3DVMA

Crystal structure of ca2+/cam-cav2.1 iq domain complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
140
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Calmodulin
total genus 46
structure length 140
sequence length 143
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dvmA00
2LLSA 2SASA 1S1EA 1B7TY 2BECA 4U8DA 1CKKA 4PE1A 1CFPA 3I5IB 1KK7Z 1UHIA 2CBLA 1U5IB 1TN4A 3EVUA 2BCBA 2KYCA 1W7IB 1QX2A 1QLSA 2Y4QA 5JJGA 5KU1A 1BLQA 2KAYA 1H8BA 2CCMA 5HLOA 3RM1A 3NSIA 1EH2A 2NZ0A 1QIWA 3KO0A 1M45A 4P2YB 1RJVA 2LP2A 2LP3A 5HKYA 3RLZA 2M3WA 1UHNA 1XFVO 4GGNA 3ICBA 5CSNA 1KFXS 1MHOA 2H61A 2B1UA 3C1VA 2L5XB 5I2QA 1Y1UA 2Y1MA 2JWWA 5KSZA 3EK8A 2NLNA 1JWDA 3PM8A 4IL1A 2DOQA 1AHRA 1R6PA 1J7OA 4AQJA 1K94A 1QIVA 1WDCC 3I5IC 4I5NB 5TNCA 1KSOA 1PSRA 1B8CA 2O5GA 3JTDB 4I5KA 5HLVA 1QX5B 1IJ6A 1SW8A 3PATA 3BUWB 5ER5A 5GQQC 4QJ3B 1K96A 1WLMA 3FWCA 4M2PA 1G4YR 4I5JA 1JBAA 4C0JA 3LK0A 3OB1B 1S6JA 4GPLB 5AFPA 5I2LA 1HQVA 2LLUA 1A4PA 3SG4A 2NCPA 1F55A 3PN7B 3IF7A 2R2IA 4PE7A 2FJUB 3OHMB 2LCPA 3BYAA 2QPTA 3SG6A 2BKHB 4CIDA 1LINA 2M1KB 1JF0A 1J7QA 3EKJA 1N65A 3LL8B 1B47A 1DJXA 1QATA 1S5GZ 1OZOA 2KQYA 1RTP1 4M2OA 4CFQA 2JNXA 3QRXA 1M63B 2M97A 1TOPA 1YUSA 5CSIA 2AAOA 3VRNA 1L2OC 5F6TA 2COLB 1Y1AA 1TNWA 2M9GA 1UWOA 1FI5A 2MLFC 1SKTA 4C0LA 2KI4B 1K95A 4NDDA 1IQ3A 1SR6B 5DKQA 5CPVA 1CFFA 2Q91A 3CTNA 3GK2A 4XJKB 1CDMA 3TDZA 1WRLA 2K7CA 1KQMC 1NYAA 1SR6C 2HQ8A 1BODA 1MUXA 4OV2A 2FCEA 3SIBA 5AERA 3KF9A 4WRIA 3SJSA 1OSAA 1J1EA 4USLA 1NCXA 1WRKA 2BL0C 1OMRA 2JPTA 3BUNB 1SNLA 2M49B 2QACA 3IQOA 1A75A 1Y0VH 1IWQA 1UHJA 2V53A 4N5XA 4WQ2A 2KAVA 2KFFA 5I2OA 1DMOA 2G2BA 2LMUA 4GAOA 1S6CA 2FCDA 4YGDB 3VGOA 1XK4A 1IGVA 2ZFDA 3BOWB 3DF0B 3WXAA 1R2UA 1NCZA 1J7PA 1J1DA 1MXLC 2JXCA 4MRYA 1DF0B 1CFCA 2L0PA 1BMOA 1RK9A 2JZIA 1XO5A 4L9MA 2F2OA 3DVMA 3DF0A 4XJKA 2JNFA 2KYFA 3D10A 2MHHA 2KFGA 2EHBA 4A4BA 3PN7C 1IG5A 1CNPA 2L2EA 4AOMA 1NX1A 5D7FA 1SYMA 3MSEB 1XFUO 1XYDA 2GGMA 4YGAA 2I94A 1XA5A 1ALWA 2KBMA 3A4UB 1KWOC 1JUOA 4BY5A 2KGRA 1NX3A 3TZ1A 4NDCA 1JC2A 1CLBA 1RECA 1DJWA 2KI4C 4YGBB 1FPWA 1RFJA 2NCOA 2KSPA 4JQ0D 4PCWA 2KNEA 2LC5A 4GNKB 1KFXL 1QV0A 1SCMC 3WNXB 1CLMA 1M31A 1BR1B 2E6WA 4PALA 2MLEC 2M7LA 5K89A 1CDNA 2K0JA 4GUKA 1WY9A 1L7ZA 3O6BA 1KFUL 1FW4A 1SL7A 1V1FA 1KSMA 1PVAA 2PRUA 2JTTA 4NQGA 3SIAA 4DIRA 1IJ5A 2H2KA 4HREE 1YVHA 1BT6A 3DD4A 1GJYA 1DTLA 3LLEA 1UHHA 2K7DA 4MVFA 1KWOB 2MJWB 2ZRTA 1XK4C 2KOTA 4PDZA 3SG3A 2LMVA 2F33A 3WHTB 1KCYA 1IRJA 2PMYA 5DKRA 1N2DA 5G08A 1Y6WA 1L2OB 4MN0A 4PHKA 1J55A 1A2XA 4Q04A 4YGEB 1K90D 1NCYA 3E3RA 1MQ1A 1D1OA 1CM4A 4ETOA 1A75B 1B7TZ 3O78A 1S3PA 1K8UA 3CR4X 1WDCB 1NX0A 4QJ4B 2JC2A 3LCPC 2BCXA 2F2PA 4QJ5B 1W7JB 1NP8A 4ORBB 5CSFA 1NSHA 5HYDA 4CFRA 1U5IA 2HETA 3VROA 3DVEA 1SRAA 1QVIY 1YRTB 4D1EA 1MXEA 1N0YA 1YURA 5FYXA 3PFVA 4MRXA 4BY4A 2F8PA 1B8LA 1F70A 1YX8A 2LM5A 1OZSA 1SL9A 3EVVA 2WNDA 1DT7B 4YGCB 1SBJA 3AAJA 3NSLA 3VRQA 3DVKA 3FIAA 1XFXO 3DVJA 1K93D 2BE4A 1BG1A 2LANA 1WRZA 2Y5IA 1DJHA 2WC8A 1LXFC 2PALA 5ER4X 1NWDA 2KGBC 2K2FA 2JRFA 4C0KA 4GFTA 3EK7A 1CDLA 2CXJA 3I5HB 5IBWA 2I7AA 1YRUB 4YI9A 1ALVA 2JULA 1DJGA 1M39A 2LVIA 1SCVA 1GGWA 1KK8B 1F4OA 1EL4A 4CLNA 4OCIA 3BUMB 1SY9A 2ZNDA 1AVSA 2JXLA 4MZKA 1DJYA 4P5OE 1C7WA 2LUXA 1YTZC 1EG4A 2CTNA 2M1UA 2VRGA 3VRPA 3IQQA 2GV5A 2KHNA 3A8RA 1HT9A 3NSKA 4M2QA 1SMGA 2PSRA 3K21A 3PALA 1C07A 2K8MB 1AJ5A 1NX2A 2JT0A 2LUCA 3AKAA 1A29A 1ZMZA 1DGUA 4HRGA 1QV1A 1UURA 2JT8A 2ZRSA 4MSPA 5CSJA 1UP5A 2ISDA 2LHLA 4N1FA 3D0YA 1B1GA 1KK8C 1PRWA 2L4HA 4PHMA 1A03A 3I5FC 1EG3A 2EGDA 2LVVA 2EC6C 1K9UA 1PALA 1G8IA 3BXKA 5KTYA 2KI6C 2MA2A 3PSRA 1ZFSA 2H61C 2G9BA 2M8UA 4ORCB 5HKZA 1JSAA 2KDHA 1SPYA 2M7NA 2KAXA 2OS8C 3TUYC 4E68A 1TTXA 2WCBA 4GGFC 1CMFA 2A4JA 1YR5A 1LA0A 1NIWA 1S36A 1SK6D 2K7BA 3KPXA 2NXQA 4OR9B 1ODBA 3GOFA 1DJZA 4HSZA 1QXPA 3CWGA 4R1EA 4DCKA 3EKHA 3TS5B 4MZJA 2WOSA 2OTGC 4DRWA 1F71A 1S6IA 2JTZA 1CDPA 2TN4A 3I5FB 2KBIA 2BBMA 3M0WA 4MBEA 3BQ3A 2ZN8A 1WLZA 4JWQA 1ZOTB 1QASA 1KFUS 2I2RE 2KI6D 3PLFB 1TNPA 2PASA 3I5GC 1LKJA 1S26D 2K61A 3H4SE 4PE0A 5B8IB 1XFWO 4I5LB 1TNXA 1QLKA 2AUCA 4MZLA 3EVRA 3HX4A 2I18A 2LLTA 2LV7A 3ZWHA 2BL0B 2M29A 1V1GA 1G33A 1KQVA 1NPQA 1K2HA 5DKNA 4NDBA 3TDIA 3OX5A 4ZCVA 2OPOA 3I5GB 2LNKA 1LA3A 1S5GY 1BOCA 1XVJA 1AUIB 2KFHA 1OMDA 1AK8A 4YI8A 1KQMB 1XFYO 4A4CA 1BR4B 2LE9B 3KHEA 3TDUA 4ORAB 5J3XA 1JF2A 1CB1A 2K7OA 1YUUA 1SCMB 4UPGA 3SG2A 3OP0A 1TIZA 2MBXA 3SG5A 1OQPA 2GGZA 1GGZA 2L51A 1F54A 1GQMA 1TCFA 3JVTB 1B9AA 3BUOB 1DJIA 5AXIA 2E30A 4MEWA 4OKHA 1J7RA 2IS9A 2OTGB 2L4IA 4FTGA 1BF5A 1B8RA 3JTDC 5I8NA 1BJFA 1YX7A 2P6BB 1IKUA 1PULA 5AEQA 1E8AA 1MR8A 1YVLA 3OB2B 1F8HA 1Q80A 3CR2A 1CLLA 4GBAA 3NSOA 1MF8B 2L98A 3KEVA 2BE6A 4JPZB 1DF0A 1XFZO 4MLWA 4N1GA 2BCAA 3CLNA 2LHIA 1AJ4A 3FWBA 3ZNIA 3TS5C 2MAZA 2AMIA 1C7VA 2JQ6A 5BPJA 2HQWA 2ZNEA 3BOWA 2O60A 1OE9B 3JVTC 4HRHA 3CZTX 5AANA 3O4YA 3OX6A 1F4QA 1QJTA 3F45A 4PE4A 2HPSA 1Y1XA 1RWYA 3AAKA 2WCEA 4PHNA 1H4BA 3GK4X 1DVIA 1UUSA 1JFKA 5D69A 2BKIB 2CNPA 1EJ3A 1JFJA 2BBNA 3CR5X 1DGVA 1LVCD 1TNQA 2JU0A 4YBHB 1MWNA 2PVBA 3BUXB 1CM1A 5PALA 1KK7Y 3CS1A 2F3ZA 4PHJA 3WHUB 1VRKA 1ZACA 1CFDA 4GGFA 4ZCUA 2LMTA 1OMVA 1EXRA 4FQOA 1M46A 3CGAA 1X02A 1K9PA 2LAPA 4ICBA 3FS7A 4OVNF 4XYNA 4F0ZB 2F3YA 3GK1A 5HKWA 2ZN9A 1B4CA 1QX7A 2MRDA 1RROA 5JOLA 1PVBA 1TCOB 2D8NA 3AKBA 1K9KA 1SL8A 1YUTA 4DUQA 2JOJA 2FOTA 3I5HC 1FF1A 1IQ5A 3LK1A 1QTXA 4WQ3A 3HCMA 1CMGA 1PK0D 2Y1NA 2OS8B 3TUYB 2LVKA 3VRRA 1BU3A 2CT9A 1AP4A 1QS7A 1FI6A 4YRUA 1NUBA 1TRFA 2JT3A 2HF5A 4CPVA 2WORA 2RGIA 1QVIZ 3O2PA 3SG7A 3NXAA 1OOJA 2LVJA 2EC6B 2K2AA 2M0RA 1CTRA 2KQ6A 4TNCA 2Q4UA 1FBVA 2ZKMX 1PSBA 4DS7A 1ZUZA 2L50A 2SCPA 1IH0A 3D0YB 2WCFA 4AQIA 3EK4A 1UHKA
chains in the Genus database with same CATH superfamily
2L5YA 2LLSA 4OR9B 2SASA 1S1EA 1B7TY 2BECA 4U8DA 3BFHA 1CKKA 4PE1A 1CFPA 3I5IB 1KK7Z 1UHIA 2CBLA 1U5IB 1TN4A 3EVUA 2BCBA 2KYCA 1W7IB 2WCJA 1QX2A 1QLSA 2Y4QA 5JJGA 5KU1A 1BLQA 2KAYA 1H8BA 2CCMA 5HLOA 3R1OA 3RM1A 2BAPA 3NSIA 1EH2A 2NZ0A 3B86A 1QIWA 3KO0A 1M45A 4JKTA 4P2YB 1RJVA 2LP2A 2LP3A 5HKYA 3QMEA 3RLZA 2M3WA 1UHNA 1XFVO 4GGNA 3ICBA 5CSNA 1KFXS 1MHOA 2H61A 2B1UA 3C1VA 2L5XB 5I2QA 1Y1UA 2Y1MA 2JWWA 5KSZA 3EK8A 2NLNA 1JWDA 3PM8A 4IL1A 2DOQA 1AHRA 1R6PA 1J7OA 4AQJA 1K94A 1QIVA 1WDCC 3FE9A 3I5IC 4I5NB 5TNCA 1KSOA 1PSRA 1B8CA 2O5GA 3JTDB 4I5KA 5HLVA 1QX5B 1IJ6A 3PM2A 1SW8A 3PATA 3BUWB 5ER5A 3BFAA 5GQQC 4QJ3B 1K96A 1WLMA 3FWCA 4M2PA 1G4YR 4I5JA 1JBAA 4C0JA 3LK0A 3OB1B 3VB1A 1S6JA 4GPLB 5AFPA 3UO9A 5I2LA 1HQVA 2LLUA 1A4PA 3SG4A 2NCPA 1F55A 3D74A 3PN7B 3IF7A 2R2IA 4PE7A 2FJUB 3OHMB 2LCPA 3BYAA 2QPTA 3SG6A 2BKHB 4CIDA 1LINA 2M1KB 1JF0A 1J7QA 3EKJA 1N65A 3LL8B 3V2LA 1TUZA 1B47A 1DJXA 1QATA 1S5GZ 3N7HA 2L2CA 1OZOA 2KQYA 1RTP1 4M2OA 2ERBA 4CFQA 2JNXA 3QRXA 1M63B 2M97A 1TOPA 1YUSA 5CSIA 2AAOA 3VRNA 1L2OC 5F6TA 2COLB 1Y1AA 1TNWA 2M9GA 1UWOA 1FI5A 2MLFC 1SKTA 5FI6A 4C0LA 2KI4B 1K95A 2PYQA 4NDDA 1IQ3A 1SR6B 2KLEA 5DKQA 3S0DA 5CPVA 1CFFA 2Q91A 4IJ7A 3CTNA 3GK2A 4XJKB 1CDMA 3TDZA 1WRLA 3CZ2A 2K7CA 1KQMC 1NYAA 1SR6C 2HQ8A 1BODA 1MUXA 4OV2A 3RZSA 2FCEA 3SIBA 5AERA 3KF9A 4WRIA 5I94A 3DZTA 3SJSA 1OSAA 1J1EA 4USLA 1Z4HA 3D77A 1NCXA 1OOFA 1WRKA 1OMRA 1XFRA 2BL0C 2JPTA 3BUNB 4KYNA 1SNLA 2M49B 2QACA 3IQOA 2K60A 1A75A 1Y0VH 1IWQA 1UHJA 2V53A 4N5XA 4WQ2A 2KAVA 2KFFA 5I2OA 1DMOA 2G2BA 2LMUA 4GAOA 1S6CA 2FCDA 4YGDB 3VGOA 1XK4A 1IGVA 2ZFDA 3BOWB 3DF0B 3WXAA 1R2UA 1NCZA 1J7PA 1J1DA 1MXLC 2JXCA 3OBVA 4MRYA 1DF0B 1CFCA 2L0PA 1BMOA 1RK9A 2JZIA 1XO5A 4L9MA 2F2OA 3DVMA 3DF0A 4XJKA 2JNFA 2KYFA 3D10A 2MHHA 2KFGA 2EHBA 3L47A 4A4BA 3PN7C 1IG5A 1CNPA 2L2EA 3S0BA 1NX1A 5D7FA 4AOMA 1P28A 1SYMA 1XFUO 3MSEB 1XYDA 2GGMA 3DYEA 4YGAA 2I94A 1XA5A 1ALWA 2KBMA 3A4UB 1KWOC 1JUOA 4BY5A 2KGRA 1NX3A 3TZ1A 4NDCA 1JC2A 1CLBA 1RECA 1DJWA 2KI4C 4YGBB 1FPWA 1RFJA 3NGVA 2NCOA 2KSPA 4JQ0D 3DY9A 4PCWA 2KNEA 2LC5A 4GNKB 1KFXL 1QV0A 3CABA 1SCMC 2WCMA 3WNXB 3CZ0A 1CLMA 1M31A 1BR1B 2E6WA 4PALA 2MLEC 2M7LA 5K89A 1CDNA 2K0JA 4GUKA 1WY9A 1L7ZA 3O6BA 1KFUL 1FW4A 1SL7A 1V1FA 3R1VA 1KSMA 1PVAA 2PRUA 2JTTA 4NQGA 3SIAA 4DIRA 1IJ5A 2H2KA 4HREE 1YVHA 1BT6A 3DD4A 1GJYA 1DTLA 3LLEA 1UHHA 2K7DA 4MVFA 1C3YA 1KWOB 2MJWB 2ZRTA 1XK4C 3UNWA 2KOTA 4PDZA 3SG3A 2LMVA 2F33A 3WHTB 1KCYA 3OGNA 1IRJA 2PMYA 3L4AA 5FI7A 5DKRA 1N2DA 5G08A 1OOIX 1Y6WA 1L2OB 4MN0A 3BFBA 4PHKA 1J55A 1A2XA 4Q04A 4YGEB 1K90D 1NCYA 3E3RA 1MQ1A 1LS8A 2H8VA 1D1OA 1CM4A 4ETOA 1A75B 1B7TZ 3O78A 1S3PA 1K8UA 3CR4X 1WDCB 1NX0A 4QJ4B 2JC2A 3LCPC 2BCXA 2F2PA 2P70A 4QJ5B 1W7JB 3D73A 1NP8A 4ORBB 5CSFA 1NSHA 5HYDA 4CFRA 1U5IA 2HETA 3VROA 3DVEA 1SRAA 1QVIY 1YRTB 4D1EA 1MXEA 1N0YA 3SS3A 1YURA 5FYXA 3PFVA 4MRXA 4BY4A 2F8PA 1B8LA 1F70A 1YX8A 2LM5A 1OZSA 1SL9A 3EVVA 2WNDA 1DT7B 4YGCB 1SBJA 3AAJA 3NSLA 3VRQA 3DVKA 3FIAA 1XFXO 3DVJA 1K93D 2BE4A 1BG1A 5EL2A 2LANA 1WRZA 2QEVA 2Y5IA 1T14A 1DJHA 2WC8A 1LXFC 2PALA 3DXLA 1NWDA 5ER4X 2KGBC 2K2FA 2JRFA 2P71A 4C0KA 4GFTA 3EK7A 1CDLA 2CXJA 3I5HB 5IBWA 2I7AA 3EG5B 1YRUB 1GM0A 4YI9A 1ALVA 2JULA 1DJGA 1M39A 2LVIA 1SCVA 1GGWA 1KK8B 1F4OA 1EL4A 4CLNA 1ORGA 4OCIA 3BUMB 1SY9A 2ZNDA 1AVSA 2JXLA 4FQTA 1DJYA 4MZKA 4P5OE 3BJHA 1C7WA 2LUXA 3B6XA 1YTZC 1EG4A 2CTNA 2M1UA 2VRGA 3VRPA 3IQQA 2GV5A 2KHNA 3A8RA 1HT9A 3NSKA 4M2QA 1SMGA 2PSRA 3K21A 1SSEB 3PALA 2K8MB 1C07A 1AJ5A 1NX2A 2JT0A 2LUCA 3AKAA 1TUJA 1A29A 1ZMZA 1DGUA 2WCHA 4HRGA 1QV1A 1UURA 2JT8A 1OW4A 2ZRSA 4MSPA 5CSJA 1UP5A 2ISDA 2LHLA 4N1FA 3D0YA 1B1GA 1KK8C 1PRWA 2L4HA 4PHMA 1A03A 3I5FC 3B87A 3B88A 3SS4A 1EG3A 2EGDA 2LVVA 2EC6C 4F7FA 1K9UA 1PALA 1G8IA 3BXKA 1DEKA 3CDNA 2KI6C 5KTYA 2MA2A 3PSRA 1ZFSA 2H61C 2G9BA 2M8UA 3O4XA 4ORCB 5HKZA 2KDHA 1JSAA 4PT1A 1SPYA 2M7NA 2KAXA 2OS8C 3TUYC 4E68A 1TTXA 2WCBA 4GGFC 3D75A 1CMFA 2A4JA 1YR5A 1LA0A 1NIWA 1DQEA 1S36A 1SK6D 2K7BA 2NXQA 3KPXA 1ODBA 3GOFA 1DJZA 4HSZA 5HL1A 1QXPA 3CWGA 4R1EA 1C3ZA 5DICA 4DCKA 3EKHA 3TS5B 4MZJA 2WOSA 2OTGC 4DRWA 3R72A 3S0GA 1F71A 1S6IA 2JTZA 1CDPA 2TN4A 3I5FB 2KBIA 2BBMA 3M0WA 4MBEA 3BQ3A 2ZN8A 1WLZA 4JWQA 1ZOTB 1OOHA 1QASA 1KFUS 2I2RE 2KI6D 3PLFB 3R1PA 1TNPA 2PASA 3I5GC 1LKJA 1S26D 2K61A 3H4SE 4PE0A 5B8IB 1XFWO 4I5LB 1TNXA 1QLKA 2AUCA 4MZLA 3EVRA 3HX4A 2I18A 2LLTA 2LV7A 2WC6A 3FE8A 2WCLA 3ZWHA 3Q8IA 2BL0B 3L4LA 2PQLA 1W9ZA 2M29A 1V1GA 1G33A 1Z2CB 5AXIA 1NPQA 1K2HA 1KQVA 3IVTA 5DKNA 4NDBA 3TDIA 3OX5A 4ZCVA 1OOGA 2OPOA 3I5GB 2LNKA 1LA3A 1S5GY 1BOCA 2WC5A 1XVJA 1AUIB 2KFHA 1OMDA 1AK8A 4INXA 4YI8A 1KQMB 1XFYO 4A4CA 1IIOA 1BR4B 2LE9B 3KHEA 3TDUA 4ORAB 5J3XA 1JF2A 1CB1A 3CZ1A 2K7OA 1YUUA 1SCMB 4UPGA 3SG2A 2KLDA 3OP0A 1TIZA 2MBXA 3SG5A 1TWOA 1OQPA 2GGZA 1GGZA 4OZDA 2L51A 1QWVA 1F54A 1GQMA 1TCFA 3JVTB 1B9AA 1DELA 1DJIA 3BUOB 2E30A 4MEWA 4OKHA 1J7RA 2IS9A 2OTGB 2L4IA 4FTGA 1BF5A 1B8RA 4JD9A 3JTDC 5I8NA 1BJFA 1YX7A 2P6BB 2QEBA 1PULA 3B7AA 1IKUA 5AEQA 1E8AA 1MR8A 1YVLA 2BNXA 3S0AA 3OB2B 1F8HA 1Q80A 3CR2A 1CLLA 4GBAA 3NSOA 1MF8B 2L98A 3KEVA 2BE6A 4JPZB 1DF0A 1XFZO 4MLWA 4N1GA 2BCAA 2JPOA 3CLNA 2LHIA 1AJ4A 3FWBA 3ZNIA 3FE6A 3TS5C 2MAZA 2AMIA 1C7VA 2JQ6A 5BPJA 2HQWA 2ZNEA 3BOWA 2O60A 1OE9B 3JVTC 4HRHA 3CZTX 5AANA 3O4YA 3OX6A 1F4QA 1QJTA 3F45A 3D78A 4PE4A 2HPSA 1Y1XA 1RWYA 3D76A 3AAKA 2WCEA 3NHIA 4PHNA 1H4BA 3GK4X 1DVIA 1UUSA 1JFKA 5D69A 2BKIB 2CNPA 1EJ3A 1JFJA 1DC1A 2QEHA 2BBNA 3CR5X 3S0FA 3S0EA 1DGVA 1LVCD 1TNQA 2JU0A 2QDIA 4YBHB 1MWNA 2PVBA 3BUXB 1CM1A 5PALA 1KK7Y 3CS1A 2F3ZA 4PHJA 3WHUB 1VRKA 1ZACA 1CFDA 4GGFA 4ZCUA 2LMTA 1OMVA 1EXRA 4FQOA 2YGUA 1M46A 3CGAA 1X02A 1K9PA 2LAPA 4ICBA 3FS7A 4OVNF 4XYNA 4F0ZB 2F3YA 3GK1A 5HKWA 2ZN9A 1B4CA 1QX7A 2MRDA 1RROA 5JOLA 1PVBA 4INWA 1TCOB 2D8NA 3AKBA 1K9KA 1SL8A 1YUTA 5D3OA 4DUQA 2JOJA 3SS5A 2FOTA 3I5HC 1FF1A 1IQ5A 3LK1A 1QTXA 4WQ3A 3HCMA 1CMGA 1PK0D 2Y1NA 2OS8B 3TUYB 5FI2A 2LVKA 3VRRA 1BU3A 2CT9A 2WCKA 1AP4A 1QS7A 1FI6A 4YRUA 1NUBA 1TRFA 2JT3A 2HF5A 4CPVA 2WORA 2KPHA 2RGIA 1QVIZ 3O2PA 3NHTA 3PJIA 3NXAA 1OOJA 2LVJA 3SG7A 2EC6B 2K2AA 2M0RA 1CTRA 2KQ6A 3K1EA 4TNCA 2Q4UA 1FBVA 2ZKMX 2FJYA 1PSBA 2GTEA 1ZUZA 2L50A 2SCPA 4DS7A 3D0YB 2WCFA 1IH0A 3CYZA 2QEOA 4AQIA 3EK4A 1UHKA
chains in the Genus database with same CATH topology
2LLSA 2SASA 1S1EA 1B7TY 2BECA 4U8DA 1CKKA 4PE1A 1CFPA 3I5IB 1KK7Z 1UHIA 2CBLA 1U5IB 1TN4A 3EVUA 2BCBA 2KYCA 1W7IB 1QX2A 1QLSA 2Y4QA 5JJGA 5KU1A 1BLQA 2KAYA 1H8BA 2CCMA 5HLOA 3RM1A 3NSIA 1EH2A 2NZ0A 1QIWA 3KO0A 1M45A 4P2YB 1RJVA 2LP2A 2LP3A 5HKYA 3RLZA 2M3WA 1UHNA 1XFVO 4GGNA 3ICBA 5CSNA 1KFXS 1MHOA 2H61A 2B1UA 3C1VA 2L5XB 5I2QA 1Y1UA 2Y1MA 2JWWA 5KSZA 3EK8A 2NLNA 1JWDA 3PM8A 4IL1A 2DOQA 1AHRA 1R6PA 1J7OA 4AQJA 1K94A 1QIVA 1WDCC 3I5IC 4I5NB 5TNCA 1KSOA 1PSRA 1B8CA 2O5GA 3JTDB 4I5KA 5HLVA 1QX5B 1IJ6A 1SW8A 3PATA 3BUWB 5ER5A 5GQQC 4QJ3B 1K96A 1WLMA 3FWCA 4M2PA 1G4YR 4I5JA 1JBAA 4C0JA 3LK0A 3OB1B 1S6JA 4GPLB 5AFPA 5I2LA 1HQVA 2LLUA 1A4PA 3SG4A 2NCPA 1F55A 3PN7B 3IF7A 2R2IA 4PE7A 2FJUB 3OHMB 2LCPA 3BYAA 2QPTA 3SG6A 2BKHB 4CIDA 1LINA 2M1KB 1JF0A 1J7QA 3EKJA 1N65A 3LL8B 1B47A 1DJXA 1QATA 1S5GZ 1OZOA 2KQYA 1RTP1 4M2OA 4CFQA 2JNXA 3QRXA 1M63B 2M97A 1TOPA 1YUSA 5CSIA 2AAOA 3VRNA 1L2OC 5F6TA 2COLB 1Y1AA 1TNWA 2M9GA 1UWOA 1FI5A 2MLFC 1SKTA 4C0LA 2KI4B 1K95A 4NDDA 1IQ3A 1SR6B 5DKQA 5CPVA 1CFFA 2Q91A 3CTNA 3GK2A 4XJKB 1CDMA 3TDZA 1WRLA 2K7CA 1KQMC 1NYAA 1SR6C 2HQ8A 1BODA 1MUXA 4OV2A 2FCEA 3SIBA 5AERA 3KF9A 4WRIA 3SJSA 1OSAA 1J1EA 4USLA 1NCXA 1WRKA 2BL0C 1OMRA 2JPTA 3BUNB 1SNLA 2M49B 2QACA 3IQOA 1A75A 1Y0VH 1IWQA 1UHJA 2V53A 4N5XA 4WQ2A 2KAVA 2KFFA 5I2OA 1DMOA 2G2BA 2LMUA 4GAOA 1S6CA 2FCDA 4YGDB 3VGOA 1XK4A 1IGVA 2ZFDA 3BOWB 3DF0B 3WXAA 1R2UA 1NCZA 1J7PA 1J1DA 1MXLC 2JXCA 4MRYA 1DF0B 1CFCA 2L0PA 1BMOA 1RK9A 2JZIA 1XO5A 4L9MA 2F2OA 3DVMA 3DF0A 4XJKA 2JNFA 2KYFA 3D10A 2MHHA 2KFGA 2EHBA 4A4BA 3PN7C 1IG5A 1CNPA 2L2EA 4AOMA 1NX1A 5D7FA 1SYMA 3MSEB 1XFUO 1XYDA 2GGMA 4YGAA 2I94A 1XA5A 1ALWA 2KBMA 3A4UB 1KWOC 1JUOA 4BY5A 2KGRA 1NX3A 3TZ1A 4NDCA 1JC2A 1CLBA 1RECA 1DJWA 2KI4C 4YGBB 1FPWA 1RFJA 2NCOA 2KSPA 4JQ0D 4PCWA 2KNEA 2LC5A 4GNKB 1KFXL 1QV0A 1SCMC 3WNXB 1CLMA 1M31A 1BR1B 2E6WA 4PALA 2MLEC 2M7LA 5K89A 1CDNA 2K0JA 4GUKA 1WY9A 1L7ZA 3O6BA 1KFUL 1FW4A 1SL7A 1V1FA 1KSMA 1PVAA 2PRUA 2JTTA 4NQGA 3SIAA 4DIRA 1IJ5A 2H2KA 4HREE 1YVHA 1BT6A 3DD4A 1GJYA 1DTLA 3LLEA 1UHHA 2K7DA 4MVFA 1KWOB 2MJWB 2ZRTA 1XK4C 2KOTA 4PDZA 3SG3A 2LMVA 2F33A 3WHTB 1KCYA 1IRJA 2PMYA 5DKRA 1N2DA 5G08A 1Y6WA 1L2OB 4MN0A 4PHKA 1J55A 1A2XA 4Q04A 4YGEB 1K90D 1NCYA 3E3RA 1MQ1A 1D1OA 1CM4A 4ETOA 1A75B 1B7TZ 3O78A 1S3PA 1K8UA 3CR4X 1WDCB 1NX0A 4QJ4B 2JC2A 3LCPC 2BCXA 2F2PA 4QJ5B 1W7JB 1NP8A 4ORBB 5CSFA 1NSHA 5HYDA 4CFRA 1U5IA 2HETA 3VROA 3DVEA 1SRAA 1QVIY 1YRTB 4D1EA 1MXEA 1N0YA 1YURA 5FYXA 3PFVA 4MRXA 4BY4A 2F8PA 1B8LA 1F70A 1YX8A 2LM5A 1OZSA 1SL9A 3EVVA 2WNDA 1DT7B 4YGCB 1SBJA 3AAJA 3NSLA 3VRQA 3DVKA 3FIAA 1XFXO 3DVJA 1K93D 2BE4A 1BG1A 2LANA 1WRZA 2Y5IA 1DJHA 2WC8A 1LXFC 2PALA 5ER4X 1NWDA 2KGBC 2K2FA 2JRFA 4C0KA 4GFTA 3EK7A 1CDLA 2CXJA 3I5HB 5IBWA 2I7AA 1YRUB 4YI9A 1ALVA 2JULA 1DJGA 1M39A 2LVIA 1SCVA 1GGWA 1KK8B 1F4OA 1EL4A 4CLNA 4OCIA 3BUMB 1SY9A 2ZNDA 1AVSA 2JXLA 4MZKA 1DJYA 4P5OE 1C7WA 2LUXA 1YTZC 1EG4A 2CTNA 2M1UA 2VRGA 3VRPA 3IQQA 2GV5A 2KHNA 3A8RA 1HT9A 3NSKA 4M2QA 1SMGA 2PSRA 3K21A 3PALA 1C07A 2K8MB 1AJ5A 1NX2A 2JT0A 2LUCA 3AKAA 1A29A 1ZMZA 1DGUA 4HRGA 1QV1A 1UURA 2JT8A 2ZRSA 4MSPA 5CSJA 1UP5A 2ISDA 2LHLA 4N1FA 3D0YA 1B1GA 1KK8C 1PRWA 2L4HA 4PHMA 1A03A 3I5FC 1EG3A 2EGDA 2LVVA 2EC6C 1K9UA 1PALA 1G8IA 3BXKA 5KTYA 2KI6C 2MA2A 3PSRA 1ZFSA 2H61C 2G9BA 2M8UA 4ORCB 5HKZA 1JSAA 2KDHA 1SPYA 2M7NA 2KAXA 2OS8C 3TUYC 4E68A 1TTXA 2WCBA 4GGFC 1CMFA 2A4JA 1YR5A 1LA0A 1NIWA 1S36A 1SK6D 2K7BA 3KPXA 2NXQA 4OR9B 1ODBA 3GOFA 1DJZA 4HSZA 1QXPA 3CWGA 4R1EA 4DCKA 3EKHA 3TS5B 4MZJA 2WOSA 2OTGC 4DRWA 1F71A 1S6IA 2JTZA 1CDPA 2TN4A 3I5FB 2KBIA 2BBMA 3M0WA 4MBEA 3BQ3A 2ZN8A 1WLZA 4JWQA 1ZOTB 1QASA 1KFUS 2I2RE 2KI6D 3PLFB 1TNPA 2PASA 3I5GC 1LKJA 1S26D 2K61A 3H4SE 4PE0A 5B8IB 1XFWO 4I5LB 1TNXA 1QLKA 2AUCA 4MZLA 3EVRA 3HX4A 2I18A 2LLTA 2LV7A 3ZWHA 2BL0B 2M29A 1V1GA 1G33A 1KQVA 1NPQA 1K2HA 5DKNA 4NDBA 3TDIA 3OX5A 4ZCVA 2OPOA 3I5GB 2LNKA 1LA3A 1S5GY 1BOCA 1XVJA 1AUIB 2KFHA 1OMDA 1AK8A 4YI8A 1KQMB 1XFYO 4A4CA 1BR4B 2LE9B 3KHEA 3TDUA 4ORAB 5J3XA 1JF2A 1CB1A 2K7OA 1YUUA 1SCMB 4UPGA 3SG2A 3OP0A 1TIZA 2MBXA 3SG5A 1OQPA 2GGZA 1GGZA 2L51A 1F54A 1GQMA 1TCFA 3JVTB 1B9AA 3BUOB 1DJIA 5AXIA 2E30A 4MEWA 4OKHA 1J7RA 2IS9A 2OTGB 2L4IA 4FTGA 1BF5A 1B8RA 3JTDC 5I8NA 1BJFA 1YX7A 2P6BB 1IKUA 1PULA 5AEQA 1E8AA 1MR8A 1YVLA 3OB2B 1F8HA 1Q80A 3CR2A 1CLLA 4GBAA 3NSOA 1MF8B 2L98A 3KEVA 2BE6A 4JPZB 1DF0A 1XFZO 4MLWA 4N1GA 2BCAA 3CLNA 2LHIA 1AJ4A 3FWBA 3ZNIA 3TS5C 2MAZA 2AMIA 1C7VA 2JQ6A 5BPJA 2HQWA 2ZNEA 3BOWA 2O60A 1OE9B 3JVTC 4HRHA 3CZTX 5AANA 3O4YA 3OX6A 1F4QA 1QJTA 3F45A 4PE4A 2HPSA 1Y1XA 1RWYA 3AAKA 2WCEA 4PHNA 1H4BA 3GK4X 1DVIA 1UUSA 1JFKA 5D69A 2BKIB 2CNPA 1EJ3A 1JFJA 2BBNA 3CR5X 1DGVA 1LVCD 1TNQA 2JU0A 4YBHB 1MWNA 2PVBA 3BUXB 1CM1A 5PALA 1KK7Y 3CS1A 2F3ZA 4PHJA 3WHUB 1VRKA 1ZACA 1CFDA 4GGFA 4ZCUA 2LMTA 1OMVA 1EXRA 4FQOA 1M46A 3CGAA 1X02A 1K9PA 2LAPA 4ICBA 3FS7A 4OVNF 4XYNA 4F0ZB 2F3YA 3GK1A 5HKWA 2ZN9A 1B4CA 1QX7A 2MRDA 1RROA 5JOLA 1PVBA 1TCOB 2D8NA 3AKBA 1K9KA 1SL8A 1YUTA 4DUQA 2JOJA 2FOTA 3I5HC 1FF1A 1IQ5A 3LK1A 1QTXA 4WQ3A 3HCMA 1CMGA 1PK0D 2Y1NA 2OS8B 3TUYB 2LVKA 3VRRA 1BU3A 2CT9A 1AP4A 1QS7A 1FI6A 4YRUA 1NUBA 1TRFA 2JT3A 2HF5A 4CPVA 2WORA 2RGIA 1QVIZ 3O2PA 3SG7A 3NXAA 1OOJA 2LVJA 2EC6B 2K2AA 2M0RA 1CTRA 2KQ6A 4TNCA 2Q4UA 1FBVA 2ZKMX 1PSBA 4DS7A 1ZUZA 2L50A 2SCPA 1IH0A 3D0YB 2WCFA 4AQIA 3EK4A 1UHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLS A;  2SAS A;  1S1E A;  1B7T Y;  2BEC A;  4U8D A;  1CKK A;  4PE1 A;  1CFP A;  3I5I B;  1KK7 Z;  1UHI A;  2CBL A;  1U5I B;  1TN4 A;  3EVU A;  2BCB A;  2KYC A;  1W7I B;  1QX2 A;  1QLS A;  2Y4Q A;  5JJG A;  5KU1 A;  1BLQ A;  2KAY A;  1H8B A;  2CCM A;  5HLO A;  3RM1 A;  3NSI A;  1EH2 A;  2NZ0 A;  1QIW A;  3KO0 A;  1M45 A;  4P2Y B;  1RJV A;  2LP2 A;  2LP3 A;  5HKY A;  3RLZ A;  2M3W A;  1UHN A;  1XFV O;  4GGN A;  3ICB A;  5CSN A;  1KFX S;  1MHO A;  2H61 A;  2B1U A;  3C1V A;  2L5X B;  5I2Q A;  1Y1U A;  2Y1M A;  2JWW A;  5KSZ A;  3EK8 A;  2NLN A;  1JWD A;  3PM8 A;  4IL1 A;  2DOQ A;  1AHR A;  1R6P A;  1J7O A;  4AQJ A;  1K94 A;  1QIV A;  1WDC C;  3I5I C;  4I5N B;  5TNC A;  1KSO A;  1PSR A;  1B8C A;  2O5G A;  3JTD B;  4I5K A;  5HLV A;  1QX5 B;  1IJ6 A;  1SW8 A;  3PAT A;  3BUW B;  5ER5 A;  5GQQ C;  4QJ3 B;  1K96 A;  1WLM A;  3FWC A;  4M2P A;  1G4Y R;  4I5J A;  1JBA A;  4C0J A;  3LK0 A;  3OB1 B;  1S6J A;  4GPL B;  5AFP A;  5I2L A;  1HQV A;  2LLU A;  1A4P A;  3SG4 A;  2NCP A;  1F55 A;  3PN7 B;  3IF7 A;  2R2I A;  4PE7 A;  2FJU B;  3OHM B;  2LCP A;  3BYA A;  2QPT A;  3SG6 A;  2BKH B;  4CID A;  1LIN A;  2M1K B;  1JF0 A;  1J7Q A;  3EKJ A;  1N65 A;  3LL8 B;  1B47 A;  1DJX A;  1QAT A;  1S5G Z;  1OZO A;  2KQY A;  1RTP 1;  4M2O A;  4CFQ A;  2JNX A;  3QRX A;  1M63 B;  2M97 A;  1TOP A;  1YUS A;  5CSI A;  2AAO A;  3VRN A;  1L2O C;  5F6T A;  2COL B;  1Y1A A;  1TNW A;  2M9G A;  1UWO A;  1FI5 A;  2MLF C;  1SKT A;  4C0L A;  2KI4 B;  1K95 A;  4NDD A;  1IQ3 A;  1SR6 B;  5DKQ A;  5CPV A;  1CFF A;  2Q91 A;  3CTN A;  3GK2 A;  4XJK B;  1CDM A;  3TDZ A;  1WRL A;  2K7C A;  1KQM C;  1NYA A;  1SR6 C;  2HQ8 A;  1BOD A;  1MUX A;  4OV2 A;  2FCE A;  3SIB A;  5AER A;  3KF9 A;  4WRI A;  3SJS A;  1OSA A;  1J1E A;  4USL A;  1NCX A;  1WRK A;  2BL0 C;  1OMR A;  2JPT A;  3BUN B;  1SNL A;  2M49 B;  2QAC A;  3IQO A;  1A75 A;  1Y0V H;  1IWQ A;  1UHJ A;  2V53 A;  4N5X A;  4WQ2 A;  2KAV A;  2KFF A;  5I2O A;  1DMO A;  2G2B A;  2LMU A;  4GAO A;  1S6C A;  2FCD A;  4YGD B;  3VGO A;  1XK4 A;  1IGV A;  2ZFD A;  3BOW B;  3DF0 B;  3WXA A;  1R2U A;  1NCZ A;  1J7P A;  1J1D A;  1MXL C;  2JXC A;  4MRY A;  1DF0 B;  1CFC A;  2L0P A;  1BMO A;  1RK9 A;  2JZI A;  1XO5 A;  4L9M A;  2F2O A;  3DVM A;  3DF0 A;  4XJK A;  2JNF A;  2KYF A;  3D10 A;  2MHH A;  2KFG A;  2EHB A;  4A4B A;  3PN7 C;  1IG5 A;  1CNP A;  2L2E A;  4AOM A;  1NX1 A;  5D7F A;  1SYM A;  3MSE B;  1XFU O;  1XYD A;  2GGM A;  4YGA A;  2I94 A;  1XA5 A;  1ALW A;  2KBM A;  3A4U B;  1KWO C;  1JUO A;  4BY5 A;  2KGR A;  1NX3 A;  3TZ1 A;  4NDC A;  1JC2 A;  1CLB A;  1REC A;  1DJW A;  2KI4 C;  4YGB B;  1FPW A;  1RFJ A;  2NCO A;  2KSP A;  4JQ0 D;  4PCW A;  2KNE A;  2LC5 A;  4GNK B;  1KFX L;  1QV0 A;  1SCM C;  3WNX B;  1CLM A;  1M31 A;  1BR1 B;  2E6W A;  4PAL A;  2MLE C;  2M7L A;  5K89 A;  1CDN A;  2K0J A;  4GUK A;  1WY9 A;  1L7Z A;  3O6B A;  1KFU L;  1FW4 A;  1SL7 A;  1V1F A;  1KSM A;  1PVA A;  2PRU A;  2JTT A;  4NQG A;  3SIA A;  4DIR A;  1IJ5 A;  2H2K A;  4HRE E;  1YVH A;  1BT6 A;  3DD4 A;  1GJY A;  1DTL A;  3LLE A;  1UHH A;  2K7D A;  4MVF A;  1KWO B;  2MJW B;  2ZRT A;  1XK4 C;  2KOT A;  4PDZ A;  3SG3 A;  2LMV A;  2F33 A;  3WHT B;  1KCY A;  1IRJ A;  2PMY A;  5DKR A;  1N2D A;  5G08 A;  1Y6W A;  1L2O B;  4MN0 A;  4PHK A;  1J55 A;  1A2X A;  4Q04 A;  4YGE B;  1K90 D;  1NCY A;  3E3R A;  1MQ1 A;  1D1O A;  1CM4 A;  4ETO A;  1A75 B;  1B7T Z;  3O78 A;  1S3P A;  1K8U A;  3CR4 X;  1WDC B;  1NX0 A;  4QJ4 B;  2JC2 A;  3LCP C;  2BCX A;  2F2P A;  4QJ5 B;  1W7J B;  1NP8 A;  4ORB B;  5CSF A;  1NSH A;  5HYD A;  4CFR A;  1U5I A;  2HET A;  3VRO A;  3DVE A;  1SRA A;  1QVI Y;  1YRT B;  4D1E A;  1MXE A;  1N0Y A;  1YUR A;  5FYX A;  3PFV A;  4MRX A;  4BY4 A;  2F8P A;  1B8L A;  1F70 A;  1YX8 A;  2LM5 A;  1OZS A;  1SL9 A;  3EVV A;  2WND A;  1DT7 B;  4YGC B;  1SBJ A;  3AAJ A;  3NSL A;  3VRQ A;  3DVK A;  3FIA A;  1XFX O;  3DVJ A;  1K93 D;  2BE4 A;  1BG1 A;  2LAN A;  1WRZ A;  2Y5I A;  1DJH A;  2WC8 A;  1LXF C;  2PAL A;  5ER4 X;  1NWD A;  2KGB C;  2K2F A;  2JRF A;  4C0K A;  4GFT A;  3EK7 A;  1CDL A;  2CXJ A;  3I5H B;  5IBW A;  2I7A A;  1YRU B;  4YI9 A;  1ALV A;  2JUL A;  1DJG A;  1M39 A;  2LVI A;  1SCV A;  1GGW A;  1KK8 B;  1F4O A;  1EL4 A;  4CLN A;  4OCI A;  3BUM B;  1SY9 A;  2ZND A;  1AVS A;  2JXL A;  4MZK A;  1DJY A;  4P5O E;  1C7W A;  2LUX A;  1YTZ C;  1EG4 A;  2CTN A;  2M1U A;  2VRG A;  3VRP A;  3IQQ A;  2GV5 A;  2KHN A;  3A8R A;  1HT9 A;  3NSK A;  4M2Q A;  1SMG A;  2PSR A;  3K21 A;  3PAL A;  1C07 A;  2K8M B;  1AJ5 A;  1NX2 A;  2JT0 A;  2LUC A;  3AKA A;  1A29 A;  1ZMZ A;  1DGU A;  4HRG A;  1QV1 A;  1UUR A;  2JT8 A;  2ZRS A;  4MSP A;  5CSJ A;  1UP5 A;  2ISD A;  2LHL A;  4N1F A;  3D0Y A;  1B1G A;  1KK8 C;  1PRW A;  2L4H A;  4PHM A;  1A03 A;  3I5F C;  1EG3 A;  2EGD A;  2LVV A;  2EC6 C;  1K9U A;  1PAL A;  1G8I A;  3BXK A;  5KTY A;  2KI6 C;  2MA2 A;  3PSR A;  1ZFS A;  2H61 C;  2G9B A;  2M8U A;  4ORC B;  5HKZ A;  1JSA A;  2KDH A;  1SPY A;  2M7N A;  2KAX A;  2OS8 C;  3TUY C;  4E68 A;  1TTX A;  2WCB A;  4GGF C;  1CMF A;  2A4J A;  1YR5 A;  1LA0 A;  1NIW A;  1S36 A;  1SK6 D;  2K7B A;  3KPX A;  2NXQ A;  4OR9 B;  1ODB A;  3GOF A;  1DJZ A;  4HSZ A;  1QXP A;  3CWG A;  4R1E A;  4DCK A;  3EKH A;  3TS5 B;  4MZJ A;  2WOS A;  2OTG C;  4DRW A;  1F71 A;  1S6I A;  2JTZ A;  1CDP A;  2TN4 A;  3I5F B;  2KBI A;  2BBM A;  3M0W A;  4MBE A;  3BQ3 A;  2ZN8 A;  1WLZ A;  4JWQ A;  1ZOT B;  1QAS A;  1KFU S;  2I2R E;  2KI6 D;  3PLF B;  1TNP A;  2PAS A;  3I5G C;  1LKJ A;  1S26 D;  2K61 A;  3H4S E;  4PE0 A;  5B8I B;  1XFW O;  4I5L B;  1TNX A;  1QLK A;  2AUC A;  4MZL A;  3EVR A;  3HX4 A;  2I18 A;  2LLT A;  2LV7 A;  3ZWH A;  2BL0 B;  2M29 A;  1V1G A;  1G33 A;  1KQV A;  1NPQ A;  1K2H A;  5DKN A;  4NDB A;  3TDI A;  3OX5 A;  4ZCV A;  2OPO A;  3I5G B;  2LNK A;  1LA3 A;  1S5G Y;  1BOC A;  1XVJ A;  1AUI B;  2KFH A;  1OMD A;  1AK8 A;  4YI8 A;  1KQM B;  1XFY O;  4A4C A;  1BR4 B;  2LE9 B;  3KHE A;  3TDU A;  4ORA B;  5J3X A;  1JF2 A;  1CB1 A;  2K7O A;  1YUU A;  1SCM B;  4UPG A;  3SG2 A;  3OP0 A;  1TIZ A;  2MBX A;  3SG5 A;  1OQP A;  2GGZ A;  1GGZ A;  2L51 A;  1F54 A;  1GQM A;  1TCF A;  3JVT B;  1B9A A;  3BUO B;  1DJI A;  5AXI A;  2E30 A;  4MEW A;  4OKH A;  1J7R A;  2IS9 A;  2OTG B;  2L4I A;  4FTG A;  1BF5 A;  1B8R A;  3JTD C;  5I8N A;  1BJF A;  1YX7 A;  2P6B B;  1IKU A;  1PUL A;  5AEQ A;  1E8A A;  1MR8 A;  1YVL A;  3OB2 B;  1F8H A;  1Q80 A;  3CR2 A;  1CLL A;  4GBA A;  3NSO A;  1MF8 B;  2L98 A;  3KEV A;  2BE6 A;  4JPZ B;  1DF0 A;  1XFZ O;  4MLW A;  4N1G A;  2BCA A;  3CLN A;  2LHI A;  1AJ4 A;  3FWB A;  3ZNI A;  3TS5 C;  2MAZ A;  2AMI A;  1C7V A;  2JQ6 A;  5BPJ A;  2HQW A;  2ZNE A;  3BOW A;  2O60 A;  1OE9 B;  3JVT C;  4HRH A;  3CZT X;  5AAN A;  3O4Y A;  3OX6 A;  1F4Q A;  1QJT A;  3F45 A;  4PE4 A;  2HPS A;  1Y1X A;  1RWY A;  3AAK A;  2WCE A;  4PHN A;  1H4B A;  3GK4 X;  1DVI A;  1UUS A;  1JFK A;  5D69 A;  2BKI B;  2CNP A;  1EJ3 A;  1JFJ A;  2BBN A;  3CR5 X;  1DGV A;  1LVC D;  1TNQ A;  2JU0 A;  4YBH B;  1MWN A;  2PVB A;  3BUX B;  1CM1 A;  5PAL A;  1KK7 Y;  3CS1 A;  2F3Z A;  4PHJ A;  3WHU B;  1VRK A;  1ZAC A;  1CFD A;  4GGF A;  4ZCU A;  2LMT A;  1OMV A;  1EXR A;  4FQO A;  1M46 A;  3CGA A;  1X02 A;  1K9P A;  2LAP A;  4ICB A;  3FS7 A;  4OVN F;  4XYN A;  4F0Z B;  2F3Y A;  3GK1 A;  5HKW A;  2ZN9 A;  1B4C A;  1QX7 A;  2MRD A;  1RRO A;  5JOL A;  1PVB A;  1TCO B;  2D8N A;  3AKB A;  1K9K A;  1SL8 A;  1YUT A;  4DUQ A;  2JOJ A;  2FOT A;  3I5H C;  1FF1 A;  1IQ5 A;  3LK1 A;  1QTX A;  4WQ3 A;  3HCM A;  1CMG A;  1PK0 D;  2Y1N A;  2OS8 B;  3TUY B;  2LVK A;  3VRR A;  1BU3 A;  2CT9 A;  1AP4 A;  1QS7 A;  1FI6 A;  4YRU A;  1NUB A;  1TRF A;  2JT3 A;  2HF5 A;  4CPV A;  2WOR A;  2RGI A;  1QVI Z;  3O2P A;  3SG7 A;  3NXA A;  1OOJ A;  2LVJ A;  2EC6 B;  2K2A A;  2M0R A;  1CTR A;  2KQ6 A;  4TNC A;  2Q4U A;  1FBV A;  2ZKM X;  1PSB A;  4DS7 A;  1ZUZ A;  2L50 A;  2SCP A;  1IH0 A;  3D0Y B;  2WCF A;  4AQI A;  3EK4 A;  1UHK A; 
#chains in the Genus database with same CATH topology
 2L5Y A;  2LLS A;  4OR9 B;  2SAS A;  1S1E A;  1B7T Y;  2BEC A;  4U8D A;  3BFH A;  1CKK A;  4PE1 A;  1CFP A;  3I5I B;  1KK7 Z;  1UHI A;  2CBL A;  1U5I B;  1TN4 A;  3EVU A;  2BCB A;  2KYC A;  1W7I B;  2WCJ A;  1QX2 A;  1QLS A;  2Y4Q A;  5JJG A;  5KU1 A;  1BLQ A;  2KAY A;  1H8B A;  2CCM A;  5HLO A;  3R1O A;  3RM1 A;  2BAP A;  3NSI A;  1EH2 A;  2NZ0 A;  3B86 A;  1QIW A;  3KO0 A;  1M45 A;  4JKT A;  4P2Y B;  1RJV A;  2LP2 A;  2LP3 A;  5HKY A;  3QME A;  3RLZ A;  2M3W A;  1UHN A;  1XFV O;  4GGN A;  3ICB A;  5CSN A;  1KFX S;  1MHO A;  2H61 A;  2B1U A;  3C1V A;  2L5X B;  5I2Q A;  1Y1U A;  2Y1M A;  2JWW A;  5KSZ A;  3EK8 A;  2NLN A;  1JWD A;  3PM8 A;  4IL1 A;  2DOQ A;  1AHR A;  1R6P A;  1J7O A;  4AQJ A;  1K94 A;  1QIV A;  1WDC C;  3FE9 A;  3I5I C;  4I5N B;  5TNC A;  1KSO A;  1PSR A;  1B8C A;  2O5G A;  3JTD B;  4I5K A;  5HLV A;  1QX5 B;  1IJ6 A;  3PM2 A;  1SW8 A;  3PAT A;  3BUW B;  5ER5 A;  3BFA A;  5GQQ C;  4QJ3 B;  1K96 A;  1WLM A;  3FWC A;  4M2P A;  1G4Y R;  4I5J A;  1JBA A;  4C0J A;  3LK0 A;  3OB1 B;  3VB1 A;  1S6J A;  4GPL B;  5AFP A;  3UO9 A;  5I2L A;  1HQV A;  2LLU A;  1A4P A;  3SG4 A;  2NCP A;  1F55 A;  3D74 A;  3PN7 B;  3IF7 A;  2R2I A;  4PE7 A;  2FJU B;  3OHM B;  2LCP A;  3BYA A;  2QPT A;  3SG6 A;  2BKH B;  4CID A;  1LIN A;  2M1K B;  1JF0 A;  1J7Q A;  3EKJ A;  1N65 A;  3LL8 B;  3V2L A;  1TUZ A;  1B47 A;  1DJX A;  1QAT A;  1S5G Z;  3N7H A;  2L2C A;  1OZO A;  2KQY A;  1RTP 1;  4M2O A;  2ERB A;  4CFQ A;  2JNX A;  3QRX A;  1M63 B;  2M97 A;  1TOP A;  1YUS A;  5CSI A;  2AAO A;  3VRN A;  1L2O C;  5F6T A;  2COL B;  1Y1A A;  1TNW A;  2M9G A;  1UWO A;  1FI5 A;  2MLF C;  1SKT A;  5FI6 A;  4C0L A;  2KI4 B;  1K95 A;  2PYQ A;  4NDD A;  1IQ3 A;  1SR6 B;  2KLE A;  5DKQ A;  3S0D A;  5CPV A;  1CFF A;  2Q91 A;  4IJ7 A;  3CTN A;  3GK2 A;  4XJK B;  1CDM A;  3TDZ A;  1WRL A;  3CZ2 A;  2K7C A;  1KQM C;  1NYA A;  1SR6 C;  2HQ8 A;  1BOD A;  1MUX A;  4OV2 A;  3RZS A;  2FCE A;  3SIB A;  5AER A;  3KF9 A;  4WRI A;  5I94 A;  3DZT A;  3SJS A;  1OSA A;  1J1E A;  4USL A;  1Z4H A;  3D77 A;  1NCX A;  1OOF A;  1WRK A;  1OMR A;  1XFR A;  2BL0 C;  2JPT A;  3BUN B;  4KYN A;  1SNL A;  2M49 B;  2QAC A;  3IQO A;  2K60 A;  1A75 A;  1Y0V H;  1IWQ A;  1UHJ A;  2V53 A;  4N5X A;  4WQ2 A;  2KAV A;  2KFF A;  5I2O A;  1DMO A;  2G2B A;  2LMU A;  4GAO A;  1S6C A;  2FCD A;  4YGD B;  3VGO A;  1XK4 A;  1IGV A;  2ZFD A;  3BOW B;  3DF0 B;  3WXA A;  1R2U A;  1NCZ A;  1J7P A;  1J1D A;  1MXL C;  2JXC A;  3OBV A;  4MRY A;  1DF0 B;  1CFC A;  2L0P A;  1BMO A;  1RK9 A;  2JZI A;  1XO5 A;  4L9M A;  2F2O A;  3DVM A;  3DF0 A;  4XJK A;  2JNF A;  2KYF A;  3D10 A;  2MHH A;  2KFG A;  2EHB A;  3L47 A;  4A4B A;  3PN7 C;  1IG5 A;  1CNP A;  2L2E A;  3S0B A;  1NX1 A;  5D7F A;  4AOM A;  1P28 A;  1SYM A;  1XFU O;  3MSE B;  1XYD A;  2GGM A;  3DYE A;  4YGA A;  2I94 A;  1XA5 A;  1ALW A;  2KBM A;  3A4U B;  1KWO C;  1JUO A;  4BY5 A;  2KGR A;  1NX3 A;  3TZ1 A;  4NDC A;  1JC2 A;  1CLB A;  1REC A;  1DJW A;  2KI4 C;  4YGB B;  1FPW A;  1RFJ A;  3NGV A;  2NCO A;  2KSP A;  4JQ0 D;  3DY9 A;  4PCW A;  2KNE A;  2LC5 A;  4GNK B;  1KFX L;  1QV0 A;  3CAB A;  1SCM C;  2WCM A;  3WNX B;  3CZ0 A;  1CLM A;  1M31 A;  1BR1 B;  2E6W A;  4PAL A;  2MLE C;  2M7L A;  5K89 A;  1CDN A;  2K0J A;  4GUK A;  1WY9 A;  1L7Z A;  3O6B A;  1KFU L;  1FW4 A;  1SL7 A;  1V1F A;  3R1V A;  1KSM A;  1PVA A;  2PRU A;  2JTT A;  4NQG A;  3SIA A;  4DIR A;  1IJ5 A;  2H2K A;  4HRE E;  1YVH A;  1BT6 A;  3DD4 A;  1GJY A;  1DTL A;  3LLE A;  1UHH A;  2K7D A;  4MVF A;  1C3Y A;  1KWO B;  2MJW B;  2ZRT A;  1XK4 C;  3UNW A;  2KOT A;  4PDZ A;  3SG3 A;  2LMV A;  2F33 A;  3WHT B;  1KCY A;  3OGN A;  1IRJ A;  2PMY A;  3L4A A;  5FI7 A;  5DKR A;  1N2D A;  5G08 A;  1OOI X;  1Y6W A;  1L2O B;  4MN0 A;  3BFB A;  4PHK A;  1J55 A;  1A2X A;  4Q04 A;  4YGE B;  1K90 D;  1NCY A;  3E3R A;  1MQ1 A;  1LS8 A;  2H8V A;  1D1O A;  1CM4 A;  4ETO A;  1A75 B;  1B7T Z;  3O78 A;  1S3P A;  1K8U A;  3CR4 X;  1WDC B;  1NX0 A;  4QJ4 B;  2JC2 A;  3LCP C;  2BCX A;  2F2P A;  2P70 A;  4QJ5 B;  1W7J B;  3D73 A;  1NP8 A;  4ORB B;  5CSF A;  1NSH A;  5HYD A;  4CFR A;  1U5I A;  2HET A;  3VRO A;  3DVE A;  1SRA A;  1QVI Y;  1YRT B;  4D1E A;  1MXE A;  1N0Y A;  3SS3 A;  1YUR A;  5FYX A;  3PFV A;  4MRX A;  4BY4 A;  2F8P A;  1B8L A;  1F70 A;  1YX8 A;  2LM5 A;  1OZS A;  1SL9 A;  3EVV A;  2WND A;  1DT7 B;  4YGC B;  1SBJ A;  3AAJ A;  3NSL A;  3VRQ A;  3DVK A;  3FIA A;  1XFX O;  3DVJ A;  1K93 D;  2BE4 A;  1BG1 A;  5EL2 A;  2LAN A;  1WRZ A;  2QEV A;  2Y5I A;  1T14 A;  1DJH A;  2WC8 A;  1LXF C;  2PAL A;  3DXL A;  1NWD A;  5ER4 X;  2KGB C;  2K2F A;  2JRF A;  2P71 A;  4C0K A;  4GFT A;  3EK7 A;  1CDL A;  2CXJ A;  3I5H B;  5IBW A;  2I7A A;  3EG5 B;  1YRU B;  1GM0 A;  4YI9 A;  1ALV A;  2JUL A;  1DJG A;  1M39 A;  2LVI A;  1SCV A;  1GGW A;  1KK8 B;  1F4O A;  1EL4 A;  4CLN A;  1ORG A;  4OCI A;  3BUM B;  1SY9 A;  2ZND A;  1AVS A;  2JXL A;  4FQT A;  1DJY A;  4MZK A;  4P5O E;  3BJH A;  1C7W A;  2LUX A;  3B6X A;  1YTZ C;  1EG4 A;  2CTN A;  2M1U A;  2VRG A;  3VRP A;  3IQQ A;  2GV5 A;  2KHN A;  3A8R A;  1HT9 A;  3NSK A;  4M2Q A;  1SMG A;  2PSR A;  3K21 A;  1SSE B;  3PAL A;  2K8M B;  1C07 A;  1AJ5 A;  1NX2 A;  2JT0 A;  2LUC A;  3AKA A;  1TUJ A;  1A29 A;  1ZMZ A;  1DGU A;  2WCH A;  4HRG A;  1QV1 A;  1UUR A;  2JT8 A;  1OW4 A;  2ZRS A;  4MSP A;  5CSJ A;  1UP5 A;  2ISD A;  2LHL A;  4N1F A;  3D0Y A;  1B1G A;  1KK8 C;  1PRW A;  2L4H A;  4PHM A;  1A03 A;  3I5F C;  3B87 A;  3B88 A;  3SS4 A;  1EG3 A;  2EGD A;  2LVV A;  2EC6 C;  4F7F A;  1K9U A;  1PAL A;  1G8I A;  3BXK A;  1DEK A;  3CDN A;  2KI6 C;  5KTY A;  2MA2 A;  3PSR A;  1ZFS A;  2H61 C;  2G9B A;  2M8U A;  3O4X A;  4ORC B;  5HKZ A;  2KDH A;  1JSA A;  4PT1 A;  1SPY A;  2M7N A;  2KAX A;  2OS8 C;  3TUY C;  4E68 A;  1TTX A;  2WCB A;  4GGF C;  3D75 A;  1CMF A;  2A4J A;  1YR5 A;  1LA0 A;  1NIW A;  1DQE A;  1S36 A;  1SK6 D;  2K7B A;  2NXQ A;  3KPX A;  1ODB A;  3GOF A;  1DJZ A;  4HSZ A;  5HL1 A;  1QXP A;  3CWG A;  4R1E A;  1C3Z A;  5DIC A;  4DCK A;  3EKH A;  3TS5 B;  4MZJ A;  2WOS A;  2OTG C;  4DRW A;  3R72 A;  3S0G A;  1F71 A;  1S6I A;  2JTZ A;  1CDP A;  2TN4 A;  3I5F B;  2KBI A;  2BBM A;  3M0W A;  4MBE A;  3BQ3 A;  2ZN8 A;  1WLZ A;  4JWQ A;  1ZOT B;  1OOH A;  1QAS A;  1KFU S;  2I2R E;  2KI6 D;  3PLF B;  3R1P A;  1TNP A;  2PAS A;  3I5G C;  1LKJ A;  1S26 D;  2K61 A;  3H4S E;  4PE0 A;  5B8I B;  1XFW O;  4I5L B;  1TNX A;  1QLK A;  2AUC A;  4MZL A;  3EVR A;  3HX4 A;  2I18 A;  2LLT A;  2LV7 A;  2WC6 A;  3FE8 A;  2WCL A;  3ZWH A;  3Q8I A;  2BL0 B;  3L4L A;  2PQL A;  1W9Z A;  2M29 A;  1V1G A;  1G33 A;  1Z2C B;  5AXI A;  1NPQ A;  1K2H A;  1KQV A;  3IVT A;  5DKN A;  4NDB A;  3TDI A;  3OX5 A;  4ZCV A;  1OOG A;  2OPO A;  3I5G B;  2LNK A;  1LA3 A;  1S5G Y;  1BOC A;  2WC5 A;  1XVJ A;  1AUI B;  2KFH A;  1OMD A;  1AK8 A;  4INX A;  4YI8 A;  1KQM B;  1XFY O;  4A4C A;  1IIO A;  1BR4 B;  2LE9 B;  3KHE A;  3TDU A;  4ORA B;  5J3X A;  1JF2 A;  1CB1 A;  3CZ1 A;  2K7O A;  1YUU A;  1SCM B;  4UPG A;  3SG2 A;  2KLD A;  3OP0 A;  1TIZ A;  2MBX A;  3SG5 A;  1TWO A;  1OQP A;  2GGZ A;  1GGZ A;  4OZD A;  2L51 A;  1QWV A;  1F54 A;  1GQM A;  1TCF A;  3JVT B;  1B9A A;  1DEL A;  1DJI A;  3BUO B;  2E30 A;  4MEW A;  4OKH A;  1J7R A;  2IS9 A;  2OTG B;  2L4I A;  4FTG A;  1BF5 A;  1B8R A;  4JD9 A;  3JTD C;  5I8N A;  1BJF A;  1YX7 A;  2P6B B;  2QEB A;  1PUL A;  3B7A A;  1IKU A;  5AEQ A;  1E8A A;  1MR8 A;  1YVL A;  2BNX A;  3S0A A;  3OB2 B;  1F8H A;  1Q80 A;  3CR2 A;  1CLL A;  4GBA A;  3NSO A;  1MF8 B;  2L98 A;  3KEV A;  2BE6 A;  4JPZ B;  1DF0 A;  1XFZ O;  4MLW A;  4N1G A;  2BCA A;  2JPO A;  3CLN A;  2LHI A;  1AJ4 A;  3FWB A;  3ZNI A;  3FE6 A;  3TS5 C;  2MAZ A;  2AMI A;  1C7V A;  2JQ6 A;  5BPJ A;  2HQW A;  2ZNE A;  3BOW A;  2O60 A;  1OE9 B;  3JVT C;  4HRH A;  3CZT X;  5AAN A;  3O4Y A;  3OX6 A;  1F4Q A;  1QJT A;  3F45 A;  3D78 A;  4PE4 A;  2HPS A;  1Y1X A;  1RWY A;  3D76 A;  3AAK A;  2WCE A;  3NHI A;  4PHN A;  1H4B A;  3GK4 X;  1DVI A;  1UUS A;  1JFK A;  5D69 A;  2BKI B;  2CNP A;  1EJ3 A;  1JFJ A;  1DC1 A;  2QEH A;  2BBN A;  3CR5 X;  3S0F A;  3S0E A;  1DGV A;  1LVC D;  1TNQ A;  2JU0 A;  2QDI A;  4YBH B;  1MWN A;  2PVB A;  3BUX B;  1CM1 A;  5PAL A;  1KK7 Y;  3CS1 A;  2F3Z A;  4PHJ A;  3WHU B;  1VRK A;  1ZAC A;  1CFD A;  4GGF A;  4ZCU A;  2LMT A;  1OMV A;  1EXR A;  4FQO A;  2YGU A;  1M46 A;  3CGA A;  1X02 A;  1K9P A;  2LAP A;  4ICB A;  3FS7 A;  4OVN F;  4XYN A;  4F0Z B;  2F3Y A;  3GK1 A;  5HKW A;  2ZN9 A;  1B4C A;  1QX7 A;  2MRD A;  1RRO A;  5JOL A;  1PVB A;  4INW A;  1TCO B;  2D8N A;  3AKB A;  1K9K A;  1SL8 A;  1YUT A;  5D3O A;  4DUQ A;  2JOJ A;  3SS5 A;  2FOT A;  3I5H C;  1FF1 A;  1IQ5 A;  3LK1 A;  1QTX A;  4WQ3 A;  3HCM A;  1CMG A;  1PK0 D;  2Y1N A;  2OS8 B;  3TUY B;  5FI2 A;  2LVK A;  3VRR A;  1BU3 A;  2CT9 A;  2WCK A;  1AP4 A;  1QS7 A;  1FI6 A;  4YRU A;  1NUB A;  1TRF A;  2JT3 A;  2HF5 A;  4CPV A;  2WOR A;  2KPH A;  2RGI A;  1QVI Z;  3O2P A;  3NHT A;  3PJI A;  3NXA A;  1OOJ A;  2LVJ A;  3SG7 A;  2EC6 B;  2K2A A;  2M0R A;  1CTR A;  2KQ6 A;  3K1E A;  4TNC A;  2Q4U A;  1FBV A;  2ZKM X;  2FJY A;  1PSB A;  2GTE A;  1ZUZ A;  2L50 A;  2SCP A;  4DS7 A;  3D0Y B;  2WCF A;  1IH0 A;  3CYZ A;  2QEO A;  4AQI A;  3EK4 A;  1UHK A; 
#chains in the Genus database with same CATH homology
 2LLS A;  2SAS A;  1S1E A;  1B7T Y;  2BEC A;  4U8D A;  1CKK A;  4PE1 A;  1CFP A;  3I5I B;  1KK7 Z;  1UHI A;  2CBL A;  1U5I B;  1TN4 A;  3EVU A;  2BCB A;  2KYC A;  1W7I B;  1QX2 A;  1QLS A;  2Y4Q A;  5JJG A;  5KU1 A;  1BLQ A;  2KAY A;  1H8B A;  2CCM A;  5HLO A;  3RM1 A;  3NSI A;  1EH2 A;  2NZ0 A;  1QIW A;  3KO0 A;  1M45 A;  4P2Y B;  1RJV A;  2LP2 A;  2LP3 A;  5HKY A;  3RLZ A;  2M3W A;  1UHN A;  1XFV O;  4GGN A;  3ICB A;  5CSN A;  1KFX S;  1MHO A;  2H61 A;  2B1U A;  3C1V A;  2L5X B;  5I2Q A;  1Y1U A;  2Y1M A;  2JWW A;  5KSZ A;  3EK8 A;  2NLN A;  1JWD A;  3PM8 A;  4IL1 A;  2DOQ A;  1AHR A;  1R6P A;  1J7O A;  4AQJ A;  1K94 A;  1QIV A;  1WDC C;  3I5I C;  4I5N B;  5TNC A;  1KSO A;  1PSR A;  1B8C A;  2O5G A;  3JTD B;  4I5K A;  5HLV A;  1QX5 B;  1IJ6 A;  1SW8 A;  3PAT A;  3BUW B;  5ER5 A;  5GQQ C;  4QJ3 B;  1K96 A;  1WLM A;  3FWC A;  4M2P A;  1G4Y R;  4I5J A;  1JBA A;  4C0J A;  3LK0 A;  3OB1 B;  1S6J A;  4GPL B;  5AFP A;  5I2L A;  1HQV A;  2LLU A;  1A4P A;  3SG4 A;  2NCP A;  1F55 A;  3PN7 B;  3IF7 A;  2R2I A;  4PE7 A;  2FJU B;  3OHM B;  2LCP A;  3BYA A;  2QPT A;  3SG6 A;  2BKH B;  4CID A;  1LIN A;  2M1K B;  1JF0 A;  1J7Q A;  3EKJ A;  1N65 A;  3LL8 B;  1B47 A;  1DJX A;  1QAT A;  1S5G Z;  1OZO A;  2KQY A;  1RTP 1;  4M2O A;  4CFQ A;  2JNX A;  3QRX A;  1M63 B;  2M97 A;  1TOP A;  1YUS A;  5CSI A;  2AAO A;  3VRN A;  1L2O C;  5F6T A;  2COL B;  1Y1A A;  1TNW A;  2M9G A;  1UWO A;  1FI5 A;  2MLF C;  1SKT A;  4C0L A;  2KI4 B;  1K95 A;  4NDD A;  1IQ3 A;  1SR6 B;  5DKQ A;  5CPV A;  1CFF A;  2Q91 A;  3CTN A;  3GK2 A;  4XJK B;  1CDM A;  3TDZ A;  1WRL A;  2K7C A;  1KQM C;  1NYA A;  1SR6 C;  2HQ8 A;  1BOD A;  1MUX A;  4OV2 A;  2FCE A;  3SIB A;  5AER A;  3KF9 A;  4WRI A;  3SJS A;  1OSA A;  1J1E A;  4USL A;  1NCX A;  1WRK A;  2BL0 C;  1OMR A;  2JPT A;  3BUN B;  1SNL A;  2M49 B;  2QAC A;  3IQO A;  1A75 A;  1Y0V H;  1IWQ A;  1UHJ A;  2V53 A;  4N5X A;  4WQ2 A;  2KAV A;  2KFF A;  5I2O A;  1DMO A;  2G2B A;  2LMU A;  4GAO A;  1S6C A;  2FCD A;  4YGD B;  3VGO A;  1XK4 A;  1IGV A;  2ZFD A;  3BOW B;  3DF0 B;  3WXA A;  1R2U A;  1NCZ A;  1J7P A;  1J1D A;  1MXL C;  2JXC A;  4MRY A;  1DF0 B;  1CFC A;  2L0P A;  1BMO A;  1RK9 A;  2JZI A;  1XO5 A;  4L9M A;  2F2O A;  3DVM A;  3DF0 A;  4XJK A;  2JNF A;  2KYF A;  3D10 A;  2MHH A;  2KFG A;  2EHB A;  4A4B A;  3PN7 C;  1IG5 A;  1CNP A;  2L2E A;  4AOM A;  1NX1 A;  5D7F A;  1SYM A;  3MSE B;  1XFU O;  1XYD A;  2GGM A;  4YGA A;  2I94 A;  1XA5 A;  1ALW A;  2KBM A;  3A4U B;  1KWO C;  1JUO A;  4BY5 A;  2KGR A;  1NX3 A;  3TZ1 A;  4NDC A;  1JC2 A;  1CLB A;  1REC A;  1DJW A;  2KI4 C;  4YGB B;  1FPW A;  1RFJ A;  2NCO A;  2KSP A;  4JQ0 D;  4PCW A;  2KNE A;  2LC5 A;  4GNK B;  1KFX L;  1QV0 A;  1SCM C;  3WNX B;  1CLM A;  1M31 A;  1BR1 B;  2E6W A;  4PAL A;  2MLE C;  2M7L A;  5K89 A;  1CDN A;  2K0J A;  4GUK A;  1WY9 A;  1L7Z A;  3O6B A;  1KFU L;  1FW4 A;  1SL7 A;  1V1F A;  1KSM A;  1PVA A;  2PRU A;  2JTT A;  4NQG A;  3SIA A;  4DIR A;  1IJ5 A;  2H2K A;  4HRE E;  1YVH A;  1BT6 A;  3DD4 A;  1GJY A;  1DTL A;  3LLE A;  1UHH A;  2K7D A;  4MVF A;  1KWO B;  2MJW B;  2ZRT A;  1XK4 C;  2KOT A;  4PDZ A;  3SG3 A;  2LMV A;  2F33 A;  3WHT B;  1KCY A;  1IRJ A;  2PMY A;  5DKR A;  1N2D A;  5G08 A;  1Y6W A;  1L2O B;  4MN0 A;  4PHK A;  1J55 A;  1A2X A;  4Q04 A;  4YGE B;  1K90 D;  1NCY A;  3E3R A;  1MQ1 A;  1D1O A;  1CM4 A;  4ETO A;  1A75 B;  1B7T Z;  3O78 A;  1S3P A;  1K8U A;  3CR4 X;  1WDC B;  1NX0 A;  4QJ4 B;  2JC2 A;  3LCP C;  2BCX A;  2F2P A;  4QJ5 B;  1W7J B;  1NP8 A;  4ORB B;  5CSF A;  1NSH A;  5HYD A;  4CFR A;  1U5I A;  2HET A;  3VRO A;  3DVE A;  1SRA A;  1QVI Y;  1YRT B;  4D1E A;  1MXE A;  1N0Y A;  1YUR A;  5FYX A;  3PFV A;  4MRX A;  4BY4 A;  2F8P A;  1B8L A;  1F70 A;  1YX8 A;  2LM5 A;  1OZS A;  1SL9 A;  3EVV A;  2WND A;  1DT7 B;  4YGC B;  1SBJ A;  3AAJ A;  3NSL A;  3VRQ A;  3DVK A;  3FIA A;  1XFX O;  3DVJ A;  1K93 D;  2BE4 A;  1BG1 A;  2LAN A;  1WRZ A;  2Y5I A;  1DJH A;  2WC8 A;  1LXF C;  2PAL A;  5ER4 X;  1NWD A;  2KGB C;  2K2F A;  2JRF A;  4C0K A;  4GFT A;  3EK7 A;  1CDL A;  2CXJ A;  3I5H B;  5IBW A;  2I7A A;  1YRU B;  4YI9 A;  1ALV A;  2JUL A;  1DJG A;  1M39 A;  2LVI A;  1SCV A;  1GGW A;  1KK8 B;  1F4O A;  1EL4 A;  4CLN A;  4OCI A;  3BUM B;  1SY9 A;  2ZND A;  1AVS A;  2JXL A;  4MZK A;  1DJY A;  4P5O E;  1C7W A;  2LUX A;  1YTZ C;  1EG4 A;  2CTN A;  2M1U A;  2VRG A;  3VRP A;  3IQQ A;  2GV5 A;  2KHN A;  3A8R A;  1HT9 A;  3NSK A;  4M2Q A;  1SMG A;  2PSR A;  3K21 A;  3PAL A;  1C07 A;  2K8M B;  1AJ5 A;  1NX2 A;  2JT0 A;  2LUC A;  3AKA A;  1A29 A;  1ZMZ A;  1DGU A;  4HRG A;  1QV1 A;  1UUR A;  2JT8 A;  2ZRS A;  4MSP A;  5CSJ A;  1UP5 A;  2ISD A;  2LHL A;  4N1F A;  3D0Y A;  1B1G A;  1KK8 C;  1PRW A;  2L4H A;  4PHM A;  1A03 A;  3I5F C;  1EG3 A;  2EGD A;  2LVV A;  2EC6 C;  1K9U A;  1PAL A;  1G8I A;  3BXK A;  5KTY A;  2KI6 C;  2MA2 A;  3PSR A;  1ZFS A;  2H61 C;  2G9B A;  2M8U A;  4ORC B;  5HKZ A;  1JSA A;  2KDH A;  1SPY A;  2M7N A;  2KAX A;  2OS8 C;  3TUY C;  4E68 A;  1TTX A;  2WCB A;  4GGF C;  1CMF A;  2A4J A;  1YR5 A;  1LA0 A;  1NIW A;  1S36 A;  1SK6 D;  2K7B A;  3KPX A;  2NXQ A;  4OR9 B;  1ODB A;  3GOF A;  1DJZ A;  4HSZ A;  1QXP A;  3CWG A;  4R1E A;  4DCK A;  3EKH A;  3TS5 B;  4MZJ A;  2WOS A;  2OTG C;  4DRW A;  1F71 A;  1S6I A;  2JTZ A;  1CDP A;  2TN4 A;  3I5F B;  2KBI A;  2BBM A;  3M0W A;  4MBE A;  3BQ3 A;  2ZN8 A;  1WLZ A;  4JWQ A;  1ZOT B;  1QAS A;  1KFU S;  2I2R E;  2KI6 D;  3PLF B;  1TNP A;  2PAS A;  3I5G C;  1LKJ A;  1S26 D;  2K61 A;  3H4S E;  4PE0 A;  5B8I B;  1XFW O;  4I5L B;  1TNX A;  1QLK A;  2AUC A;  4MZL A;  3EVR A;  3HX4 A;  2I18 A;  2LLT A;  2LV7 A;  3ZWH A;  2BL0 B;  2M29 A;  1V1G A;  1G33 A;  1KQV A;  1NPQ A;  1K2H A;  5DKN A;  4NDB A;  3TDI A;  3OX5 A;  4ZCV A;  2OPO A;  3I5G B;  2LNK A;  1LA3 A;  1S5G Y;  1BOC A;  1XVJ A;  1AUI B;  2KFH A;  1OMD A;  1AK8 A;  4YI8 A;  1KQM B;  1XFY O;  4A4C A;  1BR4 B;  2LE9 B;  3KHE A;  3TDU A;  4ORA B;  5J3X A;  1JF2 A;  1CB1 A;  2K7O A;  1YUU A;  1SCM B;  4UPG A;  3SG2 A;  3OP0 A;  1TIZ A;  2MBX A;  3SG5 A;  1OQP A;  2GGZ A;  1GGZ A;  2L51 A;  1F54 A;  1GQM A;  1TCF A;  3JVT B;  1B9A A;  3BUO B;  1DJI A;  5AXI A;  2E30 A;  4MEW A;  4OKH A;  1J7R A;  2IS9 A;  2OTG B;  2L4I A;  4FTG A;  1BF5 A;  1B8R A;  3JTD C;  5I8N A;  1BJF A;  1YX7 A;  2P6B B;  1IKU A;  1PUL A;  5AEQ A;  1E8A A;  1MR8 A;  1YVL A;  3OB2 B;  1F8H A;  1Q80 A;  3CR2 A;  1CLL A;  4GBA A;  3NSO A;  1MF8 B;  2L98 A;  3KEV A;  2BE6 A;  4JPZ B;  1DF0 A;  1XFZ O;  4MLW A;  4N1G A;  2BCA A;  3CLN A;  2LHI A;  1AJ4 A;  3FWB A;  3ZNI A;  3TS5 C;  2MAZ A;  2AMI A;  1C7V A;  2JQ6 A;  5BPJ A;  2HQW A;  2ZNE A;  3BOW A;  2O60 A;  1OE9 B;  3JVT C;  4HRH A;  3CZT X;  5AAN A;  3O4Y A;  3OX6 A;  1F4Q A;  1QJT A;  3F45 A;  4PE4 A;  2HPS A;  1Y1X A;  1RWY A;  3AAK A;  2WCE A;  4PHN A;  1H4B A;  3GK4 X;  1DVI A;  1UUS A;  1JFK A;  5D69 A;  2BKI B;  2CNP A;  1EJ3 A;  1JFJ A;  2BBN A;  3CR5 X;  1DGV A;  1LVC D;  1TNQ A;  2JU0 A;  4YBH B;  1MWN A;  2PVB A;  3BUX B;  1CM1 A;  5PAL A;  1KK7 Y;  3CS1 A;  2F3Z A;  4PHJ A;  3WHU B;  1VRK A;  1ZAC A;  1CFD A;  4GGF A;  4ZCU A;  2LMT A;  1OMV A;  1EXR A;  4FQO A;  1M46 A;  3CGA A;  1X02 A;  1K9P A;  2LAP A;  4ICB A;  3FS7 A;  4OVN F;  4XYN A;  4F0Z B;  2F3Y A;  3GK1 A;  5HKW A;  2ZN9 A;  1B4C A;  1QX7 A;  2MRD A;  1RRO A;  5JOL A;  1PVB A;  1TCO B;  2D8N A;  3AKB A;  1K9K A;  1SL8 A;  1YUT A;  4DUQ A;  2JOJ A;  2FOT A;  3I5H C;  1FF1 A;  1IQ5 A;  3LK1 A;  1QTX A;  4WQ3 A;  3HCM A;  1CMG A;  1PK0 D;  2Y1N A;  2OS8 B;  3TUY B;  2LVK A;  3VRR A;  1BU3 A;  2CT9 A;  1AP4 A;  1QS7 A;  1FI6 A;  4YRU A;  1NUB A;  1TRF A;  2JT3 A;  2HF5 A;  4CPV A;  2WOR A;  2RGI A;  1QVI Z;  3O2P A;  3SG7 A;  3NXA A;  1OOJ A;  2LVJ A;  2EC6 B;  2K2A A;  2M0R A;  1CTR A;  2KQ6 A;  4TNC A;  2Q4U A;  1FBV A;  2ZKM X;  1PSB A;  4DS7 A;  1ZUZ A;  2L50 A;  2SCP A;  1IH0 A;  3D0Y B;  2WCF A;  4AQI A;  3EK4 A;  1UHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...