3DVMA

Crystal structure of ca2+/cam-cav2.1 iq domain complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
140
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Calmodulin
publication title Structures of Ca(V)2 Ca(2+)/CaM-IQ Domain Complexes Reveal Binding Modes that Underlie Calcium-Dependent Inactivation and Facilitation.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 140
sequence length 143
ec nomenclature
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dvmA00
1TN4A 4CIDA 1UHKA 2COLB 2KHNA 1WY9A 4N1GA 3KO0A 1DJWA 3TS5B 4YGDB 1XK4A 5JJGA 1OMDA 3CTNA 1EL4A 2WNDA 1XFZO 4PDZA 1FW4A 3CR2A 1JF0A 2E6WA 1SMGA 5HKWA 1DT7B 2NCOA 1M63B 1W7IB 1U5IA 4U8DA 2ZRSA 2A4JA 1IH0A 4YGBB 1KFUS 4MZLA 5HYDA 1J7PA 1J7RA 2ZKMX 1EG4A 3M0WA 1KQMB 2CBLA 3C1VA 5K89A 3SG2A 1YURA 1WRKA 4HREE 1S6IA 4M2PA 4YRUA 2MBXA 3E3RA 1ZUZA 4ORBB 2JULA 2F2OA 2BKIB 1WDCC 1Y1AA 5DKRA 3SG3A 4WQ3A 2WCEA 1KQVA 1H4BA 3BUOB 5CSNA 4MZJA 1YRTB 2VRGA 3LCPC 3DF0A 2ZN9A 4C0LA 4QJ3B 1FI5A 2M29A 3FIAA 1A75B 1C7WA 2LP2A 1DJZA 3FWBA 3HX4A 3I5FB 4YI8A 5B8IB 4OV2A 1BJFA 2JNXA 2BL0B 3TUYC 3O6BA 1EH2A 5ER5A 4ORAB 1SL7A 1TRFA 3PFVA 4GGFA 1SL9A 1Q80A 4I5LB 1QX7A 1NX1A 3BUMB 3EK7A 3KF9A 1F71A 5CPVA 2LVJA 1TTXA 2LNKA 3I5HC 1B7TY 1L2OC 4MZKA 1CLMA 5GQQC 1TNXA 2D8NA 3AKAA 3SIBA 2L5XB 1RJVA 1CKKA 2HQWA 2M7LA 3BQ3A 1FBVA 1LVCD 3EK4A 2K7BA 1X02A 3BUNB 3I5GB 2FCEA 1UHIA 4HRHA 4M2OA 1NSHA 3O2PA 2PRUA 4HSZA 5ER4X 2BBNA 1EXRA 4PE0A 4E68A 5I8NA 1FF1A 1K9KA 2JOJA 4A4CA 4JWQA 3KHEA 1UHHA 2AMIA 2EHBA 2OTGC 1L7ZA 4XJKA 2JQ6A 2JZIA 2K2AA 3PSRA 1OQPA 1K9UA 1KK8B 3JVTC 1NIWA 3HCMA 2JT0A 2BKHB 1QVIY 5CSIA 2JTZA 2HQ8A 4IL1A 3QRXA 1YUSA 4GGFC 4PE1A 2KGRA 3VRPA 1XFXO 1AUIB 1SR6B 1F4OA 2EC6B 4M2QA 4CLNA 5I2QA 1BLQA 2M49B 2PALA 4FTGA 4GUKA 1KSMA 4I5KA 5D7FA 1QJTA 1G4YR 2JT3A 2K61A 1WRLA 3MSEB 1S5GY 4MBEA 1DJGA 1NCXA 1QIWA 2M1KB 2BCAA 1SCMC 5PALA 1RFJA 2BE4A 2WOSA 1UHNA 1M45A 1NX2A 4YI9A 2AAOA 2MRDA 2GGMA 1MQ1A 4ORCB 1KFXL 1G33A 1LA3A 1QLKA 3BXKA 1KWOC 4NDDA 3SG4A 4PCWA 3IF7A 1NX3A 3AAJA 4F0ZB 2OS8B 1NCZA 1GGWA 1IQ3A 3ZNIA 1CFDA 4GFTA 1A4PA 3EVRA 3TS5C 5KU1A 2JNFA 4ETOA 3VROA 1OMRA 1SW8A 2O5GA 1J7QA 2NCPA 4UPGA 5KTYA 3NSOA 4WQ2A 2KI4B 2JPTA 1IJ6A 5CSFA 4BY5A 3F45A 1IRJA 1CM1A 2KBMA 4FQOA 2LLTA 2MLEC 3WNXB 1A03A 1AVSA 1J1EA 1NPQA 5J3XA 4GBAA 1Y1XA 1NCYA 2M97A 2KI6C 2KFGA 2F8PA 1KQMC 1S6JA 2QACA 1DJIA 2Q91A 1RROA 2K7CA 3IQOA 2JXCA 3OB1B 1CLLA 3OX6A 4PHKA 1XFUO 1S3PA 1JSAA 1PSBA 2HPSA 1KFXS 2LUCA 1B4CA 3SG7A 3TDZA 5JOLA 3NSKA 2HF5A 2KFHA 1PSRA 1Y1UA 2LVKA 2R2IA 2GGZA 3OP0A 1JC2A 1LKJA 2JU0A 1MXEA 3I5FC 1S1EA 5AXIA 3SJSA 2BL0C 3GK1A 1V1GA 1BT6A 4GPLB 4I5NB 2WCFA 1K94A 3RLZA 1CFFA 1K90D 1F4QA 2DOQA 4AOMA 2TN4A 2F3YA 1TIZA 3VRRA 3DD4A 1GQMA 1XO5A 1KK7Y 4YGAA 2CNPA 4NDBA 4NDCA 1BOCA 1UP5A 2SCPA 1XFYO 1J1DA 1NP8A 1NX0A 4DIRA 1NYAA 2O60A 5HKYA 2LHLA 1EJ3A 2Y5IA 3DVJA 2WC8A 3BUWB 1DVIA 2ZNDA 1PALA 3TZ1A 1K96A 1J7OA 1CFPA 1DF0A 3D10A 4PHMA 3SG6A 3CGAA 2LC5A 3I5IB 3I5GC 5FYXA 1DGVA 3PN7B 2I7AA 2BBMA 4AQJA 1QXPA 3DVKA 3OHMB 4MSPA 1CFCA 2KYFA 4YGCB 2K7OA 3FWCA 2L50A 1S36A 4CFRA 2ZN8A 2QPTA 3AAKA 2ZRTA 3KPXA 3CS1A 2NXQA 2F33A 1F54A 2PMYA 4DCKA 2MAZA 4R1EA 1ZACA 1VRKA 2M3WA 2H2KA 2M0RA 1JUOA 1Y0VH 1PVBA 1XYDA 5AEQA 2MJWB 2JTTA 1KK8C 1KCYA 1JFKA 2Y1MA 1HQVA 3TDUA 1PRWA 3BOWB 2F3ZA 1DGUA 4L9MA 1BR1B 1AHRA 2KQ6A 3CLNA 2LHIA 3VRNA 2LLSA 1CDNA 2LV7A 2GV5A 2KSPA 3WXAA 1TNWA 1B1GA 3CR4X 1DMOA 3PALA 2P6BB 1A29A 2ZNEA 1SR6C 2EC6C 1SNLA 2KAVA 4GGNA 2KQYA 3H4SE 1S26D 1MXLC 1OE9B 1SKTA 1ALVA 3A8RA 1SRAA 5DKNA 4QJ5B 3GOFA 1BR4B 1KSOA 1N0YA 1YVHA 3VGOA 3EKJA 1K95A 2JRFA 2Y4QA 1MUXA 2PVBA 5AFPA 1F70A 1YRUB 2BCXA 3FS7A 3DF0B 1R2UA 3JTDB 3D0YB 2L98A 4OVNF 2AUCA 2PASA 2KGBC 2K2FA 1N65A 1UWOA 2KFFA 1AP4A 2L0PA 2OS8C 3SG5A 1IGVA 1QLSA 2MA2A 2M7NA 1CMFA 3DVEA 4P5OE 5D69A 1A75A 1WLZA 5BPJA 5DKQA 1OZSA 1D1OA 2SASA 4MRXA 1TOPA 3CZTX 4BY4A 1JBAA 2PSRA 4TNCA 1DJYA 1RECA 5HLOA 2KI4C 2LAPA 2B1UA 2KDHA 1RWYA 1J55A 1QX2A 5F6TA 1K2HA 3IQQA 1SYMA 3WHUB 1XFVO 1CLBA 1OZOA 1MF8B 3OB2B 1B7TZ 1K8UA 2LUXA 1IQ5A 1SPYA 4Q04A 2M1UA 1IG5A 3ZWHA 1YTZC 2ZFDA 1M39A 1UUSA 1G8IA 5TNCA 1UHJA 1PK0D 4OCIA 1QS7A 1A2XA 4OR9B 3BYAA 1LXFC 4PHNA 1QV1A 1CB1A 2HETA 1F55A 1OMVA 2KOTA 1UURA 1WRZA 2L4HA 1LINA 1YX7A 2LMVA 4P2YB 1R6PA 4XJKB 1K93D 5AERA 1BODA 2LP3A 4USLA 1BG1A 1DTLA 4DUQA 1RK9A 4CFQA 1XA5A 1M46A 1IJ5A 4I5JA 2CCMA 1QX5B 1HT9A 3O4YA 1YUUA 2KI6D 3BOWA 3LL8B 1QVIZ 1WLMA 2KYCA 2NLNA 2JT8A 1B8LA 2H61C 1QTXA 2JXLA 3ICBA 3EKHA 1LA0A 1BF5A 2KNEA 4C0KA 2NZ0A 1CMGA 4MRYA 1B9AA 1CDLA 1S5GZ 4PE4A 1QATA 1N2DA 3AKBA 1ZMZA 2LMUA 2MHHA 2L4IA 2I2RE 3EK8A 5G08A 2ISDA 3BUXB 1FI6A 4MEWA 4C0JA 1SK6D 1WDCB 4D1EA 2MLFC 4XYNA 5HLVA 1QIVA 2JWWA 3D0YA 3I5IC 3PN7C 2BCBA 2Q4UA 1JFJA 2I94A 1BU3A 4GAOA 2LM5A 1CNPA 1OOJA 1XK4C 3EVUA 3A4UB 3GK2A 4NQGA 3TUYB 1IWQA 1AK8A 4HRGA 1YR5A 4OKHA 1CM4A 2CTNA 2LE9B 4ZCUA 2M9GA 1NUBA 3GK4X 2LMTA 2KAYA 4CPVA 2G2BA 3VRQA 2EGDA 1U5IB 1Y6WA 3I5HB 1E8AA 2L2EA 2Y1NA 3OX5A 1JWDA 1PVAA 1SCVA 1L2OB 2K0JA 3PATA 4N5XA 4YBHB 2K8MB 3KEVA 3NSIA 4MVFA 1AJ5A 1K9PA 4JPZB 1YVLA 4PE7A 5IBWA 3NXAA 4ICBA 2LVVA 3EVVA 2KAXA 2L51A 2LVIA 3O78A 1M31A 1B8CA 2I18A 2OPOA 2WORA 1CDMA 3TDIA 2M8UA 2CXJA 2RGIA 1B47A 1PULA 1SL8A 1S6CA 1EG3A 4JQ0D 5CSJA 1TNPA 1MWNA 4GNKB 1OSAA 1QASA 4MN0A 3WHTB 1F8HA 1W7JB 4DS7A 4WRIA 5I2OA 3RM1A 1NWDA 2G9BA 2FOTA 3DVMA 1FPWA 1GGZA 3JTDC 3LK1A 2OTGB 1XVJA 1SBJA 1RTP1 1YX8A 3NSLA 4AQIA 2JC2A 4N1FA 1ODBA 4YGEB 1H8BA 3JVTB 4PALA 1BMOA 5AANA 4DRWA 1CTRA 1ZOTB 1DJHA 1MR8A 1CDPA 1AJ4A 2FCDA 2BECA 1SY9A 2F2PA 3CR5X 4ZCVA 5KSZA 1KFUL 1IKUA 2FJUB 1ALWA 4A4BA 2KBIA 2LANA 2H61A 3LLEA 2BE6A 1B8RA 3PLFB 5HKZA 1DJXA 1KK7Z 3CWGA 2V53A 1SCMB 2LLUA 1V1FA 1ZFSA 1TNQA 1QV0A 2CT9A 1C7VA 1DF0B 1TCFA 4PHJA 3LK0A 3SIAA 2WCBA 1JF2A 3K21A 1MHOA 1YUTA 3PM8A 1KWOB 2K7DA 4QJ4B 1C07A 1TCOB 4MLWA 2E30A 5I2LA 1GJYA 2IS9A 1XFWO 2LCPA
chains in the Genus database with same CATH superfamily
1TN4A 4CIDA 1UHKA 2COLB 2KHNA 1WY9A 1W9ZA 4N1GA 3KO0A 1DJWA 3TS5B 4YGDB 1XK4A 5JJGA 4F7FA 1OMDA 3CTNA 1EL4A 2WNDA 1XFZO 4PDZA 1FW4A 3CR2A 1QWVA 1JF0A 2E6WA 1SMGA 5HKWA 3B86A 1DT7B 1TUZA 2NCOA 3DXLA 1M63B 1W7IB 1U5IA 4U8DA 3D74A 2ZRSA 2A4JA 1IH0A 4YGBB 1KFUS 4MZLA 5HYDA 1J7PA 1J7RA 4JD9A 2ZKMX 1EG4A 3M0WA 3D78A 1KQMB 2CBLA 1IIOA 3CZ2A 3D73A 3C1VA 2P71A 5K89A 3SG2A 1YURA 3L47A 1WRKA 4HREE 1S6IA 4M2PA 4YRUA 2MBXA 3E3RA 1ZUZA 4ORBB 2JULA 2F2OA 2BKIB 1WDCC 1Y1AA 5DKRA 3SG3A 4WQ3A 2WCEA 1KQVA 1H4BA 3BUOB 5CSNA 2WCKA 4MZJA 1YRTB 2VRGA 3LCPC 3DF0A 2ZN9A 4C0LA 4QJ3B 1FI5A 2M29A 3FIAA 1A75B 1C7WA 2LP2A 1DJZA 3FWBA 3HX4A 3I5FB 4YI8A 5B8IB 4OV2A 3N7HA 1BJFA 3NHIA 2PQLA 2JNXA 2BL0B 3TUYC 3O6BA 1EH2A 5ER5A 4ORAB 1SL7A 1TRFA 3PFVA 4GGFA 3DZTA 1SL9A 1Q80A 3BFAA 4I5LB 1QX7A 1NX1A 3BUMB 3EK7A 3KF9A 1F71A 5CPVA 5D3OA 2LVJA 1TTXA 2LNKA 3I5HC 1B7TY 1L2OC 4MZKA 1CLMA 5GQQC 1TNXA 2D8NA 3AKAA 3SIBA 2L5XB 1RJVA 1CKKA 2HQWA 2M7LA 3BQ3A 1FBVA 1LVCD 3EK4A 2K7BA 1X02A 3BUNB 3I5GB 2P70A 4INWA 2FCEA 1UHIA 3CYZA 4HRHA 4M2OA 1NSHA 3O2PA 2PRUA 4HSZA 5ER4X 2BBNA 1EXRA 4PE0A 4E68A 5I8NA 1FF1A 1K9KA 2JOJA 4A4CA 4JWQA 3KHEA 3Q8IA 1GM0A 1UHHA 2AMIA 2EHBA 2OTGC 1L7ZA 4XJKA 1T14A 3S0GA 2JQ6A 2JZIA 2K2AA 3PSRA 1OQPA 1K9UA 1KK8B 3JVTC 1NIWA 3HCMA 2JT0A 2KLEA 2BKHB 3RZSA 1QVIY 5CSIA 2JTZA 2HQ8A 4IL1A 3QRXA 1YUSA 4GGFC 4PE1A 2KGRA 3VRPA 1XFXO 1AUIB 1SR6B 1F4OA 2EC6B 4M2QA 4CLNA 5I2QA 1BLQA 2M49B 2PALA 4FTGA 4GUKA 1KSMA 4I5KA 5D7FA 1QJTA 1G4YR 2JT3A 2K61A 1WRLA 3MSEB 1S5GY 4MBEA 1DJGA 1NCXA 1QIWA 2M1KB 2BCAA 1SCMC 5PALA 1RFJA 2BE4A 2WOSA 1UHNA 2WCLA 1M45A 1NX2A 4YI9A 2AAOA 2MRDA 2GGMA 1MQ1A 4ORCB 1KFXL 1G33A 1LA3A 1P28A 1QLKA 1KWOC 2H8VA 3BXKA 4NDDA 4PCWA 3SG4A 3IF7A 1NX3A 3AAJA 3FE9A 4F0ZB 2OS8B 3DY9A 1NCZA 3OBVA 3B7AA 1GGWA 3R72A 1IQ3A 3ZNIA 1DELA 1CFDA 4GFTA 1A4PA 3EVRA 3TS5C 3L4LA 2JNFA 5KU1A 4ETOA 3VROA 1OMRA 1OW4A 1SW8A 2K60A 2O5GA 1J7QA 2NCPA 4UPGA 5KTYA 3NSOA 4WQ2A 2KI4B 2JPTA 1IJ6A 5CSFA 4BY5A 3F45A 1IRJA 5EL2A 1CM1A 1XFRA 2KBMA 4FQOA 2LLTA 2MLEC 3SS3A 3WNXB 1AVSA 1A03A 1J1EA 1NPQA 5J3XA 4GBAA 2WCJA 1Y1XA 1NCYA 2M97A 2KI6C 2KFGA 2F8PA 3FE6A 1KQMC 1S6JA 1C3YA 2QACA 1DJIA 3O4XA 5I94A 2Q91A 1RROA 2K7CA 3IQOA 3L4AA 2JXCA 3OB1B 1CLLA 3OX6A 4PHKA 1XFUO 1S3PA 1JSAA 1DQEA 1PSBA 2QDIA 2KLDA 2HPSA 1KFXS 2LUCA 1B4CA 3SG7A 3TDZA 5JOLA 3CDNA 3CZ1A 4KYNA 3NSKA 2WCHA 2HF5A 2KFHA 1PSRA 1Y1UA 2LVKA 2R2IA 2GGZA 3OP0A 1JC2A 1LKJA 2JU0A 1MXEA 3I5FC 1S1EA 5AXIA 3SS4A 3SJSA 2BL0C 3GK1A 1V1GA 1BT6A 4GPLB 4I5NB 2WCFA 2ERBA 1K94A 3RLZA 1CFFA 1K90D 1F4QA 2DOQA 4AOMA 2TN4A 2F3YA 1TIZA 3VRRA 3DD4A 1GQMA 1XO5A 1KK7Y 3BFBA 2CNPA 4NDBA 4YGAA 4NDCA 2BNXA 1BOCA 1UP5A 2SCPA 2QEBA 1XFYO 3FE8A 1J1DA 1NP8A 1NX0A 4DIRA 3D75A 1NYAA 2O60A 5HKYA 2LHLA 1EJ3A 2Y5IA 3DVJA 2WC8A 3BUWB 1DVIA 2QEOA 1PALA 1OOIX 2ZNDA 1K96A 3TZ1A 1J7OA 1CFPA 1DF0A 3D10A 4PHMA 3SG6A 3CGAA 2LC5A 3I5IB 3I5GC 5FYXA 1DGVA 3PN7B 2I7AA 2BBMA 4AQJA 1QXPA 3DVKA 3OHMB 4MSPA 1CFCA 2KYFA 4YGCB 2K7OA 3FWCA 2L50A 1S36A 4CFRA 2ZN8A 2QPTA 3AAKA 2ZRTA 3KPXA 3CS1A 2NXQA 2F33A 1F54A 1ORGA 2PMYA 4DCKA 2MAZA 4R1EA 1ZACA 3S0EA 1VRKA 2M3WA 2H2KA 2M0RA 2PYQA 1JUOA 1Y0VH 1PVBA 1XYDA 5AEQA 2MJWB 2JTTA 1KK8C 1KCYA 1JFKA 2Y1MA 1HQVA 3TDUA 1PRWA 3BOWB 2F3ZA 1DGUA 4L9MA 1BR1B 1AHRA 2KQ6A 3CLNA 2LHIA 3VRNA 2LLSA 1CDNA 2LV7A 2GV5A 2KSPA 3WXAA 1TNWA 1B1GA 3CR4X 3R1PA 4OZDA 1DMOA 3PALA 2P6BB 1A29A 2ZNEA 1SR6C 2EC6C 1SNLA 2KAVA 4GGNA 2KQYA 3H4SE 1S26D 1MXLC 1OE9B 1SKTA 1ALVA 2FJYA 3A8RA 3UNWA 1SRAA 5DKNA 4QJ5B 3GOFA 1BR4B 1KSOA 1N0YA 1YVHA 3B88A 5FI7A 3VGOA 3EKJA 1K95A 2JRFA 2Y4QA 1MUXA 2PVBA 3S0BA 5AFPA 1F70A 1YRUB 2BCXA 3FS7A 3DF0B 1R2UA 3JTDB 3S0AA 2BAPA 2YGUA 3D0YB 3V2LA 2L98A 4JKTA 4OVNF 2AUCA 2PASA 2KGBC 2K2FA 1N65A 1UWOA 2KFFA 1AP4A 2L0PA 2OS8C 3SG5A 1IGVA 1QLSA 2MA2A 3D77A 2M7NA 1CMFA 3DVEA 4P5OE 3IVTA 1A75A 5D69A 1WLZA 5BPJA 5DKQA 1OZSA 5DICA 1D1OA 2SASA 4MRXA 1TOPA 3CZTX 4BY4A 1JBAA 1DEKA 2PSRA 4TNCA 1DJYA 1RECA 1Z2CB 5HLOA 2KI4C 2LAPA 2B1UA 3OGNA 2KDHA 1RWYA 1J55A 1OOGA 1QX2A 1OOFA 5F6TA 1K2HA 3IQQA 1SYMA 3WHUB 1XFVO 1CLBA 1OZOA 3DYEA 1MF8B 3OB2B 1B7TZ 3BFHA 1K8UA 2LUXA 1IQ5A 1SPYA 4Q04A 2M1UA 1IG5A 1Z4HA 3ZWHA 1YTZC 2ZFDA 1M39A 1UUSA 1G8IA 5TNCA 1UHJA 1PK0D 4OCIA 3VB1A 1QS7A 1A2XA 4OR9B 3BYAA 1LXFC 4PHNA 1QV1A 1CB1A 2HETA 1F55A 1OMVA 2KOTA 1UURA 1WRZA 2L4HA 4FQTA 1LINA 1YX7A 2LMVA 4P2YB 1R6PA 4XJKB 1K93D 5AERA 1BODA 2LP3A 4USLA 1BG1A 1DTLA 2L2CA 4DUQA 1RK9A 4CFQA 1XA5A 1M46A 4PT1A 1IJ5A 4I5JA 2CCMA 1QX5B 1HT9A 3O4YA 1YUUA 2KI6D 3BOWA 3LL8B 1QVIZ 1WLMA 2KYCA 2NLNA 2JT8A 1B8LA 2H61C 1QTXA 2JXLA 3ICBA 3EKHA 1LA0A 3PJIA 2QEVA 5HL1A 3R1VA 1BF5A 2KNEA 4C0KA 2NZ0A 1CMGA 4MRYA 1B9AA 1CDLA 1S5GZ 4PE4A 1QATA 1N2DA 3AKBA 1ZMZA 2LMUA 2MHHA 2L4IA 2I2RE 3EK8A 5G08A 2ISDA 3BUXB 1FI6A 4MEWA 4C0JA 1SK6D 1WDCB 4D1EA 2MLFC 1C3ZA 4XYNA 5HLVA 3SS5A 1QIVA 2JWWA 3D0YA 3D76A 3I5IC 3PN7C 2BCBA 2Q4UA 1SSEB 2I94A 1BU3A 1JFJA 4GAOA 2LM5A 5FI6A 1DC1A 1CNPA 1OOJA 3NGVA 1XK4C 3EVUA 3A4UB 3GK2A 4NQGA 3TUYB 1IWQA 1AK8A 4HRGA 1YR5A 4OKHA 1CM4A 2CTNA 2LE9B 4ZCUA 2M9GA 1NUBA 3GK4X 2LMTA 3CZ0A 2KAYA 1TWOA 4CPVA 2G2BA 3VRQA 2EGDA 1U5IB 1Y6WA 3I5HB 1E8AA 2L2EA 2Y1NA 3OX5A 1JWDA 1PVAA 1SCVA 1L2OB 2K0JA 3PATA 4N5XA 1TUJA 2GTEA 4YBHB 3EG5B 2K8MB 3KEVA 3B6XA 3NSIA 4MVFA 1AJ5A 1K9PA 4JPZB 1YVLA 4PE7A 5IBWA 3NXAA 4ICBA 3CABA 2LVVA 3EVVA 2KAXA 2L51A 2LVIA 3O78A 1M31A 1B8CA 2I18A 2OPOA 2WORA 1CDMA 3TDIA 2M8UA 2CXJA 2RGIA 1B47A 1PULA 1SL8A 1S6CA 1EG3A 4JQ0D 5CSJA 1TNPA 1MWNA 4GNKB 1OSAA 1QASA 3S0FA 4MN0A 3WHTB 1F8HA 1W7JB 4DS7A 4WRIA 5I2OA 3RM1A 1NWDA 2G9BA 2FOTA 3DVMA 1FPWA 1GGZA 3JTDC 3LK1A 2OTGB 1XVJA 1SBJA 1RTP1 1YX8A 3NSLA 3QMEA 2JC2A 3R1OA 4AQIA 4N1FA 1ODBA 4YGEB 3S0DA 1H8BA 3JVTB 4PALA 4IJ7A 1BMOA 5AANA 4DRWA 1CTRA 1ZOTB 1DJHA 1MR8A 3UO9A 2WC5A 1CDPA 1AJ4A 1OOHA 2BECA 1SY9A 2F2PA 2FCDA 3CR5X 3K1EA 4ZCVA 5KSZA 3B87A 1KFUL 1IKUA 2FJUB 1ALWA 4A4BA 2KBIA 2LANA 2H61A 2KPHA 2WC6A 3LLEA 2BE6A 1B8RA 3PLFB 5HKZA 4INXA 1DJXA 1KK7Z 3CWGA 2WCMA 2V53A 1SCMB 2LLUA 1V1FA 1ZFSA 1TNQA 1QV0A 2CT9A 2JPOA 3PM2A 1C7VA 5FI2A 1DF0B 1TCFA 4PHJA 3LK0A 2L5YA 3BJHA 3SIAA 2WCBA 1JF2A 3K21A 3NHTA 1MHOA 1YUTA 3PM8A 1KWOB 2K7DA 4QJ4B 1C07A 1TCOB 2QEHA 4MLWA 1LS8A 2E30A 5I2LA 1GJYA 2IS9A 1XFWO 2LCPA
chains in the Genus database with same CATH topology
1TN4A 4CIDA 1UHKA 2COLB 2KHNA 1WY9A 4N1GA 3KO0A 1DJWA 3TS5B 4YGDB 1XK4A 5JJGA 1OMDA 3CTNA 1EL4A 2WNDA 1XFZO 4PDZA 1FW4A 3CR2A 1JF0A 2E6WA 1SMGA 5HKWA 1DT7B 2NCOA 1M63B 1W7IB 1U5IA 4U8DA 2ZRSA 2A4JA 1IH0A 4YGBB 1KFUS 4MZLA 5HYDA 1J7PA 1J7RA 2ZKMX 1EG4A 3M0WA 1KQMB 2CBLA 3C1VA 5K89A 3SG2A 1YURA 1WRKA 4HREE 1S6IA 4M2PA 4YRUA 2MBXA 3E3RA 1ZUZA 4ORBB 2JULA 2F2OA 2BKIB 1WDCC 1Y1AA 5DKRA 3SG3A 4WQ3A 2WCEA 1KQVA 1H4BA 3BUOB 5CSNA 4MZJA 1YRTB 2VRGA 3LCPC 3DF0A 2ZN9A 4C0LA 4QJ3B 1FI5A 2M29A 3FIAA 1A75B 1C7WA 2LP2A 1DJZA 3FWBA 3HX4A 3I5FB 4YI8A 5B8IB 4OV2A 1BJFA 2JNXA 2BL0B 3TUYC 3O6BA 1EH2A 5ER5A 4ORAB 1SL7A 1TRFA 3PFVA 4GGFA 1SL9A 1Q80A 4I5LB 1QX7A 1NX1A 3BUMB 3EK7A 3KF9A 1F71A 5CPVA 2LVJA 1TTXA 2LNKA 3I5HC 1B7TY 1L2OC 4MZKA 1CLMA 5GQQC 1TNXA 2D8NA 3AKAA 3SIBA 2L5XB 1RJVA 1CKKA 2HQWA 2M7LA 3BQ3A 1FBVA 1LVCD 3EK4A 2K7BA 1X02A 3BUNB 3I5GB 2FCEA 1UHIA 4HRHA 4M2OA 1NSHA 3O2PA 2PRUA 4HSZA 5ER4X 2BBNA 1EXRA 4PE0A 4E68A 5I8NA 1FF1A 1K9KA 2JOJA 4A4CA 4JWQA 3KHEA 1UHHA 2AMIA 2EHBA 2OTGC 1L7ZA 4XJKA 2JQ6A 2JZIA 2K2AA 3PSRA 1OQPA 1K9UA 1KK8B 3JVTC 1NIWA 3HCMA 2JT0A 2BKHB 1QVIY 5CSIA 2JTZA 2HQ8A 4IL1A 3QRXA 1YUSA 4GGFC 4PE1A 2KGRA 3VRPA 1XFXO 1AUIB 1SR6B 1F4OA 2EC6B 4M2QA 4CLNA 5I2QA 1BLQA 2M49B 2PALA 4FTGA 4GUKA 1KSMA 4I5KA 5D7FA 1QJTA 1G4YR 2JT3A 2K61A 1WRLA 3MSEB 1S5GY 4MBEA 1DJGA 1NCXA 1QIWA 2M1KB 2BCAA 1SCMC 5PALA 1RFJA 2BE4A 2WOSA 1UHNA 1M45A 1NX2A 4YI9A 2AAOA 2MRDA 2GGMA 1MQ1A 4ORCB 1KFXL 1G33A 1LA3A 1QLKA 3BXKA 1KWOC 4NDDA 3SG4A 4PCWA 3IF7A 1NX3A 3AAJA 4F0ZB 2OS8B 1NCZA 1GGWA 1IQ3A 3ZNIA 1CFDA 4GFTA 1A4PA 3EVRA 3TS5C 5KU1A 2JNFA 4ETOA 3VROA 1OMRA 1SW8A 2O5GA 1J7QA 2NCPA 4UPGA 5KTYA 3NSOA 4WQ2A 2KI4B 2JPTA 1IJ6A 5CSFA 4BY5A 3F45A 1IRJA 1CM1A 2KBMA 4FQOA 2LLTA 2MLEC 3WNXB 1A03A 1AVSA 1J1EA 1NPQA 5J3XA 4GBAA 1Y1XA 1NCYA 2M97A 2KI6C 2KFGA 2F8PA 1KQMC 1S6JA 2QACA 1DJIA 2Q91A 1RROA 2K7CA 3IQOA 2JXCA 3OB1B 1CLLA 3OX6A 4PHKA 1XFUO 1S3PA 1JSAA 1PSBA 2HPSA 1KFXS 2LUCA 1B4CA 3SG7A 3TDZA 5JOLA 3NSKA 2HF5A 2KFHA 1PSRA 1Y1UA 2LVKA 2R2IA 2GGZA 3OP0A 1JC2A 1LKJA 2JU0A 1MXEA 3I5FC 1S1EA 5AXIA 3SJSA 2BL0C 3GK1A 1V1GA 1BT6A 4GPLB 4I5NB 2WCFA 1K94A 3RLZA 1CFFA 1K90D 1F4QA 2DOQA 4AOMA 2TN4A 2F3YA 1TIZA 3VRRA 3DD4A 1GQMA 1XO5A 1KK7Y 4YGAA 2CNPA 4NDBA 4NDCA 1BOCA 1UP5A 2SCPA 1XFYO 1J1DA 1NP8A 1NX0A 4DIRA 1NYAA 2O60A 5HKYA 2LHLA 1EJ3A 2Y5IA 3DVJA 2WC8A 3BUWB 1DVIA 2ZNDA 1PALA 3TZ1A 1K96A 1J7OA 1CFPA 1DF0A 3D10A 4PHMA 3SG6A 3CGAA 2LC5A 3I5IB 3I5GC 5FYXA 1DGVA 3PN7B 2I7AA 2BBMA 4AQJA 1QXPA 3DVKA 3OHMB 4MSPA 1CFCA 2KYFA 4YGCB 2K7OA 3FWCA 2L50A 1S36A 4CFRA 2ZN8A 2QPTA 3AAKA 2ZRTA 3KPXA 3CS1A 2NXQA 2F33A 1F54A 2PMYA 4DCKA 2MAZA 4R1EA 1ZACA 1VRKA 2M3WA 2H2KA 2M0RA 1JUOA 1Y0VH 1PVBA 1XYDA 5AEQA 2MJWB 2JTTA 1KK8C 1KCYA 1JFKA 2Y1MA 1HQVA 3TDUA 1PRWA 3BOWB 2F3ZA 1DGUA 4L9MA 1BR1B 1AHRA 2KQ6A 3CLNA 2LHIA 3VRNA 2LLSA 1CDNA 2LV7A 2GV5A 2KSPA 3WXAA 1TNWA 1B1GA 3CR4X 1DMOA 3PALA 2P6BB 1A29A 2ZNEA 1SR6C 2EC6C 1SNLA 2KAVA 4GGNA 2KQYA 3H4SE 1S26D 1MXLC 1OE9B 1SKTA 1ALVA 3A8RA 1SRAA 5DKNA 4QJ5B 3GOFA 1BR4B 1KSOA 1N0YA 1YVHA 3VGOA 3EKJA 1K95A 2JRFA 2Y4QA 1MUXA 2PVBA 5AFPA 1F70A 1YRUB 2BCXA 3FS7A 3DF0B 1R2UA 3JTDB 3D0YB 2L98A 4OVNF 2AUCA 2PASA 2KGBC 2K2FA 1N65A 1UWOA 2KFFA 1AP4A 2L0PA 2OS8C 3SG5A 1IGVA 1QLSA 2MA2A 2M7NA 1CMFA 3DVEA 4P5OE 5D69A 1A75A 1WLZA 5BPJA 5DKQA 1OZSA 1D1OA 2SASA 4MRXA 1TOPA 3CZTX 4BY4A 1JBAA 2PSRA 4TNCA 1DJYA 1RECA 5HLOA 2KI4C 2LAPA 2B1UA 2KDHA 1RWYA 1J55A 1QX2A 5F6TA 1K2HA 3IQQA 1SYMA 3WHUB 1XFVO 1CLBA 1OZOA 1MF8B 3OB2B 1B7TZ 1K8UA 2LUXA 1IQ5A 1SPYA 4Q04A 2M1UA 1IG5A 3ZWHA 1YTZC 2ZFDA 1M39A 1UUSA 1G8IA 5TNCA 1UHJA 1PK0D 4OCIA 1QS7A 1A2XA 4OR9B 3BYAA 1LXFC 4PHNA 1QV1A 1CB1A 2HETA 1F55A 1OMVA 2KOTA 1UURA 1WRZA 2L4HA 1LINA 1YX7A 2LMVA 4P2YB 1R6PA 4XJKB 1K93D 5AERA 1BODA 2LP3A 4USLA 1BG1A 1DTLA 4DUQA 1RK9A 4CFQA 1XA5A 1M46A 1IJ5A 4I5JA 2CCMA 1QX5B 1HT9A 3O4YA 1YUUA 2KI6D 3BOWA 3LL8B 1QVIZ 1WLMA 2KYCA 2NLNA 2JT8A 1B8LA 2H61C 1QTXA 2JXLA 3ICBA 3EKHA 1LA0A 1BF5A 2KNEA 4C0KA 2NZ0A 1CMGA 4MRYA 1B9AA 1CDLA 1S5GZ 4PE4A 1QATA 1N2DA 3AKBA 1ZMZA 2LMUA 2MHHA 2L4IA 2I2RE 3EK8A 5G08A 2ISDA 3BUXB 1FI6A 4MEWA 4C0JA 1SK6D 1WDCB 4D1EA 2MLFC 4XYNA 5HLVA 1QIVA 2JWWA 3D0YA 3I5IC 3PN7C 2BCBA 2Q4UA 1JFJA 2I94A 1BU3A 4GAOA 2LM5A 1CNPA 1OOJA 1XK4C 3EVUA 3A4UB 3GK2A 4NQGA 3TUYB 1IWQA 1AK8A 4HRGA 1YR5A 4OKHA 1CM4A 2CTNA 2LE9B 4ZCUA 2M9GA 1NUBA 3GK4X 2LMTA 2KAYA 4CPVA 2G2BA 3VRQA 2EGDA 1U5IB 1Y6WA 3I5HB 1E8AA 2L2EA 2Y1NA 3OX5A 1JWDA 1PVAA 1SCVA 1L2OB 2K0JA 3PATA 4N5XA 4YBHB 2K8MB 3KEVA 3NSIA 4MVFA 1AJ5A 1K9PA 4JPZB 1YVLA 4PE7A 5IBWA 3NXAA 4ICBA 2LVVA 3EVVA 2KAXA 2L51A 2LVIA 3O78A 1M31A 1B8CA 2I18A 2OPOA 2WORA 1CDMA 3TDIA 2M8UA 2CXJA 2RGIA 1B47A 1PULA 1SL8A 1S6CA 1EG3A 4JQ0D 5CSJA 1TNPA 1MWNA 4GNKB 1OSAA 1QASA 4MN0A 3WHTB 1F8HA 1W7JB 4DS7A 4WRIA 5I2OA 3RM1A 1NWDA 2G9BA 2FOTA 3DVMA 1FPWA 1GGZA 3JTDC 3LK1A 2OTGB 1XVJA 1SBJA 1RTP1 1YX8A 3NSLA 4AQIA 2JC2A 4N1FA 1ODBA 4YGEB 1H8BA 3JVTB 4PALA 1BMOA 5AANA 4DRWA 1CTRA 1ZOTB 1DJHA 1MR8A 1CDPA 1AJ4A 2FCDA 2BECA 1SY9A 2F2PA 3CR5X 4ZCVA 5KSZA 1KFUL 1IKUA 2FJUB 1ALWA 4A4BA 2KBIA 2LANA 2H61A 3LLEA 2BE6A 1B8RA 3PLFB 5HKZA 1DJXA 1KK7Z 3CWGA 2V53A 1SCMB 2LLUA 1V1FA 1ZFSA 1TNQA 1QV0A 2CT9A 1C7VA 1DF0B 1TCFA 4PHJA 3LK0A 3SIAA 2WCBA 1JF2A 3K21A 1MHOA 1YUTA 3PM8A 1KWOB 2K7DA 4QJ4B 1C07A 1TCOB 4MLWA 2E30A 5I2LA 1GJYA 2IS9A 1XFWO 2LCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN4 A;  4CID A;  1UHK A;  2COL B;  2KHN A;  1WY9 A;  4N1G A;  3KO0 A;  1DJW A;  3TS5 B;  4YGD B;  1XK4 A;  5JJG A;  1OMD A;  3CTN A;  1EL4 A;  2WND A;  1XFZ O;  4PDZ A;  1FW4 A;  3CR2 A;  1JF0 A;  2E6W A;  1SMG A;  5HKW A;  1DT7 B;  2NCO A;  1M63 B;  1W7I B;  1U5I A;  4U8D A;  2ZRS A;  2A4J A;  1IH0 A;  4YGB B;  1KFU S;  4MZL A;  5HYD A;  1J7P A;  1J7R A;  2ZKM X;  1EG4 A;  3M0W A;  1KQM B;  2CBL A;  3C1V A;  5K89 A;  3SG2 A;  1YUR A;  1WRK A;  4HRE E;  1S6I A;  4M2P A;  4YRU A;  2MBX A;  3E3R A;  1ZUZ A;  4ORB B;  2JUL A;  2F2O A;  2BKI B;  1WDC C;  1Y1A A;  5DKR A;  3SG3 A;  4WQ3 A;  2WCE A;  1KQV A;  1H4B A;  3BUO B;  5CSN A;  4MZJ A;  1YRT B;  2VRG A;  3LCP C;  3DF0 A;  2ZN9 A;  4C0L A;  4QJ3 B;  1FI5 A;  2M29 A;  3FIA A;  1A75 B;  1C7W A;  2LP2 A;  1DJZ A;  3FWB A;  3HX4 A;  3I5F B;  4YI8 A;  5B8I B;  4OV2 A;  1BJF A;  2JNX A;  2BL0 B;  3TUY C;  3O6B A;  1EH2 A;  5ER5 A;  4ORA B;  1SL7 A;  1TRF A;  3PFV A;  4GGF A;  1SL9 A;  1Q80 A;  4I5L B;  1QX7 A;  1NX1 A;  3BUM B;  3EK7 A;  3KF9 A;  1F71 A;  5CPV A;  2LVJ A;  1TTX A;  2LNK A;  3I5H C;  1B7T Y;  1L2O C;  4MZK A;  1CLM A;  5GQQ C;  1TNX A;  2D8N A;  3AKA A;  3SIB A;  2L5X B;  1RJV A;  1CKK A;  2HQW A;  2M7L A;  3BQ3 A;  1FBV A;  1LVC D;  3EK4 A;  2K7B A;  1X02 A;  3BUN B;  3I5G B;  2FCE A;  1UHI A;  4HRH A;  4M2O A;  1NSH A;  3O2P A;  2PRU A;  4HSZ A;  5ER4 X;  2BBN A;  1EXR A;  4PE0 A;  4E68 A;  5I8N A;  1FF1 A;  1K9K A;  2JOJ A;  4A4C A;  4JWQ A;  3KHE A;  1UHH A;  2AMI A;  2EHB A;  2OTG C;  1L7Z A;  4XJK A;  2JQ6 A;  2JZI A;  2K2A A;  3PSR A;  1OQP A;  1K9U A;  1KK8 B;  3JVT C;  1NIW A;  3HCM A;  2JT0 A;  2BKH B;  1QVI Y;  5CSI A;  2JTZ A;  2HQ8 A;  4IL1 A;  3QRX A;  1YUS A;  4GGF C;  4PE1 A;  2KGR A;  3VRP A;  1XFX O;  1AUI B;  1SR6 B;  1F4O A;  2EC6 B;  4M2Q A;  4CLN A;  5I2Q A;  1BLQ A;  2M49 B;  2PAL A;  4FTG A;  4GUK A;  1KSM A;  4I5K A;  5D7F A;  1QJT A;  1G4Y R;  2JT3 A;  2K61 A;  1WRL A;  3MSE B;  1S5G Y;  4MBE A;  1DJG A;  1NCX A;  1QIW A;  2M1K B;  2BCA A;  1SCM C;  5PAL A;  1RFJ A;  2BE4 A;  2WOS A;  1UHN A;  1M45 A;  1NX2 A;  4YI9 A;  2AAO A;  2MRD A;  2GGM A;  1MQ1 A;  4ORC B;  1KFX L;  1G33 A;  1LA3 A;  1QLK A;  3BXK A;  1KWO C;  4NDD A;  3SG4 A;  4PCW A;  3IF7 A;  1NX3 A;  3AAJ A;  4F0Z B;  2OS8 B;  1NCZ A;  1GGW A;  1IQ3 A;  3ZNI A;  1CFD A;  4GFT A;  1A4P A;  3EVR A;  3TS5 C;  5KU1 A;  2JNF A;  4ETO A;  3VRO A;  1OMR A;  1SW8 A;  2O5G A;  1J7Q A;  2NCP A;  4UPG A;  5KTY A;  3NSO A;  4WQ2 A;  2KI4 B;  2JPT A;  1IJ6 A;  5CSF A;  4BY5 A;  3F45 A;  1IRJ A;  1CM1 A;  2KBM A;  4FQO A;  2LLT A;  2MLE C;  3WNX B;  1A03 A;  1AVS A;  1J1E A;  1NPQ A;  5J3X A;  4GBA A;  1Y1X A;  1NCY A;  2M97 A;  2KI6 C;  2KFG A;  2F8P A;  1KQM C;  1S6J A;  2QAC A;  1DJI A;  2Q91 A;  1RRO A;  2K7C A;  3IQO A;  2JXC A;  3OB1 B;  1CLL A;  3OX6 A;  4PHK A;  1XFU O;  1S3P A;  1JSA A;  1PSB A;  2HPS A;  1KFX S;  2LUC A;  1B4C A;  3SG7 A;  3TDZ A;  5JOL A;  3NSK A;  2HF5 A;  2KFH A;  1PSR A;  1Y1U A;  2LVK A;  2R2I A;  2GGZ A;  3OP0 A;  1JC2 A;  1LKJ A;  2JU0 A;  1MXE A;  3I5F C;  1S1E A;  5AXI A;  3SJS A;  2BL0 C;  3GK1 A;  1V1G A;  1BT6 A;  4GPL B;  4I5N B;  2WCF A;  1K94 A;  3RLZ A;  1CFF A;  1K90 D;  1F4Q A;  2DOQ A;  4AOM A;  2TN4 A;  2F3Y A;  1TIZ A;  3VRR A;  3DD4 A;  1GQM A;  1XO5 A;  1KK7 Y;  4YGA A;  2CNP A;  4NDB A;  4NDC A;  1BOC A;  1UP5 A;  2SCP A;  1XFY O;  1J1D A;  1NP8 A;  1NX0 A;  4DIR A;  1NYA A;  2O60 A;  5HKY A;  2LHL A;  1EJ3 A;  2Y5I A;  3DVJ A;  2WC8 A;  3BUW B;  1DVI A;  2ZND A;  1PAL A;  3TZ1 A;  1K96 A;  1J7O A;  1CFP A;  1DF0 A;  3D10 A;  4PHM A;  3SG6 A;  3CGA A;  2LC5 A;  3I5I B;  3I5G C;  5FYX A;  1DGV A;  3PN7 B;  2I7A A;  2BBM A;  4AQJ A;  1QXP A;  3DVK A;  3OHM B;  4MSP A;  1CFC A;  2KYF A;  4YGC B;  2K7O A;  3FWC A;  2L50 A;  1S36 A;  4CFR A;  2ZN8 A;  2QPT A;  3AAK A;  2ZRT A;  3KPX A;  3CS1 A;  2NXQ A;  2F33 A;  1F54 A;  2PMY A;  4DCK A;  2MAZ A;  4R1E A;  1ZAC A;  1VRK A;  2M3W A;  2H2K A;  2M0R A;  1JUO A;  1Y0V H;  1PVB A;  1XYD A;  5AEQ A;  2MJW B;  2JTT A;  1KK8 C;  1KCY A;  1JFK A;  2Y1M A;  1HQV A;  3TDU A;  1PRW A;  3BOW B;  2F3Z A;  1DGU A;  4L9M A;  1BR1 B;  1AHR A;  2KQ6 A;  3CLN A;  2LHI A;  3VRN A;  2LLS A;  1CDN A;  2LV7 A;  2GV5 A;  2KSP A;  3WXA A;  1TNW A;  1B1G A;  3CR4 X;  1DMO A;  3PAL A;  2P6B B;  1A29 A;  2ZNE A;  1SR6 C;  2EC6 C;  1SNL A;  2KAV A;  4GGN A;  2KQY A;  3H4S E;  1S26 D;  1MXL C;  1OE9 B;  1SKT A;  1ALV A;  3A8R A;  1SRA A;  5DKN A;  4QJ5 B;  3GOF A;  1BR4 B;  1KSO A;  1N0Y A;  1YVH A;  3VGO A;  3EKJ A;  1K95 A;  2JRF A;  2Y4Q A;  1MUX A;  2PVB A;  5AFP A;  1F70 A;  1YRU B;  2BCX A;  3FS7 A;  3DF0 B;  1R2U A;  3JTD B;  3D0Y B;  2L98 A;  4OVN F;  2AUC A;  2PAS A;  2KGB C;  2K2F A;  1N65 A;  1UWO A;  2KFF A;  1AP4 A;  2L0P A;  2OS8 C;  3SG5 A;  1IGV A;  1QLS A;  2MA2 A;  2M7N A;  1CMF A;  3DVE A;  4P5O E;  5D69 A;  1A75 A;  1WLZ A;  5BPJ A;  5DKQ A;  1OZS A;  1D1O A;  2SAS A;  4MRX A;  1TOP A;  3CZT X;  4BY4 A;  1JBA A;  2PSR A;  4TNC A;  1DJY A;  1REC A;  5HLO A;  2KI4 C;  2LAP A;  2B1U A;  2KDH A;  1RWY A;  1J55 A;  1QX2 A;  5F6T A;  1K2H A;  3IQQ A;  1SYM A;  3WHU B;  1XFV O;  1CLB A;  1OZO A;  1MF8 B;  3OB2 B;  1B7T Z;  1K8U A;  2LUX A;  1IQ5 A;  1SPY A;  4Q04 A;  2M1U A;  1IG5 A;  3ZWH A;  1YTZ C;  2ZFD A;  1M39 A;  1UUS A;  1G8I A;  5TNC A;  1UHJ A;  1PK0 D;  4OCI A;  1QS7 A;  1A2X A;  4OR9 B;  3BYA A;  1LXF C;  4PHN A;  1QV1 A;  1CB1 A;  2HET A;  1F55 A;  1OMV A;  2KOT A;  1UUR A;  1WRZ A;  2L4H A;  1LIN A;  1YX7 A;  2LMV A;  4P2Y B;  1R6P A;  4XJK B;  1K93 D;  5AER A;  1BOD A;  2LP3 A;  4USL A;  1BG1 A;  1DTL A;  4DUQ A;  1RK9 A;  4CFQ A;  1XA5 A;  1M46 A;  1IJ5 A;  4I5J A;  2CCM A;  1QX5 B;  1HT9 A;  3O4Y A;  1YUU A;  2KI6 D;  3BOW A;  3LL8 B;  1QVI Z;  1WLM A;  2KYC A;  2NLN A;  2JT8 A;  1B8L A;  2H61 C;  1QTX A;  2JXL A;  3ICB A;  3EKH A;  1LA0 A;  1BF5 A;  2KNE A;  4C0K A;  2NZ0 A;  1CMG A;  4MRY A;  1B9A A;  1CDL A;  1S5G Z;  4PE4 A;  1QAT A;  1N2D A;  3AKB A;  1ZMZ A;  2LMU A;  2MHH A;  2L4I A;  2I2R E;  3EK8 A;  5G08 A;  2ISD A;  3BUX B;  1FI6 A;  4MEW A;  4C0J A;  1SK6 D;  1WDC B;  4D1E A;  2MLF C;  4XYN A;  5HLV A;  1QIV A;  2JWW A;  3D0Y A;  3I5I C;  3PN7 C;  2BCB A;  2Q4U A;  1JFJ A;  2I94 A;  1BU3 A;  4GAO A;  2LM5 A;  1CNP A;  1OOJ A;  1XK4 C;  3EVU A;  3A4U B;  3GK2 A;  4NQG A;  3TUY B;  1IWQ A;  1AK8 A;  4HRG A;  1YR5 A;  4OKH A;  1CM4 A;  2CTN A;  2LE9 B;  4ZCU A;  2M9G A;  1NUB A;  3GK4 X;  2LMT A;  2KAY A;  4CPV A;  2G2B A;  3VRQ A;  2EGD A;  1U5I B;  1Y6W A;  3I5H B;  1E8A A;  2L2E A;  2Y1N A;  3OX5 A;  1JWD A;  1PVA A;  1SCV A;  1L2O B;  2K0J A;  3PAT A;  4N5X A;  4YBH B;  2K8M B;  3KEV A;  3NSI A;  4MVF A;  1AJ5 A;  1K9P A;  4JPZ B;  1YVL A;  4PE7 A;  5IBW A;  3NXA A;  4ICB A;  2LVV A;  3EVV A;  2KAX A;  2L51 A;  2LVI A;  3O78 A;  1M31 A;  1B8C A;  2I18 A;  2OPO A;  2WOR A;  1CDM A;  3TDI A;  2M8U A;  2CXJ A;  2RGI A;  1B47 A;  1PUL A;  1SL8 A;  1S6C A;  1EG3 A;  4JQ0 D;  5CSJ A;  1TNP A;  1MWN A;  4GNK B;  1OSA A;  1QAS A;  4MN0 A;  3WHT B;  1F8H A;  1W7J B;  4DS7 A;  4WRI A;  5I2O A;  3RM1 A;  1NWD A;  2G9B A;  2FOT A;  3DVM A;  1FPW A;  1GGZ A;  3JTD C;  3LK1 A;  2OTG B;  1XVJ A;  1SBJ A;  1RTP 1;  1YX8 A;  3NSL A;  4AQI A;  2JC2 A;  4N1F A;  1ODB A;  4YGE B;  1H8B A;  3JVT B;  4PAL A;  1BMO A;  5AAN A;  4DRW A;  1CTR A;  1ZOT B;  1DJH A;  1MR8 A;  1CDP A;  1AJ4 A;  2FCD A;  2BEC A;  1SY9 A;  2F2P A;  3CR5 X;  4ZCV A;  5KSZ A;  1KFU L;  1IKU A;  2FJU B;  1ALW A;  4A4B A;  2KBI A;  2LAN A;  2H61 A;  3LLE A;  2BE6 A;  1B8R A;  3PLF B;  5HKZ A;  1DJX A;  1KK7 Z;  3CWG A;  2V53 A;  1SCM B;  2LLU A;  1V1F A;  1ZFS A;  1TNQ A;  1QV0 A;  2CT9 A;  1C7V A;  1DF0 B;  1TCF A;  4PHJ A;  3LK0 A;  3SIA A;  2WCB A;  1JF2 A;  3K21 A;  1MHO A;  1YUT A;  3PM8 A;  1KWO B;  2K7D A;  4QJ4 B;  1C07 A;  1TCO B;  4MLW A;  2E30 A;  5I2L A;  1GJY A;  2IS9 A;  1XFW O;  2LCP A; 
#chains in the Genus database with same CATH topology
 1TN4 A;  4CID A;  1UHK A;  2COL B;  2KHN A;  1WY9 A;  1W9Z A;  4N1G A;  3KO0 A;  1DJW A;  3TS5 B;  4YGD B;  1XK4 A;  5JJG A;  4F7F A;  1OMD A;  3CTN A;  1EL4 A;  2WND A;  1XFZ O;  4PDZ A;  1FW4 A;  3CR2 A;  1QWV A;  1JF0 A;  2E6W A;  1SMG A;  5HKW A;  3B86 A;  1DT7 B;  1TUZ A;  2NCO A;  3DXL A;  1M63 B;  1W7I B;  1U5I A;  4U8D A;  3D74 A;  2ZRS A;  2A4J A;  1IH0 A;  4YGB B;  1KFU S;  4MZL A;  5HYD A;  1J7P A;  1J7R A;  4JD9 A;  2ZKM X;  1EG4 A;  3M0W A;  3D78 A;  1KQM B;  2CBL A;  1IIO A;  3CZ2 A;  3D73 A;  3C1V A;  2P71 A;  5K89 A;  3SG2 A;  1YUR A;  3L47 A;  1WRK A;  4HRE E;  1S6I A;  4M2P A;  4YRU A;  2MBX A;  3E3R A;  1ZUZ A;  4ORB B;  2JUL A;  2F2O A;  2BKI B;  1WDC C;  1Y1A A;  5DKR A;  3SG3 A;  4WQ3 A;  2WCE A;  1KQV A;  1H4B A;  3BUO B;  5CSN A;  2WCK A;  4MZJ A;  1YRT B;  2VRG A;  3LCP C;  3DF0 A;  2ZN9 A;  4C0L A;  4QJ3 B;  1FI5 A;  2M29 A;  3FIA A;  1A75 B;  1C7W A;  2LP2 A;  1DJZ A;  3FWB A;  3HX4 A;  3I5F B;  4YI8 A;  5B8I B;  4OV2 A;  3N7H A;  1BJF A;  3NHI A;  2PQL A;  2JNX A;  2BL0 B;  3TUY C;  3O6B A;  1EH2 A;  5ER5 A;  4ORA B;  1SL7 A;  1TRF A;  3PFV A;  4GGF A;  3DZT A;  1SL9 A;  1Q80 A;  3BFA A;  4I5L B;  1QX7 A;  1NX1 A;  3BUM B;  3EK7 A;  3KF9 A;  1F71 A;  5CPV A;  5D3O A;  2LVJ A;  1TTX A;  2LNK A;  3I5H C;  1B7T Y;  1L2O C;  4MZK A;  1CLM A;  5GQQ C;  1TNX A;  2D8N A;  3AKA A;  3SIB A;  2L5X B;  1RJV A;  1CKK A;  2HQW A;  2M7L A;  3BQ3 A;  1FBV A;  1LVC D;  3EK4 A;  2K7B A;  1X02 A;  3BUN B;  3I5G B;  2P70 A;  4INW A;  2FCE A;  1UHI A;  3CYZ A;  4HRH A;  4M2O A;  1NSH A;  3O2P A;  2PRU A;  4HSZ A;  5ER4 X;  2BBN A;  1EXR A;  4PE0 A;  4E68 A;  5I8N A;  1FF1 A;  1K9K A;  2JOJ A;  4A4C A;  4JWQ A;  3KHE A;  3Q8I A;  1GM0 A;  1UHH A;  2AMI A;  2EHB A;  2OTG C;  1L7Z A;  4XJK A;  1T14 A;  3S0G A;  2JQ6 A;  2JZI A;  2K2A A;  3PSR A;  1OQP A;  1K9U A;  1KK8 B;  3JVT C;  1NIW A;  3HCM A;  2JT0 A;  2KLE A;  2BKH B;  3RZS A;  1QVI Y;  5CSI A;  2JTZ A;  2HQ8 A;  4IL1 A;  3QRX A;  1YUS A;  4GGF C;  4PE1 A;  2KGR A;  3VRP A;  1XFX O;  1AUI B;  1SR6 B;  1F4O A;  2EC6 B;  4M2Q A;  4CLN A;  5I2Q A;  1BLQ A;  2M49 B;  2PAL A;  4FTG A;  4GUK A;  1KSM A;  4I5K A;  5D7F A;  1QJT A;  1G4Y R;  2JT3 A;  2K61 A;  1WRL A;  3MSE B;  1S5G Y;  4MBE A;  1DJG A;  1NCX A;  1QIW A;  2M1K B;  2BCA A;  1SCM C;  5PAL A;  1RFJ A;  2BE4 A;  2WOS A;  1UHN A;  2WCL A;  1M45 A;  1NX2 A;  4YI9 A;  2AAO A;  2MRD A;  2GGM A;  1MQ1 A;  4ORC B;  1KFX L;  1G33 A;  1LA3 A;  1P28 A;  1QLK A;  1KWO C;  2H8V A;  3BXK A;  4NDD A;  4PCW A;  3SG4 A;  3IF7 A;  1NX3 A;  3AAJ A;  3FE9 A;  4F0Z B;  2OS8 B;  3DY9 A;  1NCZ A;  3OBV A;  3B7A A;  1GGW A;  3R72 A;  1IQ3 A;  3ZNI A;  1DEL A;  1CFD A;  4GFT A;  1A4P A;  3EVR A;  3TS5 C;  3L4L A;  2JNF A;  5KU1 A;  4ETO A;  3VRO A;  1OMR A;  1OW4 A;  1SW8 A;  2K60 A;  2O5G A;  1J7Q A;  2NCP A;  4UPG A;  5KTY A;  3NSO A;  4WQ2 A;  2KI4 B;  2JPT A;  1IJ6 A;  5CSF A;  4BY5 A;  3F45 A;  1IRJ A;  5EL2 A;  1CM1 A;  1XFR A;  2KBM A;  4FQO A;  2LLT A;  2MLE C;  3SS3 A;  3WNX B;  1AVS A;  1A03 A;  1J1E A;  1NPQ A;  5J3X A;  4GBA A;  2WCJ A;  1Y1X A;  1NCY A;  2M97 A;  2KI6 C;  2KFG A;  2F8P A;  3FE6 A;  1KQM C;  1S6J A;  1C3Y A;  2QAC A;  1DJI A;  3O4X A;  5I94 A;  2Q91 A;  1RRO A;  2K7C A;  3IQO A;  3L4A A;  2JXC A;  3OB1 B;  1CLL A;  3OX6 A;  4PHK A;  1XFU O;  1S3P A;  1JSA A;  1DQE A;  1PSB A;  2QDI A;  2KLD A;  2HPS A;  1KFX S;  2LUC A;  1B4C A;  3SG7 A;  3TDZ A;  5JOL A;  3CDN A;  3CZ1 A;  4KYN A;  3NSK A;  2WCH A;  2HF5 A;  2KFH A;  1PSR A;  1Y1U A;  2LVK A;  2R2I A;  2GGZ A;  3OP0 A;  1JC2 A;  1LKJ A;  2JU0 A;  1MXE A;  3I5F C;  1S1E A;  5AXI A;  3SS4 A;  3SJS A;  2BL0 C;  3GK1 A;  1V1G A;  1BT6 A;  4GPL B;  4I5N B;  2WCF A;  2ERB A;  1K94 A;  3RLZ A;  1CFF A;  1K90 D;  1F4Q A;  2DOQ A;  4AOM A;  2TN4 A;  2F3Y A;  1TIZ A;  3VRR A;  3DD4 A;  1GQM A;  1XO5 A;  1KK7 Y;  3BFB A;  2CNP A;  4NDB A;  4YGA A;  4NDC A;  2BNX A;  1BOC A;  1UP5 A;  2SCP A;  2QEB A;  1XFY O;  3FE8 A;  1J1D A;  1NP8 A;  1NX0 A;  4DIR A;  3D75 A;  1NYA A;  2O60 A;  5HKY A;  2LHL A;  1EJ3 A;  2Y5I A;  3DVJ A;  2WC8 A;  3BUW B;  1DVI A;  2QEO A;  1PAL A;  1OOI X;  2ZND A;  1K96 A;  3TZ1 A;  1J7O A;  1CFP A;  1DF0 A;  3D10 A;  4PHM A;  3SG6 A;  3CGA A;  2LC5 A;  3I5I B;  3I5G C;  5FYX A;  1DGV A;  3PN7 B;  2I7A A;  2BBM A;  4AQJ A;  1QXP A;  3DVK A;  3OHM B;  4MSP A;  1CFC A;  2KYF A;  4YGC B;  2K7O A;  3FWC A;  2L50 A;  1S36 A;  4CFR A;  2ZN8 A;  2QPT A;  3AAK A;  2ZRT A;  3KPX A;  3CS1 A;  2NXQ A;  2F33 A;  1F54 A;  1ORG A;  2PMY A;  4DCK A;  2MAZ A;  4R1E A;  1ZAC A;  3S0E A;  1VRK A;  2M3W A;  2H2K A;  2M0R A;  2PYQ A;  1JUO A;  1Y0V H;  1PVB A;  1XYD A;  5AEQ A;  2MJW B;  2JTT A;  1KK8 C;  1KCY A;  1JFK A;  2Y1M A;  1HQV A;  3TDU A;  1PRW A;  3BOW B;  2F3Z A;  1DGU A;  4L9M A;  1BR1 B;  1AHR A;  2KQ6 A;  3CLN A;  2LHI A;  3VRN A;  2LLS A;  1CDN A;  2LV7 A;  2GV5 A;  2KSP A;  3WXA A;  1TNW A;  1B1G A;  3CR4 X;  3R1P A;  4OZD A;  1DMO A;  3PAL A;  2P6B B;  1A29 A;  2ZNE A;  1SR6 C;  2EC6 C;  1SNL A;  2KAV A;  4GGN A;  2KQY A;  3H4S E;  1S26 D;  1MXL C;  1OE9 B;  1SKT A;  1ALV A;  2FJY A;  3A8R A;  3UNW A;  1SRA A;  5DKN A;  4QJ5 B;  3GOF A;  1BR4 B;  1KSO A;  1N0Y A;  1YVH A;  3B88 A;  5FI7 A;  3VGO A;  3EKJ A;  1K95 A;  2JRF A;  2Y4Q A;  1MUX A;  2PVB A;  3S0B A;  5AFP A;  1F70 A;  1YRU B;  2BCX A;  3FS7 A;  3DF0 B;  1R2U A;  3JTD B;  3S0A A;  2BAP A;  2YGU A;  3D0Y B;  3V2L A;  2L98 A;  4JKT A;  4OVN F;  2AUC A;  2PAS A;  2KGB C;  2K2F A;  1N65 A;  1UWO A;  2KFF A;  1AP4 A;  2L0P A;  2OS8 C;  3SG5 A;  1IGV A;  1QLS A;  2MA2 A;  3D77 A;  2M7N A;  1CMF A;  3DVE A;  4P5O E;  3IVT A;  1A75 A;  5D69 A;  1WLZ A;  5BPJ A;  5DKQ A;  1OZS A;  5DIC A;  1D1O A;  2SAS A;  4MRX A;  1TOP A;  3CZT X;  4BY4 A;  1JBA A;  1DEK A;  2PSR A;  4TNC A;  1DJY A;  1REC A;  1Z2C B;  5HLO A;  2KI4 C;  2LAP A;  2B1U A;  3OGN A;  2KDH A;  1RWY A;  1J55 A;  1OOG A;  1QX2 A;  1OOF A;  5F6T A;  1K2H A;  3IQQ A;  1SYM A;  3WHU B;  1XFV O;  1CLB A;  1OZO A;  3DYE A;  1MF8 B;  3OB2 B;  1B7T Z;  3BFH A;  1K8U A;  2LUX A;  1IQ5 A;  1SPY A;  4Q04 A;  2M1U A;  1IG5 A;  1Z4H A;  3ZWH A;  1YTZ C;  2ZFD A;  1M39 A;  1UUS A;  1G8I A;  5TNC A;  1UHJ A;  1PK0 D;  4OCI A;  3VB1 A;  1QS7 A;  1A2X A;  4OR9 B;  3BYA A;  1LXF C;  4PHN A;  1QV1 A;  1CB1 A;  2HET A;  1F55 A;  1OMV A;  2KOT A;  1UUR A;  1WRZ A;  2L4H A;  4FQT A;  1LIN A;  1YX7 A;  2LMV A;  4P2Y B;  1R6P A;  4XJK B;  1K93 D;  5AER A;  1BOD A;  2LP3 A;  4USL A;  1BG1 A;  1DTL A;  2L2C A;  4DUQ A;  1RK9 A;  4CFQ A;  1XA5 A;  1M46 A;  4PT1 A;  1IJ5 A;  4I5J A;  2CCM A;  1QX5 B;  1HT9 A;  3O4Y A;  1YUU A;  2KI6 D;  3BOW A;  3LL8 B;  1QVI Z;  1WLM A;  2KYC A;  2NLN A;  2JT8 A;  1B8L A;  2H61 C;  1QTX A;  2JXL A;  3ICB A;  3EKH A;  1LA0 A;  3PJI A;  2QEV A;  5HL1 A;  3R1V A;  1BF5 A;  2KNE A;  4C0K A;  2NZ0 A;  1CMG A;  4MRY A;  1B9A A;  1CDL A;  1S5G Z;  4PE4 A;  1QAT A;  1N2D A;  3AKB A;  1ZMZ A;  2LMU A;  2MHH A;  2L4I A;  2I2R E;  3EK8 A;  5G08 A;  2ISD A;  3BUX B;  1FI6 A;  4MEW A;  4C0J A;  1SK6 D;  1WDC B;  4D1E A;  2MLF C;  1C3Z A;  4XYN A;  5HLV A;  3SS5 A;  1QIV A;  2JWW A;  3D0Y A;  3D76 A;  3I5I C;  3PN7 C;  2BCB A;  2Q4U A;  1SSE B;  2I94 A;  1BU3 A;  1JFJ A;  4GAO A;  2LM5 A;  5FI6 A;  1DC1 A;  1CNP A;  1OOJ A;  3NGV A;  1XK4 C;  3EVU A;  3A4U B;  3GK2 A;  4NQG A;  3TUY B;  1IWQ A;  1AK8 A;  4HRG A;  1YR5 A;  4OKH A;  1CM4 A;  2CTN A;  2LE9 B;  4ZCU A;  2M9G A;  1NUB A;  3GK4 X;  2LMT A;  3CZ0 A;  2KAY A;  1TWO A;  4CPV A;  2G2B A;  3VRQ A;  2EGD A;  1U5I B;  1Y6W A;  3I5H B;  1E8A A;  2L2E A;  2Y1N A;  3OX5 A;  1JWD A;  1PVA A;  1SCV A;  1L2O B;  2K0J A;  3PAT A;  4N5X A;  1TUJ A;  2GTE A;  4YBH B;  3EG5 B;  2K8M B;  3KEV A;  3B6X A;  3NSI A;  4MVF A;  1AJ5 A;  1K9P A;  4JPZ B;  1YVL A;  4PE7 A;  5IBW A;  3NXA A;  4ICB A;  3CAB A;  2LVV A;  3EVV A;  2KAX A;  2L51 A;  2LVI A;  3O78 A;  1M31 A;  1B8C A;  2I18 A;  2OPO A;  2WOR A;  1CDM A;  3TDI A;  2M8U A;  2CXJ A;  2RGI A;  1B47 A;  1PUL A;  1SL8 A;  1S6C A;  1EG3 A;  4JQ0 D;  5CSJ A;  1TNP A;  1MWN A;  4GNK B;  1OSA A;  1QAS A;  3S0F A;  4MN0 A;  3WHT B;  1F8H A;  1W7J B;  4DS7 A;  4WRI A;  5I2O A;  3RM1 A;  1NWD A;  2G9B A;  2FOT A;  3DVM A;  1FPW A;  1GGZ A;  3JTD C;  3LK1 A;  2OTG B;  1XVJ A;  1SBJ A;  1RTP 1;  1YX8 A;  3NSL A;  3QME A;  2JC2 A;  3R1O A;  4AQI A;  4N1F A;  1ODB A;  4YGE B;  3S0D A;  1H8B A;  3JVT B;  4PAL A;  4IJ7 A;  1BMO A;  5AAN A;  4DRW A;  1CTR A;  1ZOT B;  1DJH A;  1MR8 A;  3UO9 A;  2WC5 A;  1CDP A;  1AJ4 A;  1OOH A;  2BEC A;  1SY9 A;  2F2P A;  2FCD A;  3CR5 X;  3K1E A;  4ZCV A;  5KSZ A;  3B87 A;  1KFU L;  1IKU A;  2FJU B;  1ALW A;  4A4B A;  2KBI A;  2LAN A;  2H61 A;  2KPH A;  2WC6 A;  3LLE A;  2BE6 A;  1B8R A;  3PLF B;  5HKZ A;  4INX A;  1DJX A;  1KK7 Z;  3CWG A;  2WCM A;  2V53 A;  1SCM B;  2LLU A;  1V1F A;  1ZFS A;  1TNQ A;  1QV0 A;  2CT9 A;  2JPO A;  3PM2 A;  1C7V A;  5FI2 A;  1DF0 B;  1TCF A;  4PHJ A;  3LK0 A;  2L5Y A;  3BJH A;  3SIA A;  2WCB A;  1JF2 A;  3K21 A;  3NHT A;  1MHO A;  1YUT A;  3PM8 A;  1KWO B;  2K7D A;  4QJ4 B;  1C07 A;  1TCO B;  2QEH A;  4MLW A;  1LS8 A;  2E30 A;  5I2L A;  1GJY A;  2IS9 A;  1XFW O;  2LCP A; 
#chains in the Genus database with same CATH homology
 1TN4 A;  4CID A;  1UHK A;  2COL B;  2KHN A;  1WY9 A;  4N1G A;  3KO0 A;  1DJW A;  3TS5 B;  4YGD B;  1XK4 A;  5JJG A;  1OMD A;  3CTN A;  1EL4 A;  2WND A;  1XFZ O;  4PDZ A;  1FW4 A;  3CR2 A;  1JF0 A;  2E6W A;  1SMG A;  5HKW A;  1DT7 B;  2NCO A;  1M63 B;  1W7I B;  1U5I A;  4U8D A;  2ZRS A;  2A4J A;  1IH0 A;  4YGB B;  1KFU S;  4MZL A;  5HYD A;  1J7P A;  1J7R A;  2ZKM X;  1EG4 A;  3M0W A;  1KQM B;  2CBL A;  3C1V A;  5K89 A;  3SG2 A;  1YUR A;  1WRK A;  4HRE E;  1S6I A;  4M2P A;  4YRU A;  2MBX A;  3E3R A;  1ZUZ A;  4ORB B;  2JUL A;  2F2O A;  2BKI B;  1WDC C;  1Y1A A;  5DKR A;  3SG3 A;  4WQ3 A;  2WCE A;  1KQV A;  1H4B A;  3BUO B;  5CSN A;  4MZJ A;  1YRT B;  2VRG A;  3LCP C;  3DF0 A;  2ZN9 A;  4C0L A;  4QJ3 B;  1FI5 A;  2M29 A;  3FIA A;  1A75 B;  1C7W A;  2LP2 A;  1DJZ A;  3FWB A;  3HX4 A;  3I5F B;  4YI8 A;  5B8I B;  4OV2 A;  1BJF A;  2JNX A;  2BL0 B;  3TUY C;  3O6B A;  1EH2 A;  5ER5 A;  4ORA B;  1SL7 A;  1TRF A;  3PFV A;  4GGF A;  1SL9 A;  1Q80 A;  4I5L B;  1QX7 A;  1NX1 A;  3BUM B;  3EK7 A;  3KF9 A;  1F71 A;  5CPV A;  2LVJ A;  1TTX A;  2LNK A;  3I5H C;  1B7T Y;  1L2O C;  4MZK A;  1CLM A;  5GQQ C;  1TNX A;  2D8N A;  3AKA A;  3SIB A;  2L5X B;  1RJV A;  1CKK A;  2HQW A;  2M7L A;  3BQ3 A;  1FBV A;  1LVC D;  3EK4 A;  2K7B A;  1X02 A;  3BUN B;  3I5G B;  2FCE A;  1UHI A;  4HRH A;  4M2O A;  1NSH A;  3O2P A;  2PRU A;  4HSZ A;  5ER4 X;  2BBN A;  1EXR A;  4PE0 A;  4E68 A;  5I8N A;  1FF1 A;  1K9K A;  2JOJ A;  4A4C A;  4JWQ A;  3KHE A;  1UHH A;  2AMI A;  2EHB A;  2OTG C;  1L7Z A;  4XJK A;  2JQ6 A;  2JZI A;  2K2A A;  3PSR A;  1OQP A;  1K9U A;  1KK8 B;  3JVT C;  1NIW A;  3HCM A;  2JT0 A;  2BKH B;  1QVI Y;  5CSI A;  2JTZ A;  2HQ8 A;  4IL1 A;  3QRX A;  1YUS A;  4GGF C;  4PE1 A;  2KGR A;  3VRP A;  1XFX O;  1AUI B;  1SR6 B;  1F4O A;  2EC6 B;  4M2Q A;  4CLN A;  5I2Q A;  1BLQ A;  2M49 B;  2PAL A;  4FTG A;  4GUK A;  1KSM A;  4I5K A;  5D7F A;  1QJT A;  1G4Y R;  2JT3 A;  2K61 A;  1WRL A;  3MSE B;  1S5G Y;  4MBE A;  1DJG A;  1NCX A;  1QIW A;  2M1K B;  2BCA A;  1SCM C;  5PAL A;  1RFJ A;  2BE4 A;  2WOS A;  1UHN A;  1M45 A;  1NX2 A;  4YI9 A;  2AAO A;  2MRD A;  2GGM A;  1MQ1 A;  4ORC B;  1KFX L;  1G33 A;  1LA3 A;  1QLK A;  3BXK A;  1KWO C;  4NDD A;  3SG4 A;  4PCW A;  3IF7 A;  1NX3 A;  3AAJ A;  4F0Z B;  2OS8 B;  1NCZ A;  1GGW A;  1IQ3 A;  3ZNI A;  1CFD A;  4GFT A;  1A4P A;  3EVR A;  3TS5 C;  5KU1 A;  2JNF A;  4ETO A;  3VRO A;  1OMR A;  1SW8 A;  2O5G A;  1J7Q A;  2NCP A;  4UPG A;  5KTY A;  3NSO A;  4WQ2 A;  2KI4 B;  2JPT A;  1IJ6 A;  5CSF A;  4BY5 A;  3F45 A;  1IRJ A;  1CM1 A;  2KBM A;  4FQO A;  2LLT A;  2MLE C;  3WNX B;  1A03 A;  1AVS A;  1J1E A;  1NPQ A;  5J3X A;  4GBA A;  1Y1X A;  1NCY A;  2M97 A;  2KI6 C;  2KFG A;  2F8P A;  1KQM C;  1S6J A;  2QAC A;  1DJI A;  2Q91 A;  1RRO A;  2K7C A;  3IQO A;  2JXC A;  3OB1 B;  1CLL A;  3OX6 A;  4PHK A;  1XFU O;  1S3P A;  1JSA A;  1PSB A;  2HPS A;  1KFX S;  2LUC A;  1B4C A;  3SG7 A;  3TDZ A;  5JOL A;  3NSK A;  2HF5 A;  2KFH A;  1PSR A;  1Y1U A;  2LVK A;  2R2I A;  2GGZ A;  3OP0 A;  1JC2 A;  1LKJ A;  2JU0 A;  1MXE A;  3I5F C;  1S1E A;  5AXI A;  3SJS A;  2BL0 C;  3GK1 A;  1V1G A;  1BT6 A;  4GPL B;  4I5N B;  2WCF A;  1K94 A;  3RLZ A;  1CFF A;  1K90 D;  1F4Q A;  2DOQ A;  4AOM A;  2TN4 A;  2F3Y A;  1TIZ A;  3VRR A;  3DD4 A;  1GQM A;  1XO5 A;  1KK7 Y;  4YGA A;  2CNP A;  4NDB A;  4NDC A;  1BOC A;  1UP5 A;  2SCP A;  1XFY O;  1J1D A;  1NP8 A;  1NX0 A;  4DIR A;  1NYA A;  2O60 A;  5HKY A;  2LHL A;  1EJ3 A;  2Y5I A;  3DVJ A;  2WC8 A;  3BUW B;  1DVI A;  2ZND A;  1PAL A;  3TZ1 A;  1K96 A;  1J7O A;  1CFP A;  1DF0 A;  3D10 A;  4PHM A;  3SG6 A;  3CGA A;  2LC5 A;  3I5I B;  3I5G C;  5FYX A;  1DGV A;  3PN7 B;  2I7A A;  2BBM A;  4AQJ A;  1QXP A;  3DVK A;  3OHM B;  4MSP A;  1CFC A;  2KYF A;  4YGC B;  2K7O A;  3FWC A;  2L50 A;  1S36 A;  4CFR A;  2ZN8 A;  2QPT A;  3AAK A;  2ZRT A;  3KPX A;  3CS1 A;  2NXQ A;  2F33 A;  1F54 A;  2PMY A;  4DCK A;  2MAZ A;  4R1E A;  1ZAC A;  1VRK A;  2M3W A;  2H2K A;  2M0R A;  1JUO A;  1Y0V H;  1PVB A;  1XYD A;  5AEQ A;  2MJW B;  2JTT A;  1KK8 C;  1KCY A;  1JFK A;  2Y1M A;  1HQV A;  3TDU A;  1PRW A;  3BOW B;  2F3Z A;  1DGU A;  4L9M A;  1BR1 B;  1AHR A;  2KQ6 A;  3CLN A;  2LHI A;  3VRN A;  2LLS A;  1CDN A;  2LV7 A;  2GV5 A;  2KSP A;  3WXA A;  1TNW A;  1B1G A;  3CR4 X;  1DMO A;  3PAL A;  2P6B B;  1A29 A;  2ZNE A;  1SR6 C;  2EC6 C;  1SNL A;  2KAV A;  4GGN A;  2KQY A;  3H4S E;  1S26 D;  1MXL C;  1OE9 B;  1SKT A;  1ALV A;  3A8R A;  1SRA A;  5DKN A;  4QJ5 B;  3GOF A;  1BR4 B;  1KSO A;  1N0Y A;  1YVH A;  3VGO A;  3EKJ A;  1K95 A;  2JRF A;  2Y4Q A;  1MUX A;  2PVB A;  5AFP A;  1F70 A;  1YRU B;  2BCX A;  3FS7 A;  3DF0 B;  1R2U A;  3JTD B;  3D0Y B;  2L98 A;  4OVN F;  2AUC A;  2PAS A;  2KGB C;  2K2F A;  1N65 A;  1UWO A;  2KFF A;  1AP4 A;  2L0P A;  2OS8 C;  3SG5 A;  1IGV A;  1QLS A;  2MA2 A;  2M7N A;  1CMF A;  3DVE A;  4P5O E;  5D69 A;  1A75 A;  1WLZ A;  5BPJ A;  5DKQ A;  1OZS A;  1D1O A;  2SAS A;  4MRX A;  1TOP A;  3CZT X;  4BY4 A;  1JBA A;  2PSR A;  4TNC A;  1DJY A;  1REC A;  5HLO A;  2KI4 C;  2LAP A;  2B1U A;  2KDH A;  1RWY A;  1J55 A;  1QX2 A;  5F6T A;  1K2H A;  3IQQ A;  1SYM A;  3WHU B;  1XFV O;  1CLB A;  1OZO A;  1MF8 B;  3OB2 B;  1B7T Z;  1K8U A;  2LUX A;  1IQ5 A;  1SPY A;  4Q04 A;  2M1U A;  1IG5 A;  3ZWH A;  1YTZ C;  2ZFD A;  1M39 A;  1UUS A;  1G8I A;  5TNC A;  1UHJ A;  1PK0 D;  4OCI A;  1QS7 A;  1A2X A;  4OR9 B;  3BYA A;  1LXF C;  4PHN A;  1QV1 A;  1CB1 A;  2HET A;  1F55 A;  1OMV A;  2KOT A;  1UUR A;  1WRZ A;  2L4H A;  1LIN A;  1YX7 A;  2LMV A;  4P2Y B;  1R6P A;  4XJK B;  1K93 D;  5AER A;  1BOD A;  2LP3 A;  4USL A;  1BG1 A;  1DTL A;  4DUQ A;  1RK9 A;  4CFQ A;  1XA5 A;  1M46 A;  1IJ5 A;  4I5J A;  2CCM A;  1QX5 B;  1HT9 A;  3O4Y A;  1YUU A;  2KI6 D;  3BOW A;  3LL8 B;  1QVI Z;  1WLM A;  2KYC A;  2NLN A;  2JT8 A;  1B8L A;  2H61 C;  1QTX A;  2JXL A;  3ICB A;  3EKH A;  1LA0 A;  1BF5 A;  2KNE A;  4C0K A;  2NZ0 A;  1CMG A;  4MRY A;  1B9A A;  1CDL A;  1S5G Z;  4PE4 A;  1QAT A;  1N2D A;  3AKB A;  1ZMZ A;  2LMU A;  2MHH A;  2L4I A;  2I2R E;  3EK8 A;  5G08 A;  2ISD A;  3BUX B;  1FI6 A;  4MEW A;  4C0J A;  1SK6 D;  1WDC B;  4D1E A;  2MLF C;  4XYN A;  5HLV A;  1QIV A;  2JWW A;  3D0Y A;  3I5I C;  3PN7 C;  2BCB A;  2Q4U A;  1JFJ A;  2I94 A;  1BU3 A;  4GAO A;  2LM5 A;  1CNP A;  1OOJ A;  1XK4 C;  3EVU A;  3A4U B;  3GK2 A;  4NQG A;  3TUY B;  1IWQ A;  1AK8 A;  4HRG A;  1YR5 A;  4OKH A;  1CM4 A;  2CTN A;  2LE9 B;  4ZCU A;  2M9G A;  1NUB A;  3GK4 X;  2LMT A;  2KAY A;  4CPV A;  2G2B A;  3VRQ A;  2EGD A;  1U5I B;  1Y6W A;  3I5H B;  1E8A A;  2L2E A;  2Y1N A;  3OX5 A;  1JWD A;  1PVA A;  1SCV A;  1L2O B;  2K0J A;  3PAT A;  4N5X A;  4YBH B;  2K8M B;  3KEV A;  3NSI A;  4MVF A;  1AJ5 A;  1K9P A;  4JPZ B;  1YVL A;  4PE7 A;  5IBW A;  3NXA A;  4ICB A;  2LVV A;  3EVV A;  2KAX A;  2L51 A;  2LVI A;  3O78 A;  1M31 A;  1B8C A;  2I18 A;  2OPO A;  2WOR A;  1CDM A;  3TDI A;  2M8U A;  2CXJ A;  2RGI A;  1B47 A;  1PUL A;  1SL8 A;  1S6C A;  1EG3 A;  4JQ0 D;  5CSJ A;  1TNP A;  1MWN A;  4GNK B;  1OSA A;  1QAS A;  4MN0 A;  3WHT B;  1F8H A;  1W7J B;  4DS7 A;  4WRI A;  5I2O A;  3RM1 A;  1NWD A;  2G9B A;  2FOT A;  3DVM A;  1FPW A;  1GGZ A;  3JTD C;  3LK1 A;  2OTG B;  1XVJ A;  1SBJ A;  1RTP 1;  1YX8 A;  3NSL A;  4AQI A;  2JC2 A;  4N1F A;  1ODB A;  4YGE B;  1H8B A;  3JVT B;  4PAL A;  1BMO A;  5AAN A;  4DRW A;  1CTR A;  1ZOT B;  1DJH A;  1MR8 A;  1CDP A;  1AJ4 A;  2FCD A;  2BEC A;  1SY9 A;  2F2P A;  3CR5 X;  4ZCV A;  5KSZ A;  1KFU L;  1IKU A;  2FJU B;  1ALW A;  4A4B A;  2KBI A;  2LAN A;  2H61 A;  3LLE A;  2BE6 A;  1B8R A;  3PLF B;  5HKZ A;  1DJX A;  1KK7 Z;  3CWG A;  2V53 A;  1SCM B;  2LLU A;  1V1F A;  1ZFS A;  1TNQ A;  1QV0 A;  2CT9 A;  1C7V A;  1DF0 B;  1TCF A;  4PHJ A;  3LK0 A;  3SIA A;  2WCB A;  1JF2 A;  3K21 A;  1MHO A;  1YUT A;  3PM8 A;  1KWO B;  2K7D A;  4QJ4 B;  1C07 A;  1TCO B;  4MLW A;  2E30 A;  5I2L A;  1GJY A;  2IS9 A;  1XFW O;  2LCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...