  1UP5 A;  1NWD A;  4D1E A;  5DKR A;  1J7Q A;  3OX6 A;  3PAL A;  5I2L A;  1CMG A;  3I5H B;  1S26 D;  1BMO A;  1XO5 A;  1JF2 A;  1R2U A;  1K94 A;  2KNE A;  1FI6 A;  2KAY A;  3HCM A;  1QXP A;  2LVI A;  3AKA A;  1JSA A;  2KFF A;  1K90 D;  3CR4 X;  4WRI A;  1DJH A;  1TIZ A;  3E3R A;  1NCZ A;  1XK4 A;  1L2O B;  1LKJ A;  1PVB A;  1MR8 A;  1WDC B;  2BCA A;  3D0Y B;  3SJS A;  2KQY A;  3TDI A;  5AXI A;  1CDP A;  1D1O A;  1E8A A;  2LLS A;  4MRX A;  5I2O A;  2M9G A;  3FWC A;  2KYF A;  2GV5 A;  1CDN A;  1PAL A;  4HRG A;  5HYD A;  5F6T A;  3BUN B;  2Y4Q A;  1WRL A;  2P6B B;  4IL1 A;  3GK2 A;  5CPV A;  4C0K A;  1KCY A;  1F4Q A;  2K8M B;  4YBH B;  3AKB A;  4YGE B;  1EJ3 A;  1S5G Y;  2K2A A;  2WC8 A;  3F45 A;  4PCW A;  4ZCU A;  3KF9 A;  3VGO A;  2PSR A;  1UHN A;  5D7F A;  1DGV A;  1ALV A;  3DF0 A;  3DVM A;  4PE7 A;  1FW4 A;  2L98 A;  3BUO B;  1ZOT B;  4MSP A;  5J3X A;  1OMV A;  1J7R A;  3LCP C;  2NCO A;  4XYN A;  2NCP A;  4QJ4 B;  4I5J A;  3BXK A;  2ZRT A;  2KFG A;  1UHK A;  4ZCV A;  5HKY A;  4PAL A;  3VRN A;  1F70 A;  1J1D A;  2LAN A;  4TNC A;  2LP2 A;  1FBV A;  1QLS A;  2BL0 B;  5AAN A;  1B8C A;  1F4O A;  1Y0V H;  4GGF A;  2SAS A;  1W7J B;  1N0Y A;  2ZNE A;  4PDZ A;  2JOJ A;  1PUL A;  4NDD A;  2M97 A;  2ZRS A;  1J7O A;  1OZS A;  4PHJ A;  4UPG A;  1J7P A;  2FJU B;  2BCX A;  4PHM A;  2E30 A;  2L5X B;  4NDB A;  2LC5 A;  1DJI A;  3CR5 X;  1IG5 A;  1YRU B;  1TNQ A;  2MLE C;  1BT6 A;  1KK8 C;  1H8B A;  1JWD A;  2COL B;  1B8R A;  2G9B A;  3BYA A;  3ZWH A;  2LAP A;  3BOW B;  2EC6 B;  1EH2 A;  2B1U A;  1UHI A;  3BOW A;  1QV1 A;  3EK8 A;  3PN7 C;  1SCM B;  1TCO B;  5D69 A;  4N5X A;  3TUY B;  1EXR A;  1CM1 A;  1QAS A;  4N1F A;  4MZL A;  1QVI Z;  3KO0 A;  1JF0 A;  3O78 A;  3RM1 A;  1N65 A;  3NSK A;  1RFJ A;  3PM8 A;  1KWO B;  1J55 A;  2JT0 A;  3CZT X;  3DVE A;  3GOF A;  2HET A;  2K7O A;  2CCM A;  1TOP A;  2KAV A;  3I5G B;  1BLQ A;  1S6C A;  1ZAC A;  2KI4 C;  4C0J A;  2M7L A;  2OS8 C;  1CFF A;  2LCP A;  1KK7 Z;  4CID A;  1NSH A;  1DJX A;  3JVT C;  4Q04 A;  1AVS A;  1B7T Y;  1QX5 B;  2L4H A;  1QX2 A;  4FQO A;  4M2P A;  1DMO A;  3K21 A;  2LHI A;  1N2D A;  4PE1 A;  3RLZ A;  2KQ6 A;  5ER4 X;  2LP3 A;  3OB2 B;  1MF8 B;  4PE0 A;  2BKH B;  4YGB B;  5G08 A;  2JTZ A;  1OOJ A;  2EGD A;  3EK4 A;  5CSN A;  1BG1 A;  4OVN F;  5DKQ A;  3ZNI A;  2F8P A;  1NP8 A;  2QPT A;  1J1E A;  1QIV A;  1S36 A;  3EVV A;  5JOL A;  1F55 A;  5AFP A;  1SL8 A;  3OP0 A;  3VRR A;  1K95 A;  2EHB A;  1U5I B;  2KAX A;  1DJG A;  1ZFS A;  4DIR A;  4ETO A;  4ORC B;  2M1U A;  1A75 B;  1M31 A;  2MJW B;  4MEW A;  3TDU A;  1UWO A;  2WCB A;  1FF1 A;  3WNX B;  2LVV A;  3C1V A;  2CTN A;  2M7N A;  4XJK B;  2Y5I A;  3I5I C;  3FWB A;  3DD4 A;  4DUQ A;  1F71 A;  1XFZ O;  1BF5 A;  4A4C A;  1B9A A;  4HRE E;  1M46 A;  3PFV A;  1NX1 A;  2K0J A;  1OMR A;  1K9P A;  2BE6 A;  3VRO A;  3OB1 B;  2BBM A;  3OX5 A;  1CTR A;  5KU1 A;  1NX0 A;  3VRP A;  3I5H C;  1XA5 A;  1DT7 B;  1CNP A;  2VRG A;  1NCX A;  2KYC A;  4F0Z B;  1A29 A;  3D0Y A;  4YGA A;  2KGR A;  4GUK A;  1BR4 B;  1CLL A;  3IQO A;  1XK4 C;  2KGB C;  1XFW O;  2LMU A;  1NX3 A;  4MBE A;  2JPT A;  1AJ5 A;  3IF7 A;  4CFR A;  2JRF A;  4E68 A;  3JTD B;  1K2H A;  1WDC C;  1QIW A;  2DOQ A;  2LV7 A;  1CFC A;  1HT9 A;  1NX2 A;  2ZFD A;  3O6B A;  2MA2 A;  3CTN A;  2D8N A;  1AP4 A;  1SNL A;  3LLE A;  3CLN A;  3TS5 B;  5IBW A;  2RGI A;  4ICB A;  2JTT A;  2KDH A;  4I5K A;  1KSM A;  1SL7 A;  4U8D A;  2O60 A;  1ODB A;  2I2R E;  2M3W A;  2E6W A;  1SYM A;  1RRO A;  4N1G A;  3SG2 A;  2L4I A;  1GQM A;  2O5G A;  1QS7 A;  3KEV A;  4DCK A;  1YUU A;  1SY9 A;  1A2X A;  2L0P A;  2H61 C;  4P5O E;  1M45 A;  1SBJ A;  3SG5 A;  1NUB A;  3MSE B;  2A4J A;  2WCE A;  4MN0 A;  1DVI A;  2KHN A;  1MXL C;  1KFX L;  2F2O A;  2LUX A;  3GK1 A;  4AOM A;  1JUO A;  2KSP A;  1UUR A;  2NZ0 A;  2PAS A;  1KFX S;  2GGM A;  1DF0 B;  3I5F B;  1K9U A;  2ZN9 A;  5I2Q A;  4GGF C;  4OCI A;  1AUI B;  1OMD A;  4JWQ A;  3LK0 A;  1QV0 A;  1A4P A;  2KI6 D;  1QTX A;  4GAO A;  2K7B A;  1CLM A;  1DJW A;  3EVU A;  3NSI A;  1LXF C;  1G8I A;  4GPL B;  2LUC A;  1IJ5 A;  3A4U B;  2PVB A;  4QJ3 B;  3AAK A;  1XVJ A;  1SKT A;  4M2O A;  4JPZ B;  1UHJ A;  1X02 A;  1REC A;  1SCV A;  1XFY O;  5CSF A;  1CFD A;  3FIA A;  2JQ6 A;  1FI5 A;  5HKW A;  4MZK A;  4GGN A;  1EG3 A;  1SK6 D;  3TZ1 A;  2JU0 A;  1B47 A;  1SL9 A;  3SIB A;  1M63 B;  2EC6 C;  2OTG C;  3ICB A;  2K7D A;  2WCF A;  1IWQ A;  1K9K A;  4HRH A;  2CBL A;  1SR6 C;  2LVJ A;  1BJF A;  2LVK A;  3KPX A;  1Q80 A;  2Q91 A;  2M29 A;  3TUY C;  1NIW A;  1RK9 A;  2CNP A;  2KOT A;  4P2Y B;  3O2P A;  1AJ4 A;  1TRF A;  2BCB A;  5HLO A;  1B1G A;  1FPW A;  4AQI A;  2LMV A;  3SG6 A;  3EVR A;  4C0L A;  2M8U A;  2NXQ A;  1UUS A;  1TTX A;  2M0R A;  1PRW A;  2V53 A;  2KBI A;  1DGU A;  2OPO A;  5TNC A;  1QJT A;  2MAZ A;  2K2F A;  3IQQ A;  1OSA A;  4PHN A;  2LM5 A;  1L7Z A;  2TN4 A;  3FS7 A;  1YUS A;  2BBN A;  1XFU O;  4YI9 A;  1JBA A;  2JXL A;  2BKI B;  1CDL A;  4QJ5 B;  2JT3 A;  1GGZ A;  2WOR A;  2M49 B;  3PAT A;  4R1E A;  3CGA A;  3PSR A;  1V1G A;  1JC2 A;  4MLW A;  1KK7 Y;  1U5I A;  1OZO A;  2H2K A;  2LLU A;  4ORB B;  2ISD A;  2CXJ A;  1A75 A;  2Q4U A;  1MWN A;  1QX7 A;  1S6I A;  1VRK A;  1KQM B;  3VRQ A;  4YRU A;  2WOS A;  4XJK A;  1NCY A;  3DVK A;  2ZND A;  1PSB A;  2CT9 A;  1NPQ A;  1M39 A;  2HF5 A;  2JZI A;  1F8H A;  2SCP A;  1Y1A A;  4I5L B;  1H4B A;  1C7W A;  3BUX B;  4AQJ A;  1W7I B;  1YVH A;  2Y1N A;  2LNK A;  4I5N B;  3CR2 A;  1GGW A;  2BE4 A;  1LVC D;  2JWW A;  1YRT B;  1A03 A;  1IKU A;  1K93 D;  1YR5 A;  1CFP A;  5ER5 A;  1AHR A;  1C07 A;  3SG4 A;  1G33 A;  1L2O C;  3BUM B;  1DTL A;  1OE9 B;  1S5G Z;  1BOC A;  2LE9 B;  3AAJ A;  3NSO A;  2AMI A;  1WRZ A;  2L51 A;  3SIA A;  3A8R A;  5KTY A;  1RTP 1;  1YVL A;  4OR9 B;  5BPJ A;  3NSL A;  3SG7 A;  3JTD C;  1QAT A;  2HPS A;  1S3P A;  4YGD B;  1BU3 A;  2F3Z A;  3H4S E;  4OKH A;  1MXE A;  1SRA A;  2HQW A;  2JUL A;  2KI6 C;  4M2Q A;  2GGZ A;  4GBA A;  1Y1X A;  1LIN A;  2I94 A;  4YI8 A;  5CSI A;  2FCE A;  3TS5 C;  1S6J A;  2MBX A;  1JFK A;  4OV2 A;  2MRD A;  1XYD A;  3LL8 B;  5AEQ A;  5FYX A;  1WY9 A; 
#chains in the Genus database with same CATH topology
 5K89 A;  3M0W A;  5CSJ A;  2WND A;  1YX8 A;  1Z4H A;  3PM2 A;  3DF0 B;  3BUW B;  1G4Y R;  1WLM A;  4NQG A;  3EK7 A;  4PT1 A;  1BOD A;  2JC2 A;  2H61 A;  2AAO A;  1YX7 A;  2BL0 C;  2K7C A;  3WHT B;  1DF0 A;  1JFJ A;  2F3Y A;  1V1F A;  2QEO A;  1TCF A;  3EKJ A;  2ZKM X;  3NXA A;  2L50 A;  1B8L A;  4CPV A;  3S0E A;  2PQL A;  2NLN A;  1SMG A;  1SW8 A;  3I5F C;  3LK1 A;  4JQ0 D;  1IGV A;  2M1K B;  3PLF B;  1KFU L;  5I8N A;  2L2E A;  2JXC A;  1KSO A;  2KFH A;  1CKK A;  4CLN A;  1GJY A;  1WRK A;  4CFQ A;  3NHI A;  1KFU S;  5HKZ A;  1CMF A;  3D78 A;  3S0A A;  1WLZ A;  3DVJ A;  1IQ3 A;  3O4X A;  3SG3 A;  1EG4 A;  1EL4 A;  2IS9 A;  1SPY A;  1KK8 B;  3CZ0 A;  4FTG A;  3NGV A;  4MZJ A;  1IH0 A;  1TN4 A;  5DKN A;  2ZN8 A;  1TNX A;  2AUC A;  1CLB A;  2Y1M A;  2FJY A;  3QRX A;  4BY4 A;  3OHM B;  4DS7 A;  1DEL A;  5DIC A;  4DRW A;  3PJI A;  3PN7 B;  3KHE A;  1SCM C;  3O4Y A;  1IRJ A;  1YUR A;  1AK8 A;  1KQV A;  1UHH A;  3GK4 X;  3OBV A;  5JJG A;  4NDC A;  1NYA A;  3WXA A;  1B4C A;  1B7T Z;  1K8U A;  1IQ5 A;  3D10 A;  2OTG B;  5EL2 A;  3R1P A;  5HLV A;  1KWO C;  2PAL A;  1TNW A;  3B87 A;  1DJZ A;  1SR6 B;  2F33 A;  1PSR A;  3D73 A;  1OQP A;  3B88 A;  3CS1 A;  1LA0 A;  3I5G C;  3N7H A;  2FCD A;  3BJH A;  2KI4 B;  4L9M A;  2OS8 B;  1YTZ C;  1CB1 A;  3CWG A;  4PHK A;  2KBM A;  3JVT B;  1MHO A;  1QVI Y;  2HQ8 A;  4USL A;  1PVA A;  2GTE A;  2I18 A;  4MVF A;  4WQ3 A;  1HQV A;  1DJY A;  2F2P A;  4A4B A;  4HSZ A;  1CDM A;  2JNX A;  2LHL A;  4FQT A;  4KYN A;  2BEC A;  1PK0 D;  3WHU B;  2LLT A;  1K96 A;  1C7V A;  2MHH A;  1Y1U A;  2K61 A;  2FOT A;  1Y6W A;  2QAC A;  4YGC B;  4PE4 A;  2PMY A;  1MQ1 A;  1ZUZ A;  1F54 A;  2JNF A;  1MUX A;  2G2B A;  4WQ2 A;  1XFV O;  2PRU A;  1IJ6 A;  1CM4 A;  1XFX O;  1QLK A;  1Z2C B;  1RJV A;  1TNP A;  1S1E A;  4ORA B;  5B8I B;  1YUT A;  1BR1 B;  2MLF C;  2I7A A;  4GFT A;  1ZMZ A;  3BQ3 A;  3TDZ A;  5AER A;  2JT8 A;  3EKH A;  3I5I B;  1KQM C;  5GQQ C;  1R6P A;  4MRY A;  1RWY A;  3HX4 A;  5KSZ A;  3L4A A;  2R2I A;  1ALW A;  2LMT A;  1LA3 A;  4GNK B;  5PAL A;  3S0B A;  1UP5 A;  1NWD A;  4BY5 A;  4D1E A;  2QEH A;  5DKR A;  1J7Q A;  3OX6 A;  3PAL A;  5I2L A;  1CMG A;  3I5H B;  1S26 D;  1BMO A;  1XO5 A;  1JF2 A;  1R2U A;  1K94 A;  2KNE A;  1FI6 A;  2KAY A;  3HCM A;  1QXP A;  2LVI A;  3AKA A;  1JSA A;  2KFF A;  1K90 D;  3CR4 X;  4WRI A;  1DJH A;  1TIZ A;  3E3R A;  1NCZ A;  1XK4 A;  1L2O B;  1LKJ A;  1PVB A;  1MR8 A;  1QWV A;  1WDC B;  2BCA A;  3D0Y B;  3SJS A;  2KQY A;  3TDI A;  5AXI A;  1CDP A;  1D1O A;  1E8A A;  2LLS A;  1W9Z A;  4MRX A;  5I2O A;  2M9G A;  3FWC A;  2KYF A;  2GV5 A;  1CDN A;  1PAL A;  3L47 A;  4HRG A;  5HYD A;  5F6T A;  3VB1 A;  3BUN B;  2Y4Q A;  3R1O A;  1WRL A;  2P6B B;  3DYE A;  3GK2 A;  4IL1 A;  5CPV A;  1OOH A;  3R1V A;  4C0K A;  1KCY A;  1F4Q A;  2K8M B;  4YBH B;  3AKB A;  3QME A;  4YGE B;  1EJ3 A;  1S5G Y;  2K2A A;  2WC8 A;  3F45 A;  4PCW A;  3CZ1 A;  4ZCU A;  5I94 A;  3KF9 A;  3VGO A;  3SS4 A;  2PSR A;  1UHN A;  5D7F A;  1DGV A;  1ALV A;  3DF0 A;  3OGN A;  3DVM A;  2PYQ A;  4PE7 A;  1FW4 A;  2L98 A;  3BUO B;  1ZOT B;  4MSP A;  5J3X A;  3RZS A;  1OMV A;  1J7R A;  3LCP C;  2NCO A;  4XYN A;  2NCP A;  4QJ4 B;  4I5J A;  3BXK A;  2ZRT A;  2KFG A;  1UHK A;  5FI6 A;  4ZCV A;  5HKY A;  4JKT A;  4PAL A;  3VRN A;  1F70 A;  1J1D A;  2LAN A;  4TNC A;  2LP2 A;  1LS8 A;  1FBV A;  1QLS A;  2BL0 B;  5AAN A;  1B8C A;  1F4O A;  1Y0V H;  4GGF A;  2SAS A;  2JPO A;  1W7J B;  1N0Y A;  2ZNE A;  4PDZ A;  2JOJ A;  2K60 A;  1PUL A;  4NDD A;  2M97 A;  2ZRS A;  1J7O A;  1OZS A;  4PHJ A;  4UPG A;  1J7P A;  2FJU B;  2BCX A;  4PHM A;  3S0G A;  2E30 A;  2L5X B;  4NDB A;  2LC5 A;  1DJI A;  1OOI X;  1IG5 A;  3CR5 X;  1YRU B;  1TNQ A;  2MLE C;  1DQE A;  1BT6 A;  1KK8 C;  1H8B A;  1JWD A;  2COL B;  1B8R A;  1P28 A;  4INX A;  2G9B A;  3BYA A;  3NHT A;  3ZWH A;  2LAP A;  3BOW B;  2QEV A;  2EC6 B;  1EH2 A;  2B1U A;  1UHI A;  2WCH A;  1QV1 A;  2QEB A;  3BOW A;  1SCM B;  3EK8 A;  3PN7 C;  1TCO B;  5D69 A;  4N5X A;  3TUY B;  1EXR A;  1CM1 A;  1QAS A;  4N1F A;  4MZL A;  1QVI Z;  3KO0 A;  1JF0 A;  3O78 A;  3RM1 A;  1N65 A;  3NSK A;  1RFJ A;  3PM8 A;  1KWO B;  1J55 A;  3UO9 A;  2JT0 A;  3BFA A;  3FE9 A;  3CZT X;  3DVE A;  3GOF A;  2HET A;  2K7O A;  2CCM A;  1TOP A;  2KAV A;  3I5G B;  1BLQ A;  1S6C A;  3V2L A;  1ZAC A;  2KI4 C;  4C0J A;  2M7L A;  2OS8 C;  1CFF A;  2LCP A;  1KK7 Z;  4CID A;  1NSH A;  1DJX A;  3JVT C;  4Q04 A;  3BFB A;  1AVS A;  1B7T Y;  1QX5 B;  2L4H A;  1QX2 A;  4FQO A;  4M2P A;  1DMO A;  3K21 A;  2LHI A;  1N2D A;  4PE1 A;  3RLZ A;  2KQ6 A;  5ER4 X;  2LP3 A;  3OB2 B;  1MF8 B;  4PE0 A;  2BKH B;  4YGB B;  5G08 A;  3D77 A;  2JTZ A;  1OOJ A;  2EGD A;  3EK4 A;  5CSN A;  1BG1 A;  4OVN F;  5DKQ A;  3ZNI A;  2F8P A;  1NP8 A;  2QPT A;  1J1E A;  1QIV A;  1S36 A;  3EVV A;  5JOL A;  1F55 A;  5AFP A;  1SL8 A;  3OP0 A;  3VRR A;  1K95 A;  2EHB A;  1U5I B;  2KAX A;  1XFR A;  3CYZ A;  1DJG A;  1ZFS A;  4DIR A;  4ETO A;  4ORC B;  2M1U A;  1A75 B;  1M31 A;  2MJW B;  4MEW A;  5FI7 A;  1UWO A;  3TDU A;  2YGU A;  2WCB A;  1FF1 A;  3WNX B;  2LVV A;  3C1V A;  2CTN A;  2M7N A;  3FE8 A;  4XJK B;  2Y5I A;  3I5I C;  3FWB A;  3DD4 A;  3S0F A;  2P71 A;  4DUQ A;  3L4L A;  1XFZ O;  1F71 A;  1BF5 A;  4A4C A;  1B9A A;  4HRE E;  1M46 A;  3PFV A;  1NX1 A;  2K0J A;  1OMR A;  4F7F A;  1K9P A;  2BE6 A;  3VRO A;  5HL1 A;  3OB1 B;  2BBM A;  3OX5 A;  1CTR A;  5KU1 A;  1NX0 A;  3VRP A;  3I5H C;  1XA5 A;  1DT7 B;  1CNP A;  2VRG A;  1NCX A;  2KYC A;  4F0Z B;  1A29 A;  3D0Y A;  4YGA A;  2KGR A;  4GUK A;  1BR4 B;  1CLL A;  3IQO A;  1XK4 C;  2WCK A;  2KGB C;  1XFW O;  2LMU A;  1NX3 A;  3DXL A;  2JPT A;  1AJ5 A;  3IF7 A;  4MBE A;  2JRF A;  4CFR A;  3JTD B;  1K2H A;  1WDC C;  1QIW A;  2DOQ A;  2LV7 A;  1CFC A;  1OW4 A;  1HT9 A;  1NX2 A;  2ZFD A;  3D74 A;  2MA2 A;  3CTN A;  2D8N A;  3O6B A;  1AP4 A;  1SNL A;  3LLE A;  4INW A;  3CLN A;  3CDN A;  3TS5 B;  2RGI A;  4ICB A;  5IBW A;  2JTT A;  2KDH A;  4I5K A;  1KSM A;  1SL7 A;  3DY9 A;  4U8D A;  2O60 A;  3SS3 A;  1ODB A;  2I2R E;  2M3W A;  3DZT A;  2E6W A;  1SYM A;  2KLE A;  1RRO A;  4N1G A;  2BAP A;  3SG2 A;  2L4I A;  1GQM A;  2O5G A;  1QS7 A;  3KEV A;  2QDI A;  1YUU A;  4DCK A;  1SY9 A;  1A2X A;  2L0P A;  2H61 C;  4E68 A;  4P5O E;  1M45 A;  2ERB A;  1SBJ A;  3SG5 A;  1NUB A;  3MSE B;  2A4J A;  5FI2 A;  2WCE A;  4MN0 A;  3S0D A;  1DVI A;  2KHN A;  2WCM A;  1MXL C;  1KFX L;  2F2O A;  2LUX A;  3GK1 A;  4AOM A;  1JUO A;  2KSP A;  3UNW A;  3B6X A;  1C3Y A;  1UUR A;  2NZ0 A;  2PAS A;  1KFX S;  2GGM A;  1DF0 B;  3I5F B;  1K9U A;  2ZN9 A;  5I2Q A;  4GGF C;  1T14 A;  4OCI A;  1AUI B;  4JD9 A;  1OMD A;  4JWQ A;  3LK0 A;  2L2C A;  1QV0 A;  1A4P A;  2KI6 D;  3EG5 B;  1QTX A;  4GAO A;  2K7B A;  1CLM A;  1DJW A;  3EVU A;  3NSI A;  1LXF C;  1G8I A;  4GPL B;  2LUC A;  1IJ5 A;  3A4U B;  2PVB A;  4QJ3 B;  3AAK A;  2BNX A;  1XVJ A;  1SKT A;  4M2O A;  2WCL A;  4JPZ B;  1UHJ A;  1X02 A;  1REC A;  1SCV A;  1XFY O;  5CSF A;  1CFD A;  3FIA A;  2JQ6 A;  1FI5 A;  5HKW A;  4MZK A;  4GGN A;  1EG3 A;  1SK6 D;  3TZ1 A;  2H8V A;  2JU0 A;  1B47 A;  1SL9 A;  3SIB A;  1M63 B;  2EC6 C;  2OTG C;  3ICB A;  2K7D A;  2WCF A;  1IWQ A;  1K9K A;  4HRH A;  2CBL A;  1SR6 C;  2LVJ A;  1BJF A;  2LVK A;  3KPX A;  1Q80 A;  3FE6 A;  3R72 A;  2Q91 A;  2M29 A;  1IIO A;  3TUY C;  1NIW A;  1RK9 A;  2CNP A;  2KOT A;  2WC5 A;  4P2Y B;  4IJ7 A;  3O2P A;  1AJ4 A;  1TRF A;  2BCB A;  3IVT A;  5HLO A;  4OZD A;  1B1G A;  1FPW A;  4AQI A;  2LMV A;  3SG6 A;  3EVR A;  4C0L A;  2M8U A;  5D3O A;  2NXQ A;  1UUS A;  1TTX A;  2M0R A;  1PRW A;  2V53 A;  2KBI A;  1DGU A;  2OPO A;  5TNC A;  1QJT A;  2MAZ A;  1DC1 A;  2K2F A;  3IQQ A;  1OSA A;  4PHN A;  2LM5 A;  1L7Z A;  2TN4 A;  3FS7 A;  1TUZ A;  1YUS A;  2BBN A;  1XFU O;  4YI9 A;  1JBA A;  2JXL A;  2BKI B;  1CDL A;  3D75 A;  4QJ5 B;  2JT3 A;  1GGZ A;  2WOR A;  2M49 B;  3PAT A;  4R1E A;  3CGA A;  3PSR A;  3CAB A;  1V1G A;  1JC2 A;  4MLW A;  1KK7 Y;  1U5I A;  1OZO A;  2H2K A;  2LLU A;  4ORB B;  2KPH A;  2ISD A;  2CXJ A;  1A75 A;  2Q4U A;  1TUJ A;  3B86 A;  1MWN A;  1QX7 A;  1S6I A;  1VRK A;  1KQM B;  3VRQ A;  4YRU A;  2WOS A;  4XJK A;  3D76 A;  1NCY A;  2WC6 A;  3DVK A;  2ZND A;  1PSB A;  2CT9 A;  3BFH A;  1NPQ A;  1ORG A;  1M39 A;  2HF5 A;  2JZI A;  1F8H A;  2SCP A;  1Y1A A;  3Q8I A;  4I5L B;  1DEK A;  1H4B A;  1C7W A;  3BUX B;  4AQJ A;  1W7I B;  1GM0 A;  1C3Z A;  1YVH A;  2Y1N A;  2LNK A;  4I5N B;  2WCJ A;  3CR2 A;  1GGW A;  2BE4 A;  1LVC D;  2JWW A;  1YRT B;  2KLD A;  1A03 A;  1K93 D;  1YR5 A;  1IKU A;  1CFP A;  5ER5 A;  1AHR A;  1C07 A;  3SG4 A;  1G33 A;  1L2O C;  3BUM B;  1DTL A;  1OE9 B;  1S5G Z;  1BOC A;  2LE9 B;  3AAJ A;  3NSO A;  2AMI A;  2L5Y A;  1WRZ A;  3SS5 A;  2L51 A;  3B7A A;  2P70 A;  3A8R A;  3CZ2 A;  3SIA A;  1OOG A;  5KTY A;  1YVL A;  1RTP 1;  4OR9 B;  5BPJ A;  1TWO A;  3NSL A;  3SG7 A;  3JTD C;  1QAT A;  1SSE B;  1S3P A;  2HPS A;  1BU3 A;  4YGD B;  2F3Z A;  3H4S E;  4OKH A;  1MXE A;  1SRA A;  2HQW A;  2JUL A;  2KI6 C;  4M2Q A;  2GGZ A;  4GBA A;  1OOF A;  1Y1X A;  1LIN A;  2I94 A;  4YI8 A;  5CSI A;  2FCE A;  3TS5 C;  1S6J A;  2MBX A;  1JFK A;  4OV2 A;  2MRD A;  1XYD A;  3LL8 B;  5AEQ A;  5FYX A;  1WY9 A;  3K1E A; 
#chains in the Genus database with same CATH homology
 5K89 A;  3M0W A;  5CSJ A;  2WND A;  1YX8 A;  3DF0 B;  3BUW B;  1G4Y R;  1WLM A;  4NQG A;  3EK7 A;  1BOD A;  2JC2 A;  2H61 A;  2AAO A;  1YX7 A;  2BL0 C;  2K7C A;  3WHT B;  1DF0 A;  1JFJ A;  2F3Y A;  1V1F A;  1TCF A;  3EKJ A;  2ZKM X;  3NXA A;  2L50 A;  1B8L A;  4CPV A;  2NLN A;  1SMG A;  1SW8 A;  3I5F C;  3LK1 A;  4JQ0 D;  1IGV A;  2M1K B;  3PLF B;  1KFU L;  5I8N A;  2L2E A;  2JXC A;  1KSO A;  2KFH A;  1CKK A;  4CLN A;  1GJY A;  1WRK A;  4CFQ A;  1KFU S;  5HKZ A;  1CMF A;  1WLZ A;  3DVJ A;  1IQ3 A;  3SG3 A;  1EG4 A;  1EL4 A;  2IS9 A;  1SPY A;  1KK8 B;  4FTG A;  4MZJ A;  1IH0 A;  1TN4 A;  5DKN A;  2ZN8 A;  1TNX A;  2AUC A;  1CLB A;  2Y1M A;  3QRX A;  4BY4 A;  3OHM B;  4DS7 A;  4DRW A;  3PN7 B;  3KHE A;  1SCM C;  3O4Y A;  1IRJ A;  1YUR A;  1AK8 A;  1KQV A;  1UHH A;  3GK4 X;  5JJG A;  4NDC A;  1NYA A;  3WXA A;  1B4C A;  1B7T Z;  1K8U A;  1IQ5 A;  3D10 A;  2OTG B;  5HLV A;  1KWO C;  2PAL A;  1TNW A;  1DJZ A;  1SR6 B;  2F33 A;  1PSR A;  1OQP A;  3CS1 A;  1LA0 A;  3I5G C;  2FCD A;  2KI4 B;  4L9M A;  2OS8 B;  1YTZ C;  1CB1 A;  3CWG A;  4PHK A;  2KBM A;  3JVT B;  1MHO A;  1QVI Y;  2HQ8 A;  4USL A;  1PVA A;  2I18 A;  4MVF A;  4WQ3 A;  1HQV A;  1DJY A;  2F2P A;  4A4B A;  4HSZ A;  1CDM A;  2JNX A;  2LHL A;  2BEC A;  1PK0 D;  3WHU B;  2LLT A;  1K96 A;  1C7V A;  2MHH A;  1Y1U A;  2K61 A;  2FOT A;  1Y6W A;  2QAC A;  4YGC B;  4PE4 A;  2PMY A;  1MQ1 A;  1ZUZ A;  1F54 A;  2JNF A;  1MUX A;  2G2B A;  4WQ2 A;  1XFV O;  2PRU A;  1IJ6 A;  1CM4 A;  1XFX O;  1QLK A;  1RJV A;  1TNP A;  1S1E A;  4ORA B;  5B8I B;  1YUT A;  1BR1 B;  2MLF C;  2I7A A;  4GFT A;  1ZMZ A;  3BQ3 A;  3TDZ A;  5AER A;  2JT8 A;  3EKH A;  3I5I B;  1KQM C;  5GQQ C;  1R6P A;  4MRY A;  1RWY A;  3HX4 A;  5KSZ A;  2R2I A;  1ALW A;  2LMT A;  1LA3 A;  4GNK B;  5PAL A;  4BY5 A;  1UP5 A;  1NWD A;  4D1E A;  5DKR A;  1J7Q A;  3OX6 A;  3PAL A;  5I2L A;  1CMG A;  3I5H B;  1S26 D;  1BMO A;  1XO5 A;  1JF2 A;  1R2U A;  1K94 A;  2KNE A;  1FI6 A;  2KAY A;  3HCM A;  1QXP A;  2LVI A;  3AKA A;  1JSA A;  2KFF A;  1K90 D;  3CR4 X;  4WRI A;  1DJH A;  1TIZ A;  3E3R A;  1NCZ A;  1XK4 A;  1L2O B;  1LKJ A;  1PVB A;  1MR8 A;  1WDC B;  2BCA A;  3D0Y B;  3SJS A;  2KQY A;  3TDI A;  5AXI A;  1CDP A;  1D1O A;  1E8A A;  2LLS A;  4MRX A;  5I2O A;  2M9G A;  3FWC A;  2KYF A;  2GV5 A;  1CDN A;  1PAL A;  4HRG A;  5HYD A;  5F6T A;  3BUN B;  2Y4Q A;  1WRL A;  2P6B B;  4IL1 A;  3GK2 A;  5CPV A;  4C0K A;  1KCY A;  1F4Q A;  2K8M B;  4YBH B;  3AKB A;  4YGE B;  1EJ3 A;  1S5G Y;  2K2A A;  2WC8 A;  3F45 A;  4PCW A;  4ZCU A;  3KF9 A;  3VGO A;  2PSR A;  1UHN A;  5D7F A;  1DGV A;  1ALV A;  3DF0 A;  3DVM A;  4PE7 A;  1FW4 A;  2L98 A;  3BUO B;  1ZOT B;  4MSP A;  5J3X A;  1OMV A;  1J7R A;  3LCP C;  2NCO A;  4XYN A;  2NCP A;  4QJ4 B;  4I5J A;  3BXK A;  2ZRT A;  2KFG A;  1UHK A;  4ZCV A;  5HKY A;  4PAL A;  3VRN A;  1F70 A;  1J1D A;  2LAN A;  4TNC A;  2LP2 A;  1FBV A;  1QLS A;  2BL0 B;  5AAN A;  1B8C A;  1F4O A;  1Y0V H;  4GGF A;  2SAS A;  1W7J B;  1N0Y A;  2ZNE A;  4PDZ A;  2JOJ A;  1PUL A;  4NDD A;  2M97 A;  2ZRS A;  1J7O A;  1OZS A;  4PHJ A;  4UPG A;  1J7P A;  2FJU B;  2BCX A;  4PHM A;  2E30 A;  2L5X B;  4NDB A;  2LC5 A;  1DJI A;  3CR5 X;  1IG5 A;  1YRU B;  1TNQ A;  2MLE C;  1BT6 A;  1KK8 C;  1H8B A;  1JWD A;  2COL B;  1B8R A;  2G9B A;  3BYA A;  3ZWH A;  2LAP A;  3BOW B;  2EC6 B;  1EH2 A;  2B1U A;  1UHI A;  3BOW A;  1QV1 A;  3EK8 A;  3PN7 C;  1SCM B;  1TCO B;  5D69 A;  4N5X A;  3TUY B;  1EXR A;  1CM1 A;  1QAS A;  4N1F A;  4MZL A;  1QVI Z;  3KO0 A;  1JF0 A;  3O78 A;  3RM1 A;  1N65 A;  3NSK A;  1RFJ A;  3PM8 A;  1KWO B;  1J55 A;  2JT0 A;  3CZT X;  3DVE A;  3GOF A;  2HET A;  2K7O A;  2CCM A;  1TOP A;  2KAV A;  3I5G B;  1BLQ A;  1S6C A;  1ZAC A;  2KI4 C;  4C0J A;  2M7L A;  2OS8 C;  1CFF A;  2LCP A;  1KK7 Z;  4CID A;  1NSH A;  1DJX A;  3JVT C;  4Q04 A;  1AVS A;  1B7T Y;  1QX5 B;  2L4H A;  1QX2 A;  4FQO A;  4M2P A;  1DMO A;  3K21 A;  2LHI A;  1N2D A;  4PE1 A;  3RLZ A;  2KQ6 A;  5ER4 X;  2LP3 A;  3OB2 B;  1MF8 B;  4PE0 A;  2BKH B;  4YGB B;  5G08 A;  2JTZ A;  1OOJ A;  2EGD A;  3EK4 A;  5CSN A;  1BG1 A;  4OVN F;  5DKQ A;  3ZNI A;  2F8P A;  1NP8 A;  2QPT A;  1J1E A;  1QIV A;  1S36 A;  3EVV A;  5JOL A;  1F55 A;  5AFP A;  1SL8 A;  3OP0 A;  3VRR A;  1K95 A;  2EHB A;  1U5I B;  2KAX A;  1DJG A;  1ZFS A;  4DIR A;  4ETO A;  4ORC B;  2M1U A;  1A75 B;  1M31 A;  2MJW B;  4MEW A;  3TDU A;  1UWO A;  2WCB A;  1FF1 A;  3WNX B;  2LVV A;  3C1V A;  2CTN A;  2M7N A;  4XJK B;  2Y5I A;  3I5I C;  3FWB A;  3DD4 A;  4DUQ A;  1F71 A;  1XFZ O;  1BF5 A;  4A4C A;  1B9A A;  4HRE E;  1M46 A;  3PFV A;  1NX1 A;  2K0J A;  1OMR A;  1K9P A;  2BE6 A;  3VRO A;  3OB1 B;  2BBM A;  3OX5 A;  1CTR A;  5KU1 A;  1NX0 A;  3VRP A;  3I5H C;  1XA5 A;  1DT7 B;  1CNP A;  2VRG A;  1NCX A;  2KYC A;  4F0Z B;  1A29 A;  3D0Y A;  4YGA A;  2KGR A;  4GUK A;  1BR4 B;  1CLL A;  3IQO A;  1XK4 C;  2KGB C;  1XFW O;  2LMU A;  1NX3 A;  4MBE A;  2JPT A;  1AJ5 A;  3IF7 A;  4CFR A;  2JRF A;  4E68 A;  3JTD B;  1K2H A;  1WDC C;  1QIW A;  2DOQ A;  2LV7 A;  1CFC A;  1HT9 A;  1NX2 A;  2ZFD A;  3O6B A;  2MA2 A;  3CTN A;  2D8N A;  1AP4 A;  1SNL A;  3LLE A;  3CLN A;  3TS5 B;  5IBW A;  2RGI A;  4ICB A;  2JTT A;  2KDH A;  4I5K A;  1KSM A;  1SL7 A;  4U8D A;  2O60 A;  1ODB A;  2I2R E;  2M3W A;  2E6W A;  1SYM A;  1RRO A;  4N1G A;  3SG2 A;  2L4I A;  1GQM A;  2O5G A;  1QS7 A;  3KEV A;  4DCK A;  1YUU A;  1SY9 A;  1A2X A;  2L0P A;  2H61 C;  4P5O E;  1M45 A;  1SBJ A;  3SG5 A;  1NUB A;  3MSE B;  2A4J A;  2WCE A;  4MN0 A;  1DVI A;  2KHN A;  1MXL C;  1KFX L;  2F2O A;  2LUX A;  3GK1 A;  4AOM A;  1JUO A;  2KSP A;  1UUR A;  2NZ0 A;  2PAS A;  1KFX S;  2GGM A;  1DF0 B;  3I5F B;  1K9U A;  2ZN9 A;  5I2Q A;  4GGF C;  4OCI A;  1AUI B;  1OMD A;  4JWQ A;  3LK0 A;  1QV0 A;  1A4P A;  2KI6 D;  1QTX A;  4GAO A;  2K7B A;  1CLM A;  1DJW A;  3EVU A;  3NSI A;  1LXF C;  1G8I A;  4GPL B;  2LUC A;  1IJ5 A;  3A4U B;  2PVB A;  4QJ3 B;  3AAK A;  1XVJ A;  1SKT A;  4M2O A;  4JPZ B;  1UHJ A;  1X02 A;  1REC A;  1SCV A;  1XFY O;  5CSF A;  1CFD A;  3FIA A;  2JQ6 A;  1FI5 A;  5HKW A;  4MZK A;  4GGN A;  1EG3 A;  1SK6 D;  3TZ1 A;  2JU0 A;  1B47 A;  1SL9 A;  3SIB A;  1M63 B;  2EC6 C;  2OTG C;  3ICB A;  2K7D A;  2WCF A;  1IWQ A;  1K9K A;  4HRH A;  2CBL A;  1SR6 C;  2LVJ A;  1BJF A;  2LVK A;  3KPX A;  1Q80 A;  2Q91 A;  2M29 A;  3TUY C;  1NIW A;  1RK9 A;  2CNP A;  2KOT A;  4P2Y B;  3O2P A;  1AJ4 A;  1TRF A;  2BCB A;  5HLO A;  1B1G A;  1FPW A;  4AQI A;  2LMV A;  3SG6 A;  3EVR A;  4C0L A;  2M8U A;  2NXQ A;  1UUS A;  1TTX A;  2M0R A;  1PRW A;  2V53 A;  2KBI A;  1DGU A;  2OPO A;  5TNC A;  1QJT A;  2MAZ A;  2K2F A;  3IQQ A;  1OSA A;  4PHN A;  2LM5 A;  1L7Z A;  2TN4 A;  3FS7 A;  1YUS A;  2BBN A;  1XFU O;  4YI9 A;  1JBA A;  2JXL A;  2BKI B;  1CDL A;  4QJ5 B;  2JT3 A;  1GGZ A;  2WOR A;  2M49 B;  3PAT A;  4R1E A;  3CGA A;  3PSR A;  1V1G A;  1JC2 A;  4MLW A;  1KK7 Y;  1U5I A;  1OZO A;  2H2K A;  2LLU A;  4ORB B;  2ISD A;  2CXJ A;  1A75 A;  2Q4U A;  1MWN A;  1QX7 A;  1S6I A;  1VRK A;  1KQM B;  3VRQ A;  4YRU A;  2WOS A;  4XJK A;  1NCY A;  3DVK A;  2ZND A;  1PSB A;  2CT9 A;  1NPQ A;  1M39 A;  2HF5 A;  2JZI A;  1F8H A;  2SCP A;  1Y1A A;  4I5L B;  1H4B A;  1C7W A;  3BUX B;  4AQJ A;  1W7I B;  1YVH A;  2Y1N A;  2LNK A;  4I5N B;  3CR2 A;  1GGW A;  2BE4 A;  1LVC D;  2JWW A;  1YRT B;  1A03 A;  1IKU A;  1K93 D;  1YR5 A;  1CFP A;  5ER5 A;  1AHR A;  1C07 A;  3SG4 A;  1G33 A;  1L2O C;  3BUM B;  1DTL A;  1OE9 B;  1S5G Z;  1BOC A;  2LE9 B;  3AAJ A;  3NSO A;  2AMI A;  1WRZ A;  2L51 A;  3SIA A;  3A8R A;  5KTY A;  1RTP 1;  1YVL A;  4OR9 B;  5BPJ A;  3NSL A;  3SG7 A;  3JTD C;  1QAT A;  2HPS A;  1S3P A;  4YGD B;  1BU3 A;  2F3Z A;  3H4S E;  4OKH A;  1MXE A;  1SRA A;  2HQW A;  2JUL A;  2KI6 C;  4M2Q A;  2GGZ A;  4GBA A;  1Y1X A;  1LIN A;  2I94 A;  4YI8 A;  5CSI A;  2FCE A;  3TS5 C;  1S6J A;  2MBX A;  1JFK A;  4OV2 A;  2MRD A;  1XYD A;  3LL8 B;  5AEQ A;  5FYX A;  1WY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...