2I7AA

Domain iv of human calpain 13
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
163
structure length
157
Chain Sequence
SGLVPGSDIDATQLQGLLNQELLDMFSLDECRSLVALMELKVNGRLDQEEFARLWKRLVHYQHVFQKVQTSPGVLLSSDLWKAIENTDFLRGIFISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calpain 13
publication title Structure of Human Calpain 13
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 157
sequence length 163
ec nomenclature
pdb deposition date 2006-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2i7aA00
1EL4A 4QJ3B 1V1FA 4GUKA 1Y6WA 4MBEA 2KBIA 3O78A 2IS9A 4PALA 1JF0A 1KWOC 1CNPA 1C7WA 4PE0A 1Y1XA 1QV0A 3E3RA 1JF2A 3TUYB 4GAOA 3CZTX 3KEVA 1XK4C 4YBHB 1OZSA 1K96A 3PLFB 2A4JA 2LUXA 1KSMA 1NX3A 2JXLA 2KOTA 1KFXS 1WLZA 2BKIB 1CMFA 1UHKA 4QJ4B 2LVKA 4YGAA 1K95A 1N65A 2LC5A 1YUSA 4HREE 3RM1A 2HQWA 1RROA 2PALA 2JOJA 3VRQA 1ZACA 1SBJA 2QPTA 3A8RA 3I5HB 1GGZA 3NSKA 2JT8A 4P2YB 1F71A 1XFZO 1QV1A 1S36A 2I7AA 3LK1A 1XFXO 3WXAA 1QS7A 1L2OC 2G9BA 5J3XA 1XVJA 4D1EA 2FJUB 3K21A 2OS8C 1WY9A 2MRDA 4ORAB 1CKKA 1OSAA 4QJ5B 4ZCVA 3TS5C 1V1GA 3EK4A 1M45A 1Y1AA 5TNCA 3KO0A 2DOQA 1JUOA 3O6BA 1X02A 5F6TA 2LUCA 1EG4A 1YVHA 3SG4A 3TDZA 4BY4A 4PCWA 4XJKB 1WRKA 1K94A 1XFYO 3OB1B 3LK0A 3OP0A 5IBWA 1C7VA 1GQMA 1ALWA 5JOLA 2M7LA 2LVIA 4ORCB 1QATA 1OMDA 3O2PA 4C0LA 2FCEA 4WQ3A 4YGEB 1CM4A 2L98A 3TDUA 3VROA 4OCIA 1R6PA 4NDBA 1S6CA 2JXCA 1YUTA 2BECA 4MRXA 1TN4A 4MEWA 5CSNA 2G2BA 1F55A 2SASA 4N5XA 1EJ3A 2PVBA 1S1EA 4HRHA 4M2QA 5CSFA 1CLLA 2KDHA 3LL8B 1MUXA 4Q04A 2O60A 1KFUS 2EC6B 1JFKA 1XFVO 3CR2A 3VRPA 2ZRSA 4AOMA 1J1EA 2CTNA 2LLUA 3DVJA 1NUBA 4CLNA 4A4CA 1BR1B 3DVMA 2OS8B 1FPWA 1SMGA 1JSAA 1Y1UA 3GK2A 2L51A 1BT6A 1DGUA 1XO5A 4MSPA 3TS5B 5DKRA 4UPGA 1NP8A 4YRUA 5HKYA 3IF7A 3SG3A 3GK1A 1AUIB 1J1DA 2JU0A 1CDPA 1PALA 1QLSA 3KHEA 4C0JA 2KFGA 5CSJA 2BKHB 1KQVA 4ZCUA 1S26D 1OE9B 1BR4B 5JJGA 1AP4A 3I5FC 4DIRA 3ICBA 2LHIA 3CR5X 3KPXA 2M97A 4N1FA 2JT0A 4GFTA 1NCXA 2BBMA 2LHLA 4ETOA 1IKUA 2SCPA 3C1VA 1S5GZ 3DF0A 3FWBA 3HX4A 3M0WA 3PN7C 1NCYA 2R2IA 3FIAA 1IGVA 1PK0D 2CCMA 2GGZA 3I5IB 1RJVA 2OTGC 3JTDC 1PVAA 5KTYA 5DKQA 1K2HA 1F4OA 1KQMB 1K9KA 2JPTA 3NSIA 2ZN9A 2CBLA 2I18A 3SJSA 4L9MA 1NSHA 4GPLB 3SG6A 1YRTB 2F8PA 3PSRA 4HRGA 2VRGA 1DJHA 1VRKA 4CFQA 2Q4UA 2LAPA 2KI4C 1RTP1 2BCAA 1AJ5A 1M31A 4PDZA 2ZRTA 3EVUA 1S5GY 3NXAA 1CDMA 1S6IA 1PVBA 1F4QA 3I5GB 3OB2B 4MZLA 3TZ1A 3CR4X 1D1OA 1UUSA 1YRUB 1JWDA 2E30A 3D0YA 1DF0B 1UHNA 1BF5A 1B8RA 2E6WA 1YUUA 2M9GA 1QX7A 1DJZA 1SW8A 4CPVA 4AQIA 1AHRA 1FW4A 1W7JB 3OX5A 1TOPA 3AAKA 2KBMA 4HSZA 4PHJA 1MWNA 4I5KA 4OVNF 3SG2A 4CIDA 3CTNA 2BL0C 2LVJA 1NPQA 1MF8B 3MSEB 1CM1A 1FI5A 3CS1A 4ORBB 1ZOTB 4ICBA 2PASA 3BUNB 1IQ3A 1JC2A 4F0ZB 1RFJA 3PN7B 4CFRA 1SL8A 3SIAA 5AERA 1B1GA 2OTGB 5I2OA 1HT9A 1OMRA 1UHIA 2K0JA 2K7OA 1QX5B 1LVCD 4MRYA 1DF0A 1KWOB 2KNEA 4GGNA 3O4YA 2PRUA 2AMIA 3AKBA 1DT7B 1JFJA 1NIWA 1K93D 1U5IB 1BOCA 3NSLA 4WRIA 1JBAA 2F2OA 4NQGA 3VRRA 2F33A 1LA0A 3WHUB 5HLVA 4GGFA 1J55A 3BQ3A 1PSBA 2K7CA 3ZNIA 2ISDA 2K2AA 1TTXA 1ALVA 4PE1A 1CLMA 3VRNA 1DJGA 2LV7A 3FS7A 3WNXB 2Y1MA 1NCZA 2LLSA 1LKJA 4NDCA 1NX2A 5HKWA 2M1UA 5AEQA 3H4SE 2BCBA 2EGDA 1W7IB 1M39A 2CXJA 5I2QA 5GQQC 1N2DA 1IJ5A 1QXPA 1XFWO 2AAOA 4FQOA 3AKAA 4E68A 4GNKB 5AANA 2BL0B 3LCPC 1A03A 1IQ5A 2M1KB 1ZUZA 1A75B 1AK8A 1WLMA 2WOSA 4XJKA 2NLNA 1CFDA 1L2OB 1M46A 3CLNA 1RWYA 1KCYA 1B7TZ 2L50A 1YR5A 2JULA 3EKJA 1SCMC 1Y0VH 1CMGA 3CWGA 1MHOA 3PM8A 1GJYA 1XK4A 1QVIZ 3D10A 4USLA 2O5GA 1DJXA 1YVLA 2KI6D 5HLOA 1KFXL 1A29A 1ZMZA 5D7FA 5FYXA 2LMUA 2P6BB 2K7DA 2WNDA 1L7ZA 3AAJA 2KAXA 3IQOA 2MHHA 4R1EA 1CFCA 1UURA 3BOWB 5ER5A 1DMOA 1YTZC 3TUYC 3PATA 3BUXB 2L2EA 5CPVA 1MQ1A 5BPJA 1NYAA 4JQ0D 1UHHA 1B7TY 2MLFC 2CT9A 1SK6D 1K90D 2ZN8A 3IQQA 1J7PA 1H8BA 1QVIY 2BE4A 2H2KA 1LA3A 1QTXA 2COLB 5K89A 2LNKA 2KAYA 2Y5IA 4MVFA 3WHTB 2KYFA 1J7OA 4P5OE 2LANA 1B8LA 1QIVA 3SG7A 1TNXA 1PULA 4GGFC 2GV5A 3I5HC 1DVIA 1TIZA 1BMOA 1F70A 1BU3A 2KFFA 2K8MB 1ODBA 5AXIA 4M2PA 4YGCB 1K9UA 1WRLA 1J7QA 2BCXA 1AVSA 1OMVA 1K9PA 1SCMB 2KGRA 3EKHA 3ZWHA 5AFPA 3BUOB 3FWCA 1YURA 1NX1A 1UP5A 2ZKMX 2BBNA 2LE9B 1AJ4A 2NCPA 2LCPA 2M3WA 2JNXA 4XYNA 4I5JA 5I2LA 4PHKA 3JVTC 1TRFA 2MLEC 4OV2A 3PALA 2D8NA 1IWQA 1LXFC 2MA2A 3BXKA 2I94A 2KQYA 3DVEA 1DGVA 1WRZA 1TNWA 1H4BA 3QRXA 1SY9A 1CB1A 2JC2A 3I5FB 2JZIA 4JWQA 2H61A 2L4IA 4MZJA 1PSRA 5PALA 1YX7A 1TCFA 1F54A 2NZ0A 1SNLA 2MBXA 2JT3A 3A4UB 3KF9A 2WCFA 1OOJA 1R2UA 4YGBB 1FF1A 4PHNA 3DVKA 1KFUL 5ER4X 5G08A 3VGOA 3BYAA 2NXQA 2M49B 1RECA 2KI6C 3OX6A 1M63B 1S3PA 2LP2A 1TNPA 2WCBA 1BODA 3JTDB 5CSIA 2KYCA 4YI9A 2OPOA 2LP3A 1CFFA 3GK4X 1FI6A 1SR6C 2ZNEA 4PE4A 1KK8C 2Y4QA 2EC6C 1N0YA 4PE7A 1HQVA 1SL7A 2KI4B 4FTGA 1B47A 1G8IA 1BLQA 2CNPA 1F8HA 1NWDA 1RK9A 2Y1NA 4BY5A 4IL1A 3LLEA 1MXEA 1PRWA 2RGIA 1E8AA 2WCEA 4GBAA 2KSPA 4MN0A 1CDLA 4NDDA 1QJTA 2JQ6A 2WORA 2AUCA 3JVTB 1B4CA 3SG5A 1DJIA 2LMVA 1OZOA 1EG3A 1CLBA 1BG1A 1GGWA 1A4PA 2QACA 1WDCC 1DJYA 1J7RA 2GGMA 1DTLA 1SYMA 2L0PA 2WC8A 4MZKA 3TDIA 2HQ8A 1CFPA 2F2PA 2LMTA 1MR8A 1ZFSA 2EHBA 1DJWA 1IJ6A 2JTTA 2LVVA 2KHNA 2NCOA 3GOFA 3BUMB 4AQJA 2TN4A 1TNQA 1S6JA 4OR9B 1MXLC 1KSOA 4I5NB 1KK7Z 1U5IA 4OKHA 3NSOA 1IG5A 4U8DA 1EH2A 2M0RA 1G4YR 2KAVA 3CGAA 3EVVA 3OHMB 4JPZB 2K7BA 3BUWB 3I5IC 4YGDB 2KGBC 2PMYA 2M29A 1B8CA 4I5LB 1KQMC 2I2RE 5KSZA 4WQ2A 2H61C 4M2OA 5I8NA 1QX2A 1XFUO 2JNFA 2LLTA 1SRAA 1SPYA 1Q80A 2M7NA 4A4BA 4DCKA 5DKNA 1SR6B 1KK8B 3DD4A 4TNCA 4PHMA 1SL9A 3EVRA 5D69A 1CDNA 1XA5A 3DF0B 1QIWA 1TCOB 1IH0A 2K2FA 1KK7Y 1NX0A 2L4HA 3EK7A 3I5GC 3F45A 1EXRA 2HF5A 2JRFA 5B8IB 5KU1A 1C07A 2L5XB 2FCDA 1BJFA 2KQ6A 4N1GA 1A75A 2ZFDA 4DRWA 2Q91A 1FBVA 1A2XA 2MAZA 4MLWA 2PSRA 4YI8A 3SIBA 1B9AA 2LM5A 2HETA 2ZNDA 2B1UA 2JTZA 5HYDA 2F3YA 2FOTA 1UHJA 2V53A 1CTRA 3HCMA 2KFHA 2JWWA 2K61A 5HKZA 1LINA 1WDCB 4C0KA 2F3ZA 3PFVA 2MJWB 2HPSA 1K8UA 1UWOA 1G33A 3D0YB 1OQPA 3RLZA 4DS7A 1YX8A 2BE6A 3EK8A 1XYDA 3BOWA 1QASA 1SKTA 4DUQA 1QLKA 2M8UA 1SCVA 1IRJA
chains in the Genus database with same CATH superfamily
1EL4A 4QJ3B 1V1FA 4GUKA 1Y6WA 4MBEA 2KBIA 2KLEA 3O78A 2IS9A 4PALA 1JF0A 1KWOC 1QWVA 1CNPA 1C7WA 4PE0A 1Y1XA 1QV0A 3E3RA 1JF2A 3TUYB 4GAOA 3CZTX 4JKTA 3KEVA 3NHTA 1IIOA 1XK4C 4YBHB 1OZSA 1K96A 3PLFB 2A4JA 2LUXA 1KSMA 1NX3A 2JXLA 3NHIA 2KOTA 1KFXS 3Q8IA 1WLZA 2BKIB 3EG5B 1CMFA 1UHKA 4QJ4B 2LVKA 4YGAA 4PT1A 1K95A 2L5YA 1N65A 2LC5A 3DXLA 1YUSA 4HREE 3RM1A 2HQWA 1RROA 2PALA 2JOJA 3VRQA 1ZACA 3D73A 1SBJA 2QPTA 3A8RA 3I5HB 1GGZA 3NSKA 2JT8A 4P2YB 1ORGA 1F71A 1XFZO 1QV1A 1S36A 3B87A 3IVTA 2I7AA 3LK1A 1XFXO 3CYZA 1QS7A 1L2OC 2G9BA 5J3XA 3WXAA 1XVJA 2WCKA 4D1EA 2FJUB 3K21A 2OS8C 1WY9A 2MRDA 4ORAB 1CKKA 1OSAA 4QJ5B 4ZCVA 3TS5C 1V1GA 3EK4A 1M45A 1Y1AA 5TNCA 3KO0A 2DOQA 1JUOA 3O6BA 1X02A 5F6TA 2LUCA 1EG4A 1YVHA 3SG4A 3TDZA 4BY4A 4PCWA 4XJKB 1WRKA 1K94A 1XFYO 3OB1B 3LK0A 3OP0A 5IBWA 1C7VA 1GQMA 4INWA 1ALWA 5JOLA 3S0EA 2M7LA 2LVIA 4ORCB 1QATA 3CABA 1OMDA 2QEBA 3O2PA 4C0LA 5I94A 2FCEA 4WQ3A 4YGEB 1C3YA 2FJYA 1CM4A 2L98A 3TDUA 3VROA 4OCIA 1R6PA 4NDBA 1S6CA 2JXCA 1YUTA 2BECA 4MRXA 1TN4A 4MEWA 5CSNA 2G2BA 1F55A 2SASA 3D74A 1EJ3A 4N5XA 2PVBA 1S1EA 4HRHA 4M2QA 5CSFA 1CLLA 2KDHA 3LL8B 3K1EA 1MUXA 4Q04A 2O60A 1KFUS 2EC6B 1JFKA 1XFVO 3CR2A 3VRPA 1DELA 2ZRSA 4AOMA 1J1EA 2CTNA 2LLUA 3DVJA 1NUBA 3CZ2A 4CLNA 4A4CA 1BR1B 3DVMA 2OS8B 1FPWA 1SMGA 1JSAA 1Y1UA 3GK2A 2L51A 2WC6A 1BT6A 1DGUA 1XO5A 4MSPA 3TS5B 3QMEA 5DKRA 5FI2A 4UPGA 1NP8A 4YRUA 5HKYA 3IF7A 3SG3A 3GK1A 1AUIB 1J1DA 2JU0A 1CDPA 1PALA 1QLSA 3KHEA 4C0JA 1OOGA 2KFGA 5CSJA 2BKHB 1KQVA 3UNWA 4ZCUA 1S26D 1OE9B 1BR4B 3O4XA 5JJGA 1AP4A 3I5FC 4DIRA 3B6XA 3ICBA 2LHIA 3CR5X 3KPXA 2M97A 3D78A 2JT0A 4GFTA 1NCXA 4N1FA 2BBMA 2LHLA 4ETOA 1IKUA 2SCPA 3C1VA 1S5GZ 3DF0A 3FWBA 3HX4A 3M0WA 3PN7C 3N7HA 1NCYA 2R2IA 3FIAA 1IGVA 3BFHA 1PK0D 2CCMA 2GGZA 3I5IB 5HL1A 1RJVA 2OTGC 2BNXA 3JTDC 1PVAA 5KTYA 5DKQA 2WC5A 1K2HA 1F4OA 1KQMB 1K9KA 2JPTA 3NSIA 2ZN9A 2CBLA 3VB1A 3R72A 2I18A 3SJSA 4L9MA 1NSHA 4GPLB 3SG6A 1YRTB 2F8PA 3FE9A 3PSRA 4HRGA 2VRGA 1DJHA 1VRKA 4CFQA 2Q4UA 2LAPA 2KI4C 1RTP1 3RZSA 2BCAA 1AJ5A 1M31A 4PDZA 2ZRTA 3EVUA 1S5GY 3NXAA 1CDMA 1S6IA 1PVBA 1F4QA 2WCLA 3I5GB 3L4LA 3OB2B 4MZLA 3TZ1A 3CR4X 1D1OA 3V2LA 1UUSA 1YRUB 3CZ1A 1JWDA 2E30A 3D0YA 1DF0B 1OOFA 1UHNA 1BF5A 1C3ZA 1B8RA 2E6WA 1YUUA 2M9GA 1QX7A 1DJZA 1SW8A 4CPVA 4AQIA 1AHRA 1FW4A 1W7JB 3UO9A 4IJ7A 3OX5A 1TOPA 1LS8A 2KBMA 3AAKA 4HSZA 4PHJA 1MWNA 1OW4A 4I5KA 1TUJA 4OVNF 2L2CA 3SG2A 3L4AA 4CIDA 3CTNA 2BL0C 2LVJA 1NPQA 1MF8B 3MSEB 1CM1A 4KYNA 1FI5A 3CS1A 5EL2A 4ORBB 1ZOTB 4ICBA 2PASA 3BUNB 1IQ3A 3D77A 3FE8A 1JC2A 4F0ZB 1RFJA 3PN7B 4CFRA 1SL8A 3SIAA 5AERA 2P70A 1B1GA 2OTGB 5I2OA 1HT9A 1OMRA 1UHIA 2K0JA 2K7OA 4JD9A 1QX5B 1LVCD 2QDIA 4MRYA 1DF0A 1KWOB 2KNEA 4GGNA 3O4YA 4INXA 1T14A 2PRUA 2AMIA 3SS5A 3AKBA 1DT7B 1JFJA 1NIWA 1K93D 1U5IB 1BOCA 2QEVA 3NSLA 4WRIA 1JBAA 2F2OA 4NQGA 3VRRA 2F33A 1LA0A 3WHUB 5HLVA 3L47A 2ERBA 2GTEA 1J55A 4GGFA 2P71A 5D3OA 3BQ3A 1PSBA 5FI6A 2K7CA 3ZNIA 2ISDA 2K2AA 1TTXA 1ALVA 2WCJA 4PE1A 1CLMA 3VRNA 1DJGA 2LV7A 3FS7A 3WNXB 2Y1MA 1NCZA 2LLSA 1LKJA 2YGUA 4NDCA 1NX2A 5HKWA 2M1UA 5AEQA 3H4SE 2BCBA 2EGDA 1DC1A 1W7IB 1M39A 1P28A 1Z2CB 2CXJA 5GQQC 5I2QA 1N2DA 1IJ5A 1QXPA 1XFWO 2AAOA 4FQOA 3AKAA 4E68A 4GNKB 5AANA 2BL0B 3LCPC 1A03A 1IQ5A 2M1KB 1ZUZA 1A75B 1AK8A 1WLMA 2WOSA 3R1VA 2NLNA 4XJKA 1CFDA 1L2OB 1M46A 3CLNA 1RWYA 2WCMA 1B7TZ 2L50A 1YR5A 2JULA 3EKJA 1SCMC 1Y0VH 1CMGA 3CWGA 1MHOA 3PM8A 1GJYA 1XK4A 1QVIZ 3D10A 4USLA 2O5GA 3D75A 1DJXA 1YVLA 2KI6D 5HLOA 3FE6A 1KFXL 1A29A 1ZMZA 5D7FA 5FYXA 2LMUA 2P6BB 3SS4A 2K7DA 2WNDA 4OZDA 1L7ZA 3AAJA 2KAXA 3IQOA 2MHHA 4R1EA 3S0BA 4F7FA 1UURA 3BOWB 5ER5A 1CFCA 1DMOA 1YTZC 3TUYC 3PATA 3BUXB 2L2EA 5CPVA 3CZ0A 1MQ1A 5BPJA 3S0DA 1NYAA 3DYEA 4JQ0D 1UHHA 1B7TY 2MLFC 2CT9A 1SK6D 1K90D 2ZN8A 3IQQA 1J7PA 1H8BA 1QVIY 2BE4A 2H2KA 1LA3A 1QTXA 2COLB 5K89A 1GM0A 2LNKA 2KAYA 2Y5IA 2K60A 3DZTA 4MVFA 3WHTB 2KYFA 1J7OA 4P5OE 2LANA 1B8LA 1QIVA 3SG7A 1TNXA 1PULA 4GGFC 5FI7A 1OOIX 2GV5A 3I5HC 1KCYA 1DVIA 1TIZA 1BMOA 1F70A 1BU3A 2KFFA 2K8MB 1ODBA 5AXIA 4M2PA 4YGCB 1K9UA 1WRLA 1J7QA 2BCXA 1AVSA 1OMVA 1K9PA 1SCMB 2KGRA 3EKHA 3ZWHA 5AFPA 3BUOB 3FWCA 1YURA 1NX1A 1UP5A 2ZKMX 2BBNA 2LE9B 1AJ4A 2NCPA 2PYQA 2LCPA 2M3WA 2JNXA 4XYNA 4I5JA 5I2LA 4PHKA 3JVTC 1TRFA 2MLEC 4OV2A 3PALA 2D8NA 1IWQA 3S0FA 1LXFC 2MA2A 3BXKA 3B86A 2I94A 2KQYA 3DVEA 1DGVA 1WRZA 1TNWA 1H4BA 3QRXA 1SY9A 1CB1A 2H8VA 2JC2A 3D76A 3I5FB 2JZIA 4JWQA 2H61A 2L4IA 4MZJA 1PSRA 5PALA 1YX7A 1TCFA 1F54A 2NZ0A 1SNLA 2MBXA 2JT3A 3A4UB 3KF9A 2WCFA 1OOJA 1R2UA 4YGBB 1FF1A 4PHNA 3DVKA 1KFUL 5ER4X 5G08A 1TUZA 3VGOA 3BYAA 2NXQA 2M49B 1RECA 2KI6C 3OX6A 1M63B 1S3PA 2LP2A 1TNPA 2WCBA 1BODA 3JTDB 5CSIA 2KYCA 4YI9A 2OPOA 2LP3A 1CFFA 3GK4X 1FI6A 1SR6C 2ZNEA 4PE4A 3SS3A 1KK8C 2Y4QA 2EC6C 1Z4HA 1N0YA 4PE7A 1HQVA 1SL7A 2KI4B 4FTGA 1B47A 1G8IA 3PM2A 1BLQA 3S0GA 2CNPA 3CDNA 2PQLA 1NWDA 1F8HA 1RK9A 2Y1NA 4BY5A 4IL1A 3LLEA 1MXEA 2BAPA 2WCHA 1PRWA 2RGIA 1E8AA 2WCEA 4GBAA 2KSPA 4MN0A 1CDLA 4NDDA 1QJTA 2JQ6A 2WORA 2AUCA 3JVTB 1B4CA 3SG5A 1DJIA 2LMVA 1OZOA 1EG3A 1CLBA 1BG1A 1GGWA 3R1PA 3S0AA 1A4PA 2QACA 1WDCC 3GOFA 1DJYA 3B88A 1J7RA 2GGMA 1DTLA 1SYMA 2L0PA 2WC8A 4MZKA 3TDIA 2HQ8A 1CFPA 2F2PA 2LMTA 1MR8A 1ZFSA 2EHBA 1DJWA 1IJ6A 2JTTA 2LVVA 2KHNA 2NCOA 2QEOA 3BUMB 4AQJA 2TN4A 1TNQA 1S6JA 4OR9B 1MXLC 1KSOA 4I5NB 1KK7Z 1U5IA 2QEHA 4OKHA 3NSOA 1IG5A 4U8DA 1EH2A 2M0RA 1G4YR 2KAVA 3CGAA 3EVVA 3OHMB 1DQEA 4JPZB 2K7BA 3BUWB 3I5IC 4YGDB 2KGBC 2PMYA 2M29A 3BFBA 1B8CA 4I5LB 1KQMC 2I2RE 5KSZA 4WQ2A 2H61C 4M2OA 5I8NA 1QX2A 1XFUO 2JNFA 2LLTA 3OBVA 1SRAA 1SPYA 1Q80A 2M7NA 4A4BA 4DCKA 5DKNA 1SR6B 1KK8B 3DD4A 4TNCA 2KLDA 4PHMA 1SL9A 3EVRA 5D69A 1CDNA 1XA5A 3DF0B 3BFAA 3PJIA 1QIWA 1TCOB 1IH0A 2K2FA 1KK7Y 3OGNA 4FQTA 1NX0A 2L4HA 3EK7A 3I5GC 3F45A 2JPOA 1EXRA 2HF5A 2JRFA 5B8IB 5KU1A 1C07A 2L5XB 2FCDA 1BJFA 2KQ6A 4N1GA 1A75A 2ZFDA 4DRWA 1OOHA 1TWOA 1FBVA 1A2XA 2MAZA 2Q91A 2PSRA 4MLWA 4YI8A 3B7AA 3SIBA 1B9AA 2LM5A 2HETA 2ZNDA 2B1UA 2JTZA 5DICA 2F3YA 5HYDA 2FOTA 1UHJA 3DY9A 2V53A 1CTRA 3HCMA 3NGVA 2KFHA 2JWWA 2K61A 5HKZA 1LINA 1WDCB 4C0KA 2F3ZA 3BJHA 3PFVA 1W9ZA 2MJWB 2HPSA 1K8UA 1DEKA 1UWOA 1G33A 3D0YB 1OQPA 3RLZA 4DS7A 2KPHA 1YX8A 2BE6A 3EK8A 1XYDA 3BOWA 1QASA 1SKTA 4DUQA 3R1OA 1XFRA 1QLKA 1SSEB 2M8UA 1SCVA 1IRJA
chains in the Genus database with same CATH topology
1EL4A 4QJ3B 1V1FA 4GUKA 1Y6WA 4MBEA 2KBIA 3O78A 2IS9A 4PALA 1JF0A 1KWOC 1CNPA 1C7WA 4PE0A 1Y1XA 1QV0A 3E3RA 1JF2A 3TUYB 4GAOA 3CZTX 3KEVA 1XK4C 4YBHB 1OZSA 1K96A 3PLFB 2A4JA 2LUXA 1KSMA 1NX3A 2JXLA 2KOTA 1KFXS 1WLZA 2BKIB 1CMFA 1UHKA 4QJ4B 2LVKA 4YGAA 1K95A 1N65A 2LC5A 1YUSA 4HREE 3RM1A 2HQWA 1RROA 2PALA 2JOJA 3VRQA 1ZACA 1SBJA 2QPTA 3A8RA 3I5HB 1GGZA 3NSKA 2JT8A 4P2YB 1F71A 1XFZO 1QV1A 1S36A 2I7AA 3LK1A 1XFXO 3WXAA 1QS7A 1L2OC 2G9BA 5J3XA 1XVJA 4D1EA 2FJUB 3K21A 2OS8C 1WY9A 2MRDA 4ORAB 1CKKA 1OSAA 4QJ5B 4ZCVA 3TS5C 1V1GA 3EK4A 1M45A 1Y1AA 5TNCA 3KO0A 2DOQA 1JUOA 3O6BA 1X02A 5F6TA 2LUCA 1EG4A 1YVHA 3SG4A 3TDZA 4BY4A 4PCWA 4XJKB 1WRKA 1K94A 1XFYO 3OB1B 3LK0A 3OP0A 5IBWA 1C7VA 1GQMA 1ALWA 5JOLA 2M7LA 2LVIA 4ORCB 1QATA 1OMDA 3O2PA 4C0LA 2FCEA 4WQ3A 4YGEB 1CM4A 2L98A 3TDUA 3VROA 4OCIA 1R6PA 4NDBA 1S6CA 2JXCA 1YUTA 2BECA 4MRXA 1TN4A 4MEWA 5CSNA 2G2BA 1F55A 2SASA 4N5XA 1EJ3A 2PVBA 1S1EA 4HRHA 4M2QA 5CSFA 1CLLA 2KDHA 3LL8B 1MUXA 4Q04A 2O60A 1KFUS 2EC6B 1JFKA 1XFVO 3CR2A 3VRPA 2ZRSA 4AOMA 1J1EA 2CTNA 2LLUA 3DVJA 1NUBA 4CLNA 4A4CA 1BR1B 3DVMA 2OS8B 1FPWA 1SMGA 1JSAA 1Y1UA 3GK2A 2L51A 1BT6A 1DGUA 1XO5A 4MSPA 3TS5B 5DKRA 4UPGA 1NP8A 4YRUA 5HKYA 3IF7A 3SG3A 3GK1A 1AUIB 1J1DA 2JU0A 1CDPA 1PALA 1QLSA 3KHEA 4C0JA 2KFGA 5CSJA 2BKHB 1KQVA 4ZCUA 1S26D 1OE9B 1BR4B 5JJGA 1AP4A 3I5FC 4DIRA 3ICBA 2LHIA 3CR5X 3KPXA 2M97A 4N1FA 2JT0A 4GFTA 1NCXA 2BBMA 2LHLA 4ETOA 1IKUA 2SCPA 3C1VA 1S5GZ 3DF0A 3FWBA 3HX4A 3M0WA 3PN7C 1NCYA 2R2IA 3FIAA 1IGVA 1PK0D 2CCMA 2GGZA 3I5IB 1RJVA 2OTGC 3JTDC 1PVAA 5KTYA 5DKQA 1K2HA 1F4OA 1KQMB 1K9KA 2JPTA 3NSIA 2ZN9A 2CBLA 2I18A 3SJSA 4L9MA 1NSHA 4GPLB 3SG6A 1YRTB 2F8PA 3PSRA 4HRGA 2VRGA 1DJHA 1VRKA 4CFQA 2Q4UA 2LAPA 2KI4C 1RTP1 2BCAA 1AJ5A 1M31A 4PDZA 2ZRTA 3EVUA 1S5GY 3NXAA 1CDMA 1S6IA 1PVBA 1F4QA 3I5GB 3OB2B 4MZLA 3TZ1A 3CR4X 1D1OA 1UUSA 1YRUB 1JWDA 2E30A 3D0YA 1DF0B 1UHNA 1BF5A 1B8RA 2E6WA 1YUUA 2M9GA 1QX7A 1DJZA 1SW8A 4CPVA 4AQIA 1AHRA 1FW4A 1W7JB 3OX5A 1TOPA 3AAKA 2KBMA 4HSZA 4PHJA 1MWNA 4I5KA 4OVNF 3SG2A 4CIDA 3CTNA 2BL0C 2LVJA 1NPQA 1MF8B 3MSEB 1CM1A 1FI5A 3CS1A 4ORBB 1ZOTB 4ICBA 2PASA 3BUNB 1IQ3A 1JC2A 4F0ZB 1RFJA 3PN7B 4CFRA 1SL8A 3SIAA 5AERA 1B1GA 2OTGB 5I2OA 1HT9A 1OMRA 1UHIA 2K0JA 2K7OA 1QX5B 1LVCD 4MRYA 1DF0A 1KWOB 2KNEA 4GGNA 3O4YA 2PRUA 2AMIA 3AKBA 1DT7B 1JFJA 1NIWA 1K93D 1U5IB 1BOCA 3NSLA 4WRIA 1JBAA 2F2OA 4NQGA 3VRRA 2F33A 1LA0A 3WHUB 5HLVA 4GGFA 1J55A 3BQ3A 1PSBA 2K7CA 3ZNIA 2ISDA 2K2AA 1TTXA 1ALVA 4PE1A 1CLMA 3VRNA 1DJGA 2LV7A 3FS7A 3WNXB 2Y1MA 1NCZA 2LLSA 1LKJA 4NDCA 1NX2A 5HKWA 2M1UA 5AEQA 3H4SE 2BCBA 2EGDA 1W7IB 1M39A 2CXJA 5I2QA 5GQQC 1N2DA 1IJ5A 1QXPA 1XFWO 2AAOA 4FQOA 3AKAA 4E68A 4GNKB 5AANA 2BL0B 3LCPC 1A03A 1IQ5A 2M1KB 1ZUZA 1A75B 1AK8A 1WLMA 2WOSA 4XJKA 2NLNA 1CFDA 1L2OB 1M46A 3CLNA 1RWYA 1KCYA 1B7TZ 2L50A 1YR5A 2JULA 3EKJA 1SCMC 1Y0VH 1CMGA 3CWGA 1MHOA 3PM8A 1GJYA 1XK4A 1QVIZ 3D10A 4USLA 2O5GA 1DJXA 1YVLA 2KI6D 5HLOA 1KFXL 1A29A 1ZMZA 5D7FA 5FYXA 2LMUA 2P6BB 2K7DA 2WNDA 1L7ZA 3AAJA 2KAXA 3IQOA 2MHHA 4R1EA 1CFCA 1UURA 3BOWB 5ER5A 1DMOA 1YTZC 3TUYC 3PATA 3BUXB 2L2EA 5CPVA 1MQ1A 5BPJA 1NYAA 4JQ0D 1UHHA 1B7TY 2MLFC 2CT9A 1SK6D 1K90D 2ZN8A 3IQQA 1J7PA 1H8BA 1QVIY 2BE4A 2H2KA 1LA3A 1QTXA 2COLB 5K89A 2LNKA 2KAYA 2Y5IA 4MVFA 3WHTB 2KYFA 1J7OA 4P5OE 2LANA 1B8LA 1QIVA 3SG7A 1TNXA 1PULA 4GGFC 2GV5A 3I5HC 1DVIA 1TIZA 1BMOA 1F70A 1BU3A 2KFFA 2K8MB 1ODBA 5AXIA 4M2PA 4YGCB 1K9UA 1WRLA 1J7QA 2BCXA 1AVSA 1OMVA 1K9PA 1SCMB 2KGRA 3EKHA 3ZWHA 5AFPA 3BUOB 3FWCA 1YURA 1NX1A 1UP5A 2ZKMX 2BBNA 2LE9B 1AJ4A 2NCPA 2LCPA 2M3WA 2JNXA 4XYNA 4I5JA 5I2LA 4PHKA 3JVTC 1TRFA 2MLEC 4OV2A 3PALA 2D8NA 1IWQA 1LXFC 2MA2A 3BXKA 2I94A 2KQYA 3DVEA 1DGVA 1WRZA 1TNWA 1H4BA 3QRXA 1SY9A 1CB1A 2JC2A 3I5FB 2JZIA 4JWQA 2H61A 2L4IA 4MZJA 1PSRA 5PALA 1YX7A 1TCFA 1F54A 2NZ0A 1SNLA 2MBXA 2JT3A 3A4UB 3KF9A 2WCFA 1OOJA 1R2UA 4YGBB 1FF1A 4PHNA 3DVKA 1KFUL 5ER4X 5G08A 3VGOA 3BYAA 2NXQA 2M49B 1RECA 2KI6C 3OX6A 1M63B 1S3PA 2LP2A 1TNPA 2WCBA 1BODA 3JTDB 5CSIA 2KYCA 4YI9A 2OPOA 2LP3A 1CFFA 3GK4X 1FI6A 1SR6C 2ZNEA 4PE4A 1KK8C 2Y4QA 2EC6C 1N0YA 4PE7A 1HQVA 1SL7A 2KI4B 4FTGA 1B47A 1G8IA 1BLQA 2CNPA 1F8HA 1NWDA 1RK9A 2Y1NA 4BY5A 4IL1A 3LLEA 1MXEA 1PRWA 2RGIA 1E8AA 2WCEA 4GBAA 2KSPA 4MN0A 1CDLA 4NDDA 1QJTA 2JQ6A 2WORA 2AUCA 3JVTB 1B4CA 3SG5A 1DJIA 2LMVA 1OZOA 1EG3A 1CLBA 1BG1A 1GGWA 1A4PA 2QACA 1WDCC 1DJYA 1J7RA 2GGMA 1DTLA 1SYMA 2L0PA 2WC8A 4MZKA 3TDIA 2HQ8A 1CFPA 2F2PA 2LMTA 1MR8A 1ZFSA 2EHBA 1DJWA 1IJ6A 2JTTA 2LVVA 2KHNA 2NCOA 3GOFA 3BUMB 4AQJA 2TN4A 1TNQA 1S6JA 4OR9B 1MXLC 1KSOA 4I5NB 1KK7Z 1U5IA 4OKHA 3NSOA 1IG5A 4U8DA 1EH2A 2M0RA 1G4YR 2KAVA 3CGAA 3EVVA 3OHMB 4JPZB 2K7BA 3BUWB 3I5IC 4YGDB 2KGBC 2PMYA 2M29A 1B8CA 4I5LB 1KQMC 2I2RE 5KSZA 4WQ2A 2H61C 4M2OA 5I8NA 1QX2A 1XFUO 2JNFA 2LLTA 1SRAA 1SPYA 1Q80A 2M7NA 4A4BA 4DCKA 5DKNA 1SR6B 1KK8B 3DD4A 4TNCA 4PHMA 1SL9A 3EVRA 5D69A 1CDNA 1XA5A 3DF0B 1QIWA 1TCOB 1IH0A 2K2FA 1KK7Y 1NX0A 2L4HA 3EK7A 3I5GC 3F45A 1EXRA 2HF5A 2JRFA 5B8IB 5KU1A 1C07A 2L5XB 2FCDA 1BJFA 2KQ6A 4N1GA 1A75A 2ZFDA 4DRWA 2Q91A 1FBVA 1A2XA 2MAZA 4MLWA 2PSRA 4YI8A 3SIBA 1B9AA 2LM5A 2HETA 2ZNDA 2B1UA 2JTZA 5HYDA 2F3YA 2FOTA 1UHJA 2V53A 1CTRA 3HCMA 2KFHA 2JWWA 2K61A 5HKZA 1LINA 1WDCB 4C0KA 2F3ZA 3PFVA 2MJWB 2HPSA 1K8UA 1UWOA 1G33A 3D0YB 1OQPA 3RLZA 4DS7A 1YX8A 2BE6A 3EK8A 1XYDA 3BOWA 1QASA 1SKTA 4DUQA 1QLKA 2M8UA 1SCVA 1IRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL4 A;  4QJ3 B;  1V1F A;  4GUK A;  1Y6W A;  4MBE A;  2KBI A;  3O78 A;  2IS9 A;  4PAL A;  1JF0 A;  1KWO C;  1CNP A;  1C7W A;  4PE0 A;  1Y1X A;  1QV0 A;  3E3R A;  1JF2 A;  3TUY B;  4GAO A;  3CZT X;  3KEV A;  1XK4 C;  4YBH B;  1OZS A;  1K96 A;  3PLF B;  2A4J A;  2LUX A;  1KSM A;  1NX3 A;  2JXL A;  2KOT A;  1KFX S;  1WLZ A;  2BKI B;  1CMF A;  1UHK A;  4QJ4 B;  2LVK A;  4YGA A;  1K95 A;  1N65 A;  2LC5 A;  1YUS A;  4HRE E;  3RM1 A;  2HQW A;  1RRO A;  2PAL A;  2JOJ A;  3VRQ A;  1ZAC A;  1SBJ A;  2QPT A;  3A8R A;  3I5H B;  1GGZ A;  3NSK A;  2JT8 A;  4P2Y B;  1F71 A;  1XFZ O;  1QV1 A;  1S36 A;  2I7A A;  3LK1 A;  1XFX O;  3WXA A;  1QS7 A;  1L2O C;  2G9B A;  5J3X A;  1XVJ A;  4D1E A;  2FJU B;  3K21 A;  2OS8 C;  1WY9 A;  2MRD A;  4ORA B;  1CKK A;  1OSA A;  4QJ5 B;  4ZCV A;  3TS5 C;  1V1G A;  3EK4 A;  1M45 A;  1Y1A A;  5TNC A;  3KO0 A;  2DOQ A;  1JUO A;  3O6B A;  1X02 A;  5F6T A;  2LUC A;  1EG4 A;  1YVH A;  3SG4 A;  3TDZ A;  4BY4 A;  4PCW A;  4XJK B;  1WRK A;  1K94 A;  1XFY O;  3OB1 B;  3LK0 A;  3OP0 A;  5IBW A;  1C7V A;  1GQM A;  1ALW A;  5JOL A;  2M7L A;  2LVI A;  4ORC B;  1QAT A;  1OMD A;  3O2P A;  4C0L A;  2FCE A;  4WQ3 A;  4YGE B;  1CM4 A;  2L98 A;  3TDU A;  3VRO A;  4OCI A;  1R6P A;  4NDB A;  1S6C A;  2JXC A;  1YUT A;  2BEC A;  4MRX A;  1TN4 A;  4MEW A;  5CSN A;  2G2B A;  1F55 A;  2SAS A;  4N5X A;  1EJ3 A;  2PVB A;  1S1E A;  4HRH A;  4M2Q A;  5CSF A;  1CLL A;  2KDH A;  3LL8 B;  1MUX A;  4Q04 A;  2O60 A;  1KFU S;  2EC6 B;  1JFK A;  1XFV O;  3CR2 A;  3VRP A;  2ZRS A;  4AOM A;  1J1E A;  2CTN A;  2LLU A;  3DVJ A;  1NUB A;  4CLN A;  4A4C A;  1BR1 B;  3DVM A;  2OS8 B;  1FPW A;  1SMG A;  1JSA A;  1Y1U A;  3GK2 A;  2L51 A;  1BT6 A;  1DGU A;  1XO5 A;  4MSP A;  3TS5 B;  5DKR A;  4UPG A;  1NP8 A;  4YRU A;  5HKY A;  3IF7 A;  3SG3 A;  3GK1 A;  1AUI B;  1J1D A;  2JU0 A;  1CDP A;  1PAL A;  1QLS A;  3KHE A;  4C0J A;  2KFG A;  5CSJ A;  2BKH B;  1KQV A;  4ZCU A;  1S26 D;  1OE9 B;  1BR4 B;  5JJG A;  1AP4 A;  3I5F C;  4DIR A;  3ICB A;  2LHI A;  3CR5 X;  3KPX A;  2M97 A;  4N1F A;  2JT0 A;  4GFT A;  1NCX A;  2BBM A;  2LHL A;  4ETO A;  1IKU A;  2SCP A;  3C1V A;  1S5G Z;  3DF0 A;  3FWB A;  3HX4 A;  3M0W A;  3PN7 C;  1NCY A;  2R2I A;  3FIA A;  1IGV A;  1PK0 D;  2CCM A;  2GGZ A;  3I5I B;  1RJV A;  2OTG C;  3JTD C;  1PVA A;  5KTY A;  5DKQ A;  1K2H A;  1F4O A;  1KQM B;  1K9K A;  2JPT A;  3NSI A;  2ZN9 A;  2CBL A;  2I18 A;  3SJS A;  4L9M A;  1NSH A;  4GPL B;  3SG6 A;  1YRT B;  2F8P A;  3PSR A;  4HRG A;  2VRG A;  1DJH A;  1VRK A;  4CFQ A;  2Q4U A;  2LAP A;  2KI4 C;  1RTP 1;  2BCA A;  1AJ5 A;  1M31 A;  4PDZ A;  2ZRT A;  3EVU A;  1S5G Y;  3NXA A;  1CDM A;  1S6I A;  1PVB A;  1F4Q A;  3I5G B;  3OB2 B;  4MZL A;  3TZ1 A;  3CR4 X;  1D1O A;  1UUS A;  1YRU B;  1JWD A;  2E30 A;  3D0Y A;  1DF0 B;  1UHN A;  1BF5 A;  1B8R A;  2E6W A;  1YUU A;  2M9G A;  1QX7 A;  1DJZ A;  1SW8 A;  4CPV A;  4AQI A;  1AHR A;  1FW4 A;  1W7J B;  3OX5 A;  1TOP A;  3AAK A;  2KBM A;  4HSZ A;  4PHJ A;  1MWN A;  4I5K A;  4OVN F;  3SG2 A;  4CID A;  3CTN A;  2BL0 C;  2LVJ A;  1NPQ A;  1MF8 B;  3MSE B;  1CM1 A;  1FI5 A;  3CS1 A;  4ORB B;  1ZOT B;  4ICB A;  2PAS A;  3BUN B;  1IQ3 A;  1JC2 A;  4F0Z B;  1RFJ A;  3PN7 B;  4CFR A;  1SL8 A;  3SIA A;  5AER A;  1B1G A;  2OTG B;  5I2O A;  1HT9 A;  1OMR A;  1UHI A;  2K0J A;  2K7O A;  1QX5 B;  1LVC D;  4MRY A;  1DF0 A;  1KWO B;  2KNE A;  4GGN A;  3O4Y A;  2PRU A;  2AMI A;  3AKB A;  1DT7 B;  1JFJ A;  1NIW A;  1K93 D;  1U5I B;  1BOC A;  3NSL A;  4WRI A;  1JBA A;  2F2O A;  4NQG A;  3VRR A;  2F33 A;  1LA0 A;  3WHU B;  5HLV A;  4GGF A;  1J55 A;  3BQ3 A;  1PSB A;  2K7C A;  3ZNI A;  2ISD A;  2K2A A;  1TTX A;  1ALV A;  4PE1 A;  1CLM A;  3VRN A;  1DJG A;  2LV7 A;  3FS7 A;  3WNX B;  2Y1M A;  1NCZ A;  2LLS A;  1LKJ A;  4NDC A;  1NX2 A;  5HKW A;  2M1U A;  5AEQ A;  3H4S E;  2BCB A;  2EGD A;  1W7I B;  1M39 A;  2CXJ A;  5I2Q A;  5GQQ C;  1N2D A;  1IJ5 A;  1QXP A;  1XFW O;  2AAO A;  4FQO A;  3AKA A;  4E68 A;  4GNK B;  5AAN A;  2BL0 B;  3LCP C;  1A03 A;  1IQ5 A;  2M1K B;  1ZUZ A;  1A75 B;  1AK8 A;  1WLM A;  2WOS A;  4XJK A;  2NLN A;  1CFD A;  1L2O B;  1M46 A;  3CLN A;  1RWY A;  1KCY A;  1B7T Z;  2L50 A;  1YR5 A;  2JUL A;  3EKJ A;  1SCM C;  1Y0V H;  1CMG A;  3CWG A;  1MHO A;  3PM8 A;  1GJY A;  1XK4 A;  1QVI Z;  3D10 A;  4USL A;  2O5G A;  1DJX A;  1YVL A;  2KI6 D;  5HLO A;  1KFX L;  1A29 A;  1ZMZ A;  5D7F A;  5FYX A;  2LMU A;  2P6B B;  2K7D A;  2WND A;  1L7Z A;  3AAJ A;  2KAX A;  3IQO A;  2MHH A;  4R1E A;  1CFC A;  1UUR A;  3BOW B;  5ER5 A;  1DMO A;  1YTZ C;  3TUY C;  3PAT A;  3BUX B;  2L2E A;  5CPV A;  1MQ1 A;  5BPJ A;  1NYA A;  4JQ0 D;  1UHH A;  1B7T Y;  2MLF C;  2CT9 A;  1SK6 D;  1K90 D;  2ZN8 A;  3IQQ A;  1J7P A;  1H8B A;  1QVI Y;  2BE4 A;  2H2K A;  1LA3 A;  1QTX A;  2COL B;  5K89 A;  2LNK A;  2KAY A;  2Y5I A;  4MVF A;  3WHT B;  2KYF A;  1J7O A;  4P5O E;  2LAN A;  1B8L A;  1QIV A;  3SG7 A;  1TNX A;  1PUL A;  4GGF C;  2GV5 A;  3I5H C;  1DVI A;  1TIZ A;  1BMO A;  1F70 A;  1BU3 A;  2KFF A;  2K8M B;  1ODB A;  5AXI A;  4M2P A;  4YGC B;  1K9U A;  1WRL A;  1J7Q A;  2BCX A;  1AVS A;  1OMV A;  1K9P A;  1SCM B;  2KGR A;  3EKH A;  3ZWH A;  5AFP A;  3BUO B;  3FWC A;  1YUR A;  1NX1 A;  1UP5 A;  2ZKM X;  2BBN A;  2LE9 B;  1AJ4 A;  2NCP A;  2LCP A;  2M3W A;  2JNX A;  4XYN A;  4I5J A;  5I2L A;  4PHK A;  3JVT C;  1TRF A;  2MLE C;  4OV2 A;  3PAL A;  2D8N A;  1IWQ A;  1LXF C;  2MA2 A;  3BXK A;  2I94 A;  2KQY A;  3DVE A;  1DGV A;  1WRZ A;  1TNW A;  1H4B A;  3QRX A;  1SY9 A;  1CB1 A;  2JC2 A;  3I5F B;  2JZI A;  4JWQ A;  2H61 A;  2L4I A;  4MZJ A;  1PSR A;  5PAL A;  1YX7 A;  1TCF A;  1F54 A;  2NZ0 A;  1SNL A;  2MBX A;  2JT3 A;  3A4U B;  3KF9 A;  2WCF A;  1OOJ A;  1R2U A;  4YGB B;  1FF1 A;  4PHN A;  3DVK A;  1KFU L;  5ER4 X;  5G08 A;  3VGO A;  3BYA A;  2NXQ A;  2M49 B;  1REC A;  2KI6 C;  3OX6 A;  1M63 B;  1S3P A;  2LP2 A;  1TNP A;  2WCB A;  1BOD A;  3JTD B;  5CSI A;  2KYC A;  4YI9 A;  2OPO A;  2LP3 A;  1CFF A;  3GK4 X;  1FI6 A;  1SR6 C;  2ZNE A;  4PE4 A;  1KK8 C;  2Y4Q A;  2EC6 C;  1N0Y A;  4PE7 A;  1HQV A;  1SL7 A;  2KI4 B;  4FTG A;  1B47 A;  1G8I A;  1BLQ A;  2CNP A;  1F8H A;  1NWD A;  1RK9 A;  2Y1N A;  4BY5 A;  4IL1 A;  3LLE A;  1MXE A;  1PRW A;  2RGI A;  1E8A A;  2WCE A;  4GBA A;  2KSP A;  4MN0 A;  1CDL A;  4NDD A;  1QJT A;  2JQ6 A;  2WOR A;  2AUC A;  3JVT B;  1B4C A;  3SG5 A;  1DJI A;  2LMV A;  1OZO A;  1EG3 A;  1CLB A;  1BG1 A;  1GGW A;  1A4P A;  2QAC A;  1WDC C;  1DJY A;  1J7R A;  2GGM A;  1DTL A;  1SYM A;  2L0P A;  2WC8 A;  4MZK A;  3TDI A;  2HQ8 A;  1CFP A;  2F2P A;  2LMT A;  1MR8 A;  1ZFS A;  2EHB A;  1DJW A;  1IJ6 A;  2JTT A;  2LVV A;  2KHN A;  2NCO A;  3GOF A;  3BUM B;  4AQJ A;  2TN4 A;  1TNQ A;  1S6J A;  4OR9 B;  1MXL C;  1KSO A;  4I5N B;  1KK7 Z;  1U5I A;  4OKH A;  3NSO A;  1IG5 A;  4U8D A;  1EH2 A;  2M0R A;  1G4Y R;  2KAV A;  3CGA A;  3EVV A;  3OHM B;  4JPZ B;  2K7B A;  3BUW B;  3I5I C;  4YGD B;  2KGB C;  2PMY A;  2M29 A;  1B8C A;  4I5L B;  1KQM C;  2I2R E;  5KSZ A;  4WQ2 A;  2H61 C;  4M2O A;  5I8N A;  1QX2 A;  1XFU O;  2JNF A;  2LLT A;  1SRA A;  1SPY A;  1Q80 A;  2M7N A;  4A4B A;  4DCK A;  5DKN A;  1SR6 B;  1KK8 B;  3DD4 A;  4TNC A;  4PHM A;  1SL9 A;  3EVR A;  5D69 A;  1CDN A;  1XA5 A;  3DF0 B;  1QIW A;  1TCO B;  1IH0 A;  2K2F A;  1KK7 Y;  1NX0 A;  2L4H A;  3EK7 A;  3I5G C;  3F45 A;  1EXR A;  2HF5 A;  2JRF A;  5B8I B;  5KU1 A;  1C07 A;  2L5X B;  2FCD A;  1BJF A;  2KQ6 A;  4N1G A;  1A75 A;  2ZFD A;  4DRW A;  2Q91 A;  1FBV A;  1A2X A;  2MAZ A;  4MLW A;  2PSR A;  4YI8 A;  3SIB A;  1B9A A;  2LM5 A;  2HET A;  2ZND A;  2B1U A;  2JTZ A;  5HYD A;  2F3Y A;  2FOT A;  1UHJ A;  2V53 A;  1CTR A;  3HCM A;  2KFH A;  2JWW A;  2K61 A;  5HKZ A;  1LIN A;  1WDC B;  4C0K A;  2F3Z A;  3PFV A;  2MJW B;  2HPS A;  1K8U A;  1UWO A;  1G33 A;  3D0Y B;  1OQP A;  3RLZ A;  4DS7 A;  1YX8 A;  2BE6 A;  3EK8 A;  1XYD A;  3BOW A;  1QAS A;  1SKT A;  4DUQ A;  1QLK A;  2M8U A;  1SCV A;  1IRJ A; 
#chains in the Genus database with same CATH topology
 1EL4 A;  4QJ3 B;  1V1F A;  4GUK A;  1Y6W A;  4MBE A;  2KBI A;  2KLE A;  3O78 A;  2IS9 A;  4PAL A;  1JF0 A;  1KWO C;  1QWV A;  1CNP A;  1C7W A;  4PE0 A;  1Y1X A;  1QV0 A;  3E3R A;  1JF2 A;  3TUY B;  4GAO A;  3CZT X;  4JKT A;  3KEV A;  3NHT A;  1IIO A;  1XK4 C;  4YBH B;  1OZS A;  1K96 A;  3PLF B;  2A4J A;  2LUX A;  1KSM A;  1NX3 A;  2JXL A;  3NHI A;  2KOT A;  1KFX S;  3Q8I A;  1WLZ A;  2BKI B;  3EG5 B;  1CMF A;  1UHK A;  4QJ4 B;  2LVK A;  4YGA A;  4PT1 A;  1K95 A;  2L5Y A;  1N65 A;  2LC5 A;  3DXL A;  1YUS A;  4HRE E;  3RM1 A;  2HQW A;  1RRO A;  2PAL A;  2JOJ A;  3VRQ A;  1ZAC A;  3D73 A;  1SBJ A;  2QPT A;  3A8R A;  3I5H B;  1GGZ A;  3NSK A;  2JT8 A;  4P2Y B;  1ORG A;  1F71 A;  1XFZ O;  1QV1 A;  1S36 A;  3B87 A;  3IVT A;  2I7A A;  3LK1 A;  1XFX O;  3CYZ A;  1QS7 A;  1L2O C;  2G9B A;  5J3X A;  3WXA A;  1XVJ A;  2WCK A;  4D1E A;  2FJU B;  3K21 A;  2OS8 C;  1WY9 A;  2MRD A;  4ORA B;  1CKK A;  1OSA A;  4QJ5 B;  4ZCV A;  3TS5 C;  1V1G A;  3EK4 A;  1M45 A;  1Y1A A;  5TNC A;  3KO0 A;  2DOQ A;  1JUO A;  3O6B A;  1X02 A;  5F6T A;  2LUC A;  1EG4 A;  1YVH A;  3SG4 A;  3TDZ A;  4BY4 A;  4PCW A;  4XJK B;  1WRK A;  1K94 A;  1XFY O;  3OB1 B;  3LK0 A;  3OP0 A;  5IBW A;  1C7V A;  1GQM A;  4INW A;  1ALW A;  5JOL A;  3S0E A;  2M7L A;  2LVI A;  4ORC B;  1QAT A;  3CAB A;  1OMD A;  2QEB A;  3O2P A;  4C0L A;  5I94 A;  2FCE A;  4WQ3 A;  4YGE B;  1C3Y A;  2FJY A;  1CM4 A;  2L98 A;  3TDU A;  3VRO A;  4OCI A;  1R6P A;  4NDB A;  1S6C A;  2JXC A;  1YUT A;  2BEC A;  4MRX A;  1TN4 A;  4MEW A;  5CSN A;  2G2B A;  1F55 A;  2SAS A;  3D74 A;  1EJ3 A;  4N5X A;  2PVB A;  1S1E A;  4HRH A;  4M2Q A;  5CSF A;  1CLL A;  2KDH A;  3LL8 B;  3K1E A;  1MUX A;  4Q04 A;  2O60 A;  1KFU S;  2EC6 B;  1JFK A;  1XFV O;  3CR2 A;  3VRP A;  1DEL A;  2ZRS A;  4AOM A;  1J1E A;  2CTN A;  2LLU A;  3DVJ A;  1NUB A;  3CZ2 A;  4CLN A;  4A4C A;  1BR1 B;  3DVM A;  2OS8 B;  1FPW A;  1SMG A;  1JSA A;  1Y1U A;  3GK2 A;  2L51 A;  2WC6 A;  1BT6 A;  1DGU A;  1XO5 A;  4MSP A;  3TS5 B;  3QME A;  5DKR A;  5FI2 A;  4UPG A;  1NP8 A;  4YRU A;  5HKY A;  3IF7 A;  3SG3 A;  3GK1 A;  1AUI B;  1J1D A;  2JU0 A;  1CDP A;  1PAL A;  1QLS A;  3KHE A;  4C0J A;  1OOG A;  2KFG A;  5CSJ A;  2BKH B;  1KQV A;  3UNW A;  4ZCU A;  1S26 D;  1OE9 B;  1BR4 B;  3O4X A;  5JJG A;  1AP4 A;  3I5F C;  4DIR A;  3B6X A;  3ICB A;  2LHI A;  3CR5 X;  3KPX A;  2M97 A;  3D78 A;  2JT0 A;  4GFT A;  1NCX A;  4N1F A;  2BBM A;  2LHL A;  4ETO A;  1IKU A;  2SCP A;  3C1V A;  1S5G Z;  3DF0 A;  3FWB A;  3HX4 A;  3M0W A;  3PN7 C;  3N7H A;  1NCY A;  2R2I A;  3FIA A;  1IGV A;  3BFH A;  1PK0 D;  2CCM A;  2GGZ A;  3I5I B;  5HL1 A;  1RJV A;  2OTG C;  2BNX A;  3JTD C;  1PVA A;  5KTY A;  5DKQ A;  2WC5 A;  1K2H A;  1F4O A;  1KQM B;  1K9K A;  2JPT A;  3NSI A;  2ZN9 A;  2CBL A;  3VB1 A;  3R72 A;  2I18 A;  3SJS A;  4L9M A;  1NSH A;  4GPL B;  3SG6 A;  1YRT B;  2F8P A;  3FE9 A;  3PSR A;  4HRG A;  2VRG A;  1DJH A;  1VRK A;  4CFQ A;  2Q4U A;  2LAP A;  2KI4 C;  1RTP 1;  3RZS A;  2BCA A;  1AJ5 A;  1M31 A;  4PDZ A;  2ZRT A;  3EVU A;  1S5G Y;  3NXA A;  1CDM A;  1S6I A;  1PVB A;  1F4Q A;  2WCL A;  3I5G B;  3L4L A;  3OB2 B;  4MZL A;  3TZ1 A;  3CR4 X;  1D1O A;  3V2L A;  1UUS A;  1YRU B;  3CZ1 A;  1JWD A;  2E30 A;  3D0Y A;  1DF0 B;  1OOF A;  1UHN A;  1BF5 A;  1C3Z A;  1B8R A;  2E6W A;  1YUU A;  2M9G A;  1QX7 A;  1DJZ A;  1SW8 A;  4CPV A;  4AQI A;  1AHR A;  1FW4 A;  1W7J B;  3UO9 A;  4IJ7 A;  3OX5 A;  1TOP A;  1LS8 A;  2KBM A;  3AAK A;  4HSZ A;  4PHJ A;  1MWN A;  1OW4 A;  4I5K A;  1TUJ A;  4OVN F;  2L2C A;  3SG2 A;  3L4A A;  4CID A;  3CTN A;  2BL0 C;  2LVJ A;  1NPQ A;  1MF8 B;  3MSE B;  1CM1 A;  4KYN A;  1FI5 A;  3CS1 A;  5EL2 A;  4ORB B;  1ZOT B;  4ICB A;  2PAS A;  3BUN B;  1IQ3 A;  3D77 A;  3FE8 A;  1JC2 A;  4F0Z B;  1RFJ A;  3PN7 B;  4CFR A;  1SL8 A;  3SIA A;  5AER A;  2P70 A;  1B1G A;  2OTG B;  5I2O A;  1HT9 A;  1OMR A;  1UHI A;  2K0J A;  2K7O A;  4JD9 A;  1QX5 B;  1LVC D;  2QDI A;  4MRY A;  1DF0 A;  1KWO B;  2KNE A;  4GGN A;  3O4Y A;  4INX A;  1T14 A;  2PRU A;  2AMI A;  3SS5 A;  3AKB A;  1DT7 B;  1JFJ A;  1NIW A;  1K93 D;  1U5I B;  1BOC A;  2QEV A;  3NSL A;  4WRI A;  1JBA A;  2F2O A;  4NQG A;  3VRR A;  2F33 A;  1LA0 A;  3WHU B;  5HLV A;  3L47 A;  2ERB A;  2GTE A;  1J55 A;  4GGF A;  2P71 A;  5D3O A;  3BQ3 A;  1PSB A;  5FI6 A;  2K7C A;  3ZNI A;  2ISD A;  2K2A A;  1TTX A;  1ALV A;  2WCJ A;  4PE1 A;  1CLM A;  3VRN A;  1DJG A;  2LV7 A;  3FS7 A;  3WNX B;  2Y1M A;  1NCZ A;  2LLS A;  1LKJ A;  2YGU A;  4NDC A;  1NX2 A;  5HKW A;  2M1U A;  5AEQ A;  3H4S E;  2BCB A;  2EGD A;  1DC1 A;  1W7I B;  1M39 A;  1P28 A;  1Z2C B;  2CXJ A;  5GQQ C;  5I2Q A;  1N2D A;  1IJ5 A;  1QXP A;  1XFW O;  2AAO A;  4FQO A;  3AKA A;  4E68 A;  4GNK B;  5AAN A;  2BL0 B;  3LCP C;  1A03 A;  1IQ5 A;  2M1K B;  1ZUZ A;  1A75 B;  1AK8 A;  1WLM A;  2WOS A;  3R1V A;  2NLN A;  4XJK A;  1CFD A;  1L2O B;  1M46 A;  3CLN A;  1RWY A;  2WCM A;  1B7T Z;  2L50 A;  1YR5 A;  2JUL A;  3EKJ A;  1SCM C;  1Y0V H;  1CMG A;  3CWG A;  1MHO A;  3PM8 A;  1GJY A;  1XK4 A;  1QVI Z;  3D10 A;  4USL A;  2O5G A;  3D75 A;  1DJX A;  1YVL A;  2KI6 D;  5HLO A;  3FE6 A;  1KFX L;  1A29 A;  1ZMZ A;  5D7F A;  5FYX A;  2LMU A;  2P6B B;  3SS4 A;  2K7D A;  2WND A;  4OZD A;  1L7Z A;  3AAJ A;  2KAX A;  3IQO A;  2MHH A;  4R1E A;  3S0B A;  4F7F A;  1UUR A;  3BOW B;  5ER5 A;  1CFC A;  1DMO A;  1YTZ C;  3TUY C;  3PAT A;  3BUX B;  2L2E A;  5CPV A;  3CZ0 A;  1MQ1 A;  5BPJ A;  3S0D A;  1NYA A;  3DYE A;  4JQ0 D;  1UHH A;  1B7T Y;  2MLF C;  2CT9 A;  1SK6 D;  1K90 D;  2ZN8 A;  3IQQ A;  1J7P A;  1H8B A;  1QVI Y;  2BE4 A;  2H2K A;  1LA3 A;  1QTX A;  2COL B;  5K89 A;  1GM0 A;  2LNK A;  2KAY A;  2Y5I A;  2K60 A;  3DZT A;  4MVF A;  3WHT B;  2KYF A;  1J7O A;  4P5O E;  2LAN A;  1B8L A;  1QIV A;  3SG7 A;  1TNX A;  1PUL A;  4GGF C;  5FI7 A;  1OOI X;  2GV5 A;  3I5H C;  1KCY A;  1DVI A;  1TIZ A;  1BMO A;  1F70 A;  1BU3 A;  2KFF A;  2K8M B;  1ODB A;  5AXI A;  4M2P A;  4YGC B;  1K9U A;  1WRL A;  1J7Q A;  2BCX A;  1AVS A;  1OMV A;  1K9P A;  1SCM B;  2KGR A;  3EKH A;  3ZWH A;  5AFP A;  3BUO B;  3FWC A;  1YUR A;  1NX1 A;  1UP5 A;  2ZKM X;  2BBN A;  2LE9 B;  1AJ4 A;  2NCP A;  2PYQ A;  2LCP A;  2M3W A;  2JNX A;  4XYN A;  4I5J A;  5I2L A;  4PHK A;  3JVT C;  1TRF A;  2MLE C;  4OV2 A;  3PAL A;  2D8N A;  1IWQ A;  3S0F A;  1LXF C;  2MA2 A;  3BXK A;  3B86 A;  2I94 A;  2KQY A;  3DVE A;  1DGV A;  1WRZ A;  1TNW A;  1H4B A;  3QRX A;  1SY9 A;  1CB1 A;  2H8V A;  2JC2 A;  3D76 A;  3I5F B;  2JZI A;  4JWQ A;  2H61 A;  2L4I A;  4MZJ A;  1PSR A;  5PAL A;  1YX7 A;  1TCF A;  1F54 A;  2NZ0 A;  1SNL A;  2MBX A;  2JT3 A;  3A4U B;  3KF9 A;  2WCF A;  1OOJ A;  1R2U A;  4YGB B;  1FF1 A;  4PHN A;  3DVK A;  1KFU L;  5ER4 X;  5G08 A;  1TUZ A;  3VGO A;  3BYA A;  2NXQ A;  2M49 B;  1REC A;  2KI6 C;  3OX6 A;  1M63 B;  1S3P A;  2LP2 A;  1TNP A;  2WCB A;  1BOD A;  3JTD B;  5CSI A;  2KYC A;  4YI9 A;  2OPO A;  2LP3 A;  1CFF A;  3GK4 X;  1FI6 A;  1SR6 C;  2ZNE A;  4PE4 A;  3SS3 A;  1KK8 C;  2Y4Q A;  2EC6 C;  1Z4H A;  1N0Y A;  4PE7 A;  1HQV A;  1SL7 A;  2KI4 B;  4FTG A;  1B47 A;  1G8I A;  3PM2 A;  1BLQ A;  3S0G A;  2CNP A;  3CDN A;  2PQL A;  1NWD A;  1F8H A;  1RK9 A;  2Y1N A;  4BY5 A;  4IL1 A;  3LLE A;  1MXE A;  2BAP A;  2WCH A;  1PRW A;  2RGI A;  1E8A A;  2WCE A;  4GBA A;  2KSP A;  4MN0 A;  1CDL A;  4NDD A;  1QJT A;  2JQ6 A;  2WOR A;  2AUC A;  3JVT B;  1B4C A;  3SG5 A;  1DJI A;  2LMV A;  1OZO A;  1EG3 A;  1CLB A;  1BG1 A;  1GGW A;  3R1P A;  3S0A A;  1A4P A;  2QAC A;  1WDC C;  3GOF A;  1DJY A;  3B88 A;  1J7R A;  2GGM A;  1DTL A;  1SYM A;  2L0P A;  2WC8 A;  4MZK A;  3TDI A;  2HQ8 A;  1CFP A;  2F2P A;  2LMT A;  1MR8 A;  1ZFS A;  2EHB A;  1DJW A;  1IJ6 A;  2JTT A;  2LVV A;  2KHN A;  2NCO A;  2QEO A;  3BUM B;  4AQJ A;  2TN4 A;  1TNQ A;  1S6J A;  4OR9 B;  1MXL C;  1KSO A;  4I5N B;  1KK7 Z;  1U5I A;  2QEH A;  4OKH A;  3NSO A;  1IG5 A;  4U8D A;  1EH2 A;  2M0R A;  1G4Y R;  2KAV A;  3CGA A;  3EVV A;  3OHM B;  1DQE A;  4JPZ B;  2K7B A;  3BUW B;  3I5I C;  4YGD B;  2KGB C;  2PMY A;  2M29 A;  3BFB A;  1B8C A;  4I5L B;  1KQM C;  2I2R E;  5KSZ A;  4WQ2 A;  2H61 C;  4M2O A;  5I8N A;  1QX2 A;  1XFU O;  2JNF A;  2LLT A;  3OBV A;  1SRA A;  1SPY A;  1Q80 A;  2M7N A;  4A4B A;  4DCK A;  5DKN A;  1SR6 B;  1KK8 B;  3DD4 A;  4TNC A;  2KLD A;  4PHM A;  1SL9 A;  3EVR A;  5D69 A;  1CDN A;  1XA5 A;  3DF0 B;  3BFA A;  3PJI A;  1QIW A;  1TCO B;  1IH0 A;  2K2F A;  1KK7 Y;  3OGN A;  4FQT A;  1NX0 A;  2L4H A;  3EK7 A;  3I5G C;  3F45 A;  2JPO A;  1EXR A;  2HF5 A;  2JRF A;  5B8I B;  5KU1 A;  1C07 A;  2L5X B;  2FCD A;  1BJF A;  2KQ6 A;  4N1G A;  1A75 A;  2ZFD A;  4DRW A;  1OOH A;  1TWO A;  1FBV A;  1A2X A;  2MAZ A;  2Q91 A;  2PSR A;  4MLW A;  4YI8 A;  3B7A A;  3SIB A;  1B9A A;  2LM5 A;  2HET A;  2ZND A;  2B1U A;  2JTZ A;  5DIC A;  2F3Y A;  5HYD A;  2FOT A;  1UHJ A;  3DY9 A;  2V53 A;  1CTR A;  3HCM A;  3NGV A;  2KFH A;  2JWW A;  2K61 A;  5HKZ A;  1LIN A;  1WDC B;  4C0K A;  2F3Z A;  3BJH A;  3PFV A;  1W9Z A;  2MJW B;  2HPS A;  1K8U A;  1DEK A;  1UWO A;  1G33 A;  3D0Y B;  1OQP A;  3RLZ A;  4DS7 A;  2KPH A;  1YX8 A;  2BE6 A;  3EK8 A;  1XYD A;  3BOW A;  1QAS A;  1SKT A;  4DUQ A;  3R1O A;  1XFR A;  1QLK A;  1SSE B;  2M8U A;  1SCV A;  1IRJ A; 
#chains in the Genus database with same CATH homology
 1EL4 A;  4QJ3 B;  1V1F A;  4GUK A;  1Y6W A;  4MBE A;  2KBI A;  3O78 A;  2IS9 A;  4PAL A;  1JF0 A;  1KWO C;  1CNP A;  1C7W A;  4PE0 A;  1Y1X A;  1QV0 A;  3E3R A;  1JF2 A;  3TUY B;  4GAO A;  3CZT X;  3KEV A;  1XK4 C;  4YBH B;  1OZS A;  1K96 A;  3PLF B;  2A4J A;  2LUX A;  1KSM A;  1NX3 A;  2JXL A;  2KOT A;  1KFX S;  1WLZ A;  2BKI B;  1CMF A;  1UHK A;  4QJ4 B;  2LVK A;  4YGA A;  1K95 A;  1N65 A;  2LC5 A;  1YUS A;  4HRE E;  3RM1 A;  2HQW A;  1RRO A;  2PAL A;  2JOJ A;  3VRQ A;  1ZAC A;  1SBJ A;  2QPT A;  3A8R A;  3I5H B;  1GGZ A;  3NSK A;  2JT8 A;  4P2Y B;  1F71 A;  1XFZ O;  1QV1 A;  1S36 A;  2I7A A;  3LK1 A;  1XFX O;  3WXA A;  1QS7 A;  1L2O C;  2G9B A;  5J3X A;  1XVJ A;  4D1E A;  2FJU B;  3K21 A;  2OS8 C;  1WY9 A;  2MRD A;  4ORA B;  1CKK A;  1OSA A;  4QJ5 B;  4ZCV A;  3TS5 C;  1V1G A;  3EK4 A;  1M45 A;  1Y1A A;  5TNC A;  3KO0 A;  2DOQ A;  1JUO A;  3O6B A;  1X02 A;  5F6T A;  2LUC A;  1EG4 A;  1YVH A;  3SG4 A;  3TDZ A;  4BY4 A;  4PCW A;  4XJK B;  1WRK A;  1K94 A;  1XFY O;  3OB1 B;  3LK0 A;  3OP0 A;  5IBW A;  1C7V A;  1GQM A;  1ALW A;  5JOL A;  2M7L A;  2LVI A;  4ORC B;  1QAT A;  1OMD A;  3O2P A;  4C0L A;  2FCE A;  4WQ3 A;  4YGE B;  1CM4 A;  2L98 A;  3TDU A;  3VRO A;  4OCI A;  1R6P A;  4NDB A;  1S6C A;  2JXC A;  1YUT A;  2BEC A;  4MRX A;  1TN4 A;  4MEW A;  5CSN A;  2G2B A;  1F55 A;  2SAS A;  4N5X A;  1EJ3 A;  2PVB A;  1S1E A;  4HRH A;  4M2Q A;  5CSF A;  1CLL A;  2KDH A;  3LL8 B;  1MUX A;  4Q04 A;  2O60 A;  1KFU S;  2EC6 B;  1JFK A;  1XFV O;  3CR2 A;  3VRP A;  2ZRS A;  4AOM A;  1J1E A;  2CTN A;  2LLU A;  3DVJ A;  1NUB A;  4CLN A;  4A4C A;  1BR1 B;  3DVM A;  2OS8 B;  1FPW A;  1SMG A;  1JSA A;  1Y1U A;  3GK2 A;  2L51 A;  1BT6 A;  1DGU A;  1XO5 A;  4MSP A;  3TS5 B;  5DKR A;  4UPG A;  1NP8 A;  4YRU A;  5HKY A;  3IF7 A;  3SG3 A;  3GK1 A;  1AUI B;  1J1D A;  2JU0 A;  1CDP A;  1PAL A;  1QLS A;  3KHE A;  4C0J A;  2KFG A;  5CSJ A;  2BKH B;  1KQV A;  4ZCU A;  1S26 D;  1OE9 B;  1BR4 B;  5JJG A;  1AP4 A;  3I5F C;  4DIR A;  3ICB A;  2LHI A;  3CR5 X;  3KPX A;  2M97 A;  4N1F A;  2JT0 A;  4GFT A;  1NCX A;  2BBM A;  2LHL A;  4ETO A;  1IKU A;  2SCP A;  3C1V A;  1S5G Z;  3DF0 A;  3FWB A;  3HX4 A;  3M0W A;  3PN7 C;  1NCY A;  2R2I A;  3FIA A;  1IGV A;  1PK0 D;  2CCM A;  2GGZ A;  3I5I B;  1RJV A;  2OTG C;  3JTD C;  1PVA A;  5KTY A;  5DKQ A;  1K2H A;  1F4O A;  1KQM B;  1K9K A;  2JPT A;  3NSI A;  2ZN9 A;  2CBL A;  2I18 A;  3SJS A;  4L9M A;  1NSH A;  4GPL B;  3SG6 A;  1YRT B;  2F8P A;  3PSR A;  4HRG A;  2VRG A;  1DJH A;  1VRK A;  4CFQ A;  2Q4U A;  2LAP A;  2KI4 C;  1RTP 1;  2BCA A;  1AJ5 A;  1M31 A;  4PDZ A;  2ZRT A;  3EVU A;  1S5G Y;  3NXA A;  1CDM A;  1S6I A;  1PVB A;  1F4Q A;  3I5G B;  3OB2 B;  4MZL A;  3TZ1 A;  3CR4 X;  1D1O A;  1UUS A;  1YRU B;  1JWD A;  2E30 A;  3D0Y A;  1DF0 B;  1UHN A;  1BF5 A;  1B8R A;  2E6W A;  1YUU A;  2M9G A;  1QX7 A;  1DJZ A;  1SW8 A;  4CPV A;  4AQI A;  1AHR A;  1FW4 A;  1W7J B;  3OX5 A;  1TOP A;  3AAK A;  2KBM A;  4HSZ A;  4PHJ A;  1MWN A;  4I5K A;  4OVN F;  3SG2 A;  4CID A;  3CTN A;  2BL0 C;  2LVJ A;  1NPQ A;  1MF8 B;  3MSE B;  1CM1 A;  1FI5 A;  3CS1 A;  4ORB B;  1ZOT B;  4ICB A;  2PAS A;  3BUN B;  1IQ3 A;  1JC2 A;  4F0Z B;  1RFJ A;  3PN7 B;  4CFR A;  1SL8 A;  3SIA A;  5AER A;  1B1G A;  2OTG B;  5I2O A;  1HT9 A;  1OMR A;  1UHI A;  2K0J A;  2K7O A;  1QX5 B;  1LVC D;  4MRY A;  1DF0 A;  1KWO B;  2KNE A;  4GGN A;  3O4Y A;  2PRU A;  2AMI A;  3AKB A;  1DT7 B;  1JFJ A;  1NIW A;  1K93 D;  1U5I B;  1BOC A;  3NSL A;  4WRI A;  1JBA A;  2F2O A;  4NQG A;  3VRR A;  2F33 A;  1LA0 A;  3WHU B;  5HLV A;  4GGF A;  1J55 A;  3BQ3 A;  1PSB A;  2K7C A;  3ZNI A;  2ISD A;  2K2A A;  1TTX A;  1ALV A;  4PE1 A;  1CLM A;  3VRN A;  1DJG A;  2LV7 A;  3FS7 A;  3WNX B;  2Y1M A;  1NCZ A;  2LLS A;  1LKJ A;  4NDC A;  1NX2 A;  5HKW A;  2M1U A;  5AEQ A;  3H4S E;  2BCB A;  2EGD A;  1W7I B;  1M39 A;  2CXJ A;  5I2Q A;  5GQQ C;  1N2D A;  1IJ5 A;  1QXP A;  1XFW O;  2AAO A;  4FQO A;  3AKA A;  4E68 A;  4GNK B;  5AAN A;  2BL0 B;  3LCP C;  1A03 A;  1IQ5 A;  2M1K B;  1ZUZ A;  1A75 B;  1AK8 A;  1WLM A;  2WOS A;  4XJK A;  2NLN A;  1CFD A;  1L2O B;  1M46 A;  3CLN A;  1RWY A;  1KCY A;  1B7T Z;  2L50 A;  1YR5 A;  2JUL A;  3EKJ A;  1SCM C;  1Y0V H;  1CMG A;  3CWG A;  1MHO A;  3PM8 A;  1GJY A;  1XK4 A;  1QVI Z;  3D10 A;  4USL A;  2O5G A;  1DJX A;  1YVL A;  2KI6 D;  5HLO A;  1KFX L;  1A29 A;  1ZMZ A;  5D7F A;  5FYX A;  2LMU A;  2P6B B;  2K7D A;  2WND A;  1L7Z A;  3AAJ A;  2KAX A;  3IQO A;  2MHH A;  4R1E A;  1CFC A;  1UUR A;  3BOW B;  5ER5 A;  1DMO A;  1YTZ C;  3TUY C;  3PAT A;  3BUX B;  2L2E A;  5CPV A;  1MQ1 A;  5BPJ A;  1NYA A;  4JQ0 D;  1UHH A;  1B7T Y;  2MLF C;  2CT9 A;  1SK6 D;  1K90 D;  2ZN8 A;  3IQQ A;  1J7P A;  1H8B A;  1QVI Y;  2BE4 A;  2H2K A;  1LA3 A;  1QTX A;  2COL B;  5K89 A;  2LNK A;  2KAY A;  2Y5I A;  4MVF A;  3WHT B;  2KYF A;  1J7O A;  4P5O E;  2LAN A;  1B8L A;  1QIV A;  3SG7 A;  1TNX A;  1PUL A;  4GGF C;  2GV5 A;  3I5H C;  1DVI A;  1TIZ A;  1BMO A;  1F70 A;  1BU3 A;  2KFF A;  2K8M B;  1ODB A;  5AXI A;  4M2P A;  4YGC B;  1K9U A;  1WRL A;  1J7Q A;  2BCX A;  1AVS A;  1OMV A;  1K9P A;  1SCM B;  2KGR A;  3EKH A;  3ZWH A;  5AFP A;  3BUO B;  3FWC A;  1YUR A;  1NX1 A;  1UP5 A;  2ZKM X;  2BBN A;  2LE9 B;  1AJ4 A;  2NCP A;  2LCP A;  2M3W A;  2JNX A;  4XYN A;  4I5J A;  5I2L A;  4PHK A;  3JVT C;  1TRF A;  2MLE C;  4OV2 A;  3PAL A;  2D8N A;  1IWQ A;  1LXF C;  2MA2 A;  3BXK A;  2I94 A;  2KQY A;  3DVE A;  1DGV A;  1WRZ A;  1TNW A;  1H4B A;  3QRX A;  1SY9 A;  1CB1 A;  2JC2 A;  3I5F B;  2JZI A;  4JWQ A;  2H61 A;  2L4I A;  4MZJ A;  1PSR A;  5PAL A;  1YX7 A;  1TCF A;  1F54 A;  2NZ0 A;  1SNL A;  2MBX A;  2JT3 A;  3A4U B;  3KF9 A;  2WCF A;  1OOJ A;  1R2U A;  4YGB B;  1FF1 A;  4PHN A;  3DVK A;  1KFU L;  5ER4 X;  5G08 A;  3VGO A;  3BYA A;  2NXQ A;  2M49 B;  1REC A;  2KI6 C;  3OX6 A;  1M63 B;  1S3P A;  2LP2 A;  1TNP A;  2WCB A;  1BOD A;  3JTD B;  5CSI A;  2KYC A;  4YI9 A;  2OPO A;  2LP3 A;  1CFF A;  3GK4 X;  1FI6 A;  1SR6 C;  2ZNE A;  4PE4 A;  1KK8 C;  2Y4Q A;  2EC6 C;  1N0Y A;  4PE7 A;  1HQV A;  1SL7 A;  2KI4 B;  4FTG A;  1B47 A;  1G8I A;  1BLQ A;  2CNP A;  1F8H A;  1NWD A;  1RK9 A;  2Y1N A;  4BY5 A;  4IL1 A;  3LLE A;  1MXE A;  1PRW A;  2RGI A;  1E8A A;  2WCE A;  4GBA A;  2KSP A;  4MN0 A;  1CDL A;  4NDD A;  1QJT A;  2JQ6 A;  2WOR A;  2AUC A;  3JVT B;  1B4C A;  3SG5 A;  1DJI A;  2LMV A;  1OZO A;  1EG3 A;  1CLB A;  1BG1 A;  1GGW A;  1A4P A;  2QAC A;  1WDC C;  1DJY A;  1J7R A;  2GGM A;  1DTL A;  1SYM A;  2L0P A;  2WC8 A;  4MZK A;  3TDI A;  2HQ8 A;  1CFP A;  2F2P A;  2LMT A;  1MR8 A;  1ZFS A;  2EHB A;  1DJW A;  1IJ6 A;  2JTT A;  2LVV A;  2KHN A;  2NCO A;  3GOF A;  3BUM B;  4AQJ A;  2TN4 A;  1TNQ A;  1S6J A;  4OR9 B;  1MXL C;  1KSO A;  4I5N B;  1KK7 Z;  1U5I A;  4OKH A;  3NSO A;  1IG5 A;  4U8D A;  1EH2 A;  2M0R A;  1G4Y R;  2KAV A;  3CGA A;  3EVV A;  3OHM B;  4JPZ B;  2K7B A;  3BUW B;  3I5I C;  4YGD B;  2KGB C;  2PMY A;  2M29 A;  1B8C A;  4I5L B;  1KQM C;  2I2R E;  5KSZ A;  4WQ2 A;  2H61 C;  4M2O A;  5I8N A;  1QX2 A;  1XFU O;  2JNF A;  2LLT A;  1SRA A;  1SPY A;  1Q80 A;  2M7N A;  4A4B A;  4DCK A;  5DKN A;  1SR6 B;  1KK8 B;  3DD4 A;  4TNC A;  4PHM A;  1SL9 A;  3EVR A;  5D69 A;  1CDN A;  1XA5 A;  3DF0 B;  1QIW A;  1TCO B;  1IH0 A;  2K2F A;  1KK7 Y;  1NX0 A;  2L4H A;  3EK7 A;  3I5G C;  3F45 A;  1EXR A;  2HF5 A;  2JRF A;  5B8I B;  5KU1 A;  1C07 A;  2L5X B;  2FCD A;  1BJF A;  2KQ6 A;  4N1G A;  1A75 A;  2ZFD A;  4DRW A;  2Q91 A;  1FBV A;  1A2X A;  2MAZ A;  4MLW A;  2PSR A;  4YI8 A;  3SIB A;  1B9A A;  2LM5 A;  2HET A;  2ZND A;  2B1U A;  2JTZ A;  5HYD A;  2F3Y A;  2FOT A;  1UHJ A;  2V53 A;  1CTR A;  3HCM A;  2KFH A;  2JWW A;  2K61 A;  5HKZ A;  1LIN A;  1WDC B;  4C0K A;  2F3Z A;  3PFV A;  2MJW B;  2HPS A;  1K8U A;  1UWO A;  1G33 A;  3D0Y B;  1OQP A;  3RLZ A;  4DS7 A;  1YX8 A;  2BE6 A;  3EK8 A;  1XYD A;  3BOW A;  1QAS A;  1SKT A;  4DUQ A;  1QLK A;  2M8U A;  1SCV A;  1IRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...