2I7AA

Domain iv of human calpain 13
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
163
structure length
157
Chain Sequence
SGLVPGSDIDATQLQGLLNQELLDMFSLDECRSLVALMELKVNGRLDQEEFARLWKRLVHYQHVFQKVQTSPGVLLSSDLWKAIENTDFLRGIFISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Calpain 13
publication title Structure of Human Calpain 13
rcsb
source organism Homo sapiens
total genus 53
structure length 157
sequence length 163
ec nomenclature
pdb deposition date 2006-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2i7aA00
3WNXB 1ALWA 3OX5A 1EJ3A 1XK4A 1A03A 4GBAA 1SMGA 3RM1A 1LKJA 1L2OC 2JOJA 3VRNA 4I5LB 1A75A 1IQ5A 2MBXA 3CTNA 2PVBA 1AJ4A 5HKWA 2M49B 4CFQA 1F4QA 2KHNA 2PALA 4HREE 4C0JA 4YGAA 3DVEA 1UURA 2ZNDA 3KF9A 1PSRA 2KNEA 1IGVA 1LA0A 1BMOA 3KEVA 2L0PA 1WRKA 3OB2B 1G8IA 1Y6WA 4P2YB 3I5IC 2KAVA 2K7OA 1MUXA 5K89A 2MLFC 2NCPA 1SL7A 1CMGA 1D1OA 4PDZA 4UPGA 1OSAA 5HKZA 4BY4A 5CSFA 2M29A 5JJGA 2ZRSA 2CXJA 3KHEA 3WHTB 1XK4C 1DJHA 4QJ5B 1NX3A 1KFXS 3DF0B 1CLMA 1A4PA 1PALA 2HF5A 4FTGA 5HLOA 5AEQA 1C7VA 2BCAA 2NZ0A 2KFFA 2WCEA 3CR4X 1WLZA 1UHKA 4YI9A 2CBLA 1W7JB 2L4HA 4CFRA 5BPJA 2JRFA 4PE1A 5HYDA 1C07A 1JSAA 2EC6C 1YVLA 1S6IA 4MLWA 1CB1A 1QX2A 1YVHA 4WQ2A 1CDNA 5ER5A 3SG6A 1XVJA 1IG5A 2Y1MA 1V1GA 1FI6A 1NX0A 1MHOA 1Y1XA 4MZLA 5CPVA 4JWQA 3KO0A 2SCPA 2E30A 1SNLA 1AHRA 1M31A 3BUXB 1AJ5A 1AK8A 2LCPA 4XJKA 1JF2A 1QV1A 3K21A 1L2OB 1SL8A 3SIBA 1GJYA 3ZWHA 1SW8A 1DJXA 1SY9A 3TZ1A 4JPZB 2KFHA 1QVIZ 2K61A 1CM4A 4MEWA 1EH2A 3I5GC 1DMOA 3BOWB 1QXPA 4E68A 4R1EA 4PHJA 2BECA 1R2UA 1V1FA 1XFXO 3AKAA 3PFVA 1Y0VH 2PSRA 2OTGB 3I5IB 3VROA 5ER4X 2QACA 1S3PA 1EG3A 1SKTA 2BCXA 2MJWB 3PSRA 1DJYA 4YGDB 4IL1A 3CR2A 2JNXA 2BL0B 1KK7Y 1NYAA 1FPWA 2LAPA 2LMTA 3SG2A 4AQJA 2M97A 1YRUB 1CDPA 2K0JA 2MHHA 1IJ6A 5KTYA 3AKBA 2WC8A 3JTDB 4PHNA 1DVIA 1A75B 3TS5C 4AQIA 2KBIA 1IJ5A 2PMYA 1BR1B 1PVBA 2G2BA 1OQPA 2Y1NA 1J55A 3SJSA 4NDBA 5JOLA 4QJ4B 1F54A 3TDIA 4PE7A 3BUWB 5TNCA 2K2FA 5CSIA 3O2PA 3GOFA 1NWDA 2EC6B 2M9GA 1G4YR 3LK1A 2JZIA 5D69A 3VRRA 1PRWA 1CFPA 3BOWA 5DKQA 2MLEC 3I5FC 1K94A 1S36A 1UUSA 2WOSA 4MRYA 4MZJA 1KK8C 3NXAA 1YX8A 4YRUA 2KFGA 4NDDA 2JC2A 3DVJA 1TCFA 2DOQA 1KQVA 3A4UB 1TNWA 1UHHA 4GNKB 2FCEA 3PLFB 1J1EA 1OMRA 3NSKA 1TRFA 1K96A 1AVSA 2B1UA 2PASA 4I5NB 4OVNF 4U8DA 4BY5A 1EXRA 1H4BA 2O60A 1QTXA 3CZTX 3CS1A 2BKHB 1A29A 3E3RA 3PATA 1U5IB 2HPSA 2LLUA 4FQOA 2KI4C 2M8UA 2VRGA 4YBHB 1S5GY 4N1GA 1Y1AA 1JFKA 1F55A 1MF8B 3FIAA 3AAKA 2K7DA 2JQ6A 1CMFA 4DCKA 1F4OA 2GGZA 2KYFA 4GPLB 3WHUB 1B8LA 1B7TY 2ZRTA 3I5GB 1TTXA 3D10A 2WCFA 2FJUB 3QRXA 1K9KA 2M3WA 2OTGC 1BJFA 4C0KA 1BT6A 1KFUL 1KQMB 1UHJA 1ZACA 1RFJA 4A4CA 1XYDA 1ZOTB 1KFUS 2BL0C 2I18A 5HKYA 4CIDA 2COLB 3I5HC 1OZSA 1OMVA 4WRIA 1YX7A 2AUCA 4XJKB 3SG3A 1ODBA 1M46A 3JTDC 1TIZA 1SL9A 1GQMA 2JNFA 4Q04A 3TS5B 2KQYA 3O6BA 4CLNA 2M0RA 1U5IA 2LVVA 1AP4A 3EKHA 1TCOB 2AMIA 2KDHA 1SK6D 2JT0A 2F3YA 2KSPA 3O4YA 1YUTA 1FI5A 2AAOA 1JBAA 2ZNEA 5DKNA 1QLKA 2Y5IA 1DJGA 1NCZA 3VRPA 2BE4A 1CTRA 1CDMA 2Y4QA 3I5FB 1SR6B 4YI8A 2JXLA 1N0YA 1NX1A 2HQWA 1K93D 3KPXA 1QJTA 1KK8B 2KI6C 5IBWA 1KWOC 2H2KA 2LE9B 1WDCC 5AXIA 2BE6A 2LV7A 2IS9A 4HSZA 2E6WA 2KOTA 2GGMA 2I2RE 2LLSA 1CDLA 2Q4UA 2M1UA 2CT9A 1MR8A 3NSOA 1OOJA 4OKHA 5CSNA 4F0ZB 1DJZA 2D8NA 1CNPA 3EVUA 2L4IA 4ORAB 2LVJA 1DGVA 1JFJA 1WLMA 4PE0A 2KI4B 4M2OA 3LLEA 4DIRA 1FF1A 2HETA 2PRUA 2ISDA 1Q80A 1NIWA 1SCMC 2LMUA 3FWBA 4TNCA 2F33A 2GV5A 3JVTB 4GFTA 1F71A 4MN0A 2WNDA 1JWDA 1BOCA 4QJ3B 2LHLA 3TDUA 1KQMC 1OE9B 1UHNA 1BR4B 1EL4A 2K8MB 2TN4A 1J7OA 2LHIA 1BODA 1BLQA 1J7RA 3EK8A 1CFCA 2JU0A 2ZN8A 2BBMA 1M63B 3HX4A 3VGOA 3I5HB 2HQ8A 2L98A 1YUUA 4MVFA 1YRTB 1UHIA 4NQGA 1YR5A 2JTZA 1N2DA 3LK0A 4ZCUA 1K2HA 4N5XA 3TDZA 2R2IA 2MRDA 4I5JA 1B1GA 1CLLA 2OS8C 5AANA 1QIWA 1B7TZ 1XFYO 5FYXA 1K9PA 3TUYC 4MBEA 4ZCVA 3BYAA 4ORBB 1MXEA 2JT3A 1QASA 3BUNB 2K7BA 1J1DA 3LCPC 3OHMB 5PALA 3O78A 5I2OA 3EKJA 1N65A 1WRZA 3DVMA 1M45A 1SR6C 1UP5A 4YGCB 3OX6A 2JT8A 2BCBA 2OPOA 1KWOB 2F2PA 1NX2A 2ZKMX 3F45A 5I8NA 1WDCB 4GGFA 3PM8A 2WORA 1TNPA 1LXFC 5GQQC 1B8RA 4M2PA 2A4JA 2BBNA 1GGWA 2M1KB 1QX5B 2H61A 2L50A 4OR9B 2QPTA 1YUSA 1SCVA 4YGEB 4MZKA 5HLVA 1J7PA 1ZFSA 2NLNA 3SG4A 2KGRA 1F70A 1MQ1A 4N1FA 1SCMB 1EG4A 1BU3A 1R6PA 3PN7C 1KSOA 1VRKA 1CKKA 3CWGA 3JVTC 3OP0A 3C1VA 2L51A 4GUKA 4PHMA 1S26D 3OB1B 1Y1UA 3BQ3A 1QV0A 2EGDA 2KBMA 3GK4X 1AUIB 1XFVO 1BF5A 4GGFC 4USLA 3D0YA 1B47A 1TNXA 2KQ6A 1CFDA 1XFZO 2Q91A 3VRQA 1CFFA 1PSBA 1WRLA 2H61C 2K2AA 3WXAA 2WCBA 4M2QA 3EVRA 3IQOA 1DF0A 1QS7A 4MSPA 1SYMA 2F3ZA 1DJWA 1CM1A 3ZNIA 4D1EA 1TNQA 5I2QA 2OS8B 3CGAA 4I5KA 4PCWA 3H4SE 1JC2A 4PALA 4HRHA 3FS7A 3SIAA 3SG7A 3TUYB 1DTLA 2LUXA 3BXKA 2SASA 2KGBC 1NSHA 2L2EA 1KFXL 2M7LA 3DD4A 1MXLC 1G33A 4DRWA 4NDCA 4DS7A 1H8BA 1PK0D 1E8AA 1XO5A 1K95A 1IH0A 1KK7Z 1TOPA 5B8IB 1MWNA 3NSIA 4GAOA 3AAJA 1B9AA 1LINA 5AERA 2LC5A 1ZMZA 1OMDA 3EK7A 2P6BB 4ICBA 1HQVA 5AFPA 1J7QA 5D7FA 1K90D 2M7NA 2JULA 4YGBB 3M0WA 1RROA 2O5GA 3A8RA 1CLBA 5CSJA 2FCDA 3LL8B 2EHBA 3EK4A 1L7ZA 4P5OE 1ZUZA 3PN7B 2LMVA 1A2XA 4OCIA 2LVIA 2ZN9A 1X02A 3SG5A 4C0LA 1JF0A 2LUCA 1RTP1 2CCMA 1JUOA 4JQ0D 1PVAA 1RWYA 2FOTA 1S1EA 1NPQA 2LANA 1FBVA 3DVKA 5KU1A 1W7IB 1BG1A 1HT9A 5KSZA 5G08A 3DF0A 3PALA 2JXCA 1OZOA 2LM5A 4A4BA 2V53A 3GK1A 1GGZA 2CTNA 3FWCA 2F2OA 4PHKA 2ZFDA 2NCOA 1IKUA 4ORCB 1S5GZ 1YURA 5J3XA 2K7CA 1NUBA 1FW4A 2F8PA 4L9MA 4XYNA 1UWOA 5I2LA 2I7AA 3BUOB 1XFUO 2LLTA 2LP3A 3GK2A 3NSLA 2I94A 2KAXA 3RLZA 1B8CA 1SBJA 2KAYA 3IQQA 1QX7A 1QLSA 1TN4A 3ICBA 3IF7A 1KSMA 2BKIB 2MA2A 4PE4A 3CLNA 4GGNA 1KCYA 1C7WA 1DJIA 1LVCD 1M39A 2JTTA 2LNKA 2LVKA 4DUQA 1LA3A 1SPYA 1NP8A 1DT7B 3EVVA 1RECA 3D0YB 5F6TA 1DGUA 1WY9A 2JPTA 3CR5X 1NCXA 1XA5A 1RK9A 1IRJA 1K8UA 4WQ3A 2KI6D 2LP2A 4AOMA 1SRAA 1S6CA 1B4CA 1DF0B 1XFWO 2L5XB 1ALVA 1QATA 1PULA 2MAZA 2RGIA 4ETOA 3MSEB 2NXQA 1QIVA 1QVIY 2CNPA 1YTZC 4HRGA 2G9BA 1IWQA 1IQ3A 2JWWA 4MRXA 1F8HA 1RJVA 3BUMB 1K9UA 3HCMA 1S6JA 5DKRA 4CPVA 1NCYA 4OV2A 2KYCA
chains in the Genus database with same CATH superfamily
3WNXB 1ALWA 3OX5A 1EJ3A 1XK4A 3BFHA 1A03A 4GBAA 1SMGA 3RM1A 1LKJA 1L2OC 2JOJA 3VRNA 4I5LB 1A75A 1IQ5A 2MBXA 3CTNA 2PVBA 1AJ4A 5HKWA 2M49B 4CFQA 1F4QA 2KHNA 2PALA 4HREE 4C0JA 4YGAA 3DVEA 1UURA 3CABA 2ZNDA 3KF9A 2QEVA 3S0AA 1PSRA 2KNEA 1IGVA 1LA0A 1BMOA 3KEVA 2L0PA 1WRKA 3OB2B 1G8IA 1Y6WA 2PQLA 4P2YB 1P28A 3I5IC 2KAVA 1BG1A 2K7OA 1MUXA 5K89A 2MLFC 2NCPA 1SL7A 1CMGA 1D1OA 3QMEA 4PDZA 3R72A 4UPGA 1OSAA 5HKZA 4BY4A 5CSFA 2M29A 5JJGA 2ZRSA 2CXJA 3KHEA 3WHTB 1XK4C 1DJHA 4QJ5B 1NX3A 3D73A 1KFXS 3DF0B 3DZTA 1CLMA 3FE8A 1A4PA 1PALA 2HF5A 4FTGA 5HLOA 5AEQA 1C7VA 2BCAA 2NZ0A 2KFFA 2WCEA 3CR4X 1WLZA 1UHKA 3D75A 4YI9A 2CBLA 1W7JB 2L4HA 4CFRA 5BPJA 2JRFA 4PE1A 5HYDA 1C07A 1JSAA 2EC6C 3DYEA 1YVLA 1S6IA 4MLWA 4PT1A 1CB1A 1QX2A 1YVHA 4WQ2A 1CDNA 5ER5A 3SG6A 1XVJA 1IG5A 2Y1MA 1V1GA 1FI6A 1NX0A 1MHOA 1Y1XA 4MZLA 5CPVA 4JWQA 3KO0A 2SCPA 2WC5A 2E30A 1SNLA 1AHRA 1M31A 3BUXB 1AJ5A 1AK8A 2LCPA 4XJKA 3IVTA 1JF2A 1QV1A 3K21A 1L2OB 1SL8A 3SIBA 1GJYA 3ZWHA 1SW8A 1DJXA 1SY9A 3TZ1A 4JPZB 2KFHA 1QVIZ 2K61A 1CM4A 4MEWA 1EH2A 3I5GC 1DMOA 3BOWB 1QXPA 3D78A 1SSEB 4JKTA 4E68A 4R1EA 4PHJA 1R2UA 2BECA 1V1FA 1XFXO 3AKAA 3PFVA 3S0GA 1Y0VH 2JPOA 2PSRA 2OTGB 3I5IB 1XFRA 3VROA 5ER4X 2QACA 1S3PA 1EG3A 1SKTA 2BCXA 2MJWB 3PSRA 1DJYA 4YGDB 4IL1A 2L2CA 3CR2A 2JNXA 2BL0B 1KK7Y 1NYAA 1FPWA 2LAPA 2LMTA 3SG2A 4AQJA 2M97A 1YRUB 1CDPA 4INWA 2K0JA 2MHHA 1IJ6A 5KTYA 3AKBA 2WC8A 3JTDB 4PHNA 1DVIA 2WCLA 1A75B 3TS5C 4AQIA 2KBIA 1IJ5A 2PMYA 1BR1B 1PVBA 2G2BA 1OQPA 2Y1NA 1J55A 3CZ2A 3SJSA 3CZ0A 4NDBA 5JOLA 4QJ4B 1F54A 3TDIA 4PE7A 3BUWB 5TNCA 2K2FA 3L4AA 3O2PA 3GOFA 1NWDA 2EC6B 2M9GA 1G4YR 2WCMA 2JZIA 3LK1A 5D69A 3VRRA 1PRWA 1CFPA 3BOWA 5DICA 5DKQA 2MLEC 3I5FC 1K94A 1S36A 1UUSA 2P71A 2WOSA 4MRYA 3UNWA 4MZJA 1KK8C 3N7HA 1YX8A 3NXAA 4JD9A 4YRUA 2KFGA 4NDDA 2JC2A 3DVJA 1TCFA 2DOQA 1KQVA 3A4UB 1TNWA 1UHHA 5I94A 4GNKB 2FCEA 3PLFB 1J1EA 3B7AA 1OMRA 3NSKA 1TRFA 1K96A 1AVSA 2B1UA 2PASA 4I5NB 4OVNF 4U8DA 4BY5A 1EXRA 1H4BA 2O60A 1QTXA 1OOIX 3CZTX 3CS1A 2BKHB 1A29A 3E3RA 3PATA 1U5IB 1Z4HA 2HPSA 2LLUA 2KI4C 2M8UA 2VRGA 4FQOA 1DELA 4YBHB 1S5GY 4N1GA 1Y1AA 1JFKA 1F55A 1MF8B 3FIAA 2H8VA 3AAKA 2K7DA 2JQ6A 1CMFA 4DCKA 1F4OA 2GGZA 2KYFA 4GPLB 3WHUB 1B8LA 1B7TY 2ZRTA 3I5GB 1TTXA 3CYZA 3D10A 2WCFA 2FJUB 3QRXA 1K9KA 2M3WA 2OTGC 1BJFA 4C0KA 1BT6A 1KFUL 1KQMB 1UHJA 1ZACA 1RFJA 4A4CA 1XYDA 4IJ7A 2WCJA 1ZOTB 1KFUS 2BL0C 2I18A 5HKYA 3D77A 4CIDA 2GTEA 2COLB 3FE6A 1OZSA 1OMVA 3I5HC 4WRIA 1YX7A 2AUCA 4XJKB 3SG3A 1ODBA 1M46A 3JTDC 5EL2A 1TIZA 3V2LA 4FQTA 1SL9A 1GQMA 2JNFA 3R1OA 4Q04A 2KQYA 3O6BA 3TS5B 4CLNA 2M0RA 1U5IA 2LVVA 1AP4A 3PJIA 3EKHA 1TCOB 2AMIA 2KDHA 1SK6D 2JT0A 2F3YA 2KSPA 3O4YA 1YUTA 1FI5A 2AAOA 1JBAA 2ZNEA 5DKNA 1QLKA 2Y5IA 1DJGA 1NCZA 3VRPA 2BE4A 1CTRA 1CDMA 2Y4QA 5HL1A 3I5FB 1SR6B 4YI8A 2JXLA 1N0YA 1NX1A 2HQWA 1K93D 3KPXA 1QJTA 1KK8B 2KI6C 5IBWA 1KWOC 2H2KA 2LE9B 1WDCC 5AXIA 2BE6A 2LV7A 2IS9A 4HSZA 2E6WA 2KOTA 2GGMA 2I2RE 2LLSA 1CDLA 2Q4UA 2M1UA 2CT9A 1MR8A 3NSOA 1OOJA 4OKHA 5CSNA 4F0ZB 1T14A 1DJZA 2D8NA 2YGUA 1CNPA 3EVUA 2P70A 2L4IA 4ORAB 2LVJA 1DGVA 1JFJA 1WLMA 4PE0A 2KI4B 3CDNA 3LLEA 4M2OA 4DIRA 1Z2CB 2HETA 2PRUA 1FF1A 2ISDA 1QWVA 2KLDA 1Q80A 1NIWA 1SCMC 2BAPA 2LMUA 3FWBA 4TNCA 2F33A 2GV5A 1OOFA 3JVTB 1LS8A 2K60A 4GFTA 1F71A 4MN0A 5FI2A 2WNDA 1JWDA 1BOCA 4QJ3B 2LHLA 3TDUA 1KQMC 1OE9B 1UHNA 1BR4B 1EL4A 2K8MB 2TN4A 1J7OA 2LHIA 1BODA 1BLQA 1J7RA 3EK8A 1CFCA 2ERBA 2JU0A 2QEOA 2ZN8A 2BBMA 1M63B 2FJYA 3HX4A 3VGOA 3I5HB 1OW4A 2HQ8A 2L98A 1YUUA 3NGVA 4MVFA 3L4LA 1YRTB 1UHIA 1C3ZA 4NQGA 1YR5A 2JTZA 1N2DA 3LK0A 4ZCUA 1K2HA 4N5XA 5D3OA 2R2IA 3TDZA 1C3YA 2MRDA 4I5JA 1B1GA 1CLLA 2OS8C 5AANA 1QIWA 3CZ1A 1B7TZ 1XFYO 5FYXA 1K9PA 3TUYC 4MBEA 1GM0A 4ZCVA 3BYAA 4ORBB 1MXEA 2JT3A 1QASA 3BUNB 2K7BA 1J1DA 3LCPC 3OHMB 5PALA 3O78A 5I2OA 3EKJA 1N65A 1WRZA 1DEKA 1M45A 1SR6C 1UP5A 3BJHA 3DVMA 4YGCB 3OX6A 1IIOA 2QEBA 2JT8A 2BCBA 2OPOA 3NHIA 1KWOB 2F2PA 1NX2A 2ZKMX 3F45A 3VB1A 1WDCB 5I8NA 4GGFA 3PM8A 2WORA 1DC1A 1TNPA 1LXFC 1OOHA 5GQQC 1B8RA 4M2PA 2A4JA 2BBNA 1GGWA 3D76A 3PM2A 2M1KB 1QX5B 2H61A 2L50A 3B86A 2QPTA 4OR9B 1YUSA 1SCVA 4YGEB 4MZKA 5HLVA 1J7PA 1ZFSA 2NLNA 3SG4A 2KGRA 1F70A 1MQ1A 4N1FA 1SCMB 1EG4A 1BU3A 1R6PA 3PN7C 1KSOA 1VRKA 1CKKA 3CWGA 3JVTC 3OP0A 3C1VA 2L51A 4GUKA 4PHMA 1S26D 3OB1B 3OGNA 1Y1UA 3BQ3A 1QV0A 2EGDA 2KBMA 3GK4X 1AUIB 1XFVO 3SS5A 1BF5A 4GGFC 4USLA 3D0YA 1B47A 1TNXA 2KQ6A 3UO9A 1CFDA 1XFZO 2Q91A 3EG5B 3VRQA 1CFFA 1PSBA 5CSIA 1WRLA 2H61C 2K2AA 3WXAA 2WCBA 4M2QA 3EVRA 3IQOA 1DF0A 1QS7A 4MSPA 1SYMA 2F3ZA 1DJWA 1CM1A 3R1VA 3ZNIA 4D1EA 1TNQA 5I2QA 2OS8B 3CGAA 4I5KA 4PCWA 2PYQA 3H4SE 3R1PA 1JC2A 3OBVA 4HRHA 3FS7A 4PALA 3SIAA 3SG7A 3TUYB 1DTLA 2LUXA 3BXKA 3B88A 2SASA 2KGBC 2QDIA 1NSHA 2L2EA 1KFXL 3BFBA 3DXLA 4INXA 2M7LA 2L5YA 3DD4A 1MXLC 1G33A 4DRWA 4NDCA 4DS7A 1H8BA 1PK0D 1E8AA 1XO5A 1K95A 2QEHA 1IH0A 1KK7Z 1TOPA 5B8IB 1MWNA 3BFAA 3NSIA 4GAOA 3DY9A 3AAJA 1B9AA 2BNXA 1LINA 5AERA 3D74A 2LC5A 1ZMZA 1OMDA 3EK7A 2P6BB 1DQEA 4ICBA 1HQVA 5AFPA 1J7QA 5D7FA 1K90D 2M7NA 3O4XA 2JULA 4YGBB 3M0WA 1RROA 3S0FA 2O5GA 1TWOA 3A8RA 1CLBA 5CSJA 2FCDA 3LL8B 2EHBA 3B87A 3EK4A 1L7ZA 4P5OE 1ZUZA 3PN7B 2LMVA 1TUJA 1A2XA 4OCIA 2LVIA 2ZN9A 1X02A 3SG5A 4C0LA 3S0BA 1JF0A 2LUCA 1RTP1 2CCMA 1JUOA 4JQ0D 3S0DA 1PVAA 1RWYA 2FOTA 1S1EA 1NPQA 2LANA 1FBVA 3DVKA 5KU1A 1W7IB 3K1EA 1HT9A 1ORGA 5G08A 3DF0A 5KSZA 3PALA 2JXCA 1OZOA 4OZDA 2LM5A 5FI7A 4A4BA 2V53A 3GK1A 1GGZA 2CTNA 3FWCA 3Q8IA 2F2OA 4PHKA 1TUZA 4KYNA 2ZFDA 2NCOA 1IKUA 4ORCB 1S5GZ 1YURA 5J3XA 3SS3A 2K7CA 1NUBA 3B6XA 1FW4A 2F8PA 4L9MA 4XYNA 1UWOA 5I2LA 2I7AA 3S0EA 1OOGA 3RZSA 3BUOB 5FI6A 1XFUO 2LLTA 2LP3A 3GK2A 2WCKA 3NSLA 2I94A 2KAXA 3RLZA 1B8CA 1SBJA 2KAYA 3IQQA 1QX7A 1QLSA 1TN4A 3ICBA 3IF7A 1KSMA 2BKIB 2MA2A 4PE4A 3CLNA 4GGNA 2WC6A 1KCYA 1C7WA 3L47A 1DJIA 1LVCD 1M39A 2JTTA 2LNKA 2LVKA 4DUQA 1LA3A 1SPYA 1NP8A 1DT7B 3EVVA 1RECA 3D0YB 5F6TA 1DGUA 3SS4A 1WY9A 2JPTA 3CR5X 1NCXA 1XA5A 1RK9A 1IRJA 1K8UA 4WQ3A 2KI6D 4F7FA 1W9ZA 2LP2A 3NHTA 4AOMA 1SRAA 1S6CA 2KLEA 1B4CA 1DF0B 3FE9A 1XFWO 2L5XB 1ALVA 1QATA 1PULA 2MAZA 2RGIA 4ETOA 3MSEB 2NXQA 1QIVA 1QVIY 2CNPA 1YTZC 4HRGA 2G9BA 1IWQA 1IQ3A 2JWWA 2KPHA 4MRXA 1F8HA 1RJVA 3BUMB 1K9UA 3HCMA 1S6JA 5DKRA 4CPVA 2WCHA 1NCYA 4OV2A 2KYCA
chains in the Genus database with same CATH topology
3WNXB 1ALWA 3OX5A 1EJ3A 1XK4A 1A03A 4GBAA 1SMGA 3RM1A 1LKJA 1L2OC 2JOJA 3VRNA 4I5LB 1A75A 1IQ5A 2MBXA 3CTNA 2PVBA 1AJ4A 5HKWA 2M49B 4CFQA 1F4QA 2KHNA 2PALA 4HREE 4C0JA 4YGAA 3DVEA 1UURA 2ZNDA 3KF9A 1PSRA 2KNEA 1IGVA 1LA0A 1BMOA 3KEVA 2L0PA 1WRKA 3OB2B 1G8IA 1Y6WA 4P2YB 3I5IC 2KAVA 2K7OA 1MUXA 5K89A 2MLFC 2NCPA 1SL7A 1CMGA 1D1OA 4PDZA 4UPGA 1OSAA 5HKZA 4BY4A 5CSFA 2M29A 5JJGA 2ZRSA 2CXJA 3KHEA 3WHTB 1XK4C 1DJHA 4QJ5B 1NX3A 1KFXS 3DF0B 1CLMA 1A4PA 1PALA 2HF5A 4FTGA 5HLOA 5AEQA 1C7VA 2BCAA 2NZ0A 2KFFA 2WCEA 3CR4X 1WLZA 1UHKA 4YI9A 2CBLA 1W7JB 2L4HA 4CFRA 5BPJA 2JRFA 4PE1A 5HYDA 1C07A 1JSAA 2EC6C 1YVLA 1S6IA 4MLWA 1CB1A 1QX2A 1YVHA 4WQ2A 1CDNA 5ER5A 3SG6A 1XVJA 1IG5A 2Y1MA 1V1GA 1FI6A 1NX0A 1MHOA 1Y1XA 4MZLA 5CPVA 4JWQA 3KO0A 2SCPA 2E30A 1SNLA 1AHRA 1M31A 3BUXB 1AJ5A 1AK8A 2LCPA 4XJKA 1JF2A 1QV1A 3K21A 1L2OB 1SL8A 3SIBA 1GJYA 3ZWHA 1SW8A 1DJXA 1SY9A 3TZ1A 4JPZB 2KFHA 1QVIZ 2K61A 1CM4A 4MEWA 1EH2A 3I5GC 1DMOA 3BOWB 1QXPA 4E68A 4R1EA 4PHJA 2BECA 1R2UA 1V1FA 1XFXO 3AKAA 3PFVA 1Y0VH 2PSRA 2OTGB 3I5IB 3VROA 5ER4X 2QACA 1S3PA 1EG3A 1SKTA 2BCXA 2MJWB 3PSRA 1DJYA 4YGDB 4IL1A 3CR2A 2JNXA 2BL0B 1KK7Y 1NYAA 1FPWA 2LAPA 2LMTA 3SG2A 4AQJA 2M97A 1YRUB 1CDPA 2K0JA 2MHHA 1IJ6A 5KTYA 3AKBA 2WC8A 3JTDB 4PHNA 1DVIA 1A75B 3TS5C 4AQIA 2KBIA 1IJ5A 2PMYA 1BR1B 1PVBA 2G2BA 1OQPA 2Y1NA 1J55A 3SJSA 4NDBA 5JOLA 4QJ4B 1F54A 3TDIA 4PE7A 3BUWB 5TNCA 2K2FA 5CSIA 3O2PA 3GOFA 1NWDA 2EC6B 2M9GA 1G4YR 3LK1A 2JZIA 5D69A 3VRRA 1PRWA 1CFPA 3BOWA 5DKQA 2MLEC 3I5FC 1K94A 1S36A 1UUSA 2WOSA 4MRYA 4MZJA 1KK8C 3NXAA 1YX8A 4YRUA 2KFGA 4NDDA 2JC2A 3DVJA 1TCFA 2DOQA 1KQVA 3A4UB 1TNWA 1UHHA 4GNKB 2FCEA 3PLFB 1J1EA 1OMRA 3NSKA 1TRFA 1K96A 1AVSA 2B1UA 2PASA 4I5NB 4OVNF 4U8DA 4BY5A 1EXRA 1H4BA 2O60A 1QTXA 3CZTX 3CS1A 2BKHB 1A29A 3E3RA 3PATA 1U5IB 2HPSA 2LLUA 4FQOA 2KI4C 2M8UA 2VRGA 4YBHB 1S5GY 4N1GA 1Y1AA 1JFKA 1F55A 1MF8B 3FIAA 3AAKA 2K7DA 2JQ6A 1CMFA 4DCKA 1F4OA 2GGZA 2KYFA 4GPLB 3WHUB 1B8LA 1B7TY 2ZRTA 3I5GB 1TTXA 3D10A 2WCFA 2FJUB 3QRXA 1K9KA 2M3WA 2OTGC 1BJFA 4C0KA 1BT6A 1KFUL 1KQMB 1UHJA 1ZACA 1RFJA 4A4CA 1XYDA 1ZOTB 1KFUS 2BL0C 2I18A 5HKYA 4CIDA 2COLB 3I5HC 1OZSA 1OMVA 4WRIA 1YX7A 2AUCA 4XJKB 3SG3A 1ODBA 1M46A 3JTDC 1TIZA 1SL9A 1GQMA 2JNFA 4Q04A 3TS5B 2KQYA 3O6BA 4CLNA 2M0RA 1U5IA 2LVVA 1AP4A 3EKHA 1TCOB 2AMIA 2KDHA 1SK6D 2JT0A 2F3YA 2KSPA 3O4YA 1YUTA 1FI5A 2AAOA 1JBAA 2ZNEA 5DKNA 1QLKA 2Y5IA 1DJGA 1NCZA 3VRPA 2BE4A 1CTRA 1CDMA 2Y4QA 3I5FB 1SR6B 4YI8A 2JXLA 1N0YA 1NX1A 2HQWA 1K93D 3KPXA 1QJTA 1KK8B 2KI6C 5IBWA 1KWOC 2H2KA 2LE9B 1WDCC 5AXIA 2BE6A 2LV7A 2IS9A 4HSZA 2E6WA 2KOTA 2GGMA 2I2RE 2LLSA 1CDLA 2Q4UA 2M1UA 2CT9A 1MR8A 3NSOA 1OOJA 4OKHA 5CSNA 4F0ZB 1DJZA 2D8NA 1CNPA 3EVUA 2L4IA 4ORAB 2LVJA 1DGVA 1JFJA 1WLMA 4PE0A 2KI4B 4M2OA 3LLEA 4DIRA 1FF1A 2HETA 2PRUA 2ISDA 1Q80A 1NIWA 1SCMC 2LMUA 3FWBA 4TNCA 2F33A 2GV5A 3JVTB 4GFTA 1F71A 4MN0A 2WNDA 1JWDA 1BOCA 4QJ3B 2LHLA 3TDUA 1KQMC 1OE9B 1UHNA 1BR4B 1EL4A 2K8MB 2TN4A 1J7OA 2LHIA 1BODA 1BLQA 1J7RA 3EK8A 1CFCA 2JU0A 2ZN8A 2BBMA 1M63B 3HX4A 3VGOA 3I5HB 2HQ8A 2L98A 1YUUA 4MVFA 1YRTB 1UHIA 4NQGA 1YR5A 2JTZA 1N2DA 3LK0A 4ZCUA 1K2HA 4N5XA 3TDZA 2R2IA 2MRDA 4I5JA 1B1GA 1CLLA 2OS8C 5AANA 1QIWA 1B7TZ 1XFYO 5FYXA 1K9PA 3TUYC 4MBEA 4ZCVA 3BYAA 4ORBB 1MXEA 2JT3A 1QASA 3BUNB 2K7BA 1J1DA 3LCPC 3OHMB 5PALA 3O78A 5I2OA 3EKJA 1N65A 1WRZA 3DVMA 1M45A 1SR6C 1UP5A 4YGCB 3OX6A 2JT8A 2BCBA 2OPOA 1KWOB 2F2PA 1NX2A 2ZKMX 3F45A 5I8NA 1WDCB 4GGFA 3PM8A 2WORA 1TNPA 1LXFC 5GQQC 1B8RA 4M2PA 2A4JA 2BBNA 1GGWA 2M1KB 1QX5B 2H61A 2L50A 4OR9B 2QPTA 1YUSA 1SCVA 4YGEB 4MZKA 5HLVA 1J7PA 1ZFSA 2NLNA 3SG4A 2KGRA 1F70A 1MQ1A 4N1FA 1SCMB 1EG4A 1BU3A 1R6PA 3PN7C 1KSOA 1VRKA 1CKKA 3CWGA 3JVTC 3OP0A 3C1VA 2L51A 4GUKA 4PHMA 1S26D 3OB1B 1Y1UA 3BQ3A 1QV0A 2EGDA 2KBMA 3GK4X 1AUIB 1XFVO 1BF5A 4GGFC 4USLA 3D0YA 1B47A 1TNXA 2KQ6A 1CFDA 1XFZO 2Q91A 3VRQA 1CFFA 1PSBA 1WRLA 2H61C 2K2AA 3WXAA 2WCBA 4M2QA 3EVRA 3IQOA 1DF0A 1QS7A 4MSPA 1SYMA 2F3ZA 1DJWA 1CM1A 3ZNIA 4D1EA 1TNQA 5I2QA 2OS8B 3CGAA 4I5KA 4PCWA 3H4SE 1JC2A 4PALA 4HRHA 3FS7A 3SIAA 3SG7A 3TUYB 1DTLA 2LUXA 3BXKA 2SASA 2KGBC 1NSHA 2L2EA 1KFXL 2M7LA 3DD4A 1MXLC 1G33A 4DRWA 4NDCA 4DS7A 1H8BA 1PK0D 1E8AA 1XO5A 1K95A 1IH0A 1KK7Z 1TOPA 5B8IB 1MWNA 3NSIA 4GAOA 3AAJA 1B9AA 1LINA 5AERA 2LC5A 1ZMZA 1OMDA 3EK7A 2P6BB 4ICBA 1HQVA 5AFPA 1J7QA 5D7FA 1K90D 2M7NA 2JULA 4YGBB 3M0WA 1RROA 2O5GA 3A8RA 1CLBA 5CSJA 2FCDA 3LL8B 2EHBA 3EK4A 1L7ZA 4P5OE 1ZUZA 3PN7B 2LMVA 1A2XA 4OCIA 2LVIA 2ZN9A 1X02A 3SG5A 4C0LA 1JF0A 2LUCA 1RTP1 2CCMA 1JUOA 4JQ0D 1PVAA 1RWYA 2FOTA 1S1EA 1NPQA 2LANA 1FBVA 3DVKA 5KU1A 1W7IB 1BG1A 1HT9A 5KSZA 5G08A 3DF0A 3PALA 2JXCA 1OZOA 2LM5A 4A4BA 2V53A 3GK1A 1GGZA 2CTNA 3FWCA 2F2OA 4PHKA 2ZFDA 2NCOA 1IKUA 4ORCB 1S5GZ 1YURA 5J3XA 2K7CA 1NUBA 1FW4A 2F8PA 4L9MA 4XYNA 1UWOA 5I2LA 2I7AA 3BUOB 1XFUO 2LLTA 2LP3A 3GK2A 3NSLA 2I94A 2KAXA 3RLZA 1B8CA 1SBJA 2KAYA 3IQQA 1QX7A 1QLSA 1TN4A 3ICBA 3IF7A 1KSMA 2BKIB 2MA2A 4PE4A 3CLNA 4GGNA 1KCYA 1C7WA 1DJIA 1LVCD 1M39A 2JTTA 2LNKA 2LVKA 4DUQA 1LA3A 1SPYA 1NP8A 1DT7B 3EVVA 1RECA 3D0YB 5F6TA 1DGUA 1WY9A 2JPTA 3CR5X 1NCXA 1XA5A 1RK9A 1IRJA 1K8UA 4WQ3A 2KI6D 2LP2A 4AOMA 1SRAA 1S6CA 1B4CA 1DF0B 1XFWO 2L5XB 1ALVA 1QATA 1PULA 2MAZA 2RGIA 4ETOA 3MSEB 2NXQA 1QIVA 1QVIY 2CNPA 1YTZC 4HRGA 2G9BA 1IWQA 1IQ3A 2JWWA 4MRXA 1F8HA 1RJVA 3BUMB 1K9UA 3HCMA 1S6JA 5DKRA 4CPVA 1NCYA 4OV2A 2KYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNX B;  1ALW A;  3OX5 A;  1EJ3 A;  1XK4 A;  1A03 A;  4GBA A;  1SMG A;  3RM1 A;  1LKJ A;  1L2O C;  2JOJ A;  3VRN A;  4I5L B;  1A75 A;  1IQ5 A;  2MBX A;  3CTN A;  2PVB A;  1AJ4 A;  5HKW A;  2M49 B;  4CFQ A;  1F4Q A;  2KHN A;  2PAL A;  4HRE E;  4C0J A;  4YGA A;  3DVE A;  1UUR A;  2ZND A;  3KF9 A;  1PSR A;  2KNE A;  1IGV A;  1LA0 A;  1BMO A;  3KEV A;  2L0P A;  1WRK A;  3OB2 B;  1G8I A;  1Y6W A;  4P2Y B;  3I5I C;  2KAV A;  2K7O A;  1MUX A;  5K89 A;  2MLF C;  2NCP A;  1SL7 A;  1CMG A;  1D1O A;  4PDZ A;  4UPG A;  1OSA A;  5HKZ A;  4BY4 A;  5CSF A;  2M29 A;  5JJG A;  2ZRS A;  2CXJ A;  3KHE A;  3WHT B;  1XK4 C;  1DJH A;  4QJ5 B;  1NX3 A;  1KFX S;  3DF0 B;  1CLM A;  1A4P A;  1PAL A;  2HF5 A;  4FTG A;  5HLO A;  5AEQ A;  1C7V A;  2BCA A;  2NZ0 A;  2KFF A;  2WCE A;  3CR4 X;  1WLZ A;  1UHK A;  4YI9 A;  2CBL A;  1W7J B;  2L4H A;  4CFR A;  5BPJ A;  2JRF A;  4PE1 A;  5HYD A;  1C07 A;  1JSA A;  2EC6 C;  1YVL A;  1S6I A;  4MLW A;  1CB1 A;  1QX2 A;  1YVH A;  4WQ2 A;  1CDN A;  5ER5 A;  3SG6 A;  1XVJ A;  1IG5 A;  2Y1M A;  1V1G A;  1FI6 A;  1NX0 A;  1MHO A;  1Y1X A;  4MZL A;  5CPV A;  4JWQ A;  3KO0 A;  2SCP A;  2E30 A;  1SNL A;  1AHR A;  1M31 A;  3BUX B;  1AJ5 A;  1AK8 A;  2LCP A;  4XJK A;  1JF2 A;  1QV1 A;  3K21 A;  1L2O B;  1SL8 A;  3SIB A;  1GJY A;  3ZWH A;  1SW8 A;  1DJX A;  1SY9 A;  3TZ1 A;  4JPZ B;  2KFH A;  1QVI Z;  2K61 A;  1CM4 A;  4MEW A;  1EH2 A;  3I5G C;  1DMO A;  3BOW B;  1QXP A;  4E68 A;  4R1E A;  4PHJ A;  2BEC A;  1R2U A;  1V1F A;  1XFX O;  3AKA A;  3PFV A;  1Y0V H;  2PSR A;  2OTG B;  3I5I B;  3VRO A;  5ER4 X;  2QAC A;  1S3P A;  1EG3 A;  1SKT A;  2BCX A;  2MJW B;  3PSR A;  1DJY A;  4YGD B;  4IL1 A;  3CR2 A;  2JNX A;  2BL0 B;  1KK7 Y;  1NYA A;  1FPW A;  2LAP A;  2LMT A;  3SG2 A;  4AQJ A;  2M97 A;  1YRU B;  1CDP A;  2K0J A;  2MHH A;  1IJ6 A;  5KTY A;  3AKB A;  2WC8 A;  3JTD B;  4PHN A;  1DVI A;  1A75 B;  3TS5 C;  4AQI A;  2KBI A;  1IJ5 A;  2PMY A;  1BR1 B;  1PVB A;  2G2B A;  1OQP A;  2Y1N A;  1J55 A;  3SJS A;  4NDB A;  5JOL A;  4QJ4 B;  1F54 A;  3TDI A;  4PE7 A;  3BUW B;  5TNC A;  2K2F A;  5CSI A;  3O2P A;  3GOF A;  1NWD A;  2EC6 B;  2M9G A;  1G4Y R;  3LK1 A;  2JZI A;  5D69 A;  3VRR A;  1PRW A;  1CFP A;  3BOW A;  5DKQ A;  2MLE C;  3I5F C;  1K94 A;  1S36 A;  1UUS A;  2WOS A;  4MRY A;  4MZJ A;  1KK8 C;  3NXA A;  1YX8 A;  4YRU A;  2KFG A;  4NDD A;  2JC2 A;  3DVJ A;  1TCF A;  2DOQ A;  1KQV A;  3A4U B;  1TNW A;  1UHH A;  4GNK B;  2FCE A;  3PLF B;  1J1E A;  1OMR A;  3NSK A;  1TRF A;  1K96 A;  1AVS A;  2B1U A;  2PAS A;  4I5N B;  4OVN F;  4U8D A;  4BY5 A;  1EXR A;  1H4B A;  2O60 A;  1QTX A;  3CZT X;  3CS1 A;  2BKH B;  1A29 A;  3E3R A;  3PAT A;  1U5I B;  2HPS A;  2LLU A;  4FQO A;  2KI4 C;  2M8U A;  2VRG A;  4YBH B;  1S5G Y;  4N1G A;  1Y1A A;  1JFK A;  1F55 A;  1MF8 B;  3FIA A;  3AAK A;  2K7D A;  2JQ6 A;  1CMF A;  4DCK A;  1F4O A;  2GGZ A;  2KYF A;  4GPL B;  3WHU B;  1B8L A;  1B7T Y;  2ZRT A;  3I5G B;  1TTX A;  3D10 A;  2WCF A;  2FJU B;  3QRX A;  1K9K A;  2M3W A;  2OTG C;  1BJF A;  4C0K A;  1BT6 A;  1KFU L;  1KQM B;  1UHJ A;  1ZAC A;  1RFJ A;  4A4C A;  1XYD A;  1ZOT B;  1KFU S;  2BL0 C;  2I18 A;  5HKY A;  4CID A;  2COL B;  3I5H C;  1OZS A;  1OMV A;  4WRI A;  1YX7 A;  2AUC A;  4XJK B;  3SG3 A;  1ODB A;  1M46 A;  3JTD C;  1TIZ A;  1SL9 A;  1GQM A;  2JNF A;  4Q04 A;  3TS5 B;  2KQY A;  3O6B A;  4CLN A;  2M0R A;  1U5I A;  2LVV A;  1AP4 A;  3EKH A;  1TCO B;  2AMI A;  2KDH A;  1SK6 D;  2JT0 A;  2F3Y A;  2KSP A;  3O4Y A;  1YUT A;  1FI5 A;  2AAO A;  1JBA A;  2ZNE A;  5DKN A;  1QLK A;  2Y5I A;  1DJG A;  1NCZ A;  3VRP A;  2BE4 A;  1CTR A;  1CDM A;  2Y4Q A;  3I5F B;  1SR6 B;  4YI8 A;  2JXL A;  1N0Y A;  1NX1 A;  2HQW A;  1K93 D;  3KPX A;  1QJT A;  1KK8 B;  2KI6 C;  5IBW A;  1KWO C;  2H2K A;  2LE9 B;  1WDC C;  5AXI A;  2BE6 A;  2LV7 A;  2IS9 A;  4HSZ A;  2E6W A;  2KOT A;  2GGM A;  2I2R E;  2LLS A;  1CDL A;  2Q4U A;  2M1U A;  2CT9 A;  1MR8 A;  3NSO A;  1OOJ A;  4OKH A;  5CSN A;  4F0Z B;  1DJZ A;  2D8N A;  1CNP A;  3EVU A;  2L4I A;  4ORA B;  2LVJ A;  1DGV A;  1JFJ A;  1WLM A;  4PE0 A;  2KI4 B;  4M2O A;  3LLE A;  4DIR A;  1FF1 A;  2HET A;  2PRU A;  2ISD A;  1Q80 A;  1NIW A;  1SCM C;  2LMU A;  3FWB A;  4TNC A;  2F33 A;  2GV5 A;  3JVT B;  4GFT A;  1F71 A;  4MN0 A;  2WND A;  1JWD A;  1BOC A;  4QJ3 B;  2LHL A;  3TDU A;  1KQM C;  1OE9 B;  1UHN A;  1BR4 B;  1EL4 A;  2K8M B;  2TN4 A;  1J7O A;  2LHI A;  1BOD A;  1BLQ A;  1J7R A;  3EK8 A;  1CFC A;  2JU0 A;  2ZN8 A;  2BBM A;  1M63 B;  3HX4 A;  3VGO A;  3I5H B;  2HQ8 A;  2L98 A;  1YUU A;  4MVF A;  1YRT B;  1UHI A;  4NQG A;  1YR5 A;  2JTZ A;  1N2D A;  3LK0 A;  4ZCU A;  1K2H A;  4N5X A;  3TDZ A;  2R2I A;  2MRD A;  4I5J A;  1B1G A;  1CLL A;  2OS8 C;  5AAN A;  1QIW A;  1B7T Z;  1XFY O;  5FYX A;  1K9P A;  3TUY C;  4MBE A;  4ZCV A;  3BYA A;  4ORB B;  1MXE A;  2JT3 A;  1QAS A;  3BUN B;  2K7B A;  1J1D A;  3LCP C;  3OHM B;  5PAL A;  3O78 A;  5I2O A;  3EKJ A;  1N65 A;  1WRZ A;  3DVM A;  1M45 A;  1SR6 C;  1UP5 A;  4YGC B;  3OX6 A;  2JT8 A;  2BCB A;  2OPO A;  1KWO B;  2F2P A;  1NX2 A;  2ZKM X;  3F45 A;  5I8N A;  1WDC B;  4GGF A;  3PM8 A;  2WOR A;  1TNP A;  1LXF C;  5GQQ C;  1B8R A;  4M2P A;  2A4J A;  2BBN A;  1GGW A;  2M1K B;  1QX5 B;  2H61 A;  2L50 A;  4OR9 B;  2QPT A;  1YUS A;  1SCV A;  4YGE B;  4MZK A;  5HLV A;  1J7P A;  1ZFS A;  2NLN A;  3SG4 A;  2KGR A;  1F70 A;  1MQ1 A;  4N1F A;  1SCM B;  1EG4 A;  1BU3 A;  1R6P A;  3PN7 C;  1KSO A;  1VRK A;  1CKK A;  3CWG A;  3JVT C;  3OP0 A;  3C1V A;  2L51 A;  4GUK A;  4PHM A;  1S26 D;  3OB1 B;  1Y1U A;  3BQ3 A;  1QV0 A;  2EGD A;  2KBM A;  3GK4 X;  1AUI B;  1XFV O;  1BF5 A;  4GGF C;  4USL A;  3D0Y A;  1B47 A;  1TNX A;  2KQ6 A;  1CFD A;  1XFZ O;  2Q91 A;  3VRQ A;  1CFF A;  1PSB A;  1WRL A;  2H61 C;  2K2A A;  3WXA A;  2WCB A;  4M2Q A;  3EVR A;  3IQO A;  1DF0 A;  1QS7 A;  4MSP A;  1SYM A;  2F3Z A;  1DJW A;  1CM1 A;  3ZNI A;  4D1E A;  1TNQ A;  5I2Q A;  2OS8 B;  3CGA A;  4I5K A;  4PCW A;  3H4S E;  1JC2 A;  4PAL A;  4HRH A;  3FS7 A;  3SIA A;  3SG7 A;  3TUY B;  1DTL A;  2LUX A;  3BXK A;  2SAS A;  2KGB C;  1NSH A;  2L2E A;  1KFX L;  2M7L A;  3DD4 A;  1MXL C;  1G33 A;  4DRW A;  4NDC A;  4DS7 A;  1H8B A;  1PK0 D;  1E8A A;  1XO5 A;  1K95 A;  1IH0 A;  1KK7 Z;  1TOP A;  5B8I B;  1MWN A;  3NSI A;  4GAO A;  3AAJ A;  1B9A A;  1LIN A;  5AER A;  2LC5 A;  1ZMZ A;  1OMD A;  3EK7 A;  2P6B B;  4ICB A;  1HQV A;  5AFP A;  1J7Q A;  5D7F A;  1K90 D;  2M7N A;  2JUL A;  4YGB B;  3M0W A;  1RRO A;  2O5G A;  3A8R A;  1CLB A;  5CSJ A;  2FCD A;  3LL8 B;  2EHB A;  3EK4 A;  1L7Z A;  4P5O E;  1ZUZ A;  3PN7 B;  2LMV A;  1A2X A;  4OCI A;  2LVI A;  2ZN9 A;  1X02 A;  3SG5 A;  4C0L A;  1JF0 A;  2LUC A;  1RTP 1;  2CCM A;  1JUO A;  4JQ0 D;  1PVA A;  1RWY A;  2FOT A;  1S1E A;  1NPQ A;  2LAN A;  1FBV A;  3DVK A;  5KU1 A;  1W7I B;  1BG1 A;  1HT9 A;  5KSZ A;  5G08 A;  3DF0 A;  3PAL A;  2JXC A;  1OZO A;  2LM5 A;  4A4B A;  2V53 A;  3GK1 A;  1GGZ A;  2CTN A;  3FWC A;  2F2O A;  4PHK A;  2ZFD A;  2NCO A;  1IKU A;  4ORC B;  1S5G Z;  1YUR A;  5J3X A;  2K7C A;  1NUB A;  1FW4 A;  2F8P A;  4L9M A;  4XYN A;  1UWO A;  5I2L A;  2I7A A;  3BUO B;  1XFU O;  2LLT A;  2LP3 A;  3GK2 A;  3NSL A;  2I94 A;  2KAX A;  3RLZ A;  1B8C A;  1SBJ A;  2KAY A;  3IQQ A;  1QX7 A;  1QLS A;  1TN4 A;  3ICB A;  3IF7 A;  1KSM A;  2BKI B;  2MA2 A;  4PE4 A;  3CLN A;  4GGN A;  1KCY A;  1C7W A;  1DJI A;  1LVC D;  1M39 A;  2JTT A;  2LNK A;  2LVK A;  4DUQ A;  1LA3 A;  1SPY A;  1NP8 A;  1DT7 B;  3EVV A;  1REC A;  3D0Y B;  5F6T A;  1DGU A;  1WY9 A;  2JPT A;  3CR5 X;  1NCX A;  1XA5 A;  1RK9 A;  1IRJ A;  1K8U A;  4WQ3 A;  2KI6 D;  2LP2 A;  4AOM A;  1SRA A;  1S6C A;  1B4C A;  1DF0 B;  1XFW O;  2L5X B;  1ALV A;  1QAT A;  1PUL A;  2MAZ A;  2RGI A;  4ETO A;  3MSE B;  2NXQ A;  1QIV A;  1QVI Y;  2CNP A;  1YTZ C;  4HRG A;  2G9B A;  1IWQ A;  1IQ3 A;  2JWW A;  4MRX A;  1F8H A;  1RJV A;  3BUM B;  1K9U A;  3HCM A;  1S6J A;  5DKR A;  4CPV A;  1NCY A;  4OV2 A;  2KYC A; 
#chains in the Genus database with same CATH topology
 3WNX B;  1ALW A;  3OX5 A;  1EJ3 A;  1XK4 A;  3BFH A;  1A03 A;  4GBA A;  1SMG A;  3RM1 A;  1LKJ A;  1L2O C;  2JOJ A;  3VRN A;  4I5L B;  1A75 A;  1IQ5 A;  2MBX A;  3CTN A;  2PVB A;  1AJ4 A;  5HKW A;  2M49 B;  4CFQ A;  1F4Q A;  2KHN A;  2PAL A;  4HRE E;  4C0J A;  4YGA A;  3DVE A;  1UUR A;  3CAB A;  2ZND A;  3KF9 A;  2QEV A;  3S0A A;  1PSR A;  2KNE A;  1IGV A;  1LA0 A;  1BMO A;  3KEV A;  2L0P A;  1WRK A;  3OB2 B;  1G8I A;  1Y6W A;  2PQL A;  4P2Y B;  1P28 A;  3I5I C;  2KAV A;  1BG1 A;  2K7O A;  1MUX A;  5K89 A;  2MLF C;  2NCP A;  1SL7 A;  1CMG A;  1D1O A;  3QME A;  4PDZ A;  3R72 A;  4UPG A;  1OSA A;  5HKZ A;  4BY4 A;  5CSF A;  2M29 A;  5JJG A;  2ZRS A;  2CXJ A;  3KHE A;  3WHT B;  1XK4 C;  1DJH A;  4QJ5 B;  1NX3 A;  3D73 A;  1KFX S;  3DF0 B;  3DZT A;  1CLM A;  3FE8 A;  1A4P A;  1PAL A;  2HF5 A;  4FTG A;  5HLO A;  5AEQ A;  1C7V A;  2BCA A;  2NZ0 A;  2KFF A;  2WCE A;  3CR4 X;  1WLZ A;  1UHK A;  3D75 A;  4YI9 A;  2CBL A;  1W7J B;  2L4H A;  4CFR A;  5BPJ A;  2JRF A;  4PE1 A;  5HYD A;  1C07 A;  1JSA A;  2EC6 C;  3DYE A;  1YVL A;  1S6I A;  4MLW A;  4PT1 A;  1CB1 A;  1QX2 A;  1YVH A;  4WQ2 A;  1CDN A;  5ER5 A;  3SG6 A;  1XVJ A;  1IG5 A;  2Y1M A;  1V1G A;  1FI6 A;  1NX0 A;  1MHO A;  1Y1X A;  4MZL A;  5CPV A;  4JWQ A;  3KO0 A;  2SCP A;  2WC5 A;  2E30 A;  1SNL A;  1AHR A;  1M31 A;  3BUX B;  1AJ5 A;  1AK8 A;  2LCP A;  4XJK A;  3IVT A;  1JF2 A;  1QV1 A;  3K21 A;  1L2O B;  1SL8 A;  3SIB A;  1GJY A;  3ZWH A;  1SW8 A;  1DJX A;  1SY9 A;  3TZ1 A;  4JPZ B;  2KFH A;  1QVI Z;  2K61 A;  1CM4 A;  4MEW A;  1EH2 A;  3I5G C;  1DMO A;  3BOW B;  1QXP A;  3D78 A;  1SSE B;  4JKT A;  4E68 A;  4R1E A;  4PHJ A;  1R2U A;  2BEC A;  1V1F A;  1XFX O;  3AKA A;  3PFV A;  3S0G A;  1Y0V H;  2JPO A;  2PSR A;  2OTG B;  3I5I B;  1XFR A;  3VRO A;  5ER4 X;  2QAC A;  1S3P A;  1EG3 A;  1SKT A;  2BCX A;  2MJW B;  3PSR A;  1DJY A;  4YGD B;  4IL1 A;  2L2C A;  3CR2 A;  2JNX A;  2BL0 B;  1KK7 Y;  1NYA A;  1FPW A;  2LAP A;  2LMT A;  3SG2 A;  4AQJ A;  2M97 A;  1YRU B;  1CDP A;  4INW A;  2K0J A;  2MHH A;  1IJ6 A;  5KTY A;  3AKB A;  2WC8 A;  3JTD B;  4PHN A;  1DVI A;  2WCL A;  1A75 B;  3TS5 C;  4AQI A;  2KBI A;  1IJ5 A;  2PMY A;  1BR1 B;  1PVB A;  2G2B A;  1OQP A;  2Y1N A;  1J55 A;  3CZ2 A;  3SJS A;  3CZ0 A;  4NDB A;  5JOL A;  4QJ4 B;  1F54 A;  3TDI A;  4PE7 A;  3BUW B;  5TNC A;  2K2F A;  3L4A A;  3O2P A;  3GOF A;  1NWD A;  2EC6 B;  2M9G A;  1G4Y R;  2WCM A;  2JZI A;  3LK1 A;  5D69 A;  3VRR A;  1PRW A;  1CFP A;  3BOW A;  5DIC A;  5DKQ A;  2MLE C;  3I5F C;  1K94 A;  1S36 A;  1UUS A;  2P71 A;  2WOS A;  4MRY A;  3UNW A;  4MZJ A;  1KK8 C;  3N7H A;  1YX8 A;  3NXA A;  4JD9 A;  4YRU A;  2KFG A;  4NDD A;  2JC2 A;  3DVJ A;  1TCF A;  2DOQ A;  1KQV A;  3A4U B;  1TNW A;  1UHH A;  5I94 A;  4GNK B;  2FCE A;  3PLF B;  1J1E A;  3B7A A;  1OMR A;  3NSK A;  1TRF A;  1K96 A;  1AVS A;  2B1U A;  2PAS A;  4I5N B;  4OVN F;  4U8D A;  4BY5 A;  1EXR A;  1H4B A;  2O60 A;  1QTX A;  1OOI X;  3CZT X;  3CS1 A;  2BKH B;  1A29 A;  3E3R A;  3PAT A;  1U5I B;  1Z4H A;  2HPS A;  2LLU A;  2KI4 C;  2M8U A;  2VRG A;  4FQO A;  1DEL A;  4YBH B;  1S5G Y;  4N1G A;  1Y1A A;  1JFK A;  1F55 A;  1MF8 B;  3FIA A;  2H8V A;  3AAK A;  2K7D A;  2JQ6 A;  1CMF A;  4DCK A;  1F4O A;  2GGZ A;  2KYF A;  4GPL B;  3WHU B;  1B8L A;  1B7T Y;  2ZRT A;  3I5G B;  1TTX A;  3CYZ A;  3D10 A;  2WCF A;  2FJU B;  3QRX A;  1K9K A;  2M3W A;  2OTG C;  1BJF A;  4C0K A;  1BT6 A;  1KFU L;  1KQM B;  1UHJ A;  1ZAC A;  1RFJ A;  4A4C A;  1XYD A;  4IJ7 A;  2WCJ A;  1ZOT B;  1KFU S;  2BL0 C;  2I18 A;  5HKY A;  3D77 A;  4CID A;  2GTE A;  2COL B;  3FE6 A;  1OZS A;  1OMV A;  3I5H C;  4WRI A;  1YX7 A;  2AUC A;  4XJK B;  3SG3 A;  1ODB A;  1M46 A;  3JTD C;  5EL2 A;  1TIZ A;  3V2L A;  4FQT A;  1SL9 A;  1GQM A;  2JNF A;  3R1O A;  4Q04 A;  2KQY A;  3O6B A;  3TS5 B;  4CLN A;  2M0R A;  1U5I A;  2LVV A;  1AP4 A;  3PJI A;  3EKH A;  1TCO B;  2AMI A;  2KDH A;  1SK6 D;  2JT0 A;  2F3Y A;  2KSP A;  3O4Y A;  1YUT A;  1FI5 A;  2AAO A;  1JBA A;  2ZNE A;  5DKN A;  1QLK A;  2Y5I A;  1DJG A;  1NCZ A;  3VRP A;  2BE4 A;  1CTR A;  1CDM A;  2Y4Q A;  5HL1 A;  3I5F B;  1SR6 B;  4YI8 A;  2JXL A;  1N0Y A;  1NX1 A;  2HQW A;  1K93 D;  3KPX A;  1QJT A;  1KK8 B;  2KI6 C;  5IBW A;  1KWO C;  2H2K A;  2LE9 B;  1WDC C;  5AXI A;  2BE6 A;  2LV7 A;  2IS9 A;  4HSZ A;  2E6W A;  2KOT A;  2GGM A;  2I2R E;  2LLS A;  1CDL A;  2Q4U A;  2M1U A;  2CT9 A;  1MR8 A;  3NSO A;  1OOJ A;  4OKH A;  5CSN A;  4F0Z B;  1T14 A;  1DJZ A;  2D8N A;  2YGU A;  1CNP A;  3EVU A;  2P70 A;  2L4I A;  4ORA B;  2LVJ A;  1DGV A;  1JFJ A;  1WLM A;  4PE0 A;  2KI4 B;  3CDN A;  3LLE A;  4M2O A;  4DIR A;  1Z2C B;  2HET A;  2PRU A;  1FF1 A;  2ISD A;  1QWV A;  2KLD A;  1Q80 A;  1NIW A;  1SCM C;  2BAP A;  2LMU A;  3FWB A;  4TNC A;  2F33 A;  2GV5 A;  1OOF A;  3JVT B;  1LS8 A;  2K60 A;  4GFT A;  1F71 A;  4MN0 A;  5FI2 A;  2WND A;  1JWD A;  1BOC A;  4QJ3 B;  2LHL A;  3TDU A;  1KQM C;  1OE9 B;  1UHN A;  1BR4 B;  1EL4 A;  2K8M B;  2TN4 A;  1J7O A;  2LHI A;  1BOD A;  1BLQ A;  1J7R A;  3EK8 A;  1CFC A;  2ERB A;  2JU0 A;  2QEO A;  2ZN8 A;  2BBM A;  1M63 B;  2FJY A;  3HX4 A;  3VGO A;  3I5H B;  1OW4 A;  2HQ8 A;  2L98 A;  1YUU A;  3NGV A;  4MVF A;  3L4L A;  1YRT B;  1UHI A;  1C3Z A;  4NQG A;  1YR5 A;  2JTZ A;  1N2D A;  3LK0 A;  4ZCU A;  1K2H A;  4N5X A;  5D3O A;  2R2I A;  3TDZ A;  1C3Y A;  2MRD A;  4I5J A;  1B1G A;  1CLL A;  2OS8 C;  5AAN A;  1QIW A;  3CZ1 A;  1B7T Z;  1XFY O;  5FYX A;  1K9P A;  3TUY C;  4MBE A;  1GM0 A;  4ZCV A;  3BYA A;  4ORB B;  1MXE A;  2JT3 A;  1QAS A;  3BUN B;  2K7B A;  1J1D A;  3LCP C;  3OHM B;  5PAL A;  3O78 A;  5I2O A;  3EKJ A;  1N65 A;  1WRZ A;  1DEK A;  1M45 A;  1SR6 C;  1UP5 A;  3BJH A;  3DVM A;  4YGC B;  3OX6 A;  1IIO A;  2QEB A;  2JT8 A;  2BCB A;  2OPO A;  3NHI A;  1KWO B;  2F2P A;  1NX2 A;  2ZKM X;  3F45 A;  3VB1 A;  1WDC B;  5I8N A;  4GGF A;  3PM8 A;  2WOR A;  1DC1 A;  1TNP A;  1LXF C;  1OOH A;  5GQQ C;  1B8R A;  4M2P A;  2A4J A;  2BBN A;  1GGW A;  3D76 A;  3PM2 A;  2M1K B;  1QX5 B;  2H61 A;  2L50 A;  3B86 A;  2QPT A;  4OR9 B;  1YUS A;  1SCV A;  4YGE B;  4MZK A;  5HLV A;  1J7P A;  1ZFS A;  2NLN A;  3SG4 A;  2KGR A;  1F70 A;  1MQ1 A;  4N1F A;  1SCM B;  1EG4 A;  1BU3 A;  1R6P A;  3PN7 C;  1KSO A;  1VRK A;  1CKK A;  3CWG A;  3JVT C;  3OP0 A;  3C1V A;  2L51 A;  4GUK A;  4PHM A;  1S26 D;  3OB1 B;  3OGN A;  1Y1U A;  3BQ3 A;  1QV0 A;  2EGD A;  2KBM A;  3GK4 X;  1AUI B;  1XFV O;  3SS5 A;  1BF5 A;  4GGF C;  4USL A;  3D0Y A;  1B47 A;  1TNX A;  2KQ6 A;  3UO9 A;  1CFD A;  1XFZ O;  2Q91 A;  3EG5 B;  3VRQ A;  1CFF A;  1PSB A;  5CSI A;  1WRL A;  2H61 C;  2K2A A;  3WXA A;  2WCB A;  4M2Q A;  3EVR A;  3IQO A;  1DF0 A;  1QS7 A;  4MSP A;  1SYM A;  2F3Z A;  1DJW A;  1CM1 A;  3R1V A;  3ZNI A;  4D1E A;  1TNQ A;  5I2Q A;  2OS8 B;  3CGA A;  4I5K A;  4PCW A;  2PYQ A;  3H4S E;  3R1P A;  1JC2 A;  3OBV A;  4HRH A;  3FS7 A;  4PAL A;  3SIA A;  3SG7 A;  3TUY B;  1DTL A;  2LUX A;  3BXK A;  3B88 A;  2SAS A;  2KGB C;  2QDI A;  1NSH A;  2L2E A;  1KFX L;  3BFB A;  3DXL A;  4INX A;  2M7L A;  2L5Y A;  3DD4 A;  1MXL C;  1G33 A;  4DRW A;  4NDC A;  4DS7 A;  1H8B A;  1PK0 D;  1E8A A;  1XO5 A;  1K95 A;  2QEH A;  1IH0 A;  1KK7 Z;  1TOP A;  5B8I B;  1MWN A;  3BFA A;  3NSI A;  4GAO A;  3DY9 A;  3AAJ A;  1B9A A;  2BNX A;  1LIN A;  5AER A;  3D74 A;  2LC5 A;  1ZMZ A;  1OMD A;  3EK7 A;  2P6B B;  1DQE A;  4ICB A;  1HQV A;  5AFP A;  1J7Q A;  5D7F A;  1K90 D;  2M7N A;  3O4X A;  2JUL A;  4YGB B;  3M0W A;  1RRO A;  3S0F A;  2O5G A;  1TWO A;  3A8R A;  1CLB A;  5CSJ A;  2FCD A;  3LL8 B;  2EHB A;  3B87 A;  3EK4 A;  1L7Z A;  4P5O E;  1ZUZ A;  3PN7 B;  2LMV A;  1TUJ A;  1A2X A;  4OCI A;  2LVI A;  2ZN9 A;  1X02 A;  3SG5 A;  4C0L A;  3S0B A;  1JF0 A;  2LUC A;  1RTP 1;  2CCM A;  1JUO A;  4JQ0 D;  3S0D A;  1PVA A;  1RWY A;  2FOT A;  1S1E A;  1NPQ A;  2LAN A;  1FBV A;  3DVK A;  5KU1 A;  1W7I B;  3K1E A;  1HT9 A;  1ORG A;  5G08 A;  3DF0 A;  5KSZ A;  3PAL A;  2JXC A;  1OZO A;  4OZD A;  2LM5 A;  5FI7 A;  4A4B A;  2V53 A;  3GK1 A;  1GGZ A;  2CTN A;  3FWC A;  3Q8I A;  2F2O A;  4PHK A;  1TUZ A;  4KYN A;  2ZFD A;  2NCO A;  1IKU A;  4ORC B;  1S5G Z;  1YUR A;  5J3X A;  3SS3 A;  2K7C A;  1NUB A;  3B6X A;  1FW4 A;  2F8P A;  4L9M A;  4XYN A;  1UWO A;  5I2L A;  2I7A A;  3S0E A;  1OOG A;  3RZS A;  3BUO B;  5FI6 A;  1XFU O;  2LLT A;  2LP3 A;  3GK2 A;  2WCK A;  3NSL A;  2I94 A;  2KAX A;  3RLZ A;  1B8C A;  1SBJ A;  2KAY A;  3IQQ A;  1QX7 A;  1QLS A;  1TN4 A;  3ICB A;  3IF7 A;  1KSM A;  2BKI B;  2MA2 A;  4PE4 A;  3CLN A;  4GGN A;  2WC6 A;  1KCY A;  1C7W A;  3L47 A;  1DJI A;  1LVC D;  1M39 A;  2JTT A;  2LNK A;  2LVK A;  4DUQ A;  1LA3 A;  1SPY A;  1NP8 A;  1DT7 B;  3EVV A;  1REC A;  3D0Y B;  5F6T A;  1DGU A;  3SS4 A;  1WY9 A;  2JPT A;  3CR5 X;  1NCX A;  1XA5 A;  1RK9 A;  1IRJ A;  1K8U A;  4WQ3 A;  2KI6 D;  4F7F A;  1W9Z A;  2LP2 A;  3NHT A;  4AOM A;  1SRA A;  1S6C A;  2KLE A;  1B4C A;  1DF0 B;  3FE9 A;  1XFW O;  2L5X B;  1ALV A;  1QAT A;  1PUL A;  2MAZ A;  2RGI A;  4ETO A;  3MSE B;  2NXQ A;  1QIV A;  1QVI Y;  2CNP A;  1YTZ C;  4HRG A;  2G9B A;  1IWQ A;  1IQ3 A;  2JWW A;  2KPH A;  4MRX A;  1F8H A;  1RJV A;  3BUM B;  1K9U A;  3HCM A;  1S6J A;  5DKR A;  4CPV A;  2WCH A;  1NCY A;  4OV2 A;  2KYC A; 
#chains in the Genus database with same CATH homology
 3WNX B;  1ALW A;  3OX5 A;  1EJ3 A;  1XK4 A;  1A03 A;  4GBA A;  1SMG A;  3RM1 A;  1LKJ A;  1L2O C;  2JOJ A;  3VRN A;  4I5L B;  1A75 A;  1IQ5 A;  2MBX A;  3CTN A;  2PVB A;  1AJ4 A;  5HKW A;  2M49 B;  4CFQ A;  1F4Q A;  2KHN A;  2PAL A;  4HRE E;  4C0J A;  4YGA A;  3DVE A;  1UUR A;  2ZND A;  3KF9 A;  1PSR A;  2KNE A;  1IGV A;  1LA0 A;  1BMO A;  3KEV A;  2L0P A;  1WRK A;  3OB2 B;  1G8I A;  1Y6W A;  4P2Y B;  3I5I C;  2KAV A;  2K7O A;  1MUX A;  5K89 A;  2MLF C;  2NCP A;  1SL7 A;  1CMG A;  1D1O A;  4PDZ A;  4UPG A;  1OSA A;  5HKZ A;  4BY4 A;  5CSF A;  2M29 A;  5JJG A;  2ZRS A;  2CXJ A;  3KHE A;  3WHT B;  1XK4 C;  1DJH A;  4QJ5 B;  1NX3 A;  1KFX S;  3DF0 B;  1CLM A;  1A4P A;  1PAL A;  2HF5 A;  4FTG A;  5HLO A;  5AEQ A;  1C7V A;  2BCA A;  2NZ0 A;  2KFF A;  2WCE A;  3CR4 X;  1WLZ A;  1UHK A;  4YI9 A;  2CBL A;  1W7J B;  2L4H A;  4CFR A;  5BPJ A;  2JRF A;  4PE1 A;  5HYD A;  1C07 A;  1JSA A;  2EC6 C;  1YVL A;  1S6I A;  4MLW A;  1CB1 A;  1QX2 A;  1YVH A;  4WQ2 A;  1CDN A;  5ER5 A;  3SG6 A;  1XVJ A;  1IG5 A;  2Y1M A;  1V1G A;  1FI6 A;  1NX0 A;  1MHO A;  1Y1X A;  4MZL A;  5CPV A;  4JWQ A;  3KO0 A;  2SCP A;  2E30 A;  1SNL A;  1AHR A;  1M31 A;  3BUX B;  1AJ5 A;  1AK8 A;  2LCP A;  4XJK A;  1JF2 A;  1QV1 A;  3K21 A;  1L2O B;  1SL8 A;  3SIB A;  1GJY A;  3ZWH A;  1SW8 A;  1DJX A;  1SY9 A;  3TZ1 A;  4JPZ B;  2KFH A;  1QVI Z;  2K61 A;  1CM4 A;  4MEW A;  1EH2 A;  3I5G C;  1DMO A;  3BOW B;  1QXP A;  4E68 A;  4R1E A;  4PHJ A;  2BEC A;  1R2U A;  1V1F A;  1XFX O;  3AKA A;  3PFV A;  1Y0V H;  2PSR A;  2OTG B;  3I5I B;  3VRO A;  5ER4 X;  2QAC A;  1S3P A;  1EG3 A;  1SKT A;  2BCX A;  2MJW B;  3PSR A;  1DJY A;  4YGD B;  4IL1 A;  3CR2 A;  2JNX A;  2BL0 B;  1KK7 Y;  1NYA A;  1FPW A;  2LAP A;  2LMT A;  3SG2 A;  4AQJ A;  2M97 A;  1YRU B;  1CDP A;  2K0J A;  2MHH A;  1IJ6 A;  5KTY A;  3AKB A;  2WC8 A;  3JTD B;  4PHN A;  1DVI A;  1A75 B;  3TS5 C;  4AQI A;  2KBI A;  1IJ5 A;  2PMY A;  1BR1 B;  1PVB A;  2G2B A;  1OQP A;  2Y1N A;  1J55 A;  3SJS A;  4NDB A;  5JOL A;  4QJ4 B;  1F54 A;  3TDI A;  4PE7 A;  3BUW B;  5TNC A;  2K2F A;  5CSI A;  3O2P A;  3GOF A;  1NWD A;  2EC6 B;  2M9G A;  1G4Y R;  3LK1 A;  2JZI A;  5D69 A;  3VRR A;  1PRW A;  1CFP A;  3BOW A;  5DKQ A;  2MLE C;  3I5F C;  1K94 A;  1S36 A;  1UUS A;  2WOS A;  4MRY A;  4MZJ A;  1KK8 C;  3NXA A;  1YX8 A;  4YRU A;  2KFG A;  4NDD A;  2JC2 A;  3DVJ A;  1TCF A;  2DOQ A;  1KQV A;  3A4U B;  1TNW A;  1UHH A;  4GNK B;  2FCE A;  3PLF B;  1J1E A;  1OMR A;  3NSK A;  1TRF A;  1K96 A;  1AVS A;  2B1U A;  2PAS A;  4I5N B;  4OVN F;  4U8D A;  4BY5 A;  1EXR A;  1H4B A;  2O60 A;  1QTX A;  3CZT X;  3CS1 A;  2BKH B;  1A29 A;  3E3R A;  3PAT A;  1U5I B;  2HPS A;  2LLU A;  4FQO A;  2KI4 C;  2M8U A;  2VRG A;  4YBH B;  1S5G Y;  4N1G A;  1Y1A A;  1JFK A;  1F55 A;  1MF8 B;  3FIA A;  3AAK A;  2K7D A;  2JQ6 A;  1CMF A;  4DCK A;  1F4O A;  2GGZ A;  2KYF A;  4GPL B;  3WHU B;  1B8L A;  1B7T Y;  2ZRT A;  3I5G B;  1TTX A;  3D10 A;  2WCF A;  2FJU B;  3QRX A;  1K9K A;  2M3W A;  2OTG C;  1BJF A;  4C0K A;  1BT6 A;  1KFU L;  1KQM B;  1UHJ A;  1ZAC A;  1RFJ A;  4A4C A;  1XYD A;  1ZOT B;  1KFU S;  2BL0 C;  2I18 A;  5HKY A;  4CID A;  2COL B;  3I5H C;  1OZS A;  1OMV A;  4WRI A;  1YX7 A;  2AUC A;  4XJK B;  3SG3 A;  1ODB A;  1M46 A;  3JTD C;  1TIZ A;  1SL9 A;  1GQM A;  2JNF A;  4Q04 A;  3TS5 B;  2KQY A;  3O6B A;  4CLN A;  2M0R A;  1U5I A;  2LVV A;  1AP4 A;  3EKH A;  1TCO B;  2AMI A;  2KDH A;  1SK6 D;  2JT0 A;  2F3Y A;  2KSP A;  3O4Y A;  1YUT A;  1FI5 A;  2AAO A;  1JBA A;  2ZNE A;  5DKN A;  1QLK A;  2Y5I A;  1DJG A;  1NCZ A;  3VRP A;  2BE4 A;  1CTR A;  1CDM A;  2Y4Q A;  3I5F B;  1SR6 B;  4YI8 A;  2JXL A;  1N0Y A;  1NX1 A;  2HQW A;  1K93 D;  3KPX A;  1QJT A;  1KK8 B;  2KI6 C;  5IBW A;  1KWO C;  2H2K A;  2LE9 B;  1WDC C;  5AXI A;  2BE6 A;  2LV7 A;  2IS9 A;  4HSZ A;  2E6W A;  2KOT A;  2GGM A;  2I2R E;  2LLS A;  1CDL A;  2Q4U A;  2M1U A;  2CT9 A;  1MR8 A;  3NSO A;  1OOJ A;  4OKH A;  5CSN A;  4F0Z B;  1DJZ A;  2D8N A;  1CNP A;  3EVU A;  2L4I A;  4ORA B;  2LVJ A;  1DGV A;  1JFJ A;  1WLM A;  4PE0 A;  2KI4 B;  4M2O A;  3LLE A;  4DIR A;  1FF1 A;  2HET A;  2PRU A;  2ISD A;  1Q80 A;  1NIW A;  1SCM C;  2LMU A;  3FWB A;  4TNC A;  2F33 A;  2GV5 A;  3JVT B;  4GFT A;  1F71 A;  4MN0 A;  2WND A;  1JWD A;  1BOC A;  4QJ3 B;  2LHL A;  3TDU A;  1KQM C;  1OE9 B;  1UHN A;  1BR4 B;  1EL4 A;  2K8M B;  2TN4 A;  1J7O A;  2LHI A;  1BOD A;  1BLQ A;  1J7R A;  3EK8 A;  1CFC A;  2JU0 A;  2ZN8 A;  2BBM A;  1M63 B;  3HX4 A;  3VGO A;  3I5H B;  2HQ8 A;  2L98 A;  1YUU A;  4MVF A;  1YRT B;  1UHI A;  4NQG A;  1YR5 A;  2JTZ A;  1N2D A;  3LK0 A;  4ZCU A;  1K2H A;  4N5X A;  3TDZ A;  2R2I A;  2MRD A;  4I5J A;  1B1G A;  1CLL A;  2OS8 C;  5AAN A;  1QIW A;  1B7T Z;  1XFY O;  5FYX A;  1K9P A;  3TUY C;  4MBE A;  4ZCV A;  3BYA A;  4ORB B;  1MXE A;  2JT3 A;  1QAS A;  3BUN B;  2K7B A;  1J1D A;  3LCP C;  3OHM B;  5PAL A;  3O78 A;  5I2O A;  3EKJ A;  1N65 A;  1WRZ A;  3DVM A;  1M45 A;  1SR6 C;  1UP5 A;  4YGC B;  3OX6 A;  2JT8 A;  2BCB A;  2OPO A;  1KWO B;  2F2P A;  1NX2 A;  2ZKM X;  3F45 A;  5I8N A;  1WDC B;  4GGF A;  3PM8 A;  2WOR A;  1TNP A;  1LXF C;  5GQQ C;  1B8R A;  4M2P A;  2A4J A;  2BBN A;  1GGW A;  2M1K B;  1QX5 B;  2H61 A;  2L50 A;  4OR9 B;  2QPT A;  1YUS A;  1SCV A;  4YGE B;  4MZK A;  5HLV A;  1J7P A;  1ZFS A;  2NLN A;  3SG4 A;  2KGR A;  1F70 A;  1MQ1 A;  4N1F A;  1SCM B;  1EG4 A;  1BU3 A;  1R6P A;  3PN7 C;  1KSO A;  1VRK A;  1CKK A;  3CWG A;  3JVT C;  3OP0 A;  3C1V A;  2L51 A;  4GUK A;  4PHM A;  1S26 D;  3OB1 B;  1Y1U A;  3BQ3 A;  1QV0 A;  2EGD A;  2KBM A;  3GK4 X;  1AUI B;  1XFV O;  1BF5 A;  4GGF C;  4USL A;  3D0Y A;  1B47 A;  1TNX A;  2KQ6 A;  1CFD A;  1XFZ O;  2Q91 A;  3VRQ A;  1CFF A;  1PSB A;  1WRL A;  2H61 C;  2K2A A;  3WXA A;  2WCB A;  4M2Q A;  3EVR A;  3IQO A;  1DF0 A;  1QS7 A;  4MSP A;  1SYM A;  2F3Z A;  1DJW A;  1CM1 A;  3ZNI A;  4D1E A;  1TNQ A;  5I2Q A;  2OS8 B;  3CGA A;  4I5K A;  4PCW A;  3H4S E;  1JC2 A;  4PAL A;  4HRH A;  3FS7 A;  3SIA A;  3SG7 A;  3TUY B;  1DTL A;  2LUX A;  3BXK A;  2SAS A;  2KGB C;  1NSH A;  2L2E A;  1KFX L;  2M7L A;  3DD4 A;  1MXL C;  1G33 A;  4DRW A;  4NDC A;  4DS7 A;  1H8B A;  1PK0 D;  1E8A A;  1XO5 A;  1K95 A;  1IH0 A;  1KK7 Z;  1TOP A;  5B8I B;  1MWN A;  3NSI A;  4GAO A;  3AAJ A;  1B9A A;  1LIN A;  5AER A;  2LC5 A;  1ZMZ A;  1OMD A;  3EK7 A;  2P6B B;  4ICB A;  1HQV A;  5AFP A;  1J7Q A;  5D7F A;  1K90 D;  2M7N A;  2JUL A;  4YGB B;  3M0W A;  1RRO A;  2O5G A;  3A8R A;  1CLB A;  5CSJ A;  2FCD A;  3LL8 B;  2EHB A;  3EK4 A;  1L7Z A;  4P5O E;  1ZUZ A;  3PN7 B;  2LMV A;  1A2X A;  4OCI A;  2LVI A;  2ZN9 A;  1X02 A;  3SG5 A;  4C0L A;  1JF0 A;  2LUC A;  1RTP 1;  2CCM A;  1JUO A;  4JQ0 D;  1PVA A;  1RWY A;  2FOT A;  1S1E A;  1NPQ A;  2LAN A;  1FBV A;  3DVK A;  5KU1 A;  1W7I B;  1BG1 A;  1HT9 A;  5KSZ A;  5G08 A;  3DF0 A;  3PAL A;  2JXC A;  1OZO A;  2LM5 A;  4A4B A;  2V53 A;  3GK1 A;  1GGZ A;  2CTN A;  3FWC A;  2F2O A;  4PHK A;  2ZFD A;  2NCO A;  1IKU A;  4ORC B;  1S5G Z;  1YUR A;  5J3X A;  2K7C A;  1NUB A;  1FW4 A;  2F8P A;  4L9M A;  4XYN A;  1UWO A;  5I2L A;  2I7A A;  3BUO B;  1XFU O;  2LLT A;  2LP3 A;  3GK2 A;  3NSL A;  2I94 A;  2KAX A;  3RLZ A;  1B8C A;  1SBJ A;  2KAY A;  3IQQ A;  1QX7 A;  1QLS A;  1TN4 A;  3ICB A;  3IF7 A;  1KSM A;  2BKI B;  2MA2 A;  4PE4 A;  3CLN A;  4GGN A;  1KCY A;  1C7W A;  1DJI A;  1LVC D;  1M39 A;  2JTT A;  2LNK A;  2LVK A;  4DUQ A;  1LA3 A;  1SPY A;  1NP8 A;  1DT7 B;  3EVV A;  1REC A;  3D0Y B;  5F6T A;  1DGU A;  1WY9 A;  2JPT A;  3CR5 X;  1NCX A;  1XA5 A;  1RK9 A;  1IRJ A;  1K8U A;  4WQ3 A;  2KI6 D;  2LP2 A;  4AOM A;  1SRA A;  1S6C A;  1B4C A;  1DF0 B;  1XFW O;  2L5X B;  1ALV A;  1QAT A;  1PUL A;  2MAZ A;  2RGI A;  4ETO A;  3MSE B;  2NXQ A;  1QIV A;  1QVI Y;  2CNP A;  1YTZ C;  4HRG A;  2G9B A;  1IWQ A;  1IQ3 A;  2JWW A;  4MRX A;  1F8H A;  1RJV A;  3BUM B;  1K9U A;  3HCM A;  1S6J A;  5DKR A;  4CPV A;  1NCY A;  4OV2 A;  2KYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...