3PN7B

Visualizing new hinges and a potential major source of compliance in the lever arm of myosin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
b'RLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Visualizing key hinges and a potential major source of compliance in the lever arm of myosin.
pubmed doi rcsb
molecule tags Protein binding
total genus 44
structure length 141
sequence length 141
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pn7B01
1S26D 1BT6A 3H4SE 3A4UB 1BF5A 1X02A 3AAKA 1K90D 1QATA 1B8RA 3IF7A 1OSAA 2G9BA 2ISDA 2LUXA 1L2OB 2KI6C 3ZNIA 1SR6C 1KFUS 4XJKB 1R2UA 1K94A 2M7LA 4NQGA 1DJHA 3D0YA 4P2YB 4YGAA 1GQMA 1DGVA 4AQJA 2QACA 1ALWA 1UHKA 1Y6WA 4JQ0D 2K7DA 1AVSA 2O60A 1M45A 4PE4A 3I5IB 3PFVA 4YBHB 5I2OA 3PN7C 1RWYA 1SL9A 2LAPA 3BOWA 2LMUA 2NCPA 1B7TY 1S5GZ 1S36A 1UUSA 2D8NA 4MZKA 2M0RA 3WNXB 4GGFA 1Q80A 2HQWA 3DVJA 1DGUA 1G8IA 1KCYA 2LVIA 1DTLA 1J7RA 1L7ZA 2KGBC 1TIZA 2LANA 3BUXB 2IS9A 1OMRA 1EG4A 3TDZA 2LMVA 2EC6C 1SKTA 3PSRA 4HREE 2Y4QA 2M1KB 2JT0A 3BYAA 1CLLA 1UWOA 2JZIA 1LA0A 3JVTC 1CFCA 4ORCB 3TDUA 1AJ4A 2CNPA 2KOTA 2LHLA 1A03A 3OP0A 1AUIB 1B4CA 4NDBA 2LP3A 3I5GB 4DS7A 1J55A 3DF0B 1RTP1 5HKZA 2KGRA 2LE9B 1KK7Z 2I7AA 5ER4X 3ZWHA 2LC5A 4OR9B 4GPLB 1CFDA 1NYAA 1OMVA 1FF1A 1PALA 2E30A 1RK9A 3CWGA 3SG7A 3AAJA 3TS5B 3F45A 3O2PA 2JNXA 2AAOA 4I5LB 2BE4A 1YX7A 1SYMA 2K7CA 4BY4A 2KI4C 1CLMA 1M63B 5CSFA 1S5GY 1Y1XA 1NWDA 4PHJA 1SW8A 1H8BA 1UP5A 4USLA 3SG4A 4MZLA 2M1UA 4OV2A 1QJTA 1LINA 2L98A 3I5FC 1SR6B 3I5IC 3FS7A 2ZNEA 1QLKA 2OTGC 1XK4A 1QXPA 3O78A 3SG5A 3CTNA 1QIWA 2M3WA 3HCMA 2M29A 1B8CA 4HRGA 4MRXA 1IWQA 5KTYA 2KFHA 2CXJA 3SIBA 4DUQA 2KSPA 2L51A 1XA5A 2P6BB 2ZN9A 4YGCB 1UHHA 2NZ0A 1TNPA 1TTXA 3RLZA 3PN7B 2LV7A 1C07A 5HKYA 5DKRA 1LVCD 5AERA 2SASA 2JWWA 3TDIA 2WOSA 1K95A 2LMTA 1OZSA 3FWCA 1TCOB 3PATA 4MZJA 4DRWA 1SPYA 3QRXA 1IJ5A 1KK7Y 5CSIA 5G08A 1CKKA 1GGWA 1B8LA 2EGDA 5D7FA 5KU1A 1NCZA 1QV1A 1XVJA 1IH0A 5B8IB 3JTDC 1B7TZ 1QS7A 2BBNA 2EC6B 4N1GA 1TNWA 1A29A 3VRRA 3CGAA 1WRKA 1YVHA 1TNXA 1BG1A 2HPSA 4PE1A 5F6TA 4UPGA 1BLQA 3NXAA 3JVTB 2BCXA 3TS5C 1MHOA 3AKBA 4PDZA 1R6PA 3CS1A 2H61A 4MEWA 3A8RA 5PALA 1KFXS 2M49B 1PSBA 2FJUB 2JNFA 2FCEA 1M31A 2KAYA 1Y1AA 2WCBA 3CR5X 5TNCA 2BCBA 1QTXA 1V1FA 3KO0A 3TZ1A 3SG2A 2FOTA 2B1UA 4N5XA 2JOJA 1NX0A 1ZACA 4XJKA 1CMGA 1MF8B 2MBXA 2F33A 1BODA 1NIWA 1J1EA 2ZRSA 1NP8A 1NX2A 2CTNA 2M7NA 4L9MA 1CMFA 1IRJA 1M46A 4DIRA 1JF2A 2MLFC 2KI4B 3BXKA 3BUOB 3O4YA 1SCVA 1F71A 1WRZA 2ZN8A 2MA2A 2LLSA 1OOJA 1FBVA 1YR5A 2ZRTA 3OX5A 4FTGA 1RECA 5BPJA 1K9PA 2LHIA 2I94A 1Y0VH 2Q91A 3EKJA 3I5FB 3MSEB 1NCYA 1F8HA 1BOCA 2VRGA 1S6CA 4IL1A 5HLOA 1WLMA 2OTGB 1EXRA 1KSMA 2PALA 3EKHA 4YGBB 1M39A 2NCOA 4GNKB 4GGNA 1YUTA 1PK0D 1UHNA 3K21A 4HSZA 2LNKA 1K96A 1SMGA 1J7OA 1XYDA 1BR1B 4MRYA 1OE9B 1DF0B 1B47A 5AXIA 2KDHA 3CZTX 4ORAB 1K8UA 2KAXA 2WCFA 4XYNA 2I18A 2AUCA 1YTZC 2LVJA 2R2IA 3FIAA 4HRHA 2JC2A 3AKAA 1J1DA 1DMOA 2F2OA 1BR4B 4GBAA 2Y1MA 3GK1A 1MXLC 3ICBA 3PLFB 1H4BA 3KF9A 1YUSA 3JTDB 4QJ4B 1DJZA 1IG5A 4MVFA 4I5KA 1WLZA 1TN4A 1SBJA 3DF0A 1SL7A 3OB1B 1QX2A 4OKHA 2L4HA 1CDMA 4ZCVA 1TCFA 1IQ5A 1WY9A 1K93D 2JXCA 5HLVA 1QVIZ 1XFZO 4PHNA 1UHIA 2WORA 5I2QA 2F3ZA 1EH2A 4ETOA 4I5NB 4Q04A 3SG3A 3D10A 3EK7A 2V53A 1TNQA 2NXQA 1KQMC 4QJ3B 1TRFA 3VRQA 4CLNA 2JTTA 1YURA 2K0JA 1DVIA 2JT3A 3NSKA 1E8AA 2PVBA 3I5HC 1S6JA 4QJ5B 4OCIA 1B9AA 4CPVA 1IQ3A 1LKJA 1BU3A 3LL8B 2LLTA 1QIVA 1UURA 2FCDA 1D1OA 1XFVO 2K2AA 2F2PA 2K2FA 3BUMB 4NDDA 4PE0A 4YI8A 3DVMA 5CPVA 1KQVA 3CR4X 1PULA 5AEQA 1SL8A 3VGOA 1G33A 1ZFSA 1CB1A 1C7WA 2I2RE 2KNEA 2RGIA 1U5IA 1DJWA 1ALVA 1QX5B 4JWQA 2E6WA 2A4JA 2KBIA 1C7VA 2QPTA 1EL4A 5CSJA 1JBAA 1IKUA 1SCMC 2M9GA 1XFWO 3FWBA 1F55A 1IJ6A 1SRAA 2MAZA 4PHMA 1LA3A 4GGFC 2WNDA 4M2PA 2KFGA 4MSPA 4D1EA 3O6BA 2ZNDA 5DKQA 1QVIY 1A75B 2PMYA 2G2BA 1S6IA 3GOFA 1OMDA 1PSRA 3DD4A 5JOLA 2BL0C 4YRUA 5AFPA 2BE6A 3WHUB 1KWOC 4C0JA 1DJIA 4PE7A 1B1GA 1CDPA 1WDCC 4YGEB 1N0YA 2COLB 3LK1A 2K61A 2L2EA 4F0ZB 1KFXL 1XO5A 1CFFA 1XFUO 4P5OE 2MJWB 2MRDA 5D69A 2ZFDA 1RROA 1DT7B 1PRWA 1LXFC 1KFUL 4BY5A 1S1EA 2LVKA 1S3PA 1SK6D 1K9KA 1YRUB 4A4BA 1QASA 3SG6A 2MLEC 1SY9A 5I2LA 3KEVA 1F70A 2GGZA 2OS8C 4R1EA 2MHHA 2SCPA 3VRPA 1F4QA 2KYCA 1ZMZA 3TUYC 2KYFA 3PALA 4PALA 4ICBA 1KQMB 1ODBA 3CLNA 5HKWA 1W7IB 4GFTA 2Y1NA 1NPQA 5FYXA 1HT9A 1KK8C 1GGZA 3I5HB 2OPOA 1MUXA 4C0LA 2JPTA 1BMOA 2DOQA 3WHTB 3OHMB 2CT9A 1UHJA 2EHBA 3D0YB 3VROA 1XK4C 2BCAA 1WRLA 1AK8A 4JPZB 4ZCUA 1G4YR 1K9UA 1JC2A 1DF0A 1EG3A 4MN0A 5I8NA 1PVBA 2JTZA 3VRNA 2CBLA 4AQIA 2JU0A 1DJGA 3BOWB 1IGVA 2LM5A 2LP2A 2HQ8A 2Q4UA 2KI6D 5DKNA 3NSOA 5KSZA 2PASA 2TN4A 1YX8A 5CSNA 1SCMB 1NUBA 4M2QA 1JFJA 5GQQC 2LLUA 2K7BA 3WXAA 1NX1A 2L0PA 1BJFA 1N2DA 2KQYA 3NSIA 1CM1A 2L4IA 2BL0B 4CFRA 2AMIA 1HQVA 1KWOB 2BKIB 4YGDB 1FI5A 1QX7A 2LVVA 3OB2B 4OVNF 1JWDA 1WDCB 3EVRA 4DCKA 2L5XB 1F4OA 2KHNA 1JUOA 2LCPA 4MBEA 2NLNA 4U8DA 1A4PA 2H61C 1FW4A 1XFXO 3NSLA 3SJSA 2JXLA 2KBMA 4E68A 3IQQA 1MQ1A 2BKHB 4MLWA 2JRFA 1JFKA 2JQ6A 3DVEA 5HYDA 3BUNB 1JSAA 4WQ3A 1L2OC 3KHEA 2L50A 4WQ2A 3EVVA 1ZOTB 1MR8A 1YVLA 2HF5A 2K8MB 2OS8B 1CNPA 2KAVA 1RJVA 2BBMA 4WRIA 3EK8A 4N1FA 3TUYB 1SNLA 1NX3A 2CCMA 2M97A 4GAOA 1GJYA 4ORBB 1CDNA 3M0WA 1KK8B 4PHKA 1DJYA 2O5GA 1AP4A 3LCPC 2GGMA 3HX4A 1W7JB 5ER5A 1CDLA 3BQ3A 2JULA 3DVKA 2BECA 1AJ5A 1V1GA 1CFPA 4M2OA 1RFJA 3GK2A 1VRKA 5K89A 1TOPA 3CR2A 4I5JA 2JT8A 3RM1A 2K7OA 4GUKA 1FI6A 4FQOA 1J7QA 3PM8A 1CTRA 3SIAA 1YRTB 1N65A 1OZOA 4AOMA 1QV0A 5AANA 1A75A 1NSHA 2F3YA 1ZUZA 2F8PA 5J3XA 1YUUA 4TNCA 4YI9A 1CLBA 3LLEA 1MWNA 2ZKMX 1NCXA 5IBWA 1J7PA 3EK4A 4PCWA 1U5IB 3IQOA 1OQPA 2LUCA 2HETA 4NDCA 4A4CA 1CM4A 2H2KA 1F54A 2GV5A 1XFYO 1AHRA 1DJXA 1EJ3A 1KSOA 1K2HA 4CIDA 1FPWA 3KPXA 2PRUA 2WC8A 3I5GC 3C1VA 4CFQA 1JF0A 1QLSA 2PSRA 3EVUA 3LK0A 2KQ6A 2M8UA 1PVAA 2Y5IA 3GK4X 3E3RA 2WCEA 1Y1UA 1MXEA 3BUWB 4C0KA 2KFFA 3OX6A 1A2XA 5JJGA
chains in the Genus database with same CATH superfamily
3OGNA 1S26D 1BT6A 1XFRA 3S0GA 3H4SE 2H8VA 3A4UB 1BF5A 1X02A 3AAKA 3IVTA 3R1PA 1K90D 1QATA 1B8RA 3IF7A 1OSAA 2G9BA 2ISDA 2LUXA 1L2OB 3B88A 2KI6C 3ZNIA 1SR6C 1KFUS 4XJKB 1R2UA 1K94A 2M7LA 1ORGA 4NQGA 1DJHA 3D0YA 3N7HA 4P2YB 3S0FA 4YGAA 1GQMA 1DGVA 4AQJA 2QACA 1ALWA 1UHKA 1Y6WA 1DELA 3S0AA 4JQ0D 2K7DA 1AVSA 2O60A 1M45A 2P71A 3OBVA 4PE4A 3I5IB 3PFVA 4YBHB 5I2OA 3FE6A 3PN7C 1RWYA 1SL9A 2LAPA 3BOWA 2LMUA 2NCPA 1B7TY 1S5GZ 1S36A 1UUSA 2D8NA 4KYNA 4MZKA 1Z2CB 2M0RA 3WNXB 4GGFA 1Q80A 2HQWA 3DVJA 1DGUA 1G8IA 1KCYA 2LVIA 1DTLA 1J7RA 1L7ZA 2KGBC 1TIZA 2KLEA 2LANA 3BUXB 2IS9A 1OMRA 1EG4A 3TDZA 2LMVA 2EC6C 1SKTA 3PSRA 4HREE 2Y4QA 2M1KB 2JT0A 3BYAA 1CLLA 2QEHA 1UWOA 2JZIA 1LA0A 3JVTC 1CFCA 4ORCB 3FE9A 3TDUA 1AJ4A 2CNPA 2KOTA 2LHLA 1A03A 3OP0A 1AUIB 1B4CA 4NDBA 2LP3A 3I5GB 4DS7A 1J55A 3DF0B 1RTP1 5HKZA 2KGRA 2LE9B 1KK7Z 2I7AA 5ER4X 3ZWHA 2LC5A 4OR9B 4GPLB 1CFDA 1NYAA 1OMVA 1FF1A 1PALA 2E30A 1RK9A 3CWGA 1SSEB 3SG7A 3AAJA 3TS5B 3F45A 3O2PA 5FI2A 2JNXA 2AAOA 4I5LB 2BE4A 1YX7A 2FJYA 1SYMA 2K7CA 4BY4A 2KI4C 1CLMA 1M63B 2PYQA 5CSFA 1S5GY 1Y1XA 1NWDA 4PHJA 1SW8A 1H8BA 1UP5A 4USLA 3SG4A 4MZLA 2M1UA 4OV2A 1QJTA 3SS5A 1LINA 2L98A 3B86A 3I5FC 1SR6B 3I5IC 3FS7A 2ZNEA 1QLKA 3BJHA 2OTGC 1XK4A 3FE8A 1QXPA 3CZ1A 3O78A 3SG5A 3CTNA 1QIWA 2M3WA 3HCMA 2M29A 1B8CA 4HRGA 4MRXA 1IWQA 5KTYA 2KFHA 2CXJA 3SIBA 4DUQA 2KSPA 2L51A 1XA5A 2P6BB 2ZN9A 4YGCB 1UHHA 3NGVA 2NZ0A 1TNPA 3L4AA 1TTXA 3RLZA 3PN7B 2LV7A 1C07A 5HKYA 2YGUA 5DKRA 1LVCD 3V2LA 5AERA 2SASA 2JWWA 3TDIA 2WOSA 1K95A 2LMTA 1OZSA 3FWCA 4JD9A 1TCOB 3PATA 4MZJA 4DRWA 1SPYA 3QRXA 1IJ5A 1KK7Y 5CSIA 5G08A 1CKKA 1GGWA 1B8LA 2EGDA 5D7FA 5KU1A 1NCZA 1QV1A 1XVJA 1IH0A 5B8IB 3JTDC 3PM2A 1B7TZ 1QS7A 2BBNA 2EC6B 1IIOA 4N1GA 2KLDA 1TNWA 1A29A 3UO9A 3VRRA 3CGAA 1WRKA 1YVHA 2ERBA 1TNXA 4OZDA 1BG1A 2HPSA 4PE1A 5F6TA 4UPGA 1BLQA 3NXAA 3JVTB 2BCXA 3DY9A 3BFAA 2K60A 3TS5C 1MHOA 3AKBA 4PDZA 4F7FA 1R6PA 3CS1A 2H61A 4MEWA 3A8RA 5PALA 3D78A 1KFXS 2M49B 1PSBA 2FJUB 2JNFA 2FCEA 1M31A 2KAYA 4INXA 1Y1AA 2WCBA 4IJ7A 3CR5X 5TNCA 2WCMA 5FI7A 2BCBA 1QTXA 1V1FA 3KO0A 3TZ1A 3SG2A 2FOTA 3S0DA 2B1UA 4N5XA 2JOJA 1NX0A 1ZACA 4XJKA 1CMGA 1MF8B 2MBXA 1QWVA 2F33A 1BODA 1NIWA 1J1EA 2ZRSA 1NP8A 1NX2A 2CTNA 2M7NA 4L9MA 5D3OA 1IRJA 1M46A 4DIRA 1CMFA 1JF2A 2MLFC 2KI4B 3BXKA 3BUOB 4PT1A 3O4YA 1SCVA 2WC6A 1F71A 1WRZA 2ZN8A 2MA2A 2LLSA 1OOJA 1FBVA 1YR5A 2ZRTA 3OX5A 4FTGA 5FI6A 1RECA 5BPJA 1K9PA 2LHIA 2I94A 2L2CA 3NHTA 1Y0VH 2Q91A 3EKJA 3I5FB 3MSEB 3UNWA 1NCYA 1F8HA 1BOCA 2VRGA 1S6CA 4IL1A 5HLOA 1WLMA 2OTGB 1EXRA 3PJIA 1KSMA 2PALA 3EKHA 4YGBB 1M39A 2NCOA 4GNKB 4GGNA 1YUTA 1PK0D 1UHNA 3K21A 4HSZA 2LNKA 1K96A 1SMGA 1J7OA 1XYDA 2BAPA 1BR1B 2WCKA 4MRYA 1OE9B 3SS4A 1DF0B 1DQEA 1B47A 5AXIA 2KDHA 3CZTX 4ORAB 1K8UA 2KAXA 2WCFA 4XYNA 2I18A 2AUCA 1YTZC 2LVJA 2R2IA 3FIAA 4HRHA 2JC2A 3AKAA 1J1DA 1DMOA 2F2OA 1BR4B 4GBAA 2Y1MA 3GK1A 1MXLC 3ICBA 3PLFB 1H4BA 3KF9A 1YUSA 3JTDB 4QJ4B 1DJZA 1IG5A 2QDIA 4MVFA 4I5KA 3B87A 1WLZA 1TN4A 1SBJA 3DF0A 1SL7A 3OB1B 3DZTA 1QX2A 4OKHA 2L4HA 1CDMA 4ZCVA 1TCFA 1IQ5A 1WY9A 3DXLA 1GM0A 1K93D 1OW4A 2JXCA 5HLVA 1QVIZ 1XFZO 4PHNA 1UHIA 2WORA 5I2QA 2F3ZA 1EH2A 4ETOA 4I5NB 4Q04A 3SG3A 3D10A 3EK7A 3D77A 2V53A 1TNQA 2NXQA 1KQMC 4QJ3B 3R1VA 1TRFA 3VRQA 4CLNA 2JTTA 1YURA 2K0JA 1DVIA 2JT3A 3NSKA 1E8AA 2PVBA 3I5HC 1S6JA 4QJ5B 4OCIA 2L5YA 1B9AA 3D75A 4CPVA 1IQ3A 1LKJA 1BU3A 3LL8B 2LLTA 1QIVA 1UURA 2FCDA 2QEBA 1D1OA 1XFVO 2K2AA 2F2PA 2K2FA 3BUMB 4NDDA 4PE0A 4YI8A 3DVMA 5CPVA 1KQVA 3CR4X 1P28A 1PULA 5AEQA 1SL8A 3VGOA 1G33A 1ZFSA 1CB1A 1C7WA 3NHIA 2I2RE 2KNEA 2RGIA 1U5IA 1DJWA 1ALVA 1QX5B 4JWQA 2E6WA 2A4JA 2KBIA 3S0BA 1C7VA 2QPTA 1EL4A 5CSJA 1JBAA 1IKUA 1SCMC 2M9GA 1XFWO 3FWBA 1F55A 1IJ6A 1SRAA 2MAZA 2QEOA 4PHMA 1LA3A 4GGFC 2WNDA 4M2PA 2KFGA 4MSPA 4D1EA 3O6BA 2ZNDA 5DKQA 1QVIY 1A75B 2PMYA 3BFBA 1TUJA 2P70A 4FQTA 2G2BA 1S6IA 3GOFA 1OMDA 1PSRA 3DD4A 5JOLA 2BL0C 4YRUA 5AFPA 2BE6A 3WHUB 1KWOC 4C0JA 3O4XA 3CABA 1DJIA 4PE7A 1B1GA 1CDPA 1WDCC 4YGEB 5HL1A 1C3YA 1N0YA 1DC1A 2COLB 3LK1A 2K61A 2L2EA 4F0ZB 1KFXL 1XO5A 3R1OA 3R72A 1XFUO 4P5OE 1CFFA 2MJWB 2WCJA 2MRDA 5D69A 2ZFDA 2BNXA 1RROA 1DT7B 2JPOA 1PRWA 1LXFC 1KFUL 3L4LA 1S1EA 2LVKA 1S3PA 3DYEA 4BY5A 1SK6D 1K9KA 1YRUB 4A4BA 1QASA 3SG6A 2MLEC 1SY9A 5EL2A 5I2LA 3KEVA 1F70A 2GGZA 2OS8C 4R1EA 2MHHA 2SCPA 3VRPA 1F4QA 2KYCA 1ZMZA 1OOGA 3TUYC 2KYFA 3PALA 4PALA 4ICBA 1KQMB 1ODBA 3CLNA 5HKWA 1W7IB 4GFTA 2Y1NA 1NPQA 5FYXA 1HT9A 1KK8C 2WCLA 1GGZA 3I5HB 2OPOA 1MUXA 4C0LA 2JPTA 1BMOA 2DOQA 3L47A 3WHTB 3OHMB 2CT9A 1UHJA 2EHBA 3D0YB 3VROA 1XK4C 2BCAA 1WRLA 1AK8A 4JPZB 4ZCUA 1W9ZA 1G4YR 1K9UA 1JC2A 5DICA 1DF0A 1EG3A 3B6XA 4MN0A 1PVBA 5I8NA 2JTZA 3VRNA 2CBLA 4AQIA 3BFHA 2JU0A 1DJGA 3D74A 3BOWB 1IGVA 2LM5A 2LP2A 2HQ8A 2Q4UA 2KI6D 5DKNA 3NSOA 5KSZA 2PASA 4INWA 3CYZA 3SS3A 2TN4A 1YX8A 5CSNA 1SCMB 1NUBA 4M2QA 1JFJA 5GQQC 2LLUA 2K7BA 3D76A 3WXAA 1NX1A 3K1EA 2L0PA 1BJFA 1N2DA 2KQYA 3NSIA 1CM1A 2L4IA 2BL0B 4CFRA 2AMIA 1HQVA 1KWOB 2BKIB 2WCHA 4YGDB 1FI5A 1QX7A 2LVVA 3B7AA 3OB2B 4OVNF 1JWDA 1WDCB 3EVRA 4DCKA 2L5XB 1F4OA 1Z4HA 2KHNA 1JUOA 2KPHA 2LCPA 3RZSA 4MBEA 2NLNA 4U8DA 1A4PA 2H61C 1FW4A 1XFXO 3NSLA 3SJSA 2JXLA 2KBMA 4E68A 3IQQA 1MQ1A 1OOHA 2BKHB 4MLWA 1OOIX 2JRFA 1JFKA 2JQ6A 3DVEA 5HYDA 3S0EA 3BUNB 1JSAA 4WQ3A 1L2OC 3EG5B 3KHEA 2L50A 4WQ2A 3EVVA 1ZOTB 1MR8A 1YVLA 2HF5A 2K8MB 2OS8B 1CNPA 2KAVA 1RJVA 2BBMA 4WRIA 3EK8A 4N1FA 3TUYB 1SNLA 1NX3A 2CCMA 2M97A 2GTEA 1GJYA 4GAOA 4ORBB 1CDNA 3M0WA 1KK8B 4PHKA 1DJYA 2WC5A 2O5GA 3CDNA 3Q8IA 5I94A 3LCPC 1AP4A 2GGMA 3HX4A 1W7JB 5ER5A 1CDLA 3BQ3A 2JULA 3DVKA 2BECA 1AJ5A 1V1GA 3QMEA 1CFPA 4M2OA 1RFJA 3GK2A 1VRKA 5K89A 1TOPA 3CR2A 4I5JA 1DEKA 2JT8A 3RM1A 2K7OA 4GUKA 1FI6A 1LS8A 4FQOA 1J7QA 3PM8A 1CTRA 3SIAA 1YRTB 1N65A 1OZOA 4AOMA 1QV0A 5AANA 1A75A 1NSHA 2F3YA 1ZUZA 2F8PA 5J3XA 1YUUA 4TNCA 4YI9A 1CLBA 3LLEA 1MWNA 2ZKMX 1NCXA 5IBWA 1J7PA 3EK4A 4PCWA 1U5IB 3IQOA 1C3ZA 1OQPA 2LUCA 2HETA 4NDCA 1T14A 1CM4A 2H2KA 4A4CA 1F54A 2GV5A 3CZ2A 1XFYO 1AHRA 1DJXA 3VB1A 1EJ3A 1KSOA 1K2HA 4CIDA 1FPWA 3KPXA 2PRUA 2PQLA 2WC8A 4JKTA 3I5GC 1OOFA 3CZ0A 3C1VA 4CFQA 1JF0A 1QLSA 1TWOA 2PSRA 3EVUA 3LK0A 3D73A 2KQ6A 2M8UA 1PVAA 2Y5IA 3GK4X 3E3RA 2WCEA 1Y1UA 1MXEA 3BUWB 4C0KA 1TUZA 2KFFA 2QEVA 3OX6A 1A2XA 5JJGA
chains in the Genus database with same CATH topology
1S26D 1BT6A 3H4SE 3A4UB 1BF5A 1X02A 3AAKA 1K90D 1QATA 1B8RA 3IF7A 1OSAA 2G9BA 2ISDA 2LUXA 1L2OB 2KI6C 3ZNIA 1SR6C 1KFUS 4XJKB 1R2UA 1K94A 2M7LA 4NQGA 1DJHA 3D0YA 4P2YB 4YGAA 1GQMA 1DGVA 4AQJA 2QACA 1ALWA 1UHKA 1Y6WA 4JQ0D 2K7DA 1AVSA 2O60A 1M45A 4PE4A 3I5IB 3PFVA 4YBHB 5I2OA 3PN7C 1RWYA 1SL9A 2LAPA 3BOWA 2LMUA 2NCPA 1B7TY 1S5GZ 1S36A 1UUSA 2D8NA 4MZKA 2M0RA 3WNXB 4GGFA 1Q80A 2HQWA 3DVJA 1DGUA 1G8IA 1KCYA 2LVIA 1DTLA 1J7RA 1L7ZA 2KGBC 1TIZA 2LANA 3BUXB 2IS9A 1OMRA 1EG4A 3TDZA 2LMVA 2EC6C 1SKTA 3PSRA 4HREE 2Y4QA 2M1KB 2JT0A 3BYAA 1CLLA 1UWOA 2JZIA 1LA0A 3JVTC 1CFCA 4ORCB 3TDUA 1AJ4A 2CNPA 2KOTA 2LHLA 1A03A 3OP0A 1AUIB 1B4CA 4NDBA 2LP3A 3I5GB 4DS7A 1J55A 3DF0B 1RTP1 5HKZA 2KGRA 2LE9B 1KK7Z 2I7AA 5ER4X 3ZWHA 2LC5A 4OR9B 4GPLB 1CFDA 1NYAA 1OMVA 1FF1A 1PALA 2E30A 1RK9A 3CWGA 3SG7A 3AAJA 3TS5B 3F45A 3O2PA 2JNXA 2AAOA 4I5LB 2BE4A 1YX7A 1SYMA 2K7CA 4BY4A 2KI4C 1CLMA 1M63B 5CSFA 1S5GY 1Y1XA 1NWDA 4PHJA 1SW8A 1H8BA 1UP5A 4USLA 3SG4A 4MZLA 2M1UA 4OV2A 1QJTA 1LINA 2L98A 3I5FC 1SR6B 3I5IC 3FS7A 2ZNEA 1QLKA 2OTGC 1XK4A 1QXPA 3O78A 3SG5A 3CTNA 1QIWA 2M3WA 3HCMA 2M29A 1B8CA 4HRGA 4MRXA 1IWQA 5KTYA 2KFHA 2CXJA 3SIBA 4DUQA 2KSPA 2L51A 1XA5A 2P6BB 2ZN9A 4YGCB 1UHHA 2NZ0A 1TNPA 1TTXA 3RLZA 3PN7B 2LV7A 1C07A 5HKYA 5DKRA 1LVCD 5AERA 2SASA 2JWWA 3TDIA 2WOSA 1K95A 2LMTA 1OZSA 3FWCA 1TCOB 3PATA 4MZJA 4DRWA 1SPYA 3QRXA 1IJ5A 1KK7Y 5CSIA 5G08A 1CKKA 1GGWA 1B8LA 2EGDA 5D7FA 5KU1A 1NCZA 1QV1A 1XVJA 1IH0A 5B8IB 3JTDC 1B7TZ 1QS7A 2BBNA 2EC6B 4N1GA 1TNWA 1A29A 3VRRA 3CGAA 1WRKA 1YVHA 1TNXA 1BG1A 2HPSA 4PE1A 5F6TA 4UPGA 1BLQA 3NXAA 3JVTB 2BCXA 3TS5C 1MHOA 3AKBA 4PDZA 1R6PA 3CS1A 2H61A 4MEWA 3A8RA 5PALA 1KFXS 2M49B 1PSBA 2FJUB 2JNFA 2FCEA 1M31A 2KAYA 1Y1AA 2WCBA 3CR5X 5TNCA 2BCBA 1QTXA 1V1FA 3KO0A 3TZ1A 3SG2A 2FOTA 2B1UA 4N5XA 2JOJA 1NX0A 1ZACA 4XJKA 1CMGA 1MF8B 2MBXA 2F33A 1BODA 1NIWA 1J1EA 2ZRSA 1NP8A 1NX2A 2CTNA 2M7NA 4L9MA 1CMFA 1IRJA 1M46A 4DIRA 1JF2A 2MLFC 2KI4B 3BXKA 3BUOB 3O4YA 1SCVA 1F71A 1WRZA 2ZN8A 2MA2A 2LLSA 1OOJA 1FBVA 1YR5A 2ZRTA 3OX5A 4FTGA 1RECA 5BPJA 1K9PA 2LHIA 2I94A 1Y0VH 2Q91A 3EKJA 3I5FB 3MSEB 1NCYA 1F8HA 1BOCA 2VRGA 1S6CA 4IL1A 5HLOA 1WLMA 2OTGB 1EXRA 1KSMA 2PALA 3EKHA 4YGBB 1M39A 2NCOA 4GNKB 4GGNA 1YUTA 1PK0D 1UHNA 3K21A 4HSZA 2LNKA 1K96A 1SMGA 1J7OA 1XYDA 1BR1B 4MRYA 1OE9B 1DF0B 1B47A 5AXIA 2KDHA 3CZTX 4ORAB 1K8UA 2KAXA 2WCFA 4XYNA 2I18A 2AUCA 1YTZC 2LVJA 2R2IA 3FIAA 4HRHA 2JC2A 3AKAA 1J1DA 1DMOA 2F2OA 1BR4B 4GBAA 2Y1MA 3GK1A 1MXLC 3ICBA 3PLFB 1H4BA 3KF9A 1YUSA 3JTDB 4QJ4B 1DJZA 1IG5A 4MVFA 4I5KA 1WLZA 1TN4A 1SBJA 3DF0A 1SL7A 3OB1B 1QX2A 4OKHA 2L4HA 1CDMA 4ZCVA 1TCFA 1IQ5A 1WY9A 1K93D 2JXCA 5HLVA 1QVIZ 1XFZO 4PHNA 1UHIA 2WORA 5I2QA 2F3ZA 1EH2A 4ETOA 4I5NB 4Q04A 3SG3A 3D10A 3EK7A 2V53A 1TNQA 2NXQA 1KQMC 4QJ3B 1TRFA 3VRQA 4CLNA 2JTTA 1YURA 2K0JA 1DVIA 2JT3A 3NSKA 1E8AA 2PVBA 3I5HC 1S6JA 4QJ5B 4OCIA 1B9AA 4CPVA 1IQ3A 1LKJA 1BU3A 3LL8B 2LLTA 1QIVA 1UURA 2FCDA 1D1OA 1XFVO 2K2AA 2F2PA 2K2FA 3BUMB 4NDDA 4PE0A 4YI8A 3DVMA 5CPVA 1KQVA 3CR4X 1PULA 5AEQA 1SL8A 3VGOA 1G33A 1ZFSA 1CB1A 1C7WA 2I2RE 2KNEA 2RGIA 1U5IA 1DJWA 1ALVA 1QX5B 4JWQA 2E6WA 2A4JA 2KBIA 1C7VA 2QPTA 1EL4A 5CSJA 1JBAA 1IKUA 1SCMC 2M9GA 1XFWO 3FWBA 1F55A 1IJ6A 1SRAA 2MAZA 4PHMA 1LA3A 4GGFC 2WNDA 4M2PA 2KFGA 4MSPA 4D1EA 3O6BA 2ZNDA 5DKQA 1QVIY 1A75B 2PMYA 2G2BA 1S6IA 3GOFA 1OMDA 1PSRA 3DD4A 5JOLA 2BL0C 4YRUA 5AFPA 2BE6A 3WHUB 1KWOC 4C0JA 1DJIA 4PE7A 1B1GA 1CDPA 1WDCC 4YGEB 1N0YA 2COLB 3LK1A 2K61A 2L2EA 4F0ZB 1KFXL 1XO5A 1CFFA 1XFUO 4P5OE 2MJWB 2MRDA 5D69A 2ZFDA 1RROA 1DT7B 1PRWA 1LXFC 1KFUL 4BY5A 1S1EA 2LVKA 1S3PA 1SK6D 1K9KA 1YRUB 4A4BA 1QASA 3SG6A 2MLEC 1SY9A 5I2LA 3KEVA 1F70A 2GGZA 2OS8C 4R1EA 2MHHA 2SCPA 3VRPA 1F4QA 2KYCA 1ZMZA 3TUYC 2KYFA 3PALA 4PALA 4ICBA 1KQMB 1ODBA 3CLNA 5HKWA 1W7IB 4GFTA 2Y1NA 1NPQA 5FYXA 1HT9A 1KK8C 1GGZA 3I5HB 2OPOA 1MUXA 4C0LA 2JPTA 1BMOA 2DOQA 3WHTB 3OHMB 2CT9A 1UHJA 2EHBA 3D0YB 3VROA 1XK4C 2BCAA 1WRLA 1AK8A 4JPZB 4ZCUA 1G4YR 1K9UA 1JC2A 1DF0A 1EG3A 4MN0A 5I8NA 1PVBA 2JTZA 3VRNA 2CBLA 4AQIA 2JU0A 1DJGA 3BOWB 1IGVA 2LM5A 2LP2A 2HQ8A 2Q4UA 2KI6D 5DKNA 3NSOA 5KSZA 2PASA 2TN4A 1YX8A 5CSNA 1SCMB 1NUBA 4M2QA 1JFJA 5GQQC 2LLUA 2K7BA 3WXAA 1NX1A 2L0PA 1BJFA 1N2DA 2KQYA 3NSIA 1CM1A 2L4IA 2BL0B 4CFRA 2AMIA 1HQVA 1KWOB 2BKIB 4YGDB 1FI5A 1QX7A 2LVVA 3OB2B 4OVNF 1JWDA 1WDCB 3EVRA 4DCKA 2L5XB 1F4OA 2KHNA 1JUOA 2LCPA 4MBEA 2NLNA 4U8DA 1A4PA 2H61C 1FW4A 1XFXO 3NSLA 3SJSA 2JXLA 2KBMA 4E68A 3IQQA 1MQ1A 2BKHB 4MLWA 2JRFA 1JFKA 2JQ6A 3DVEA 5HYDA 3BUNB 1JSAA 4WQ3A 1L2OC 3KHEA 2L50A 4WQ2A 3EVVA 1ZOTB 1MR8A 1YVLA 2HF5A 2K8MB 2OS8B 1CNPA 2KAVA 1RJVA 2BBMA 4WRIA 3EK8A 4N1FA 3TUYB 1SNLA 1NX3A 2CCMA 2M97A 4GAOA 1GJYA 4ORBB 1CDNA 3M0WA 1KK8B 4PHKA 1DJYA 2O5GA 1AP4A 3LCPC 2GGMA 3HX4A 1W7JB 5ER5A 1CDLA 3BQ3A 2JULA 3DVKA 2BECA 1AJ5A 1V1GA 1CFPA 4M2OA 1RFJA 3GK2A 1VRKA 5K89A 1TOPA 3CR2A 4I5JA 2JT8A 3RM1A 2K7OA 4GUKA 1FI6A 4FQOA 1J7QA 3PM8A 1CTRA 3SIAA 1YRTB 1N65A 1OZOA 4AOMA 1QV0A 5AANA 1A75A 1NSHA 2F3YA 1ZUZA 2F8PA 5J3XA 1YUUA 4TNCA 4YI9A 1CLBA 3LLEA 1MWNA 2ZKMX 1NCXA 5IBWA 1J7PA 3EK4A 4PCWA 1U5IB 3IQOA 1OQPA 2LUCA 2HETA 4NDCA 4A4CA 1CM4A 2H2KA 1F54A 2GV5A 1XFYO 1AHRA 1DJXA 1EJ3A 1KSOA 1K2HA 4CIDA 1FPWA 3KPXA 2PRUA 2WC8A 3I5GC 3C1VA 4CFQA 1JF0A 1QLSA 2PSRA 3EVUA 3LK0A 2KQ6A 2M8UA 1PVAA 2Y5IA 3GK4X 3E3RA 2WCEA 1Y1UA 1MXEA 3BUWB 4C0KA 2KFFA 3OX6A 1A2XA 5JJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S26 D;  1BT6 A;  3H4S E;  3A4U B;  1BF5 A;  1X02 A;  3AAK A;  1K90 D;  1QAT A;  1B8R A;  3IF7 A;  1OSA A;  2G9B A;  2ISD A;  2LUX A;  1L2O B;  2KI6 C;  3ZNI A;  1SR6 C;  1KFU S;  4XJK B;  1R2U A;  1K94 A;  2M7L A;  4NQG A;  1DJH A;  3D0Y A;  4P2Y B;  4YGA A;  1GQM A;  1DGV A;  4AQJ A;  2QAC A;  1ALW A;  1UHK A;  1Y6W A;  4JQ0 D;  2K7D A;  1AVS A;  2O60 A;  1M45 A;  4PE4 A;  3I5I B;  3PFV A;  4YBH B;  5I2O A;  3PN7 C;  1RWY A;  1SL9 A;  2LAP A;  3BOW A;  2LMU A;  2NCP A;  1B7T Y;  1S5G Z;  1S36 A;  1UUS A;  2D8N A;  4MZK A;  2M0R A;  3WNX B;  4GGF A;  1Q80 A;  2HQW A;  3DVJ A;  1DGU A;  1G8I A;  1KCY A;  2LVI A;  1DTL A;  1J7R A;  1L7Z A;  2KGB C;  1TIZ A;  2LAN A;  3BUX B;  2IS9 A;  1OMR A;  1EG4 A;  3TDZ A;  2LMV A;  2EC6 C;  1SKT A;  3PSR A;  4HRE E;  2Y4Q A;  2M1K B;  2JT0 A;  3BYA A;  1CLL A;  1UWO A;  2JZI A;  1LA0 A;  3JVT C;  1CFC A;  4ORC B;  3TDU A;  1AJ4 A;  2CNP A;  2KOT A;  2LHL A;  1A03 A;  3OP0 A;  1AUI B;  1B4C A;  4NDB A;  2LP3 A;  3I5G B;  4DS7 A;  1J55 A;  3DF0 B;  1RTP 1;  5HKZ A;  2KGR A;  2LE9 B;  1KK7 Z;  2I7A A;  5ER4 X;  3ZWH A;  2LC5 A;  4OR9 B;  4GPL B;  1CFD A;  1NYA A;  1OMV A;  1FF1 A;  1PAL A;  2E30 A;  1RK9 A;  3CWG A;  3SG7 A;  3AAJ A;  3TS5 B;  3F45 A;  3O2P A;  2JNX A;  2AAO A;  4I5L B;  2BE4 A;  1YX7 A;  1SYM A;  2K7C A;  4BY4 A;  2KI4 C;  1CLM A;  1M63 B;  5CSF A;  1S5G Y;  1Y1X A;  1NWD A;  4PHJ A;  1SW8 A;  1H8B A;  1UP5 A;  4USL A;  3SG4 A;  4MZL A;  2M1U A;  4OV2 A;  1QJT A;  1LIN A;  2L98 A;  3I5F C;  1SR6 B;  3I5I C;  3FS7 A;  2ZNE A;  1QLK A;  2OTG C;  1XK4 A;  1QXP A;  3O78 A;  3SG5 A;  3CTN A;  1QIW A;  2M3W A;  3HCM A;  2M29 A;  1B8C A;  4HRG A;  4MRX A;  1IWQ A;  5KTY A;  2KFH A;  2CXJ A;  3SIB A;  4DUQ A;  2KSP A;  2L51 A;  1XA5 A;  2P6B B;  2ZN9 A;  4YGC B;  1UHH A;  2NZ0 A;  1TNP A;  1TTX A;  3RLZ A;  3PN7 B;  2LV7 A;  1C07 A;  5HKY A;  5DKR A;  1LVC D;  5AER A;  2SAS A;  2JWW A;  3TDI A;  2WOS A;  1K95 A;  2LMT A;  1OZS A;  3FWC A;  1TCO B;  3PAT A;  4MZJ A;  4DRW A;  1SPY A;  3QRX A;  1IJ5 A;  1KK7 Y;  5CSI A;  5G08 A;  1CKK A;  1GGW A;  1B8L A;  2EGD A;  5D7F A;  5KU1 A;  1NCZ A;  1QV1 A;  1XVJ A;  1IH0 A;  5B8I B;  3JTD C;  1B7T Z;  1QS7 A;  2BBN A;  2EC6 B;  4N1G A;  1TNW A;  1A29 A;  3VRR A;  3CGA A;  1WRK A;  1YVH A;  1TNX A;  1BG1 A;  2HPS A;  4PE1 A;  5F6T A;  4UPG A;  1BLQ A;  3NXA A;  3JVT B;  2BCX A;  3TS5 C;  1MHO A;  3AKB A;  4PDZ A;  1R6P A;  3CS1 A;  2H61 A;  4MEW A;  3A8R A;  5PAL A;  1KFX S;  2M49 B;  1PSB A;  2FJU B;  2JNF A;  2FCE A;  1M31 A;  2KAY A;  1Y1A A;  2WCB A;  3CR5 X;  5TNC A;  2BCB A;  1QTX A;  1V1F A;  3KO0 A;  3TZ1 A;  3SG2 A;  2FOT A;  2B1U A;  4N5X A;  2JOJ A;  1NX0 A;  1ZAC A;  4XJK A;  1CMG A;  1MF8 B;  2MBX A;  2F33 A;  1BOD A;  1NIW A;  1J1E A;  2ZRS A;  1NP8 A;  1NX2 A;  2CTN A;  2M7N A;  4L9M A;  1CMF A;  1IRJ A;  1M46 A;  4DIR A;  1JF2 A;  2MLF C;  2KI4 B;  3BXK A;  3BUO B;  3O4Y A;  1SCV A;  1F71 A;  1WRZ A;  2ZN8 A;  2MA2 A;  2LLS A;  1OOJ A;  1FBV A;  1YR5 A;  2ZRT A;  3OX5 A;  4FTG A;  1REC A;  5BPJ A;  1K9P A;  2LHI A;  2I94 A;  1Y0V H;  2Q91 A;  3EKJ A;  3I5F B;  3MSE B;  1NCY A;  1F8H A;  1BOC A;  2VRG A;  1S6C A;  4IL1 A;  5HLO A;  1WLM A;  2OTG B;  1EXR A;  1KSM A;  2PAL A;  3EKH A;  4YGB B;  1M39 A;  2NCO A;  4GNK B;  4GGN A;  1YUT A;  1PK0 D;  1UHN A;  3K21 A;  4HSZ A;  2LNK A;  1K96 A;  1SMG A;  1J7O A;  1XYD A;  1BR1 B;  4MRY A;  1OE9 B;  1DF0 B;  1B47 A;  5AXI A;  2KDH A;  3CZT X;  4ORA B;  1K8U A;  2KAX A;  2WCF A;  4XYN A;  2I18 A;  2AUC A;  1YTZ C;  2LVJ A;  2R2I A;  3FIA A;  4HRH A;  2JC2 A;  3AKA A;  1J1D A;  1DMO A;  2F2O A;  1BR4 B;  4GBA A;  2Y1M A;  3GK1 A;  1MXL C;  3ICB A;  3PLF B;  1H4B A;  3KF9 A;  1YUS A;  3JTD B;  4QJ4 B;  1DJZ A;  1IG5 A;  4MVF A;  4I5K A;  1WLZ A;  1TN4 A;  1SBJ A;  3DF0 A;  1SL7 A;  3OB1 B;  1QX2 A;  4OKH A;  2L4H A;  1CDM A;  4ZCV A;  1TCF A;  1IQ5 A;  1WY9 A;  1K93 D;  2JXC A;  5HLV A;  1QVI Z;  1XFZ O;  4PHN A;  1UHI A;  2WOR A;  5I2Q A;  2F3Z A;  1EH2 A;  4ETO A;  4I5N B;  4Q04 A;  3SG3 A;  3D10 A;  3EK7 A;  2V53 A;  1TNQ A;  2NXQ A;  1KQM C;  4QJ3 B;  1TRF A;  3VRQ A;  4CLN A;  2JTT A;  1YUR A;  2K0J A;  1DVI A;  2JT3 A;  3NSK A;  1E8A A;  2PVB A;  3I5H C;  1S6J A;  4QJ5 B;  4OCI A;  1B9A A;  4CPV A;  1IQ3 A;  1LKJ A;  1BU3 A;  3LL8 B;  2LLT A;  1QIV A;  1UUR A;  2FCD A;  1D1O A;  1XFV O;  2K2A A;  2F2P A;  2K2F A;  3BUM B;  4NDD A;  4PE0 A;  4YI8 A;  3DVM A;  5CPV A;  1KQV A;  3CR4 X;  1PUL A;  5AEQ A;  1SL8 A;  3VGO A;  1G33 A;  1ZFS A;  1CB1 A;  1C7W A;  2I2R E;  2KNE A;  2RGI A;  1U5I A;  1DJW A;  1ALV A;  1QX5 B;  4JWQ A;  2E6W A;  2A4J A;  2KBI A;  1C7V A;  2QPT A;  1EL4 A;  5CSJ A;  1JBA A;  1IKU A;  1SCM C;  2M9G A;  1XFW O;  3FWB A;  1F55 A;  1IJ6 A;  1SRA A;  2MAZ A;  4PHM A;  1LA3 A;  4GGF C;  2WND A;  4M2P A;  2KFG A;  4MSP A;  4D1E A;  3O6B A;  2ZND A;  5DKQ A;  1QVI Y;  1A75 B;  2PMY A;  2G2B A;  1S6I A;  3GOF A;  1OMD A;  1PSR A;  3DD4 A;  5JOL A;  2BL0 C;  4YRU A;  5AFP A;  2BE6 A;  3WHU B;  1KWO C;  4C0J A;  1DJI A;  4PE7 A;  1B1G A;  1CDP A;  1WDC C;  4YGE B;  1N0Y A;  2COL B;  3LK1 A;  2K61 A;  2L2E A;  4F0Z B;  1KFX L;  1XO5 A;  1CFF A;  1XFU O;  4P5O E;  2MJW B;  2MRD A;  5D69 A;  2ZFD A;  1RRO A;  1DT7 B;  1PRW A;  1LXF C;  1KFU L;  4BY5 A;  1S1E A;  2LVK A;  1S3P A;  1SK6 D;  1K9K A;  1YRU B;  4A4B A;  1QAS A;  3SG6 A;  2MLE C;  1SY9 A;  5I2L A;  3KEV A;  1F70 A;  2GGZ A;  2OS8 C;  4R1E A;  2MHH A;  2SCP A;  3VRP A;  1F4Q A;  2KYC A;  1ZMZ A;  3TUY C;  2KYF A;  3PAL A;  4PAL A;  4ICB A;  1KQM B;  1ODB A;  3CLN A;  5HKW A;  1W7I B;  4GFT A;  2Y1N A;  1NPQ A;  5FYX A;  1HT9 A;  1KK8 C;  1GGZ A;  3I5H B;  2OPO A;  1MUX A;  4C0L A;  2JPT A;  1BMO A;  2DOQ A;  3WHT B;  3OHM B;  2CT9 A;  1UHJ A;  2EHB A;  3D0Y B;  3VRO A;  1XK4 C;  2BCA A;  1WRL A;  1AK8 A;  4JPZ B;  4ZCU A;  1G4Y R;  1K9U A;  1JC2 A;  1DF0 A;  1EG3 A;  4MN0 A;  5I8N A;  1PVB A;  2JTZ A;  3VRN A;  2CBL A;  4AQI A;  2JU0 A;  1DJG A;  3BOW B;  1IGV A;  2LM5 A;  2LP2 A;  2HQ8 A;  2Q4U A;  2KI6 D;  5DKN A;  3NSO A;  5KSZ A;  2PAS A;  2TN4 A;  1YX8 A;  5CSN A;  1SCM B;  1NUB A;  4M2Q A;  1JFJ A;  5GQQ C;  2LLU A;  2K7B A;  3WXA A;  1NX1 A;  2L0P A;  1BJF A;  1N2D A;  2KQY A;  3NSI A;  1CM1 A;  2L4I A;  2BL0 B;  4CFR A;  2AMI A;  1HQV A;  1KWO B;  2BKI B;  4YGD B;  1FI5 A;  1QX7 A;  2LVV A;  3OB2 B;  4OVN F;  1JWD A;  1WDC B;  3EVR A;  4DCK A;  2L5X B;  1F4O A;  2KHN A;  1JUO A;  2LCP A;  4MBE A;  2NLN A;  4U8D A;  1A4P A;  2H61 C;  1FW4 A;  1XFX O;  3NSL A;  3SJS A;  2JXL A;  2KBM A;  4E68 A;  3IQQ A;  1MQ1 A;  2BKH B;  4MLW A;  2JRF A;  1JFK A;  2JQ6 A;  3DVE A;  5HYD A;  3BUN B;  1JSA A;  4WQ3 A;  1L2O C;  3KHE A;  2L50 A;  4WQ2 A;  3EVV A;  1ZOT B;  1MR8 A;  1YVL A;  2HF5 A;  2K8M B;  2OS8 B;  1CNP A;  2KAV A;  1RJV A;  2BBM A;  4WRI A;  3EK8 A;  4N1F A;  3TUY B;  1SNL A;  1NX3 A;  2CCM A;  2M97 A;  4GAO A;  1GJY A;  4ORB B;  1CDN A;  3M0W A;  1KK8 B;  4PHK A;  1DJY A;  2O5G A;  1AP4 A;  3LCP C;  2GGM A;  3HX4 A;  1W7J B;  5ER5 A;  1CDL A;  3BQ3 A;  2JUL A;  3DVK A;  2BEC A;  1AJ5 A;  1V1G A;  1CFP A;  4M2O A;  1RFJ A;  3GK2 A;  1VRK A;  5K89 A;  1TOP A;  3CR2 A;  4I5J A;  2JT8 A;  3RM1 A;  2K7O A;  4GUK A;  1FI6 A;  4FQO A;  1J7Q A;  3PM8 A;  1CTR A;  3SIA A;  1YRT B;  1N65 A;  1OZO A;  4AOM A;  1QV0 A;  5AAN A;  1A75 A;  1NSH A;  2F3Y A;  1ZUZ A;  2F8P A;  5J3X A;  1YUU A;  4TNC A;  4YI9 A;  1CLB A;  3LLE A;  1MWN A;  2ZKM X;  1NCX A;  5IBW A;  1J7P A;  3EK4 A;  4PCW A;  1U5I B;  3IQO A;  1OQP A;  2LUC A;  2HET A;  4NDC A;  4A4C A;  1CM4 A;  2H2K A;  1F54 A;  2GV5 A;  1XFY O;  1AHR A;  1DJX A;  1EJ3 A;  1KSO A;  1K2H A;  4CID A;  1FPW A;  3KPX A;  2PRU A;  2WC8 A;  3I5G C;  3C1V A;  4CFQ A;  1JF0 A;  1QLS A;  2PSR A;  3EVU A;  3LK0 A;  2KQ6 A;  2M8U A;  1PVA A;  2Y5I A;  3GK4 X;  3E3R A;  2WCE A;  1Y1U A;  1MXE A;  3BUW B;  4C0K A;  2KFF A;  3OX6 A;  1A2X A;  5JJG A; 
#chains in the Genus database with same CATH topology
 3OGN A;  1S26 D;  1BT6 A;  1XFR A;  3S0G A;  3H4S E;  2H8V A;  3A4U B;  1BF5 A;  1X02 A;  3AAK A;  3IVT A;  3R1P A;  1K90 D;  1QAT A;  1B8R A;  3IF7 A;  1OSA A;  2G9B A;  2ISD A;  2LUX A;  1L2O B;  3B88 A;  2KI6 C;  3ZNI A;  1SR6 C;  1KFU S;  4XJK B;  1R2U A;  1K94 A;  2M7L A;  1ORG A;  4NQG A;  1DJH A;  3D0Y A;  3N7H A;  4P2Y B;  3S0F A;  4YGA A;  1GQM A;  1DGV A;  4AQJ A;  2QAC A;  1ALW A;  1UHK A;  1Y6W A;  1DEL A;  3S0A A;  4JQ0 D;  2K7D A;  1AVS A;  2O60 A;  1M45 A;  2P71 A;  3OBV A;  4PE4 A;  3I5I B;  3PFV A;  4YBH B;  5I2O A;  3FE6 A;  3PN7 C;  1RWY A;  1SL9 A;  2LAP A;  3BOW A;  2LMU A;  2NCP A;  1B7T Y;  1S5G Z;  1S36 A;  1UUS A;  2D8N A;  4KYN A;  4MZK A;  1Z2C B;  2M0R A;  3WNX B;  4GGF A;  1Q80 A;  2HQW A;  3DVJ A;  1DGU A;  1G8I A;  1KCY A;  2LVI A;  1DTL A;  1J7R A;  1L7Z A;  2KGB C;  1TIZ A;  2KLE A;  2LAN A;  3BUX B;  2IS9 A;  1OMR A;  1EG4 A;  3TDZ A;  2LMV A;  2EC6 C;  1SKT A;  3PSR A;  4HRE E;  2Y4Q A;  2M1K B;  2JT0 A;  3BYA A;  1CLL A;  2QEH A;  1UWO A;  2JZI A;  1LA0 A;  3JVT C;  1CFC A;  4ORC B;  3FE9 A;  3TDU A;  1AJ4 A;  2CNP A;  2KOT A;  2LHL A;  1A03 A;  3OP0 A;  1AUI B;  1B4C A;  4NDB A;  2LP3 A;  3I5G B;  4DS7 A;  1J55 A;  3DF0 B;  1RTP 1;  5HKZ A;  2KGR A;  2LE9 B;  1KK7 Z;  2I7A A;  5ER4 X;  3ZWH A;  2LC5 A;  4OR9 B;  4GPL B;  1CFD A;  1NYA A;  1OMV A;  1FF1 A;  1PAL A;  2E30 A;  1RK9 A;  3CWG A;  1SSE B;  3SG7 A;  3AAJ A;  3TS5 B;  3F45 A;  3O2P A;  5FI2 A;  2JNX A;  2AAO A;  4I5L B;  2BE4 A;  1YX7 A;  2FJY A;  1SYM A;  2K7C A;  4BY4 A;  2KI4 C;  1CLM A;  1M63 B;  2PYQ A;  5CSF A;  1S5G Y;  1Y1X A;  1NWD A;  4PHJ A;  1SW8 A;  1H8B A;  1UP5 A;  4USL A;  3SG4 A;  4MZL A;  2M1U A;  4OV2 A;  1QJT A;  3SS5 A;  1LIN A;  2L98 A;  3B86 A;  3I5F C;  1SR6 B;  3I5I C;  3FS7 A;  2ZNE A;  1QLK A;  3BJH A;  2OTG C;  1XK4 A;  3FE8 A;  1QXP A;  3CZ1 A;  3O78 A;  3SG5 A;  3CTN A;  1QIW A;  2M3W A;  3HCM A;  2M29 A;  1B8C A;  4HRG A;  4MRX A;  1IWQ A;  5KTY A;  2KFH A;  2CXJ A;  3SIB A;  4DUQ A;  2KSP A;  2L51 A;  1XA5 A;  2P6B B;  2ZN9 A;  4YGC B;  1UHH A;  3NGV A;  2NZ0 A;  1TNP A;  3L4A A;  1TTX A;  3RLZ A;  3PN7 B;  2LV7 A;  1C07 A;  5HKY A;  2YGU A;  5DKR A;  1LVC D;  3V2L A;  5AER A;  2SAS A;  2JWW A;  3TDI A;  2WOS A;  1K95 A;  2LMT A;  1OZS A;  3FWC A;  4JD9 A;  1TCO B;  3PAT A;  4MZJ A;  4DRW A;  1SPY A;  3QRX A;  1IJ5 A;  1KK7 Y;  5CSI A;  5G08 A;  1CKK A;  1GGW A;  1B8L A;  2EGD A;  5D7F A;  5KU1 A;  1NCZ A;  1QV1 A;  1XVJ A;  1IH0 A;  5B8I B;  3JTD C;  3PM2 A;  1B7T Z;  1QS7 A;  2BBN A;  2EC6 B;  1IIO A;  4N1G A;  2KLD A;  1TNW A;  1A29 A;  3UO9 A;  3VRR A;  3CGA A;  1WRK A;  1YVH A;  2ERB A;  1TNX A;  4OZD A;  1BG1 A;  2HPS A;  4PE1 A;  5F6T A;  4UPG A;  1BLQ A;  3NXA A;  3JVT B;  2BCX A;  3DY9 A;  3BFA A;  2K60 A;  3TS5 C;  1MHO A;  3AKB A;  4PDZ A;  4F7F A;  1R6P A;  3CS1 A;  2H61 A;  4MEW A;  3A8R A;  5PAL A;  3D78 A;  1KFX S;  2M49 B;  1PSB A;  2FJU B;  2JNF A;  2FCE A;  1M31 A;  2KAY A;  4INX A;  1Y1A A;  2WCB A;  4IJ7 A;  3CR5 X;  5TNC A;  2WCM A;  5FI7 A;  2BCB A;  1QTX A;  1V1F A;  3KO0 A;  3TZ1 A;  3SG2 A;  2FOT A;  3S0D A;  2B1U A;  4N5X A;  2JOJ A;  1NX0 A;  1ZAC A;  4XJK A;  1CMG A;  1MF8 B;  2MBX A;  1QWV A;  2F33 A;  1BOD A;  1NIW A;  1J1E A;  2ZRS A;  1NP8 A;  1NX2 A;  2CTN A;  2M7N A;  4L9M A;  5D3O A;  1IRJ A;  1M46 A;  4DIR A;  1CMF A;  1JF2 A;  2MLF C;  2KI4 B;  3BXK A;  3BUO B;  4PT1 A;  3O4Y A;  1SCV A;  2WC6 A;  1F71 A;  1WRZ A;  2ZN8 A;  2MA2 A;  2LLS A;  1OOJ A;  1FBV A;  1YR5 A;  2ZRT A;  3OX5 A;  4FTG A;  5FI6 A;  1REC A;  5BPJ A;  1K9P A;  2LHI A;  2I94 A;  2L2C A;  3NHT A;  1Y0V H;  2Q91 A;  3EKJ A;  3I5F B;  3MSE B;  3UNW A;  1NCY A;  1F8H A;  1BOC A;  2VRG A;  1S6C A;  4IL1 A;  5HLO A;  1WLM A;  2OTG B;  1EXR A;  3PJI A;  1KSM A;  2PAL A;  3EKH A;  4YGB B;  1M39 A;  2NCO A;  4GNK B;  4GGN A;  1YUT A;  1PK0 D;  1UHN A;  3K21 A;  4HSZ A;  2LNK A;  1K96 A;  1SMG A;  1J7O A;  1XYD A;  2BAP A;  1BR1 B;  2WCK A;  4MRY A;  1OE9 B;  3SS4 A;  1DF0 B;  1DQE A;  1B47 A;  5AXI A;  2KDH A;  3CZT X;  4ORA B;  1K8U A;  2KAX A;  2WCF A;  4XYN A;  2I18 A;  2AUC A;  1YTZ C;  2LVJ A;  2R2I A;  3FIA A;  4HRH A;  2JC2 A;  3AKA A;  1J1D A;  1DMO A;  2F2O A;  1BR4 B;  4GBA A;  2Y1M A;  3GK1 A;  1MXL C;  3ICB A;  3PLF B;  1H4B A;  3KF9 A;  1YUS A;  3JTD B;  4QJ4 B;  1DJZ A;  1IG5 A;  2QDI A;  4MVF A;  4I5K A;  3B87 A;  1WLZ A;  1TN4 A;  1SBJ A;  3DF0 A;  1SL7 A;  3OB1 B;  3DZT A;  1QX2 A;  4OKH A;  2L4H A;  1CDM A;  4ZCV A;  1TCF A;  1IQ5 A;  1WY9 A;  3DXL A;  1GM0 A;  1K93 D;  1OW4 A;  2JXC A;  5HLV A;  1QVI Z;  1XFZ O;  4PHN A;  1UHI A;  2WOR A;  5I2Q A;  2F3Z A;  1EH2 A;  4ETO A;  4I5N B;  4Q04 A;  3SG3 A;  3D10 A;  3EK7 A;  3D77 A;  2V53 A;  1TNQ A;  2NXQ A;  1KQM C;  4QJ3 B;  3R1V A;  1TRF A;  3VRQ A;  4CLN A;  2JTT A;  1YUR A;  2K0J A;  1DVI A;  2JT3 A;  3NSK A;  1E8A A;  2PVB A;  3I5H C;  1S6J A;  4QJ5 B;  4OCI A;  2L5Y A;  1B9A A;  3D75 A;  4CPV A;  1IQ3 A;  1LKJ A;  1BU3 A;  3LL8 B;  2LLT A;  1QIV A;  1UUR A;  2FCD A;  2QEB A;  1D1O A;  1XFV O;  2K2A A;  2F2P A;  2K2F A;  3BUM B;  4NDD A;  4PE0 A;  4YI8 A;  3DVM A;  5CPV A;  1KQV A;  3CR4 X;  1P28 A;  1PUL A;  5AEQ A;  1SL8 A;  3VGO A;  1G33 A;  1ZFS A;  1CB1 A;  1C7W A;  3NHI A;  2I2R E;  2KNE A;  2RGI A;  1U5I A;  1DJW A;  1ALV A;  1QX5 B;  4JWQ A;  2E6W A;  2A4J A;  2KBI A;  3S0B A;  1C7V A;  2QPT A;  1EL4 A;  5CSJ A;  1JBA A;  1IKU A;  1SCM C;  2M9G A;  1XFW O;  3FWB A;  1F55 A;  1IJ6 A;  1SRA A;  2MAZ A;  2QEO A;  4PHM A;  1LA3 A;  4GGF C;  2WND A;  4M2P A;  2KFG A;  4MSP A;  4D1E A;  3O6B A;  2ZND A;  5DKQ A;  1QVI Y;  1A75 B;  2PMY A;  3BFB A;  1TUJ A;  2P70 A;  4FQT A;  2G2B A;  1S6I A;  3GOF A;  1OMD A;  1PSR A;  3DD4 A;  5JOL A;  2BL0 C;  4YRU A;  5AFP A;  2BE6 A;  3WHU B;  1KWO C;  4C0J A;  3O4X A;  3CAB A;  1DJI A;  4PE7 A;  1B1G A;  1CDP A;  1WDC C;  4YGE B;  5HL1 A;  1C3Y A;  1N0Y A;  1DC1 A;  2COL B;  3LK1 A;  2K61 A;  2L2E A;  4F0Z B;  1KFX L;  1XO5 A;  3R1O A;  3R72 A;  1XFU O;  4P5O E;  1CFF A;  2MJW B;  2WCJ A;  2MRD A;  5D69 A;  2ZFD A;  2BNX A;  1RRO A;  1DT7 B;  2JPO A;  1PRW A;  1LXF C;  1KFU L;  3L4L A;  1S1E A;  2LVK A;  1S3P A;  3DYE A;  4BY5 A;  1SK6 D;  1K9K A;  1YRU B;  4A4B A;  1QAS A;  3SG6 A;  2MLE C;  1SY9 A;  5EL2 A;  5I2L A;  3KEV A;  1F70 A;  2GGZ A;  2OS8 C;  4R1E A;  2MHH A;  2SCP A;  3VRP A;  1F4Q A;  2KYC A;  1ZMZ A;  1OOG A;  3TUY C;  2KYF A;  3PAL A;  4PAL A;  4ICB A;  1KQM B;  1ODB A;  3CLN A;  5HKW A;  1W7I B;  4GFT A;  2Y1N A;  1NPQ A;  5FYX A;  1HT9 A;  1KK8 C;  2WCL A;  1GGZ A;  3I5H B;  2OPO A;  1MUX A;  4C0L A;  2JPT A;  1BMO A;  2DOQ A;  3L47 A;  3WHT B;  3OHM B;  2CT9 A;  1UHJ A;  2EHB A;  3D0Y B;  3VRO A;  1XK4 C;  2BCA A;  1WRL A;  1AK8 A;  4JPZ B;  4ZCU A;  1W9Z A;  1G4Y R;  1K9U A;  1JC2 A;  5DIC A;  1DF0 A;  1EG3 A;  3B6X A;  4MN0 A;  1PVB A;  5I8N A;  2JTZ A;  3VRN A;  2CBL A;  4AQI A;  3BFH A;  2JU0 A;  1DJG A;  3D74 A;  3BOW B;  1IGV A;  2LM5 A;  2LP2 A;  2HQ8 A;  2Q4U A;  2KI6 D;  5DKN A;  3NSO A;  5KSZ A;  2PAS A;  4INW A;  3CYZ A;  3SS3 A;  2TN4 A;  1YX8 A;  5CSN A;  1SCM B;  1NUB A;  4M2Q A;  1JFJ A;  5GQQ C;  2LLU A;  2K7B A;  3D76 A;  3WXA A;  1NX1 A;  3K1E A;  2L0P A;  1BJF A;  1N2D A;  2KQY A;  3NSI A;  1CM1 A;  2L4I A;  2BL0 B;  4CFR A;  2AMI A;  1HQV A;  1KWO B;  2BKI B;  2WCH A;  4YGD B;  1FI5 A;  1QX7 A;  2LVV A;  3B7A A;  3OB2 B;  4OVN F;  1JWD A;  1WDC B;  3EVR A;  4DCK A;  2L5X B;  1F4O A;  1Z4H A;  2KHN A;  1JUO A;  2KPH A;  2LCP A;  3RZS A;  4MBE A;  2NLN A;  4U8D A;  1A4P A;  2H61 C;  1FW4 A;  1XFX O;  3NSL A;  3SJS A;  2JXL A;  2KBM A;  4E68 A;  3IQQ A;  1MQ1 A;  1OOH A;  2BKH B;  4MLW A;  1OOI X;  2JRF A;  1JFK A;  2JQ6 A;  3DVE A;  5HYD A;  3S0E A;  3BUN B;  1JSA A;  4WQ3 A;  1L2O C;  3EG5 B;  3KHE A;  2L50 A;  4WQ2 A;  3EVV A;  1ZOT B;  1MR8 A;  1YVL A;  2HF5 A;  2K8M B;  2OS8 B;  1CNP A;  2KAV A;  1RJV A;  2BBM A;  4WRI A;  3EK8 A;  4N1F A;  3TUY B;  1SNL A;  1NX3 A;  2CCM A;  2M97 A;  2GTE A;  1GJY A;  4GAO A;  4ORB B;  1CDN A;  3M0W A;  1KK8 B;  4PHK A;  1DJY A;  2WC5 A;  2O5G A;  3CDN A;  3Q8I A;  5I94 A;  3LCP C;  1AP4 A;  2GGM A;  3HX4 A;  1W7J B;  5ER5 A;  1CDL A;  3BQ3 A;  2JUL A;  3DVK A;  2BEC A;  1AJ5 A;  1V1G A;  3QME A;  1CFP A;  4M2O A;  1RFJ A;  3GK2 A;  1VRK A;  5K89 A;  1TOP A;  3CR2 A;  4I5J A;  1DEK A;  2JT8 A;  3RM1 A;  2K7O A;  4GUK A;  1FI6 A;  1LS8 A;  4FQO A;  1J7Q A;  3PM8 A;  1CTR A;  3SIA A;  1YRT B;  1N65 A;  1OZO A;  4AOM A;  1QV0 A;  5AAN A;  1A75 A;  1NSH A;  2F3Y A;  1ZUZ A;  2F8P A;  5J3X A;  1YUU A;  4TNC A;  4YI9 A;  1CLB A;  3LLE A;  1MWN A;  2ZKM X;  1NCX A;  5IBW A;  1J7P A;  3EK4 A;  4PCW A;  1U5I B;  3IQO A;  1C3Z A;  1OQP A;  2LUC A;  2HET A;  4NDC A;  1T14 A;  1CM4 A;  2H2K A;  4A4C A;  1F54 A;  2GV5 A;  3CZ2 A;  1XFY O;  1AHR A;  1DJX A;  3VB1 A;  1EJ3 A;  1KSO A;  1K2H A;  4CID A;  1FPW A;  3KPX A;  2PRU A;  2PQL A;  2WC8 A;  4JKT A;  3I5G C;  1OOF A;  3CZ0 A;  3C1V A;  4CFQ A;  1JF0 A;  1QLS A;  1TWO A;  2PSR A;  3EVU A;  3LK0 A;  3D73 A;  2KQ6 A;  2M8U A;  1PVA A;  2Y5I A;  3GK4 X;  3E3R A;  2WCE A;  1Y1U A;  1MXE A;  3BUW B;  4C0K A;  1TUZ A;  2KFF A;  2QEV A;  3OX6 A;  1A2X A;  5JJG A; 
#chains in the Genus database with same CATH homology
 1S26 D;  1BT6 A;  3H4S E;  3A4U B;  1BF5 A;  1X02 A;  3AAK A;  1K90 D;  1QAT A;  1B8R A;  3IF7 A;  1OSA A;  2G9B A;  2ISD A;  2LUX A;  1L2O B;  2KI6 C;  3ZNI A;  1SR6 C;  1KFU S;  4XJK B;  1R2U A;  1K94 A;  2M7L A;  4NQG A;  1DJH A;  3D0Y A;  4P2Y B;  4YGA A;  1GQM A;  1DGV A;  4AQJ A;  2QAC A;  1ALW A;  1UHK A;  1Y6W A;  4JQ0 D;  2K7D A;  1AVS A;  2O60 A;  1M45 A;  4PE4 A;  3I5I B;  3PFV A;  4YBH B;  5I2O A;  3PN7 C;  1RWY A;  1SL9 A;  2LAP A;  3BOW A;  2LMU A;  2NCP A;  1B7T Y;  1S5G Z;  1S36 A;  1UUS A;  2D8N A;  4MZK A;  2M0R A;  3WNX B;  4GGF A;  1Q80 A;  2HQW A;  3DVJ A;  1DGU A;  1G8I A;  1KCY A;  2LVI A;  1DTL A;  1J7R A;  1L7Z A;  2KGB C;  1TIZ A;  2LAN A;  3BUX B;  2IS9 A;  1OMR A;  1EG4 A;  3TDZ A;  2LMV A;  2EC6 C;  1SKT A;  3PSR A;  4HRE E;  2Y4Q A;  2M1K B;  2JT0 A;  3BYA A;  1CLL A;  1UWO A;  2JZI A;  1LA0 A;  3JVT C;  1CFC A;  4ORC B;  3TDU A;  1AJ4 A;  2CNP A;  2KOT A;  2LHL A;  1A03 A;  3OP0 A;  1AUI B;  1B4C A;  4NDB A;  2LP3 A;  3I5G B;  4DS7 A;  1J55 A;  3DF0 B;  1RTP 1;  5HKZ A;  2KGR A;  2LE9 B;  1KK7 Z;  2I7A A;  5ER4 X;  3ZWH A;  2LC5 A;  4OR9 B;  4GPL B;  1CFD A;  1NYA A;  1OMV A;  1FF1 A;  1PAL A;  2E30 A;  1RK9 A;  3CWG A;  3SG7 A;  3AAJ A;  3TS5 B;  3F45 A;  3O2P A;  2JNX A;  2AAO A;  4I5L B;  2BE4 A;  1YX7 A;  1SYM A;  2K7C A;  4BY4 A;  2KI4 C;  1CLM A;  1M63 B;  5CSF A;  1S5G Y;  1Y1X A;  1NWD A;  4PHJ A;  1SW8 A;  1H8B A;  1UP5 A;  4USL A;  3SG4 A;  4MZL A;  2M1U A;  4OV2 A;  1QJT A;  1LIN A;  2L98 A;  3I5F C;  1SR6 B;  3I5I C;  3FS7 A;  2ZNE A;  1QLK A;  2OTG C;  1XK4 A;  1QXP A;  3O78 A;  3SG5 A;  3CTN A;  1QIW A;  2M3W A;  3HCM A;  2M29 A;  1B8C A;  4HRG A;  4MRX A;  1IWQ A;  5KTY A;  2KFH A;  2CXJ A;  3SIB A;  4DUQ A;  2KSP A;  2L51 A;  1XA5 A;  2P6B B;  2ZN9 A;  4YGC B;  1UHH A;  2NZ0 A;  1TNP A;  1TTX A;  3RLZ A;  3PN7 B;  2LV7 A;  1C07 A;  5HKY A;  5DKR A;  1LVC D;  5AER A;  2SAS A;  2JWW A;  3TDI A;  2WOS A;  1K95 A;  2LMT A;  1OZS A;  3FWC A;  1TCO B;  3PAT A;  4MZJ A;  4DRW A;  1SPY A;  3QRX A;  1IJ5 A;  1KK7 Y;  5CSI A;  5G08 A;  1CKK A;  1GGW A;  1B8L A;  2EGD A;  5D7F A;  5KU1 A;  1NCZ A;  1QV1 A;  1XVJ A;  1IH0 A;  5B8I B;  3JTD C;  1B7T Z;  1QS7 A;  2BBN A;  2EC6 B;  4N1G A;  1TNW A;  1A29 A;  3VRR A;  3CGA A;  1WRK A;  1YVH A;  1TNX A;  1BG1 A;  2HPS A;  4PE1 A;  5F6T A;  4UPG A;  1BLQ A;  3NXA A;  3JVT B;  2BCX A;  3TS5 C;  1MHO A;  3AKB A;  4PDZ A;  1R6P A;  3CS1 A;  2H61 A;  4MEW A;  3A8R A;  5PAL A;  1KFX S;  2M49 B;  1PSB A;  2FJU B;  2JNF A;  2FCE A;  1M31 A;  2KAY A;  1Y1A A;  2WCB A;  3CR5 X;  5TNC A;  2BCB A;  1QTX A;  1V1F A;  3KO0 A;  3TZ1 A;  3SG2 A;  2FOT A;  2B1U A;  4N5X A;  2JOJ A;  1NX0 A;  1ZAC A;  4XJK A;  1CMG A;  1MF8 B;  2MBX A;  2F33 A;  1BOD A;  1NIW A;  1J1E A;  2ZRS A;  1NP8 A;  1NX2 A;  2CTN A;  2M7N A;  4L9M A;  1CMF A;  1IRJ A;  1M46 A;  4DIR A;  1JF2 A;  2MLF C;  2KI4 B;  3BXK A;  3BUO B;  3O4Y A;  1SCV A;  1F71 A;  1WRZ A;  2ZN8 A;  2MA2 A;  2LLS A;  1OOJ A;  1FBV A;  1YR5 A;  2ZRT A;  3OX5 A;  4FTG A;  1REC A;  5BPJ A;  1K9P A;  2LHI A;  2I94 A;  1Y0V H;  2Q91 A;  3EKJ A;  3I5F B;  3MSE B;  1NCY A;  1F8H A;  1BOC A;  2VRG A;  1S6C A;  4IL1 A;  5HLO A;  1WLM A;  2OTG B;  1EXR A;  1KSM A;  2PAL A;  3EKH A;  4YGB B;  1M39 A;  2NCO A;  4GNK B;  4GGN A;  1YUT A;  1PK0 D;  1UHN A;  3K21 A;  4HSZ A;  2LNK A;  1K96 A;  1SMG A;  1J7O A;  1XYD A;  1BR1 B;  4MRY A;  1OE9 B;  1DF0 B;  1B47 A;  5AXI A;  2KDH A;  3CZT X;  4ORA B;  1K8U A;  2KAX A;  2WCF A;  4XYN A;  2I18 A;  2AUC A;  1YTZ C;  2LVJ A;  2R2I A;  3FIA A;  4HRH A;  2JC2 A;  3AKA A;  1J1D A;  1DMO A;  2F2O A;  1BR4 B;  4GBA A;  2Y1M A;  3GK1 A;  1MXL C;  3ICB A;  3PLF B;  1H4B A;  3KF9 A;  1YUS A;  3JTD B;  4QJ4 B;  1DJZ A;  1IG5 A;  4MVF A;  4I5K A;  1WLZ A;  1TN4 A;  1SBJ A;  3DF0 A;  1SL7 A;  3OB1 B;  1QX2 A;  4OKH A;  2L4H A;  1CDM A;  4ZCV A;  1TCF A;  1IQ5 A;  1WY9 A;  1K93 D;  2JXC A;  5HLV A;  1QVI Z;  1XFZ O;  4PHN A;  1UHI A;  2WOR A;  5I2Q A;  2F3Z A;  1EH2 A;  4ETO A;  4I5N B;  4Q04 A;  3SG3 A;  3D10 A;  3EK7 A;  2V53 A;  1TNQ A;  2NXQ A;  1KQM C;  4QJ3 B;  1TRF A;  3VRQ A;  4CLN A;  2JTT A;  1YUR A;  2K0J A;  1DVI A;  2JT3 A;  3NSK A;  1E8A A;  2PVB A;  3I5H C;  1S6J A;  4QJ5 B;  4OCI A;  1B9A A;  4CPV A;  1IQ3 A;  1LKJ A;  1BU3 A;  3LL8 B;  2LLT A;  1QIV A;  1UUR A;  2FCD A;  1D1O A;  1XFV O;  2K2A A;  2F2P A;  2K2F A;  3BUM B;  4NDD A;  4PE0 A;  4YI8 A;  3DVM A;  5CPV A;  1KQV A;  3CR4 X;  1PUL A;  5AEQ A;  1SL8 A;  3VGO A;  1G33 A;  1ZFS A;  1CB1 A;  1C7W A;  2I2R E;  2KNE A;  2RGI A;  1U5I A;  1DJW A;  1ALV A;  1QX5 B;  4JWQ A;  2E6W A;  2A4J A;  2KBI A;  1C7V A;  2QPT A;  1EL4 A;  5CSJ A;  1JBA A;  1IKU A;  1SCM C;  2M9G A;  1XFW O;  3FWB A;  1F55 A;  1IJ6 A;  1SRA A;  2MAZ A;  4PHM A;  1LA3 A;  4GGF C;  2WND A;  4M2P A;  2KFG A;  4MSP A;  4D1E A;  3O6B A;  2ZND A;  5DKQ A;  1QVI Y;  1A75 B;  2PMY A;  2G2B A;  1S6I A;  3GOF A;  1OMD A;  1PSR A;  3DD4 A;  5JOL A;  2BL0 C;  4YRU A;  5AFP A;  2BE6 A;  3WHU B;  1KWO C;  4C0J A;  1DJI A;  4PE7 A;  1B1G A;  1CDP A;  1WDC C;  4YGE B;  1N0Y A;  2COL B;  3LK1 A;  2K61 A;  2L2E A;  4F0Z B;  1KFX L;  1XO5 A;  1CFF A;  1XFU O;  4P5O E;  2MJW B;  2MRD A;  5D69 A;  2ZFD A;  1RRO A;  1DT7 B;  1PRW A;  1LXF C;  1KFU L;  4BY5 A;  1S1E A;  2LVK A;  1S3P A;  1SK6 D;  1K9K A;  1YRU B;  4A4B A;  1QAS A;  3SG6 A;  2MLE C;  1SY9 A;  5I2L A;  3KEV A;  1F70 A;  2GGZ A;  2OS8 C;  4R1E A;  2MHH A;  2SCP A;  3VRP A;  1F4Q A;  2KYC A;  1ZMZ A;  3TUY C;  2KYF A;  3PAL A;  4PAL A;  4ICB A;  1KQM B;  1ODB A;  3CLN A;  5HKW A;  1W7I B;  4GFT A;  2Y1N A;  1NPQ A;  5FYX A;  1HT9 A;  1KK8 C;  1GGZ A;  3I5H B;  2OPO A;  1MUX A;  4C0L A;  2JPT A;  1BMO A;  2DOQ A;  3WHT B;  3OHM B;  2CT9 A;  1UHJ A;  2EHB A;  3D0Y B;  3VRO A;  1XK4 C;  2BCA A;  1WRL A;  1AK8 A;  4JPZ B;  4ZCU A;  1G4Y R;  1K9U A;  1JC2 A;  1DF0 A;  1EG3 A;  4MN0 A;  5I8N A;  1PVB A;  2JTZ A;  3VRN A;  2CBL A;  4AQI A;  2JU0 A;  1DJG A;  3BOW B;  1IGV A;  2LM5 A;  2LP2 A;  2HQ8 A;  2Q4U A;  2KI6 D;  5DKN A;  3NSO A;  5KSZ A;  2PAS A;  2TN4 A;  1YX8 A;  5CSN A;  1SCM B;  1NUB A;  4M2Q A;  1JFJ A;  5GQQ C;  2LLU A;  2K7B A;  3WXA A;  1NX1 A;  2L0P A;  1BJF A;  1N2D A;  2KQY A;  3NSI A;  1CM1 A;  2L4I A;  2BL0 B;  4CFR A;  2AMI A;  1HQV A;  1KWO B;  2BKI B;  4YGD B;  1FI5 A;  1QX7 A;  2LVV A;  3OB2 B;  4OVN F;  1JWD A;  1WDC B;  3EVR A;  4DCK A;  2L5X B;  1F4O A;  2KHN A;  1JUO A;  2LCP A;  4MBE A;  2NLN A;  4U8D A;  1A4P A;  2H61 C;  1FW4 A;  1XFX O;  3NSL A;  3SJS A;  2JXL A;  2KBM A;  4E68 A;  3IQQ A;  1MQ1 A;  2BKH B;  4MLW A;  2JRF A;  1JFK A;  2JQ6 A;  3DVE A;  5HYD A;  3BUN B;  1JSA A;  4WQ3 A;  1L2O C;  3KHE A;  2L50 A;  4WQ2 A;  3EVV A;  1ZOT B;  1MR8 A;  1YVL A;  2HF5 A;  2K8M B;  2OS8 B;  1CNP A;  2KAV A;  1RJV A;  2BBM A;  4WRI A;  3EK8 A;  4N1F A;  3TUY B;  1SNL A;  1NX3 A;  2CCM A;  2M97 A;  4GAO A;  1GJY A;  4ORB B;  1CDN A;  3M0W A;  1KK8 B;  4PHK A;  1DJY A;  2O5G A;  1AP4 A;  3LCP C;  2GGM A;  3HX4 A;  1W7J B;  5ER5 A;  1CDL A;  3BQ3 A;  2JUL A;  3DVK A;  2BEC A;  1AJ5 A;  1V1G A;  1CFP A;  4M2O A;  1RFJ A;  3GK2 A;  1VRK A;  5K89 A;  1TOP A;  3CR2 A;  4I5J A;  2JT8 A;  3RM1 A;  2K7O A;  4GUK A;  1FI6 A;  4FQO A;  1J7Q A;  3PM8 A;  1CTR A;  3SIA A;  1YRT B;  1N65 A;  1OZO A;  4AOM A;  1QV0 A;  5AAN A;  1A75 A;  1NSH A;  2F3Y A;  1ZUZ A;  2F8P A;  5J3X A;  1YUU A;  4TNC A;  4YI9 A;  1CLB A;  3LLE A;  1MWN A;  2ZKM X;  1NCX A;  5IBW A;  1J7P A;  3EK4 A;  4PCW A;  1U5I B;  3IQO A;  1OQP A;  2LUC A;  2HET A;  4NDC A;  4A4C A;  1CM4 A;  2H2K A;  1F54 A;  2GV5 A;  1XFY O;  1AHR A;  1DJX A;  1EJ3 A;  1KSO A;  1K2H A;  4CID A;  1FPW A;  3KPX A;  2PRU A;  2WC8 A;  3I5G C;  3C1V A;  4CFQ A;  1JF0 A;  1QLS A;  2PSR A;  3EVU A;  3LK0 A;  2KQ6 A;  2M8U A;  1PVA A;  2Y5I A;  3GK4 X;  3E3R A;  2WCE A;  1Y1U A;  1MXE A;  3BUW B;  4C0K A;  2KFF A;  3OX6 A;  1A2X A;  5JJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...