3PN7B

Visualizing new hinges and a potential major source of compliance in the lever arm of myosin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
RLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Visualizing key hinges and a potential major source of compliance in the lever arm of myosin.
pubmed doi rcsb
molecule tags Protein binding
total genus 44
structure length 141
sequence length 141
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7B01
1PK0D 2F3ZA 2KI6D 1QLSA 2JC2A 3PM8A 2NZ0A 1GQMA 1DJXA 1OMVA 1N65A 1KWOC 2BCBA 5B8IB 1K9KA 2M9GA 5I2LA 5BPJA 4C0LA 4I5NB 2JPTA 1A75A 3CS1A 3BYAA 1H4BA 2JT8A 3MSEB 3OP0A 2NLNA 1F54A 4I5JA 2BL0B 1MWNA 1ZFSA 3FWCA 2KDHA 3LLEA 1UHKA 4GGFC 2M49B 4CIDA 1SBJA 3K21A 3BQ3A 4OCIA 1PVAA 1XYDA 4A4CA 4OKHA 3GOFA 4ZCUA 2SASA 1CM4A 1MUXA 1TNWA 2BKHB 4I5KA 1TCFA 2Y4QA 1FBVA 3EK8A 1KFUS 3SG6A 2L4IA 1M45A 1SCMC 2GGZA 1A2XA 5KSZA 1SK6D 5HLVA 1L2OC 2PVBA 1F4OA 1MXLC 1TOPA 3E3RA 4CLNA 1CMGA 2OPOA 3TUYC 4GGFA 1YUUA 1QIWA 3IQOA 2JXLA 2L4HA 1SCVA 3A4UB 2F8PA 1B9AA 2I2RE 3M0WA 1JFKA 2HETA 1V1FA 1AUIB 1DJGA 2LCPA 2KI4C 1XO5A 4C0JA 1RK9A 1EG4A 3FIAA 1B8CA 1K93D 5TNCA 2JRFA 1OOJA 1KK8B 2LUXA 1J7RA 5AEQA 5I2QA 3CLNA 3VGOA 2JNXA 1QV0A 3BUWB 2WOSA 3PLFB 1V1GA 4ORBB 2BBMA 1QJTA 2DOQA 1NCZA 1CTRA 2TN4A 1QV1A 2FJUB 2HF5A 1KCYA 3SG7A 4YI8A 1AHRA 4L9MA 4C0KA 2AUCA 2NCPA 4ETOA 1AJ5A 1QVIY 2HQ8A 3EKJA 4P5OE 1SYMA 5HKYA 1PRWA 4YI9A 3PN7C 3D10A 1FI6A 3I5IB 3CR4X 1JF2A 2Y5IA 2M7NA 2ZKMX 4PHMA 1SR6C 1QVIZ 2KFFA 2JULA 4MZKA 2LMTA 1KFXL 1TNPA 2ZNDA 1J7QA 3WNXB 3KPXA 1RWYA 3EVVA 3IQQA 4ICBA 5D69A 1FPWA 1W7JB 1OE9B 2BCXA 1NYAA 1YRUB 2BE4A 4JPZB 3I5FC 1S5GY 3OB2B 1YVLA 1J7PA 1TN4A 4NDCA 1B8RA 2AAOA 2LVKA 2JZIA 1N2DA 4MN0A 3OX5A 4GBAA 3CZTX 2LUCA 1CDLA 1GJYA 1ZMZA 1F55A 2LAPA 3I5HC 5FYXA 4BY5A 1PALA 1GGWA 1XK4C 3CR2A 1YRTB 4PE4A 1S5GZ 4CFQA 2ZNEA 3EK7A 3AAJA 3O78A 2K61A 2KSPA 1CM1A 1XVJA 3AKAA 1UHNA 4JQ0D 1BOCA 1XA5A 1CMFA 2F33A 1IH0A 2CT9A 5CSNA 4XYNA 2I7AA 1UWOA 1WDCC 3PFVA 4N1FA 4PE0A 2KFHA 2KOTA 2WCFA 2K0JA 1XFXO 2K7BA 1LVCD 1UHJA 1B47A 1L2OB 3QRXA 2JQ6A 1EL4A 3GK4X 2MJWB 1KSOA 4M2QA 1C7VA 1XK4A 3AAKA 3I5GC 1DJYA 1BODA 3DVJA 1ALVA 2O5GA 1S6IA 4AQJA 2LM5A 2AMIA 2JU0A 3A8RA 1R2UA 4P2YB 2FOTA 2HQWA 1LA0A 2KI4B 3NXAA 4AOMA 1S6CA 4DS7A 1RFJA 1WRKA 2PRUA 5HKZA 2BBNA 3CWGA 2SCPA 1LKJA 1G8IA 1J1DA 2WORA 1BR4B 1A4PA 1QASA 4N1GA 1IJ6A 4TNCA 4ZCVA 3FWBA 1OZOA 1H8BA 3DD4A 2CCMA 1NPQA 2Y1MA 4CFRA 1OSAA 4YGCB 3LCPC 2P6BB 1U5IA 1YURA 1QXPA 5JOLA 4U8DA 1M39A 1DF0A 1DTLA 2I18A 4PE7A 3ZWHA 3OHMB 5K89A 5DKQA 2JWWA 5HLOA 1MR8A 4FTGA 1C7WA 2KAVA 2G9BA 5JJGA 1M31A 2KYCA 1SPYA 4HSZA 4PHJA 5J3XA 2WCBA 1IJ5A 1SW8A 5KTYA 1JFJA 4MEWA 1FF1A 2PSRA 3SG4A 1Y1XA 4OV2A 4DIRA 1HT9A 1NX1A 1SKTA 3WHTB 1SNLA 3I5FB 1JBAA 1EH2A 1YUTA 1J7OA 2KAXA 4E68A 2LE9B 1CLBA 2VRGA 1Y0VH 4CPVA 1F4QA 2PMYA 2ZRSA 3VRNA 1A03A 2M0RA 1B1GA 1QTXA 2M3WA 3SJSA 3LK1A 3GK2A 3O2PA 3VROA 1CFCA 2LV7A 2E30A 2FCDA 2V53A 1BT6A 2BECA 1XFYO 2A4JA 2KAYA 1DMOA 1SY9A 4DCKA 1BU3A 1BF5A 1UP5A 1DGVA 2MRDA 4IL1A 4Q04A 3DVKA 3SIBA 1YX8A 2LANA 1QATA 2OS8C 3KF9A 2NCOA 3O6BA 2JTZA 4R1EA 4PHNA 1MQ1A 4QJ4B 1A75B 3PSRA 1JSAA 2QPTA 3JTDC 1RECA 1G33A 1B4CA 1WLZA 3CR5X 3H4SE 3VRQA 1QIVA 2M7LA 2JT3A 1A29A 2CNPA 3I5GB 1KQVA 2BCAA 5CSJA 2O60A 1DJHA 4F0ZB 5HKWA 4MLWA 1K2HA 1QX2A 5CPVA 2F2PA 3NSLA 2M8UA 3TS5C 1KWOB 1U5IB 2H2KA 1OMRA 3BUMB 1TTXA 1NIWA 3LK0A 1S26D 4ORAB 4JWQA 1K94A 1SMGA 1OZSA 1K9UA 2JNFA 5ER4X 1K96A 4HREE 2LP3A 4GPLB 1DVIA 2KFGA 2LMVA 3OB1B 2MA2A 2KGBC 1JC2A 1KFUL 4GUKA 1B7TY 1YTZC 1NUBA 1X02A 1IQ3A 2HPSA 2LC5A 3LL8B 4N5XA 5KU1A 1BLQA 2COLB 1B8LA 2ZRTA 1EJ3A 2GV5A 2WCEA 3EK4A 2H61C 2M1UA 2JT0A 3BOWA 4XJKA 1K95A 1YUSA 3VRPA 1LA3A 2ZN9A 4NDBA 1JF0A 1KSMA 1QX5B 2G2BA 1SL9A 1AK8A 1ZOTB 1SCMB 4MZLA 2K7CA 3JVTC 1B7TZ 4GAOA 4WQ3A 1F71A 5DKNA 1M46A 1OMDA 3TZ1A 2Q4UA 1L7ZA 4MVFA 4PALA 3TUYB 1QLKA 3BUXB 1YX7A 3C1VA 1NX0A 3CGAA 2M1KB 4QJ3B 2PASA 5CSIA 1IRJA 1LINA 1QS7A 1ZUZA 2H61A 4YBHB 1K9PA 3IF7A 5CSFA 1M63B 2WNDA 1PVBA 1YR5A 5I2OA 1XFUO 2Y1NA 1R6PA 1AJ4A 1N0YA 1YVHA 2L5XB 1E8AA 3I5IC 1NSHA 1SRAA 5HYDA 3WXAA 1CFDA 1WY9A 2IS9A 2CTNA 4D1EA 1KQMC 2PALA 2KGRA 2L98A 4USLA 2Q91A 5GQQC 4AQIA 4QJ5B 1G4YR 1IGVA 3SIAA 3DVEA 1LXFC 1RTP1 1TNXA 2KQ6A 1UUSA 1FW4A 1J1EA 3KEVA 1IKUA 3EVRA 1KFXS 5I8NA 1Y6WA 4YGDB 3F45A 2L51A 2BKIB 1IQ5A 4MRXA 2EC6C 2OS8B 1Q80A 3TDZA 5G08A 1FI5A 4GFTA 4BY4A 3PN7B 3JTDB 1WRZA 2MBXA 2OTGC 2EGDA 3D0YA 1SR6B 2BE6A 1XFZO 3BXKA 3O4YA 2LHLA 1NCYA 3SG5A 1K90D 4YGBB 2MLEC 1CLMA 1C07A 1OQPA 1S1EA 3BOWB 2MLFC 4XJKB 3RLZA 5AERA 2JOJA 3TS5B 2ZFDA 1Y1AA 3DVMA 4OR9B 4ORCB 4PDZA 4DRWA 3DF0A 2KQYA 2L2EA 1JUOA 3I5HB 4OVNF 1DJZA 2B1UA 3HCMA 1CNPA 4DUQA 2KBMA 1BR1B 1CLLA 3KHEA 2LLSA 2ISDA 1DJWA 2L50A 3ICBA 3SG2A 2LVIA 3PATA 2ZN8A 5AFPA 3PALA 1F70A 1KK7Y 1CB1A 2D8NA 5F6TA 4UPGA 1WDCB 1DJIA 2JTTA 2BL0C 1EXRA 2I94A 2LLUA 2RGIA 5D7FA 2CXJA 1WLMA 3JVTB 4PE1A 2FCEA 2KI6C 1CFFA 4A4BA 1AP4A 1XFWO 4MRYA 1ODBA 4MSPA 2LMUA 2KBIA 4WQ2A 1KK7Z 4PHKA 4M2PA 3KO0A 1RJVA 2LVVA 1CFPA 1AVSA 2K2FA 4PCWA 2K2AA 1CDMA 2K7OA 1S3PA 1IG5A 4M2OA 2MHHA 3NSOA 1CDNA 1TNQA 2KHNA 1BG1A 3NSKA 1DF0B 1NX3A 1MF8B 1MHOA 2F3YA 3BUOB 1DT7B 1F8HA 1UURA 1JWDA 3CTNA 2GGMA 1NP8A 4YGAA 5ER5A 1NCXA 1PSBA 2KNEA 2M29A 4FQOA 5PALA 3TDIA 5AXIA 1KQMB 3GK1A 1TCOB 1XFVO 2QACA 3NSIA 3D0YB 4MBEA 3VRRA 5IBWA 2LNKA 2MAZA 2R2IA 4YRUA 3FS7A 2CBLA 1WRLA 1MXEA 1HQVA 1ZACA 3BUNB 1PSRA 3EVUA 2LVJA 2M97A 1IWQA 4MZJA 1SL7A 1S6JA 4GGNA 4NQGA 1CDPA 1KK8C 1UHIA 1VRKA 1GGZA 2LP2A 1J55A 2L0PA 4HRGA 2EC6B 1CKKA 1RROA 1W7IB 3DF0B 1NX2A 1ALWA 3AKBA 3OX6A 1D1OA 1UHHA 5AANA 2OTGB 3SG3A 2F2OA 1K8UA 4I5LB 3EKHA 4GNKB 4YGEB 4WRIA 4HRHA 2LLTA 2KYFA 1NWDA 3WHUB 1EG3A 2K8MB 2K7DA 3RM1A 2LHIA 1SL8A 5DKRA 2NXQA 1Y1UA 2EHBA 4NDDA 3ZNIA 3HX4A 1BMOA 1BJFA 2JXCA 3TDUA 1S36A 1PULA 1DGUA 1TIZA 2WC8A 1QX7A 2E6WA 1TRFA
chains in the Genus database with same CATH superfamily
1PK0D 2F3ZA 2KI6D 1QLSA 2JC2A 3PM8A 2NZ0A 1GQMA 5D3OA 1DJXA 1OMVA 1N65A 3L4LA 1KWOC 2BCBA 5B8IB 1K9KA 2M9GA 5I2LA 5BPJA 1QWVA 2QEHA 3UNWA 4C0LA 4I5NB 2JPTA 1A75A 3CS1A 4JD9A 3BYAA 1H4BA 2JT8A 3MSEB 3OP0A 2NLNA 1F54A 4I5JA 2BL0B 1MWNA 1ZFSA 3FWCA 2KDHA 3LLEA 1UHKA 4GGFC 2M49B 2WC5A 4CIDA 1SBJA 3K21A 3BQ3A 4OCIA 1PVAA 1XYDA 4A4CA 4OKHA 3GOFA 4ZCUA 2SASA 1CM4A 2KPHA 1MUXA 1TNWA 2BKHB 4I5KA 1TCFA 2Y4QA 1FBVA 3EK8A 1KFUS 3SG6A 3R72A 2L4IA 1M45A 1SCMC 2GGZA 1A2XA 5KSZA 1SK6D 5HLVA 1L2OC 2PVBA 1F4OA 1MXLC 1TOPA 3E3RA 4CLNA 1CMGA 2OPOA 3TUYC 4GGFA 3L4AA 1YUUA 1QIWA 3CDNA 3IQOA 2JXLA 2L4HA 1SCVA 2PQLA 3A4UB 2F8PA 1B9AA 2I2RE 3M0WA 1JFKA 2HETA 1V1FA 1AUIB 1DJGA 1TUJA 2LCPA 2KI4C 1XO5A 4C0JA 1RK9A 1EG4A 3FIAA 1B8CA 1K93D 3BFBA 2JRFA 1OOJA 1KK8B 2LUXA 1J7RA 5AEQA 5DICA 3CLNA 5I2QA 3VGOA 2JNXA 1QV0A 3BUWB 2WOSA 3PLFB 1V1GA 4ORBB 2BBMA 1QJTA 2DOQA 1NCZA 1CTRA 2TN4A 1QV1A 2FJUB 5TNCA 2HF5A 1KCYA 3SG7A 4YI8A 1AHRA 4L9MA 4C0KA 2AUCA 2NCPA 4ETOA 1AJ5A 1QVIY 3CZ0A 2HQ8A 3EKJA 2KLEA 4P5OE 1SYMA 2WCMA 5HKYA 1OW4A 1PRWA 4YI9A 3PN7C 1DELA 3D10A 1FI6A 3EG5B 3CR4X 3I5IB 3SS4A 1JF2A 2Y5IA 2M7NA 2ZKMX 4PHMA 1SR6C 1QVIZ 2KFFA 2JULA 3CYZA 4MZKA 2LMTA 1KFXL 1TNPA 2ZNDA 3DZTA 3WNXB 3KPXA 1J7QA 1RWYA 3EVVA 3IQQA 4ICBA 5D69A 1FPWA 3D78A 1W7JB 1OE9B 2BCXA 1NYAA 1YRUB 2BE4A 4JPZB 3I5FC 1S5GY 3OB2B 1YVLA 1J7PA 1TN4A 4NDCA 1B8RA 2AAOA 2LVKA 2JZIA 1N2DA 4MN0A 3OX5A 4GBAA 3CZTX 2WCHA 2LUCA 1CDLA 1GJYA 1ZMZA 1F55A 1Z2CB 2LAPA 3I5HC 5FYXA 2H8VA 4BY5A 1PALA 1GGWA 1XK4C 3CR2A 1YRTB 4PE4A 1S5GZ 4CFQA 2ZNEA 3EK7A 3AAJA 3O78A 2K61A 2KSPA 3DXLA 1CM1A 1XVJA 3AKAA 1UHNA 4JQ0D 1BOCA 1XA5A 3B6XA 1CMFA 2F33A 1IH0A 2CT9A 3S0BA 5CSNA 2YGUA 4XYNA 2I7AA 1UWOA 1WDCC 3PFVA 3B7AA 3O4XA 4N1FA 4PE0A 2KFHA 2KOTA 2WCFA 2K0JA 2QEBA 1XFXO 2K7BA 1LVCD 1UHJA 1B47A 1L2OB 3QRXA 4OZDA 2JQ6A 1EL4A 3GK4X 3R1VA 2MJWB 3S0DA 1KSOA 4M2QA 1C7VA 1XK4A 3AAKA 3I5GC 1DJYA 1BODA 3DVJA 1ALVA 2O5GA 1S6IA 4AQJA 2LM5A 2AMIA 2JU0A 3A8RA 1R2UA 2JPOA 2GTEA 4P2YB 2FOTA 2P70A 2HQWA 1W9ZA 1LA0A 2KI4B 3NXAA 4AOMA 1S6CA 4DS7A 1RFJA 1WRKA 2PRUA 3FE8A 5HKZA 2BBNA 3CWGA 2SCPA 3NHTA 1OOIX 1LKJA 1G8IA 1IIOA 1J1DA 2WORA 1BR4B 1A4PA 1QASA 2BAPA 4N1GA 1IJ6A 4TNCA 4ZCVA 3FWBA 1OZOA 3B87A 3DD4A 2CCMA 1NPQA 2Y1MA 4INWA 1H8BA 4CFRA 1OSAA 3BFAA 4YGCB 5FI6A 3LCPC 2P6BB 1U5IA 2L2CA 1YURA 1QXPA 5JOLA 4U8DA 3R1OA 1M39A 1DF0A 1DTLA 2I18A 4PE7A 3ZWHA 3OHMB 5K89A 5DKQA 2JWWA 2ERBA 5HLOA 1MR8A 4FTGA 1C7WA 2KAVA 1C3YA 2G9BA 5JJGA 1M31A 2KYCA 1SPYA 4HSZA 3R1PA 4PHJA 5J3XA 2WCBA 1IJ5A 1SW8A 5KTYA 1JFJA 4MEWA 1FF1A 3S0GA 2QEOA 2PSRA 3SG4A 1Y1XA 4OV2A 4DIRA 1HT9A 1NX1A 1SKTA 3WHTB 1SNLA 4IJ7A 3I5FB 1JBAA 4INXA 1EH2A 1YUTA 1J7OA 2KAXA 4E68A 1SSEB 2LE9B 3CABA 1CLBA 2VRGA 1Y0VH 4CPVA 1F4QA 2PMYA 2ZRSA 3VRNA 1A03A 2M0RA 1B1GA 1QTXA 2M3WA 3D77A 3LK1A 3GK2A 3SJSA 3O2PA 3VROA 1CFCA 2LV7A 2E30A 2FCDA 2V53A 3CZ1A 1BT6A 1XFYO 2A4JA 2BECA 2KAYA 2L5YA 1SY9A 4DCKA 2KLDA 1DMOA 1BU3A 1BF5A 1UP5A 1DGVA 2MRDA 4IL1A 4Q04A 3DVKA 3SIBA 1YX8A 2LANA 1QATA 2OS8C 3KF9A 2NCOA 3O6BA 2JTZA 4R1EA 4PHNA 1MQ1A 4QJ4B 1A75B 3PSRA 1JSAA 2QPTA 3JTDC 1RECA 1G33A 1B4CA 1WLZA 3CR5X 3H4SE 3VRQA 1QIVA 2M7LA 2JT3A 1A29A 2CNPA 3I5GB 1KQVA 2BCAA 3B86A 5CSJA 2O60A 1DJHA 4F0ZB 5FI2A 5HKWA 4MLWA 1K2HA 1QX2A 5CPVA 2F2PA 3NSLA 2M8UA 3TS5C 1KWOB 1U5IB 2H2KA 1OMRA 3BUMB 1T14A 3SS3A 3FE9A 3D73A 1TTXA 1NIWA 3LK0A 3NHIA 1S26D 4ORAB 4JWQA 1K94A 1SMGA 1OZSA 1TUZA 1K9UA 2JNFA 5ER4X 1K96A 4HREE 2LP3A 3B88A 1DVIA 2KFGA 2LMVA 3DY9A 3OB1B 2MA2A 2KGBC 4GPLB 1JC2A 1KFUL 4GUKA 4F7FA 1B7TY 1YTZC 1NUBA 1X02A 2WCLA 1IQ3A 2HPSA 2LC5A 3LL8B 4N5XA 5KU1A 1BLQA 2COLB 1B8LA 2ZRTA 1EJ3A 2GV5A 2WCEA 3EK4A 2H61C 2M1UA 2JT0A 3BOWA 4XJKA 1K95A 1YUSA 3VRPA 1LA3A 2ZN9A 3SS5A 4NDBA 1JF0A 1KSMA 1QX5B 2G2BA 1SL9A 1AK8A 1ZOTB 1SCMB 4MZLA 2K7CA 3PJIA 3JVTC 1B7TZ 3Q8IA 4GAOA 1C3ZA 4WQ3A 5DKNA 1M46A 1F71A 1OMDA 3TZ1A 2Q4UA 1L7ZA 4MVFA 4PALA 3TUYB 1QLKA 1DC1A 3BUXB 1XFRA 1YX7A 3C1VA 1NX0A 3CGAA 2M1KB 4QJ3B 2PASA 5CSIA 1IRJA 1ZUZA 1LINA 1QS7A 2H61A 4YBHB 1K9PA 1LS8A 3IF7A 5CSFA 1M63B 2WNDA 1PVBA 1YR5A 5I2OA 1XFUO 2Y1NA 3S0AA 1R6PA 1AJ4A 1N0YA 1YVHA 2L5XB 1E8AA 3I5IC 1NSHA 1SRAA 5HYDA 3WXAA 3NGVA 1CFDA 1OOGA 1WY9A 2CTNA 2IS9A 4D1EA 1KQMC 2PALA 2KGRA 2L98A 3S0EA 4USLA 2Q91A 5GQQC 4AQIA 4QJ5B 1G4YR 1IGVA 3SIAA 3DVEA 1LXFC 1RTP1 1TNXA 2KQ6A 1UUSA 1FW4A 1J1EA 3KEVA 2QDIA 1IKUA 3EVRA 5I94A 1KFXS 5I8NA 1Y6WA 3K1EA 4YGDB 3F45A 2L51A 2BKIB 1IQ5A 4MRXA 2EC6C 3S0FA 2OS8B 1Q80A 3TDZA 5G08A 1FI5A 3VB1A 2QEVA 4GFTA 4BY4A 3PN7B 3PM2A 3JTDB 4JKTA 1WRZA 2MBXA 2OTGC 3V2LA 2EGDA 3D0YA 3OGNA 1SR6B 1ORGA 4FQTA 5FI7A 2BE6A 1XFZO 3BXKA 3O4YA 4PT1A 2LHLA 1NCYA 3SG5A 1K90D 1DQEA 4YGBB 2MLEC 1CLMA 1C07A 1OQPA 1S1EA 3BOWB 2MLFC 4XJKB 3RLZA 5AERA 1OOFA 2JOJA 3TS5B 2ZFDA 1Y1AA 3DVMA 4OR9B 4ORCB 4PDZA 4DRWA 3DF0A 2KQYA 2L2EA 1JUOA 3I5HB 4OVNF 1DJZA 1Z4HA 2B1UA 3HCMA 1CNPA 4DUQA 2KBMA 1BR1B 1CLLA 3KHEA 2LLSA 2ISDA 3UO9A 1DJWA 2L50A 3ICBA 3N7HA 3SG2A 2LVIA 3PATA 3RZSA 2ZN8A 5AFPA 3PALA 1F70A 1KK7Y 1CB1A 3FE6A 2D8NA 5F6TA 4UPGA 1WDCB 1DJIA 2JTTA 2BL0C 1EXRA 2I94A 2LLUA 2RGIA 5D7FA 2CXJA 1WLMA 3JVTB 4PE1A 2FCEA 2KI6C 1CFFA 2BNXA 4KYNA 4A4BA 1AP4A 1XFWO 4MRYA 1ODBA 3OBVA 4MSPA 2LMUA 2KBIA 4WQ2A 1KK7Z 4PHKA 4M2PA 3KO0A 1RJVA 2LVVA 1CFPA 1AVSA 2K2FA 4PCWA 2K2AA 1CDMA 2K7OA 1S3PA 1IG5A 4M2OA 2MHHA 3NSOA 1CDNA 1TNQA 3D74A 2KHNA 3D76A 3NSKA 1DF0B 1BG1A 1NX3A 1MF8B 1MHOA 2F3YA 3BUOB 1DT7B 1F8HA 1UURA 1JWDA 3CTNA 2GGMA 1GM0A 1NP8A 4YGAA 5ER5A 1NCXA 1PSBA 2KNEA 2M29A 4FQOA 5PALA 3TDIA 5AXIA 5HL1A 1KQMB 3GK1A 1TCOB 3IVTA 1XFVO 2QACA 3NSIA 3D0YB 4MBEA 3VRRA 5IBWA 2P71A 2LNKA 1TWOA 2MAZA 2R2IA 4YRUA 3FS7A 1WRLA 1MXEA 2CBLA 1HQVA 1ZACA 3BUNB 1PSRA 3EVUA 2LVJA 2WC6A 2M97A 1IWQA 4MZJA 1SL7A 1S6JA 4GGNA 4NQGA 1CDPA 1KK8C 1UHIA 1VRKA 1GGZA 2LP2A 1J55A 2L0PA 4HRGA 2EC6B 3D75A 1CKKA 1P28A 1RROA 1W7IB 3DF0B 1NX2A 1ALWA 3AKBA 3OX6A 1D1OA 1UHHA 2K60A 5AANA 2WCKA 2OTGB 3SG3A 1DEKA 2F2OA 1K8UA 3DYEA 4I5LB 3EKHA 4GNKB 4YGEB 4WRIA 3BJHA 4HRHA 2LLTA 2KYFA 1NWDA 3WHUB 1EG3A 2K8MB 2K7DA 3RM1A 2LHIA 1SL8A 5DKRA 2NXQA 3BFHA 2FJYA 3QMEA 5EL2A 1Y1UA 2EHBA 1OOHA 2WCJA 4NDDA 3ZNIA 3L47A 3HX4A 1BMOA 1BJFA 2JXCA 3TDUA 1S36A 1PULA 1DGUA 2PYQA 1TIZA 2WC8A 3CZ2A 1QX7A 2E6WA 1TRFA
chains in the Genus database with same CATH topology
1PK0D 2F3ZA 2KI6D 1QLSA 2JC2A 3PM8A 2NZ0A 1GQMA 1DJXA 1OMVA 1N65A 1KWOC 2BCBA 5B8IB 1K9KA 2M9GA 5I2LA 5BPJA 4C0LA 4I5NB 2JPTA 1A75A 3CS1A 3BYAA 1H4BA 2JT8A 3MSEB 3OP0A 2NLNA 1F54A 4I5JA 2BL0B 1MWNA 1ZFSA 3FWCA 2KDHA 3LLEA 1UHKA 4GGFC 2M49B 4CIDA 1SBJA 3K21A 3BQ3A 4OCIA 1PVAA 1XYDA 4A4CA 4OKHA 3GOFA 4ZCUA 2SASA 1CM4A 1MUXA 1TNWA 2BKHB 4I5KA 1TCFA 2Y4QA 1FBVA 3EK8A 1KFUS 3SG6A 2L4IA 1M45A 1SCMC 2GGZA 1A2XA 5KSZA 1SK6D 5HLVA 1L2OC 2PVBA 1F4OA 1MXLC 1TOPA 3E3RA 4CLNA 1CMGA 2OPOA 3TUYC 4GGFA 1YUUA 1QIWA 3IQOA 2JXLA 2L4HA 1SCVA 3A4UB 2F8PA 1B9AA 2I2RE 3M0WA 1JFKA 2HETA 1V1FA 1AUIB 1DJGA 2LCPA 2KI4C 1XO5A 4C0JA 1RK9A 1EG4A 3FIAA 1B8CA 1K93D 5TNCA 2JRFA 1OOJA 1KK8B 2LUXA 1J7RA 5AEQA 5I2QA 3CLNA 3VGOA 2JNXA 1QV0A 3BUWB 2WOSA 3PLFB 1V1GA 4ORBB 2BBMA 1QJTA 2DOQA 1NCZA 1CTRA 2TN4A 1QV1A 2FJUB 2HF5A 1KCYA 3SG7A 4YI8A 1AHRA 4L9MA 4C0KA 2AUCA 2NCPA 4ETOA 1AJ5A 1QVIY 2HQ8A 3EKJA 4P5OE 1SYMA 5HKYA 1PRWA 4YI9A 3PN7C 3D10A 1FI6A 3I5IB 3CR4X 1JF2A 2Y5IA 2M7NA 2ZKMX 4PHMA 1SR6C 1QVIZ 2KFFA 2JULA 4MZKA 2LMTA 1KFXL 1TNPA 2ZNDA 1J7QA 3WNXB 3KPXA 1RWYA 3EVVA 3IQQA 4ICBA 5D69A 1FPWA 1W7JB 1OE9B 2BCXA 1NYAA 1YRUB 2BE4A 4JPZB 3I5FC 1S5GY 3OB2B 1YVLA 1J7PA 1TN4A 4NDCA 1B8RA 2AAOA 2LVKA 2JZIA 1N2DA 4MN0A 3OX5A 4GBAA 3CZTX 2LUCA 1CDLA 1GJYA 1ZMZA 1F55A 2LAPA 3I5HC 5FYXA 4BY5A 1PALA 1GGWA 1XK4C 3CR2A 1YRTB 4PE4A 1S5GZ 4CFQA 2ZNEA 3EK7A 3AAJA 3O78A 2K61A 2KSPA 1CM1A 1XVJA 3AKAA 1UHNA 4JQ0D 1BOCA 1XA5A 1CMFA 2F33A 1IH0A 2CT9A 5CSNA 4XYNA 2I7AA 1UWOA 1WDCC 3PFVA 4N1FA 4PE0A 2KFHA 2KOTA 2WCFA 2K0JA 1XFXO 2K7BA 1LVCD 1UHJA 1B47A 1L2OB 3QRXA 2JQ6A 1EL4A 3GK4X 2MJWB 1KSOA 4M2QA 1C7VA 1XK4A 3AAKA 3I5GC 1DJYA 1BODA 3DVJA 1ALVA 2O5GA 1S6IA 4AQJA 2LM5A 2AMIA 2JU0A 3A8RA 1R2UA 4P2YB 2FOTA 2HQWA 1LA0A 2KI4B 3NXAA 4AOMA 1S6CA 4DS7A 1RFJA 1WRKA 2PRUA 5HKZA 2BBNA 3CWGA 2SCPA 1LKJA 1G8IA 1J1DA 2WORA 1BR4B 1A4PA 1QASA 4N1GA 1IJ6A 4TNCA 4ZCVA 3FWBA 1OZOA 1H8BA 3DD4A 2CCMA 1NPQA 2Y1MA 4CFRA 1OSAA 4YGCB 3LCPC 2P6BB 1U5IA 1YURA 1QXPA 5JOLA 4U8DA 1M39A 1DF0A 1DTLA 2I18A 4PE7A 3ZWHA 3OHMB 5K89A 5DKQA 2JWWA 5HLOA 1MR8A 4FTGA 1C7WA 2KAVA 2G9BA 5JJGA 1M31A 2KYCA 1SPYA 4HSZA 4PHJA 5J3XA 2WCBA 1IJ5A 1SW8A 5KTYA 1JFJA 4MEWA 1FF1A 2PSRA 3SG4A 1Y1XA 4OV2A 4DIRA 1HT9A 1NX1A 1SKTA 3WHTB 1SNLA 3I5FB 1JBAA 1EH2A 1YUTA 1J7OA 2KAXA 4E68A 2LE9B 1CLBA 2VRGA 1Y0VH 4CPVA 1F4QA 2PMYA 2ZRSA 3VRNA 1A03A 2M0RA 1B1GA 1QTXA 2M3WA 3SJSA 3LK1A 3GK2A 3O2PA 3VROA 1CFCA 2LV7A 2E30A 2FCDA 2V53A 1BT6A 2BECA 1XFYO 2A4JA 2KAYA 1DMOA 1SY9A 4DCKA 1BU3A 1BF5A 1UP5A 1DGVA 2MRDA 4IL1A 4Q04A 3DVKA 3SIBA 1YX8A 2LANA 1QATA 2OS8C 3KF9A 2NCOA 3O6BA 2JTZA 4R1EA 4PHNA 1MQ1A 4QJ4B 1A75B 3PSRA 1JSAA 2QPTA 3JTDC 1RECA 1G33A 1B4CA 1WLZA 3CR5X 3H4SE 3VRQA 1QIVA 2M7LA 2JT3A 1A29A 2CNPA 3I5GB 1KQVA 2BCAA 5CSJA 2O60A 1DJHA 4F0ZB 5HKWA 4MLWA 1K2HA 1QX2A 5CPVA 2F2PA 3NSLA 2M8UA 3TS5C 1KWOB 1U5IB 2H2KA 1OMRA 3BUMB 1TTXA 1NIWA 3LK0A 1S26D 4ORAB 4JWQA 1K94A 1SMGA 1OZSA 1K9UA 2JNFA 5ER4X 1K96A 4HREE 2LP3A 4GPLB 1DVIA 2KFGA 2LMVA 3OB1B 2MA2A 2KGBC 1JC2A 1KFUL 4GUKA 1B7TY 1YTZC 1NUBA 1X02A 1IQ3A 2HPSA 2LC5A 3LL8B 4N5XA 5KU1A 1BLQA 2COLB 1B8LA 2ZRTA 1EJ3A 2GV5A 2WCEA 3EK4A 2H61C 2M1UA 2JT0A 3BOWA 4XJKA 1K95A 1YUSA 3VRPA 1LA3A 2ZN9A 4NDBA 1JF0A 1KSMA 1QX5B 2G2BA 1SL9A 1AK8A 1ZOTB 1SCMB 4MZLA 2K7CA 3JVTC 1B7TZ 4GAOA 4WQ3A 1F71A 5DKNA 1M46A 1OMDA 3TZ1A 2Q4UA 1L7ZA 4MVFA 4PALA 3TUYB 1QLKA 3BUXB 1YX7A 3C1VA 1NX0A 3CGAA 2M1KB 4QJ3B 2PASA 5CSIA 1IRJA 1LINA 1QS7A 1ZUZA 2H61A 4YBHB 1K9PA 3IF7A 5CSFA 1M63B 2WNDA 1PVBA 1YR5A 5I2OA 1XFUO 2Y1NA 1R6PA 1AJ4A 1N0YA 1YVHA 2L5XB 1E8AA 3I5IC 1NSHA 1SRAA 5HYDA 3WXAA 1CFDA 1WY9A 2IS9A 2CTNA 4D1EA 1KQMC 2PALA 2KGRA 2L98A 4USLA 2Q91A 5GQQC 4AQIA 4QJ5B 1G4YR 1IGVA 3SIAA 3DVEA 1LXFC 1RTP1 1TNXA 2KQ6A 1UUSA 1FW4A 1J1EA 3KEVA 1IKUA 3EVRA 1KFXS 5I8NA 1Y6WA 4YGDB 3F45A 2L51A 2BKIB 1IQ5A 4MRXA 2EC6C 2OS8B 1Q80A 3TDZA 5G08A 1FI5A 4GFTA 4BY4A 3PN7B 3JTDB 1WRZA 2MBXA 2OTGC 2EGDA 3D0YA 1SR6B 2BE6A 1XFZO 3BXKA 3O4YA 2LHLA 1NCYA 3SG5A 1K90D 4YGBB 2MLEC 1CLMA 1C07A 1OQPA 1S1EA 3BOWB 2MLFC 4XJKB 3RLZA 5AERA 2JOJA 3TS5B 2ZFDA 1Y1AA 3DVMA 4OR9B 4ORCB 4PDZA 4DRWA 3DF0A 2KQYA 2L2EA 1JUOA 3I5HB 4OVNF 1DJZA 2B1UA 3HCMA 1CNPA 4DUQA 2KBMA 1BR1B 1CLLA 3KHEA 2LLSA 2ISDA 1DJWA 2L50A 3ICBA 3SG2A 2LVIA 3PATA 2ZN8A 5AFPA 3PALA 1F70A 1KK7Y 1CB1A 2D8NA 5F6TA 4UPGA 1WDCB 1DJIA 2JTTA 2BL0C 1EXRA 2I94A 2LLUA 2RGIA 5D7FA 2CXJA 1WLMA 3JVTB 4PE1A 2FCEA 2KI6C 1CFFA 4A4BA 1AP4A 1XFWO 4MRYA 1ODBA 4MSPA 2LMUA 2KBIA 4WQ2A 1KK7Z 4PHKA 4M2PA 3KO0A 1RJVA 2LVVA 1CFPA 1AVSA 2K2FA 4PCWA 2K2AA 1CDMA 2K7OA 1S3PA 1IG5A 4M2OA 2MHHA 3NSOA 1CDNA 1TNQA 2KHNA 1BG1A 3NSKA 1DF0B 1NX3A 1MF8B 1MHOA 2F3YA 3BUOB 1DT7B 1F8HA 1UURA 1JWDA 3CTNA 2GGMA 1NP8A 4YGAA 5ER5A 1NCXA 1PSBA 2KNEA 2M29A 4FQOA 5PALA 3TDIA 5AXIA 1KQMB 3GK1A 1TCOB 1XFVO 2QACA 3NSIA 3D0YB 4MBEA 3VRRA 5IBWA 2LNKA 2MAZA 2R2IA 4YRUA 3FS7A 2CBLA 1WRLA 1MXEA 1HQVA 1ZACA 3BUNB 1PSRA 3EVUA 2LVJA 2M97A 1IWQA 4MZJA 1SL7A 1S6JA 4GGNA 4NQGA 1CDPA 1KK8C 1UHIA 1VRKA 1GGZA 2LP2A 1J55A 2L0PA 4HRGA 2EC6B 1CKKA 1RROA 1W7IB 3DF0B 1NX2A 1ALWA 3AKBA 3OX6A 1D1OA 1UHHA 5AANA 2OTGB 3SG3A 2F2OA 1K8UA 4I5LB 3EKHA 4GNKB 4YGEB 4WRIA 4HRHA 2LLTA 2KYFA 1NWDA 3WHUB 1EG3A 2K8MB 2K7DA 3RM1A 2LHIA 1SL8A 5DKRA 2NXQA 1Y1UA 2EHBA 4NDDA 3ZNIA 3HX4A 1BMOA 1BJFA 2JXCA 3TDUA 1S36A 1PULA 1DGUA 1TIZA 2WC8A 1QX7A 2E6WA 1TRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK0 D;  2F3Z A;  2KI6 D;  1QLS A;  2JC2 A;  3PM8 A;  2NZ0 A;  1GQM A;  1DJX A;  1OMV A;  1N65 A;  1KWO C;  2BCB A;  5B8I B;  1K9K A;  2M9G A;  5I2L A;  5BPJ A;  4C0L A;  4I5N B;  2JPT A;  1A75 A;  3CS1 A;  3BYA A;  1H4B A;  2JT8 A;  3MSE B;  3OP0 A;  2NLN A;  1F54 A;  4I5J A;  2BL0 B;  1MWN A;  1ZFS A;  3FWC A;  2KDH A;  3LLE A;  1UHK A;  4GGF C;  2M49 B;  4CID A;  1SBJ A;  3K21 A;  3BQ3 A;  4OCI A;  1PVA A;  1XYD A;  4A4C A;  4OKH A;  3GOF A;  4ZCU A;  2SAS A;  1CM4 A;  1MUX A;  1TNW A;  2BKH B;  4I5K A;  1TCF A;  2Y4Q A;  1FBV A;  3EK8 A;  1KFU S;  3SG6 A;  2L4I A;  1M45 A;  1SCM C;  2GGZ A;  1A2X A;  5KSZ A;  1SK6 D;  5HLV A;  1L2O C;  2PVB A;  1F4O A;  1MXL C;  1TOP A;  3E3R A;  4CLN A;  1CMG A;  2OPO A;  3TUY C;  4GGF A;  1YUU A;  1QIW A;  3IQO A;  2JXL A;  2L4H A;  1SCV A;  3A4U B;  2F8P A;  1B9A A;  2I2R E;  3M0W A;  1JFK A;  2HET A;  1V1F A;  1AUI B;  1DJG A;  2LCP A;  2KI4 C;  1XO5 A;  4C0J A;  1RK9 A;  1EG4 A;  3FIA A;  1B8C A;  1K93 D;  5TNC A;  2JRF A;  1OOJ A;  1KK8 B;  2LUX A;  1J7R A;  5AEQ A;  5I2Q A;  3CLN A;  3VGO A;  2JNX A;  1QV0 A;  3BUW B;  2WOS A;  3PLF B;  1V1G A;  4ORB B;  2BBM A;  1QJT A;  2DOQ A;  1NCZ A;  1CTR A;  2TN4 A;  1QV1 A;  2FJU B;  2HF5 A;  1KCY A;  3SG7 A;  4YI8 A;  1AHR A;  4L9M A;  4C0K A;  2AUC A;  2NCP A;  4ETO A;  1AJ5 A;  1QVI Y;  2HQ8 A;  3EKJ A;  4P5O E;  1SYM A;  5HKY A;  1PRW A;  4YI9 A;  3PN7 C;  3D10 A;  1FI6 A;  3I5I B;  3CR4 X;  1JF2 A;  2Y5I A;  2M7N A;  2ZKM X;  4PHM A;  1SR6 C;  1QVI Z;  2KFF A;  2JUL A;  4MZK A;  2LMT A;  1KFX L;  1TNP A;  2ZND A;  1J7Q A;  3WNX B;  3KPX A;  1RWY A;  3EVV A;  3IQQ A;  4ICB A;  5D69 A;  1FPW A;  1W7J B;  1OE9 B;  2BCX A;  1NYA A;  1YRU B;  2BE4 A;  4JPZ B;  3I5F C;  1S5G Y;  3OB2 B;  1YVL A;  1J7P A;  1TN4 A;  4NDC A;  1B8R A;  2AAO A;  2LVK A;  2JZI A;  1N2D A;  4MN0 A;  3OX5 A;  4GBA A;  3CZT X;  2LUC A;  1CDL A;  1GJY A;  1ZMZ A;  1F55 A;  2LAP A;  3I5H C;  5FYX A;  4BY5 A;  1PAL A;  1GGW A;  1XK4 C;  3CR2 A;  1YRT B;  4PE4 A;  1S5G Z;  4CFQ A;  2ZNE A;  3EK7 A;  3AAJ A;  3O78 A;  2K61 A;  2KSP A;  1CM1 A;  1XVJ A;  3AKA A;  1UHN A;  4JQ0 D;  1BOC A;  1XA5 A;  1CMF A;  2F33 A;  1IH0 A;  2CT9 A;  5CSN A;  4XYN A;  2I7A A;  1UWO A;  1WDC C;  3PFV A;  4N1F A;  4PE0 A;  2KFH A;  2KOT A;  2WCF A;  2K0J A;  1XFX O;  2K7B A;  1LVC D;  1UHJ A;  1B47 A;  1L2O B;  3QRX A;  2JQ6 A;  1EL4 A;  3GK4 X;  2MJW B;  1KSO A;  4M2Q A;  1C7V A;  1XK4 A;  3AAK A;  3I5G C;  1DJY A;  1BOD A;  3DVJ A;  1ALV A;  2O5G A;  1S6I A;  4AQJ A;  2LM5 A;  2AMI A;  2JU0 A;  3A8R A;  1R2U A;  4P2Y B;  2FOT A;  2HQW A;  1LA0 A;  2KI4 B;  3NXA A;  4AOM A;  1S6C A;  4DS7 A;  1RFJ A;  1WRK A;  2PRU A;  5HKZ A;  2BBN A;  3CWG A;  2SCP A;  1LKJ A;  1G8I A;  1J1D A;  2WOR A;  1BR4 B;  1A4P A;  1QAS A;  4N1G A;  1IJ6 A;  4TNC A;  4ZCV A;  3FWB A;  1OZO A;  1H8B A;  3DD4 A;  2CCM A;  1NPQ A;  2Y1M A;  4CFR A;  1OSA A;  4YGC B;  3LCP C;  2P6B B;  1U5I A;  1YUR A;  1QXP A;  5JOL A;  4U8D A;  1M39 A;  1DF0 A;  1DTL A;  2I18 A;  4PE7 A;  3ZWH A;  3OHM B;  5K89 A;  5DKQ A;  2JWW A;  5HLO A;  1MR8 A;  4FTG A;  1C7W A;  2KAV A;  2G9B A;  5JJG A;  1M31 A;  2KYC A;  1SPY A;  4HSZ A;  4PHJ A;  5J3X A;  2WCB A;  1IJ5 A;  1SW8 A;  5KTY A;  1JFJ A;  4MEW A;  1FF1 A;  2PSR A;  3SG4 A;  1Y1X A;  4OV2 A;  4DIR A;  1HT9 A;  1NX1 A;  1SKT A;  3WHT B;  1SNL A;  3I5F B;  1JBA A;  1EH2 A;  1YUT A;  1J7O A;  2KAX A;  4E68 A;  2LE9 B;  1CLB A;  2VRG A;  1Y0V H;  4CPV A;  1F4Q A;  2PMY A;  2ZRS A;  3VRN A;  1A03 A;  2M0R A;  1B1G A;  1QTX A;  2M3W A;  3SJS A;  3LK1 A;  3GK2 A;  3O2P A;  3VRO A;  1CFC A;  2LV7 A;  2E30 A;  2FCD A;  2V53 A;  1BT6 A;  2BEC A;  1XFY O;  2A4J A;  2KAY A;  1DMO A;  1SY9 A;  4DCK A;  1BU3 A;  1BF5 A;  1UP5 A;  1DGV A;  2MRD A;  4IL1 A;  4Q04 A;  3DVK A;  3SIB A;  1YX8 A;  2LAN A;  1QAT A;  2OS8 C;  3KF9 A;  2NCO A;  3O6B A;  2JTZ A;  4R1E A;  4PHN A;  1MQ1 A;  4QJ4 B;  1A75 B;  3PSR A;  1JSA A;  2QPT A;  3JTD C;  1REC A;  1G33 A;  1B4C A;  1WLZ A;  3CR5 X;  3H4S E;  3VRQ A;  1QIV A;  2M7L A;  2JT3 A;  1A29 A;  2CNP A;  3I5G B;  1KQV A;  2BCA A;  5CSJ A;  2O60 A;  1DJH A;  4F0Z B;  5HKW A;  4MLW A;  1K2H A;  1QX2 A;  5CPV A;  2F2P A;  3NSL A;  2M8U A;  3TS5 C;  1KWO B;  1U5I B;  2H2K A;  1OMR A;  3BUM B;  1TTX A;  1NIW A;  3LK0 A;  1S26 D;  4ORA B;  4JWQ A;  1K94 A;  1SMG A;  1OZS A;  1K9U A;  2JNF A;  5ER4 X;  1K96 A;  4HRE E;  2LP3 A;  4GPL B;  1DVI A;  2KFG A;  2LMV A;  3OB1 B;  2MA2 A;  2KGB C;  1JC2 A;  1KFU L;  4GUK A;  1B7T Y;  1YTZ C;  1NUB A;  1X02 A;  1IQ3 A;  2HPS A;  2LC5 A;  3LL8 B;  4N5X A;  5KU1 A;  1BLQ A;  2COL B;  1B8L A;  2ZRT A;  1EJ3 A;  2GV5 A;  2WCE A;  3EK4 A;  2H61 C;  2M1U A;  2JT0 A;  3BOW A;  4XJK A;  1K95 A;  1YUS A;  3VRP A;  1LA3 A;  2ZN9 A;  4NDB A;  1JF0 A;  1KSM A;  1QX5 B;  2G2B A;  1SL9 A;  1AK8 A;  1ZOT B;  1SCM B;  4MZL A;  2K7C A;  3JVT C;  1B7T Z;  4GAO A;  4WQ3 A;  1F71 A;  5DKN A;  1M46 A;  1OMD A;  3TZ1 A;  2Q4U A;  1L7Z A;  4MVF A;  4PAL A;  3TUY B;  1QLK A;  3BUX B;  1YX7 A;  3C1V A;  1NX0 A;  3CGA A;  2M1K B;  4QJ3 B;  2PAS A;  5CSI A;  1IRJ A;  1LIN A;  1QS7 A;  1ZUZ A;  2H61 A;  4YBH B;  1K9P A;  3IF7 A;  5CSF A;  1M63 B;  2WND A;  1PVB A;  1YR5 A;  5I2O A;  1XFU O;  2Y1N A;  1R6P A;  1AJ4 A;  1N0Y A;  1YVH A;  2L5X B;  1E8A A;  3I5I C;  1NSH A;  1SRA A;  5HYD A;  3WXA A;  1CFD A;  1WY9 A;  2IS9 A;  2CTN A;  4D1E A;  1KQM C;  2PAL A;  2KGR A;  2L98 A;  4USL A;  2Q91 A;  5GQQ C;  4AQI A;  4QJ5 B;  1G4Y R;  1IGV A;  3SIA A;  3DVE A;  1LXF C;  1RTP 1;  1TNX A;  2KQ6 A;  1UUS A;  1FW4 A;  1J1E A;  3KEV A;  1IKU A;  3EVR A;  1KFX S;  5I8N A;  1Y6W A;  4YGD B;  3F45 A;  2L51 A;  2BKI B;  1IQ5 A;  4MRX A;  2EC6 C;  2OS8 B;  1Q80 A;  3TDZ A;  5G08 A;  1FI5 A;  4GFT A;  4BY4 A;  3PN7 B;  3JTD B;  1WRZ A;  2MBX A;  2OTG C;  2EGD A;  3D0Y A;  1SR6 B;  2BE6 A;  1XFZ O;  3BXK A;  3O4Y A;  2LHL A;  1NCY A;  3SG5 A;  1K90 D;  4YGB B;  2MLE C;  1CLM A;  1C07 A;  1OQP A;  1S1E A;  3BOW B;  2MLF C;  4XJK B;  3RLZ A;  5AER A;  2JOJ A;  3TS5 B;  2ZFD A;  1Y1A A;  3DVM A;  4OR9 B;  4ORC B;  4PDZ A;  4DRW A;  3DF0 A;  2KQY A;  2L2E A;  1JUO A;  3I5H B;  4OVN F;  1DJZ A;  2B1U A;  3HCM A;  1CNP A;  4DUQ A;  2KBM A;  1BR1 B;  1CLL A;  3KHE A;  2LLS A;  2ISD A;  1DJW A;  2L50 A;  3ICB A;  3SG2 A;  2LVI A;  3PAT A;  2ZN8 A;  5AFP A;  3PAL A;  1F70 A;  1KK7 Y;  1CB1 A;  2D8N A;  5F6T A;  4UPG A;  1WDC B;  1DJI A;  2JTT A;  2BL0 C;  1EXR A;  2I94 A;  2LLU A;  2RGI A;  5D7F A;  2CXJ A;  1WLM A;  3JVT B;  4PE1 A;  2FCE A;  2KI6 C;  1CFF A;  4A4B A;  1AP4 A;  1XFW O;  4MRY A;  1ODB A;  4MSP A;  2LMU A;  2KBI A;  4WQ2 A;  1KK7 Z;  4PHK A;  4M2P A;  3KO0 A;  1RJV A;  2LVV A;  1CFP A;  1AVS A;  2K2F A;  4PCW A;  2K2A A;  1CDM A;  2K7O A;  1S3P A;  1IG5 A;  4M2O A;  2MHH A;  3NSO A;  1CDN A;  1TNQ A;  2KHN A;  1BG1 A;  3NSK A;  1DF0 B;  1NX3 A;  1MF8 B;  1MHO A;  2F3Y A;  3BUO B;  1DT7 B;  1F8H A;  1UUR A;  1JWD A;  3CTN A;  2GGM A;  1NP8 A;  4YGA A;  5ER5 A;  1NCX A;  1PSB A;  2KNE A;  2M29 A;  4FQO A;  5PAL A;  3TDI A;  5AXI A;  1KQM B;  3GK1 A;  1TCO B;  1XFV O;  2QAC A;  3NSI A;  3D0Y B;  4MBE A;  3VRR A;  5IBW A;  2LNK A;  2MAZ A;  2R2I A;  4YRU A;  3FS7 A;  2CBL A;  1WRL A;  1MXE A;  1HQV A;  1ZAC A;  3BUN B;  1PSR A;  3EVU A;  2LVJ A;  2M97 A;  1IWQ A;  4MZJ A;  1SL7 A;  1S6J A;  4GGN A;  4NQG A;  1CDP A;  1KK8 C;  1UHI A;  1VRK A;  1GGZ A;  2LP2 A;  1J55 A;  2L0P A;  4HRG A;  2EC6 B;  1CKK A;  1RRO A;  1W7I B;  3DF0 B;  1NX2 A;  1ALW A;  3AKB A;  3OX6 A;  1D1O A;  1UHH A;  5AAN A;  2OTG B;  3SG3 A;  2F2O A;  1K8U A;  4I5L B;  3EKH A;  4GNK B;  4YGE B;  4WRI A;  4HRH A;  2LLT A;  2KYF A;  1NWD A;  3WHU B;  1EG3 A;  2K8M B;  2K7D A;  3RM1 A;  2LHI A;  1SL8 A;  5DKR A;  2NXQ A;  1Y1U A;  2EHB A;  4NDD A;  3ZNI A;  3HX4 A;  1BMO A;  1BJF A;  2JXC A;  3TDU A;  1S36 A;  1PUL A;  1DGU A;  1TIZ A;  2WC8 A;  1QX7 A;  2E6W A;  1TRF A; 
#chains in the Genus database with same CATH topology
 1PK0 D;  2F3Z A;  2KI6 D;  1QLS A;  2JC2 A;  3PM8 A;  2NZ0 A;  1GQM A;  5D3O A;  1DJX A;  1OMV A;  1N65 A;  3L4L A;  1KWO C;  2BCB A;  5B8I B;  1K9K A;  2M9G A;  5I2L A;  5BPJ A;  1QWV A;  2QEH A;  3UNW A;  4C0L A;  4I5N B;  2JPT A;  1A75 A;  3CS1 A;  4JD9 A;  3BYA A;  1H4B A;  2JT8 A;  3MSE B;  3OP0 A;  2NLN A;  1F54 A;  4I5J A;  2BL0 B;  1MWN A;  1ZFS A;  3FWC A;  2KDH A;  3LLE A;  1UHK A;  4GGF C;  2M49 B;  2WC5 A;  4CID A;  1SBJ A;  3K21 A;  3BQ3 A;  4OCI A;  1PVA A;  1XYD A;  4A4C A;  4OKH A;  3GOF A;  4ZCU A;  2SAS A;  1CM4 A;  2KPH A;  1MUX A;  1TNW A;  2BKH B;  4I5K A;  1TCF A;  2Y4Q A;  1FBV A;  3EK8 A;  1KFU S;  3SG6 A;  3R72 A;  2L4I A;  1M45 A;  1SCM C;  2GGZ A;  1A2X A;  5KSZ A;  1SK6 D;  5HLV A;  1L2O C;  2PVB A;  1F4O A;  1MXL C;  1TOP A;  3E3R A;  4CLN A;  1CMG A;  2OPO A;  3TUY C;  4GGF A;  3L4A A;  1YUU A;  1QIW A;  3CDN A;  3IQO A;  2JXL A;  2L4H A;  1SCV A;  2PQL A;  3A4U B;  2F8P A;  1B9A A;  2I2R E;  3M0W A;  1JFK A;  2HET A;  1V1F A;  1AUI B;  1DJG A;  1TUJ A;  2LCP A;  2KI4 C;  1XO5 A;  4C0J A;  1RK9 A;  1EG4 A;  3FIA A;  1B8C A;  1K93 D;  3BFB A;  2JRF A;  1OOJ A;  1KK8 B;  2LUX A;  1J7R A;  5AEQ A;  5DIC A;  3CLN A;  5I2Q A;  3VGO A;  2JNX A;  1QV0 A;  3BUW B;  2WOS A;  3PLF B;  1V1G A;  4ORB B;  2BBM A;  1QJT A;  2DOQ A;  1NCZ A;  1CTR A;  2TN4 A;  1QV1 A;  2FJU B;  5TNC A;  2HF5 A;  1KCY A;  3SG7 A;  4YI8 A;  1AHR A;  4L9M A;  4C0K A;  2AUC A;  2NCP A;  4ETO A;  1AJ5 A;  1QVI Y;  3CZ0 A;  2HQ8 A;  3EKJ A;  2KLE A;  4P5O E;  1SYM A;  2WCM A;  5HKY A;  1OW4 A;  1PRW A;  4YI9 A;  3PN7 C;  1DEL A;  3D10 A;  1FI6 A;  3EG5 B;  3CR4 X;  3I5I B;  3SS4 A;  1JF2 A;  2Y5I A;  2M7N A;  2ZKM X;  4PHM A;  1SR6 C;  1QVI Z;  2KFF A;  2JUL A;  3CYZ A;  4MZK A;  2LMT A;  1KFX L;  1TNP A;  2ZND A;  3DZT A;  3WNX B;  3KPX A;  1J7Q A;  1RWY A;  3EVV A;  3IQQ A;  4ICB A;  5D69 A;  1FPW A;  3D78 A;  1W7J B;  1OE9 B;  2BCX A;  1NYA A;  1YRU B;  2BE4 A;  4JPZ B;  3I5F C;  1S5G Y;  3OB2 B;  1YVL A;  1J7P A;  1TN4 A;  4NDC A;  1B8R A;  2AAO A;  2LVK A;  2JZI A;  1N2D A;  4MN0 A;  3OX5 A;  4GBA A;  3CZT X;  2WCH A;  2LUC A;  1CDL A;  1GJY A;  1ZMZ A;  1F55 A;  1Z2C B;  2LAP A;  3I5H C;  5FYX A;  2H8V A;  4BY5 A;  1PAL A;  1GGW A;  1XK4 C;  3CR2 A;  1YRT B;  4PE4 A;  1S5G Z;  4CFQ A;  2ZNE A;  3EK7 A;  3AAJ A;  3O78 A;  2K61 A;  2KSP A;  3DXL A;  1CM1 A;  1XVJ A;  3AKA A;  1UHN A;  4JQ0 D;  1BOC A;  1XA5 A;  3B6X A;  1CMF A;  2F33 A;  1IH0 A;  2CT9 A;  3S0B A;  5CSN A;  2YGU A;  4XYN A;  2I7A A;  1UWO A;  1WDC C;  3PFV A;  3B7A A;  3O4X A;  4N1F A;  4PE0 A;  2KFH A;  2KOT A;  2WCF A;  2K0J A;  2QEB A;  1XFX O;  2K7B A;  1LVC D;  1UHJ A;  1B47 A;  1L2O B;  3QRX A;  4OZD A;  2JQ6 A;  1EL4 A;  3GK4 X;  3R1V A;  2MJW B;  3S0D A;  1KSO A;  4M2Q A;  1C7V A;  1XK4 A;  3AAK A;  3I5G C;  1DJY A;  1BOD A;  3DVJ A;  1ALV A;  2O5G A;  1S6I A;  4AQJ A;  2LM5 A;  2AMI A;  2JU0 A;  3A8R A;  1R2U A;  2JPO A;  2GTE A;  4P2Y B;  2FOT A;  2P70 A;  2HQW A;  1W9Z A;  1LA0 A;  2KI4 B;  3NXA A;  4AOM A;  1S6C A;  4DS7 A;  1RFJ A;  1WRK A;  2PRU A;  3FE8 A;  5HKZ A;  2BBN A;  3CWG A;  2SCP A;  3NHT A;  1OOI X;  1LKJ A;  1G8I A;  1IIO A;  1J1D A;  2WOR A;  1BR4 B;  1A4P A;  1QAS A;  2BAP A;  4N1G A;  1IJ6 A;  4TNC A;  4ZCV A;  3FWB A;  1OZO A;  3B87 A;  3DD4 A;  2CCM A;  1NPQ A;  2Y1M A;  4INW A;  1H8B A;  4CFR A;  1OSA A;  3BFA A;  4YGC B;  5FI6 A;  3LCP C;  2P6B B;  1U5I A;  2L2C A;  1YUR A;  1QXP A;  5JOL A;  4U8D A;  3R1O A;  1M39 A;  1DF0 A;  1DTL A;  2I18 A;  4PE7 A;  3ZWH A;  3OHM B;  5K89 A;  5DKQ A;  2JWW A;  2ERB A;  5HLO A;  1MR8 A;  4FTG A;  1C7W A;  2KAV A;  1C3Y A;  2G9B A;  5JJG A;  1M31 A;  2KYC A;  1SPY A;  4HSZ A;  3R1P A;  4PHJ A;  5J3X A;  2WCB A;  1IJ5 A;  1SW8 A;  5KTY A;  1JFJ A;  4MEW A;  1FF1 A;  3S0G A;  2QEO A;  2PSR A;  3SG4 A;  1Y1X A;  4OV2 A;  4DIR A;  1HT9 A;  1NX1 A;  1SKT A;  3WHT B;  1SNL A;  4IJ7 A;  3I5F B;  1JBA A;  4INX A;  1EH2 A;  1YUT A;  1J7O A;  2KAX A;  4E68 A;  1SSE B;  2LE9 B;  3CAB A;  1CLB A;  2VRG A;  1Y0V H;  4CPV A;  1F4Q A;  2PMY A;  2ZRS A;  3VRN A;  1A03 A;  2M0R A;  1B1G A;  1QTX A;  2M3W A;  3D77 A;  3LK1 A;  3GK2 A;  3SJS A;  3O2P A;  3VRO A;  1CFC A;  2LV7 A;  2E30 A;  2FCD A;  2V53 A;  3CZ1 A;  1BT6 A;  1XFY O;  2A4J A;  2BEC A;  2KAY A;  2L5Y A;  1SY9 A;  4DCK A;  2KLD A;  1DMO A;  1BU3 A;  1BF5 A;  1UP5 A;  1DGV A;  2MRD A;  4IL1 A;  4Q04 A;  3DVK A;  3SIB A;  1YX8 A;  2LAN A;  1QAT A;  2OS8 C;  3KF9 A;  2NCO A;  3O6B A;  2JTZ A;  4R1E A;  4PHN A;  1MQ1 A;  4QJ4 B;  1A75 B;  3PSR A;  1JSA A;  2QPT A;  3JTD C;  1REC A;  1G33 A;  1B4C A;  1WLZ A;  3CR5 X;  3H4S E;  3VRQ A;  1QIV A;  2M7L A;  2JT3 A;  1A29 A;  2CNP A;  3I5G B;  1KQV A;  2BCA A;  3B86 A;  5CSJ A;  2O60 A;  1DJH A;  4F0Z B;  5FI2 A;  5HKW A;  4MLW A;  1K2H A;  1QX2 A;  5CPV A;  2F2P A;  3NSL A;  2M8U A;  3TS5 C;  1KWO B;  1U5I B;  2H2K A;  1OMR A;  3BUM B;  1T14 A;  3SS3 A;  3FE9 A;  3D73 A;  1TTX A;  1NIW A;  3LK0 A;  3NHI A;  1S26 D;  4ORA B;  4JWQ A;  1K94 A;  1SMG A;  1OZS A;  1TUZ A;  1K9U A;  2JNF A;  5ER4 X;  1K96 A;  4HRE E;  2LP3 A;  3B88 A;  1DVI A;  2KFG A;  2LMV A;  3DY9 A;  3OB1 B;  2MA2 A;  2KGB C;  4GPL B;  1JC2 A;  1KFU L;  4GUK A;  4F7F A;  1B7T Y;  1YTZ C;  1NUB A;  1X02 A;  2WCL A;  1IQ3 A;  2HPS A;  2LC5 A;  3LL8 B;  4N5X A;  5KU1 A;  1BLQ A;  2COL B;  1B8L A;  2ZRT A;  1EJ3 A;  2GV5 A;  2WCE A;  3EK4 A;  2H61 C;  2M1U A;  2JT0 A;  3BOW A;  4XJK A;  1K95 A;  1YUS A;  3VRP A;  1LA3 A;  2ZN9 A;  3SS5 A;  4NDB A;  1JF0 A;  1KSM A;  1QX5 B;  2G2B A;  1SL9 A;  1AK8 A;  1ZOT B;  1SCM B;  4MZL A;  2K7C A;  3PJI A;  3JVT C;  1B7T Z;  3Q8I A;  4GAO A;  1C3Z A;  4WQ3 A;  5DKN A;  1M46 A;  1F71 A;  1OMD A;  3TZ1 A;  2Q4U A;  1L7Z A;  4MVF A;  4PAL A;  3TUY B;  1QLK A;  1DC1 A;  3BUX B;  1XFR A;  1YX7 A;  3C1V A;  1NX0 A;  3CGA A;  2M1K B;  4QJ3 B;  2PAS A;  5CSI A;  1IRJ A;  1ZUZ A;  1LIN A;  1QS7 A;  2H61 A;  4YBH B;  1K9P A;  1LS8 A;  3IF7 A;  5CSF A;  1M63 B;  2WND A;  1PVB A;  1YR5 A;  5I2O A;  1XFU O;  2Y1N A;  3S0A A;  1R6P A;  1AJ4 A;  1N0Y A;  1YVH A;  2L5X B;  1E8A A;  3I5I C;  1NSH A;  1SRA A;  5HYD A;  3WXA A;  3NGV A;  1CFD A;  1OOG A;  1WY9 A;  2CTN A;  2IS9 A;  4D1E A;  1KQM C;  2PAL A;  2KGR A;  2L98 A;  3S0E A;  4USL A;  2Q91 A;  5GQQ C;  4AQI A;  4QJ5 B;  1G4Y R;  1IGV A;  3SIA A;  3DVE A;  1LXF C;  1RTP 1;  1TNX A;  2KQ6 A;  1UUS A;  1FW4 A;  1J1E A;  3KEV A;  2QDI A;  1IKU A;  3EVR A;  5I94 A;  1KFX S;  5I8N A;  1Y6W A;  3K1E A;  4YGD B;  3F45 A;  2L51 A;  2BKI B;  1IQ5 A;  4MRX A;  2EC6 C;  3S0F A;  2OS8 B;  1Q80 A;  3TDZ A;  5G08 A;  1FI5 A;  3VB1 A;  2QEV A;  4GFT A;  4BY4 A;  3PN7 B;  3PM2 A;  3JTD B;  4JKT A;  1WRZ A;  2MBX A;  2OTG C;  3V2L A;  2EGD A;  3D0Y A;  3OGN A;  1SR6 B;  1ORG A;  4FQT A;  5FI7 A;  2BE6 A;  1XFZ O;  3BXK A;  3O4Y A;  4PT1 A;  2LHL A;  1NCY A;  3SG5 A;  1K90 D;  1DQE A;  4YGB B;  2MLE C;  1CLM A;  1C07 A;  1OQP A;  1S1E A;  3BOW B;  2MLF C;  4XJK B;  3RLZ A;  5AER A;  1OOF A;  2JOJ A;  3TS5 B;  2ZFD A;  1Y1A A;  3DVM A;  4OR9 B;  4ORC B;  4PDZ A;  4DRW A;  3DF0 A;  2KQY A;  2L2E A;  1JUO A;  3I5H B;  4OVN F;  1DJZ A;  1Z4H A;  2B1U A;  3HCM A;  1CNP A;  4DUQ A;  2KBM A;  1BR1 B;  1CLL A;  3KHE A;  2LLS A;  2ISD A;  3UO9 A;  1DJW A;  2L50 A;  3ICB A;  3N7H A;  3SG2 A;  2LVI A;  3PAT A;  3RZS A;  2ZN8 A;  5AFP A;  3PAL A;  1F70 A;  1KK7 Y;  1CB1 A;  3FE6 A;  2D8N A;  5F6T A;  4UPG A;  1WDC B;  1DJI A;  2JTT A;  2BL0 C;  1EXR A;  2I94 A;  2LLU A;  2RGI A;  5D7F A;  2CXJ A;  1WLM A;  3JVT B;  4PE1 A;  2FCE A;  2KI6 C;  1CFF A;  2BNX A;  4KYN A;  4A4B A;  1AP4 A;  1XFW O;  4MRY A;  1ODB A;  3OBV A;  4MSP A;  2LMU A;  2KBI A;  4WQ2 A;  1KK7 Z;  4PHK A;  4M2P A;  3KO0 A;  1RJV A;  2LVV A;  1CFP A;  1AVS A;  2K2F A;  4PCW A;  2K2A A;  1CDM A;  2K7O A;  1S3P A;  1IG5 A;  4M2O A;  2MHH A;  3NSO A;  1CDN A;  1TNQ A;  3D74 A;  2KHN A;  3D76 A;  3NSK A;  1DF0 B;  1BG1 A;  1NX3 A;  1MF8 B;  1MHO A;  2F3Y A;  3BUO B;  1DT7 B;  1F8H A;  1UUR A;  1JWD A;  3CTN A;  2GGM A;  1GM0 A;  1NP8 A;  4YGA A;  5ER5 A;  1NCX A;  1PSB A;  2KNE A;  2M29 A;  4FQO A;  5PAL A;  3TDI A;  5AXI A;  5HL1 A;  1KQM B;  3GK1 A;  1TCO B;  3IVT A;  1XFV O;  2QAC A;  3NSI A;  3D0Y B;  4MBE A;  3VRR A;  5IBW A;  2P71 A;  2LNK A;  1TWO A;  2MAZ A;  2R2I A;  4YRU A;  3FS7 A;  1WRL A;  1MXE A;  2CBL A;  1HQV A;  1ZAC A;  3BUN B;  1PSR A;  3EVU A;  2LVJ A;  2WC6 A;  2M97 A;  1IWQ A;  4MZJ A;  1SL7 A;  1S6J A;  4GGN A;  4NQG A;  1CDP A;  1KK8 C;  1UHI A;  1VRK A;  1GGZ A;  2LP2 A;  1J55 A;  2L0P A;  4HRG A;  2EC6 B;  3D75 A;  1CKK A;  1P28 A;  1RRO A;  1W7I B;  3DF0 B;  1NX2 A;  1ALW A;  3AKB A;  3OX6 A;  1D1O A;  1UHH A;  2K60 A;  5AAN A;  2WCK A;  2OTG B;  3SG3 A;  1DEK A;  2F2O A;  1K8U A;  3DYE A;  4I5L B;  3EKH A;  4GNK B;  4YGE B;  4WRI A;  3BJH A;  4HRH A;  2LLT A;  2KYF A;  1NWD A;  3WHU B;  1EG3 A;  2K8M B;  2K7D A;  3RM1 A;  2LHI A;  1SL8 A;  5DKR A;  2NXQ A;  3BFH A;  2FJY A;  3QME A;  5EL2 A;  1Y1U A;  2EHB A;  1OOH A;  2WCJ A;  4NDD A;  3ZNI A;  3L47 A;  3HX4 A;  1BMO A;  1BJF A;  2JXC A;  3TDU A;  1S36 A;  1PUL A;  1DGU A;  2PYQ A;  1TIZ A;  2WC8 A;  3CZ2 A;  1QX7 A;  2E6W A;  1TRF A; 
#chains in the Genus database with same CATH homology
 1PK0 D;  2F3Z A;  2KI6 D;  1QLS A;  2JC2 A;  3PM8 A;  2NZ0 A;  1GQM A;  1DJX A;  1OMV A;  1N65 A;  1KWO C;  2BCB A;  5B8I B;  1K9K A;  2M9G A;  5I2L A;  5BPJ A;  4C0L A;  4I5N B;  2JPT A;  1A75 A;  3CS1 A;  3BYA A;  1H4B A;  2JT8 A;  3MSE B;  3OP0 A;  2NLN A;  1F54 A;  4I5J A;  2BL0 B;  1MWN A;  1ZFS A;  3FWC A;  2KDH A;  3LLE A;  1UHK A;  4GGF C;  2M49 B;  4CID A;  1SBJ A;  3K21 A;  3BQ3 A;  4OCI A;  1PVA A;  1XYD A;  4A4C A;  4OKH A;  3GOF A;  4ZCU A;  2SAS A;  1CM4 A;  1MUX A;  1TNW A;  2BKH B;  4I5K A;  1TCF A;  2Y4Q A;  1FBV A;  3EK8 A;  1KFU S;  3SG6 A;  2L4I A;  1M45 A;  1SCM C;  2GGZ A;  1A2X A;  5KSZ A;  1SK6 D;  5HLV A;  1L2O C;  2PVB A;  1F4O A;  1MXL C;  1TOP A;  3E3R A;  4CLN A;  1CMG A;  2OPO A;  3TUY C;  4GGF A;  1YUU A;  1QIW A;  3IQO A;  2JXL A;  2L4H A;  1SCV A;  3A4U B;  2F8P A;  1B9A A;  2I2R E;  3M0W A;  1JFK A;  2HET A;  1V1F A;  1AUI B;  1DJG A;  2LCP A;  2KI4 C;  1XO5 A;  4C0J A;  1RK9 A;  1EG4 A;  3FIA A;  1B8C A;  1K93 D;  5TNC A;  2JRF A;  1OOJ A;  1KK8 B;  2LUX A;  1J7R A;  5AEQ A;  5I2Q A;  3CLN A;  3VGO A;  2JNX A;  1QV0 A;  3BUW B;  2WOS A;  3PLF B;  1V1G A;  4ORB B;  2BBM A;  1QJT A;  2DOQ A;  1NCZ A;  1CTR A;  2TN4 A;  1QV1 A;  2FJU B;  2HF5 A;  1KCY A;  3SG7 A;  4YI8 A;  1AHR A;  4L9M A;  4C0K A;  2AUC A;  2NCP A;  4ETO A;  1AJ5 A;  1QVI Y;  2HQ8 A;  3EKJ A;  4P5O E;  1SYM A;  5HKY A;  1PRW A;  4YI9 A;  3PN7 C;  3D10 A;  1FI6 A;  3I5I B;  3CR4 X;  1JF2 A;  2Y5I A;  2M7N A;  2ZKM X;  4PHM A;  1SR6 C;  1QVI Z;  2KFF A;  2JUL A;  4MZK A;  2LMT A;  1KFX L;  1TNP A;  2ZND A;  1J7Q A;  3WNX B;  3KPX A;  1RWY A;  3EVV A;  3IQQ A;  4ICB A;  5D69 A;  1FPW A;  1W7J B;  1OE9 B;  2BCX A;  1NYA A;  1YRU B;  2BE4 A;  4JPZ B;  3I5F C;  1S5G Y;  3OB2 B;  1YVL A;  1J7P A;  1TN4 A;  4NDC A;  1B8R A;  2AAO A;  2LVK A;  2JZI A;  1N2D A;  4MN0 A;  3OX5 A;  4GBA A;  3CZT X;  2LUC A;  1CDL A;  1GJY A;  1ZMZ A;  1F55 A;  2LAP A;  3I5H C;  5FYX A;  4BY5 A;  1PAL A;  1GGW A;  1XK4 C;  3CR2 A;  1YRT B;  4PE4 A;  1S5G Z;  4CFQ A;  2ZNE A;  3EK7 A;  3AAJ A;  3O78 A;  2K61 A;  2KSP A;  1CM1 A;  1XVJ A;  3AKA A;  1UHN A;  4JQ0 D;  1BOC A;  1XA5 A;  1CMF A;  2F33 A;  1IH0 A;  2CT9 A;  5CSN A;  4XYN A;  2I7A A;  1UWO A;  1WDC C;  3PFV A;  4N1F A;  4PE0 A;  2KFH A;  2KOT A;  2WCF A;  2K0J A;  1XFX O;  2K7B A;  1LVC D;  1UHJ A;  1B47 A;  1L2O B;  3QRX A;  2JQ6 A;  1EL4 A;  3GK4 X;  2MJW B;  1KSO A;  4M2Q A;  1C7V A;  1XK4 A;  3AAK A;  3I5G C;  1DJY A;  1BOD A;  3DVJ A;  1ALV A;  2O5G A;  1S6I A;  4AQJ A;  2LM5 A;  2AMI A;  2JU0 A;  3A8R A;  1R2U A;  4P2Y B;  2FOT A;  2HQW A;  1LA0 A;  2KI4 B;  3NXA A;  4AOM A;  1S6C A;  4DS7 A;  1RFJ A;  1WRK A;  2PRU A;  5HKZ A;  2BBN A;  3CWG A;  2SCP A;  1LKJ A;  1G8I A;  1J1D A;  2WOR A;  1BR4 B;  1A4P A;  1QAS A;  4N1G A;  1IJ6 A;  4TNC A;  4ZCV A;  3FWB A;  1OZO A;  1H8B A;  3DD4 A;  2CCM A;  1NPQ A;  2Y1M A;  4CFR A;  1OSA A;  4YGC B;  3LCP C;  2P6B B;  1U5I A;  1YUR A;  1QXP A;  5JOL A;  4U8D A;  1M39 A;  1DF0 A;  1DTL A;  2I18 A;  4PE7 A;  3ZWH A;  3OHM B;  5K89 A;  5DKQ A;  2JWW A;  5HLO A;  1MR8 A;  4FTG A;  1C7W A;  2KAV A;  2G9B A;  5JJG A;  1M31 A;  2KYC A;  1SPY A;  4HSZ A;  4PHJ A;  5J3X A;  2WCB A;  1IJ5 A;  1SW8 A;  5KTY A;  1JFJ A;  4MEW A;  1FF1 A;  2PSR A;  3SG4 A;  1Y1X A;  4OV2 A;  4DIR A;  1HT9 A;  1NX1 A;  1SKT A;  3WHT B;  1SNL A;  3I5F B;  1JBA A;  1EH2 A;  1YUT A;  1J7O A;  2KAX A;  4E68 A;  2LE9 B;  1CLB A;  2VRG A;  1Y0V H;  4CPV A;  1F4Q A;  2PMY A;  2ZRS A;  3VRN A;  1A03 A;  2M0R A;  1B1G A;  1QTX A;  2M3W A;  3SJS A;  3LK1 A;  3GK2 A;  3O2P A;  3VRO A;  1CFC A;  2LV7 A;  2E30 A;  2FCD A;  2V53 A;  1BT6 A;  2BEC A;  1XFY O;  2A4J A;  2KAY A;  1DMO A;  1SY9 A;  4DCK A;  1BU3 A;  1BF5 A;  1UP5 A;  1DGV A;  2MRD A;  4IL1 A;  4Q04 A;  3DVK A;  3SIB A;  1YX8 A;  2LAN A;  1QAT A;  2OS8 C;  3KF9 A;  2NCO A;  3O6B A;  2JTZ A;  4R1E A;  4PHN A;  1MQ1 A;  4QJ4 B;  1A75 B;  3PSR A;  1JSA A;  2QPT A;  3JTD C;  1REC A;  1G33 A;  1B4C A;  1WLZ A;  3CR5 X;  3H4S E;  3VRQ A;  1QIV A;  2M7L A;  2JT3 A;  1A29 A;  2CNP A;  3I5G B;  1KQV A;  2BCA A;  5CSJ A;  2O60 A;  1DJH A;  4F0Z B;  5HKW A;  4MLW A;  1K2H A;  1QX2 A;  5CPV A;  2F2P A;  3NSL A;  2M8U A;  3TS5 C;  1KWO B;  1U5I B;  2H2K A;  1OMR A;  3BUM B;  1TTX A;  1NIW A;  3LK0 A;  1S26 D;  4ORA B;  4JWQ A;  1K94 A;  1SMG A;  1OZS A;  1K9U A;  2JNF A;  5ER4 X;  1K96 A;  4HRE E;  2LP3 A;  4GPL B;  1DVI A;  2KFG A;  2LMV A;  3OB1 B;  2MA2 A;  2KGB C;  1JC2 A;  1KFU L;  4GUK A;  1B7T Y;  1YTZ C;  1NUB A;  1X02 A;  1IQ3 A;  2HPS A;  2LC5 A;  3LL8 B;  4N5X A;  5KU1 A;  1BLQ A;  2COL B;  1B8L A;  2ZRT A;  1EJ3 A;  2GV5 A;  2WCE A;  3EK4 A;  2H61 C;  2M1U A;  2JT0 A;  3BOW A;  4XJK A;  1K95 A;  1YUS A;  3VRP A;  1LA3 A;  2ZN9 A;  4NDB A;  1JF0 A;  1KSM A;  1QX5 B;  2G2B A;  1SL9 A;  1AK8 A;  1ZOT B;  1SCM B;  4MZL A;  2K7C A;  3JVT C;  1B7T Z;  4GAO A;  4WQ3 A;  1F71 A;  5DKN A;  1M46 A;  1OMD A;  3TZ1 A;  2Q4U A;  1L7Z A;  4MVF A;  4PAL A;  3TUY B;  1QLK A;  3BUX B;  1YX7 A;  3C1V A;  1NX0 A;  3CGA A;  2M1K B;  4QJ3 B;  2PAS A;  5CSI A;  1IRJ A;  1LIN A;  1QS7 A;  1ZUZ A;  2H61 A;  4YBH B;  1K9P A;  3IF7 A;  5CSF A;  1M63 B;  2WND A;  1PVB A;  1YR5 A;  5I2O A;  1XFU O;  2Y1N A;  1R6P A;  1AJ4 A;  1N0Y A;  1YVH A;  2L5X B;  1E8A A;  3I5I C;  1NSH A;  1SRA A;  5HYD A;  3WXA A;  1CFD A;  1WY9 A;  2IS9 A;  2CTN A;  4D1E A;  1KQM C;  2PAL A;  2KGR A;  2L98 A;  4USL A;  2Q91 A;  5GQQ C;  4AQI A;  4QJ5 B;  1G4Y R;  1IGV A;  3SIA A;  3DVE A;  1LXF C;  1RTP 1;  1TNX A;  2KQ6 A;  1UUS A;  1FW4 A;  1J1E A;  3KEV A;  1IKU A;  3EVR A;  1KFX S;  5I8N A;  1Y6W A;  4YGD B;  3F45 A;  2L51 A;  2BKI B;  1IQ5 A;  4MRX A;  2EC6 C;  2OS8 B;  1Q80 A;  3TDZ A;  5G08 A;  1FI5 A;  4GFT A;  4BY4 A;  3PN7 B;  3JTD B;  1WRZ A;  2MBX A;  2OTG C;  2EGD A;  3D0Y A;  1SR6 B;  2BE6 A;  1XFZ O;  3BXK A;  3O4Y A;  2LHL A;  1NCY A;  3SG5 A;  1K90 D;  4YGB B;  2MLE C;  1CLM A;  1C07 A;  1OQP A;  1S1E A;  3BOW B;  2MLF C;  4XJK B;  3RLZ A;  5AER A;  2JOJ A;  3TS5 B;  2ZFD A;  1Y1A A;  3DVM A;  4OR9 B;  4ORC B;  4PDZ A;  4DRW A;  3DF0 A;  2KQY A;  2L2E A;  1JUO A;  3I5H B;  4OVN F;  1DJZ A;  2B1U A;  3HCM A;  1CNP A;  4DUQ A;  2KBM A;  1BR1 B;  1CLL A;  3KHE A;  2LLS A;  2ISD A;  1DJW A;  2L50 A;  3ICB A;  3SG2 A;  2LVI A;  3PAT A;  2ZN8 A;  5AFP A;  3PAL A;  1F70 A;  1KK7 Y;  1CB1 A;  2D8N A;  5F6T A;  4UPG A;  1WDC B;  1DJI A;  2JTT A;  2BL0 C;  1EXR A;  2I94 A;  2LLU A;  2RGI A;  5D7F A;  2CXJ A;  1WLM A;  3JVT B;  4PE1 A;  2FCE A;  2KI6 C;  1CFF A;  4A4B A;  1AP4 A;  1XFW O;  4MRY A;  1ODB A;  4MSP A;  2LMU A;  2KBI A;  4WQ2 A;  1KK7 Z;  4PHK A;  4M2P A;  3KO0 A;  1RJV A;  2LVV A;  1CFP A;  1AVS A;  2K2F A;  4PCW A;  2K2A A;  1CDM A;  2K7O A;  1S3P A;  1IG5 A;  4M2O A;  2MHH A;  3NSO A;  1CDN A;  1TNQ A;  2KHN A;  1BG1 A;  3NSK A;  1DF0 B;  1NX3 A;  1MF8 B;  1MHO A;  2F3Y A;  3BUO B;  1DT7 B;  1F8H A;  1UUR A;  1JWD A;  3CTN A;  2GGM A;  1NP8 A;  4YGA A;  5ER5 A;  1NCX A;  1PSB A;  2KNE A;  2M29 A;  4FQO A;  5PAL A;  3TDI A;  5AXI A;  1KQM B;  3GK1 A;  1TCO B;  1XFV O;  2QAC A;  3NSI A;  3D0Y B;  4MBE A;  3VRR A;  5IBW A;  2LNK A;  2MAZ A;  2R2I A;  4YRU A;  3FS7 A;  2CBL A;  1WRL A;  1MXE A;  1HQV A;  1ZAC A;  3BUN B;  1PSR A;  3EVU A;  2LVJ A;  2M97 A;  1IWQ A;  4MZJ A;  1SL7 A;  1S6J A;  4GGN A;  4NQG A;  1CDP A;  1KK8 C;  1UHI A;  1VRK A;  1GGZ A;  2LP2 A;  1J55 A;  2L0P A;  4HRG A;  2EC6 B;  1CKK A;  1RRO A;  1W7I B;  3DF0 B;  1NX2 A;  1ALW A;  3AKB A;  3OX6 A;  1D1O A;  1UHH A;  5AAN A;  2OTG B;  3SG3 A;  2F2O A;  1K8U A;  4I5L B;  3EKH A;  4GNK B;  4YGE B;  4WRI A;  4HRH A;  2LLT A;  2KYF A;  1NWD A;  3WHU B;  1EG3 A;  2K8M B;  2K7D A;  3RM1 A;  2LHI A;  1SL8 A;  5DKR A;  2NXQ A;  1Y1U A;  2EHB A;  4NDD A;  3ZNI A;  3HX4 A;  1BMO A;  1BJF A;  2JXC A;  3TDU A;  1S36 A;  1PUL A;  1DGU A;  1TIZ A;  2WC8 A;  1QX7 A;  2E6W A;  1TRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...