2KYCA

Solution structure of ca-free chicken parvalbumin 3 (cpv3)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
108
structure length
108
Chain Sequence
SLTDILSPSDIAAALRDCQAPDSFSPKKFFQISGMSKKSSSQLKEIFRILDNDQSGFIEEDELKYFLQRFESGARVLTASETKTFLAAADHDGDGKIGAEEFQEMVQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin, thymic CPV3
publication title Solution structures of chicken parvalbumin 3 in the Ca(2+) -free and Ca(2+) -bound states.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium binding protein
total genus 10
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2010-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kycA00
5CSNA 4MZKA 1LA3A 1WLMA 3JVTC 1NP8A 2KQ6A 1MR8A 1TOPA 3EKJA 2KGRA 2PASA 1V1FA 1NCXA 1CM4A 1S36A 1RJVA 1J7QA 2I7AA 2JNFA 4TNCA 1KWOB 3DD4A 2Y5IA 1KQVA 1PULA 4CPVA 3I5IB 1OZOA 3VGOA 1G33A 1KQMB 3F45A 2K7OA 1NYAA 4PE4A 3SIBA 4M2QA 1F54A 1PSBA 1SW8A 1TCFA 2LCPA 2BBNA 2BBMA 2EC6B 1OMVA 1BODA 4YI8A 1XA5A 2L4IA 2SASA 3I5FC 4P5OE 4QJ4B 2L50A 2F3ZA 3IQQA 3NXAA 1C07A 3AKAA 2BL0B 2M49B 1SPYA 1ZMZA 3PSRA 1DTLA 4DS7A 2CTNA 2LNKA 3TZ1A 1BLQA 4I5JA 1OZSA 3ZNIA 4FTGA 1RWYA 4USLA 2NZ0A 1NX2A 2JTTA 1NIWA 1S6JA 1QATA 1PALA 4ZCVA 3BOWB 3C1VA 1K9KA 5HLOA 5AERA 1K9UA 2ZRSA 2LC5A 1SBJA 1DJGA 1NWDA 4MVFA 4MZLA 5KU1A 4PALA 5IBWA 3IF7A 1WRKA 1B7TZ 2Q91A 1L2OB 1QVIY 4PCWA 3VRQA 2LMTA 2H61C 1D1OA 4M2OA 2AMIA 4JPZB 3PALA 2M7LA 2JQ6A 4MLWA 2MA2A 1BJFA 1FBVA 2NLNA 3WHTB 3QRXA 5ER5A 4UPGA 2CT9A 2KI6C 4CFRA 2CXJA 4AQIA 1QX5B 5KSZA 1SCVA 1JFJA 3LLEA 4MRXA 1B8LA 1LKJA 1BF5A 1K9PA 4WQ2A 1IG5A 1J7RA 1J7OA 1UHHA 1FI6A 1UUSA 3KO0A 4PHMA 1OMRA 3TDUA 2M97A 1A03A 1MHOA 2G9BA 3O2PA 1K2HA 1BR4B 1NSHA 2ZN9A 2PMYA 4E68A 2O60A 5CSFA 2KFHA 1PRWA 4OVNF 1DF0B 1A29A 1UWOA 1AJ4A 5F6TA 3BUXB 1QLKA 4P2YB 4ZCUA 2M8UA 3AAJA 2E6WA 2JRFA 2LV7A 3JTDB 2K2FA 1U5IB 2BE4A 2PVBA 4N1GA 1R6PA 1GGWA 1YTZC 1K95A 4DCKA 1N2DA 1FW4A 5I2LA 1Y1XA 2M1UA 5D7FA 1W7IB 1YR5A 1J7PA 3OHMB 1SK6D 5HKWA 1AHRA 1XFUO 1Y1UA 2ZRTA 1CLMA 2L0PA 1TRFA 3D0YB 1HT9A 4DRWA 4N5XA 3SG6A 1JBAA 1DJYA 3I5HC 2L51A 2B1UA 1QS7A 1JWDA 1DJIA 2WNDA 5I2QA 1K93D 1KK7Y 4YGDB 2LMUA 1TNQA 5GQQC 1AVSA 2MJWB 1BMOA 3E3RA 1L7ZA 1DMOA 1XVJA 1A75A 1QVIZ 1KQMC 4JQ0D 1XFWO 2H61A 2LMVA 3DF0A 1SKTA 3OP0A 4MRYA 2KFFA 1BG1A 1KSOA 1LINA 1RFJA 1WRZA 1WDCC 1OQPA 3CGAA 2HQ8A 1UP5A 1M46A 1KFUS 3IQOA 4PHNA 4I5KA 1QV0A 4NQGA 4MSPA 2G2BA 1WLZA 5J3XA 1M63B 3MSEB 5JJGA 1CFPA 2LAPA 1RK9A 1J1EA 1JUOA 5FYXA 3TS5B 1FF1A 2JT3A 3PN7B 2LHIA 1AUIB 5I8NA 1CLBA 2JWWA 1NCZA 2E30A 4XJKA 1IWQA 1YX7A 4ORBB 4PE7A 4WQ3A 1K94A 4MN0A 3GOFA 3WXAA 1DGVA 4YBHB 3SG4A 2Y1NA 1QV1A 2P6BB 3TUYB 4C0KA 4GNKB 1LA0A 1WRLA 2OS8B 3O78A 3BUMB 4DIRA 3AAKA 4BY5A 3A4UB 2KOTA 2O5GA 4MEWA 1F55A 1G4YR 1GGZA 3OX5A 2LVIA 3BYAA 3PLFB 2HETA 1C7VA 4ETOA 2OTGC 2JC2A 1SRAA 2JT8A 4JWQA 1NX0A 1PVBA 1F70A 4DUQA 2D8NA 3EK4A 5KTYA 4PE0A 4I5NB 2ZNDA 5ER4X 1QIWA 1QXPA 1F4OA 1NCYA 1PSRA 2NXQA 1ODBA 3K21A 1QX2A 2I18A 1AK8A 2M29A 4A4CA 3BQ3A 1YURA 1CTRA 3JVTB 1ZUZA 2LLSA 1S1EA 1B47A 1CFDA 2LP2A 1KCYA 1IJ5A 4I5LB 4Q04A 2ISDA 4C0JA 4AOMA 1CB1A 2AAOA 4GPLB 1TNXA 2KBMA 1KFXL 1KK7Z 1RECA 1SNLA 1S6IA 4MBEA 2MLEC 3HX4A 3PM8A 2BKIB 1ALWA 1M39A 3DVMA 1J55A 2KI4C 2WOSA 3O4YA 1CMGA 2PRUA 2HQWA 2KYCA 2GGZA 4OV2A 3TDIA 3VROA 2CNPA 4QJ5B 2M1KB 2F8PA 3H4SE 3I5FB 2EGDA 3PATA 2NCOA 1FI5A 2KFGA 1NUBA 1QX7A 3EKHA 1UHKA 3BUOB 3DVKA 2L2EA 1MF8B 1FPWA 3OB1B 3ICBA 5CSIA 2WCEA 2JT0A 4ORCB 1CDLA 1CKKA 2HPSA 2M3WA 1SL8A 1CFCA 4GAOA 5B8IB 1KFXS 1B4CA 3BOWA 3FWCA 3FIAA 1MWNA 1XFYO 2LHLA 2ZNEA 1TCOB 2ZN8A 4YGEB 1F8HA 1ALVA 1CDMA 3FS7A 1SR6B 1PK0D 2IS9A 2BCAA 1KFUL 2JU0A 3LL8B 3CWGA 3SG3A 3GK2A 1CDNA 1LXFC 1TNWA 3GK4X 1SCMC 1SL7A 3KPXA 2LLUA 4YI9A 2V53A 3CS1A 5PALA 2HF5A 2L98A 3EVUA 3BUNB 1B9AA 1R2UA 2KDHA 3CZTX 3EVVA 2QPTA 1XK4C 1Y1AA 3VRRA 1IQ3A 1KWOC 1V1GA 1XO5A 2Q4UA 1QTXA 3KF9A 3NSOA 3TS5C 4CIDA 3I5IC 1YVLA 2BECA 2M7NA 4YGCB 1IKUA 1S5GY 1YX8A 4OKHA 4GGNA 1E8AA 2JXLA 3KHEA 3WHUB 2H2KA 1KK8B 1B7TY 2A4JA 5HYDA 2EC6C 2BKHB 2BCXA 4F0ZB 4XYNA 1J1DA 4C0LA 3TUYC 1YUSA 4PHJA 1NX3A 2GV5A 3A8RA 1A4PA 1Y6WA 1TN4A 1B8CA 2K7DA 2BL0C 2LM5A 2PALA 4QJ3B 2TN4A 1YRUB 1U5IA 1MUXA 1DJHA 1XFZO 3DVJA 1H8BA 4AQJA 1IQ5A 1JF0A 1YUUA 1NX1A 1JC2A 1YVHA 1CFFA 2F2OA 3EVRA 4NDDA 5D69A 2WCFA 2GGMA 1IRJA 1YRTB 3KEVA 1L2OC 1WY9A 2K61A 1CNPA 5AXIA 2QACA 3OB2B 3I5HB 2LLTA 5CSJA 2PSRA 1SMGA 3SJSA 4PDZA 5TNCA 3RLZA 3VRPA 1N65A 2Y1MA 1PVAA 1UHJA 3CR5X 3SG7A 1DJZA 1LVCD 2F33A 1QJTA 2KSPA 4IL1A 2CCMA 2L5XB 4YGAA 2KYFA 3LK0A 4CFQA 1B1GA 1CDPA 3DVEA 1F4QA 3I5GB 2K7BA 2KNEA 1M45A 2COLB 2MAZA 4N1FA 1TNPA 2VRGA 1WDCB 3M0WA 2NCPA 2Y4QA 5AEQA 2JZIA 2K7CA 2EHBA 1CM1A 1X02A 1XYDA 3BXKA 1S6CA 1Q80A 2KGBC 2LP3A 1CMFA 4YGBB 2SCPA 1OE9B 2DOQA 4YRUA 1AJ5A 1BU3A 1GQMA 1XK4A 2FOTA 1H4BA 5DKQA 3SIAA 4GUKA 2JTZA 2WCBA 2L4HA 3NSIA 1VRKA 2BE6A 1DGUA 1S5GZ 2M0RA 5CPVA 5AFPA 1S3PA 1RTP1 2K0JA 1XFXO 5K89A 3D10A 4GGFA 2FCDA 1K96A 1DJXA 1QLSA 3JTDC 1A2XA 2MBXA 1EH2A 1SR6C 2KHNA 1G8IA 5I2OA 4R1EA 2KAVA 1XFVO 1Y0VH 3O6BA 1JSAA 3CTNA 1B8RA 1IJ6A 2LVVA 1SL9A 3EK8A 4FQOA 4CLNA 3LK1A 2OTGB 2OPOA 1ZFSA 1UHNA 5BPJA 1EG4A 4OCIA 1BT6A 2RGIA 3CR2A 1EJ3A 1DJWA 2K8MB 3BUWB 4ICBA 2LANA 5HKZA 1DVIA 3OX6A 3VRNA 5DKRA 1OOJA 2JXCA 2M9GA 4OR9B 1MQ1A 5G08A 4HRHA 1A75B 1BOCA 2LVJA 5JOLA 2R2IA 1HQVA 1MXEA 3DF0B 1MXLC 1DT7B 1CLLA 2ZKMX 3NSKA 4M2PA 3HCMA 1NPQA 1KK8C 1QIVA 2KAXA 2LVKA 1BR1B 1KSMA 2BCBA 2KBIA 2KI4B 4BY4A 1OMDA 1IGVA 3FWBA 4D1EA 4WRIA 2KAYA 3AKBA 2ZFDA 5AANA 1C7WA 4NDCA 4A4BA 3TDZA 3LCPC 1QASA 3PN7C 3GK1A 3WNXB 1EXRA 1JF2A 2KI6D 2JOJA 4XJKB 1SY9A 1S26D 3EK7A 3NSLA 1AP4A 1M31A 2JPTA 1K90D 4GGFC 1ZACA 4L9MA 2LUCA 5HKYA 1JFKA 5HLVA 4NDBA 3SG5A 2OS8C 3ZWHA 2MRDA 1W7JB 2LUXA 3SG2A 4GBAA 2CBLA 2K2AA 4MZJA 1UURA 1N0YA 2WC8A 3PFVA 4HREE 1DF0A 1TIZA 4PHKA 2AUCA 2JNXA 4U8DA 1EG3A 2F3YA 2F2PA 2LE9B 1GJYA 1TTXA 2MHHA 2FCEA 2WORA 3CLNA 3RM1A 1OSAA 2FJUB 5DKNA 1F71A 1SYMA 1K8UA 1YUTA 2KQYA 4ORAB 1EL4A 4HRGA 4GFTA 4PE1A 3I5GC 2JULA 1IH0A 2I2RE 3CR4X 4HSZA 1SCMB 1UHIA 2I94A 2MLFC 1RROA 1ZOTB 3D0YA
chains in the Genus database with same CATH superfamily
5CSNA 3CDNA 4MZKA 1LA3A 1WLMA 3JVTC 1NP8A 2KQ6A 1MR8A 1TOPA 3EKJA 2KGRA 2PASA 3SS3A 1V1FA 1NCXA 1CM4A 1S36A 2WCJA 1RJVA 1J7QA 2I7AA 2JNFA 4TNCA 1KWOB 3DD4A 2Y5IA 1KQVA 1PULA 4CPVA 3I5IB 1OZOA 3VGOA 1G33A 1KQMB 3F45A 2K7OA 1NYAA 4PE4A 3S0EA 4M2QA 3SIBA 1F54A 1PSBA 1SW8A 1TCFA 2LCPA 2BBNA 3S0BA 2BBMA 2EC6B 1DEKA 1OMVA 1BODA 4YI8A 3N7HA 1DC1A 1XA5A 2L4IA 2SASA 3I5FC 4P5OE 3R72A 2L50A 2F3ZA 3IQQA 3NXAA 4QJ4B 1C07A 5DICA 3AKAA 2BL0B 2M49B 1SPYA 1ZMZA 2QDIA 1DTLA 3PSRA 2CTNA 2LNKA 4DS7A 3TZ1A 1BLQA 4I5JA 1OZSA 2L5YA 3ZNIA 4FTGA 1RWYA 4USLA 4PT1A 2NZ0A 1NX2A 2JTTA 1NIWA 1S6JA 1QATA 3OBVA 1PALA 3CABA 4ZCVA 3BOWB 3C1VA 1K9KA 5HLOA 5AERA 1K9UA 2ZRSA 2LC5A 1SBJA 1DJGA 1NWDA 3DYEA 4MVFA 4MZLA 5KU1A 4PALA 5IBWA 3IF7A 1WRKA 1B7TZ 2Q91A 1L2OB 1QVIY 4PCWA 3VRQA 2LMTA 3DXLA 2H61C 2QEHA 1D1OA 1QWVA 4M2OA 2AMIA 4JPZB 3PALA 2M7LA 2JQ6A 4MLWA 2MA2A 1BJFA 1FBVA 2NLNA 3WHTB 5HL1A 3QRXA 5ER5A 4UPGA 1OOHA 2CT9A 2KI6C 3B88A 4CFRA 2CXJA 4AQIA 1QX5B 3V2LA 5KSZA 1SCVA 4F7FA 3D74A 3LLEA 4MRXA 1JFJA 1B8LA 1LKJA 1BF5A 1XFRA 2WCMA 1K9PA 4WQ2A 1IG5A 1J7RA 1J7OA 1UHHA 1FI6A 5FI6A 1UUSA 3KO0A 2JPOA 4PHMA 1OMRA 3TDUA 2M97A 1A03A 1MHOA 2G9BA 3O2PA 1K2HA 1BR4B 1NSHA 2ZN9A 3IVTA 2PMYA 3S0FA 3B7AA 4E68A 2O60A 4INXA 5CSFA 2KFHA 1PRWA 4OVNF 1DF0B 1P28A 1A29A 1UWOA 1AJ4A 5F6TA 3BUXB 1QLKA 4P2YB 4ZCUA 2M8UA 3AAJA 2E6WA 2JRFA 2LV7A 3BFHA 3JTDB 4JD9A 2K2FA 1U5IB 2BE4A 2PVBA 4N1GA 1R6PA 1GGWA 1YTZC 1K95A 2WCLA 4DCKA 1N2DA 1OOIX 1FW4A 5I2LA 1Y1XA 2M1UA 5D7FA 1W7IB 1YR5A 1Z2CB 1J7PA 3OHMB 1SK6D 5HKWA 1AHRA 2PQLA 1OOGA 1XFUO 1Y1UA 2ZRTA 1CLMA 2L0PA 1TRFA 3D0YB 1HT9A 4DRWA 4N5XA 3SG6A 3K1EA 1JBAA 1DJYA 3I5HC 3CZ0A 2L51A 2B1UA 1QS7A 1JWDA 1DJIA 2WNDA 5I2QA 1K93D 1KK7Y 3PM2A 4YGDB 2LMUA 1TNQA 5GQQC 1AVSA 2MJWB 1BMOA 3E3RA 1L7ZA 1DMOA 1XVJA 1A75A 1QVIZ 1KQMC 4JQ0D 1XFWO 2H61A 2LMVA 3DF0A 1SKTA 3OP0A 4MRYA 2KFFA 1BG1A 1KSOA 1LINA 1RFJA 1WRZA 1WDCC 1OQPA 3CGAA 2HQ8A 1UP5A 3R1VA 1M46A 1KFUS 3IQOA 4PHNA 4I5KA 1QV0A 4NQGA 4MSPA 2G2BA 1WLZA 2WC5A 5J3XA 5I94A 1M63B 3MSEB 5JJGA 1CFPA 2LAPA 1RK9A 1J1EA 1JUOA 5FYXA 3TS5B 1FF1A 2JT3A 3PN7B 2LHIA 1AUIB 5I8NA 1CLBA 2JWWA 1NCZA 2E30A 4XJKA 1IWQA 1YX7A 4ORBB 4PE7A 4WQ3A 1K94A 4MN0A 3GOFA 3WXAA 1DGVA 4YBHB 3SG4A 2Y1NA 1QV1A 2P6BB 3TUYB 4C0KA 4GNKB 1LA0A 1WRLA 2L2CA 2OS8B 2QEBA 3DY9A 3BUMB 3O78A 4DIRA 3AAKA 3UO9A 4BY5A 3S0AA 3A4UB 2KOTA 2O5GA 4MEWA 1F55A 3CYZA 1G4YR 2BNXA 1GGZA 3OX5A 2LVIA 3BYAA 3PLFB 2HETA 3D78A 1C7VA 4ETOA 2OTGC 2JC2A 1SRAA 2JT8A 4JWQA 1NX0A 1PVBA 1F70A 4DUQA 2D8NA 3EK4A 5KTYA 4PE0A 4I5NB 2ZNDA 5ER4X 1QIWA 1QXPA 1F4OA 1NCYA 1PSRA 2NXQA 1ODBA 4OZDA 3K21A 1QX2A 2I18A 1AK8A 2M29A 4A4CA 3BQ3A 1YURA 1CTRA 3JVTB 1ZUZA 2LLSA 1S1EA 1B47A 1CFDA 2LP2A 1KCYA 1IJ5A 4I5LB 4Q04A 2ISDA 3D77A 4C0JA 4AOMA 1CB1A 2AAOA 4GPLB 1TNXA 2KBMA 1KFXL 1KK7Z 1RECA 1SNLA 1S6IA 4MBEA 2MLEC 3HX4A 3PM8A 2BKIB 3R1OA 1ALWA 1M39A 3FE9A 3DVMA 1J55A 2KI4C 2WOSA 3O4YA 1CMGA 2PRUA 2HQWA 2KYCA 2GGZA 4OV2A 3TDIA 3VROA 2CNPA 4QJ5B 1OOFA 2F8PA 2KLEA 2M1KB 3H4SE 3I5FB 1DQEA 1W9ZA 2EGDA 3PATA 2NCOA 4FQTA 1FI5A 2KFGA 1NUBA 2WC6A 1QX7A 3EKHA 1UHKA 3BUOB 3DVKA 2L2EA 1MF8B 1DELA 3OB1B 3ICBA 5CSIA 2WCEA 3DZTA 1FPWA 2JT0A 4ORCB 1CDLA 1CKKA 2HPSA 2M3WA 1SL8A 1CFCA 1TUJA 4GAOA 5B8IB 1KFXS 1B4CA 3BOWA 3FWCA 3L4AA 3FIAA 1MWNA 4INWA 1XFYO 2LHLA 2ZNEA 3FE6A 1TCOB 2ZN8A 4YGEB 1F8HA 1ALVA 1CDMA 3FS7A 1SR6B 1PK0D 2IS9A 2BCAA 1KFUL 2JU0A 3LL8B 3CWGA 3QMEA 3GK2A 3SG3A 1CDNA 1LXFC 1TNWA 1C3ZA 3GK4X 1SCMC 1SL7A 2ERBA 3KPXA 2LLUA 4YI9A 2V53A 3CS1A 5PALA 2HF5A 2L98A 3EVUA 3BUNB 1B9AA 1R2UA 2KDHA 3CZTX 3EVVA 2QPTA 1XK4C 1Y1AA 3VRRA 1IQ3A 1KWOC 1V1GA 1XO5A 2Q4UA 1QTXA 3KF9A 3NSOA 1OW4A 3TS5C 3D73A 4CIDA 3R1PA 3I5IC 1YVLA 2BECA 2M7NA 4YGCB 1IKUA 1S5GY 1YX8A 4OKHA 3BJHA 4GGNA 1ORGA 1E8AA 2JXLA 3KHEA 3WHUB 2H2KA 1KK8B 1B7TY 2A4JA 5HYDA 2EC6C 2BKHB 2BCXA 4F0ZB 4XYNA 1J1DA 3BFBA 4C0LA 3TUYC 3VRNA 1YUSA 4PHJA 1NX3A 1C3YA 2GV5A 3A8RA 1A4PA 1Y6WA 2GTEA 3D75A 1TN4A 1B8CA 2K7DA 2BL0C 2LM5A 2PALA 4QJ3B 2TN4A 1YRUB 3L47A 2WCKA 3OGNA 1U5IA 1MUXA 1DJHA 1XFZO 3DVJA 1H8BA 4AQJA 1IQ5A 1JF0A 1YUUA 1NX1A 1JC2A 1YVHA 1CFFA 2F2OA 3EVRA 4NDDA 5D69A 1SSEB 2WCFA 2GGMA 3VB1A 1IRJA 1YRTB 3KEVA 1L2OC 1WY9A 2K61A 1CNPA 5AXIA 2QACA 3B86A 2P70A 3OB2B 2QEVA 3I5HB 2LLTA 5CSJA 2PSRA 1SMGA 2WCHA 3SJSA 4PDZA 5TNCA 3RLZA 3VRPA 1N65A 2Y1MA 1PVAA 3PJIA 1UHJA 3CR5X 3SG7A 1DJZA 1LVCD 2F33A 1QJTA 2KSPA 4IL1A 2CCMA 2L5XB 3B87A 2KYFA 3LK0A 4YGAA 4CFQA 1B1GA 1CDPA 3CZ1A 3DVEA 1F4QA 2H8VA 3I5GB 2K7BA 3S0DA 2KNEA 1M45A 2COLB 2MAZA 4N1FA 1TNPA 2VRGA 1WDCB 3M0WA 2NCPA 2Y4QA 5AEQA 2JZIA 2K7CA 2EHBA 1CM1A 1X02A 2KLDA 3S0GA 1XYDA 3BXKA 1S6CA 1Z4HA 3RZSA 1Q80A 2KGBC 2P71A 2LP3A 3SS5A 1CMFA 4YGBB 2SCPA 1OE9B 2DOQA 4YRUA 1AJ5A 1BU3A 1GQMA 1XK4A 2FOTA 1H4BA 5DKQA 3SIAA 4GUKA 2JTZA 2WCBA 3SS4A 2L4HA 3NSIA 4IJ7A 1VRKA 2BE6A 1DGUA 1S5GZ 2M0RA 5CPVA 5AFPA 1S3PA 1RTP1 2K0JA 1XFXO 2YGUA 1T14A 5K89A 3D10A 4GGFA 2FCDA 1K96A 1DJXA 1QLSA 3JTDC 1A2XA 2MBXA 1EH2A 2QEOA 3EG5B 1SR6C 2KHNA 1G8IA 5I2OA 4R1EA 2KAVA 1XFVO 1Y0VH 3NHIA 3O6BA 1JSAA 3CTNA 1B8RA 1LS8A 1IJ6A 2LVVA 1SL9A 3EK8A 4FQOA 4CLNA 3LK1A 1TUZA 2OTGB 3B6XA 2OPOA 1ZFSA 1UHNA 3NGVA 3L4LA 5BPJA 1EG4A 4OCIA 1BT6A 5FI7A 2BAPA 2PYQA 2RGIA 3CR2A 1EJ3A 1DJWA 2K8MB 3BUWB 3FE8A 2LANA 4ICBA 1DVIA 3OX6A 5HKZA 2FJYA 5DKRA 1OOJA 5D3OA 2JXCA 2M9GA 2KPHA 4OR9B 1MQ1A 5G08A 4HRHA 1A75B 1BOCA 2LVJA 5JOLA 2R2IA 1HQVA 1MXEA 3DF0B 1MXLC 1DT7B 1CLLA 2ZKMX 3NSKA 4M2PA 3HCMA 1NPQA 1KK8C 1QIVA 2KAXA 2LVKA 1BR1B 1KSMA 2BCBA 2KBIA 3CZ2A 2KI4B 4BY4A 1OMDA 1IGVA 3FWBA 4D1EA 4WRIA 2KAYA 3AKBA 2ZFDA 5AANA 1C7WA 5EL2A 3Q8IA 4NDCA 4A4BA 3TDZA 3LCPC 1QASA 3PN7C 3D76A 3GK1A 3BFAA 1EXRA 3WNXB 1JF2A 2K60A 2KI6D 2JOJA 4XJKB 1SY9A 1S26D 3O4XA 3EK7A 3NSLA 1AP4A 1M31A 1TWOA 1K90D 2JPTA 4GGFC 1ZACA 4L9MA 2LUCA 5HKYA 1JFKA 4KYNA 4NDBA 5HLVA 2OS8C 3SG5A 2MRDA 1W7JB 2LUXA 3SG2A 3ZWHA 4GBAA 2CBLA 2K2AA 4MZJA 1UURA 3NHTA 1GM0A 1N0YA 2WC8A 3PFVA 4HREE 1DF0A 1TIZA 4PHKA 2AUCA 2JNXA 4U8DA 1EG3A 2F3YA 3UNWA 2F2PA 2LE9B 1GJYA 1TTXA 2MHHA 2FCEA 2WORA 3CLNA 3RM1A 1OSAA 2FJUB 5DKNA 1F71A 1SYMA 1K8UA 1YUTA 2KQYA 4ORAB 1EL4A 4HRGA 1IIOA 4GFTA 4PE1A 3I5GC 2JULA 4JKTA 1IH0A 2I2RE 3CR4X 4HSZA 1SCMB 1UHIA 2I94A 2MLFC 1RROA 5FI2A 1ZOTB 3D0YA
chains in the Genus database with same CATH topology
5CSNA 4MZKA 1LA3A 1WLMA 3JVTC 1NP8A 2KQ6A 1MR8A 1TOPA 3EKJA 2KGRA 2PASA 1V1FA 1NCXA 1CM4A 1S36A 1RJVA 1J7QA 2I7AA 2JNFA 4TNCA 1KWOB 3DD4A 2Y5IA 1KQVA 1PULA 4CPVA 3I5IB 1OZOA 3VGOA 1G33A 1KQMB 3F45A 2K7OA 1NYAA 4PE4A 3SIBA 4M2QA 1F54A 1PSBA 1SW8A 1TCFA 2LCPA 2BBNA 2BBMA 2EC6B 1OMVA 1BODA 4YI8A 1XA5A 2L4IA 2SASA 3I5FC 4P5OE 4QJ4B 2L50A 2F3ZA 3IQQA 3NXAA 1C07A 3AKAA 2BL0B 2M49B 1SPYA 1ZMZA 3PSRA 1DTLA 4DS7A 2CTNA 2LNKA 3TZ1A 1BLQA 4I5JA 1OZSA 3ZNIA 4FTGA 1RWYA 4USLA 2NZ0A 1NX2A 2JTTA 1NIWA 1S6JA 1QATA 1PALA 4ZCVA 3BOWB 3C1VA 1K9KA 5HLOA 5AERA 1K9UA 2ZRSA 2LC5A 1SBJA 1DJGA 1NWDA 4MVFA 4MZLA 5KU1A 4PALA 5IBWA 3IF7A 1WRKA 1B7TZ 2Q91A 1L2OB 1QVIY 4PCWA 3VRQA 2LMTA 2H61C 1D1OA 4M2OA 2AMIA 4JPZB 3PALA 2M7LA 2JQ6A 4MLWA 2MA2A 1BJFA 1FBVA 2NLNA 3WHTB 3QRXA 5ER5A 4UPGA 2CT9A 2KI6C 4CFRA 2CXJA 4AQIA 1QX5B 5KSZA 1SCVA 1JFJA 3LLEA 4MRXA 1B8LA 1LKJA 1BF5A 1K9PA 4WQ2A 1IG5A 1J7RA 1J7OA 1UHHA 1FI6A 1UUSA 3KO0A 4PHMA 1OMRA 3TDUA 2M97A 1A03A 1MHOA 2G9BA 3O2PA 1K2HA 1BR4B 1NSHA 2ZN9A 2PMYA 4E68A 2O60A 5CSFA 2KFHA 1PRWA 4OVNF 1DF0B 1A29A 1UWOA 1AJ4A 5F6TA 3BUXB 1QLKA 4P2YB 4ZCUA 2M8UA 3AAJA 2E6WA 2JRFA 2LV7A 3JTDB 2K2FA 1U5IB 2BE4A 2PVBA 4N1GA 1R6PA 1GGWA 1YTZC 1K95A 4DCKA 1N2DA 1FW4A 5I2LA 1Y1XA 2M1UA 5D7FA 1W7IB 1YR5A 1J7PA 3OHMB 1SK6D 5HKWA 1AHRA 1XFUO 1Y1UA 2ZRTA 1CLMA 2L0PA 1TRFA 3D0YB 1HT9A 4DRWA 4N5XA 3SG6A 1JBAA 1DJYA 3I5HC 2L51A 2B1UA 1QS7A 1JWDA 1DJIA 2WNDA 5I2QA 1K93D 1KK7Y 4YGDB 2LMUA 1TNQA 5GQQC 1AVSA 2MJWB 1BMOA 3E3RA 1L7ZA 1DMOA 1XVJA 1A75A 1QVIZ 1KQMC 4JQ0D 1XFWO 2H61A 2LMVA 3DF0A 1SKTA 3OP0A 4MRYA 2KFFA 1BG1A 1KSOA 1LINA 1RFJA 1WRZA 1WDCC 1OQPA 3CGAA 2HQ8A 1UP5A 1M46A 1KFUS 3IQOA 4PHNA 4I5KA 1QV0A 4NQGA 4MSPA 2G2BA 1WLZA 5J3XA 1M63B 3MSEB 5JJGA 1CFPA 2LAPA 1RK9A 1J1EA 1JUOA 5FYXA 3TS5B 1FF1A 2JT3A 3PN7B 2LHIA 1AUIB 5I8NA 1CLBA 2JWWA 1NCZA 2E30A 4XJKA 1IWQA 1YX7A 4ORBB 4PE7A 4WQ3A 1K94A 4MN0A 3GOFA 3WXAA 1DGVA 4YBHB 3SG4A 2Y1NA 1QV1A 2P6BB 3TUYB 4C0KA 4GNKB 1LA0A 1WRLA 2OS8B 3O78A 3BUMB 4DIRA 3AAKA 4BY5A 3A4UB 2KOTA 2O5GA 4MEWA 1F55A 1G4YR 1GGZA 3OX5A 2LVIA 3BYAA 3PLFB 2HETA 1C7VA 4ETOA 2OTGC 2JC2A 1SRAA 2JT8A 4JWQA 1NX0A 1PVBA 1F70A 4DUQA 2D8NA 3EK4A 5KTYA 4PE0A 4I5NB 2ZNDA 5ER4X 1QIWA 1QXPA 1F4OA 1NCYA 1PSRA 2NXQA 1ODBA 3K21A 1QX2A 2I18A 1AK8A 2M29A 4A4CA 3BQ3A 1YURA 1CTRA 3JVTB 1ZUZA 2LLSA 1S1EA 1B47A 1CFDA 2LP2A 1KCYA 1IJ5A 4I5LB 4Q04A 2ISDA 4C0JA 4AOMA 1CB1A 2AAOA 4GPLB 1TNXA 2KBMA 1KFXL 1KK7Z 1RECA 1SNLA 1S6IA 4MBEA 2MLEC 3HX4A 3PM8A 2BKIB 1ALWA 1M39A 3DVMA 1J55A 2KI4C 2WOSA 3O4YA 1CMGA 2PRUA 2HQWA 2KYCA 2GGZA 4OV2A 3TDIA 3VROA 2CNPA 4QJ5B 2M1KB 2F8PA 3H4SE 3I5FB 2EGDA 3PATA 2NCOA 1FI5A 2KFGA 1NUBA 1QX7A 3EKHA 1UHKA 3BUOB 3DVKA 2L2EA 1MF8B 1FPWA 3OB1B 3ICBA 5CSIA 2WCEA 2JT0A 4ORCB 1CDLA 1CKKA 2HPSA 2M3WA 1SL8A 1CFCA 4GAOA 5B8IB 1KFXS 1B4CA 3BOWA 3FWCA 3FIAA 1MWNA 1XFYO 2LHLA 2ZNEA 1TCOB 2ZN8A 4YGEB 1F8HA 1ALVA 1CDMA 3FS7A 1SR6B 1PK0D 2IS9A 2BCAA 1KFUL 2JU0A 3LL8B 3CWGA 3SG3A 3GK2A 1CDNA 1LXFC 1TNWA 3GK4X 1SCMC 1SL7A 3KPXA 2LLUA 4YI9A 2V53A 3CS1A 5PALA 2HF5A 2L98A 3EVUA 3BUNB 1B9AA 1R2UA 2KDHA 3CZTX 3EVVA 2QPTA 1XK4C 1Y1AA 3VRRA 1IQ3A 1KWOC 1V1GA 1XO5A 2Q4UA 1QTXA 3KF9A 3NSOA 3TS5C 4CIDA 3I5IC 1YVLA 2BECA 2M7NA 4YGCB 1IKUA 1S5GY 1YX8A 4OKHA 4GGNA 1E8AA 2JXLA 3KHEA 3WHUB 2H2KA 1KK8B 1B7TY 2A4JA 5HYDA 2EC6C 2BKHB 2BCXA 4F0ZB 4XYNA 1J1DA 4C0LA 3TUYC 1YUSA 4PHJA 1NX3A 2GV5A 3A8RA 1A4PA 1Y6WA 1TN4A 1B8CA 2K7DA 2BL0C 2LM5A 2PALA 4QJ3B 2TN4A 1YRUB 1U5IA 1MUXA 1DJHA 1XFZO 3DVJA 1H8BA 4AQJA 1IQ5A 1JF0A 1YUUA 1NX1A 1JC2A 1YVHA 1CFFA 2F2OA 3EVRA 4NDDA 5D69A 2WCFA 2GGMA 1IRJA 1YRTB 3KEVA 1L2OC 1WY9A 2K61A 1CNPA 5AXIA 2QACA 3OB2B 3I5HB 2LLTA 5CSJA 2PSRA 1SMGA 3SJSA 4PDZA 5TNCA 3RLZA 3VRPA 1N65A 2Y1MA 1PVAA 1UHJA 3CR5X 3SG7A 1DJZA 1LVCD 2F33A 1QJTA 2KSPA 4IL1A 2CCMA 2L5XB 4YGAA 2KYFA 3LK0A 4CFQA 1B1GA 1CDPA 3DVEA 1F4QA 3I5GB 2K7BA 2KNEA 1M45A 2COLB 2MAZA 4N1FA 1TNPA 2VRGA 1WDCB 3M0WA 2NCPA 2Y4QA 5AEQA 2JZIA 2K7CA 2EHBA 1CM1A 1X02A 1XYDA 3BXKA 1S6CA 1Q80A 2KGBC 2LP3A 1CMFA 4YGBB 2SCPA 1OE9B 2DOQA 4YRUA 1AJ5A 1BU3A 1GQMA 1XK4A 2FOTA 1H4BA 5DKQA 3SIAA 4GUKA 2JTZA 2WCBA 2L4HA 3NSIA 1VRKA 2BE6A 1DGUA 1S5GZ 2M0RA 5CPVA 5AFPA 1S3PA 1RTP1 2K0JA 1XFXO 5K89A 3D10A 4GGFA 2FCDA 1K96A 1DJXA 1QLSA 3JTDC 1A2XA 2MBXA 1EH2A 1SR6C 2KHNA 1G8IA 5I2OA 4R1EA 2KAVA 1XFVO 1Y0VH 3O6BA 1JSAA 3CTNA 1B8RA 1IJ6A 2LVVA 1SL9A 3EK8A 4FQOA 4CLNA 3LK1A 2OTGB 2OPOA 1ZFSA 1UHNA 5BPJA 1EG4A 4OCIA 1BT6A 2RGIA 3CR2A 1EJ3A 1DJWA 2K8MB 3BUWB 4ICBA 2LANA 5HKZA 1DVIA 3OX6A 3VRNA 5DKRA 1OOJA 2JXCA 2M9GA 4OR9B 1MQ1A 5G08A 4HRHA 1A75B 1BOCA 2LVJA 5JOLA 2R2IA 1HQVA 1MXEA 3DF0B 1MXLC 1DT7B 1CLLA 2ZKMX 3NSKA 4M2PA 3HCMA 1NPQA 1KK8C 1QIVA 2KAXA 2LVKA 1BR1B 1KSMA 2BCBA 2KBIA 2KI4B 4BY4A 1OMDA 1IGVA 3FWBA 4D1EA 4WRIA 2KAYA 3AKBA 2ZFDA 5AANA 1C7WA 4NDCA 4A4BA 3TDZA 3LCPC 1QASA 3PN7C 3GK1A 3WNXB 1EXRA 1JF2A 2KI6D 2JOJA 4XJKB 1SY9A 1S26D 3EK7A 3NSLA 1AP4A 1M31A 2JPTA 1K90D 4GGFC 1ZACA 4L9MA 2LUCA 5HKYA 1JFKA 5HLVA 4NDBA 3SG5A 2OS8C 3ZWHA 2MRDA 1W7JB 2LUXA 3SG2A 4GBAA 2CBLA 2K2AA 4MZJA 1UURA 1N0YA 2WC8A 3PFVA 4HREE 1DF0A 1TIZA 4PHKA 2AUCA 2JNXA 4U8DA 1EG3A 2F3YA 2F2PA 2LE9B 1GJYA 1TTXA 2MHHA 2FCEA 2WORA 3CLNA 3RM1A 1OSAA 2FJUB 5DKNA 1F71A 1SYMA 1K8UA 1YUTA 2KQYA 4ORAB 1EL4A 4HRGA 4GFTA 4PE1A 3I5GC 2JULA 1IH0A 2I2RE 3CR4X 4HSZA 1SCMB 1UHIA 2I94A 2MLFC 1RROA 1ZOTB 3D0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSN A;  4MZK A;  1LA3 A;  1WLM A;  3JVT C;  1NP8 A;  2KQ6 A;  1MR8 A;  1TOP A;  3EKJ A;  2KGR A;  2PAS A;  1V1F A;  1NCX A;  1CM4 A;  1S36 A;  1RJV A;  1J7Q A;  2I7A A;  2JNF A;  4TNC A;  1KWO B;  3DD4 A;  2Y5I A;  1KQV A;  1PUL A;  4CPV A;  3I5I B;  1OZO A;  3VGO A;  1G33 A;  1KQM B;  3F45 A;  2K7O A;  1NYA A;  4PE4 A;  3SIB A;  4M2Q A;  1F54 A;  1PSB A;  1SW8 A;  1TCF A;  2LCP A;  2BBN A;  2BBM A;  2EC6 B;  1OMV A;  1BOD A;  4YI8 A;  1XA5 A;  2L4I A;  2SAS A;  3I5F C;  4P5O E;  4QJ4 B;  2L50 A;  2F3Z A;  3IQQ A;  3NXA A;  1C07 A;  3AKA A;  2BL0 B;  2M49 B;  1SPY A;  1ZMZ A;  3PSR A;  1DTL A;  4DS7 A;  2CTN A;  2LNK A;  3TZ1 A;  1BLQ A;  4I5J A;  1OZS A;  3ZNI A;  4FTG A;  1RWY A;  4USL A;  2NZ0 A;  1NX2 A;  2JTT A;  1NIW A;  1S6J A;  1QAT A;  1PAL A;  4ZCV A;  3BOW B;  3C1V A;  1K9K A;  5HLO A;  5AER A;  1K9U A;  2ZRS A;  2LC5 A;  1SBJ A;  1DJG A;  1NWD A;  4MVF A;  4MZL A;  5KU1 A;  4PAL A;  5IBW A;  3IF7 A;  1WRK A;  1B7T Z;  2Q91 A;  1L2O B;  1QVI Y;  4PCW A;  3VRQ A;  2LMT A;  2H61 C;  1D1O A;  4M2O A;  2AMI A;  4JPZ B;  3PAL A;  2M7L A;  2JQ6 A;  4MLW A;  2MA2 A;  1BJF A;  1FBV A;  2NLN A;  3WHT B;  3QRX A;  5ER5 A;  4UPG A;  2CT9 A;  2KI6 C;  4CFR A;  2CXJ A;  4AQI A;  1QX5 B;  5KSZ A;  1SCV A;  1JFJ A;  3LLE A;  4MRX A;  1B8L A;  1LKJ A;  1BF5 A;  1K9P A;  4WQ2 A;  1IG5 A;  1J7R A;  1J7O A;  1UHH A;  1FI6 A;  1UUS A;  3KO0 A;  4PHM A;  1OMR A;  3TDU A;  2M97 A;  1A03 A;  1MHO A;  2G9B A;  3O2P A;  1K2H A;  1BR4 B;  1NSH A;  2ZN9 A;  2PMY A;  4E68 A;  2O60 A;  5CSF A;  2KFH A;  1PRW A;  4OVN F;  1DF0 B;  1A29 A;  1UWO A;  1AJ4 A;  5F6T A;  3BUX B;  1QLK A;  4P2Y B;  4ZCU A;  2M8U A;  3AAJ A;  2E6W A;  2JRF A;  2LV7 A;  3JTD B;  2K2F A;  1U5I B;  2BE4 A;  2PVB A;  4N1G A;  1R6P A;  1GGW A;  1YTZ C;  1K95 A;  4DCK A;  1N2D A;  1FW4 A;  5I2L A;  1Y1X A;  2M1U A;  5D7F A;  1W7I B;  1YR5 A;  1J7P A;  3OHM B;  1SK6 D;  5HKW A;  1AHR A;  1XFU O;  1Y1U A;  2ZRT A;  1CLM A;  2L0P A;  1TRF A;  3D0Y B;  1HT9 A;  4DRW A;  4N5X A;  3SG6 A;  1JBA A;  1DJY A;  3I5H C;  2L51 A;  2B1U A;  1QS7 A;  1JWD A;  1DJI A;  2WND A;  5I2Q A;  1K93 D;  1KK7 Y;  4YGD B;  2LMU A;  1TNQ A;  5GQQ C;  1AVS A;  2MJW B;  1BMO A;  3E3R A;  1L7Z A;  1DMO A;  1XVJ A;  1A75 A;  1QVI Z;  1KQM C;  4JQ0 D;  1XFW O;  2H61 A;  2LMV A;  3DF0 A;  1SKT A;  3OP0 A;  4MRY A;  2KFF A;  1BG1 A;  1KSO A;  1LIN A;  1RFJ A;  1WRZ A;  1WDC C;  1OQP A;  3CGA A;  2HQ8 A;  1UP5 A;  1M46 A;  1KFU S;  3IQO A;  4PHN A;  4I5K A;  1QV0 A;  4NQG A;  4MSP A;  2G2B A;  1WLZ A;  5J3X A;  1M63 B;  3MSE B;  5JJG A;  1CFP A;  2LAP A;  1RK9 A;  1J1E A;  1JUO A;  5FYX A;  3TS5 B;  1FF1 A;  2JT3 A;  3PN7 B;  2LHI A;  1AUI B;  5I8N A;  1CLB A;  2JWW A;  1NCZ A;  2E30 A;  4XJK A;  1IWQ A;  1YX7 A;  4ORB B;  4PE7 A;  4WQ3 A;  1K94 A;  4MN0 A;  3GOF A;  3WXA A;  1DGV A;  4YBH B;  3SG4 A;  2Y1N A;  1QV1 A;  2P6B B;  3TUY B;  4C0K A;  4GNK B;  1LA0 A;  1WRL A;  2OS8 B;  3O78 A;  3BUM B;  4DIR A;  3AAK A;  4BY5 A;  3A4U B;  2KOT A;  2O5G A;  4MEW A;  1F55 A;  1G4Y R;  1GGZ A;  3OX5 A;  2LVI A;  3BYA A;  3PLF B;  2HET A;  1C7V A;  4ETO A;  2OTG C;  2JC2 A;  1SRA A;  2JT8 A;  4JWQ A;  1NX0 A;  1PVB A;  1F70 A;  4DUQ A;  2D8N A;  3EK4 A;  5KTY A;  4PE0 A;  4I5N B;  2ZND A;  5ER4 X;  1QIW A;  1QXP A;  1F4O A;  1NCY A;  1PSR A;  2NXQ A;  1ODB A;  3K21 A;  1QX2 A;  2I18 A;  1AK8 A;  2M29 A;  4A4C A;  3BQ3 A;  1YUR A;  1CTR A;  3JVT B;  1ZUZ A;  2LLS A;  1S1E A;  1B47 A;  1CFD A;  2LP2 A;  1KCY A;  1IJ5 A;  4I5L B;  4Q04 A;  2ISD A;  4C0J A;  4AOM A;  1CB1 A;  2AAO A;  4GPL B;  1TNX A;  2KBM A;  1KFX L;  1KK7 Z;  1REC A;  1SNL A;  1S6I A;  4MBE A;  2MLE C;  3HX4 A;  3PM8 A;  2BKI B;  1ALW A;  1M39 A;  3DVM A;  1J55 A;  2KI4 C;  2WOS A;  3O4Y A;  1CMG A;  2PRU A;  2HQW A;  2KYC A;  2GGZ A;  4OV2 A;  3TDI A;  3VRO A;  2CNP A;  4QJ5 B;  2M1K B;  2F8P A;  3H4S E;  3I5F B;  2EGD A;  3PAT A;  2NCO A;  1FI5 A;  2KFG A;  1NUB A;  1QX7 A;  3EKH A;  1UHK A;  3BUO B;  3DVK A;  2L2E A;  1MF8 B;  1FPW A;  3OB1 B;  3ICB A;  5CSI A;  2WCE A;  2JT0 A;  4ORC B;  1CDL A;  1CKK A;  2HPS A;  2M3W A;  1SL8 A;  1CFC A;  4GAO A;  5B8I B;  1KFX S;  1B4C A;  3BOW A;  3FWC A;  3FIA A;  1MWN A;  1XFY O;  2LHL A;  2ZNE A;  1TCO B;  2ZN8 A;  4YGE B;  1F8H A;  1ALV A;  1CDM A;  3FS7 A;  1SR6 B;  1PK0 D;  2IS9 A;  2BCA A;  1KFU L;  2JU0 A;  3LL8 B;  3CWG A;  3SG3 A;  3GK2 A;  1CDN A;  1LXF C;  1TNW A;  3GK4 X;  1SCM C;  1SL7 A;  3KPX A;  2LLU A;  4YI9 A;  2V53 A;  3CS1 A;  5PAL A;  2HF5 A;  2L98 A;  3EVU A;  3BUN B;  1B9A A;  1R2U A;  2KDH A;  3CZT X;  3EVV A;  2QPT A;  1XK4 C;  1Y1A A;  3VRR A;  1IQ3 A;  1KWO C;  1V1G A;  1XO5 A;  2Q4U A;  1QTX A;  3KF9 A;  3NSO A;  3TS5 C;  4CID A;  3I5I C;  1YVL A;  2BEC A;  2M7N A;  4YGC B;  1IKU A;  1S5G Y;  1YX8 A;  4OKH A;  4GGN A;  1E8A A;  2JXL A;  3KHE A;  3WHU B;  2H2K A;  1KK8 B;  1B7T Y;  2A4J A;  5HYD A;  2EC6 C;  2BKH B;  2BCX A;  4F0Z B;  4XYN A;  1J1D A;  4C0L A;  3TUY C;  1YUS A;  4PHJ A;  1NX3 A;  2GV5 A;  3A8R A;  1A4P A;  1Y6W A;  1TN4 A;  1B8C A;  2K7D A;  2BL0 C;  2LM5 A;  2PAL A;  4QJ3 B;  2TN4 A;  1YRU B;  1U5I A;  1MUX A;  1DJH A;  1XFZ O;  3DVJ A;  1H8B A;  4AQJ A;  1IQ5 A;  1JF0 A;  1YUU A;  1NX1 A;  1JC2 A;  1YVH A;  1CFF A;  2F2O A;  3EVR A;  4NDD A;  5D69 A;  2WCF A;  2GGM A;  1IRJ A;  1YRT B;  3KEV A;  1L2O C;  1WY9 A;  2K61 A;  1CNP A;  5AXI A;  2QAC A;  3OB2 B;  3I5H B;  2LLT A;  5CSJ A;  2PSR A;  1SMG A;  3SJS A;  4PDZ A;  5TNC A;  3RLZ A;  3VRP A;  1N65 A;  2Y1M A;  1PVA A;  1UHJ A;  3CR5 X;  3SG7 A;  1DJZ A;  1LVC D;  2F33 A;  1QJT A;  2KSP A;  4IL1 A;  2CCM A;  2L5X B;  4YGA A;  2KYF A;  3LK0 A;  4CFQ A;  1B1G A;  1CDP A;  3DVE A;  1F4Q A;  3I5G B;  2K7B A;  2KNE A;  1M45 A;  2COL B;  2MAZ A;  4N1F A;  1TNP A;  2VRG A;  1WDC B;  3M0W A;  2NCP A;  2Y4Q A;  5AEQ A;  2JZI A;  2K7C A;  2EHB A;  1CM1 A;  1X02 A;  1XYD A;  3BXK A;  1S6C A;  1Q80 A;  2KGB C;  2LP3 A;  1CMF A;  4YGB B;  2SCP A;  1OE9 B;  2DOQ A;  4YRU A;  1AJ5 A;  1BU3 A;  1GQM A;  1XK4 A;  2FOT A;  1H4B A;  5DKQ A;  3SIA A;  4GUK A;  2JTZ A;  2WCB A;  2L4H A;  3NSI A;  1VRK A;  2BE6 A;  1DGU A;  1S5G Z;  2M0R A;  5CPV A;  5AFP A;  1S3P A;  1RTP 1;  2K0J A;  1XFX O;  5K89 A;  3D10 A;  4GGF A;  2FCD A;  1K96 A;  1DJX A;  1QLS A;  3JTD C;  1A2X A;  2MBX A;  1EH2 A;  1SR6 C;  2KHN A;  1G8I A;  5I2O A;  4R1E A;  2KAV A;  1XFV O;  1Y0V H;  3O6B A;  1JSA A;  3CTN A;  1B8R A;  1IJ6 A;  2LVV A;  1SL9 A;  3EK8 A;  4FQO A;  4CLN A;  3LK1 A;  2OTG B;  2OPO A;  1ZFS A;  1UHN A;  5BPJ A;  1EG4 A;  4OCI A;  1BT6 A;  2RGI A;  3CR2 A;  1EJ3 A;  1DJW A;  2K8M B;  3BUW B;  4ICB A;  2LAN A;  5HKZ A;  1DVI A;  3OX6 A;  3VRN A;  5DKR A;  1OOJ A;  2JXC A;  2M9G A;  4OR9 B;  1MQ1 A;  5G08 A;  4HRH A;  1A75 B;  1BOC A;  2LVJ A;  5JOL A;  2R2I A;  1HQV A;  1MXE A;  3DF0 B;  1MXL C;  1DT7 B;  1CLL A;  2ZKM X;  3NSK A;  4M2P A;  3HCM A;  1NPQ A;  1KK8 C;  1QIV A;  2KAX A;  2LVK A;  1BR1 B;  1KSM A;  2BCB A;  2KBI A;  2KI4 B;  4BY4 A;  1OMD A;  1IGV A;  3FWB A;  4D1E A;  4WRI A;  2KAY A;  3AKB A;  2ZFD A;  5AAN A;  1C7W A;  4NDC A;  4A4B A;  3TDZ A;  3LCP C;  1QAS A;  3PN7 C;  3GK1 A;  3WNX B;  1EXR A;  1JF2 A;  2KI6 D;  2JOJ A;  4XJK B;  1SY9 A;  1S26 D;  3EK7 A;  3NSL A;  1AP4 A;  1M31 A;  2JPT A;  1K90 D;  4GGF C;  1ZAC A;  4L9M A;  2LUC A;  5HKY A;  1JFK A;  5HLV A;  4NDB A;  3SG5 A;  2OS8 C;  3ZWH A;  2MRD A;  1W7J B;  2LUX A;  3SG2 A;  4GBA A;  2CBL A;  2K2A A;  4MZJ A;  1UUR A;  1N0Y A;  2WC8 A;  3PFV A;  4HRE E;  1DF0 A;  1TIZ A;  4PHK A;  2AUC A;  2JNX A;  4U8D A;  1EG3 A;  2F3Y A;  2F2P A;  2LE9 B;  1GJY A;  1TTX A;  2MHH A;  2FCE A;  2WOR A;  3CLN A;  3RM1 A;  1OSA A;  2FJU B;  5DKN A;  1F71 A;  1SYM A;  1K8U A;  1YUT A;  2KQY A;  4ORA B;  1EL4 A;  4HRG A;  4GFT A;  4PE1 A;  3I5G C;  2JUL A;  1IH0 A;  2I2R E;  3CR4 X;  4HSZ A;  1SCM B;  1UHI A;  2I94 A;  2MLF C;  1RRO A;  1ZOT B;  3D0Y A; 
#chains in the Genus database with same CATH topology
 5CSN A;  3CDN A;  4MZK A;  1LA3 A;  1WLM A;  3JVT C;  1NP8 A;  2KQ6 A;  1MR8 A;  1TOP A;  3EKJ A;  2KGR A;  2PAS A;  3SS3 A;  1V1F A;  1NCX A;  1CM4 A;  1S36 A;  2WCJ A;  1RJV A;  1J7Q A;  2I7A A;  2JNF A;  4TNC A;  1KWO B;  3DD4 A;  2Y5I A;  1KQV A;  1PUL A;  4CPV A;  3I5I B;  1OZO A;  3VGO A;  1G33 A;  1KQM B;  3F45 A;  2K7O A;  1NYA A;  4PE4 A;  3S0E A;  4M2Q A;  3SIB A;  1F54 A;  1PSB A;  1SW8 A;  1TCF A;  2LCP A;  2BBN A;  3S0B A;  2BBM A;  2EC6 B;  1DEK A;  1OMV A;  1BOD A;  4YI8 A;  3N7H A;  1DC1 A;  1XA5 A;  2L4I A;  2SAS A;  3I5F C;  4P5O E;  3R72 A;  2L50 A;  2F3Z A;  3IQQ A;  3NXA A;  4QJ4 B;  1C07 A;  5DIC A;  3AKA A;  2BL0 B;  2M49 B;  1SPY A;  1ZMZ A;  2QDI A;  1DTL A;  3PSR A;  2CTN A;  2LNK A;  4DS7 A;  3TZ1 A;  1BLQ A;  4I5J A;  1OZS A;  2L5Y A;  3ZNI A;  4FTG A;  1RWY A;  4USL A;  4PT1 A;  2NZ0 A;  1NX2 A;  2JTT A;  1NIW A;  1S6J A;  1QAT A;  3OBV A;  1PAL A;  3CAB A;  4ZCV A;  3BOW B;  3C1V A;  1K9K A;  5HLO A;  5AER A;  1K9U A;  2ZRS A;  2LC5 A;  1SBJ A;  1DJG A;  1NWD A;  3DYE A;  4MVF A;  4MZL A;  5KU1 A;  4PAL A;  5IBW A;  3IF7 A;  1WRK A;  1B7T Z;  2Q91 A;  1L2O B;  1QVI Y;  4PCW A;  3VRQ A;  2LMT A;  3DXL A;  2H61 C;  2QEH A;  1D1O A;  1QWV A;  4M2O A;  2AMI A;  4JPZ B;  3PAL A;  2M7L A;  2JQ6 A;  4MLW A;  2MA2 A;  1BJF A;  1FBV A;  2NLN A;  3WHT B;  5HL1 A;  3QRX A;  5ER5 A;  4UPG A;  1OOH A;  2CT9 A;  2KI6 C;  3B88 A;  4CFR A;  2CXJ A;  4AQI A;  1QX5 B;  3V2L A;  5KSZ A;  1SCV A;  4F7F A;  3D74 A;  3LLE A;  4MRX A;  1JFJ A;  1B8L A;  1LKJ A;  1BF5 A;  1XFR A;  2WCM A;  1K9P A;  4WQ2 A;  1IG5 A;  1J7R A;  1J7O A;  1UHH A;  1FI6 A;  5FI6 A;  1UUS A;  3KO0 A;  2JPO A;  4PHM A;  1OMR A;  3TDU A;  2M97 A;  1A03 A;  1MHO A;  2G9B A;  3O2P A;  1K2H A;  1BR4 B;  1NSH A;  2ZN9 A;  3IVT A;  2PMY A;  3S0F A;  3B7A A;  4E68 A;  2O60 A;  4INX A;  5CSF A;  2KFH A;  1PRW A;  4OVN F;  1DF0 B;  1P28 A;  1A29 A;  1UWO A;  1AJ4 A;  5F6T A;  3BUX B;  1QLK A;  4P2Y B;  4ZCU A;  2M8U A;  3AAJ A;  2E6W A;  2JRF A;  2LV7 A;  3BFH A;  3JTD B;  4JD9 A;  2K2F A;  1U5I B;  2BE4 A;  2PVB A;  4N1G A;  1R6P A;  1GGW A;  1YTZ C;  1K95 A;  2WCL A;  4DCK A;  1N2D A;  1OOI X;  1FW4 A;  5I2L A;  1Y1X A;  2M1U A;  5D7F A;  1W7I B;  1YR5 A;  1Z2C B;  1J7P A;  3OHM B;  1SK6 D;  5HKW A;  1AHR A;  2PQL A;  1OOG A;  1XFU O;  1Y1U A;  2ZRT A;  1CLM A;  2L0P A;  1TRF A;  3D0Y B;  1HT9 A;  4DRW A;  4N5X A;  3SG6 A;  3K1E A;  1JBA A;  1DJY A;  3I5H C;  3CZ0 A;  2L51 A;  2B1U A;  1QS7 A;  1JWD A;  1DJI A;  2WND A;  5I2Q A;  1K93 D;  1KK7 Y;  3PM2 A;  4YGD B;  2LMU A;  1TNQ A;  5GQQ C;  1AVS A;  2MJW B;  1BMO A;  3E3R A;  1L7Z A;  1DMO A;  1XVJ A;  1A75 A;  1QVI Z;  1KQM C;  4JQ0 D;  1XFW O;  2H61 A;  2LMV A;  3DF0 A;  1SKT A;  3OP0 A;  4MRY A;  2KFF A;  1BG1 A;  1KSO A;  1LIN A;  1RFJ A;  1WRZ A;  1WDC C;  1OQP A;  3CGA A;  2HQ8 A;  1UP5 A;  3R1V A;  1M46 A;  1KFU S;  3IQO A;  4PHN A;  4I5K A;  1QV0 A;  4NQG A;  4MSP A;  2G2B A;  1WLZ A;  2WC5 A;  5J3X A;  5I94 A;  1M63 B;  3MSE B;  5JJG A;  1CFP A;  2LAP A;  1RK9 A;  1J1E A;  1JUO A;  5FYX A;  3TS5 B;  1FF1 A;  2JT3 A;  3PN7 B;  2LHI A;  1AUI B;  5I8N A;  1CLB A;  2JWW A;  1NCZ A;  2E30 A;  4XJK A;  1IWQ A;  1YX7 A;  4ORB B;  4PE7 A;  4WQ3 A;  1K94 A;  4MN0 A;  3GOF A;  3WXA A;  1DGV A;  4YBH B;  3SG4 A;  2Y1N A;  1QV1 A;  2P6B B;  3TUY B;  4C0K A;  4GNK B;  1LA0 A;  1WRL A;  2L2C A;  2OS8 B;  2QEB A;  3DY9 A;  3BUM B;  3O78 A;  4DIR A;  3AAK A;  3UO9 A;  4BY5 A;  3S0A A;  3A4U B;  2KOT A;  2O5G A;  4MEW A;  1F55 A;  3CYZ A;  1G4Y R;  2BNX A;  1GGZ A;  3OX5 A;  2LVI A;  3BYA A;  3PLF B;  2HET A;  3D78 A;  1C7V A;  4ETO A;  2OTG C;  2JC2 A;  1SRA A;  2JT8 A;  4JWQ A;  1NX0 A;  1PVB A;  1F70 A;  4DUQ A;  2D8N A;  3EK4 A;  5KTY A;  4PE0 A;  4I5N B;  2ZND A;  5ER4 X;  1QIW A;  1QXP A;  1F4O A;  1NCY A;  1PSR A;  2NXQ A;  1ODB A;  4OZD A;  3K21 A;  1QX2 A;  2I18 A;  1AK8 A;  2M29 A;  4A4C A;  3BQ3 A;  1YUR A;  1CTR A;  3JVT B;  1ZUZ A;  2LLS A;  1S1E A;  1B47 A;  1CFD A;  2LP2 A;  1KCY A;  1IJ5 A;  4I5L B;  4Q04 A;  2ISD A;  3D77 A;  4C0J A;  4AOM A;  1CB1 A;  2AAO A;  4GPL B;  1TNX A;  2KBM A;  1KFX L;  1KK7 Z;  1REC A;  1SNL A;  1S6I A;  4MBE A;  2MLE C;  3HX4 A;  3PM8 A;  2BKI B;  3R1O A;  1ALW A;  1M39 A;  3FE9 A;  3DVM A;  1J55 A;  2KI4 C;  2WOS A;  3O4Y A;  1CMG A;  2PRU A;  2HQW A;  2KYC A;  2GGZ A;  4OV2 A;  3TDI A;  3VRO A;  2CNP A;  4QJ5 B;  1OOF A;  2F8P A;  2KLE A;  2M1K B;  3H4S E;  3I5F B;  1DQE A;  1W9Z A;  2EGD A;  3PAT A;  2NCO A;  4FQT A;  1FI5 A;  2KFG A;  1NUB A;  2WC6 A;  1QX7 A;  3EKH A;  1UHK A;  3BUO B;  3DVK A;  2L2E A;  1MF8 B;  1DEL A;  3OB1 B;  3ICB A;  5CSI A;  2WCE A;  3DZT A;  1FPW A;  2JT0 A;  4ORC B;  1CDL A;  1CKK A;  2HPS A;  2M3W A;  1SL8 A;  1CFC A;  1TUJ A;  4GAO A;  5B8I B;  1KFX S;  1B4C A;  3BOW A;  3FWC A;  3L4A A;  3FIA A;  1MWN A;  4INW A;  1XFY O;  2LHL A;  2ZNE A;  3FE6 A;  1TCO B;  2ZN8 A;  4YGE B;  1F8H A;  1ALV A;  1CDM A;  3FS7 A;  1SR6 B;  1PK0 D;  2IS9 A;  2BCA A;  1KFU L;  2JU0 A;  3LL8 B;  3CWG A;  3QME A;  3GK2 A;  3SG3 A;  1CDN A;  1LXF C;  1TNW A;  1C3Z A;  3GK4 X;  1SCM C;  1SL7 A;  2ERB A;  3KPX A;  2LLU A;  4YI9 A;  2V53 A;  3CS1 A;  5PAL A;  2HF5 A;  2L98 A;  3EVU A;  3BUN B;  1B9A A;  1R2U A;  2KDH A;  3CZT X;  3EVV A;  2QPT A;  1XK4 C;  1Y1A A;  3VRR A;  1IQ3 A;  1KWO C;  1V1G A;  1XO5 A;  2Q4U A;  1QTX A;  3KF9 A;  3NSO A;  1OW4 A;  3TS5 C;  3D73 A;  4CID A;  3R1P A;  3I5I C;  1YVL A;  2BEC A;  2M7N A;  4YGC B;  1IKU A;  1S5G Y;  1YX8 A;  4OKH A;  3BJH A;  4GGN A;  1ORG A;  1E8A A;  2JXL A;  3KHE A;  3WHU B;  2H2K A;  1KK8 B;  1B7T Y;  2A4J A;  5HYD A;  2EC6 C;  2BKH B;  2BCX A;  4F0Z B;  4XYN A;  1J1D A;  3BFB A;  4C0L A;  3TUY C;  3VRN A;  1YUS A;  4PHJ A;  1NX3 A;  1C3Y A;  2GV5 A;  3A8R A;  1A4P A;  1Y6W A;  2GTE A;  3D75 A;  1TN4 A;  1B8C A;  2K7D A;  2BL0 C;  2LM5 A;  2PAL A;  4QJ3 B;  2TN4 A;  1YRU B;  3L47 A;  2WCK A;  3OGN A;  1U5I A;  1MUX A;  1DJH A;  1XFZ O;  3DVJ A;  1H8B A;  4AQJ A;  1IQ5 A;  1JF0 A;  1YUU A;  1NX1 A;  1JC2 A;  1YVH A;  1CFF A;  2F2O A;  3EVR A;  4NDD A;  5D69 A;  1SSE B;  2WCF A;  2GGM A;  3VB1 A;  1IRJ A;  1YRT B;  3KEV A;  1L2O C;  1WY9 A;  2K61 A;  1CNP A;  5AXI A;  2QAC A;  3B86 A;  2P70 A;  3OB2 B;  2QEV A;  3I5H B;  2LLT A;  5CSJ A;  2PSR A;  1SMG A;  2WCH A;  3SJS A;  4PDZ A;  5TNC A;  3RLZ A;  3VRP A;  1N65 A;  2Y1M A;  1PVA A;  3PJI A;  1UHJ A;  3CR5 X;  3SG7 A;  1DJZ A;  1LVC D;  2F33 A;  1QJT A;  2KSP A;  4IL1 A;  2CCM A;  2L5X B;  3B87 A;  2KYF A;  3LK0 A;  4YGA A;  4CFQ A;  1B1G A;  1CDP A;  3CZ1 A;  3DVE A;  1F4Q A;  2H8V A;  3I5G B;  2K7B A;  3S0D A;  2KNE A;  1M45 A;  2COL B;  2MAZ A;  4N1F A;  1TNP A;  2VRG A;  1WDC B;  3M0W A;  2NCP A;  2Y4Q A;  5AEQ A;  2JZI A;  2K7C A;  2EHB A;  1CM1 A;  1X02 A;  2KLD A;  3S0G A;  1XYD A;  3BXK A;  1S6C A;  1Z4H A;  3RZS A;  1Q80 A;  2KGB C;  2P71 A;  2LP3 A;  3SS5 A;  1CMF A;  4YGB B;  2SCP A;  1OE9 B;  2DOQ A;  4YRU A;  1AJ5 A;  1BU3 A;  1GQM A;  1XK4 A;  2FOT A;  1H4B A;  5DKQ A;  3SIA A;  4GUK A;  2JTZ A;  2WCB A;  3SS4 A;  2L4H A;  3NSI A;  4IJ7 A;  1VRK A;  2BE6 A;  1DGU A;  1S5G Z;  2M0R A;  5CPV A;  5AFP A;  1S3P A;  1RTP 1;  2K0J A;  1XFX O;  2YGU A;  1T14 A;  5K89 A;  3D10 A;  4GGF A;  2FCD A;  1K96 A;  1DJX A;  1QLS A;  3JTD C;  1A2X A;  2MBX A;  1EH2 A;  2QEO A;  3EG5 B;  1SR6 C;  2KHN A;  1G8I A;  5I2O A;  4R1E A;  2KAV A;  1XFV O;  1Y0V H;  3NHI A;  3O6B A;  1JSA A;  3CTN A;  1B8R A;  1LS8 A;  1IJ6 A;  2LVV A;  1SL9 A;  3EK8 A;  4FQO A;  4CLN A;  3LK1 A;  1TUZ A;  2OTG B;  3B6X A;  2OPO A;  1ZFS A;  1UHN A;  3NGV A;  3L4L A;  5BPJ A;  1EG4 A;  4OCI A;  1BT6 A;  5FI7 A;  2BAP A;  2PYQ A;  2RGI A;  3CR2 A;  1EJ3 A;  1DJW A;  2K8M B;  3BUW B;  3FE8 A;  2LAN A;  4ICB A;  1DVI A;  3OX6 A;  5HKZ A;  2FJY A;  5DKR A;  1OOJ A;  5D3O A;  2JXC A;  2M9G A;  2KPH A;  4OR9 B;  1MQ1 A;  5G08 A;  4HRH A;  1A75 B;  1BOC A;  2LVJ A;  5JOL A;  2R2I A;  1HQV A;  1MXE A;  3DF0 B;  1MXL C;  1DT7 B;  1CLL A;  2ZKM X;  3NSK A;  4M2P A;  3HCM A;  1NPQ A;  1KK8 C;  1QIV A;  2KAX A;  2LVK A;  1BR1 B;  1KSM A;  2BCB A;  2KBI A;  3CZ2 A;  2KI4 B;  4BY4 A;  1OMD A;  1IGV A;  3FWB A;  4D1E A;  4WRI A;  2KAY A;  3AKB A;  2ZFD A;  5AAN A;  1C7W A;  5EL2 A;  3Q8I A;  4NDC A;  4A4B A;  3TDZ A;  3LCP C;  1QAS A;  3PN7 C;  3D76 A;  3GK1 A;  3BFA A;  1EXR A;  3WNX B;  1JF2 A;  2K60 A;  2KI6 D;  2JOJ A;  4XJK B;  1SY9 A;  1S26 D;  3O4X A;  3EK7 A;  3NSL A;  1AP4 A;  1M31 A;  1TWO A;  1K90 D;  2JPT A;  4GGF C;  1ZAC A;  4L9M A;  2LUC A;  5HKY A;  1JFK A;  4KYN A;  4NDB A;  5HLV A;  2OS8 C;  3SG5 A;  2MRD A;  1W7J B;  2LUX A;  3SG2 A;  3ZWH A;  4GBA A;  2CBL A;  2K2A A;  4MZJ A;  1UUR A;  3NHT A;  1GM0 A;  1N0Y A;  2WC8 A;  3PFV A;  4HRE E;  1DF0 A;  1TIZ A;  4PHK A;  2AUC A;  2JNX A;  4U8D A;  1EG3 A;  2F3Y A;  3UNW A;  2F2P A;  2LE9 B;  1GJY A;  1TTX A;  2MHH A;  2FCE A;  2WOR A;  3CLN A;  3RM1 A;  1OSA A;  2FJU B;  5DKN A;  1F71 A;  1SYM A;  1K8U A;  1YUT A;  2KQY A;  4ORA B;  1EL4 A;  4HRG A;  1IIO A;  4GFT A;  4PE1 A;  3I5G C;  2JUL A;  4JKT A;  1IH0 A;  2I2R E;  3CR4 X;  4HSZ A;  1SCM B;  1UHI A;  2I94 A;  2MLF C;  1RRO A;  5FI2 A;  1ZOT B;  3D0Y A; 
#chains in the Genus database with same CATH homology
 5CSN A;  4MZK A;  1LA3 A;  1WLM A;  3JVT C;  1NP8 A;  2KQ6 A;  1MR8 A;  1TOP A;  3EKJ A;  2KGR A;  2PAS A;  1V1F A;  1NCX A;  1CM4 A;  1S36 A;  1RJV A;  1J7Q A;  2I7A A;  2JNF A;  4TNC A;  1KWO B;  3DD4 A;  2Y5I A;  1KQV A;  1PUL A;  4CPV A;  3I5I B;  1OZO A;  3VGO A;  1G33 A;  1KQM B;  3F45 A;  2K7O A;  1NYA A;  4PE4 A;  3SIB A;  4M2Q A;  1F54 A;  1PSB A;  1SW8 A;  1TCF A;  2LCP A;  2BBN A;  2BBM A;  2EC6 B;  1OMV A;  1BOD A;  4YI8 A;  1XA5 A;  2L4I A;  2SAS A;  3I5F C;  4P5O E;  4QJ4 B;  2L50 A;  2F3Z A;  3IQQ A;  3NXA A;  1C07 A;  3AKA A;  2BL0 B;  2M49 B;  1SPY A;  1ZMZ A;  3PSR A;  1DTL A;  4DS7 A;  2CTN A;  2LNK A;  3TZ1 A;  1BLQ A;  4I5J A;  1OZS A;  3ZNI A;  4FTG A;  1RWY A;  4USL A;  2NZ0 A;  1NX2 A;  2JTT A;  1NIW A;  1S6J A;  1QAT A;  1PAL A;  4ZCV A;  3BOW B;  3C1V A;  1K9K A;  5HLO A;  5AER A;  1K9U A;  2ZRS A;  2LC5 A;  1SBJ A;  1DJG A;  1NWD A;  4MVF A;  4MZL A;  5KU1 A;  4PAL A;  5IBW A;  3IF7 A;  1WRK A;  1B7T Z;  2Q91 A;  1L2O B;  1QVI Y;  4PCW A;  3VRQ A;  2LMT A;  2H61 C;  1D1O A;  4M2O A;  2AMI A;  4JPZ B;  3PAL A;  2M7L A;  2JQ6 A;  4MLW A;  2MA2 A;  1BJF A;  1FBV A;  2NLN A;  3WHT B;  3QRX A;  5ER5 A;  4UPG A;  2CT9 A;  2KI6 C;  4CFR A;  2CXJ A;  4AQI A;  1QX5 B;  5KSZ A;  1SCV A;  1JFJ A;  3LLE A;  4MRX A;  1B8L A;  1LKJ A;  1BF5 A;  1K9P A;  4WQ2 A;  1IG5 A;  1J7R A;  1J7O A;  1UHH A;  1FI6 A;  1UUS A;  3KO0 A;  4PHM A;  1OMR A;  3TDU A;  2M97 A;  1A03 A;  1MHO A;  2G9B A;  3O2P A;  1K2H A;  1BR4 B;  1NSH A;  2ZN9 A;  2PMY A;  4E68 A;  2O60 A;  5CSF A;  2KFH A;  1PRW A;  4OVN F;  1DF0 B;  1A29 A;  1UWO A;  1AJ4 A;  5F6T A;  3BUX B;  1QLK A;  4P2Y B;  4ZCU A;  2M8U A;  3AAJ A;  2E6W A;  2JRF A;  2LV7 A;  3JTD B;  2K2F A;  1U5I B;  2BE4 A;  2PVB A;  4N1G A;  1R6P A;  1GGW A;  1YTZ C;  1K95 A;  4DCK A;  1N2D A;  1FW4 A;  5I2L A;  1Y1X A;  2M1U A;  5D7F A;  1W7I B;  1YR5 A;  1J7P A;  3OHM B;  1SK6 D;  5HKW A;  1AHR A;  1XFU O;  1Y1U A;  2ZRT A;  1CLM A;  2L0P A;  1TRF A;  3D0Y B;  1HT9 A;  4DRW A;  4N5X A;  3SG6 A;  1JBA A;  1DJY A;  3I5H C;  2L51 A;  2B1U A;  1QS7 A;  1JWD A;  1DJI A;  2WND A;  5I2Q A;  1K93 D;  1KK7 Y;  4YGD B;  2LMU A;  1TNQ A;  5GQQ C;  1AVS A;  2MJW B;  1BMO A;  3E3R A;  1L7Z A;  1DMO A;  1XVJ A;  1A75 A;  1QVI Z;  1KQM C;  4JQ0 D;  1XFW O;  2H61 A;  2LMV A;  3DF0 A;  1SKT A;  3OP0 A;  4MRY A;  2KFF A;  1BG1 A;  1KSO A;  1LIN A;  1RFJ A;  1WRZ A;  1WDC C;  1OQP A;  3CGA A;  2HQ8 A;  1UP5 A;  1M46 A;  1KFU S;  3IQO A;  4PHN A;  4I5K A;  1QV0 A;  4NQG A;  4MSP A;  2G2B A;  1WLZ A;  5J3X A;  1M63 B;  3MSE B;  5JJG A;  1CFP A;  2LAP A;  1RK9 A;  1J1E A;  1JUO A;  5FYX A;  3TS5 B;  1FF1 A;  2JT3 A;  3PN7 B;  2LHI A;  1AUI B;  5I8N A;  1CLB A;  2JWW A;  1NCZ A;  2E30 A;  4XJK A;  1IWQ A;  1YX7 A;  4ORB B;  4PE7 A;  4WQ3 A;  1K94 A;  4MN0 A;  3GOF A;  3WXA A;  1DGV A;  4YBH B;  3SG4 A;  2Y1N A;  1QV1 A;  2P6B B;  3TUY B;  4C0K A;  4GNK B;  1LA0 A;  1WRL A;  2OS8 B;  3O78 A;  3BUM B;  4DIR A;  3AAK A;  4BY5 A;  3A4U B;  2KOT A;  2O5G A;  4MEW A;  1F55 A;  1G4Y R;  1GGZ A;  3OX5 A;  2LVI A;  3BYA A;  3PLF B;  2HET A;  1C7V A;  4ETO A;  2OTG C;  2JC2 A;  1SRA A;  2JT8 A;  4JWQ A;  1NX0 A;  1PVB A;  1F70 A;  4DUQ A;  2D8N A;  3EK4 A;  5KTY A;  4PE0 A;  4I5N B;  2ZND A;  5ER4 X;  1QIW A;  1QXP A;  1F4O A;  1NCY A;  1PSR A;  2NXQ A;  1ODB A;  3K21 A;  1QX2 A;  2I18 A;  1AK8 A;  2M29 A;  4A4C A;  3BQ3 A;  1YUR A;  1CTR A;  3JVT B;  1ZUZ A;  2LLS A;  1S1E A;  1B47 A;  1CFD A;  2LP2 A;  1KCY A;  1IJ5 A;  4I5L B;  4Q04 A;  2ISD A;  4C0J A;  4AOM A;  1CB1 A;  2AAO A;  4GPL B;  1TNX A;  2KBM A;  1KFX L;  1KK7 Z;  1REC A;  1SNL A;  1S6I A;  4MBE A;  2MLE C;  3HX4 A;  3PM8 A;  2BKI B;  1ALW A;  1M39 A;  3DVM A;  1J55 A;  2KI4 C;  2WOS A;  3O4Y A;  1CMG A;  2PRU A;  2HQW A;  2KYC A;  2GGZ A;  4OV2 A;  3TDI A;  3VRO A;  2CNP A;  4QJ5 B;  2M1K B;  2F8P A;  3H4S E;  3I5F B;  2EGD A;  3PAT A;  2NCO A;  1FI5 A;  2KFG A;  1NUB A;  1QX7 A;  3EKH A;  1UHK A;  3BUO B;  3DVK A;  2L2E A;  1MF8 B;  1FPW A;  3OB1 B;  3ICB A;  5CSI A;  2WCE A;  2JT0 A;  4ORC B;  1CDL A;  1CKK A;  2HPS A;  2M3W A;  1SL8 A;  1CFC A;  4GAO A;  5B8I B;  1KFX S;  1B4C A;  3BOW A;  3FWC A;  3FIA A;  1MWN A;  1XFY O;  2LHL A;  2ZNE A;  1TCO B;  2ZN8 A;  4YGE B;  1F8H A;  1ALV A;  1CDM A;  3FS7 A;  1SR6 B;  1PK0 D;  2IS9 A;  2BCA A;  1KFU L;  2JU0 A;  3LL8 B;  3CWG A;  3SG3 A;  3GK2 A;  1CDN A;  1LXF C;  1TNW A;  3GK4 X;  1SCM C;  1SL7 A;  3KPX A;  2LLU A;  4YI9 A;  2V53 A;  3CS1 A;  5PAL A;  2HF5 A;  2L98 A;  3EVU A;  3BUN B;  1B9A A;  1R2U A;  2KDH A;  3CZT X;  3EVV A;  2QPT A;  1XK4 C;  1Y1A A;  3VRR A;  1IQ3 A;  1KWO C;  1V1G A;  1XO5 A;  2Q4U A;  1QTX A;  3KF9 A;  3NSO A;  3TS5 C;  4CID A;  3I5I C;  1YVL A;  2BEC A;  2M7N A;  4YGC B;  1IKU A;  1S5G Y;  1YX8 A;  4OKH A;  4GGN A;  1E8A A;  2JXL A;  3KHE A;  3WHU B;  2H2K A;  1KK8 B;  1B7T Y;  2A4J A;  5HYD A;  2EC6 C;  2BKH B;  2BCX A;  4F0Z B;  4XYN A;  1J1D A;  4C0L A;  3TUY C;  1YUS A;  4PHJ A;  1NX3 A;  2GV5 A;  3A8R A;  1A4P A;  1Y6W A;  1TN4 A;  1B8C A;  2K7D A;  2BL0 C;  2LM5 A;  2PAL A;  4QJ3 B;  2TN4 A;  1YRU B;  1U5I A;  1MUX A;  1DJH A;  1XFZ O;  3DVJ A;  1H8B A;  4AQJ A;  1IQ5 A;  1JF0 A;  1YUU A;  1NX1 A;  1JC2 A;  1YVH A;  1CFF A;  2F2O A;  3EVR A;  4NDD A;  5D69 A;  2WCF A;  2GGM A;  1IRJ A;  1YRT B;  3KEV A;  1L2O C;  1WY9 A;  2K61 A;  1CNP A;  5AXI A;  2QAC A;  3OB2 B;  3I5H B;  2LLT A;  5CSJ A;  2PSR A;  1SMG A;  3SJS A;  4PDZ A;  5TNC A;  3RLZ A;  3VRP A;  1N65 A;  2Y1M A;  1PVA A;  1UHJ A;  3CR5 X;  3SG7 A;  1DJZ A;  1LVC D;  2F33 A;  1QJT A;  2KSP A;  4IL1 A;  2CCM A;  2L5X B;  4YGA A;  2KYF A;  3LK0 A;  4CFQ A;  1B1G A;  1CDP A;  3DVE A;  1F4Q A;  3I5G B;  2K7B A;  2KNE A;  1M45 A;  2COL B;  2MAZ A;  4N1F A;  1TNP A;  2VRG A;  1WDC B;  3M0W A;  2NCP A;  2Y4Q A;  5AEQ A;  2JZI A;  2K7C A;  2EHB A;  1CM1 A;  1X02 A;  1XYD A;  3BXK A;  1S6C A;  1Q80 A;  2KGB C;  2LP3 A;  1CMF A;  4YGB B;  2SCP A;  1OE9 B;  2DOQ A;  4YRU A;  1AJ5 A;  1BU3 A;  1GQM A;  1XK4 A;  2FOT A;  1H4B A;  5DKQ A;  3SIA A;  4GUK A;  2JTZ A;  2WCB A;  2L4H A;  3NSI A;  1VRK A;  2BE6 A;  1DGU A;  1S5G Z;  2M0R A;  5CPV A;  5AFP A;  1S3P A;  1RTP 1;  2K0J A;  1XFX O;  5K89 A;  3D10 A;  4GGF A;  2FCD A;  1K96 A;  1DJX A;  1QLS A;  3JTD C;  1A2X A;  2MBX A;  1EH2 A;  1SR6 C;  2KHN A;  1G8I A;  5I2O A;  4R1E A;  2KAV A;  1XFV O;  1Y0V H;  3O6B A;  1JSA A;  3CTN A;  1B8R A;  1IJ6 A;  2LVV A;  1SL9 A;  3EK8 A;  4FQO A;  4CLN A;  3LK1 A;  2OTG B;  2OPO A;  1ZFS A;  1UHN A;  5BPJ A;  1EG4 A;  4OCI A;  1BT6 A;  2RGI A;  3CR2 A;  1EJ3 A;  1DJW A;  2K8M B;  3BUW B;  4ICB A;  2LAN A;  5HKZ A;  1DVI A;  3OX6 A;  3VRN A;  5DKR A;  1OOJ A;  2JXC A;  2M9G A;  4OR9 B;  1MQ1 A;  5G08 A;  4HRH A;  1A75 B;  1BOC A;  2LVJ A;  5JOL A;  2R2I A;  1HQV A;  1MXE A;  3DF0 B;  1MXL C;  1DT7 B;  1CLL A;  2ZKM X;  3NSK A;  4M2P A;  3HCM A;  1NPQ A;  1KK8 C;  1QIV A;  2KAX A;  2LVK A;  1BR1 B;  1KSM A;  2BCB A;  2KBI A;  2KI4 B;  4BY4 A;  1OMD A;  1IGV A;  3FWB A;  4D1E A;  4WRI A;  2KAY A;  3AKB A;  2ZFD A;  5AAN A;  1C7W A;  4NDC A;  4A4B A;  3TDZ A;  3LCP C;  1QAS A;  3PN7 C;  3GK1 A;  3WNX B;  1EXR A;  1JF2 A;  2KI6 D;  2JOJ A;  4XJK B;  1SY9 A;  1S26 D;  3EK7 A;  3NSL A;  1AP4 A;  1M31 A;  2JPT A;  1K90 D;  4GGF C;  1ZAC A;  4L9M A;  2LUC A;  5HKY A;  1JFK A;  5HLV A;  4NDB A;  3SG5 A;  2OS8 C;  3ZWH A;  2MRD A;  1W7J B;  2LUX A;  3SG2 A;  4GBA A;  2CBL A;  2K2A A;  4MZJ A;  1UUR A;  1N0Y A;  2WC8 A;  3PFV A;  4HRE E;  1DF0 A;  1TIZ A;  4PHK A;  2AUC A;  2JNX A;  4U8D A;  1EG3 A;  2F3Y A;  2F2P A;  2LE9 B;  1GJY A;  1TTX A;  2MHH A;  2FCE A;  2WOR A;  3CLN A;  3RM1 A;  1OSA A;  2FJU B;  5DKN A;  1F71 A;  1SYM A;  1K8U A;  1YUT A;  2KQY A;  4ORA B;  1EL4 A;  4HRG A;  4GFT A;  4PE1 A;  3I5G C;  2JUL A;  1IH0 A;  2I2R E;  3CR4 X;  4HSZ A;  1SCM B;  1UHI A;  2I94 A;  2MLF C;  1RRO A;  1ZOT B;  3D0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...