3PN7B

Visualizing new hinges and a potential major source of compliance in the lever arm of myosin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
RLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Visualizing key hinges and a potential major source of compliance in the lever arm of myosin.
pubmed doi rcsb
molecule tags Protein binding
total genus 44
structure length 141
sequence length 141
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7B01
1BLQA 3I5FC 2KI4B 2FJUB 1F4QA 4PE7A 3BOWA 2L4IA 1NCZA 3BQ3A 1TN4A 2Y4QA 1E8AA 1MQ1A 2O60A 5ER4X 3SG2A 1NCYA 4ICBA 1K90D 3I5FB 2KQ6A 1SCMC 1WRLA 2FCDA 1ZACA 2I2RE 1YUUA 2JTZA 2LP3A 2TN4A 1R2UA 2HETA 1SK6D 3SG5A 3A8RA 2LHIA 2JOJA 3ICBA 1MWNA 1A03A 2M3WA 4YGAA 5HKYA 1CB1A 1SCMB 3EKHA 4MN0A 2LUCA 1J1DA 1Q80A 1RECA 1D1OA 2RGIA 1UHJA 1YX7A 3K21A 4DUQA 1AK8A 4QJ5B 5ER5A 1OOJA 1K9KA 1XFUO 1SBJA 2CTNA 1DJYA 2FCEA 1XFVO 2K7CA 2ZN9A 3WHTB 1H4BA 1SL8A 1AHRA 5I2QA 1WLZA 1U5IA 2KHNA 1J7PA 2BECA 3PSRA 4PHMA 4AOMA 1WDCC 3DF0B 4ORAB 1M45A 2LE9B 2SCPA 1A75A 4WQ2A 2K7OA 5CSFA 4WRIA 1BF5A 2PRUA 2CXJA 3RM1A 1S1EA 5TNCA 1LA3A 2EGDA 3HCMA 1WDCB 3BUMB 1B47A 1TNQA 3TUYC 4Q04A 1QV0A 1XK4C 4CFRA 3IQQA 1KK8B 1LVCD 1UP5A 2KYCA 3TUYB 1AJ4A 3WXAA 2ZRTA 1UHIA 3GK4X 4OV2A 4GNKB 2NCPA 3AKBA 1DJHA 1DMOA 1K93D 1KWOC 1BODA 3BUNB 1V1GA 1ZFSA 1QLKA 4PE4A 1K8UA 3KO0A 4IL1A 1M39A 1FF1A 5KU1A 1KFXL 1PALA 3PLFB 1G8IA 1EJ3A 3GOFA 2K7BA 3CR2A 3BYAA 2JULA 1QTXA 2WOSA 3BOWB 3E3RA 4HREE 4ORBB 1NCXA 2NCOA 4I5NB 2K0JA 3I5HC 5IBWA 5DKRA 1LKJA 1K9UA 1QIWA 2MLEC 1RFJA 4OCIA 2L98A 1IQ5A 3IF7A 1AP4A 3ZWHA 4AQJA 3BUXB 2LC5A 2H61C 1XA5A 1Y1AA 3OB2B 1R6PA 2JNFA 3SG6A 3VRNA 3I5HB 1M63B 2B1UA 1QASA 2L5XB 1SW8A 1CLBA 1NX0A 2ISDA 4CLNA 4XJKA 2PMYA 5AFPA 1N2DA 4CFQA 4OVNF 1RROA 4M2PA 1OMVA 2OS8C 1NUBA 2AAOA 1OZOA 1KCYA 4C0JA 2MJWB 4MRXA 1NX2A 2K61A 3TDZA 2LMUA 2CNPA 3TS5C 1FI6A 1SMGA 2ZN8A 1B4CA 1YRUB 1XFYO 2JRFA 2KDHA 4AQIA 1FPWA 2OPOA 1SRAA 3CZTX 1DJIA 1V1FA 5D7FA 1IRJA 1LA0A 1TCOB 3WNXB 1EH2A 3EVRA 1LINA 4OR9B 1U5IB 2V53A 1ZMZA 2BKHB 1PK0D 1XVJA 2WC8A 1L2OC 1K95A 1XFXO 1BR4B 3SIAA 1CMFA 2HQ8A 4R1EA 2BE6A 1A75B 1G4YR 3EK4A 3TDIA 1ZUZA 3F45A 5B8IB 2K8MB 2JT8A 4GAOA 1F8HA 1J55A 3CR4X 1OE9B 4NQGA 1YUTA 3CLNA 1PVAA 2JXCA 4M2OA 3OB1B 2JNXA 5HKZA 4GPLB 3I5GC 3VGOA 1ODBA 1TIZA 2MRDA 3JVTC 1AVSA 5HKWA 4F0ZB 4QJ4B 2KBMA 1NX3A 4NDCA 3FS7A 3QRXA 1DJWA 3LL8B 3GK2A 4CPVA 1RJVA 4WQ3A 4YGBB 3I5GB 1XFWO 3OHMB 2BBMA 4YRUA 2I18A 5I8NA 2F3YA 4YI8A 2GV5A 2O5GA 1BJFA 4PE0A 1B8RA 5AXIA 1IJ5A 2GGMA 2JXLA 5G08A 2MAZA 3D10A 3LK1A 1QJTA 2BBNA 3LK0A 2LMTA 1F70A 2GGZA 2HQWA 4JQ0D 4MEWA 4MZKA 2F8PA 5HLVA 1L7ZA 1Y1XA 2NLNA 1DJXA 2BL0C 3SG4A 1PULA 1RK9A 4YI9A 2BKIB 3EVUA 1TNPA 1BT6A 3O4YA 5CPVA 4ZCVA 3CWGA 1DF0A 1S6CA 1SR6C 2KYFA 4GFTA 1K2HA 4A4CA 3MSEB 1MUXA 1IQ3A 1QS7A 2CT9A 1EG3A 4U8DA 4GGFA 1AJ5A 1F4OA 5PALA 3GK1A 2LVKA 1SR6B 1GGWA 1NX1A 2LLTA 5J3XA 5GQQC 3M0WA 4CIDA 2JT3A 2LM5A 3FWCA 1YVHA 1OSAA 1CFDA 2Y1NA 4N1GA 4HRGA 3PALA 4MZLA 1S5GZ 4PHNA 1QX7A 3O6BA 3RLZA 4BY5A 4I5JA 1CFPA 5F6TA 1XO5A 2KFFA 1CM4A 2L50A 1M46A 1DGVA 1J7RA 2LVJA 3CGAA 2LV7A 3FIAA 4HSZA 4TNCA 1SL9A 3BXKA 1CFCA 1CMGA 3OX5A 5I2OA 4FQOA 2MA2A 4DRWA 1QX5B 1B8CA 1Y6WA 1BMOA 2I94A 4NDBA 1K96A 1KWOB 3PFVA 1JF2A 5FYXA 3SG7A 4ETOA 1NWDA 3VRPA 1CTRA 1KSMA 1KSOA 2KAYA 2LLSA 2CBLA 2R2IA 2M0RA 3ZNIA 2QPTA 3DVEA 2E30A 3NSLA 4QJ3B 2I7AA 3VRRA 1S5GY 4GUKA 2MLFC 1UHKA 1RTP1 3LLEA 2M97A 2EHBA 1K94A 1F54A 2LHLA 1CLMA 4YBHB 4PHKA 4YGEB 1MHOA 1FW4A 4MZJA 3VRQA 1ZOTB 3EKJA 2EC6C 1NP8A 3D0YA 1YVLA 4HRHA 1GQMA 2G9BA 4DS7A 2WCEA 1KFUL 1NPQA 1PVBA 1SY9A 2LP2A 3DVMA 1BR1B 1QVIZ 4MBEA 5DKNA 1CNPA 3H4SE 1A4PA 1CM1A 2EC6B 3FWBA 1KFXS 2HPSA 2WORA 5HLOA 1DJGA 1A29A 4ORCB 3DF0A 4PCWA 3NSIA 1GJYA 2KQYA 1B8LA 3DVKA 2MHHA 1DGUA 4MLWA 2AUCA 1VRKA 2BCAA 2F33A 2JPTA 2Y1MA 4N1FA 1OMRA 4MSPA 4MVFA 2P6BB 2OS8B 1CDLA 1QLSA 1TNXA 1UUSA 2KSPA 2L2EA 3CS1A 3TS5B 1JBAA 2L51A 4GGNA 1DTLA 1WLMA 3PATA 1B9AA 4GGFC 3TDUA 3AAKA 2OTGC 1SCVA 1XFZO 2ZFDA 1B1GA 1QVIY 3CTNA 4ZCUA 2LANA 2LNKA 2E6WA 1CDMA 5AEQA 1L2OB 2M1KB 4USLA 3CR5X 2D8NA 2JT0A 4N5XA 2KAVA 1CKKA 1SKTA 2OTGB 2BE4A 3EVVA 1N0YA 1SNLA 5BPJA 1MXLC 1IGVA 1RWYA 1S3PA 3BUOB 4YGDB 2ZNEA 2DOQA 2KI4C 2NZ0A 4DIRA 1SPYA 1QXPA 2Y5IA 3EK8A 4PE1A 3VROA 1JSAA 1GGZA 2M7NA 2K2FA 2LVVA 2PASA 2PSRA 3AKAA 4M2QA 3JVTB 4P5OE 2JQ6A 4FTGA 2AMIA 1C7VA 2CCMA 1LXFC 2VRGA 2JC2A 1HQVA 4MRYA 1JF0A 1QIVA 4C0KA 1YTZC 2KGRA 5JJGA 1ALVA 1TNWA 4BY4A 1KK7Z 1JUOA 1J7OA 1OMDA 2F3ZA 1X02A 4OKHA 1IJ6A 2L4HA 2M1UA 1QX2A 5I2LA 4XYNA 2H61A 1C07A 1DVIA 3O78A 4PHJA 2JZIA 2BL0B 2K7DA 1WY9A 2IS9A 4UPGA 1EG4A 4JPZB 3D0YB 2NXQA 1TCFA 1ALWA 3JTDC 4XJKB 4PDZA 1FBVA 1S26D 3C1VA 5CSNA 1YR5A 5DKQA 1MR8A 4PALA 1KK7Y 1EL4A 1OQPA 2JU0A 1PSBA 4A4BA 3KPXA 2KFHA 3JTDB 3TZ1A 2K2AA 2M7LA 1H8BA 3KHEA 5KTYA 1NIWA 2ZNDA 1J7QA 3SJSA 2L0PA 3BUWB 2Q4UA 1KK8C 1SYMA 2KAXA 1M31A 2QACA 4GBAA 3OX6A 5CSJA 1XYDA 3O2PA 1OZSA 4I5LB 3KEVA 1HT9A 1YURA 4E68A 1MF8B 1DJZA 1N65A 2G2BA 2KGBC 1B7TZ 4DCKA 1CDNA 1JC2A 2KI6D 1JFJA 2WCBA 1YX8A 2PVBA 1F55A 2KFGA 2M8UA 2WNDA 3OP0A 5AANA 2BCXA 4D1EA 2KNEA 2HF5A 2FOTA 1BOCA 1TOPA 2PALA 1C7WA 1DT7B 1QV1A 1BU3A 1SL7A 2WCFA 1K9PA 1PSRA 1UURA 5K89A 3HX4A 2M49B 1MXEA 1CFFA 5CSIA 1JWDA 1KQVA 5D69A 1JFKA 2BCBA 1G33A 1F71A 2ZKMX 1S6JA 1AUIB 1UWOA 1WRKA 4C0LA 2A4JA 1W7JB 1BG1A 1B7TY 2JWWA 4YGCB 3SG3A 3EK7A 5JOLA 3LCPC 1WRZA 3KF9A 5AERA 3NXAA 3NSKA 3SIBA 3I5IC 2F2OA 2H2KA 2LLUA 4NDDA 3IQOA 3PN7C 3AAJA 2LVIA 2KOTA 2KI6C 3WHUB 1FI5A 1YUSA 1EXRA 2LCPA 1PRWA 1DF0B 3I5IB 1UHNA 1W7IB 2SASA 2M29A 3NSOA 4P2YB 1IH0A 1IG5A 1KQMC 4I5KA 3PN7B 3PM8A 1YRTB 2LMVA 2LUXA 5HYDA 1S6IA 2LAPA 1Y1UA 5KSZA 1KFUS 4L9MA 1CDPA 1XK4A 2ZRSA 1TTXA 1TRFA 2Q91A 1IKUA 1J1EA 1Y0VH 2JTTA 1KQMB 1CLLA 2MBXA 1IWQA 3DD4A 3DVJA 1A2XA 2M9GA 2F2PA 1NYAA 1QATA 1UHHA 2KBIA 3A4UB 1S36A 2COLB 4JWQA 1NSHA
chains in the Genus database with same CATH superfamily
1BLQA 3I5FC 2KI4B 1W9ZA 1F4QA 2FJUB 4PE7A 3BOWA 4MVFA 2L4IA 1NCZA 3BQ3A 1TN4A 2Y4QA 1E8AA 1MQ1A 2O60A 5ER4X 3SG2A 3VB1A 1NCYA 4ICBA 1K90D 3I5FB 2KQ6A 1SCMC 1WRLA 2FCDA 1ZACA 2I2RE 1YUUA 2JTZA 2LP3A 2TN4A 1R2UA 3D77A 2HETA 1SK6D 3SG5A 3A8RA 2LHIA 2JOJA 3DXLA 3ICBA 1MWNA 1A03A 2M3WA 4YGAA 5HKYA 1CB1A 1SCMB 3EKHA 4MN0A 2LUCA 1J1DA 1Q80A 1RECA 1D1OA 2RGIA 1UHJA 1YX7A 4JKTA 3K21A 3R1VA 4DUQA 1AK8A 4QJ5B 3EG5B 1OOJA 5ER5A 1K9KA 1XFUO 1SBJA 2CTNA 1DJYA 2FCEA 1XFVO 2K7CA 2ZN9A 3WHTB 1H4BA 5FI6A 3L47A 1SL8A 1AHRA 5I2QA 1WLZA 1U5IA 2KHNA 1J7PA 2BECA 3PSRA 1Z2CB 4PHMA 4AOMA 1WDCC 3DF0B 4ORAB 1M45A 2LE9B 2SCPA 1A75A 4WQ2A 2K7OA 3B86A 4PT1A 5CSFA 4WRIA 1BF5A 2PRUA 2CXJA 3RM1A 1S1EA 5TNCA 1LA3A 3L4AA 2EGDA 3HCMA 1WDCB 3BUMB 1B47A 1TNQA 3TUYC 4Q04A 1QV0A 1XK4C 4CFRA 3O4XA 3IQQA 1KK8B 1LVCD 1UP5A 2KYCA 5I94A 3TUYB 1AJ4A 3UNWA 3WXAA 2ZRTA 1UHIA 3GK4X 4OV2A 4GNKB 2NCPA 3AKBA 1DJHA 1DMOA 1K93D 1KWOC 3NHTA 1BODA 3BUNB 1V1GA 1ZFSA 1QLKA 4PE4A 1K8UA 3KO0A 4IL1A 3PJIA 3D73A 1M39A 1FF1A 3SS5A 5KU1A 1KFXL 1PALA 3PLFB 1G8IA 1EJ3A 3GOFA 2K7BA 3CR2A 2P70A 2JPOA 3BYAA 2JULA 1QTXA 2WOSA 3BOWB 3E3RA 4HREE 4ORBB 1NCXA 2NCOA 4I5NB 2K0JA 3I5HC 5IBWA 5DKRA 1LKJA 1K9UA 1QIWA 2MLEC 1RFJA 4OCIA 2L98A 1IQ5A 3IF7A 1AP4A 3ZWHA 4AQJA 3BUXB 2LC5A 2H61C 1XA5A 1Y1AA 3OB2B 1R6PA 2JNFA 3SG6A 3VRNA 3I5HB 1M63B 2B1UA 1QASA 3FE9A 2L5XB 1SW8A 1CLBA 1NX0A 2ISDA 4CLNA 2WCJA 3B7AA 4XJKA 2PMYA 5AFPA 1N2DA 4CFQA 4OVNF 1RROA 2WCHA 4M2PA 1OMVA 5D3OA 2OS8C 1NUBA 3D76A 2AAOA 1OZOA 1KCYA 3NHIA 3V2LA 4C0JA 2MJWB 4MRXA 1NX2A 2K61A 3TDZA 2LMUA 2CNPA 3TS5C 1FI6A 1SMGA 3BFHA 2ZN8A 1B4CA 3CZ2A 1YRUB 1XFYO 2JRFA 2KDHA 1TUZA 3S0GA 4AQIA 1FPWA 2OPOA 1DELA 1SRAA 4IJ7A 3CZTX 1DJIA 1V1FA 5D7FA 1IRJA 1LA0A 1TCOB 3WNXB 1EH2A 3EVRA 1LINA 2QEHA 3BFAA 1U5IB 4OR9B 2V53A 1ZMZA 2BKHB 1PK0D 1XVJA 2WC8A 1L2OC 1K95A 1XFXO 1BR4B 3SIAA 1CMFA 2HQ8A 4R1EA 2BE6A 1A75B 1G4YR 3EK4A 3TDIA 1ZUZA 3F45A 2QEBA 5B8IB 2K8MB 2JT8A 4GAOA 1F8HA 1J55A 3CR4X 3CZ1A 1OE9B 4NQGA 1YUTA 3CLNA 1PVAA 2JXCA 2WC6A 4M2OA 3OB1B 2JNXA 5HKZA 4GPLB 3I5GC 3VGOA 1ODBA 1TIZA 2MRDA 3JVTC 1AVSA 5HKWA 4F0ZB 4QJ4B 2KBMA 1NX3A 4NDCA 3FS7A 3PM2A 3QRXA 1DJWA 3LL8B 3GK2A 4CPVA 1RJVA 4WQ3A 4YGBB 3I5GB 5FI2A 1XFWO 3OHMB 2BBMA 4YRUA 2I18A 5I8NA 2F3YA 4YI8A 2GV5A 2O5GA 1BJFA 4PE0A 1B8RA 4KYNA 5AXIA 1IJ5A 2GGMA 2JXLA 3B88A 3BFBA 2MAZA 5G08A 3D10A 3LK1A 1QJTA 2BBNA 3LK0A 2LMTA 1F70A 2GGZA 2HQWA 4JQ0D 4MEWA 4MZKA 2F8PA 1DQEA 1L7ZA 1Y1XA 2NLNA 5HLVA 1DJXA 2BL0C 3SG4A 1PULA 1RK9A 4YI9A 2BKIB 3EVUA 1TNPA 1BT6A 3O4YA 5CPVA 4ZCVA 3CWGA 1DF0A 5FI7A 1S6CA 1SR6C 2KYFA 4GFTA 1K2HA 4A4CA 3MSEB 1MUXA 1IQ3A 1QS7A 2CT9A 1EG3A 4U8DA 3S0AA 4GGFA 1AJ5A 1F4OA 5PALA 3GK1A 2H8VA 5EL2A 2LVKA 1SR6B 1GGWA 1NX1A 2LLTA 5J3XA 5GQQC 3M0WA 4CIDA 2JT3A 2LM5A 3FWCA 1YVHA 1OSAA 1CFDA 2Y1NA 4N1GA 4HRGA 3PALA 4MZLA 2KLEA 1S5GZ 4PHNA 2PQLA 1QX7A 3O6BA 3RLZA 4BY5A 4I5JA 1CFPA 3CYZA 2WCLA 5F6TA 1T14A 1XO5A 2KFFA 1IIOA 1CM4A 2L50A 1M46A 1DGVA 1J7RA 2LVJA 3CGAA 2LV7A 2BAPA 3FIAA 4HSZA 1SL9A 3BXKA 4TNCA 1CFCA 3OX5A 3S0BA 4FQOA 5I2OA 2MA2A 3CABA 3S0DA 4DRWA 1QX5B 1B8CA 1Y6WA 1BMOA 2I94A 4NDBA 1K96A 1KWOB 3PFVA 1JF2A 5FYXA 3SG7A 4ETOA 1NWDA 3VRPA 1CTRA 1KSMA 1KSOA 2KAYA 2LLSA 2CBLA 2R2IA 2M0RA 3ZNIA 2QPTA 3DVEA 2E30A 3NSLA 4QJ3B 3OGNA 2I7AA 3VRRA 1S5GY 2P71A 3CDNA 4GUKA 1DC1A 2MLFC 1UHKA 1RTP1 3LLEA 2M97A 2EHBA 1K94A 1F54A 2LHLA 1CLMA 4YBHB 4PHKA 4YGEB 1MHOA 3DY9A 1FW4A 4MZJA 5HL1A 1TUJA 3VRQA 1ZOTB 3EKJA 2FJYA 2EC6C 1NP8A 3D0YA 1YVLA 4HRHA 2WC5A 1GQMA 2G9BA 3S0EA 4DS7A 2WCEA 3BJHA 1KFUL 1NPQA 1PVBA 1SY9A 2LP2A 3DVMA 1BR1B 1QVIZ 4MBEA 5DKNA 1CNPA 3H4SE 1A4PA 1CM1A 2EC6B 3FWBA 1KFXS 2HPSA 2WORA 5HLOA 1DJGA 1A29A 4ORCB 3DF0A 4PCWA 3NSIA 1ORGA 1GJYA 2KQYA 1B8LA 3DVKA 2MHHA 1DGUA 4MLWA 2AUCA 1VRKA 2BCAA 2F33A 2JPTA 2Y1MA 4N1FA 1OMRA 2QEOA 4MSPA 2P6BB 1C3ZA 2OS8B 1CDLA 1QLSA 1TNXA 1UUSA 2KSPA 2L2EA 3CS1A 3TS5B 1JBAA 4INXA 3DZTA 2L51A 4GGNA 1DTLA 1WLMA 1OOFA 3PATA 1B9AA 3RZSA 4GGFC 3TDUA 3AAKA 2OTGC 1SCVA 1XFZO 2ZFDA 1B1GA 1QVIY 3CTNA 4ZCUA 2LANA 2LNKA 2E6WA 1CDMA 3D74A 1L2OB 2M1KB 5AEQA 4USLA 3CR5X 2D8NA 2JT0A 4JD9A 4N5XA 2KAVA 1CKKA 1SKTA 3FE6A 2OTGB 3FE8A 2BE4A 2L2CA 3EVVA 1N0YA 1SNLA 3K1EA 5BPJA 1OW4A 1MXLC 1IGVA 1RWYA 1S3PA 2K60A 3BUOB 2ZNEA 4YGDB 3SS3A 2DOQA 2KI4C 3QMEA 2NZ0A 4DIRA 1SPYA 4FQTA 1QXPA 2Y5IA 3EK8A 4PE1A 3VROA 1JSAA 2L5YA 1GGZA 2M7NA 2K2FA 2LVVA 2PASA 2PSRA 3AKAA 4M2QA 3JVTB 4P5OE 1TWOA 2JQ6A 4FTGA 2AMIA 1C7VA 3R1PA 2CCMA 1LXFC 2VRGA 1OOIX 2JC2A 1HQVA 4MRYA 1JF0A 1QIVA 4C0KA 1YTZC 2KGRA 5JJGA 1ALVA 1TNWA 4BY4A 1KK7Z 1JUOA 1J7OA 1OMDA 1OOHA 2F3ZA 1X02A 4OKHA 1IJ6A 2L4HA 2M1UA 1QX2A 5I2LA 3DYEA 2BNXA 1GM0A 4XYNA 2H61A 1C07A 1DVIA 3O78A 4PHJA 2JZIA 3NGVA 2BL0B 2K7DA 1WY9A 2IS9A 4UPGA 1EG4A 4JPZB 2QEVA 3D0YB 2NXQA 2PYQA 1TCFA 1ALWA 2WCKA 3JTDC 4XJKB 4PDZA 3B6XA 1FBVA 1S26D 3C1VA 5CSNA 1YR5A 5DKQA 1MR8A 4PALA 1KK7Y 1EL4A 1OQPA 2JU0A 1PSBA 4A4BA 3KPXA 2WCMA 3Q8IA 2KFHA 3JTDB 3R72A 3TZ1A 2K2AA 3UO9A 1DEKA 2M7LA 1H8BA 3KHEA 5KTYA 1NIWA 2ZNDA 1J7QA 3SJSA 2L0PA 3D75A 3BUWB 2Q4UA 1KK8C 1SYMA 2KAXA 1M31A 2QACA 4GBAA 3OX6A 5CSJA 1XYDA 2GTEA 2QDIA 1CMGA 3O2PA 1OZSA 4I5LB 1Z4HA 3KEVA 1HT9A 1YURA 4E68A 1MF8B 1DJZA 1N65A 2G2BA 2KGBC 1B7TZ 4INWA 4DCKA 3L4LA 2KI6D 1CDNA 1JC2A 1JFJA 2WCBA 1YX8A 2PVBA 1F55A 1P28A 2KFGA 2M8UA 2WNDA 3OP0A 5AANA 2BCXA 4D1EA 2KNEA 2HF5A 2FOTA 1BOCA 1TOPA 2PALA 1C7WA 1DT7B 1QV1A 1BU3A 1SL7A 2WCFA 1K9PA 1PSRA 1UURA 1OOGA 5K89A 3HX4A 2M49B 1MXEA 1CFFA 5CSIA 1JWDA 1KQVA 5D69A 1JFKA 2BCBA 3N7HA 3B87A 1G33A 1F71A 2ZKMX 1XFRA 1S6JA 1AUIB 3OBVA 1UWOA 1WRKA 4C0LA 2A4JA 1W7JB 1BG1A 1B7TY 2JWWA 4YGCB 2KPHA 3SG3A 3EK7A 5JOLA 1LS8A 3LCPC 1WRZA 3KF9A 3SS4A 5DICA 3D78A 5AERA 3NXAA 3NSKA 3SIBA 3I5IC 2F2OA 2H2KA 2LLUA 4NDDA 1C3YA 3IQOA 3PN7C 3AAJA 2LVIA 2KOTA 2KI6C 3WHUB 3CZ0A 1FI5A 1YUSA 1EXRA 1SSEB 2LCPA 1PRWA 4OZDA 1DF0B 3I5IB 1UHNA 1W7IB 2SASA 2M29A 3NSOA 4P2YB 1IH0A 1IG5A 1KQMC 4I5KA 3PN7B 3PM8A 1YRTB 3IVTA 2LMVA 2LUXA 5HYDA 1S6IA 2LAPA 1Y1UA 5KSZA 1KFUS 4L9MA 1CDPA 1XK4A 2ZRSA 1TTXA 2KLDA 1TRFA 2Q91A 1IKUA 1J1EA 1Y0VH 2YGUA 2JTTA 1KQMB 1CLLA 2MBXA 1IWQA 3S0FA 3DD4A 3DVJA 2ERBA 1A2XA 3R1OA 2M9GA 2F2PA 1NYAA 1QATA 1QWVA 1UHHA 2KBIA 4F7FA 3A4UB 1S36A 2COLB 4JWQA 1NSHA
chains in the Genus database with same CATH topology
1BLQA 3I5FC 2KI4B 2FJUB 1F4QA 4PE7A 3BOWA 2L4IA 1NCZA 3BQ3A 1TN4A 2Y4QA 1E8AA 1MQ1A 2O60A 5ER4X 3SG2A 1NCYA 4ICBA 1K90D 3I5FB 2KQ6A 1SCMC 1WRLA 2FCDA 1ZACA 2I2RE 1YUUA 2JTZA 2LP3A 2TN4A 1R2UA 2HETA 1SK6D 3SG5A 3A8RA 2LHIA 2JOJA 3ICBA 1MWNA 1A03A 2M3WA 4YGAA 5HKYA 1CB1A 1SCMB 3EKHA 4MN0A 2LUCA 1J1DA 1Q80A 1RECA 1D1OA 2RGIA 1UHJA 1YX7A 3K21A 4DUQA 1AK8A 4QJ5B 5ER5A 1OOJA 1K9KA 1XFUO 1SBJA 2CTNA 1DJYA 2FCEA 1XFVO 2K7CA 2ZN9A 3WHTB 1H4BA 1SL8A 1AHRA 5I2QA 1WLZA 1U5IA 2KHNA 1J7PA 2BECA 3PSRA 4PHMA 4AOMA 1WDCC 3DF0B 4ORAB 1M45A 2LE9B 2SCPA 1A75A 4WQ2A 2K7OA 5CSFA 4WRIA 1BF5A 2PRUA 2CXJA 3RM1A 1S1EA 5TNCA 1LA3A 2EGDA 3HCMA 1WDCB 3BUMB 1B47A 1TNQA 3TUYC 4Q04A 1QV0A 1XK4C 4CFRA 3IQQA 1KK8B 1LVCD 1UP5A 2KYCA 3TUYB 1AJ4A 3WXAA 2ZRTA 1UHIA 3GK4X 4OV2A 4GNKB 2NCPA 3AKBA 1DJHA 1DMOA 1K93D 1KWOC 1BODA 3BUNB 1V1GA 1ZFSA 1QLKA 4PE4A 1K8UA 3KO0A 4IL1A 1M39A 1FF1A 5KU1A 1KFXL 1PALA 3PLFB 1G8IA 1EJ3A 3GOFA 2K7BA 3CR2A 3BYAA 2JULA 1QTXA 2WOSA 3BOWB 3E3RA 4HREE 4ORBB 1NCXA 2NCOA 4I5NB 2K0JA 3I5HC 5IBWA 5DKRA 1LKJA 1K9UA 1QIWA 2MLEC 1RFJA 4OCIA 2L98A 1IQ5A 3IF7A 1AP4A 3ZWHA 4AQJA 3BUXB 2LC5A 2H61C 1XA5A 1Y1AA 3OB2B 1R6PA 2JNFA 3SG6A 3VRNA 3I5HB 1M63B 2B1UA 1QASA 2L5XB 1SW8A 1CLBA 1NX0A 2ISDA 4CLNA 4XJKA 2PMYA 5AFPA 1N2DA 4CFQA 4OVNF 1RROA 4M2PA 1OMVA 2OS8C 1NUBA 2AAOA 1OZOA 1KCYA 4C0JA 2MJWB 4MRXA 1NX2A 2K61A 3TDZA 2LMUA 2CNPA 3TS5C 1FI6A 1SMGA 2ZN8A 1B4CA 1YRUB 1XFYO 2JRFA 2KDHA 4AQIA 1FPWA 2OPOA 1SRAA 3CZTX 1DJIA 1V1FA 5D7FA 1IRJA 1LA0A 1TCOB 3WNXB 1EH2A 3EVRA 1LINA 4OR9B 1U5IB 2V53A 1ZMZA 2BKHB 1PK0D 1XVJA 2WC8A 1L2OC 1K95A 1XFXO 1BR4B 3SIAA 1CMFA 2HQ8A 4R1EA 2BE6A 1A75B 1G4YR 3EK4A 3TDIA 1ZUZA 3F45A 5B8IB 2K8MB 2JT8A 4GAOA 1F8HA 1J55A 3CR4X 1OE9B 4NQGA 1YUTA 3CLNA 1PVAA 2JXCA 4M2OA 3OB1B 2JNXA 5HKZA 4GPLB 3I5GC 3VGOA 1ODBA 1TIZA 2MRDA 3JVTC 1AVSA 5HKWA 4F0ZB 4QJ4B 2KBMA 1NX3A 4NDCA 3FS7A 3QRXA 1DJWA 3LL8B 3GK2A 4CPVA 1RJVA 4WQ3A 4YGBB 3I5GB 1XFWO 3OHMB 2BBMA 4YRUA 2I18A 5I8NA 2F3YA 4YI8A 2GV5A 2O5GA 1BJFA 4PE0A 1B8RA 5AXIA 1IJ5A 2GGMA 2JXLA 5G08A 2MAZA 3D10A 3LK1A 1QJTA 2BBNA 3LK0A 2LMTA 1F70A 2GGZA 2HQWA 4JQ0D 4MEWA 4MZKA 2F8PA 5HLVA 1L7ZA 1Y1XA 2NLNA 1DJXA 2BL0C 3SG4A 1PULA 1RK9A 4YI9A 2BKIB 3EVUA 1TNPA 1BT6A 3O4YA 5CPVA 4ZCVA 3CWGA 1DF0A 1S6CA 1SR6C 2KYFA 4GFTA 1K2HA 4A4CA 3MSEB 1MUXA 1IQ3A 1QS7A 2CT9A 1EG3A 4U8DA 4GGFA 1AJ5A 1F4OA 5PALA 3GK1A 2LVKA 1SR6B 1GGWA 1NX1A 2LLTA 5J3XA 5GQQC 3M0WA 4CIDA 2JT3A 2LM5A 3FWCA 1YVHA 1OSAA 1CFDA 2Y1NA 4N1GA 4HRGA 3PALA 4MZLA 1S5GZ 4PHNA 1QX7A 3O6BA 3RLZA 4BY5A 4I5JA 1CFPA 5F6TA 1XO5A 2KFFA 1CM4A 2L50A 1M46A 1DGVA 1J7RA 2LVJA 3CGAA 2LV7A 3FIAA 4HSZA 4TNCA 1SL9A 3BXKA 1CFCA 1CMGA 3OX5A 5I2OA 4FQOA 2MA2A 4DRWA 1QX5B 1B8CA 1Y6WA 1BMOA 2I94A 4NDBA 1K96A 1KWOB 3PFVA 1JF2A 5FYXA 3SG7A 4ETOA 1NWDA 3VRPA 1CTRA 1KSMA 1KSOA 2KAYA 2LLSA 2CBLA 2R2IA 2M0RA 3ZNIA 2QPTA 3DVEA 2E30A 3NSLA 4QJ3B 2I7AA 3VRRA 1S5GY 4GUKA 2MLFC 1UHKA 1RTP1 3LLEA 2M97A 2EHBA 1K94A 1F54A 2LHLA 1CLMA 4YBHB 4PHKA 4YGEB 1MHOA 1FW4A 4MZJA 3VRQA 1ZOTB 3EKJA 2EC6C 1NP8A 3D0YA 1YVLA 4HRHA 1GQMA 2G9BA 4DS7A 2WCEA 1KFUL 1NPQA 1PVBA 1SY9A 2LP2A 3DVMA 1BR1B 1QVIZ 4MBEA 5DKNA 1CNPA 3H4SE 1A4PA 1CM1A 2EC6B 3FWBA 1KFXS 2HPSA 2WORA 5HLOA 1DJGA 1A29A 4ORCB 3DF0A 4PCWA 3NSIA 1GJYA 2KQYA 1B8LA 3DVKA 2MHHA 1DGUA 4MLWA 2AUCA 1VRKA 2BCAA 2F33A 2JPTA 2Y1MA 4N1FA 1OMRA 4MSPA 4MVFA 2P6BB 2OS8B 1CDLA 1QLSA 1TNXA 1UUSA 2KSPA 2L2EA 3CS1A 3TS5B 1JBAA 2L51A 4GGNA 1DTLA 1WLMA 3PATA 1B9AA 4GGFC 3TDUA 3AAKA 2OTGC 1SCVA 1XFZO 2ZFDA 1B1GA 1QVIY 3CTNA 4ZCUA 2LANA 2LNKA 2E6WA 1CDMA 5AEQA 1L2OB 2M1KB 4USLA 3CR5X 2D8NA 2JT0A 4N5XA 2KAVA 1CKKA 1SKTA 2OTGB 2BE4A 3EVVA 1N0YA 1SNLA 5BPJA 1MXLC 1IGVA 1RWYA 1S3PA 3BUOB 4YGDB 2ZNEA 2DOQA 2KI4C 2NZ0A 4DIRA 1SPYA 1QXPA 2Y5IA 3EK8A 4PE1A 3VROA 1JSAA 1GGZA 2M7NA 2K2FA 2LVVA 2PASA 2PSRA 3AKAA 4M2QA 3JVTB 4P5OE 2JQ6A 4FTGA 2AMIA 1C7VA 2CCMA 1LXFC 2VRGA 2JC2A 1HQVA 4MRYA 1JF0A 1QIVA 4C0KA 1YTZC 2KGRA 5JJGA 1ALVA 1TNWA 4BY4A 1KK7Z 1JUOA 1J7OA 1OMDA 2F3ZA 1X02A 4OKHA 1IJ6A 2L4HA 2M1UA 1QX2A 5I2LA 4XYNA 2H61A 1C07A 1DVIA 3O78A 4PHJA 2JZIA 2BL0B 2K7DA 1WY9A 2IS9A 4UPGA 1EG4A 4JPZB 3D0YB 2NXQA 1TCFA 1ALWA 3JTDC 4XJKB 4PDZA 1FBVA 1S26D 3C1VA 5CSNA 1YR5A 5DKQA 1MR8A 4PALA 1KK7Y 1EL4A 1OQPA 2JU0A 1PSBA 4A4BA 3KPXA 2KFHA 3JTDB 3TZ1A 2K2AA 2M7LA 1H8BA 3KHEA 5KTYA 1NIWA 2ZNDA 1J7QA 3SJSA 2L0PA 3BUWB 2Q4UA 1KK8C 1SYMA 2KAXA 1M31A 2QACA 4GBAA 3OX6A 5CSJA 1XYDA 3O2PA 1OZSA 4I5LB 3KEVA 1HT9A 1YURA 4E68A 1MF8B 1DJZA 1N65A 2G2BA 2KGBC 1B7TZ 4DCKA 1CDNA 1JC2A 2KI6D 1JFJA 2WCBA 1YX8A 2PVBA 1F55A 2KFGA 2M8UA 2WNDA 3OP0A 5AANA 2BCXA 4D1EA 2KNEA 2HF5A 2FOTA 1BOCA 1TOPA 2PALA 1C7WA 1DT7B 1QV1A 1BU3A 1SL7A 2WCFA 1K9PA 1PSRA 1UURA 5K89A 3HX4A 2M49B 1MXEA 1CFFA 5CSIA 1JWDA 1KQVA 5D69A 1JFKA 2BCBA 1G33A 1F71A 2ZKMX 1S6JA 1AUIB 1UWOA 1WRKA 4C0LA 2A4JA 1W7JB 1BG1A 1B7TY 2JWWA 4YGCB 3SG3A 3EK7A 5JOLA 3LCPC 1WRZA 3KF9A 5AERA 3NXAA 3NSKA 3SIBA 3I5IC 2F2OA 2H2KA 2LLUA 4NDDA 3IQOA 3PN7C 3AAJA 2LVIA 2KOTA 2KI6C 3WHUB 1FI5A 1YUSA 1EXRA 2LCPA 1PRWA 1DF0B 3I5IB 1UHNA 1W7IB 2SASA 2M29A 3NSOA 4P2YB 1IH0A 1IG5A 1KQMC 4I5KA 3PN7B 3PM8A 1YRTB 2LMVA 2LUXA 5HYDA 1S6IA 2LAPA 1Y1UA 5KSZA 1KFUS 4L9MA 1CDPA 1XK4A 2ZRSA 1TTXA 1TRFA 2Q91A 1IKUA 1J1EA 1Y0VH 2JTTA 1KQMB 1CLLA 2MBXA 1IWQA 3DD4A 3DVJA 1A2XA 2M9GA 2F2PA 1NYAA 1QATA 1UHHA 2KBIA 3A4UB 1S36A 2COLB 4JWQA 1NSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLQ A;  3I5F C;  2KI4 B;  2FJU B;  1F4Q A;  4PE7 A;  3BOW A;  2L4I A;  1NCZ A;  3BQ3 A;  1TN4 A;  2Y4Q A;  1E8A A;  1MQ1 A;  2O60 A;  5ER4 X;  3SG2 A;  1NCY A;  4ICB A;  1K90 D;  3I5F B;  2KQ6 A;  1SCM C;  1WRL A;  2FCD A;  1ZAC A;  2I2R E;  1YUU A;  2JTZ A;  2LP3 A;  2TN4 A;  1R2U A;  2HET A;  1SK6 D;  3SG5 A;  3A8R A;  2LHI A;  2JOJ A;  3ICB A;  1MWN A;  1A03 A;  2M3W A;  4YGA A;  5HKY A;  1CB1 A;  1SCM B;  3EKH A;  4MN0 A;  2LUC A;  1J1D A;  1Q80 A;  1REC A;  1D1O A;  2RGI A;  1UHJ A;  1YX7 A;  3K21 A;  4DUQ A;  1AK8 A;  4QJ5 B;  5ER5 A;  1OOJ A;  1K9K A;  1XFU O;  1SBJ A;  2CTN A;  1DJY A;  2FCE A;  1XFV O;  2K7C A;  2ZN9 A;  3WHT B;  1H4B A;  1SL8 A;  1AHR A;  5I2Q A;  1WLZ A;  1U5I A;  2KHN A;  1J7P A;  2BEC A;  3PSR A;  4PHM A;  4AOM A;  1WDC C;  3DF0 B;  4ORA B;  1M45 A;  2LE9 B;  2SCP A;  1A75 A;  4WQ2 A;  2K7O A;  5CSF A;  4WRI A;  1BF5 A;  2PRU A;  2CXJ A;  3RM1 A;  1S1E A;  5TNC A;  1LA3 A;  2EGD A;  3HCM A;  1WDC B;  3BUM B;  1B47 A;  1TNQ A;  3TUY C;  4Q04 A;  1QV0 A;  1XK4 C;  4CFR A;  3IQQ A;  1KK8 B;  1LVC D;  1UP5 A;  2KYC A;  3TUY B;  1AJ4 A;  3WXA A;  2ZRT A;  1UHI A;  3GK4 X;  4OV2 A;  4GNK B;  2NCP A;  3AKB A;  1DJH A;  1DMO A;  1K93 D;  1KWO C;  1BOD A;  3BUN B;  1V1G A;  1ZFS A;  1QLK A;  4PE4 A;  1K8U A;  3KO0 A;  4IL1 A;  1M39 A;  1FF1 A;  5KU1 A;  1KFX L;  1PAL A;  3PLF B;  1G8I A;  1EJ3 A;  3GOF A;  2K7B A;  3CR2 A;  3BYA A;  2JUL A;  1QTX A;  2WOS A;  3BOW B;  3E3R A;  4HRE E;  4ORB B;  1NCX A;  2NCO A;  4I5N B;  2K0J A;  3I5H C;  5IBW A;  5DKR A;  1LKJ A;  1K9U A;  1QIW A;  2MLE C;  1RFJ A;  4OCI A;  2L98 A;  1IQ5 A;  3IF7 A;  1AP4 A;  3ZWH A;  4AQJ A;  3BUX B;  2LC5 A;  2H61 C;  1XA5 A;  1Y1A A;  3OB2 B;  1R6P A;  2JNF A;  3SG6 A;  3VRN A;  3I5H B;  1M63 B;  2B1U A;  1QAS A;  2L5X B;  1SW8 A;  1CLB A;  1NX0 A;  2ISD A;  4CLN A;  4XJK A;  2PMY A;  5AFP A;  1N2D A;  4CFQ A;  4OVN F;  1RRO A;  4M2P A;  1OMV A;  2OS8 C;  1NUB A;  2AAO A;  1OZO A;  1KCY A;  4C0J A;  2MJW B;  4MRX A;  1NX2 A;  2K61 A;  3TDZ A;  2LMU A;  2CNP A;  3TS5 C;  1FI6 A;  1SMG A;  2ZN8 A;  1B4C A;  1YRU B;  1XFY O;  2JRF A;  2KDH A;  4AQI A;  1FPW A;  2OPO A;  1SRA A;  3CZT X;  1DJI A;  1V1F A;  5D7F A;  1IRJ A;  1LA0 A;  1TCO B;  3WNX B;  1EH2 A;  3EVR A;  1LIN A;  4OR9 B;  1U5I B;  2V53 A;  1ZMZ A;  2BKH B;  1PK0 D;  1XVJ A;  2WC8 A;  1L2O C;  1K95 A;  1XFX O;  1BR4 B;  3SIA A;  1CMF A;  2HQ8 A;  4R1E A;  2BE6 A;  1A75 B;  1G4Y R;  3EK4 A;  3TDI A;  1ZUZ A;  3F45 A;  5B8I B;  2K8M B;  2JT8 A;  4GAO A;  1F8H A;  1J55 A;  3CR4 X;  1OE9 B;  4NQG A;  1YUT A;  3CLN A;  1PVA A;  2JXC A;  4M2O A;  3OB1 B;  2JNX A;  5HKZ A;  4GPL B;  3I5G C;  3VGO A;  1ODB A;  1TIZ A;  2MRD A;  3JVT C;  1AVS A;  5HKW A;  4F0Z B;  4QJ4 B;  2KBM A;  1NX3 A;  4NDC A;  3FS7 A;  3QRX A;  1DJW A;  3LL8 B;  3GK2 A;  4CPV A;  1RJV A;  4WQ3 A;  4YGB B;  3I5G B;  1XFW O;  3OHM B;  2BBM A;  4YRU A;  2I18 A;  5I8N A;  2F3Y A;  4YI8 A;  2GV5 A;  2O5G A;  1BJF A;  4PE0 A;  1B8R A;  5AXI A;  1IJ5 A;  2GGM A;  2JXL A;  5G08 A;  2MAZ A;  3D10 A;  3LK1 A;  1QJT A;  2BBN A;  3LK0 A;  2LMT A;  1F70 A;  2GGZ A;  2HQW A;  4JQ0 D;  4MEW A;  4MZK A;  2F8P A;  5HLV A;  1L7Z A;  1Y1X A;  2NLN A;  1DJX A;  2BL0 C;  3SG4 A;  1PUL A;  1RK9 A;  4YI9 A;  2BKI B;  3EVU A;  1TNP A;  1BT6 A;  3O4Y A;  5CPV A;  4ZCV A;  3CWG A;  1DF0 A;  1S6C A;  1SR6 C;  2KYF A;  4GFT A;  1K2H A;  4A4C A;  3MSE B;  1MUX A;  1IQ3 A;  1QS7 A;  2CT9 A;  1EG3 A;  4U8D A;  4GGF A;  1AJ5 A;  1F4O A;  5PAL A;  3GK1 A;  2LVK A;  1SR6 B;  1GGW A;  1NX1 A;  2LLT A;  5J3X A;  5GQQ C;  3M0W A;  4CID A;  2JT3 A;  2LM5 A;  3FWC A;  1YVH A;  1OSA A;  1CFD A;  2Y1N A;  4N1G A;  4HRG A;  3PAL A;  4MZL A;  1S5G Z;  4PHN A;  1QX7 A;  3O6B A;  3RLZ A;  4BY5 A;  4I5J A;  1CFP A;  5F6T A;  1XO5 A;  2KFF A;  1CM4 A;  2L50 A;  1M46 A;  1DGV A;  1J7R A;  2LVJ A;  3CGA A;  2LV7 A;  3FIA A;  4HSZ A;  4TNC A;  1SL9 A;  3BXK A;  1CFC A;  1CMG A;  3OX5 A;  5I2O A;  4FQO A;  2MA2 A;  4DRW A;  1QX5 B;  1B8C A;  1Y6W A;  1BMO A;  2I94 A;  4NDB A;  1K96 A;  1KWO B;  3PFV A;  1JF2 A;  5FYX A;  3SG7 A;  4ETO A;  1NWD A;  3VRP A;  1CTR A;  1KSM A;  1KSO A;  2KAY A;  2LLS A;  2CBL A;  2R2I A;  2M0R A;  3ZNI A;  2QPT A;  3DVE A;  2E30 A;  3NSL A;  4QJ3 B;  2I7A A;  3VRR A;  1S5G Y;  4GUK A;  2MLF C;  1UHK A;  1RTP 1;  3LLE A;  2M97 A;  2EHB A;  1K94 A;  1F54 A;  2LHL A;  1CLM A;  4YBH B;  4PHK A;  4YGE B;  1MHO A;  1FW4 A;  4MZJ A;  3VRQ A;  1ZOT B;  3EKJ A;  2EC6 C;  1NP8 A;  3D0Y A;  1YVL A;  4HRH A;  1GQM A;  2G9B A;  4DS7 A;  2WCE A;  1KFU L;  1NPQ A;  1PVB A;  1SY9 A;  2LP2 A;  3DVM A;  1BR1 B;  1QVI Z;  4MBE A;  5DKN A;  1CNP A;  3H4S E;  1A4P A;  1CM1 A;  2EC6 B;  3FWB A;  1KFX S;  2HPS A;  2WOR A;  5HLO A;  1DJG A;  1A29 A;  4ORC B;  3DF0 A;  4PCW A;  3NSI A;  1GJY A;  2KQY A;  1B8L A;  3DVK A;  2MHH A;  1DGU A;  4MLW A;  2AUC A;  1VRK A;  2BCA A;  2F33 A;  2JPT A;  2Y1M A;  4N1F A;  1OMR A;  4MSP A;  4MVF A;  2P6B B;  2OS8 B;  1CDL A;  1QLS A;  1TNX A;  1UUS A;  2KSP A;  2L2E A;  3CS1 A;  3TS5 B;  1JBA A;  2L51 A;  4GGN A;  1DTL A;  1WLM A;  3PAT A;  1B9A A;  4GGF C;  3TDU A;  3AAK A;  2OTG C;  1SCV A;  1XFZ O;  2ZFD A;  1B1G A;  1QVI Y;  3CTN A;  4ZCU A;  2LAN A;  2LNK A;  2E6W A;  1CDM A;  5AEQ A;  1L2O B;  2M1K B;  4USL A;  3CR5 X;  2D8N A;  2JT0 A;  4N5X A;  2KAV A;  1CKK A;  1SKT A;  2OTG B;  2BE4 A;  3EVV A;  1N0Y A;  1SNL A;  5BPJ A;  1MXL C;  1IGV A;  1RWY A;  1S3P A;  3BUO B;  4YGD B;  2ZNE A;  2DOQ A;  2KI4 C;  2NZ0 A;  4DIR A;  1SPY A;  1QXP A;  2Y5I A;  3EK8 A;  4PE1 A;  3VRO A;  1JSA A;  1GGZ A;  2M7N A;  2K2F A;  2LVV A;  2PAS A;  2PSR A;  3AKA A;  4M2Q A;  3JVT B;  4P5O E;  2JQ6 A;  4FTG A;  2AMI A;  1C7V A;  2CCM A;  1LXF C;  2VRG A;  2JC2 A;  1HQV A;  4MRY A;  1JF0 A;  1QIV A;  4C0K A;  1YTZ C;  2KGR A;  5JJG A;  1ALV A;  1TNW A;  4BY4 A;  1KK7 Z;  1JUO A;  1J7O A;  1OMD A;  2F3Z A;  1X02 A;  4OKH A;  1IJ6 A;  2L4H A;  2M1U A;  1QX2 A;  5I2L A;  4XYN A;  2H61 A;  1C07 A;  1DVI A;  3O78 A;  4PHJ A;  2JZI A;  2BL0 B;  2K7D A;  1WY9 A;  2IS9 A;  4UPG A;  1EG4 A;  4JPZ B;  3D0Y B;  2NXQ A;  1TCF A;  1ALW A;  3JTD C;  4XJK B;  4PDZ A;  1FBV A;  1S26 D;  3C1V A;  5CSN A;  1YR5 A;  5DKQ A;  1MR8 A;  4PAL A;  1KK7 Y;  1EL4 A;  1OQP A;  2JU0 A;  1PSB A;  4A4B A;  3KPX A;  2KFH A;  3JTD B;  3TZ1 A;  2K2A A;  2M7L A;  1H8B A;  3KHE A;  5KTY A;  1NIW A;  2ZND A;  1J7Q A;  3SJS A;  2L0P A;  3BUW B;  2Q4U A;  1KK8 C;  1SYM A;  2KAX A;  1M31 A;  2QAC A;  4GBA A;  3OX6 A;  5CSJ A;  1XYD A;  3O2P A;  1OZS A;  4I5L B;  3KEV A;  1HT9 A;  1YUR A;  4E68 A;  1MF8 B;  1DJZ A;  1N65 A;  2G2B A;  2KGB C;  1B7T Z;  4DCK A;  1CDN A;  1JC2 A;  2KI6 D;  1JFJ A;  2WCB A;  1YX8 A;  2PVB A;  1F55 A;  2KFG A;  2M8U A;  2WND A;  3OP0 A;  5AAN A;  2BCX A;  4D1E A;  2KNE A;  2HF5 A;  2FOT A;  1BOC A;  1TOP A;  2PAL A;  1C7W A;  1DT7 B;  1QV1 A;  1BU3 A;  1SL7 A;  2WCF A;  1K9P A;  1PSR A;  1UUR A;  5K89 A;  3HX4 A;  2M49 B;  1MXE A;  1CFF A;  5CSI A;  1JWD A;  1KQV A;  5D69 A;  1JFK A;  2BCB A;  1G33 A;  1F71 A;  2ZKM X;  1S6J A;  1AUI B;  1UWO A;  1WRK A;  4C0L A;  2A4J A;  1W7J B;  1BG1 A;  1B7T Y;  2JWW A;  4YGC B;  3SG3 A;  3EK7 A;  5JOL A;  3LCP C;  1WRZ A;  3KF9 A;  5AER A;  3NXA A;  3NSK A;  3SIB A;  3I5I C;  2F2O A;  2H2K A;  2LLU A;  4NDD A;  3IQO A;  3PN7 C;  3AAJ A;  2LVI A;  2KOT A;  2KI6 C;  3WHU B;  1FI5 A;  1YUS A;  1EXR A;  2LCP A;  1PRW A;  1DF0 B;  3I5I B;  1UHN A;  1W7I B;  2SAS A;  2M29 A;  3NSO A;  4P2Y B;  1IH0 A;  1IG5 A;  1KQM C;  4I5K A;  3PN7 B;  3PM8 A;  1YRT B;  2LMV A;  2LUX A;  5HYD A;  1S6I A;  2LAP A;  1Y1U A;  5KSZ A;  1KFU S;  4L9M A;  1CDP A;  1XK4 A;  2ZRS A;  1TTX A;  1TRF A;  2Q91 A;  1IKU A;  1J1E A;  1Y0V H;  2JTT A;  1KQM B;  1CLL A;  2MBX A;  1IWQ A;  3DD4 A;  3DVJ A;  1A2X A;  2M9G A;  2F2P A;  1NYA A;  1QAT A;  1UHH A;  2KBI A;  3A4U B;  1S36 A;  2COL B;  4JWQ A;  1NSH A; 
#chains in the Genus database with same CATH topology
 1BLQ A;  3I5F C;  2KI4 B;  1W9Z A;  1F4Q A;  2FJU B;  4PE7 A;  3BOW A;  4MVF A;  2L4I A;  1NCZ A;  3BQ3 A;  1TN4 A;  2Y4Q A;  1E8A A;  1MQ1 A;  2O60 A;  5ER4 X;  3SG2 A;  3VB1 A;  1NCY A;  4ICB A;  1K90 D;  3I5F B;  2KQ6 A;  1SCM C;  1WRL A;  2FCD A;  1ZAC A;  2I2R E;  1YUU A;  2JTZ A;  2LP3 A;  2TN4 A;  1R2U A;  3D77 A;  2HET A;  1SK6 D;  3SG5 A;  3A8R A;  2LHI A;  2JOJ A;  3DXL A;  3ICB A;  1MWN A;  1A03 A;  2M3W A;  4YGA A;  5HKY A;  1CB1 A;  1SCM B;  3EKH A;  4MN0 A;  2LUC A;  1J1D A;  1Q80 A;  1REC A;  1D1O A;  2RGI A;  1UHJ A;  1YX7 A;  4JKT A;  3K21 A;  3R1V A;  4DUQ A;  1AK8 A;  4QJ5 B;  3EG5 B;  1OOJ A;  5ER5 A;  1K9K A;  1XFU O;  1SBJ A;  2CTN A;  1DJY A;  2FCE A;  1XFV O;  2K7C A;  2ZN9 A;  3WHT B;  1H4B A;  5FI6 A;  3L47 A;  1SL8 A;  1AHR A;  5I2Q A;  1WLZ A;  1U5I A;  2KHN A;  1J7P A;  2BEC A;  3PSR A;  1Z2C B;  4PHM A;  4AOM A;  1WDC C;  3DF0 B;  4ORA B;  1M45 A;  2LE9 B;  2SCP A;  1A75 A;  4WQ2 A;  2K7O A;  3B86 A;  4PT1 A;  5CSF A;  4WRI A;  1BF5 A;  2PRU A;  2CXJ A;  3RM1 A;  1S1E A;  5TNC A;  1LA3 A;  3L4A A;  2EGD A;  3HCM A;  1WDC B;  3BUM B;  1B47 A;  1TNQ A;  3TUY C;  4Q04 A;  1QV0 A;  1XK4 C;  4CFR A;  3O4X A;  3IQQ A;  1KK8 B;  1LVC D;  1UP5 A;  2KYC A;  5I94 A;  3TUY B;  1AJ4 A;  3UNW A;  3WXA A;  2ZRT A;  1UHI A;  3GK4 X;  4OV2 A;  4GNK B;  2NCP A;  3AKB A;  1DJH A;  1DMO A;  1K93 D;  1KWO C;  3NHT A;  1BOD A;  3BUN B;  1V1G A;  1ZFS A;  1QLK A;  4PE4 A;  1K8U A;  3KO0 A;  4IL1 A;  3PJI A;  3D73 A;  1M39 A;  1FF1 A;  3SS5 A;  5KU1 A;  1KFX L;  1PAL A;  3PLF B;  1G8I A;  1EJ3 A;  3GOF A;  2K7B A;  3CR2 A;  2P70 A;  2JPO A;  3BYA A;  2JUL A;  1QTX A;  2WOS A;  3BOW B;  3E3R A;  4HRE E;  4ORB B;  1NCX A;  2NCO A;  4I5N B;  2K0J A;  3I5H C;  5IBW A;  5DKR A;  1LKJ A;  1K9U A;  1QIW A;  2MLE C;  1RFJ A;  4OCI A;  2L98 A;  1IQ5 A;  3IF7 A;  1AP4 A;  3ZWH A;  4AQJ A;  3BUX B;  2LC5 A;  2H61 C;  1XA5 A;  1Y1A A;  3OB2 B;  1R6P A;  2JNF A;  3SG6 A;  3VRN A;  3I5H B;  1M63 B;  2B1U A;  1QAS A;  3FE9 A;  2L5X B;  1SW8 A;  1CLB A;  1NX0 A;  2ISD A;  4CLN A;  2WCJ A;  3B7A A;  4XJK A;  2PMY A;  5AFP A;  1N2D A;  4CFQ A;  4OVN F;  1RRO A;  2WCH A;  4M2P A;  1OMV A;  5D3O A;  2OS8 C;  1NUB A;  3D76 A;  2AAO A;  1OZO A;  1KCY A;  3NHI A;  3V2L A;  4C0J A;  2MJW B;  4MRX A;  1NX2 A;  2K61 A;  3TDZ A;  2LMU A;  2CNP A;  3TS5 C;  1FI6 A;  1SMG A;  3BFH A;  2ZN8 A;  1B4C A;  3CZ2 A;  1YRU B;  1XFY O;  2JRF A;  2KDH A;  1TUZ A;  3S0G A;  4AQI A;  1FPW A;  2OPO A;  1DEL A;  1SRA A;  4IJ7 A;  3CZT X;  1DJI A;  1V1F A;  5D7F A;  1IRJ A;  1LA0 A;  1TCO B;  3WNX B;  1EH2 A;  3EVR A;  1LIN A;  2QEH A;  3BFA A;  1U5I B;  4OR9 B;  2V53 A;  1ZMZ A;  2BKH B;  1PK0 D;  1XVJ A;  2WC8 A;  1L2O C;  1K95 A;  1XFX O;  1BR4 B;  3SIA A;  1CMF A;  2HQ8 A;  4R1E A;  2BE6 A;  1A75 B;  1G4Y R;  3EK4 A;  3TDI A;  1ZUZ A;  3F45 A;  2QEB A;  5B8I B;  2K8M B;  2JT8 A;  4GAO A;  1F8H A;  1J55 A;  3CR4 X;  3CZ1 A;  1OE9 B;  4NQG A;  1YUT A;  3CLN A;  1PVA A;  2JXC A;  2WC6 A;  4M2O A;  3OB1 B;  2JNX A;  5HKZ A;  4GPL B;  3I5G C;  3VGO A;  1ODB A;  1TIZ A;  2MRD A;  3JVT C;  1AVS A;  5HKW A;  4F0Z B;  4QJ4 B;  2KBM A;  1NX3 A;  4NDC A;  3FS7 A;  3PM2 A;  3QRX A;  1DJW A;  3LL8 B;  3GK2 A;  4CPV A;  1RJV A;  4WQ3 A;  4YGB B;  3I5G B;  5FI2 A;  1XFW O;  3OHM B;  2BBM A;  4YRU A;  2I18 A;  5I8N A;  2F3Y A;  4YI8 A;  2GV5 A;  2O5G A;  1BJF A;  4PE0 A;  1B8R A;  4KYN A;  5AXI A;  1IJ5 A;  2GGM A;  2JXL A;  3B88 A;  3BFB A;  2MAZ A;  5G08 A;  3D10 A;  3LK1 A;  1QJT A;  2BBN A;  3LK0 A;  2LMT A;  1F70 A;  2GGZ A;  2HQW A;  4JQ0 D;  4MEW A;  4MZK A;  2F8P A;  1DQE A;  1L7Z A;  1Y1X A;  2NLN A;  5HLV A;  1DJX A;  2BL0 C;  3SG4 A;  1PUL A;  1RK9 A;  4YI9 A;  2BKI B;  3EVU A;  1TNP A;  1BT6 A;  3O4Y A;  5CPV A;  4ZCV A;  3CWG A;  1DF0 A;  5FI7 A;  1S6C A;  1SR6 C;  2KYF A;  4GFT A;  1K2H A;  4A4C A;  3MSE B;  1MUX A;  1IQ3 A;  1QS7 A;  2CT9 A;  1EG3 A;  4U8D A;  3S0A A;  4GGF A;  1AJ5 A;  1F4O A;  5PAL A;  3GK1 A;  2H8V A;  5EL2 A;  2LVK A;  1SR6 B;  1GGW A;  1NX1 A;  2LLT A;  5J3X A;  5GQQ C;  3M0W A;  4CID A;  2JT3 A;  2LM5 A;  3FWC A;  1YVH A;  1OSA A;  1CFD A;  2Y1N A;  4N1G A;  4HRG A;  3PAL A;  4MZL A;  2KLE A;  1S5G Z;  4PHN A;  2PQL A;  1QX7 A;  3O6B A;  3RLZ A;  4BY5 A;  4I5J A;  1CFP A;  3CYZ A;  2WCL A;  5F6T A;  1T14 A;  1XO5 A;  2KFF A;  1IIO A;  1CM4 A;  2L50 A;  1M46 A;  1DGV A;  1J7R A;  2LVJ A;  3CGA A;  2LV7 A;  2BAP A;  3FIA A;  4HSZ A;  1SL9 A;  3BXK A;  4TNC A;  1CFC A;  3OX5 A;  3S0B A;  4FQO A;  5I2O A;  2MA2 A;  3CAB A;  3S0D A;  4DRW A;  1QX5 B;  1B8C A;  1Y6W A;  1BMO A;  2I94 A;  4NDB A;  1K96 A;  1KWO B;  3PFV A;  1JF2 A;  5FYX A;  3SG7 A;  4ETO A;  1NWD A;  3VRP A;  1CTR A;  1KSM A;  1KSO A;  2KAY A;  2LLS A;  2CBL A;  2R2I A;  2M0R A;  3ZNI A;  2QPT A;  3DVE A;  2E30 A;  3NSL A;  4QJ3 B;  3OGN A;  2I7A A;  3VRR A;  1S5G Y;  2P71 A;  3CDN A;  4GUK A;  1DC1 A;  2MLF C;  1UHK A;  1RTP 1;  3LLE A;  2M97 A;  2EHB A;  1K94 A;  1F54 A;  2LHL A;  1CLM A;  4YBH B;  4PHK A;  4YGE B;  1MHO A;  3DY9 A;  1FW4 A;  4MZJ A;  5HL1 A;  1TUJ A;  3VRQ A;  1ZOT B;  3EKJ A;  2FJY A;  2EC6 C;  1NP8 A;  3D0Y A;  1YVL A;  4HRH A;  2WC5 A;  1GQM A;  2G9B A;  3S0E A;  4DS7 A;  2WCE A;  3BJH A;  1KFU L;  1NPQ A;  1PVB A;  1SY9 A;  2LP2 A;  3DVM A;  1BR1 B;  1QVI Z;  4MBE A;  5DKN A;  1CNP A;  3H4S E;  1A4P A;  1CM1 A;  2EC6 B;  3FWB A;  1KFX S;  2HPS A;  2WOR A;  5HLO A;  1DJG A;  1A29 A;  4ORC B;  3DF0 A;  4PCW A;  3NSI A;  1ORG A;  1GJY A;  2KQY A;  1B8L A;  3DVK A;  2MHH A;  1DGU A;  4MLW A;  2AUC A;  1VRK A;  2BCA A;  2F33 A;  2JPT A;  2Y1M A;  4N1F A;  1OMR A;  2QEO A;  4MSP A;  2P6B B;  1C3Z A;  2OS8 B;  1CDL A;  1QLS A;  1TNX A;  1UUS A;  2KSP A;  2L2E A;  3CS1 A;  3TS5 B;  1JBA A;  4INX A;  3DZT A;  2L51 A;  4GGN A;  1DTL A;  1WLM A;  1OOF A;  3PAT A;  1B9A A;  3RZS A;  4GGF C;  3TDU A;  3AAK A;  2OTG C;  1SCV A;  1XFZ O;  2ZFD A;  1B1G A;  1QVI Y;  3CTN A;  4ZCU A;  2LAN A;  2LNK A;  2E6W A;  1CDM A;  3D74 A;  1L2O B;  2M1K B;  5AEQ A;  4USL A;  3CR5 X;  2D8N A;  2JT0 A;  4JD9 A;  4N5X A;  2KAV A;  1CKK A;  1SKT A;  3FE6 A;  2OTG B;  3FE8 A;  2BE4 A;  2L2C A;  3EVV A;  1N0Y A;  1SNL A;  3K1E A;  5BPJ A;  1OW4 A;  1MXL C;  1IGV A;  1RWY A;  1S3P A;  2K60 A;  3BUO B;  2ZNE A;  4YGD B;  3SS3 A;  2DOQ A;  2KI4 C;  3QME A;  2NZ0 A;  4DIR A;  1SPY A;  4FQT A;  1QXP A;  2Y5I A;  3EK8 A;  4PE1 A;  3VRO A;  1JSA A;  2L5Y A;  1GGZ A;  2M7N A;  2K2F A;  2LVV A;  2PAS A;  2PSR A;  3AKA A;  4M2Q A;  3JVT B;  4P5O E;  1TWO A;  2JQ6 A;  4FTG A;  2AMI A;  1C7V A;  3R1P A;  2CCM A;  1LXF C;  2VRG A;  1OOI X;  2JC2 A;  1HQV A;  4MRY A;  1JF0 A;  1QIV A;  4C0K A;  1YTZ C;  2KGR A;  5JJG A;  1ALV A;  1TNW A;  4BY4 A;  1KK7 Z;  1JUO A;  1J7O A;  1OMD A;  1OOH A;  2F3Z A;  1X02 A;  4OKH A;  1IJ6 A;  2L4H A;  2M1U A;  1QX2 A;  5I2L A;  3DYE A;  2BNX A;  1GM0 A;  4XYN A;  2H61 A;  1C07 A;  1DVI A;  3O78 A;  4PHJ A;  2JZI A;  3NGV A;  2BL0 B;  2K7D A;  1WY9 A;  2IS9 A;  4UPG A;  1EG4 A;  4JPZ B;  2QEV A;  3D0Y B;  2NXQ A;  2PYQ A;  1TCF A;  1ALW A;  2WCK A;  3JTD C;  4XJK B;  4PDZ A;  3B6X A;  1FBV A;  1S26 D;  3C1V A;  5CSN A;  1YR5 A;  5DKQ A;  1MR8 A;  4PAL A;  1KK7 Y;  1EL4 A;  1OQP A;  2JU0 A;  1PSB A;  4A4B A;  3KPX A;  2WCM A;  3Q8I A;  2KFH A;  3JTD B;  3R72 A;  3TZ1 A;  2K2A A;  3UO9 A;  1DEK A;  2M7L A;  1H8B A;  3KHE A;  5KTY A;  1NIW A;  2ZND A;  1J7Q A;  3SJS A;  2L0P A;  3D75 A;  3BUW B;  2Q4U A;  1KK8 C;  1SYM A;  2KAX A;  1M31 A;  2QAC A;  4GBA A;  3OX6 A;  5CSJ A;  1XYD A;  2GTE A;  2QDI A;  1CMG A;  3O2P A;  1OZS A;  4I5L B;  1Z4H A;  3KEV A;  1HT9 A;  1YUR A;  4E68 A;  1MF8 B;  1DJZ A;  1N65 A;  2G2B A;  2KGB C;  1B7T Z;  4INW A;  4DCK A;  3L4L A;  2KI6 D;  1CDN A;  1JC2 A;  1JFJ A;  2WCB A;  1YX8 A;  2PVB A;  1F55 A;  1P28 A;  2KFG A;  2M8U A;  2WND A;  3OP0 A;  5AAN A;  2BCX A;  4D1E A;  2KNE A;  2HF5 A;  2FOT A;  1BOC A;  1TOP A;  2PAL A;  1C7W A;  1DT7 B;  1QV1 A;  1BU3 A;  1SL7 A;  2WCF A;  1K9P A;  1PSR A;  1UUR A;  1OOG A;  5K89 A;  3HX4 A;  2M49 B;  1MXE A;  1CFF A;  5CSI A;  1JWD A;  1KQV A;  5D69 A;  1JFK A;  2BCB A;  3N7H A;  3B87 A;  1G33 A;  1F71 A;  2ZKM X;  1XFR A;  1S6J A;  1AUI B;  3OBV A;  1UWO A;  1WRK A;  4C0L A;  2A4J A;  1W7J B;  1BG1 A;  1B7T Y;  2JWW A;  4YGC B;  2KPH A;  3SG3 A;  3EK7 A;  5JOL A;  1LS8 A;  3LCP C;  1WRZ A;  3KF9 A;  3SS4 A;  5DIC A;  3D78 A;  5AER A;  3NXA A;  3NSK A;  3SIB A;  3I5I C;  2F2O A;  2H2K A;  2LLU A;  4NDD A;  1C3Y A;  3IQO A;  3PN7 C;  3AAJ A;  2LVI A;  2KOT A;  2KI6 C;  3WHU B;  3CZ0 A;  1FI5 A;  1YUS A;  1EXR A;  1SSE B;  2LCP A;  1PRW A;  4OZD A;  1DF0 B;  3I5I B;  1UHN A;  1W7I B;  2SAS A;  2M29 A;  3NSO A;  4P2Y B;  1IH0 A;  1IG5 A;  1KQM C;  4I5K A;  3PN7 B;  3PM8 A;  1YRT B;  3IVT A;  2LMV A;  2LUX A;  5HYD A;  1S6I A;  2LAP A;  1Y1U A;  5KSZ A;  1KFU S;  4L9M A;  1CDP A;  1XK4 A;  2ZRS A;  1TTX A;  2KLD A;  1TRF A;  2Q91 A;  1IKU A;  1J1E A;  1Y0V H;  2YGU A;  2JTT A;  1KQM B;  1CLL A;  2MBX A;  1IWQ A;  3S0F A;  3DD4 A;  3DVJ A;  2ERB A;  1A2X A;  3R1O A;  2M9G A;  2F2P A;  1NYA A;  1QAT A;  1QWV A;  1UHH A;  2KBI A;  4F7F A;  3A4U B;  1S36 A;  2COL B;  4JWQ A;  1NSH A; 
#chains in the Genus database with same CATH homology
 1BLQ A;  3I5F C;  2KI4 B;  2FJU B;  1F4Q A;  4PE7 A;  3BOW A;  2L4I A;  1NCZ A;  3BQ3 A;  1TN4 A;  2Y4Q A;  1E8A A;  1MQ1 A;  2O60 A;  5ER4 X;  3SG2 A;  1NCY A;  4ICB A;  1K90 D;  3I5F B;  2KQ6 A;  1SCM C;  1WRL A;  2FCD A;  1ZAC A;  2I2R E;  1YUU A;  2JTZ A;  2LP3 A;  2TN4 A;  1R2U A;  2HET A;  1SK6 D;  3SG5 A;  3A8R A;  2LHI A;  2JOJ A;  3ICB A;  1MWN A;  1A03 A;  2M3W A;  4YGA A;  5HKY A;  1CB1 A;  1SCM B;  3EKH A;  4MN0 A;  2LUC A;  1J1D A;  1Q80 A;  1REC A;  1D1O A;  2RGI A;  1UHJ A;  1YX7 A;  3K21 A;  4DUQ A;  1AK8 A;  4QJ5 B;  5ER5 A;  1OOJ A;  1K9K A;  1XFU O;  1SBJ A;  2CTN A;  1DJY A;  2FCE A;  1XFV O;  2K7C A;  2ZN9 A;  3WHT B;  1H4B A;  1SL8 A;  1AHR A;  5I2Q A;  1WLZ A;  1U5I A;  2KHN A;  1J7P A;  2BEC A;  3PSR A;  4PHM A;  4AOM A;  1WDC C;  3DF0 B;  4ORA B;  1M45 A;  2LE9 B;  2SCP A;  1A75 A;  4WQ2 A;  2K7O A;  5CSF A;  4WRI A;  1BF5 A;  2PRU A;  2CXJ A;  3RM1 A;  1S1E A;  5TNC A;  1LA3 A;  2EGD A;  3HCM A;  1WDC B;  3BUM B;  1B47 A;  1TNQ A;  3TUY C;  4Q04 A;  1QV0 A;  1XK4 C;  4CFR A;  3IQQ A;  1KK8 B;  1LVC D;  1UP5 A;  2KYC A;  3TUY B;  1AJ4 A;  3WXA A;  2ZRT A;  1UHI A;  3GK4 X;  4OV2 A;  4GNK B;  2NCP A;  3AKB A;  1DJH A;  1DMO A;  1K93 D;  1KWO C;  1BOD A;  3BUN B;  1V1G A;  1ZFS A;  1QLK A;  4PE4 A;  1K8U A;  3KO0 A;  4IL1 A;  1M39 A;  1FF1 A;  5KU1 A;  1KFX L;  1PAL A;  3PLF B;  1G8I A;  1EJ3 A;  3GOF A;  2K7B A;  3CR2 A;  3BYA A;  2JUL A;  1QTX A;  2WOS A;  3BOW B;  3E3R A;  4HRE E;  4ORB B;  1NCX A;  2NCO A;  4I5N B;  2K0J A;  3I5H C;  5IBW A;  5DKR A;  1LKJ A;  1K9U A;  1QIW A;  2MLE C;  1RFJ A;  4OCI A;  2L98 A;  1IQ5 A;  3IF7 A;  1AP4 A;  3ZWH A;  4AQJ A;  3BUX B;  2LC5 A;  2H61 C;  1XA5 A;  1Y1A A;  3OB2 B;  1R6P A;  2JNF A;  3SG6 A;  3VRN A;  3I5H B;  1M63 B;  2B1U A;  1QAS A;  2L5X B;  1SW8 A;  1CLB A;  1NX0 A;  2ISD A;  4CLN A;  4XJK A;  2PMY A;  5AFP A;  1N2D A;  4CFQ A;  4OVN F;  1RRO A;  4M2P A;  1OMV A;  2OS8 C;  1NUB A;  2AAO A;  1OZO A;  1KCY A;  4C0J A;  2MJW B;  4MRX A;  1NX2 A;  2K61 A;  3TDZ A;  2LMU A;  2CNP A;  3TS5 C;  1FI6 A;  1SMG A;  2ZN8 A;  1B4C A;  1YRU B;  1XFY O;  2JRF A;  2KDH A;  4AQI A;  1FPW A;  2OPO A;  1SRA A;  3CZT X;  1DJI A;  1V1F A;  5D7F A;  1IRJ A;  1LA0 A;  1TCO B;  3WNX B;  1EH2 A;  3EVR A;  1LIN A;  4OR9 B;  1U5I B;  2V53 A;  1ZMZ A;  2BKH B;  1PK0 D;  1XVJ A;  2WC8 A;  1L2O C;  1K95 A;  1XFX O;  1BR4 B;  3SIA A;  1CMF A;  2HQ8 A;  4R1E A;  2BE6 A;  1A75 B;  1G4Y R;  3EK4 A;  3TDI A;  1ZUZ A;  3F45 A;  5B8I B;  2K8M B;  2JT8 A;  4GAO A;  1F8H A;  1J55 A;  3CR4 X;  1OE9 B;  4NQG A;  1YUT A;  3CLN A;  1PVA A;  2JXC A;  4M2O A;  3OB1 B;  2JNX A;  5HKZ A;  4GPL B;  3I5G C;  3VGO A;  1ODB A;  1TIZ A;  2MRD A;  3JVT C;  1AVS A;  5HKW A;  4F0Z B;  4QJ4 B;  2KBM A;  1NX3 A;  4NDC A;  3FS7 A;  3QRX A;  1DJW A;  3LL8 B;  3GK2 A;  4CPV A;  1RJV A;  4WQ3 A;  4YGB B;  3I5G B;  1XFW O;  3OHM B;  2BBM A;  4YRU A;  2I18 A;  5I8N A;  2F3Y A;  4YI8 A;  2GV5 A;  2O5G A;  1BJF A;  4PE0 A;  1B8R A;  5AXI A;  1IJ5 A;  2GGM A;  2JXL A;  5G08 A;  2MAZ A;  3D10 A;  3LK1 A;  1QJT A;  2BBN A;  3LK0 A;  2LMT A;  1F70 A;  2GGZ A;  2HQW A;  4JQ0 D;  4MEW A;  4MZK A;  2F8P A;  5HLV A;  1L7Z A;  1Y1X A;  2NLN A;  1DJX A;  2BL0 C;  3SG4 A;  1PUL A;  1RK9 A;  4YI9 A;  2BKI B;  3EVU A;  1TNP A;  1BT6 A;  3O4Y A;  5CPV A;  4ZCV A;  3CWG A;  1DF0 A;  1S6C A;  1SR6 C;  2KYF A;  4GFT A;  1K2H A;  4A4C A;  3MSE B;  1MUX A;  1IQ3 A;  1QS7 A;  2CT9 A;  1EG3 A;  4U8D A;  4GGF A;  1AJ5 A;  1F4O A;  5PAL A;  3GK1 A;  2LVK A;  1SR6 B;  1GGW A;  1NX1 A;  2LLT A;  5J3X A;  5GQQ C;  3M0W A;  4CID A;  2JT3 A;  2LM5 A;  3FWC A;  1YVH A;  1OSA A;  1CFD A;  2Y1N A;  4N1G A;  4HRG A;  3PAL A;  4MZL A;  1S5G Z;  4PHN A;  1QX7 A;  3O6B A;  3RLZ A;  4BY5 A;  4I5J A;  1CFP A;  5F6T A;  1XO5 A;  2KFF A;  1CM4 A;  2L50 A;  1M46 A;  1DGV A;  1J7R A;  2LVJ A;  3CGA A;  2LV7 A;  3FIA A;  4HSZ A;  4TNC A;  1SL9 A;  3BXK A;  1CFC A;  1CMG A;  3OX5 A;  5I2O A;  4FQO A;  2MA2 A;  4DRW A;  1QX5 B;  1B8C A;  1Y6W A;  1BMO A;  2I94 A;  4NDB A;  1K96 A;  1KWO B;  3PFV A;  1JF2 A;  5FYX A;  3SG7 A;  4ETO A;  1NWD A;  3VRP A;  1CTR A;  1KSM A;  1KSO A;  2KAY A;  2LLS A;  2CBL A;  2R2I A;  2M0R A;  3ZNI A;  2QPT A;  3DVE A;  2E30 A;  3NSL A;  4QJ3 B;  2I7A A;  3VRR A;  1S5G Y;  4GUK A;  2MLF C;  1UHK A;  1RTP 1;  3LLE A;  2M97 A;  2EHB A;  1K94 A;  1F54 A;  2LHL A;  1CLM A;  4YBH B;  4PHK A;  4YGE B;  1MHO A;  1FW4 A;  4MZJ A;  3VRQ A;  1ZOT B;  3EKJ A;  2EC6 C;  1NP8 A;  3D0Y A;  1YVL A;  4HRH A;  1GQM A;  2G9B A;  4DS7 A;  2WCE A;  1KFU L;  1NPQ A;  1PVB A;  1SY9 A;  2LP2 A;  3DVM A;  1BR1 B;  1QVI Z;  4MBE A;  5DKN A;  1CNP A;  3H4S E;  1A4P A;  1CM1 A;  2EC6 B;  3FWB A;  1KFX S;  2HPS A;  2WOR A;  5HLO A;  1DJG A;  1A29 A;  4ORC B;  3DF0 A;  4PCW A;  3NSI A;  1GJY A;  2KQY A;  1B8L A;  3DVK A;  2MHH A;  1DGU A;  4MLW A;  2AUC A;  1VRK A;  2BCA A;  2F33 A;  2JPT A;  2Y1M A;  4N1F A;  1OMR A;  4MSP A;  4MVF A;  2P6B B;  2OS8 B;  1CDL A;  1QLS A;  1TNX A;  1UUS A;  2KSP A;  2L2E A;  3CS1 A;  3TS5 B;  1JBA A;  2L51 A;  4GGN A;  1DTL A;  1WLM A;  3PAT A;  1B9A A;  4GGF C;  3TDU A;  3AAK A;  2OTG C;  1SCV A;  1XFZ O;  2ZFD A;  1B1G A;  1QVI Y;  3CTN A;  4ZCU A;  2LAN A;  2LNK A;  2E6W A;  1CDM A;  5AEQ A;  1L2O B;  2M1K B;  4USL A;  3CR5 X;  2D8N A;  2JT0 A;  4N5X A;  2KAV A;  1CKK A;  1SKT A;  2OTG B;  2BE4 A;  3EVV A;  1N0Y A;  1SNL A;  5BPJ A;  1MXL C;  1IGV A;  1RWY A;  1S3P A;  3BUO B;  4YGD B;  2ZNE A;  2DOQ A;  2KI4 C;  2NZ0 A;  4DIR A;  1SPY A;  1QXP A;  2Y5I A;  3EK8 A;  4PE1 A;  3VRO A;  1JSA A;  1GGZ A;  2M7N A;  2K2F A;  2LVV A;  2PAS A;  2PSR A;  3AKA A;  4M2Q A;  3JVT B;  4P5O E;  2JQ6 A;  4FTG A;  2AMI A;  1C7V A;  2CCM A;  1LXF C;  2VRG A;  2JC2 A;  1HQV A;  4MRY A;  1JF0 A;  1QIV A;  4C0K A;  1YTZ C;  2KGR A;  5JJG A;  1ALV A;  1TNW A;  4BY4 A;  1KK7 Z;  1JUO A;  1J7O A;  1OMD A;  2F3Z A;  1X02 A;  4OKH A;  1IJ6 A;  2L4H A;  2M1U A;  1QX2 A;  5I2L A;  4XYN A;  2H61 A;  1C07 A;  1DVI A;  3O78 A;  4PHJ A;  2JZI A;  2BL0 B;  2K7D A;  1WY9 A;  2IS9 A;  4UPG A;  1EG4 A;  4JPZ B;  3D0Y B;  2NXQ A;  1TCF A;  1ALW A;  3JTD C;  4XJK B;  4PDZ A;  1FBV A;  1S26 D;  3C1V A;  5CSN A;  1YR5 A;  5DKQ A;  1MR8 A;  4PAL A;  1KK7 Y;  1EL4 A;  1OQP A;  2JU0 A;  1PSB A;  4A4B A;  3KPX A;  2KFH A;  3JTD B;  3TZ1 A;  2K2A A;  2M7L A;  1H8B A;  3KHE A;  5KTY A;  1NIW A;  2ZND A;  1J7Q A;  3SJS A;  2L0P A;  3BUW B;  2Q4U A;  1KK8 C;  1SYM A;  2KAX A;  1M31 A;  2QAC A;  4GBA A;  3OX6 A;  5CSJ A;  1XYD A;  3O2P A;  1OZS A;  4I5L B;  3KEV A;  1HT9 A;  1YUR A;  4E68 A;  1MF8 B;  1DJZ A;  1N65 A;  2G2B A;  2KGB C;  1B7T Z;  4DCK A;  1CDN A;  1JC2 A;  2KI6 D;  1JFJ A;  2WCB A;  1YX8 A;  2PVB A;  1F55 A;  2KFG A;  2M8U A;  2WND A;  3OP0 A;  5AAN A;  2BCX A;  4D1E A;  2KNE A;  2HF5 A;  2FOT A;  1BOC A;  1TOP A;  2PAL A;  1C7W A;  1DT7 B;  1QV1 A;  1BU3 A;  1SL7 A;  2WCF A;  1K9P A;  1PSR A;  1UUR A;  5K89 A;  3HX4 A;  2M49 B;  1MXE A;  1CFF A;  5CSI A;  1JWD A;  1KQV A;  5D69 A;  1JFK A;  2BCB A;  1G33 A;  1F71 A;  2ZKM X;  1S6J A;  1AUI B;  1UWO A;  1WRK A;  4C0L A;  2A4J A;  1W7J B;  1BG1 A;  1B7T Y;  2JWW A;  4YGC B;  3SG3 A;  3EK7 A;  5JOL A;  3LCP C;  1WRZ A;  3KF9 A;  5AER A;  3NXA A;  3NSK A;  3SIB A;  3I5I C;  2F2O A;  2H2K A;  2LLU A;  4NDD A;  3IQO A;  3PN7 C;  3AAJ A;  2LVI A;  2KOT A;  2KI6 C;  3WHU B;  1FI5 A;  1YUS A;  1EXR A;  2LCP A;  1PRW A;  1DF0 B;  3I5I B;  1UHN A;  1W7I B;  2SAS A;  2M29 A;  3NSO A;  4P2Y B;  1IH0 A;  1IG5 A;  1KQM C;  4I5K A;  3PN7 B;  3PM8 A;  1YRT B;  2LMV A;  2LUX A;  5HYD A;  1S6I A;  2LAP A;  1Y1U A;  5KSZ A;  1KFU S;  4L9M A;  1CDP A;  1XK4 A;  2ZRS A;  1TTX A;  1TRF A;  2Q91 A;  1IKU A;  1J1E A;  1Y0V H;  2JTT A;  1KQM B;  1CLL A;  2MBX A;  1IWQ A;  3DD4 A;  3DVJ A;  1A2X A;  2M9G A;  2F2P A;  1NYA A;  1QAT A;  1UHH A;  2KBI A;  3A4U B;  1S36 A;  2COL B;  4JWQ A;  1NSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...