3PN7B

Visualizing new hinges and a potential major source of compliance in the lever arm of myosin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
RLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Myosin heavy chain
publication title Visualizing key hinges and a potential major source of compliance in the lever arm of myosin.
pubmed doi rcsb
total genus 44
structure length 141
sequence length 141
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7B01
2CTNA 1TNXA 1YVLA 2HQWA 2JTTA 1WRKA 1YUSA 2K7OA 5BPJA 1IWQA 1BU3A 2JTZA 2KYCA 2ZNDA 3CZTX 3TDUA 1BMOA 4PE0A 2R2IA 3NSIA 2JT3A 1NYAA 4QJ3B 1SL8A 3KHEA 3CGAA 1GGZA 2H61C 1NX2A 1DJXA 4MBEA 1J7PA 2EC6C 4MSPA 1RJVA 3JVTC 1DMOA 1QASA 1CM1A 2H61A 4CIDA 2WORA 2LLSA 4WQ3A 2KNEA 1C07A 1M45A 3KF9A 1R6PA 3I5GC 4R1EA 3IF7A 5HLOA 3KPXA 3H4SE 2PVBA 1DGVA 1QV0A 1F71A 1DJIA 1RTP1 4DCKA 1LA0A 3SJSA 2LMVA 3BXKA 2LM5A 1BODA 2BBNA 3LK0A 1A4PA 1QJTA 2WCFA 2KHNA 3BUWB 1LINA 1Y6WA 1K93D 4PHKA 2M7LA 1CM4A 2G2BA 3I5IB 4I5JA 1VRKA 1QTXA 2MLFC 2DOQA 4D1EA 1DTLA 3M0WA 4QJ5B 1N2DA 4NDDA 3CR2A 3PLFB 1FI6A 1CFDA 1QX5B 1UHJA 1C7VA 1AJ5A 1KQVA 2EHBA 5PALA 2WOSA 2KDHA 4ORCB 4PE7A 1AUIB 2L5XB 3I5FC 5AANA 1YUTA 2WCEA 4GBAA 5G08A 2K7CA 3EKJA 3IQOA 4IL1A 3BUNB 3VRRA 2LUXA 4YI9A 1K9PA 2M7NA 3O78A 2COLB 1D1OA 2L51A 1CMGA 4MZKA 1TRFA 1J1DA 2LV7A 3PN7B 1AK8A 3TDZA 5CPVA 2F2PA 3CLNA 2LVIA 3NSLA 1CMFA 4YGBB 3O2PA 1OQPA 4USLA 1F54A 4Q04A 1B8RA 1NIWA 2LHLA 4GAOA 1NUBA 2KGBC 1M39A 2LP3A 2LMUA 2L50A 1TNQA 5DKNA 3OX6A 2E30A 2OTGB 1DGUA 5AXIA 3ZNIA 1R2UA 1FBVA 4YGCB 1YTZC 2FCEA 4N1GA 3FWBA 1SMGA 2Y5IA 3SG6A 1K2HA 4PE4A 4BY4A 3GOFA 1G33A 5B8IB 2P6BB 3RLZA 2KFHA 4OCIA 2RGIA 5GQQC 1UUSA 3MSEB 1CDPA 1OMDA 1TNPA 2LE9B 4F0ZB 3DVJA 1BF5A 1U5IB 1V1GA 1KQMB 5IBWA 3TDIA 1A2XA 3WXAA 2BECA 2LCPA 2F8PA 4YGAA 1QV1A 1KWOC 1S5GY 5TNCA 1RECA 1JWDA 1TCFA 4ETOA 1QXPA 1S26D 5I2LA 1G8IA 5JJGA 1TN4A 2M29A 2O60A 1SY9A 1MUXA 5CSJA 2E6WA 1L2OC 1Q80A 4PHMA 1JBAA 3O4YA 2MBXA 4L9MA 1WRLA 1JC2A 1B7TY 4OV2A 1EH2A 2CNPA 2HPSA 3DVMA 1S1EA 1BR4B 4MZJA 4WQ2A 3AAJA 1YX8A 1XFVO 1CFCA 2EC6B 3JVTB 2MJWB 1SW8A 1Y1XA 3VROA 2JXLA 1QX7A 1J7QA 1YX7A 2L4IA 1IH0A 2M49B 1S6IA 1F8HA 4PE1A 1XK4C 4AOMA 1JFKA 3I5GB 2KFGA 1EG3A 1FI5A 1S36A 2L2EA 4ICBA 1DF0B 1MXLC 1BOCA 1XYDA 1ALVA 3RM1A 3AKAA 1F4OA 4PHNA 1CB1A 4DS7A 1Y1UA 1MHOA 1SCVA 2ZN8A 1NPQA 2LAPA 1SR6C 2CBLA 4GGFC 1YVHA 3A4UB 2IS9A 3GK4X 5FYXA 1SKTA 2MLEC 2PALA 5DKQA 2BL0C 1IKUA 2ZFDA 1DF0A 1QX2A 4GGFA 4AQIA 1TTXA 4FTGA 3BUXB 1UP5A 1ZMZA 1BR1B 3VRPA 4XYNA 3TS5C 3QRXA 1GGWA 2V53A 1QATA 2WCBA 1DJZA 1AJ4A 5I2QA 1NP8A 1XFUO 1TCOB 1YURA 1JF2A 1JUOA 1K95A 2LC5A 1M63B 1A29A 1IRJA 1DVIA 1DJGA 3I5FB 1YRUB 3OHMB 2G9BA 1UHKA 1QLKA 4N5XA 2Y1MA 1AP4A 2LLUA 1B4CA 3GK1A 3BUOB 3EVRA 3ZWHA 2EGDA 5KSZA 4GGNA 4CFQA 1FF1A 2B1UA 1EXRA 1YR5A 2BE4A 5ER4X 5AEQA 1SCMC 2Q91A 2JPTA 3CS1A 1BT6A 3SG3A 3KEVA 3FIAA 2HQ8A 1CFPA 2I18A 1BLQA 1SRAA 3SG5A 1AHRA 1X02A 1QVIZ 2L0PA 3CR4X 5D69A 4HRGA 1A75B 2NCPA 1PALA 2JOJA 1J7RA 2HETA 1KK8C 4MEWA 1CKKA 1XA5A 1K90D 1EL4A 2JRFA 4YGEB 2KYFA 3BQ3A 1S5GZ 2FJUB 1PSBA 2L98A 1ODBA 2BE6A 1KSOA 1PK0D 1S6CA 2F33A 4C0KA 1XFYO 1DJWA 4YI8A 1IJ5A 3SIBA 1B8LA 1MR8A 4ORAB 2I2RE 1A75A 2PMYA 4PHJA 1FW4A 5K89A 2BBMA 3F45A 2LHIA 3VGOA 4GFTA 2KAXA 2K8MB 1PRWA 1NX1A 2OS8C 3SIAA 3VRNA 1K9UA 5DKRA 3I5HC 1EJ3A 1K8UA 2ZNEA 3D0YB 1KK7Z 1LVCD 4ZCUA 5AFPA 2KQ6A 3TUYC 1TOPA 1PSRA 2JNXA 1HT9A 3A8RA 3HCMA 2LP2A 3DVEA 1RK9A 3PATA 2ZKMX 2JT0A 5HKWA 1CLMA 1KWOB 4DUQA 1OMRA 3LLEA 2LANA 1KFUL 1NX3A 1IQ5A 1GQMA 1KFXL 1JSAA 3D0YA 2ZN9A 5CSNA 1RFJA 3KO0A 2SASA 2JULA 4GUKA 1N0YA 1B47A 1TIZA 1TNWA 3WHUB 4CFRA 1B1GA 2KI4C 5AERA 1L2OB 2Y4QA 1K96A 1SYMA 4JPZB 5ER5A 1NWDA 5JOLA 2BKIB 2GGZA 1OZSA 4I5NB 5KU1A 2AMIA 2PASA 1M31A 2CXJA 3CWGA 1XO5A 2LVKA 2LVVA 2LUCA 1ZFSA 3WHTB 2PSRA 4WRIA 1SL7A 1FPWA 3BYAA 3PFVA 1UHIA 4QJ4B 3NSOA 2K2AA 4MRXA 2BCAA 2KOTA 2K2FA 4U8DA 2JZIA 1CLLA 2K61A 1QIWA 3K21A 5HKZA 4C0LA 3SG7A 3TZ1A 4HSZA 2JXCA 4ORBB 4HRHA 2K7DA 2JU0A 4A4CA 5HLVA 1SR6B 4MLWA 4GPLB 2JNFA 5I8NA 3EK7A 2K7BA 1QS7A 1XK4A 2BL0B 3EK8A 1JFJA 2WNDA 3AAKA 1F70A 2KSPA 2F2OA 2MHHA 2BKHB 3AKBA 3JTDC 4OVNF 1G4YR 2KBMA 2NCOA 1H8BA 2SCPA 4M2OA 1J55A 1NSHA 3LCPC 4I5LB 3SG2A 1H4BA 3FS7A 4YBHB 1QLSA 4MN0A 4YRUA 2M8UA 3PM8A 1C7WA 3TS5B 1CFFA 4GNKB 1BG1A 1SL9A 1CDNA 1F55A 1SK6D 1NCXA 1OE9B 2HF5A 2KAVA 4PDZA 1DJYA 1NCZA 4XJKB 2TN4A 2JWWA 2M0RA 4YGDB 1S6JA 1DJHA 1CTRA 5HYDA 1IGVA 1LA3A 1PVBA 4E68A 2F3ZA 3OP0A 2I94A 1GJYA 4P5OE 3E3RA 4CLNA 3NSKA 1A03A 1MXEA 5KTYA 2CCMA 1V1FA 5CSIA 4OR9B 2L4HA 1KFUS 3C1VA 3LK1A 2M9GA 4XJKA 2KAYA 1KFXS 1SCMB 4NDCA 2LVJA 3EVVA 4FQOA 1IG5A 3EVUA 5F6TA 1CDLA 2NZ0A 1UURA 1XFZO 2AAOA 2ZRSA 1MQ1A 1YRTB 1UWOA 1WY9A 2QACA 3ICBA 4PALA 1KK8B 2KI6D 3FWCA 1QIVA 2QPTA 2M3WA 1IQ3A 1LKJA 5CSFA 3DF0B 2CT9A 2FCDA 2VRGA 3I5IC 4UPGA 1JF0A 1F4QA 1OSAA 1SNLA 5I2OA 3WNXB 3OB1B 3SG4A 4ZCVA 1WDCB 2KGRA 2OS8B 1K9KA 1HQVA 1OZOA 3I5HB 4OKHA 1YUUA 1RROA 3DF0A 1J7OA 2Y1NA 2WC8A 1WDCC 1XFWO 3TUYB 3HX4A 2GV5A 1XFXO 1NX0A 4MZLA 1B7TZ 2JT8A 1OOJA 3EK4A 5HKYA 4I5KA 3PALA 2AUCA 4AQJA 2LLTA 3EKHA 3PN7C 4BY5A 4DRWA 1EG4A 2I7AA 2PRUA 1IJ6A 1SPYA 4PCWA 4P2YB 2KI4B 2A4JA 2H2KA 2KFFA 1OMVA 2O5GA 2JC2A 4JQ0D 2KBIA 3D10A 4A4BA 3DD4A 1ZOTB 1NCYA 4NQGA 1M46A 1SBJA 2Q4UA 2D8NA 1J1EA 2OPOA 2OTGC 3OX5A 2KQYA 3PSRA 5D7FA 2F3YA 1AVSA 3BOWB 4DIRA 4M2QA 2JQ6A 1CLBA 2KI6C 1S3PA 1BJFA 3BUMB 1WRZA 1PVAA 4N1FA 1ZUZA 1PULA 3DVKA 1MF8B 2LNKA 2M97A 1QVIY 1N65A 2ZRTA 2MAZA 1UHNA 3LL8B 4M2PA 1WLZA 5J3XA 1XVJA 1CDMA 3BOWA 2MA2A 4C0JA 1MWNA 1Y0VH 3CTNA 1L7ZA 1KQMC 1ZACA 1K94A 3GK2A 3O6BA 2FOTA 2LMTA 1B8CA 1WLMA 2BCBA 1DT7B 4NDBA 1U5IA 2M1UA 1ALWA 3OB2B 1LXFC 2NXQA 1CNPA 2GGMA 4HREE 1Y1AA 4MRYA 1RWYA 4MVFA 2ISDA 4CPVA 1UHHA 4JWQA 3VRQA 3JTDB 2NLNA 4TNCA 1KSMA 1E8AA 2K0JA 1W7IB 3NXAA 2BCXA 2M1KB 1KCYA 3IQQA 3CR5X 1B9AA 1W7JB 1KK7Y 2MRDA
chains in the Genus database with same CATH superfamily
2CTNA 1TNXA 1YVLA 2HQWA 2JTTA 2WC5A 1WRKA 1YUSA 1DQEA 2K7OA 5BPJA 3FE9A 1IWQA 1BU3A 2JTZA 2KYCA 2ZNDA 3CZTX 3TDUA 1BMOA 4PE0A 2R2IA 3NSIA 2JT3A 1NYAA 4QJ3B 3CZ0A 1SL8A 3KHEA 3CGAA 1GGZA 2H61C 1NX2A 1DJXA 3IVTA 4MBEA 1J7PA 2EC6C 4MSPA 1RJVA 3JVTC 1DMOA 1QASA 1CM1A 2H61A 4CIDA 2WORA 2LLSA 3CZ2A 4WQ3A 2KNEA 1C07A 1M45A 3KF9A 1QWVA 1R6PA 3I5GC 4R1EA 2GTEA 3IF7A 5HLOA 3B6XA 3KPXA 3H4SE 1W9ZA 2PVBA 1DGVA 3UO9A 1QV0A 1F71A 1DJIA 1RTP1 3L4AA 3NHTA 4DCKA 1TWOA 1LA0A 3SJSA 2LMVA 3BXKA 2LM5A 1BODA 2BBNA 3LK0A 1A4PA 1QJTA 2WCFA 2KHNA 3D74A 3BUWB 1LINA 1Y6WA 1K93D 4PHKA 2M7LA 1CM4A 3VB1A 2G2BA 3I5IB 4I5JA 1VRKA 1QTXA 2MLFC 2DOQA 4D1EA 1OOGA 2KPHA 1DC1A 1DTLA 3M0WA 4QJ5B 1N2DA 4NDDA 3CR2A 3PLFB 1FI6A 1CFDA 1QX5B 1UHJA 1C7VA 1AJ5A 1KQVA 2EHBA 5PALA 2WOSA 2KDHA 1OOIX 4ORCB 4PE7A 1AUIB 2L5XB 2YGUA 3I5FC 5AANA 1YUTA 2WCEA 4GBAA 5G08A 2K7CA 4PT1A 3EKJA 3IQOA 4IL1A 3BUNB 3VRRA 2LUXA 4YI9A 1K9PA 2M7NA 3O78A 2COLB 1D1OA 2QEHA 2L51A 1CMGA 4MZKA 1TRFA 1J1DA 2LV7A 3PN7B 1AK8A 2H8VA 3TDZA 3QMEA 5CPVA 3SS5A 2F2PA 3B7AA 3CLNA 2LVIA 3NSLA 1CMFA 4YGBB 3O2PA 1OQPA 4USLA 1F54A 4Q04A 1B8RA 1NIWA 2LHLA 4GAOA 1NUBA 2KGBC 1M39A 2LP3A 2LMUA 2L50A 1TNQA 5DKNA 3OX6A 2E30A 2OTGB 1DGUA 5AXIA 3ZNIA 3S0EA 1R2UA 1FBVA 3B86A 3D78A 4YGCB 1YTZC 2FCEA 3D77A 4N1GA 3FWBA 1SMGA 2Y5IA 3DY9A 3SG6A 1K2HA 4PE4A 4BY4A 3GOFA 1G33A 5B8IB 2P6BB 3RLZA 2KFHA 4OCIA 2RGIA 5GQQC 1UUSA 3MSEB 1CDPA 1OMDA 1Z2CB 1TNPA 3DXLA 2LE9B 4F0ZB 3PJIA 3DVJA 1BF5A 1U5IB 1V1GA 1KQMB 5IBWA 3NHIA 3TDIA 1A2XA 3WXAA 2BECA 2LCPA 3DZTA 4INWA 2F8PA 4YGAA 1QV1A 3CABA 1KWOC 4JD9A 3S0FA 1S5GY 2KLDA 5TNCA 1RECA 3RZSA 1JWDA 1TCFA 4ETOA 1QXPA 1S26D 5I2LA 1G8IA 5JJGA 1TN4A 2M29A 2O60A 3D73A 1SY9A 1MUXA 1OW4A 1C3YA 3B88A 4KYNA 5CSJA 2E6WA 1L2OC 1Q80A 4PHMA 1JBAA 3O4YA 2MBXA 4L9MA 1WRLA 3R1PA 1JC2A 1B7TY 4OV2A 1ORGA 1EH2A 2CNPA 2HPSA 5EL2A 3DVMA 1S1EA 1BR4B 4MZJA 4WQ2A 3AAJA 1YX8A 1XFVO 1CFCA 3S0BA 2EC6B 3JVTB 2MJWB 1SW8A 1Y1XA 3VROA 2JXLA 1QX7A 3V2LA 1YX7A 2L4IA 1J7QA 1IH0A 2M49B 3CYZA 1S6IA 1F8HA 4PE1A 1XK4C 4AOMA 1JFKA 3I5GB 2KFGA 1EG3A 1FI5A 1S36A 2L2EA 4ICBA 1DF0B 1MXLC 5DICA 1BOCA 1XYDA 1ALVA 3RM1A 3AKAA 1F4OA 4PHNA 1IIOA 1CB1A 4DS7A 1Y1UA 1MHOA 1SCVA 2ZN8A 1NPQA 2LAPA 1SR6C 2CBLA 1LS8A 4GGFC 1YVHA 3A4UB 2IS9A 3GK4X 5FYXA 1SKTA 2MLEC 2PALA 5DKQA 2BL0C 1IKUA 2ZFDA 1P28A 1DF0A 3O4XA 4JKTA 1QX2A 4GGFA 4AQIA 1TTXA 4FTGA 3BUXB 1UP5A 1ZMZA 1BR1B 2BNXA 3VRPA 4XYNA 3TS5C 3QRXA 5FI7A 2V53A 1QATA 1GGWA 2WCBA 1DJZA 1AJ4A 5I2QA 1NP8A 1XFUO 1TCOB 1YURA 1JF2A 1JUOA 1Z4HA 1K95A 2LC5A 1M63B 1A29A 1IRJA 1DVIA 1DJGA 3I5FB 3R1OA 1YRUB 3OHMB 2QEOA 3OBVA 4FQTA 2G9BA 1UHKA 1QLKA 4N5XA 4OZDA 2Y1MA 1AP4A 2LLUA 1B4CA 3BFBA 3GK1A 3BUOB 3EVRA 3ZWHA 2EGDA 5KSZA 3BFAA 4GGNA 4CFQA 1GM0A 1FF1A 2B1UA 1EXRA 1YR5A 2BE4A 5ER4X 5AEQA 1SCMC 2Q91A 2JPTA 3CS1A 1BT6A 3SG3A 3KEVA 2WC6A 3FIAA 2HQ8A 1CFPA 2I18A 1BLQA 1SRAA 3SG5A 1AHRA 1X02A 1QVIZ 2FJYA 2L0PA 5FI6A 3CR4X 3OGNA 5D69A 4HRGA 1A75B 2NCPA 1PALA 2WCLA 2JOJA 1J7RA 2HETA 1KK8C 4MEWA 1CKKA 1XA5A 1K90D 1EL4A 2JRFA 4YGEB 2KYFA 1T14A 3BQ3A 1S5GZ 2FJUB 1PSBA 2L98A 1ODBA 2BE6A 1KSOA 1PK0D 1S6CA 2F33A 4C0KA 1XFYO 1DJWA 4YI8A 1IJ5A 3SIBA 1B8LA 1MR8A 4ORAB 2I2RE 1A75A 2P71A 2PMYA 3S0AA 4PHJA 1FW4A 5K89A 2BBMA 3B87A 3F45A 2LHIA 3VGOA 4GFTA 2KAXA 2K8MB 1PRWA 1NX1A 2OS8C 3SIAA 2L2CA 3VRNA 1K9UA 5DKRA 3I5HC 1EJ3A 1K8UA 2ZNEA 3D0YB 1KK7Z 1LVCD 3CZ1A 3D75A 3PM2A 4ZCUA 5AFPA 2KQ6A 3TUYC 1SSEB 1TOPA 1PSRA 2JNXA 1HT9A 2PYQA 3A8RA 3BFHA 3HCMA 2LP2A 3DVEA 5HL1A 1RK9A 3PATA 2ZKMX 2JT0A 3NGVA 5HKWA 1CLMA 1KWOB 2QEBA 4DUQA 1OMRA 3LLEA 2LANA 1KFUL 1NX3A 1IQ5A 3DYEA 1GQMA 1KFXL 1JSAA 3D0YA 2ZN9A 5CSNA 1RFJA 3KO0A 2SASA 2ERBA 2JULA 1N0YA 1DEKA 1B47A 1TIZA 1TNWA 4GUKA 3WHUB 4CFRA 1B1GA 2KI4C 5AERA 1L2OB 3FE6A 2Y4QA 1K96A 1SYMA 4JPZB 5ER5A 1NWDA 5JOLA 2BKIB 2GGZA 1OZSA 4I5NB 5KU1A 2AMIA 2PASA 3UNWA 1M31A 2CXJA 3CWGA 1XO5A 2LVKA 2LVVA 2LUCA 1ZFSA 3R1VA 2PSRA 3WHTB 4WRIA 1SL7A 1FPWA 3BYAA 3PFVA 1UHIA 4QJ4B 2WCJA 3NSOA 2K2AA 4MRXA 2BCAA 2KOTA 2K2FA 4U8DA 2JZIA 1CLLA 2K61A 1QIWA 3K21A 5HKZA 4C0LA 3SG7A 3TZ1A 2JPOA 4HSZA 2JXCA 4ORBB 4HRHA 2K7DA 2JU0A 4A4CA 5HLVA 1SR6B 3Q8IA 4MLWA 4GPLB 2JNFA 5I8NA 3EK7A 2K7BA 1QS7A 1XK4A 2WCKA 5FI2A 2BL0B 3EK8A 3BJHA 1JFJA 2WNDA 3AAKA 1F70A 2KSPA 3S0DA 2F2OA 2MHHA 2BKHB 3AKBA 3JTDC 4OVNF 1G4YR 2KBMA 2NCOA 1H8BA 2WCHA 2SCPA 4M2OA 1J55A 1NSHA 3LCPC 4I5LB 3SG2A 2BAPA 1H4BA 3FS7A 4YBHB 1QLSA 3CDNA 4MN0A 2M8UA 2PQLA 1C7WA 3PM8A 3TS5B 4YRUA 1CFFA 4GNKB 1BG1A 4INXA 1SL9A 1CDNA 1F55A 1SK6D 1NCXA 1OE9B 2HF5A 2KAVA 4PDZA 1DJYA 1NCZA 4XJKB 2TN4A 2JWWA 2M0RA 4YGDB 1S6JA 1DJHA 1CTRA 5HYDA 1IGVA 1LA3A 1PVBA 4E68A 2F3ZA 3OP0A 2I94A 1GJYA 2K60A 3E3RA 4P5OE 4CLNA 3NSKA 1A03A 1MXEA 5KTYA 2CCMA 1V1FA 5CSIA 4OR9B 2L4HA 1KFUS 3C1VA 3LK1A 2M9GA 4XJKA 2KAYA 1KFXS 1SCMB 4NDCA 2LVJA 3EVVA 4FQOA 1IG5A 5D3OA 3EVUA 2WCMA 5F6TA 1CDLA 2NZ0A 1UURA 1XFZO 2AAOA 2ZRSA 3SS3A 1MQ1A 1YRTB 1UWOA 1WY9A 2QACA 3D76A 3ICBA 1KK8B 2KI6D 2QEVA 3FWCA 4IJ7A 4PALA 1QIVA 2QPTA 2M3WA 1IQ3A 1LKJA 5CSFA 3DF0B 2CT9A 2FCDA 2VRGA 3I5IC 3R72A 4UPGA 1DELA 1JF0A 1F4QA 1OSAA 1SNLA 5I2OA 3WNXB 3OB1B 3SG4A 3EG5B 4F7FA 4ZCVA 1WDCB 2QDIA 2KGRA 2OS8B 1K9KA 1HQVA 1OZOA 3FE8A 3I5HB 4OKHA 1YUUA 1RROA 3DF0A 1J7OA 2Y1NA 2WC8A 1WDCC 1XFWO 3TUYB 2KLEA 3HX4A 2GV5A 1XFXO 1NX0A 4MZLA 1B7TZ 2JT8A 3N7HA 1OOJA 3EK4A 5HKYA 4I5KA 3PALA 2AUCA 4AQJA 2LLTA 3EKHA 3PN7C 1TUJA 4BY5A 4DRWA 1EG4A 2I7AA 2PRUA 1IJ6A 1SPYA 4PCWA 4P2YB 2KI4B 2A4JA 2H2KA 2KFFA 1OMVA 2O5GA 2JC2A 3K1EA 4JQ0D 1C3ZA 2KBIA 3D10A 4A4BA 3DD4A 1ZOTB 1NCYA 4NQGA 1M46A 1SBJA 2Q4UA 2D8NA 1J1EA 2OPOA 2OTGC 3OX5A 2KQYA 1OOFA 3PSRA 2F3YA 5D7FA 1AVSA 3BOWB 4DIRA 4M2QA 2JQ6A 1CLBA 2KI6C 1S3PA 1BJFA 3BUMB 1WRZA 2L5YA 1PVAA 4N1FA 1OOHA 1ZUZA 1PULA 3DVKA 1MF8B 2LNKA 2M97A 1QVIY 1N65A 2P70A 2ZRTA 2MAZA 1UHNA 3LL8B 4M2PA 1WLZA 5J3XA 1XVJA 3SS4A 1CDMA 3BOWA 2MA2A 4C0JA 1MWNA 1Y0VH 3CTNA 1L7ZA 1KQMC 1ZACA 1K94A 3GK2A 3O6BA 3S0GA 2FOTA 2LMTA 1B8CA 1WLMA 2BCBA 1DT7B 4NDBA 1U5IA 2M1UA 1ALWA 3OB2B 1LXFC 2NXQA 3L47A 1CNPA 1XFRA 2GGMA 1Y1AA 4HREE 1RWYA 4MRYA 1TUZA 4MVFA 2ISDA 4CPVA 1UHHA 4JWQA 3VRQA 3L4LA 3JTDB 2NLNA 4TNCA 1KSMA 1E8AA 5I94A 2K0JA 1W7IB 3NXAA 2BCXA 2M1KB 1KCYA 3IQQA 3CR5X 1B9AA 1W7JB 1KK7Y 2MRDA
chains in the Genus database with same CATH topology
2CTNA 1TNXA 1YVLA 2HQWA 2JTTA 1WRKA 1YUSA 2K7OA 5BPJA 1IWQA 1BU3A 2JTZA 2KYCA 2ZNDA 3CZTX 3TDUA 1BMOA 4PE0A 2R2IA 3NSIA 2JT3A 1NYAA 4QJ3B 1SL8A 3KHEA 3CGAA 1GGZA 2H61C 1NX2A 1DJXA 4MBEA 1J7PA 2EC6C 4MSPA 1RJVA 3JVTC 1DMOA 1QASA 1CM1A 2H61A 4CIDA 2WORA 2LLSA 4WQ3A 2KNEA 1C07A 1M45A 3KF9A 1R6PA 3I5GC 4R1EA 3IF7A 5HLOA 3KPXA 3H4SE 2PVBA 1DGVA 1QV0A 1F71A 1DJIA 1RTP1 4DCKA 1LA0A 3SJSA 2LMVA 3BXKA 2LM5A 1BODA 2BBNA 3LK0A 1A4PA 1QJTA 2WCFA 2KHNA 3BUWB 1LINA 1Y6WA 1K93D 4PHKA 2M7LA 1CM4A 2G2BA 3I5IB 4I5JA 1VRKA 1QTXA 2MLFC 2DOQA 4D1EA 1DTLA 3M0WA 4QJ5B 1N2DA 4NDDA 3CR2A 3PLFB 1FI6A 1CFDA 1QX5B 1UHJA 1C7VA 1AJ5A 1KQVA 2EHBA 5PALA 2WOSA 2KDHA 4ORCB 4PE7A 1AUIB 2L5XB 3I5FC 5AANA 1YUTA 2WCEA 4GBAA 5G08A 2K7CA 3EKJA 3IQOA 4IL1A 3BUNB 3VRRA 2LUXA 4YI9A 1K9PA 2M7NA 3O78A 2COLB 1D1OA 2L51A 1CMGA 4MZKA 1TRFA 1J1DA 2LV7A 3PN7B 1AK8A 3TDZA 5CPVA 2F2PA 3CLNA 2LVIA 3NSLA 1CMFA 4YGBB 3O2PA 1OQPA 4USLA 1F54A 4Q04A 1B8RA 1NIWA 2LHLA 4GAOA 1NUBA 2KGBC 1M39A 2LP3A 2LMUA 2L50A 1TNQA 5DKNA 3OX6A 2E30A 2OTGB 1DGUA 5AXIA 3ZNIA 1R2UA 1FBVA 4YGCB 1YTZC 2FCEA 4N1GA 3FWBA 1SMGA 2Y5IA 3SG6A 1K2HA 4PE4A 4BY4A 3GOFA 1G33A 5B8IB 2P6BB 3RLZA 2KFHA 4OCIA 2RGIA 5GQQC 1UUSA 3MSEB 1CDPA 1OMDA 1TNPA 2LE9B 4F0ZB 3DVJA 1BF5A 1U5IB 1V1GA 1KQMB 5IBWA 3TDIA 1A2XA 3WXAA 2BECA 2LCPA 2F8PA 4YGAA 1QV1A 1KWOC 1S5GY 5TNCA 1RECA 1JWDA 1TCFA 4ETOA 1QXPA 1S26D 5I2LA 1G8IA 5JJGA 1TN4A 2M29A 2O60A 1SY9A 1MUXA 5CSJA 2E6WA 1L2OC 1Q80A 4PHMA 1JBAA 3O4YA 2MBXA 4L9MA 1WRLA 1JC2A 1B7TY 4OV2A 1EH2A 2CNPA 2HPSA 3DVMA 1S1EA 1BR4B 4MZJA 4WQ2A 3AAJA 1YX8A 1XFVO 1CFCA 2EC6B 3JVTB 2MJWB 1SW8A 1Y1XA 3VROA 2JXLA 1QX7A 1J7QA 1YX7A 2L4IA 1IH0A 2M49B 1S6IA 1F8HA 4PE1A 1XK4C 4AOMA 1JFKA 3I5GB 2KFGA 1EG3A 1FI5A 1S36A 2L2EA 4ICBA 1DF0B 1MXLC 1BOCA 1XYDA 1ALVA 3RM1A 3AKAA 1F4OA 4PHNA 1CB1A 4DS7A 1Y1UA 1MHOA 1SCVA 2ZN8A 1NPQA 2LAPA 1SR6C 2CBLA 4GGFC 1YVHA 3A4UB 2IS9A 3GK4X 5FYXA 1SKTA 2MLEC 2PALA 5DKQA 2BL0C 1IKUA 2ZFDA 1DF0A 1QX2A 4GGFA 4AQIA 1TTXA 4FTGA 3BUXB 1UP5A 1ZMZA 1BR1B 3VRPA 4XYNA 3TS5C 3QRXA 1GGWA 2V53A 1QATA 2WCBA 1DJZA 1AJ4A 5I2QA 1NP8A 1XFUO 1TCOB 1YURA 1JF2A 1JUOA 1K95A 2LC5A 1M63B 1A29A 1IRJA 1DVIA 1DJGA 3I5FB 1YRUB 3OHMB 2G9BA 1UHKA 1QLKA 4N5XA 2Y1MA 1AP4A 2LLUA 1B4CA 3GK1A 3BUOB 3EVRA 3ZWHA 2EGDA 5KSZA 4GGNA 4CFQA 1FF1A 2B1UA 1EXRA 1YR5A 2BE4A 5ER4X 5AEQA 1SCMC 2Q91A 2JPTA 3CS1A 1BT6A 3SG3A 3KEVA 3FIAA 2HQ8A 1CFPA 2I18A 1BLQA 1SRAA 3SG5A 1AHRA 1X02A 1QVIZ 2L0PA 3CR4X 5D69A 4HRGA 1A75B 2NCPA 1PALA 2JOJA 1J7RA 2HETA 1KK8C 4MEWA 1CKKA 1XA5A 1K90D 1EL4A 2JRFA 4YGEB 2KYFA 3BQ3A 1S5GZ 2FJUB 1PSBA 2L98A 1ODBA 2BE6A 1KSOA 1PK0D 1S6CA 2F33A 4C0KA 1XFYO 1DJWA 4YI8A 1IJ5A 3SIBA 1B8LA 1MR8A 4ORAB 2I2RE 1A75A 2PMYA 4PHJA 1FW4A 5K89A 2BBMA 3F45A 2LHIA 3VGOA 4GFTA 2KAXA 2K8MB 1PRWA 1NX1A 2OS8C 3SIAA 3VRNA 1K9UA 5DKRA 3I5HC 1EJ3A 1K8UA 2ZNEA 3D0YB 1KK7Z 1LVCD 4ZCUA 5AFPA 2KQ6A 3TUYC 1TOPA 1PSRA 2JNXA 1HT9A 3A8RA 3HCMA 2LP2A 3DVEA 1RK9A 3PATA 2ZKMX 2JT0A 5HKWA 1CLMA 1KWOB 4DUQA 1OMRA 3LLEA 2LANA 1KFUL 1NX3A 1IQ5A 1GQMA 1KFXL 1JSAA 3D0YA 2ZN9A 5CSNA 1RFJA 3KO0A 2SASA 2JULA 4GUKA 1N0YA 1B47A 1TIZA 1TNWA 3WHUB 4CFRA 1B1GA 2KI4C 5AERA 1L2OB 2Y4QA 1K96A 1SYMA 4JPZB 5ER5A 1NWDA 5JOLA 2BKIB 2GGZA 1OZSA 4I5NB 5KU1A 2AMIA 2PASA 1M31A 2CXJA 3CWGA 1XO5A 2LVKA 2LVVA 2LUCA 1ZFSA 3WHTB 2PSRA 4WRIA 1SL7A 1FPWA 3BYAA 3PFVA 1UHIA 4QJ4B 3NSOA 2K2AA 4MRXA 2BCAA 2KOTA 2K2FA 4U8DA 2JZIA 1CLLA 2K61A 1QIWA 3K21A 5HKZA 4C0LA 3SG7A 3TZ1A 4HSZA 2JXCA 4ORBB 4HRHA 2K7DA 2JU0A 4A4CA 5HLVA 1SR6B 4MLWA 4GPLB 2JNFA 5I8NA 3EK7A 2K7BA 1QS7A 1XK4A 2BL0B 3EK8A 1JFJA 2WNDA 3AAKA 1F70A 2KSPA 2F2OA 2MHHA 2BKHB 3AKBA 3JTDC 4OVNF 1G4YR 2KBMA 2NCOA 1H8BA 2SCPA 4M2OA 1J55A 1NSHA 3LCPC 4I5LB 3SG2A 1H4BA 3FS7A 4YBHB 1QLSA 4MN0A 4YRUA 2M8UA 3PM8A 1C7WA 3TS5B 1CFFA 4GNKB 1BG1A 1SL9A 1CDNA 1F55A 1SK6D 1NCXA 1OE9B 2HF5A 2KAVA 4PDZA 1DJYA 1NCZA 4XJKB 2TN4A 2JWWA 2M0RA 4YGDB 1S6JA 1DJHA 1CTRA 5HYDA 1IGVA 1LA3A 1PVBA 4E68A 2F3ZA 3OP0A 2I94A 1GJYA 4P5OE 3E3RA 4CLNA 3NSKA 1A03A 1MXEA 5KTYA 2CCMA 1V1FA 5CSIA 4OR9B 2L4HA 1KFUS 3C1VA 3LK1A 2M9GA 4XJKA 2KAYA 1KFXS 1SCMB 4NDCA 2LVJA 3EVVA 4FQOA 1IG5A 3EVUA 5F6TA 1CDLA 2NZ0A 1UURA 1XFZO 2AAOA 2ZRSA 1MQ1A 1YRTB 1UWOA 1WY9A 2QACA 3ICBA 4PALA 1KK8B 2KI6D 3FWCA 1QIVA 2QPTA 2M3WA 1IQ3A 1LKJA 5CSFA 3DF0B 2CT9A 2FCDA 2VRGA 3I5IC 4UPGA 1JF0A 1F4QA 1OSAA 1SNLA 5I2OA 3WNXB 3OB1B 3SG4A 4ZCVA 1WDCB 2KGRA 2OS8B 1K9KA 1HQVA 1OZOA 3I5HB 4OKHA 1YUUA 1RROA 3DF0A 1J7OA 2Y1NA 2WC8A 1WDCC 1XFWO 3TUYB 3HX4A 2GV5A 1XFXO 1NX0A 4MZLA 1B7TZ 2JT8A 1OOJA 3EK4A 5HKYA 4I5KA 3PALA 2AUCA 4AQJA 2LLTA 3EKHA 3PN7C 4BY5A 4DRWA 1EG4A 2I7AA 2PRUA 1IJ6A 1SPYA 4PCWA 4P2YB 2KI4B 2A4JA 2H2KA 2KFFA 1OMVA 2O5GA 2JC2A 4JQ0D 2KBIA 3D10A 4A4BA 3DD4A 1ZOTB 1NCYA 4NQGA 1M46A 1SBJA 2Q4UA 2D8NA 1J1EA 2OPOA 2OTGC 3OX5A 2KQYA 3PSRA 5D7FA 2F3YA 1AVSA 3BOWB 4DIRA 4M2QA 2JQ6A 1CLBA 2KI6C 1S3PA 1BJFA 3BUMB 1WRZA 1PVAA 4N1FA 1ZUZA 1PULA 3DVKA 1MF8B 2LNKA 2M97A 1QVIY 1N65A 2ZRTA 2MAZA 1UHNA 3LL8B 4M2PA 1WLZA 5J3XA 1XVJA 1CDMA 3BOWA 2MA2A 4C0JA 1MWNA 1Y0VH 3CTNA 1L7ZA 1KQMC 1ZACA 1K94A 3GK2A 3O6BA 2FOTA 2LMTA 1B8CA 1WLMA 2BCBA 1DT7B 4NDBA 1U5IA 2M1UA 1ALWA 3OB2B 1LXFC 2NXQA 1CNPA 2GGMA 4HREE 1Y1AA 4MRYA 1RWYA 4MVFA 2ISDA 4CPVA 1UHHA 4JWQA 3VRQA 3JTDB 2NLNA 4TNCA 1KSMA 1E8AA 2K0JA 1W7IB 3NXAA 2BCXA 2M1KB 1KCYA 3IQQA 3CR5X 1B9AA 1W7JB 1KK7Y 2MRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTN A;  1TNX A;  1YVL A;  2HQW A;  2JTT A;  1WRK A;  1YUS A;  2K7O A;  5BPJ A;  1IWQ A;  1BU3 A;  2JTZ A;  2KYC A;  2ZND A;  3CZT X;  3TDU A;  1BMO A;  4PE0 A;  2R2I A;  3NSI A;  2JT3 A;  1NYA A;  4QJ3 B;  1SL8 A;  3KHE A;  3CGA A;  1GGZ A;  2H61 C;  1NX2 A;  1DJX A;  4MBE A;  1J7P A;  2EC6 C;  4MSP A;  1RJV A;  3JVT C;  1DMO A;  1QAS A;  1CM1 A;  2H61 A;  4CID A;  2WOR A;  2LLS A;  4WQ3 A;  2KNE A;  1C07 A;  1M45 A;  3KF9 A;  1R6P A;  3I5G C;  4R1E A;  3IF7 A;  5HLO A;  3KPX A;  3H4S E;  2PVB A;  1DGV A;  1QV0 A;  1F71 A;  1DJI A;  1RTP 1;  4DCK A;  1LA0 A;  3SJS A;  2LMV A;  3BXK A;  2LM5 A;  1BOD A;  2BBN A;  3LK0 A;  1A4P A;  1QJT A;  2WCF A;  2KHN A;  3BUW B;  1LIN A;  1Y6W A;  1K93 D;  4PHK A;  2M7L A;  1CM4 A;  2G2B A;  3I5I B;  4I5J A;  1VRK A;  1QTX A;  2MLF C;  2DOQ A;  4D1E A;  1DTL A;  3M0W A;  4QJ5 B;  1N2D A;  4NDD A;  3CR2 A;  3PLF B;  1FI6 A;  1CFD A;  1QX5 B;  1UHJ A;  1C7V A;  1AJ5 A;  1KQV A;  2EHB A;  5PAL A;  2WOS A;  2KDH A;  4ORC B;  4PE7 A;  1AUI B;  2L5X B;  3I5F C;  5AAN A;  1YUT A;  2WCE A;  4GBA A;  5G08 A;  2K7C A;  3EKJ A;  3IQO A;  4IL1 A;  3BUN B;  3VRR A;  2LUX A;  4YI9 A;  1K9P A;  2M7N A;  3O78 A;  2COL B;  1D1O A;  2L51 A;  1CMG A;  4MZK A;  1TRF A;  1J1D A;  2LV7 A;  3PN7 B;  1AK8 A;  3TDZ A;  5CPV A;  2F2P A;  3CLN A;  2LVI A;  3NSL A;  1CMF A;  4YGB B;  3O2P A;  1OQP A;  4USL A;  1F54 A;  4Q04 A;  1B8R A;  1NIW A;  2LHL A;  4GAO A;  1NUB A;  2KGB C;  1M39 A;  2LP3 A;  2LMU A;  2L50 A;  1TNQ A;  5DKN A;  3OX6 A;  2E30 A;  2OTG B;  1DGU A;  5AXI A;  3ZNI A;  1R2U A;  1FBV A;  4YGC B;  1YTZ C;  2FCE A;  4N1G A;  3FWB A;  1SMG A;  2Y5I A;  3SG6 A;  1K2H A;  4PE4 A;  4BY4 A;  3GOF A;  1G33 A;  5B8I B;  2P6B B;  3RLZ A;  2KFH A;  4OCI A;  2RGI A;  5GQQ C;  1UUS A;  3MSE B;  1CDP A;  1OMD A;  1TNP A;  2LE9 B;  4F0Z B;  3DVJ A;  1BF5 A;  1U5I B;  1V1G A;  1KQM B;  5IBW A;  3TDI A;  1A2X A;  3WXA A;  2BEC A;  2LCP A;  2F8P A;  4YGA A;  1QV1 A;  1KWO C;  1S5G Y;  5TNC A;  1REC A;  1JWD A;  1TCF A;  4ETO A;  1QXP A;  1S26 D;  5I2L A;  1G8I A;  5JJG A;  1TN4 A;  2M29 A;  2O60 A;  1SY9 A;  1MUX A;  5CSJ A;  2E6W A;  1L2O C;  1Q80 A;  4PHM A;  1JBA A;  3O4Y A;  2MBX A;  4L9M A;  1WRL A;  1JC2 A;  1B7T Y;  4OV2 A;  1EH2 A;  2CNP A;  2HPS A;  3DVM A;  1S1E A;  1BR4 B;  4MZJ A;  4WQ2 A;  3AAJ A;  1YX8 A;  1XFV O;  1CFC A;  2EC6 B;  3JVT B;  2MJW B;  1SW8 A;  1Y1X A;  3VRO A;  2JXL A;  1QX7 A;  1J7Q A;  1YX7 A;  2L4I A;  1IH0 A;  2M49 B;  1S6I A;  1F8H A;  4PE1 A;  1XK4 C;  4AOM A;  1JFK A;  3I5G B;  2KFG A;  1EG3 A;  1FI5 A;  1S36 A;  2L2E A;  4ICB A;  1DF0 B;  1MXL C;  1BOC A;  1XYD A;  1ALV A;  3RM1 A;  3AKA A;  1F4O A;  4PHN A;  1CB1 A;  4DS7 A;  1Y1U A;  1MHO A;  1SCV A;  2ZN8 A;  1NPQ A;  2LAP A;  1SR6 C;  2CBL A;  4GGF C;  1YVH A;  3A4U B;  2IS9 A;  3GK4 X;  5FYX A;  1SKT A;  2MLE C;  2PAL A;  5DKQ A;  2BL0 C;  1IKU A;  2ZFD A;  1DF0 A;  1QX2 A;  4GGF A;  4AQI A;  1TTX A;  4FTG A;  3BUX B;  1UP5 A;  1ZMZ A;  1BR1 B;  3VRP A;  4XYN A;  3TS5 C;  3QRX A;  1GGW A;  2V53 A;  1QAT A;  2WCB A;  1DJZ A;  1AJ4 A;  5I2Q A;  1NP8 A;  1XFU O;  1TCO B;  1YUR A;  1JF2 A;  1JUO A;  1K95 A;  2LC5 A;  1M63 B;  1A29 A;  1IRJ A;  1DVI A;  1DJG A;  3I5F B;  1YRU B;  3OHM B;  2G9B A;  1UHK A;  1QLK A;  4N5X A;  2Y1M A;  1AP4 A;  2LLU A;  1B4C A;  3GK1 A;  3BUO B;  3EVR A;  3ZWH A;  2EGD A;  5KSZ A;  4GGN A;  4CFQ A;  1FF1 A;  2B1U A;  1EXR A;  1YR5 A;  2BE4 A;  5ER4 X;  5AEQ A;  1SCM C;  2Q91 A;  2JPT A;  3CS1 A;  1BT6 A;  3SG3 A;  3KEV A;  3FIA A;  2HQ8 A;  1CFP A;  2I18 A;  1BLQ A;  1SRA A;  3SG5 A;  1AHR A;  1X02 A;  1QVI Z;  2L0P A;  3CR4 X;  5D69 A;  4HRG A;  1A75 B;  2NCP A;  1PAL A;  2JOJ A;  1J7R A;  2HET A;  1KK8 C;  4MEW A;  1CKK A;  1XA5 A;  1K90 D;  1EL4 A;  2JRF A;  4YGE B;  2KYF A;  3BQ3 A;  1S5G Z;  2FJU B;  1PSB A;  2L98 A;  1ODB A;  2BE6 A;  1KSO A;  1PK0 D;  1S6C A;  2F33 A;  4C0K A;  1XFY O;  1DJW A;  4YI8 A;  1IJ5 A;  3SIB A;  1B8L A;  1MR8 A;  4ORA B;  2I2R E;  1A75 A;  2PMY A;  4PHJ A;  1FW4 A;  5K89 A;  2BBM A;  3F45 A;  2LHI A;  3VGO A;  4GFT A;  2KAX A;  2K8M B;  1PRW A;  1NX1 A;  2OS8 C;  3SIA A;  3VRN A;  1K9U A;  5DKR A;  3I5H C;  1EJ3 A;  1K8U A;  2ZNE A;  3D0Y B;  1KK7 Z;  1LVC D;  4ZCU A;  5AFP A;  2KQ6 A;  3TUY C;  1TOP A;  1PSR A;  2JNX A;  1HT9 A;  3A8R A;  3HCM A;  2LP2 A;  3DVE A;  1RK9 A;  3PAT A;  2ZKM X;  2JT0 A;  5HKW A;  1CLM A;  1KWO B;  4DUQ A;  1OMR A;  3LLE A;  2LAN A;  1KFU L;  1NX3 A;  1IQ5 A;  1GQM A;  1KFX L;  1JSA A;  3D0Y A;  2ZN9 A;  5CSN A;  1RFJ A;  3KO0 A;  2SAS A;  2JUL A;  4GUK A;  1N0Y A;  1B47 A;  1TIZ A;  1TNW A;  3WHU B;  4CFR A;  1B1G A;  2KI4 C;  5AER A;  1L2O B;  2Y4Q A;  1K96 A;  1SYM A;  4JPZ B;  5ER5 A;  1NWD A;  5JOL A;  2BKI B;  2GGZ A;  1OZS A;  4I5N B;  5KU1 A;  2AMI A;  2PAS A;  1M31 A;  2CXJ A;  3CWG A;  1XO5 A;  2LVK A;  2LVV A;  2LUC A;  1ZFS A;  3WHT B;  2PSR A;  4WRI A;  1SL7 A;  1FPW A;  3BYA A;  3PFV A;  1UHI A;  4QJ4 B;  3NSO A;  2K2A A;  4MRX A;  2BCA A;  2KOT A;  2K2F A;  4U8D A;  2JZI A;  1CLL A;  2K61 A;  1QIW A;  3K21 A;  5HKZ A;  4C0L A;  3SG7 A;  3TZ1 A;  4HSZ A;  2JXC A;  4ORB B;  4HRH A;  2K7D A;  2JU0 A;  4A4C A;  5HLV A;  1SR6 B;  4MLW A;  4GPL B;  2JNF A;  5I8N A;  3EK7 A;  2K7B A;  1QS7 A;  1XK4 A;  2BL0 B;  3EK8 A;  1JFJ A;  2WND A;  3AAK A;  1F70 A;  2KSP A;  2F2O A;  2MHH A;  2BKH B;  3AKB A;  3JTD C;  4OVN F;  1G4Y R;  2KBM A;  2NCO A;  1H8B A;  2SCP A;  4M2O A;  1J55 A;  1NSH A;  3LCP C;  4I5L B;  3SG2 A;  1H4B A;  3FS7 A;  4YBH B;  1QLS A;  4MN0 A;  4YRU A;  2M8U A;  3PM8 A;  1C7W A;  3TS5 B;  1CFF A;  4GNK B;  1BG1 A;  1SL9 A;  1CDN A;  1F55 A;  1SK6 D;  1NCX A;  1OE9 B;  2HF5 A;  2KAV A;  4PDZ A;  1DJY A;  1NCZ A;  4XJK B;  2TN4 A;  2JWW A;  2M0R A;  4YGD B;  1S6J A;  1DJH A;  1CTR A;  5HYD A;  1IGV A;  1LA3 A;  1PVB A;  4E68 A;  2F3Z A;  3OP0 A;  2I94 A;  1GJY A;  4P5O E;  3E3R A;  4CLN A;  3NSK A;  1A03 A;  1MXE A;  5KTY A;  2CCM A;  1V1F A;  5CSI A;  4OR9 B;  2L4H A;  1KFU S;  3C1V A;  3LK1 A;  2M9G A;  4XJK A;  2KAY A;  1KFX S;  1SCM B;  4NDC A;  2LVJ A;  3EVV A;  4FQO A;  1IG5 A;  3EVU A;  5F6T A;  1CDL A;  2NZ0 A;  1UUR A;  1XFZ O;  2AAO A;  2ZRS A;  1MQ1 A;  1YRT B;  1UWO A;  1WY9 A;  2QAC A;  3ICB A;  4PAL A;  1KK8 B;  2KI6 D;  3FWC A;  1QIV A;  2QPT A;  2M3W A;  1IQ3 A;  1LKJ A;  5CSF A;  3DF0 B;  2CT9 A;  2FCD A;  2VRG A;  3I5I C;  4UPG A;  1JF0 A;  1F4Q A;  1OSA A;  1SNL A;  5I2O A;  3WNX B;  3OB1 B;  3SG4 A;  4ZCV A;  1WDC B;  2KGR A;  2OS8 B;  1K9K A;  1HQV A;  1OZO A;  3I5H B;  4OKH A;  1YUU A;  1RRO A;  3DF0 A;  1J7O A;  2Y1N A;  2WC8 A;  1WDC C;  1XFW O;  3TUY B;  3HX4 A;  2GV5 A;  1XFX O;  1NX0 A;  4MZL A;  1B7T Z;  2JT8 A;  1OOJ A;  3EK4 A;  5HKY A;  4I5K A;  3PAL A;  2AUC A;  4AQJ A;  2LLT A;  3EKH A;  3PN7 C;  4BY5 A;  4DRW A;  1EG4 A;  2I7A A;  2PRU A;  1IJ6 A;  1SPY A;  4PCW A;  4P2Y B;  2KI4 B;  2A4J A;  2H2K A;  2KFF A;  1OMV A;  2O5G A;  2JC2 A;  4JQ0 D;  2KBI A;  3D10 A;  4A4B A;  3DD4 A;  1ZOT B;  1NCY A;  4NQG A;  1M46 A;  1SBJ A;  2Q4U A;  2D8N A;  1J1E A;  2OPO A;  2OTG C;  3OX5 A;  2KQY A;  3PSR A;  5D7F A;  2F3Y A;  1AVS A;  3BOW B;  4DIR A;  4M2Q A;  2JQ6 A;  1CLB A;  2KI6 C;  1S3P A;  1BJF A;  3BUM B;  1WRZ A;  1PVA A;  4N1F A;  1ZUZ A;  1PUL A;  3DVK A;  1MF8 B;  2LNK A;  2M97 A;  1QVI Y;  1N65 A;  2ZRT A;  2MAZ A;  1UHN A;  3LL8 B;  4M2P A;  1WLZ A;  5J3X A;  1XVJ A;  1CDM A;  3BOW A;  2MA2 A;  4C0J A;  1MWN A;  1Y0V H;  3CTN A;  1L7Z A;  1KQM C;  1ZAC A;  1K94 A;  3GK2 A;  3O6B A;  2FOT A;  2LMT A;  1B8C A;  1WLM A;  2BCB A;  1DT7 B;  4NDB A;  1U5I A;  2M1U A;  1ALW A;  3OB2 B;  1LXF C;  2NXQ A;  1CNP A;  2GGM A;  4HRE E;  1Y1A A;  4MRY A;  1RWY A;  4MVF A;  2ISD A;  4CPV A;  1UHH A;  4JWQ A;  3VRQ A;  3JTD B;  2NLN A;  4TNC A;  1KSM A;  1E8A A;  2K0J A;  1W7I B;  3NXA A;  2BCX A;  2M1K B;  1KCY A;  3IQQ A;  3CR5 X;  1B9A A;  1W7J B;  1KK7 Y;  2MRD A; 
#chains in the Genus database with same CATH topology
 2CTN A;  1TNX A;  1YVL A;  2HQW A;  2JTT A;  2WC5 A;  1WRK A;  1YUS A;  1DQE A;  2K7O A;  5BPJ A;  3FE9 A;  1IWQ A;  1BU3 A;  2JTZ A;  2KYC A;  2ZND A;  3CZT X;  3TDU A;  1BMO A;  4PE0 A;  2R2I A;  3NSI A;  2JT3 A;  1NYA A;  4QJ3 B;  3CZ0 A;  1SL8 A;  3KHE A;  3CGA A;  1GGZ A;  2H61 C;  1NX2 A;  1DJX A;  3IVT A;  4MBE A;  1J7P A;  2EC6 C;  4MSP A;  1RJV A;  3JVT C;  1DMO A;  1QAS A;  1CM1 A;  2H61 A;  4CID A;  2WOR A;  2LLS A;  3CZ2 A;  4WQ3 A;  2KNE A;  1C07 A;  1M45 A;  3KF9 A;  1QWV A;  1R6P A;  3I5G C;  4R1E A;  2GTE A;  3IF7 A;  5HLO A;  3B6X A;  3KPX A;  3H4S E;  1W9Z A;  2PVB A;  1DGV A;  3UO9 A;  1QV0 A;  1F71 A;  1DJI A;  1RTP 1;  3L4A A;  3NHT A;  4DCK A;  1TWO A;  1LA0 A;  3SJS A;  2LMV A;  3BXK A;  2LM5 A;  1BOD A;  2BBN A;  3LK0 A;  1A4P A;  1QJT A;  2WCF A;  2KHN A;  3D74 A;  3BUW B;  1LIN A;  1Y6W A;  1K93 D;  4PHK A;  2M7L A;  1CM4 A;  3VB1 A;  2G2B A;  3I5I B;  4I5J A;  1VRK A;  1QTX A;  2MLF C;  2DOQ A;  4D1E A;  1OOG A;  2KPH A;  1DC1 A;  1DTL A;  3M0W A;  4QJ5 B;  1N2D A;  4NDD A;  3CR2 A;  3PLF B;  1FI6 A;  1CFD A;  1QX5 B;  1UHJ A;  1C7V A;  1AJ5 A;  1KQV A;  2EHB A;  5PAL A;  2WOS A;  2KDH A;  1OOI X;  4ORC B;  4PE7 A;  1AUI B;  2L5X B;  2YGU A;  3I5F C;  5AAN A;  1YUT A;  2WCE A;  4GBA A;  5G08 A;  2K7C A;  4PT1 A;  3EKJ A;  3IQO A;  4IL1 A;  3BUN B;  3VRR A;  2LUX A;  4YI9 A;  1K9P A;  2M7N A;  3O78 A;  2COL B;  1D1O A;  2QEH A;  2L51 A;  1CMG A;  4MZK A;  1TRF A;  1J1D A;  2LV7 A;  3PN7 B;  1AK8 A;  2H8V A;  3TDZ A;  3QME A;  5CPV A;  3SS5 A;  2F2P A;  3B7A A;  3CLN A;  2LVI A;  3NSL A;  1CMF A;  4YGB B;  3O2P A;  1OQP A;  4USL A;  1F54 A;  4Q04 A;  1B8R A;  1NIW A;  2LHL A;  4GAO A;  1NUB A;  2KGB C;  1M39 A;  2LP3 A;  2LMU A;  2L50 A;  1TNQ A;  5DKN A;  3OX6 A;  2E30 A;  2OTG B;  1DGU A;  5AXI A;  3ZNI A;  3S0E A;  1R2U A;  1FBV A;  3B86 A;  3D78 A;  4YGC B;  1YTZ C;  2FCE A;  3D77 A;  4N1G A;  3FWB A;  1SMG A;  2Y5I A;  3DY9 A;  3SG6 A;  1K2H A;  4PE4 A;  4BY4 A;  3GOF A;  1G33 A;  5B8I B;  2P6B B;  3RLZ A;  2KFH A;  4OCI A;  2RGI A;  5GQQ C;  1UUS A;  3MSE B;  1CDP A;  1OMD A;  1Z2C B;  1TNP A;  3DXL A;  2LE9 B;  4F0Z B;  3PJI A;  3DVJ A;  1BF5 A;  1U5I B;  1V1G A;  1KQM B;  5IBW A;  3NHI A;  3TDI A;  1A2X A;  3WXA A;  2BEC A;  2LCP A;  3DZT A;  4INW A;  2F8P A;  4YGA A;  1QV1 A;  3CAB A;  1KWO C;  4JD9 A;  3S0F A;  1S5G Y;  2KLD A;  5TNC A;  1REC A;  3RZS A;  1JWD A;  1TCF A;  4ETO A;  1QXP A;  1S26 D;  5I2L A;  1G8I A;  5JJG A;  1TN4 A;  2M29 A;  2O60 A;  3D73 A;  1SY9 A;  1MUX A;  1OW4 A;  1C3Y A;  3B88 A;  4KYN A;  5CSJ A;  2E6W A;  1L2O C;  1Q80 A;  4PHM A;  1JBA A;  3O4Y A;  2MBX A;  4L9M A;  1WRL A;  3R1P A;  1JC2 A;  1B7T Y;  4OV2 A;  1ORG A;  1EH2 A;  2CNP A;  2HPS A;  5EL2 A;  3DVM A;  1S1E A;  1BR4 B;  4MZJ A;  4WQ2 A;  3AAJ A;  1YX8 A;  1XFV O;  1CFC A;  3S0B A;  2EC6 B;  3JVT B;  2MJW B;  1SW8 A;  1Y1X A;  3VRO A;  2JXL A;  1QX7 A;  3V2L A;  1YX7 A;  2L4I A;  1J7Q A;  1IH0 A;  2M49 B;  3CYZ A;  1S6I A;  1F8H A;  4PE1 A;  1XK4 C;  4AOM A;  1JFK A;  3I5G B;  2KFG A;  1EG3 A;  1FI5 A;  1S36 A;  2L2E A;  4ICB A;  1DF0 B;  1MXL C;  5DIC A;  1BOC A;  1XYD A;  1ALV A;  3RM1 A;  3AKA A;  1F4O A;  4PHN A;  1IIO A;  1CB1 A;  4DS7 A;  1Y1U A;  1MHO A;  1SCV A;  2ZN8 A;  1NPQ A;  2LAP A;  1SR6 C;  2CBL A;  1LS8 A;  4GGF C;  1YVH A;  3A4U B;  2IS9 A;  3GK4 X;  5FYX A;  1SKT A;  2MLE C;  2PAL A;  5DKQ A;  2BL0 C;  1IKU A;  2ZFD A;  1P28 A;  1DF0 A;  3O4X A;  4JKT A;  1QX2 A;  4GGF A;  4AQI A;  1TTX A;  4FTG A;  3BUX B;  1UP5 A;  1ZMZ A;  1BR1 B;  2BNX A;  3VRP A;  4XYN A;  3TS5 C;  3QRX A;  5FI7 A;  2V53 A;  1QAT A;  1GGW A;  2WCB A;  1DJZ A;  1AJ4 A;  5I2Q A;  1NP8 A;  1XFU O;  1TCO B;  1YUR A;  1JF2 A;  1JUO A;  1Z4H A;  1K95 A;  2LC5 A;  1M63 B;  1A29 A;  1IRJ A;  1DVI A;  1DJG A;  3I5F B;  3R1O A;  1YRU B;  3OHM B;  2QEO A;  3OBV A;  4FQT A;  2G9B A;  1UHK A;  1QLK A;  4N5X A;  4OZD A;  2Y1M A;  1AP4 A;  2LLU A;  1B4C A;  3BFB A;  3GK1 A;  3BUO B;  3EVR A;  3ZWH A;  2EGD A;  5KSZ A;  3BFA A;  4GGN A;  4CFQ A;  1GM0 A;  1FF1 A;  2B1U A;  1EXR A;  1YR5 A;  2BE4 A;  5ER4 X;  5AEQ A;  1SCM C;  2Q91 A;  2JPT A;  3CS1 A;  1BT6 A;  3SG3 A;  3KEV A;  2WC6 A;  3FIA A;  2HQ8 A;  1CFP A;  2I18 A;  1BLQ A;  1SRA A;  3SG5 A;  1AHR A;  1X02 A;  1QVI Z;  2FJY A;  2L0P A;  5FI6 A;  3CR4 X;  3OGN A;  5D69 A;  4HRG A;  1A75 B;  2NCP A;  1PAL A;  2WCL A;  2JOJ A;  1J7R A;  2HET A;  1KK8 C;  4MEW A;  1CKK A;  1XA5 A;  1K90 D;  1EL4 A;  2JRF A;  4YGE B;  2KYF A;  1T14 A;  3BQ3 A;  1S5G Z;  2FJU B;  1PSB A;  2L98 A;  1ODB A;  2BE6 A;  1KSO A;  1PK0 D;  1S6C A;  2F33 A;  4C0K A;  1XFY O;  1DJW A;  4YI8 A;  1IJ5 A;  3SIB A;  1B8L A;  1MR8 A;  4ORA B;  2I2R E;  1A75 A;  2P71 A;  2PMY A;  3S0A A;  4PHJ A;  1FW4 A;  5K89 A;  2BBM A;  3B87 A;  3F45 A;  2LHI A;  3VGO A;  4GFT A;  2KAX A;  2K8M B;  1PRW A;  1NX1 A;  2OS8 C;  3SIA A;  2L2C A;  3VRN A;  1K9U A;  5DKR A;  3I5H C;  1EJ3 A;  1K8U A;  2ZNE A;  3D0Y B;  1KK7 Z;  1LVC D;  3CZ1 A;  3D75 A;  3PM2 A;  4ZCU A;  5AFP A;  2KQ6 A;  3TUY C;  1SSE B;  1TOP A;  1PSR A;  2JNX A;  1HT9 A;  2PYQ A;  3A8R A;  3BFH A;  3HCM A;  2LP2 A;  3DVE A;  5HL1 A;  1RK9 A;  3PAT A;  2ZKM X;  2JT0 A;  3NGV A;  5HKW A;  1CLM A;  1KWO B;  2QEB A;  4DUQ A;  1OMR A;  3LLE A;  2LAN A;  1KFU L;  1NX3 A;  1IQ5 A;  3DYE A;  1GQM A;  1KFX L;  1JSA A;  3D0Y A;  2ZN9 A;  5CSN A;  1RFJ A;  3KO0 A;  2SAS A;  2ERB A;  2JUL A;  1N0Y A;  1DEK A;  1B47 A;  1TIZ A;  1TNW A;  4GUK A;  3WHU B;  4CFR A;  1B1G A;  2KI4 C;  5AER A;  1L2O B;  3FE6 A;  2Y4Q A;  1K96 A;  1SYM A;  4JPZ B;  5ER5 A;  1NWD A;  5JOL A;  2BKI B;  2GGZ A;  1OZS A;  4I5N B;  5KU1 A;  2AMI A;  2PAS A;  3UNW A;  1M31 A;  2CXJ A;  3CWG A;  1XO5 A;  2LVK A;  2LVV A;  2LUC A;  1ZFS A;  3R1V A;  2PSR A;  3WHT B;  4WRI A;  1SL7 A;  1FPW A;  3BYA A;  3PFV A;  1UHI A;  4QJ4 B;  2WCJ A;  3NSO A;  2K2A A;  4MRX A;  2BCA A;  2KOT A;  2K2F A;  4U8D A;  2JZI A;  1CLL A;  2K61 A;  1QIW A;  3K21 A;  5HKZ A;  4C0L A;  3SG7 A;  3TZ1 A;  2JPO A;  4HSZ A;  2JXC A;  4ORB B;  4HRH A;  2K7D A;  2JU0 A;  4A4C A;  5HLV A;  1SR6 B;  3Q8I A;  4MLW A;  4GPL B;  2JNF A;  5I8N A;  3EK7 A;  2K7B A;  1QS7 A;  1XK4 A;  2WCK A;  5FI2 A;  2BL0 B;  3EK8 A;  3BJH A;  1JFJ A;  2WND A;  3AAK A;  1F70 A;  2KSP A;  3S0D A;  2F2O A;  2MHH A;  2BKH B;  3AKB A;  3JTD C;  4OVN F;  1G4Y R;  2KBM A;  2NCO A;  1H8B A;  2WCH A;  2SCP A;  4M2O A;  1J55 A;  1NSH A;  3LCP C;  4I5L B;  3SG2 A;  2BAP A;  1H4B A;  3FS7 A;  4YBH B;  1QLS A;  3CDN A;  4MN0 A;  2M8U A;  2PQL A;  1C7W A;  3PM8 A;  3TS5 B;  4YRU A;  1CFF A;  4GNK B;  1BG1 A;  4INX A;  1SL9 A;  1CDN A;  1F55 A;  1SK6 D;  1NCX A;  1OE9 B;  2HF5 A;  2KAV A;  4PDZ A;  1DJY A;  1NCZ A;  4XJK B;  2TN4 A;  2JWW A;  2M0R A;  4YGD B;  1S6J A;  1DJH A;  1CTR A;  5HYD A;  1IGV A;  1LA3 A;  1PVB A;  4E68 A;  2F3Z A;  3OP0 A;  2I94 A;  1GJY A;  2K60 A;  3E3R A;  4P5O E;  4CLN A;  3NSK A;  1A03 A;  1MXE A;  5KTY A;  2CCM A;  1V1F A;  5CSI A;  4OR9 B;  2L4H A;  1KFU S;  3C1V A;  3LK1 A;  2M9G A;  4XJK A;  2KAY A;  1KFX S;  1SCM B;  4NDC A;  2LVJ A;  3EVV A;  4FQO A;  1IG5 A;  5D3O A;  3EVU A;  2WCM A;  5F6T A;  1CDL A;  2NZ0 A;  1UUR A;  1XFZ O;  2AAO A;  2ZRS A;  3SS3 A;  1MQ1 A;  1YRT B;  1UWO A;  1WY9 A;  2QAC A;  3D76 A;  3ICB A;  1KK8 B;  2KI6 D;  2QEV A;  3FWC A;  4IJ7 A;  4PAL A;  1QIV A;  2QPT A;  2M3W A;  1IQ3 A;  1LKJ A;  5CSF A;  3DF0 B;  2CT9 A;  2FCD A;  2VRG A;  3I5I C;  3R72 A;  4UPG A;  1DEL A;  1JF0 A;  1F4Q A;  1OSA A;  1SNL A;  5I2O A;  3WNX B;  3OB1 B;  3SG4 A;  3EG5 B;  4F7F A;  4ZCV A;  1WDC B;  2QDI A;  2KGR A;  2OS8 B;  1K9K A;  1HQV A;  1OZO A;  3FE8 A;  3I5H B;  4OKH A;  1YUU A;  1RRO A;  3DF0 A;  1J7O A;  2Y1N A;  2WC8 A;  1WDC C;  1XFW O;  3TUY B;  2KLE A;  3HX4 A;  2GV5 A;  1XFX O;  1NX0 A;  4MZL A;  1B7T Z;  2JT8 A;  3N7H A;  1OOJ A;  3EK4 A;  5HKY A;  4I5K A;  3PAL A;  2AUC A;  4AQJ A;  2LLT A;  3EKH A;  3PN7 C;  1TUJ A;  4BY5 A;  4DRW A;  1EG4 A;  2I7A A;  2PRU A;  1IJ6 A;  1SPY A;  4PCW A;  4P2Y B;  2KI4 B;  2A4J A;  2H2K A;  2KFF A;  1OMV A;  2O5G A;  2JC2 A;  3K1E A;  4JQ0 D;  1C3Z A;  2KBI A;  3D10 A;  4A4B A;  3DD4 A;  1ZOT B;  1NCY A;  4NQG A;  1M46 A;  1SBJ A;  2Q4U A;  2D8N A;  1J1E A;  2OPO A;  2OTG C;  3OX5 A;  2KQY A;  1OOF A;  3PSR A;  2F3Y A;  5D7F A;  1AVS A;  3BOW B;  4DIR A;  4M2Q A;  2JQ6 A;  1CLB A;  2KI6 C;  1S3P A;  1BJF A;  3BUM B;  1WRZ A;  2L5Y A;  1PVA A;  4N1F A;  1OOH A;  1ZUZ A;  1PUL A;  3DVK A;  1MF8 B;  2LNK A;  2M97 A;  1QVI Y;  1N65 A;  2P70 A;  2ZRT A;  2MAZ A;  1UHN A;  3LL8 B;  4M2P A;  1WLZ A;  5J3X A;  1XVJ A;  3SS4 A;  1CDM A;  3BOW A;  2MA2 A;  4C0J A;  1MWN A;  1Y0V H;  3CTN A;  1L7Z A;  1KQM C;  1ZAC A;  1K94 A;  3GK2 A;  3O6B A;  3S0G A;  2FOT A;  2LMT A;  1B8C A;  1WLM A;  2BCB A;  1DT7 B;  4NDB A;  1U5I A;  2M1U A;  1ALW A;  3OB2 B;  1LXF C;  2NXQ A;  3L47 A;  1CNP A;  1XFR A;  2GGM A;  1Y1A A;  4HRE E;  1RWY A;  4MRY A;  1TUZ A;  4MVF A;  2ISD A;  4CPV A;  1UHH A;  4JWQ A;  3VRQ A;  3L4L A;  3JTD B;  2NLN A;  4TNC A;  1KSM A;  1E8A A;  5I94 A;  2K0J A;  1W7I B;  3NXA A;  2BCX A;  2M1K B;  1KCY A;  3IQQ A;  3CR5 X;  1B9A A;  1W7J B;  1KK7 Y;  2MRD A; 
#chains in the Genus database with same CATH homology
 2CTN A;  1TNX A;  1YVL A;  2HQW A;  2JTT A;  1WRK A;  1YUS A;  2K7O A;  5BPJ A;  1IWQ A;  1BU3 A;  2JTZ A;  2KYC A;  2ZND A;  3CZT X;  3TDU A;  1BMO A;  4PE0 A;  2R2I A;  3NSI A;  2JT3 A;  1NYA A;  4QJ3 B;  1SL8 A;  3KHE A;  3CGA A;  1GGZ A;  2H61 C;  1NX2 A;  1DJX A;  4MBE A;  1J7P A;  2EC6 C;  4MSP A;  1RJV A;  3JVT C;  1DMO A;  1QAS A;  1CM1 A;  2H61 A;  4CID A;  2WOR A;  2LLS A;  4WQ3 A;  2KNE A;  1C07 A;  1M45 A;  3KF9 A;  1R6P A;  3I5G C;  4R1E A;  3IF7 A;  5HLO A;  3KPX A;  3H4S E;  2PVB A;  1DGV A;  1QV0 A;  1F71 A;  1DJI A;  1RTP 1;  4DCK A;  1LA0 A;  3SJS A;  2LMV A;  3BXK A;  2LM5 A;  1BOD A;  2BBN A;  3LK0 A;  1A4P A;  1QJT A;  2WCF A;  2KHN A;  3BUW B;  1LIN A;  1Y6W A;  1K93 D;  4PHK A;  2M7L A;  1CM4 A;  2G2B A;  3I5I B;  4I5J A;  1VRK A;  1QTX A;  2MLF C;  2DOQ A;  4D1E A;  1DTL A;  3M0W A;  4QJ5 B;  1N2D A;  4NDD A;  3CR2 A;  3PLF B;  1FI6 A;  1CFD A;  1QX5 B;  1UHJ A;  1C7V A;  1AJ5 A;  1KQV A;  2EHB A;  5PAL A;  2WOS A;  2KDH A;  4ORC B;  4PE7 A;  1AUI B;  2L5X B;  3I5F C;  5AAN A;  1YUT A;  2WCE A;  4GBA A;  5G08 A;  2K7C A;  3EKJ A;  3IQO A;  4IL1 A;  3BUN B;  3VRR A;  2LUX A;  4YI9 A;  1K9P A;  2M7N A;  3O78 A;  2COL B;  1D1O A;  2L51 A;  1CMG A;  4MZK A;  1TRF A;  1J1D A;  2LV7 A;  3PN7 B;  1AK8 A;  3TDZ A;  5CPV A;  2F2P A;  3CLN A;  2LVI A;  3NSL A;  1CMF A;  4YGB B;  3O2P A;  1OQP A;  4USL A;  1F54 A;  4Q04 A;  1B8R A;  1NIW A;  2LHL A;  4GAO A;  1NUB A;  2KGB C;  1M39 A;  2LP3 A;  2LMU A;  2L50 A;  1TNQ A;  5DKN A;  3OX6 A;  2E30 A;  2OTG B;  1DGU A;  5AXI A;  3ZNI A;  1R2U A;  1FBV A;  4YGC B;  1YTZ C;  2FCE A;  4N1G A;  3FWB A;  1SMG A;  2Y5I A;  3SG6 A;  1K2H A;  4PE4 A;  4BY4 A;  3GOF A;  1G33 A;  5B8I B;  2P6B B;  3RLZ A;  2KFH A;  4OCI A;  2RGI A;  5GQQ C;  1UUS A;  3MSE B;  1CDP A;  1OMD A;  1TNP A;  2LE9 B;  4F0Z B;  3DVJ A;  1BF5 A;  1U5I B;  1V1G A;  1KQM B;  5IBW A;  3TDI A;  1A2X A;  3WXA A;  2BEC A;  2LCP A;  2F8P A;  4YGA A;  1QV1 A;  1KWO C;  1S5G Y;  5TNC A;  1REC A;  1JWD A;  1TCF A;  4ETO A;  1QXP A;  1S26 D;  5I2L A;  1G8I A;  5JJG A;  1TN4 A;  2M29 A;  2O60 A;  1SY9 A;  1MUX A;  5CSJ A;  2E6W A;  1L2O C;  1Q80 A;  4PHM A;  1JBA A;  3O4Y A;  2MBX A;  4L9M A;  1WRL A;  1JC2 A;  1B7T Y;  4OV2 A;  1EH2 A;  2CNP A;  2HPS A;  3DVM A;  1S1E A;  1BR4 B;  4MZJ A;  4WQ2 A;  3AAJ A;  1YX8 A;  1XFV O;  1CFC A;  2EC6 B;  3JVT B;  2MJW B;  1SW8 A;  1Y1X A;  3VRO A;  2JXL A;  1QX7 A;  1J7Q A;  1YX7 A;  2L4I A;  1IH0 A;  2M49 B;  1S6I A;  1F8H A;  4PE1 A;  1XK4 C;  4AOM A;  1JFK A;  3I5G B;  2KFG A;  1EG3 A;  1FI5 A;  1S36 A;  2L2E A;  4ICB A;  1DF0 B;  1MXL C;  1BOC A;  1XYD A;  1ALV A;  3RM1 A;  3AKA A;  1F4O A;  4PHN A;  1CB1 A;  4DS7 A;  1Y1U A;  1MHO A;  1SCV A;  2ZN8 A;  1NPQ A;  2LAP A;  1SR6 C;  2CBL A;  4GGF C;  1YVH A;  3A4U B;  2IS9 A;  3GK4 X;  5FYX A;  1SKT A;  2MLE C;  2PAL A;  5DKQ A;  2BL0 C;  1IKU A;  2ZFD A;  1DF0 A;  1QX2 A;  4GGF A;  4AQI A;  1TTX A;  4FTG A;  3BUX B;  1UP5 A;  1ZMZ A;  1BR1 B;  3VRP A;  4XYN A;  3TS5 C;  3QRX A;  1GGW A;  2V53 A;  1QAT A;  2WCB A;  1DJZ A;  1AJ4 A;  5I2Q A;  1NP8 A;  1XFU O;  1TCO B;  1YUR A;  1JF2 A;  1JUO A;  1K95 A;  2LC5 A;  1M63 B;  1A29 A;  1IRJ A;  1DVI A;  1DJG A;  3I5F B;  1YRU B;  3OHM B;  2G9B A;  1UHK A;  1QLK A;  4N5X A;  2Y1M A;  1AP4 A;  2LLU A;  1B4C A;  3GK1 A;  3BUO B;  3EVR A;  3ZWH A;  2EGD A;  5KSZ A;  4GGN A;  4CFQ A;  1FF1 A;  2B1U A;  1EXR A;  1YR5 A;  2BE4 A;  5ER4 X;  5AEQ A;  1SCM C;  2Q91 A;  2JPT A;  3CS1 A;  1BT6 A;  3SG3 A;  3KEV A;  3FIA A;  2HQ8 A;  1CFP A;  2I18 A;  1BLQ A;  1SRA A;  3SG5 A;  1AHR A;  1X02 A;  1QVI Z;  2L0P A;  3CR4 X;  5D69 A;  4HRG A;  1A75 B;  2NCP A;  1PAL A;  2JOJ A;  1J7R A;  2HET A;  1KK8 C;  4MEW A;  1CKK A;  1XA5 A;  1K90 D;  1EL4 A;  2JRF A;  4YGE B;  2KYF A;  3BQ3 A;  1S5G Z;  2FJU B;  1PSB A;  2L98 A;  1ODB A;  2BE6 A;  1KSO A;  1PK0 D;  1S6C A;  2F33 A;  4C0K A;  1XFY O;  1DJW A;  4YI8 A;  1IJ5 A;  3SIB A;  1B8L A;  1MR8 A;  4ORA B;  2I2R E;  1A75 A;  2PMY A;  4PHJ A;  1FW4 A;  5K89 A;  2BBM A;  3F45 A;  2LHI A;  3VGO A;  4GFT A;  2KAX A;  2K8M B;  1PRW A;  1NX1 A;  2OS8 C;  3SIA A;  3VRN A;  1K9U A;  5DKR A;  3I5H C;  1EJ3 A;  1K8U A;  2ZNE A;  3D0Y B;  1KK7 Z;  1LVC D;  4ZCU A;  5AFP A;  2KQ6 A;  3TUY C;  1TOP A;  1PSR A;  2JNX A;  1HT9 A;  3A8R A;  3HCM A;  2LP2 A;  3DVE A;  1RK9 A;  3PAT A;  2ZKM X;  2JT0 A;  5HKW A;  1CLM A;  1KWO B;  4DUQ A;  1OMR A;  3LLE A;  2LAN A;  1KFU L;  1NX3 A;  1IQ5 A;  1GQM A;  1KFX L;  1JSA A;  3D0Y A;  2ZN9 A;  5CSN A;  1RFJ A;  3KO0 A;  2SAS A;  2JUL A;  4GUK A;  1N0Y A;  1B47 A;  1TIZ A;  1TNW A;  3WHU B;  4CFR A;  1B1G A;  2KI4 C;  5AER A;  1L2O B;  2Y4Q A;  1K96 A;  1SYM A;  4JPZ B;  5ER5 A;  1NWD A;  5JOL A;  2BKI B;  2GGZ A;  1OZS A;  4I5N B;  5KU1 A;  2AMI A;  2PAS A;  1M31 A;  2CXJ A;  3CWG A;  1XO5 A;  2LVK A;  2LVV A;  2LUC A;  1ZFS A;  3WHT B;  2PSR A;  4WRI A;  1SL7 A;  1FPW A;  3BYA A;  3PFV A;  1UHI A;  4QJ4 B;  3NSO A;  2K2A A;  4MRX A;  2BCA A;  2KOT A;  2K2F A;  4U8D A;  2JZI A;  1CLL A;  2K61 A;  1QIW A;  3K21 A;  5HKZ A;  4C0L A;  3SG7 A;  3TZ1 A;  4HSZ A;  2JXC A;  4ORB B;  4HRH A;  2K7D A;  2JU0 A;  4A4C A;  5HLV A;  1SR6 B;  4MLW A;  4GPL B;  2JNF A;  5I8N A;  3EK7 A;  2K7B A;  1QS7 A;  1XK4 A;  2BL0 B;  3EK8 A;  1JFJ A;  2WND A;  3AAK A;  1F70 A;  2KSP A;  2F2O A;  2MHH A;  2BKH B;  3AKB A;  3JTD C;  4OVN F;  1G4Y R;  2KBM A;  2NCO A;  1H8B A;  2SCP A;  4M2O A;  1J55 A;  1NSH A;  3LCP C;  4I5L B;  3SG2 A;  1H4B A;  3FS7 A;  4YBH B;  1QLS A;  4MN0 A;  4YRU A;  2M8U A;  3PM8 A;  1C7W A;  3TS5 B;  1CFF A;  4GNK B;  1BG1 A;  1SL9 A;  1CDN A;  1F55 A;  1SK6 D;  1NCX A;  1OE9 B;  2HF5 A;  2KAV A;  4PDZ A;  1DJY A;  1NCZ A;  4XJK B;  2TN4 A;  2JWW A;  2M0R A;  4YGD B;  1S6J A;  1DJH A;  1CTR A;  5HYD A;  1IGV A;  1LA3 A;  1PVB A;  4E68 A;  2F3Z A;  3OP0 A;  2I94 A;  1GJY A;  4P5O E;  3E3R A;  4CLN A;  3NSK A;  1A03 A;  1MXE A;  5KTY A;  2CCM A;  1V1F A;  5CSI A;  4OR9 B;  2L4H A;  1KFU S;  3C1V A;  3LK1 A;  2M9G A;  4XJK A;  2KAY A;  1KFX S;  1SCM B;  4NDC A;  2LVJ A;  3EVV A;  4FQO A;  1IG5 A;  3EVU A;  5F6T A;  1CDL A;  2NZ0 A;  1UUR A;  1XFZ O;  2AAO A;  2ZRS A;  1MQ1 A;  1YRT B;  1UWO A;  1WY9 A;  2QAC A;  3ICB A;  4PAL A;  1KK8 B;  2KI6 D;  3FWC A;  1QIV A;  2QPT A;  2M3W A;  1IQ3 A;  1LKJ A;  5CSF A;  3DF0 B;  2CT9 A;  2FCD A;  2VRG A;  3I5I C;  4UPG A;  1JF0 A;  1F4Q A;  1OSA A;  1SNL A;  5I2O A;  3WNX B;  3OB1 B;  3SG4 A;  4ZCV A;  1WDC B;  2KGR A;  2OS8 B;  1K9K A;  1HQV A;  1OZO A;  3I5H B;  4OKH A;  1YUU A;  1RRO A;  3DF0 A;  1J7O A;  2Y1N A;  2WC8 A;  1WDC C;  1XFW O;  3TUY B;  3HX4 A;  2GV5 A;  1XFX O;  1NX0 A;  4MZL A;  1B7T Z;  2JT8 A;  1OOJ A;  3EK4 A;  5HKY A;  4I5K A;  3PAL A;  2AUC A;  4AQJ A;  2LLT A;  3EKH A;  3PN7 C;  4BY5 A;  4DRW A;  1EG4 A;  2I7A A;  2PRU A;  1IJ6 A;  1SPY A;  4PCW A;  4P2Y B;  2KI4 B;  2A4J A;  2H2K A;  2KFF A;  1OMV A;  2O5G A;  2JC2 A;  4JQ0 D;  2KBI A;  3D10 A;  4A4B A;  3DD4 A;  1ZOT B;  1NCY A;  4NQG A;  1M46 A;  1SBJ A;  2Q4U A;  2D8N A;  1J1E A;  2OPO A;  2OTG C;  3OX5 A;  2KQY A;  3PSR A;  5D7F A;  2F3Y A;  1AVS A;  3BOW B;  4DIR A;  4M2Q A;  2JQ6 A;  1CLB A;  2KI6 C;  1S3P A;  1BJF A;  3BUM B;  1WRZ A;  1PVA A;  4N1F A;  1ZUZ A;  1PUL A;  3DVK A;  1MF8 B;  2LNK A;  2M97 A;  1QVI Y;  1N65 A;  2ZRT A;  2MAZ A;  1UHN A;  3LL8 B;  4M2P A;  1WLZ A;  5J3X A;  1XVJ A;  1CDM A;  3BOW A;  2MA2 A;  4C0J A;  1MWN A;  1Y0V H;  3CTN A;  1L7Z A;  1KQM C;  1ZAC A;  1K94 A;  3GK2 A;  3O6B A;  2FOT A;  2LMT A;  1B8C A;  1WLM A;  2BCB A;  1DT7 B;  4NDB A;  1U5I A;  2M1U A;  1ALW A;  3OB2 B;  1LXF C;  2NXQ A;  1CNP A;  2GGM A;  4HRE E;  1Y1A A;  4MRY A;  1RWY A;  4MVF A;  2ISD A;  4CPV A;  1UHH A;  4JWQ A;  3VRQ A;  3JTD B;  2NLN A;  4TNC A;  1KSM A;  1E8A A;  2K0J A;  1W7I B;  3NXA A;  2BCX A;  2M1K B;  1KCY A;  3IQQ A;  3CR5 X;  1B9A A;  1W7J B;  1KK7 Y;  2MRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...