2KYCA

Solution structure of ca-free chicken parvalbumin 3 (cpv3)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
108
structure length
108
Chain Sequence
SLTDILSPSDIAAALRDCQAPDSFSPKKFFQISGMSKKSSSQLKEIFRILDNDQSGFIEEDELKYFLQRFESGARVLTASETKTFLAAADHDGDGKIGAEEFQEMVQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin, thymic CPV3
publication title Solution structures of chicken parvalbumin 3 in the Ca(2+) -free and Ca(2+) -bound states.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium binding protein
total genus 10
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2010-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kycA00
4MN0A 1A2XA 1EJ3A 3PLFB 4C0LA 1DGVA 1YVHA 3OX5A 3ZWHA 1NX2A 4MEWA 5KSZA 1WRZA 2RGIA 5D7FA 1S1EA 1B7TY 1KFXL 1SYMA 2L4HA 1M63B 3DVJA 1B47A 2BL0B 4OV2A 1K9UA 1N0YA 1VRKA 2COLB 1ODBA 1BLQA 1M31A 1A29A 2H61A 2LUXA 2MLEC 2HQ8A 2I2RE 4IL1A 3O2PA 1JF2A 2M8UA 2KDHA 5AANA 4ICBA 1KQVA 5FYXA 1M45A 5ER5A 1F4QA 2I7AA 1GQMA 1YUSA 1AJ5A 3AKBA 3PSRA 3CLNA 1GGZA 1MUXA 1CMGA 1IH0A 1SY9A 1J7OA 1IJ5A 1Q80A 2GGZA 1XFUO 1G4YR 2KYCA 1KWOB 4OCIA 4XJKB 3SJSA 1B1GA 3RM1A 1U5IA 1B8RA 3EK7A 1K96A 1S3PA 1K2HA 4OKHA 1IWQA 2WNDA 1AVSA 1UURA 1E8AA 1KCYA 2LMVA 3BOWB 1SR6C 5I2QA 1N2DA 4MRXA 1KQMC 2JXCA 1ZUZA 3C1VA 1YRUB 4HRHA 2MAZA 3I5GB 3LCPC 2F2OA 2JOJA 2EC6B 3A4UB 1EG3A 2KFFA 3SIAA 1XO5A 5GQQC 4N1FA 3O4YA 1KK8C 5DKRA 3I5FC 1J1EA 3DF0B 3JVTB 1QV0A 4YGCB 2L5XB 2FCEA 3OP0A 2BE6A 1HT9A 1EH2A 4UPGA 2FJUB 3VGOA 2F8PA 2KFHA 1XYDA 5HKWA 1F55A 1FF1A 1DF0B 4DRWA 1DJGA 4I5JA 1JWDA 3CS1A 4WRIA 4MBEA 4AQJA 2BCAA 1S36A 2K8MB 4ORBB 2LHIA 1CM1A 2B1UA 4QJ5B 3GK1A 1IJ6A 1RK9A 3JTDB 4USLA 2IS9A 4P5OE 1XFZO 2KQ6A 4GBAA 3AKAA 3I5IC 1JFJA 1TTXA 1SKTA 2F33A 1MR8A 2O60A 3EK8A 1OMRA 1EXRA 1NPQA 2L98A 1FBVA 1B9AA 5PALA 4PE7A 1C7WA 3GOFA 1XK4A 2K61A 1SNLA 3NXAA 4PHKA 3TS5B 2M3WA 3KPXA 1L2OB 4DIRA 2Y1NA 1XFYO 4N1GA 5KU1A 2K2AA 1HQVA 1LA3A 1BR1B 1OQPA 4MLWA 1UHHA 1NX0A 4M2OA 5AEQA 2JT8A 3LL8B 4P2YB 4JWQA 4NDCA 4A4BA 2LMUA 2OTGB 1J7QA 2ZN8A 1DJYA 1YRTB 1NX3A 1UWOA 2NCPA 3EVUA 1SCMC 1BR4B 2JRFA 4PALA 4PDZA 4JPZB 1S6CA 1TCOB 5DKNA 1LXFC 1TCFA 4L9MA 1ZACA 2O5GA 5BPJA 3SIBA 3IF7A 2MLFC 1CLLA 2JZIA 3BUWB 2NCOA 4MSPA 4E68A 3BUXB 3DVMA 2MRDA 1SCVA 2F3ZA 1NWDA 1UP5A 1ALVA 2I18A 3VRPA 4YGEB 1DJXA 3FIAA 2R2IA 2Q91A 1K9PA 3I5HC 4M2PA 1BU3A 1K93D 4GPLB 4JQ0D 5CSIA 2BECA 4C0KA 3EVRA 2LM5A 2EGDA 3BUMB 2AAOA 2M9GA 1CM4A 1WY9A 1JC2A 3OHMB 3WHTB 2P6BB 4MVFA 1SL8A 2A4JA 3F45A 4HREE 4YI9A 1QIVA 1QVIY 3BQ3A 3DVKA 5CPVA 4Q04A 4YI8A 1BJFA 1CKKA 4GGFA 3PM8A 4XJKA 1CB1A 4BY5A 1XFVO 2ZRSA 3D0YB 1RFJA 1F8HA 1W7IB 1L7ZA 1SMGA 2HPSA 1OSAA 2MHHA 1PVBA 1YUUA 3BOWA 3CZTX 2ZNEA 3BXKA 1OE9B 2LVJA 2CXJA 2JTTA 2M7LA 2H61C 3SG3A 2KAYA 1TRFA 3IQQA 4PCWA 5JJGA 2KBMA 1KFXS 1LVCD 3DD4A 2OPOA 3EK4A 3LLEA 1IGVA 1GJYA 2M49B 1CNPA 2LHLA 5D69A 1DJHA 3VRRA 3QRXA 1RECA 1SR6B 2AMIA 1DJIA 2PMYA 2HETA 2OS8C 4DUQA 2KI4C 1KQMB 1TNWA 3OB1B 1YUTA 4N5XA 2NZ0A 3OB2B 4I5KA 1TNPA 2K2FA 1QXPA 1FW4A 3PN7C 3DVEA 1QV1A 2E30A 3DF0A 1MWNA 5JOLA 3VRQA 2LVIA 3EVVA 2M1KB 2HF5A 1CDPA 2ZRTA 1B4CA 2LC5A 4AQIA 2ZN9A 1CTRA 1IG5A 3EKHA 1PALA 3VRNA 1J7RA 4WQ2A 2K7CA 4PHMA 3I5FB 1IKUA 3D10A 4MZJA 3NSLA 5CSNA 3LK1A 1WDCC 2LLSA 1DJWA 4GGNA 1B8LA 1CFFA 1MF8B 4CPVA 2KQYA 2WOSA 5AERA 1UUSA 1QX2A 2M29A 5HKZA 5TNCA 1NX1A 3O78A 1Y6WA 4HSZA 2PSRA 5IBWA 3KO0A 4ORAB 1WRLA 3SG2A 2KAVA 1KFUL 1RJVA 2M97A 1SL7A 4TNCA 3PFVA 2MJWB 1CDNA 1FPWA 3I5IB 2LP2A 3WNXB 4FTGA 2CNPA 4NQGA 1A4PA 1K90D 2M1UA 2WCEA 3OX6A 1S5GZ 2JT3A 1F70A 2M7NA 4QJ4B 2I94A 3NSIA 5KTYA 1XFXO 5I2OA 1JSAA 4F0ZB 3AAKA 1CDMA 1D1OA 1RWYA 2GGMA 2HQWA 4FQOA 4D1EA 2PVBA 4ORCB 1KK7Z 3SG4A 1PSBA 1MXLC 3TDUA 1JBAA 4I5NB 1LKJA 2KNEA 2WCFA 4XYNA 1DJZA 1OOJA 2LP3A 2F2PA 2LMTA 1B7TZ 1FI5A 4QJ3B 1BG1A 3RLZA 3TUYC 1Y1UA 1AJ4A 1WRKA 1XK4C 2G9BA 3A8RA 3TZ1A 1CLMA 4C0JA 1AK8A 1C7VA 4MZKA 3PALA 1QX5B 1BOCA 1SCMB 2LANA 1R2UA 2JTZA 4WQ3A 1Y0VH 4R1EA 1NUBA 2WORA 2ZFDA 1XA5A 1KSOA 4OVNF 1PSRA 1NCYA 1V1FA 1S6IA 5G08A 1CFPA 1OMVA 3EKJA 1XFWO 3WHUB 3BUOB 1ZOTB 1UHNA 3HX4A 5AXIA 1A75B 1WLMA 2F3YA 1QTXA 4CIDA 2EHBA 2CCMA 2Y1MA 2BCXA 2BCBA 1S5GY 1YX8A 2KHNA 1W7JB 3I5HB 2JU0A 1QX7A 2L2EA 2KBIA 4DS7A 3TDIA 2PRUA 1ZMZA 3D0YA 2L51A 2LVVA 1EL4A 2KI6C 2WC8A 4OR9B 5ER4X 1DGUA 1KK7Y 2GV5A 4PE0A 3CR4X 4NDDA 4ZCVA 2BE4A 2BL0C 3CTNA 4PE1A 5F6TA 4ZCUA 1SPYA 3H4SE 4AOMA 2NLNA 1QATA 3IQOA 5I2LA 1WLZA 2KGRA 2CTNA 3ZNIA 2LV7A 5CSFA 1DMOA 1MQ1A 1H4BA 1Y1AA 1NSHA 2LVKA 3FWBA 1M39A 1CFDA 1YTZC 2SASA 4GAOA 1X02A 1QLKA 2JXLA 4MRYA 1CFCA 4PE4A 1OMDA 2G2BA 3KF9A 4NDBA 5HLOA 2AUCA 2DOQA 1KWOC 2KI6D 2JQ6A 1SL9A 4BY4A 4GGFC 1MXEA 1ZFSA 1N65A 2VRGA 1RTP1 1F4OA 1DTLA 2KYFA 1J7PA 1K94A 1PVAA 1SK6D 1XVJA 2K7BA 2K7OA 1OZOA 1RROA 4YGBB 4YRUA 1EG4A 2OS8B 3BYAA 2KI4B 3SG7A 4I5LB 2L50A 2ISDA 3K21A 4ETOA 1CDLA 1TNXA 3KHEA 3BUNB 1NIWA 1U5IB 1MHOA 3PN7B 1S26D 2BKHB 2Y4QA 4YBHB 3O6BA 1JFKA 2K0JA 1NYAA 3I5GC 1IQ5A 1K95A 2QACA 5AFPA 1KK8B 3NSOA 4YGDB 2SCPA 1G8IA 4U8DA 2NXQA 1DF0A 2EC6C 1UHIA 4PHNA 1DVIA 1F71A 2KSPA 1AUIB 1SRAA 3WXAA 2L0PA 4GUKA 1H8BA 3FWCA 1WDCB 3VROA 1LA0A 1QS7A 1R6PA 2LLTA 2QPTA 3JVTC 1C07A 1F54A 1YR5A 4YGAA 3TDZA 2LNKA 2LUCA 1YX7A 3SG5A 5B8IB 1AP4A 2LE9B 1BMOA 2JC2A 1TNQA 3HCMA 1KSMA 1NCZA 2KGBC 2ZKMX 1JUOA 3E3RA 3CGAA 1PULA 4DCKA 2BKIB 1CMFA 4PHJA 3GK2A 3JTDC 1M46A 3SG6A 4CLNA 5K89A 1NP8A 2Y5IA 2KAXA 4GFTA 1QASA 5CSJA 2KOTA 2FCDA 2H2KA 2FOTA 1B8CA 2WCBA 3ICBA 1UHJA 2JPTA 3NSKA 1G33A 3KEVA 1YVLA 1QLSA 1TOPA 2JNXA 1QIWA 1LINA 5DKQA 3TS5C 1Y1XA 1BT6A 1PRWA 1L2OC 1PK0D 3LK0A 4A4CA 1FI6A 2Q4UA 2BBNA 2JT0A 2PALA 3MSEB 3AAJA 3PATA 4M2QA 1AHRA 2JULA 2TN4A 5HKYA 1QJTA 4GNKB 5I8NA 1J1DA 2E6WA 2MA2A 3TUYB 3CWGA 1SW8A 4CFQA 2JWWA 2L4IA 4HRGA 1KFUS 1QVIZ 3FS7A 2PASA 2LCPA 1OZSA 3CR5X 2CT9A 5HLVA 2MBXA 2OTGC 1ALWA 1IRJA 3CR2A 1A75A 2LLUA 5J3XA 2K7DA 1JF0A 2LAPA 3M0WA 1GGWA 1K9KA 1TIZA 2D8NA 4CFRA 1IQ3A 2ZNDA 5HYDA 2M0RA 1CLBA 3GK4X 1UHKA 1K8UA 2CBLA 1V1GA 2V53A 1NCXA 2BBMA 1S6JA 1A03A 2JNFA 1J55A 1SBJA 1DT7B 1YURA 2KFGA 1TN4A 1BF5A 1BODA 4MZLA
chains in the Genus database with same CATH superfamily
4MN0A 1A2XA 1EJ3A 1SSEB 3PLFB 4C0LA 1DGVA 1YVHA 3OX5A 3Q8IA 1NX2A 4MEWA 3ZWHA 1WRZA 5KSZA 2RGIA 3B7AA 5FI2A 5D7FA 1S1EA 1B7TY 1KFXL 1SYMA 3BFHA 2L4HA 1M63B 3DVJA 5I94A 1B47A 2BL0B 4OV2A 1K9UA 1N0YA 1VRKA 2COLB 3PJIA 1ODBA 1BLQA 1M31A 1A29A 2H61A 2LUXA 2MLEC 2HQ8A 2I2RE 4IL1A 3O2PA 1JF2A 2M8UA 2KDHA 5AANA 4ICBA 1KQVA 5FYXA 1M45A 5ER5A 1F4QA 3RZSA 2I7AA 1GQMA 1YUSA 1AJ5A 3AKBA 3CZ1A 3CLNA 3PSRA 1GGZA 1MUXA 1CMGA 1IH0A 1SY9A 1J7OA 1IJ5A 1Q80A 2GGZA 1XFUO 3R1VA 1G4YR 2KYCA 1KWOB 4OCIA 4XJKB 3SJSA 1B1GA 3RM1A 2PQLA 1U5IA 1B8RA 3D76A 3EK7A 3R1PA 1K96A 1S3PA 1K2HA 4OKHA 1IWQA 2WNDA 1AVSA 1UURA 1E8AA 1KCYA 2JPOA 2LMVA 3BOWB 4JKTA 1SR6C 5I2QA 1N2DA 4MRXA 1KQMC 2JXCA 1ZUZA 2WCJA 1YRUB 3C1VA 4HRHA 4PT1A 2MAZA 3I5GB 3LCPC 2F2OA 2JOJA 2EC6B 3A4UB 1EG3A 3CYZA 2KFFA 3SIAA 1XO5A 3S0GA 3D74A 5GQQC 1QWVA 4N1FA 3O4YA 1KK8C 2QEOA 4JD9A 2KLEA 5DKRA 3I5FC 1J1EA 3DF0B 3JVTB 1QV0A 4YGCB 2L5XB 2FCEA 3OP0A 2BE6A 1HT9A 2P70A 1EH2A 4UPGA 2FJUB 3VGOA 2F8PA 2KFHA 3D78A 1XYDA 5HKWA 1ORGA 1F55A 1FF1A 1DF0B 4DRWA 1DJGA 4I5JA 2K60A 1JWDA 3CS1A 4WRIA 4MBEA 4AQJA 2BCAA 1S36A 2K8MB 4ORBB 2LHIA 1CM1A 2B1UA 4QJ5B 3GK1A 1IJ6A 1RK9A 3JTDB 4USLA 2IS9A 4P5OE 3D73A 1DQEA 1XFZO 3BJHA 2KQ6A 4GBAA 3AKAA 3I5IC 1JFJA 1TTXA 1SKTA 1OOGA 2F33A 1MR8A 2O60A 3CZ0A 1OMRA 3EK8A 1TUJA 2L5YA 1EXRA 1NPQA 2L98A 5HL1A 1FBVA 1B9AA 5PALA 4PE7A 1C7WA 3GOFA 1XK4A 2K61A 1SNLA 3B6XA 3NXAA 4PHKA 3TS5B 2M3WA 3KPXA 1L2OB 4DIRA 2Y1NA 1XFYO 4N1GA 5KU1A 2K2AA 1HQVA 1LA3A 1BR1B 1OQPA 4MLWA 1UHHA 2WC6A 1NX0A 4M2OA 5AEQA 4INXA 2JT8A 3LL8B 4P2YB 4JWQA 3FE8A 4NDCA 4A4BA 2LMUA 1LS8A 2OTGB 1J7QA 2ZN8A 1DJYA 1YRTB 1NX3A 1UWOA 2NCPA 1DEKA 3EVUA 2WCKA 1SCMC 1BR4B 2JRFA 3DY9A 4PALA 4PDZA 4FQTA 4JPZB 1S6CA 4IJ7A 1TCOB 5DKNA 1LXFC 5FI7A 1TCFA 4L9MA 1ZACA 2O5GA 5BPJA 3SIBA 3IF7A 2MLFC 1CLLA 2JZIA 3BUWB 2NCOA 4MSPA 4E68A 3BUXB 3DVMA 2MRDA 1SCVA 2F3ZA 3K1EA 1NWDA 1UP5A 1ALVA 2I18A 3VRPA 4YGEB 1DJXA 3FIAA 2R2IA 2Q91A 1K9PA 1GM0A 3I5HC 4M2PA 1BU3A 1K93D 4GPLB 4JQ0D 5CSIA 2BECA 4C0KA 3EVRA 2LM5A 2EGDA 3BUMB 2YGUA 2AAOA 2M9GA 2P71A 1CM4A 1WY9A 1JC2A 3OHMB 3WHTB 2P6BB 4MVFA 1SL8A 2A4JA 3F45A 4HREE 4YI9A 1QIVA 3BFAA 1QVIY 1OOIX 3BQ3A 3DVKA 5CPVA 4Q04A 4YI8A 1BJFA 1CKKA 4GGFA 3PM8A 4XJKA 1CB1A 4BY5A 1XFVO 2ZRSA 3D0YB 1RFJA 1F8HA 1W7IB 1L7ZA 1SMGA 2HPSA 1OSAA 2MHHA 1TWOA 1PVBA 1OOHA 1YUUA 3BOWA 3CZTX 2ZNEA 3BXKA 1OE9B 2LVJA 2CXJA 2JTTA 2M7LA 2H61C 3SG3A 2KAYA 1TRFA 3IQQA 4PCWA 5JJGA 1DC1A 2KBMA 1KFXS 1LVCD 3DD4A 2OPOA 3EK4A 3LLEA 1IGVA 1GJYA 2M49B 1CNPA 2LHLA 1TUZA 5D69A 1DJHA 3VRRA 3QRXA 1RECA 1SR6B 2AMIA 1DJIA 2PMYA 2HETA 2OS8C 4DUQA 2KI4C 1KQMB 1TNWA 3OB1B 1YUTA 4N5XA 2NZ0A 3OB2B 4I5KA 1TNPA 2K2FA 1QXPA 1FW4A 2WC5A 3DVEA 1QV1A 3PN7C 2E30A 3DF0A 1MWNA 5JOLA 3VRQA 2LVIA 3EVVA 2M1KB 2HF5A 1CDPA 2FJYA 2WCHA 2ZRTA 1B4CA 3CABA 2LC5A 4AQIA 2ZN9A 1CTRA 1IG5A 3CDNA 3EKHA 1PALA 3VRNA 3S0FA 1J7RA 4WQ2A 2K7CA 4PHMA 3I5FB 1IKUA 3D10A 2GTEA 4MZJA 3NSLA 5CSNA 3LK1A 1WDCC 2LLSA 1DJWA 4GGNA 1B8LA 3FE9A 1CFFA 1MF8B 3FE6A 2KQYA 2WOSA 4CPVA 5AERA 1UUSA 1QX2A 2M29A 5HKZA 5TNCA 1NX1A 3O78A 1Y6WA 4HSZA 2PSRA 3R1OA 5IBWA 3KO0A 4ORAB 1WRLA 3SG2A 2KAVA 1KFUL 1RJVA 2M97A 1SL7A 4TNCA 3PFVA 2MJWB 1CDNA 1FPWA 3I5IB 2LP2A 3WNXB 4FTGA 5EL2A 2CNPA 2KLDA 1A4PA 3DXLA 4NQGA 1K90D 2M1UA 2WCEA 3OX6A 1S5GZ 2JT3A 3D75A 1F70A 2M7NA 4QJ4B 2I94A 3NSIA 1DELA 5KTYA 1XFXO 3L4AA 3L4LA 5I2OA 1JSAA 4F0ZB 3AAKA 1CDMA 1D1OA 1RWYA 2GGMA 2HQWA 4FQOA 4D1EA 2PVBA 4ORCB 1KK7Z 3SG4A 1PSBA 1MXLC 3TDUA 1JBAA 4I5NB 1LKJA 2KNEA 2WCFA 4XYNA 1DJZA 1OOJA 2LP3A 2F2PA 2LMTA 1B7TZ 1FI5A 4QJ3B 1BG1A 3RLZA 3TUYC 1Y1UA 1AJ4A 3B88A 1WRKA 1XK4C 2G9BA 3A8RA 3TZ1A 1CLMA 4C0JA 1AK8A 1C7VA 4MZKA 3PALA 1QX5B 1BOCA 1SCMB 2LANA 1R2UA 1OOFA 2JTZA 4WQ3A 1Y0VH 4R1EA 1NUBA 2WORA 2ZFDA 5DICA 1XA5A 1KSOA 5D3OA 4OVNF 1PSRA 1NCYA 1V1FA 3BFBA 1S6IA 5G08A 1CFPA 1OMVA 3EKJA 1XFWO 3WHUB 3BUOB 1ZOTB 1IIOA 1UHNA 3HX4A 5AXIA 1A75B 4F7FA 1WLMA 2F3YA 1QTXA 4CIDA 2EHBA 1XFRA 2CCMA 2Y1MA 2BCXA 2BCBA 1S5GY 1YX8A 2KHNA 1W7JB 3I5HB 2JU0A 2BNXA 1QX7A 2L2EA 2KBIA 4DS7A 3TDIA 2PRUA 2BAPA 3OBVA 3S0AA 1ZMZA 3D0YA 2L51A 2LVVA 3DZTA 1EL4A 2KI6C 2WC8A 4OR9B 5ER4X 4INWA 2QEVA 1DGUA 1KK7Y 2GV5A 4PE0A 3CR4X 4NDDA 4ZCVA 3UO9A 2BE4A 2BL0C 3CTNA 4PE1A 5F6TA 4ZCUA 1SPYA 3H4SE 1Z2CB 4AOMA 2NLNA 1QATA 3IQOA 2L2CA 5I2LA 1WLZA 5FI6A 2KGRA 2CTNA 3ZNIA 2LV7A 3VB1A 5CSFA 2WCMA 1DMOA 1MQ1A 1H4BA 1Y1AA 1NSHA 2LVKA 3FWBA 1M39A 1CFDA 1YTZC 2QDIA 2SASA 1X02A 4GAOA 1QLKA 3SS5A 2JXLA 4MRYA 1CFCA 4PE4A 1OMDA 2G2BA 3IVTA 3EG5B 3KF9A 3NHIA 4NDBA 5HLOA 2AUCA 2DOQA 1KWOC 2KI6D 2JQ6A 1SL9A 4BY4A 4GGFC 2PYQA 3B86A 1MXEA 1ZFSA 2H8VA 1N65A 2VRGA 1RTP1 1F4OA 1DTLA 2KYFA 1J7PA 1OW4A 1K94A 1PVAA 1SK6D 1XVJA 2K7BA 2K7OA 1OZOA 1RROA 4YGBB 4YRUA 1EG4A 2OS8B 3UNWA 3BYAA 2KI4B 3SG7A 4I5LB 2L50A 2ISDA 3K21A 4ETOA 1CDLA 1TNXA 3KHEA 3BUNB 3PM2A 1NIWA 1U5IB 1MHOA 3SS3A 3PN7B 1S26D 2BKHB 2Y4QA 4YBHB 3O6BA 1JFKA 2K0JA 1NYAA 3I5GC 3QMEA 1Z4HA 1IQ5A 1K95A 2QACA 5AFPA 3SS4A 1KK8B 3NSOA 4YGDB 2SCPA 1G8IA 2QEHA 4U8DA 2NXQA 1DF0A 2EC6C 1UHIA 4PHNA 1DVIA 1F71A 1C3ZA 2KSPA 4KYNA 1AUIB 1SRAA 3WXAA 2L0PA 4GUKA 1H8BA 3FWCA 1WDCB 3VROA 1LA0A 1QS7A 1R6PA 2LLTA 2QPTA 3JVTC 1C07A 1F54A 1YR5A 4YGAA 3TDZA 2LNKA 2LUCA 1YX7A 3SG5A 5B8IB 1AP4A 2LE9B 1BMOA 2JC2A 1TNQA 3HCMA 1KSMA 1NCZA 2KGBC 3CZ2A 3S0BA 2ZKMX 3V2LA 1JUOA 3E3RA 3CGAA 1PULA 4DCKA 2BKIB 3NHTA 1CMFA 4PHJA 3GK2A 3JTDC 1M46A 3SG6A 4CLNA 3DYEA 3D77A 2WCLA 5K89A 1C3YA 1NP8A 2Y5IA 3S0EA 3NGVA 2KAXA 4GFTA 1QASA 2ERBA 2KOTA 5CSJA 3S0DA 1W9ZA 2FCDA 2H2KA 2FOTA 1B8CA 2WCBA 3ICBA 1UHJA 2JPTA 3NSKA 1G33A 3KEVA 2KPHA 3O4XA 1YVLA 1QLSA 1TOPA 1T14A 2JNXA 1QIWA 1LINA 5DKQA 3TS5C 1Y1XA 1BT6A 1PRWA 1L2OC 1PK0D 3LK0A 4A4CA 1FI6A 1P28A 2BBNA 2JT0A 2PALA 2Q4UA 3AAJA 3MSEB 3PATA 4M2QA 1AHRA 2JULA 2TN4A 5HKYA 1QJTA 4GNKB 5I8NA 1J1DA 2E6WA 2MA2A 3TUYB 3CWGA 1SW8A 4CFQA 2JWWA 2L4IA 4HRGA 1KFUS 1QVIZ 3FS7A 2PASA 2LCPA 1OZSA 3CR5X 2CT9A 5HLVA 2MBXA 2OTGC 1ALWA 1IRJA 3CR2A 1A75A 2LLUA 5J3XA 2K7DA 1JF0A 2LAPA 3OGNA 3M0WA 1GGWA 1K9KA 3B87A 1TIZA 2D8NA 4CFRA 1IQ3A 2ZNDA 5HYDA 2M0RA 1CLBA 3GK4X 1UHKA 1K8UA 3L47A 3N7HA 2CBLA 2QEBA 1V1GA 2V53A 1NCXA 2BBMA 1S6JA 1A03A 2JNFA 1J55A 1SBJA 3R72A 1DT7B 1YURA 2KFGA 4OZDA 1TN4A 1BF5A 1BODA 4MZLA
chains in the Genus database with same CATH topology
4MN0A 1A2XA 1EJ3A 3PLFB 4C0LA 1DGVA 1YVHA 3OX5A 3ZWHA 1NX2A 4MEWA 5KSZA 1WRZA 2RGIA 5D7FA 1S1EA 1B7TY 1KFXL 1SYMA 2L4HA 1M63B 3DVJA 1B47A 2BL0B 4OV2A 1K9UA 1N0YA 1VRKA 2COLB 1ODBA 1BLQA 1M31A 1A29A 2H61A 2LUXA 2MLEC 2HQ8A 2I2RE 4IL1A 3O2PA 1JF2A 2M8UA 2KDHA 5AANA 4ICBA 1KQVA 5FYXA 1M45A 5ER5A 1F4QA 2I7AA 1GQMA 1YUSA 1AJ5A 3AKBA 3PSRA 3CLNA 1GGZA 1MUXA 1CMGA 1IH0A 1SY9A 1J7OA 1IJ5A 1Q80A 2GGZA 1XFUO 1G4YR 2KYCA 1KWOB 4OCIA 4XJKB 3SJSA 1B1GA 3RM1A 1U5IA 1B8RA 3EK7A 1K96A 1S3PA 1K2HA 4OKHA 1IWQA 2WNDA 1AVSA 1UURA 1E8AA 1KCYA 2LMVA 3BOWB 1SR6C 5I2QA 1N2DA 4MRXA 1KQMC 2JXCA 1ZUZA 3C1VA 1YRUB 4HRHA 2MAZA 3I5GB 3LCPC 2F2OA 2JOJA 2EC6B 3A4UB 1EG3A 2KFFA 3SIAA 1XO5A 5GQQC 4N1FA 3O4YA 1KK8C 5DKRA 3I5FC 1J1EA 3DF0B 3JVTB 1QV0A 4YGCB 2L5XB 2FCEA 3OP0A 2BE6A 1HT9A 1EH2A 4UPGA 2FJUB 3VGOA 2F8PA 2KFHA 1XYDA 5HKWA 1F55A 1FF1A 1DF0B 4DRWA 1DJGA 4I5JA 1JWDA 3CS1A 4WRIA 4MBEA 4AQJA 2BCAA 1S36A 2K8MB 4ORBB 2LHIA 1CM1A 2B1UA 4QJ5B 3GK1A 1IJ6A 1RK9A 3JTDB 4USLA 2IS9A 4P5OE 1XFZO 2KQ6A 4GBAA 3AKAA 3I5IC 1JFJA 1TTXA 1SKTA 2F33A 1MR8A 2O60A 3EK8A 1OMRA 1EXRA 1NPQA 2L98A 1FBVA 1B9AA 5PALA 4PE7A 1C7WA 3GOFA 1XK4A 2K61A 1SNLA 3NXAA 4PHKA 3TS5B 2M3WA 3KPXA 1L2OB 4DIRA 2Y1NA 1XFYO 4N1GA 5KU1A 2K2AA 1HQVA 1LA3A 1BR1B 1OQPA 4MLWA 1UHHA 1NX0A 4M2OA 5AEQA 2JT8A 3LL8B 4P2YB 4JWQA 4NDCA 4A4BA 2LMUA 2OTGB 1J7QA 2ZN8A 1DJYA 1YRTB 1NX3A 1UWOA 2NCPA 3EVUA 1SCMC 1BR4B 2JRFA 4PALA 4PDZA 4JPZB 1S6CA 1TCOB 5DKNA 1LXFC 1TCFA 4L9MA 1ZACA 2O5GA 5BPJA 3SIBA 3IF7A 2MLFC 1CLLA 2JZIA 3BUWB 2NCOA 4MSPA 4E68A 3BUXB 3DVMA 2MRDA 1SCVA 2F3ZA 1NWDA 1UP5A 1ALVA 2I18A 3VRPA 4YGEB 1DJXA 3FIAA 2R2IA 2Q91A 1K9PA 3I5HC 4M2PA 1BU3A 1K93D 4GPLB 4JQ0D 5CSIA 2BECA 4C0KA 3EVRA 2LM5A 2EGDA 3BUMB 2AAOA 2M9GA 1CM4A 1WY9A 1JC2A 3OHMB 3WHTB 2P6BB 4MVFA 1SL8A 2A4JA 3F45A 4HREE 4YI9A 1QIVA 1QVIY 3BQ3A 3DVKA 5CPVA 4Q04A 4YI8A 1BJFA 1CKKA 4GGFA 3PM8A 4XJKA 1CB1A 4BY5A 1XFVO 2ZRSA 3D0YB 1RFJA 1F8HA 1W7IB 1L7ZA 1SMGA 2HPSA 1OSAA 2MHHA 1PVBA 1YUUA 3BOWA 3CZTX 2ZNEA 3BXKA 1OE9B 2LVJA 2CXJA 2JTTA 2M7LA 2H61C 3SG3A 2KAYA 1TRFA 3IQQA 4PCWA 5JJGA 2KBMA 1KFXS 1LVCD 3DD4A 2OPOA 3EK4A 3LLEA 1IGVA 1GJYA 2M49B 1CNPA 2LHLA 5D69A 1DJHA 3VRRA 3QRXA 1RECA 1SR6B 2AMIA 1DJIA 2PMYA 2HETA 2OS8C 4DUQA 2KI4C 1KQMB 1TNWA 3OB1B 1YUTA 4N5XA 2NZ0A 3OB2B 4I5KA 1TNPA 2K2FA 1QXPA 1FW4A 3PN7C 3DVEA 1QV1A 2E30A 3DF0A 1MWNA 5JOLA 3VRQA 2LVIA 3EVVA 2M1KB 2HF5A 1CDPA 2ZRTA 1B4CA 2LC5A 4AQIA 2ZN9A 1CTRA 1IG5A 3EKHA 1PALA 3VRNA 1J7RA 4WQ2A 2K7CA 4PHMA 3I5FB 1IKUA 3D10A 4MZJA 3NSLA 5CSNA 3LK1A 1WDCC 2LLSA 1DJWA 4GGNA 1B8LA 1CFFA 1MF8B 4CPVA 2KQYA 2WOSA 5AERA 1UUSA 1QX2A 2M29A 5HKZA 5TNCA 1NX1A 3O78A 1Y6WA 4HSZA 2PSRA 5IBWA 3KO0A 4ORAB 1WRLA 3SG2A 2KAVA 1KFUL 1RJVA 2M97A 1SL7A 4TNCA 3PFVA 2MJWB 1CDNA 1FPWA 3I5IB 2LP2A 3WNXB 4FTGA 2CNPA 4NQGA 1A4PA 1K90D 2M1UA 2WCEA 3OX6A 1S5GZ 2JT3A 1F70A 2M7NA 4QJ4B 2I94A 3NSIA 5KTYA 1XFXO 5I2OA 1JSAA 4F0ZB 3AAKA 1CDMA 1D1OA 1RWYA 2GGMA 2HQWA 4FQOA 4D1EA 2PVBA 4ORCB 1KK7Z 3SG4A 1PSBA 1MXLC 3TDUA 1JBAA 4I5NB 1LKJA 2KNEA 2WCFA 4XYNA 1DJZA 1OOJA 2LP3A 2F2PA 2LMTA 1B7TZ 1FI5A 4QJ3B 1BG1A 3RLZA 3TUYC 1Y1UA 1AJ4A 1WRKA 1XK4C 2G9BA 3A8RA 3TZ1A 1CLMA 4C0JA 1AK8A 1C7VA 4MZKA 3PALA 1QX5B 1BOCA 1SCMB 2LANA 1R2UA 2JTZA 4WQ3A 1Y0VH 4R1EA 1NUBA 2WORA 2ZFDA 1XA5A 1KSOA 4OVNF 1PSRA 1NCYA 1V1FA 1S6IA 5G08A 1CFPA 1OMVA 3EKJA 1XFWO 3WHUB 3BUOB 1ZOTB 1UHNA 3HX4A 5AXIA 1A75B 1WLMA 2F3YA 1QTXA 4CIDA 2EHBA 2CCMA 2Y1MA 2BCXA 2BCBA 1S5GY 1YX8A 2KHNA 1W7JB 3I5HB 2JU0A 1QX7A 2L2EA 2KBIA 4DS7A 3TDIA 2PRUA 1ZMZA 3D0YA 2L51A 2LVVA 1EL4A 2KI6C 2WC8A 4OR9B 5ER4X 1DGUA 1KK7Y 2GV5A 4PE0A 3CR4X 4NDDA 4ZCVA 2BE4A 2BL0C 3CTNA 4PE1A 5F6TA 4ZCUA 1SPYA 3H4SE 4AOMA 2NLNA 1QATA 3IQOA 5I2LA 1WLZA 2KGRA 2CTNA 3ZNIA 2LV7A 5CSFA 1DMOA 1MQ1A 1H4BA 1Y1AA 1NSHA 2LVKA 3FWBA 1M39A 1CFDA 1YTZC 2SASA 4GAOA 1X02A 1QLKA 2JXLA 4MRYA 1CFCA 4PE4A 1OMDA 2G2BA 3KF9A 4NDBA 5HLOA 2AUCA 2DOQA 1KWOC 2KI6D 2JQ6A 1SL9A 4BY4A 4GGFC 1MXEA 1ZFSA 1N65A 2VRGA 1RTP1 1F4OA 1DTLA 2KYFA 1J7PA 1K94A 1PVAA 1SK6D 1XVJA 2K7BA 2K7OA 1OZOA 1RROA 4YGBB 4YRUA 1EG4A 2OS8B 3BYAA 2KI4B 3SG7A 4I5LB 2L50A 2ISDA 3K21A 4ETOA 1CDLA 1TNXA 3KHEA 3BUNB 1NIWA 1U5IB 1MHOA 3PN7B 1S26D 2BKHB 2Y4QA 4YBHB 3O6BA 1JFKA 2K0JA 1NYAA 3I5GC 1IQ5A 1K95A 2QACA 5AFPA 1KK8B 3NSOA 4YGDB 2SCPA 1G8IA 4U8DA 2NXQA 1DF0A 2EC6C 1UHIA 4PHNA 1DVIA 1F71A 2KSPA 1AUIB 1SRAA 3WXAA 2L0PA 4GUKA 1H8BA 3FWCA 1WDCB 3VROA 1LA0A 1QS7A 1R6PA 2LLTA 2QPTA 3JVTC 1C07A 1F54A 1YR5A 4YGAA 3TDZA 2LNKA 2LUCA 1YX7A 3SG5A 5B8IB 1AP4A 2LE9B 1BMOA 2JC2A 1TNQA 3HCMA 1KSMA 1NCZA 2KGBC 2ZKMX 1JUOA 3E3RA 3CGAA 1PULA 4DCKA 2BKIB 1CMFA 4PHJA 3GK2A 3JTDC 1M46A 3SG6A 4CLNA 5K89A 1NP8A 2Y5IA 2KAXA 4GFTA 1QASA 5CSJA 2KOTA 2FCDA 2H2KA 2FOTA 1B8CA 2WCBA 3ICBA 1UHJA 2JPTA 3NSKA 1G33A 3KEVA 1YVLA 1QLSA 1TOPA 2JNXA 1QIWA 1LINA 5DKQA 3TS5C 1Y1XA 1BT6A 1PRWA 1L2OC 1PK0D 3LK0A 4A4CA 1FI6A 2Q4UA 2BBNA 2JT0A 2PALA 3MSEB 3AAJA 3PATA 4M2QA 1AHRA 2JULA 2TN4A 5HKYA 1QJTA 4GNKB 5I8NA 1J1DA 2E6WA 2MA2A 3TUYB 3CWGA 1SW8A 4CFQA 2JWWA 2L4IA 4HRGA 1KFUS 1QVIZ 3FS7A 2PASA 2LCPA 1OZSA 3CR5X 2CT9A 5HLVA 2MBXA 2OTGC 1ALWA 1IRJA 3CR2A 1A75A 2LLUA 5J3XA 2K7DA 1JF0A 2LAPA 3M0WA 1GGWA 1K9KA 1TIZA 2D8NA 4CFRA 1IQ3A 2ZNDA 5HYDA 2M0RA 1CLBA 3GK4X 1UHKA 1K8UA 2CBLA 1V1GA 2V53A 1NCXA 2BBMA 1S6JA 1A03A 2JNFA 1J55A 1SBJA 1DT7B 1YURA 2KFGA 1TN4A 1BF5A 1BODA 4MZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN0 A;  1A2X A;  1EJ3 A;  3PLF B;  4C0L A;  1DGV A;  1YVH A;  3OX5 A;  3ZWH A;  1NX2 A;  4MEW A;  5KSZ A;  1WRZ A;  2RGI A;  5D7F A;  1S1E A;  1B7T Y;  1KFX L;  1SYM A;  2L4H A;  1M63 B;  3DVJ A;  1B47 A;  2BL0 B;  4OV2 A;  1K9U A;  1N0Y A;  1VRK A;  2COL B;  1ODB A;  1BLQ A;  1M31 A;  1A29 A;  2H61 A;  2LUX A;  2MLE C;  2HQ8 A;  2I2R E;  4IL1 A;  3O2P A;  1JF2 A;  2M8U A;  2KDH A;  5AAN A;  4ICB A;  1KQV A;  5FYX A;  1M45 A;  5ER5 A;  1F4Q A;  2I7A A;  1GQM A;  1YUS A;  1AJ5 A;  3AKB A;  3PSR A;  3CLN A;  1GGZ A;  1MUX A;  1CMG A;  1IH0 A;  1SY9 A;  1J7O A;  1IJ5 A;  1Q80 A;  2GGZ A;  1XFU O;  1G4Y R;  2KYC A;  1KWO B;  4OCI A;  4XJK B;  3SJS A;  1B1G A;  3RM1 A;  1U5I A;  1B8R A;  3EK7 A;  1K96 A;  1S3P A;  1K2H A;  4OKH A;  1IWQ A;  2WND A;  1AVS A;  1UUR A;  1E8A A;  1KCY A;  2LMV A;  3BOW B;  1SR6 C;  5I2Q A;  1N2D A;  4MRX A;  1KQM C;  2JXC A;  1ZUZ A;  3C1V A;  1YRU B;  4HRH A;  2MAZ A;  3I5G B;  3LCP C;  2F2O A;  2JOJ A;  2EC6 B;  3A4U B;  1EG3 A;  2KFF A;  3SIA A;  1XO5 A;  5GQQ C;  4N1F A;  3O4Y A;  1KK8 C;  5DKR A;  3I5F C;  1J1E A;  3DF0 B;  3JVT B;  1QV0 A;  4YGC B;  2L5X B;  2FCE A;  3OP0 A;  2BE6 A;  1HT9 A;  1EH2 A;  4UPG A;  2FJU B;  3VGO A;  2F8P A;  2KFH A;  1XYD A;  5HKW A;  1F55 A;  1FF1 A;  1DF0 B;  4DRW A;  1DJG A;  4I5J A;  1JWD A;  3CS1 A;  4WRI A;  4MBE A;  4AQJ A;  2BCA A;  1S36 A;  2K8M B;  4ORB B;  2LHI A;  1CM1 A;  2B1U A;  4QJ5 B;  3GK1 A;  1IJ6 A;  1RK9 A;  3JTD B;  4USL A;  2IS9 A;  4P5O E;  1XFZ O;  2KQ6 A;  4GBA A;  3AKA A;  3I5I C;  1JFJ A;  1TTX A;  1SKT A;  2F33 A;  1MR8 A;  2O60 A;  3EK8 A;  1OMR A;  1EXR A;  1NPQ A;  2L98 A;  1FBV A;  1B9A A;  5PAL A;  4PE7 A;  1C7W A;  3GOF A;  1XK4 A;  2K61 A;  1SNL A;  3NXA A;  4PHK A;  3TS5 B;  2M3W A;  3KPX A;  1L2O B;  4DIR A;  2Y1N A;  1XFY O;  4N1G A;  5KU1 A;  2K2A A;  1HQV A;  1LA3 A;  1BR1 B;  1OQP A;  4MLW A;  1UHH A;  1NX0 A;  4M2O A;  5AEQ A;  2JT8 A;  3LL8 B;  4P2Y B;  4JWQ A;  4NDC A;  4A4B A;  2LMU A;  2OTG B;  1J7Q A;  2ZN8 A;  1DJY A;  1YRT B;  1NX3 A;  1UWO A;  2NCP A;  3EVU A;  1SCM C;  1BR4 B;  2JRF A;  4PAL A;  4PDZ A;  4JPZ B;  1S6C A;  1TCO B;  5DKN A;  1LXF C;  1TCF A;  4L9M A;  1ZAC A;  2O5G A;  5BPJ A;  3SIB A;  3IF7 A;  2MLF C;  1CLL A;  2JZI A;  3BUW B;  2NCO A;  4MSP A;  4E68 A;  3BUX B;  3DVM A;  2MRD A;  1SCV A;  2F3Z A;  1NWD A;  1UP5 A;  1ALV A;  2I18 A;  3VRP A;  4YGE B;  1DJX A;  3FIA A;  2R2I A;  2Q91 A;  1K9P A;  3I5H C;  4M2P A;  1BU3 A;  1K93 D;  4GPL B;  4JQ0 D;  5CSI A;  2BEC A;  4C0K A;  3EVR A;  2LM5 A;  2EGD A;  3BUM B;  2AAO A;  2M9G A;  1CM4 A;  1WY9 A;  1JC2 A;  3OHM B;  3WHT B;  2P6B B;  4MVF A;  1SL8 A;  2A4J A;  3F45 A;  4HRE E;  4YI9 A;  1QIV A;  1QVI Y;  3BQ3 A;  3DVK A;  5CPV A;  4Q04 A;  4YI8 A;  1BJF A;  1CKK A;  4GGF A;  3PM8 A;  4XJK A;  1CB1 A;  4BY5 A;  1XFV O;  2ZRS A;  3D0Y B;  1RFJ A;  1F8H A;  1W7I B;  1L7Z A;  1SMG A;  2HPS A;  1OSA A;  2MHH A;  1PVB A;  1YUU A;  3BOW A;  3CZT X;  2ZNE A;  3BXK A;  1OE9 B;  2LVJ A;  2CXJ A;  2JTT A;  2M7L A;  2H61 C;  3SG3 A;  2KAY A;  1TRF A;  3IQQ A;  4PCW A;  5JJG A;  2KBM A;  1KFX S;  1LVC D;  3DD4 A;  2OPO A;  3EK4 A;  3LLE A;  1IGV A;  1GJY A;  2M49 B;  1CNP A;  2LHL A;  5D69 A;  1DJH A;  3VRR A;  3QRX A;  1REC A;  1SR6 B;  2AMI A;  1DJI A;  2PMY A;  2HET A;  2OS8 C;  4DUQ A;  2KI4 C;  1KQM B;  1TNW A;  3OB1 B;  1YUT A;  4N5X A;  2NZ0 A;  3OB2 B;  4I5K A;  1TNP A;  2K2F A;  1QXP A;  1FW4 A;  3PN7 C;  3DVE A;  1QV1 A;  2E30 A;  3DF0 A;  1MWN A;  5JOL A;  3VRQ A;  2LVI A;  3EVV A;  2M1K B;  2HF5 A;  1CDP A;  2ZRT A;  1B4C A;  2LC5 A;  4AQI A;  2ZN9 A;  1CTR A;  1IG5 A;  3EKH A;  1PAL A;  3VRN A;  1J7R A;  4WQ2 A;  2K7C A;  4PHM A;  3I5F B;  1IKU A;  3D10 A;  4MZJ A;  3NSL A;  5CSN A;  3LK1 A;  1WDC C;  2LLS A;  1DJW A;  4GGN A;  1B8L A;  1CFF A;  1MF8 B;  4CPV A;  2KQY A;  2WOS A;  5AER A;  1UUS A;  1QX2 A;  2M29 A;  5HKZ A;  5TNC A;  1NX1 A;  3O78 A;  1Y6W A;  4HSZ A;  2PSR A;  5IBW A;  3KO0 A;  4ORA B;  1WRL A;  3SG2 A;  2KAV A;  1KFU L;  1RJV A;  2M97 A;  1SL7 A;  4TNC A;  3PFV A;  2MJW B;  1CDN A;  1FPW A;  3I5I B;  2LP2 A;  3WNX B;  4FTG A;  2CNP A;  4NQG A;  1A4P A;  1K90 D;  2M1U A;  2WCE A;  3OX6 A;  1S5G Z;  2JT3 A;  1F70 A;  2M7N A;  4QJ4 B;  2I94 A;  3NSI A;  5KTY A;  1XFX O;  5I2O A;  1JSA A;  4F0Z B;  3AAK A;  1CDM A;  1D1O A;  1RWY A;  2GGM A;  2HQW A;  4FQO A;  4D1E A;  2PVB A;  4ORC B;  1KK7 Z;  3SG4 A;  1PSB A;  1MXL C;  3TDU A;  1JBA A;  4I5N B;  1LKJ A;  2KNE A;  2WCF A;  4XYN A;  1DJZ A;  1OOJ A;  2LP3 A;  2F2P A;  2LMT A;  1B7T Z;  1FI5 A;  4QJ3 B;  1BG1 A;  3RLZ A;  3TUY C;  1Y1U A;  1AJ4 A;  1WRK A;  1XK4 C;  2G9B A;  3A8R A;  3TZ1 A;  1CLM A;  4C0J A;  1AK8 A;  1C7V A;  4MZK A;  3PAL A;  1QX5 B;  1BOC A;  1SCM B;  2LAN A;  1R2U A;  2JTZ A;  4WQ3 A;  1Y0V H;  4R1E A;  1NUB A;  2WOR A;  2ZFD A;  1XA5 A;  1KSO A;  4OVN F;  1PSR A;  1NCY A;  1V1F A;  1S6I A;  5G08 A;  1CFP A;  1OMV A;  3EKJ A;  1XFW O;  3WHU B;  3BUO B;  1ZOT B;  1UHN A;  3HX4 A;  5AXI A;  1A75 B;  1WLM A;  2F3Y A;  1QTX A;  4CID A;  2EHB A;  2CCM A;  2Y1M A;  2BCX A;  2BCB A;  1S5G Y;  1YX8 A;  2KHN A;  1W7J B;  3I5H B;  2JU0 A;  1QX7 A;  2L2E A;  2KBI A;  4DS7 A;  3TDI A;  2PRU A;  1ZMZ A;  3D0Y A;  2L51 A;  2LVV A;  1EL4 A;  2KI6 C;  2WC8 A;  4OR9 B;  5ER4 X;  1DGU A;  1KK7 Y;  2GV5 A;  4PE0 A;  3CR4 X;  4NDD A;  4ZCV A;  2BE4 A;  2BL0 C;  3CTN A;  4PE1 A;  5F6T A;  4ZCU A;  1SPY A;  3H4S E;  4AOM A;  2NLN A;  1QAT A;  3IQO A;  5I2L A;  1WLZ A;  2KGR A;  2CTN A;  3ZNI A;  2LV7 A;  5CSF A;  1DMO A;  1MQ1 A;  1H4B A;  1Y1A A;  1NSH A;  2LVK A;  3FWB A;  1M39 A;  1CFD A;  1YTZ C;  2SAS A;  4GAO A;  1X02 A;  1QLK A;  2JXL A;  4MRY A;  1CFC A;  4PE4 A;  1OMD A;  2G2B A;  3KF9 A;  4NDB A;  5HLO A;  2AUC A;  2DOQ A;  1KWO C;  2KI6 D;  2JQ6 A;  1SL9 A;  4BY4 A;  4GGF C;  1MXE A;  1ZFS A;  1N65 A;  2VRG A;  1RTP 1;  1F4O A;  1DTL A;  2KYF A;  1J7P A;  1K94 A;  1PVA A;  1SK6 D;  1XVJ A;  2K7B A;  2K7O A;  1OZO A;  1RRO A;  4YGB B;  4YRU A;  1EG4 A;  2OS8 B;  3BYA A;  2KI4 B;  3SG7 A;  4I5L B;  2L50 A;  2ISD A;  3K21 A;  4ETO A;  1CDL A;  1TNX A;  3KHE A;  3BUN B;  1NIW A;  1U5I B;  1MHO A;  3PN7 B;  1S26 D;  2BKH B;  2Y4Q A;  4YBH B;  3O6B A;  1JFK A;  2K0J A;  1NYA A;  3I5G C;  1IQ5 A;  1K95 A;  2QAC A;  5AFP A;  1KK8 B;  3NSO A;  4YGD B;  2SCP A;  1G8I A;  4U8D A;  2NXQ A;  1DF0 A;  2EC6 C;  1UHI A;  4PHN A;  1DVI A;  1F71 A;  2KSP A;  1AUI B;  1SRA A;  3WXA A;  2L0P A;  4GUK A;  1H8B A;  3FWC A;  1WDC B;  3VRO A;  1LA0 A;  1QS7 A;  1R6P A;  2LLT A;  2QPT A;  3JVT C;  1C07 A;  1F54 A;  1YR5 A;  4YGA A;  3TDZ A;  2LNK A;  2LUC A;  1YX7 A;  3SG5 A;  5B8I B;  1AP4 A;  2LE9 B;  1BMO A;  2JC2 A;  1TNQ A;  3HCM A;  1KSM A;  1NCZ A;  2KGB C;  2ZKM X;  1JUO A;  3E3R A;  3CGA A;  1PUL A;  4DCK A;  2BKI B;  1CMF A;  4PHJ A;  3GK2 A;  3JTD C;  1M46 A;  3SG6 A;  4CLN A;  5K89 A;  1NP8 A;  2Y5I A;  2KAX A;  4GFT A;  1QAS A;  5CSJ A;  2KOT A;  2FCD A;  2H2K A;  2FOT A;  1B8C A;  2WCB A;  3ICB A;  1UHJ A;  2JPT A;  3NSK A;  1G33 A;  3KEV A;  1YVL A;  1QLS A;  1TOP A;  2JNX A;  1QIW A;  1LIN A;  5DKQ A;  3TS5 C;  1Y1X A;  1BT6 A;  1PRW A;  1L2O C;  1PK0 D;  3LK0 A;  4A4C A;  1FI6 A;  2Q4U A;  2BBN A;  2JT0 A;  2PAL A;  3MSE B;  3AAJ A;  3PAT A;  4M2Q A;  1AHR A;  2JUL A;  2TN4 A;  5HKY A;  1QJT A;  4GNK B;  5I8N A;  1J1D A;  2E6W A;  2MA2 A;  3TUY B;  3CWG A;  1SW8 A;  4CFQ A;  2JWW A;  2L4I A;  4HRG A;  1KFU S;  1QVI Z;  3FS7 A;  2PAS A;  2LCP A;  1OZS A;  3CR5 X;  2CT9 A;  5HLV A;  2MBX A;  2OTG C;  1ALW A;  1IRJ A;  3CR2 A;  1A75 A;  2LLU A;  5J3X A;  2K7D A;  1JF0 A;  2LAP A;  3M0W A;  1GGW A;  1K9K A;  1TIZ A;  2D8N A;  4CFR A;  1IQ3 A;  2ZND A;  5HYD A;  2M0R A;  1CLB A;  3GK4 X;  1UHK A;  1K8U A;  2CBL A;  1V1G A;  2V53 A;  1NCX A;  2BBM A;  1S6J A;  1A03 A;  2JNF A;  1J55 A;  1SBJ A;  1DT7 B;  1YUR A;  2KFG A;  1TN4 A;  1BF5 A;  1BOD A;  4MZL A; 
#chains in the Genus database with same CATH topology
 4MN0 A;  1A2X A;  1EJ3 A;  1SSE B;  3PLF B;  4C0L A;  1DGV A;  1YVH A;  3OX5 A;  3Q8I A;  1NX2 A;  4MEW A;  3ZWH A;  1WRZ A;  5KSZ A;  2RGI A;  3B7A A;  5FI2 A;  5D7F A;  1S1E A;  1B7T Y;  1KFX L;  1SYM A;  3BFH A;  2L4H A;  1M63 B;  3DVJ A;  5I94 A;  1B47 A;  2BL0 B;  4OV2 A;  1K9U A;  1N0Y A;  1VRK A;  2COL B;  3PJI A;  1ODB A;  1BLQ A;  1M31 A;  1A29 A;  2H61 A;  2LUX A;  2MLE C;  2HQ8 A;  2I2R E;  4IL1 A;  3O2P A;  1JF2 A;  2M8U A;  2KDH A;  5AAN A;  4ICB A;  1KQV A;  5FYX A;  1M45 A;  5ER5 A;  1F4Q A;  3RZS A;  2I7A A;  1GQM A;  1YUS A;  1AJ5 A;  3AKB A;  3CZ1 A;  3CLN A;  3PSR A;  1GGZ A;  1MUX A;  1CMG A;  1IH0 A;  1SY9 A;  1J7O A;  1IJ5 A;  1Q80 A;  2GGZ A;  1XFU O;  3R1V A;  1G4Y R;  2KYC A;  1KWO B;  4OCI A;  4XJK B;  3SJS A;  1B1G A;  3RM1 A;  2PQL A;  1U5I A;  1B8R A;  3D76 A;  3EK7 A;  3R1P A;  1K96 A;  1S3P A;  1K2H A;  4OKH A;  1IWQ A;  2WND A;  1AVS A;  1UUR A;  1E8A A;  1KCY A;  2JPO A;  2LMV A;  3BOW B;  4JKT A;  1SR6 C;  5I2Q A;  1N2D A;  4MRX A;  1KQM C;  2JXC A;  1ZUZ A;  2WCJ A;  1YRU B;  3C1V A;  4HRH A;  4PT1 A;  2MAZ A;  3I5G B;  3LCP C;  2F2O A;  2JOJ A;  2EC6 B;  3A4U B;  1EG3 A;  3CYZ A;  2KFF A;  3SIA A;  1XO5 A;  3S0G A;  3D74 A;  5GQQ C;  1QWV A;  4N1F A;  3O4Y A;  1KK8 C;  2QEO A;  4JD9 A;  2KLE A;  5DKR A;  3I5F C;  1J1E A;  3DF0 B;  3JVT B;  1QV0 A;  4YGC B;  2L5X B;  2FCE A;  3OP0 A;  2BE6 A;  1HT9 A;  2P70 A;  1EH2 A;  4UPG A;  2FJU B;  3VGO A;  2F8P A;  2KFH A;  3D78 A;  1XYD A;  5HKW A;  1ORG A;  1F55 A;  1FF1 A;  1DF0 B;  4DRW A;  1DJG A;  4I5J A;  2K60 A;  1JWD A;  3CS1 A;  4WRI A;  4MBE A;  4AQJ A;  2BCA A;  1S36 A;  2K8M B;  4ORB B;  2LHI A;  1CM1 A;  2B1U A;  4QJ5 B;  3GK1 A;  1IJ6 A;  1RK9 A;  3JTD B;  4USL A;  2IS9 A;  4P5O E;  3D73 A;  1DQE A;  1XFZ O;  3BJH A;  2KQ6 A;  4GBA A;  3AKA A;  3I5I C;  1JFJ A;  1TTX A;  1SKT A;  1OOG A;  2F33 A;  1MR8 A;  2O60 A;  3CZ0 A;  1OMR A;  3EK8 A;  1TUJ A;  2L5Y A;  1EXR A;  1NPQ A;  2L98 A;  5HL1 A;  1FBV A;  1B9A A;  5PAL A;  4PE7 A;  1C7W A;  3GOF A;  1XK4 A;  2K61 A;  1SNL A;  3B6X A;  3NXA A;  4PHK A;  3TS5 B;  2M3W A;  3KPX A;  1L2O B;  4DIR A;  2Y1N A;  1XFY O;  4N1G A;  5KU1 A;  2K2A A;  1HQV A;  1LA3 A;  1BR1 B;  1OQP A;  4MLW A;  1UHH A;  2WC6 A;  1NX0 A;  4M2O A;  5AEQ A;  4INX A;  2JT8 A;  3LL8 B;  4P2Y B;  4JWQ A;  3FE8 A;  4NDC A;  4A4B A;  2LMU A;  1LS8 A;  2OTG B;  1J7Q A;  2ZN8 A;  1DJY A;  1YRT B;  1NX3 A;  1UWO A;  2NCP A;  1DEK A;  3EVU A;  2WCK A;  1SCM C;  1BR4 B;  2JRF A;  3DY9 A;  4PAL A;  4PDZ A;  4FQT A;  4JPZ B;  1S6C A;  4IJ7 A;  1TCO B;  5DKN A;  1LXF C;  5FI7 A;  1TCF A;  4L9M A;  1ZAC A;  2O5G A;  5BPJ A;  3SIB A;  3IF7 A;  2MLF C;  1CLL A;  2JZI A;  3BUW B;  2NCO A;  4MSP A;  4E68 A;  3BUX B;  3DVM A;  2MRD A;  1SCV A;  2F3Z A;  3K1E A;  1NWD A;  1UP5 A;  1ALV A;  2I18 A;  3VRP A;  4YGE B;  1DJX A;  3FIA A;  2R2I A;  2Q91 A;  1K9P A;  1GM0 A;  3I5H C;  4M2P A;  1BU3 A;  1K93 D;  4GPL B;  4JQ0 D;  5CSI A;  2BEC A;  4C0K A;  3EVR A;  2LM5 A;  2EGD A;  3BUM B;  2YGU A;  2AAO A;  2M9G A;  2P71 A;  1CM4 A;  1WY9 A;  1JC2 A;  3OHM B;  3WHT B;  2P6B B;  4MVF A;  1SL8 A;  2A4J A;  3F45 A;  4HRE E;  4YI9 A;  1QIV A;  3BFA A;  1QVI Y;  1OOI X;  3BQ3 A;  3DVK A;  5CPV A;  4Q04 A;  4YI8 A;  1BJF A;  1CKK A;  4GGF A;  3PM8 A;  4XJK A;  1CB1 A;  4BY5 A;  1XFV O;  2ZRS A;  3D0Y B;  1RFJ A;  1F8H A;  1W7I B;  1L7Z A;  1SMG A;  2HPS A;  1OSA A;  2MHH A;  1TWO A;  1PVB A;  1OOH A;  1YUU A;  3BOW A;  3CZT X;  2ZNE A;  3BXK A;  1OE9 B;  2LVJ A;  2CXJ A;  2JTT A;  2M7L A;  2H61 C;  3SG3 A;  2KAY A;  1TRF A;  3IQQ A;  4PCW A;  5JJG A;  1DC1 A;  2KBM A;  1KFX S;  1LVC D;  3DD4 A;  2OPO A;  3EK4 A;  3LLE A;  1IGV A;  1GJY A;  2M49 B;  1CNP A;  2LHL A;  1TUZ A;  5D69 A;  1DJH A;  3VRR A;  3QRX A;  1REC A;  1SR6 B;  2AMI A;  1DJI A;  2PMY A;  2HET A;  2OS8 C;  4DUQ A;  2KI4 C;  1KQM B;  1TNW A;  3OB1 B;  1YUT A;  4N5X A;  2NZ0 A;  3OB2 B;  4I5K A;  1TNP A;  2K2F A;  1QXP A;  1FW4 A;  2WC5 A;  3DVE A;  1QV1 A;  3PN7 C;  2E30 A;  3DF0 A;  1MWN A;  5JOL A;  3VRQ A;  2LVI A;  3EVV A;  2M1K B;  2HF5 A;  1CDP A;  2FJY A;  2WCH A;  2ZRT A;  1B4C A;  3CAB A;  2LC5 A;  4AQI A;  2ZN9 A;  1CTR A;  1IG5 A;  3CDN A;  3EKH A;  1PAL A;  3VRN A;  3S0F A;  1J7R A;  4WQ2 A;  2K7C A;  4PHM A;  3I5F B;  1IKU A;  3D10 A;  2GTE A;  4MZJ A;  3NSL A;  5CSN A;  3LK1 A;  1WDC C;  2LLS A;  1DJW A;  4GGN A;  1B8L A;  3FE9 A;  1CFF A;  1MF8 B;  3FE6 A;  2KQY A;  2WOS A;  4CPV A;  5AER A;  1UUS A;  1QX2 A;  2M29 A;  5HKZ A;  5TNC A;  1NX1 A;  3O78 A;  1Y6W A;  4HSZ A;  2PSR A;  3R1O A;  5IBW A;  3KO0 A;  4ORA B;  1WRL A;  3SG2 A;  2KAV A;  1KFU L;  1RJV A;  2M97 A;  1SL7 A;  4TNC A;  3PFV A;  2MJW B;  1CDN A;  1FPW A;  3I5I B;  2LP2 A;  3WNX B;  4FTG A;  5EL2 A;  2CNP A;  2KLD A;  1A4P A;  3DXL A;  4NQG A;  1K90 D;  2M1U A;  2WCE A;  3OX6 A;  1S5G Z;  2JT3 A;  3D75 A;  1F70 A;  2M7N A;  4QJ4 B;  2I94 A;  3NSI A;  1DEL A;  5KTY A;  1XFX O;  3L4A A;  3L4L A;  5I2O A;  1JSA A;  4F0Z B;  3AAK A;  1CDM A;  1D1O A;  1RWY A;  2GGM A;  2HQW A;  4FQO A;  4D1E A;  2PVB A;  4ORC B;  1KK7 Z;  3SG4 A;  1PSB A;  1MXL C;  3TDU A;  1JBA A;  4I5N B;  1LKJ A;  2KNE A;  2WCF A;  4XYN A;  1DJZ A;  1OOJ A;  2LP3 A;  2F2P A;  2LMT A;  1B7T Z;  1FI5 A;  4QJ3 B;  1BG1 A;  3RLZ A;  3TUY C;  1Y1U A;  1AJ4 A;  3B88 A;  1WRK A;  1XK4 C;  2G9B A;  3A8R A;  3TZ1 A;  1CLM A;  4C0J A;  1AK8 A;  1C7V A;  4MZK A;  3PAL A;  1QX5 B;  1BOC A;  1SCM B;  2LAN A;  1R2U A;  1OOF A;  2JTZ A;  4WQ3 A;  1Y0V H;  4R1E A;  1NUB A;  2WOR A;  2ZFD A;  5DIC A;  1XA5 A;  1KSO A;  5D3O A;  4OVN F;  1PSR A;  1NCY A;  1V1F A;  3BFB A;  1S6I A;  5G08 A;  1CFP A;  1OMV A;  3EKJ A;  1XFW O;  3WHU B;  3BUO B;  1ZOT B;  1IIO A;  1UHN A;  3HX4 A;  5AXI A;  1A75 B;  4F7F A;  1WLM A;  2F3Y A;  1QTX A;  4CID A;  2EHB A;  1XFR A;  2CCM A;  2Y1M A;  2BCX A;  2BCB A;  1S5G Y;  1YX8 A;  2KHN A;  1W7J B;  3I5H B;  2JU0 A;  2BNX A;  1QX7 A;  2L2E A;  2KBI A;  4DS7 A;  3TDI A;  2PRU A;  2BAP A;  3OBV A;  3S0A A;  1ZMZ A;  3D0Y A;  2L51 A;  2LVV A;  3DZT A;  1EL4 A;  2KI6 C;  2WC8 A;  4OR9 B;  5ER4 X;  4INW A;  2QEV A;  1DGU A;  1KK7 Y;  2GV5 A;  4PE0 A;  3CR4 X;  4NDD A;  4ZCV A;  3UO9 A;  2BE4 A;  2BL0 C;  3CTN A;  4PE1 A;  5F6T A;  4ZCU A;  1SPY A;  3H4S E;  1Z2C B;  4AOM A;  2NLN A;  1QAT A;  3IQO A;  2L2C A;  5I2L A;  1WLZ A;  5FI6 A;  2KGR A;  2CTN A;  3ZNI A;  2LV7 A;  3VB1 A;  5CSF A;  2WCM A;  1DMO A;  1MQ1 A;  1H4B A;  1Y1A A;  1NSH A;  2LVK A;  3FWB A;  1M39 A;  1CFD A;  1YTZ C;  2QDI A;  2SAS A;  1X02 A;  4GAO A;  1QLK A;  3SS5 A;  2JXL A;  4MRY A;  1CFC A;  4PE4 A;  1OMD A;  2G2B A;  3IVT A;  3EG5 B;  3KF9 A;  3NHI A;  4NDB A;  5HLO A;  2AUC A;  2DOQ A;  1KWO C;  2KI6 D;  2JQ6 A;  1SL9 A;  4BY4 A;  4GGF C;  2PYQ A;  3B86 A;  1MXE A;  1ZFS A;  2H8V A;  1N65 A;  2VRG A;  1RTP 1;  1F4O A;  1DTL A;  2KYF A;  1J7P A;  1OW4 A;  1K94 A;  1PVA A;  1SK6 D;  1XVJ A;  2K7B A;  2K7O A;  1OZO A;  1RRO A;  4YGB B;  4YRU A;  1EG4 A;  2OS8 B;  3UNW A;  3BYA A;  2KI4 B;  3SG7 A;  4I5L B;  2L50 A;  2ISD A;  3K21 A;  4ETO A;  1CDL A;  1TNX A;  3KHE A;  3BUN B;  3PM2 A;  1NIW A;  1U5I B;  1MHO A;  3SS3 A;  3PN7 B;  1S26 D;  2BKH B;  2Y4Q A;  4YBH B;  3O6B A;  1JFK A;  2K0J A;  1NYA A;  3I5G C;  3QME A;  1Z4H A;  1IQ5 A;  1K95 A;  2QAC A;  5AFP A;  3SS4 A;  1KK8 B;  3NSO A;  4YGD B;  2SCP A;  1G8I A;  2QEH A;  4U8D A;  2NXQ A;  1DF0 A;  2EC6 C;  1UHI A;  4PHN A;  1DVI A;  1F71 A;  1C3Z A;  2KSP A;  4KYN A;  1AUI B;  1SRA A;  3WXA A;  2L0P A;  4GUK A;  1H8B A;  3FWC A;  1WDC B;  3VRO A;  1LA0 A;  1QS7 A;  1R6P A;  2LLT A;  2QPT A;  3JVT C;  1C07 A;  1F54 A;  1YR5 A;  4YGA A;  3TDZ A;  2LNK A;  2LUC A;  1YX7 A;  3SG5 A;  5B8I B;  1AP4 A;  2LE9 B;  1BMO A;  2JC2 A;  1TNQ A;  3HCM A;  1KSM A;  1NCZ A;  2KGB C;  3CZ2 A;  3S0B A;  2ZKM X;  3V2L A;  1JUO A;  3E3R A;  3CGA A;  1PUL A;  4DCK A;  2BKI B;  3NHT A;  1CMF A;  4PHJ A;  3GK2 A;  3JTD C;  1M46 A;  3SG6 A;  4CLN A;  3DYE A;  3D77 A;  2WCL A;  5K89 A;  1C3Y A;  1NP8 A;  2Y5I A;  3S0E A;  3NGV A;  2KAX A;  4GFT A;  1QAS A;  2ERB A;  2KOT A;  5CSJ A;  3S0D A;  1W9Z A;  2FCD A;  2H2K A;  2FOT A;  1B8C A;  2WCB A;  3ICB A;  1UHJ A;  2JPT A;  3NSK A;  1G33 A;  3KEV A;  2KPH A;  3O4X A;  1YVL A;  1QLS A;  1TOP A;  1T14 A;  2JNX A;  1QIW A;  1LIN A;  5DKQ A;  3TS5 C;  1Y1X A;  1BT6 A;  1PRW A;  1L2O C;  1PK0 D;  3LK0 A;  4A4C A;  1FI6 A;  1P28 A;  2BBN A;  2JT0 A;  2PAL A;  2Q4U A;  3AAJ A;  3MSE B;  3PAT A;  4M2Q A;  1AHR A;  2JUL A;  2TN4 A;  5HKY A;  1QJT A;  4GNK B;  5I8N A;  1J1D A;  2E6W A;  2MA2 A;  3TUY B;  3CWG A;  1SW8 A;  4CFQ A;  2JWW A;  2L4I A;  4HRG A;  1KFU S;  1QVI Z;  3FS7 A;  2PAS A;  2LCP A;  1OZS A;  3CR5 X;  2CT9 A;  5HLV A;  2MBX A;  2OTG C;  1ALW A;  1IRJ A;  3CR2 A;  1A75 A;  2LLU A;  5J3X A;  2K7D A;  1JF0 A;  2LAP A;  3OGN A;  3M0W A;  1GGW A;  1K9K A;  3B87 A;  1TIZ A;  2D8N A;  4CFR A;  1IQ3 A;  2ZND A;  5HYD A;  2M0R A;  1CLB A;  3GK4 X;  1UHK A;  1K8U A;  3L47 A;  3N7H A;  2CBL A;  2QEB A;  1V1G A;  2V53 A;  1NCX A;  2BBM A;  1S6J A;  1A03 A;  2JNF A;  1J55 A;  1SBJ A;  3R72 A;  1DT7 B;  1YUR A;  2KFG A;  4OZD A;  1TN4 A;  1BF5 A;  1BOD A;  4MZL A; 
#chains in the Genus database with same CATH homology
 4MN0 A;  1A2X A;  1EJ3 A;  3PLF B;  4C0L A;  1DGV A;  1YVH A;  3OX5 A;  3ZWH A;  1NX2 A;  4MEW A;  5KSZ A;  1WRZ A;  2RGI A;  5D7F A;  1S1E A;  1B7T Y;  1KFX L;  1SYM A;  2L4H A;  1M63 B;  3DVJ A;  1B47 A;  2BL0 B;  4OV2 A;  1K9U A;  1N0Y A;  1VRK A;  2COL B;  1ODB A;  1BLQ A;  1M31 A;  1A29 A;  2H61 A;  2LUX A;  2MLE C;  2HQ8 A;  2I2R E;  4IL1 A;  3O2P A;  1JF2 A;  2M8U A;  2KDH A;  5AAN A;  4ICB A;  1KQV A;  5FYX A;  1M45 A;  5ER5 A;  1F4Q A;  2I7A A;  1GQM A;  1YUS A;  1AJ5 A;  3AKB A;  3PSR A;  3CLN A;  1GGZ A;  1MUX A;  1CMG A;  1IH0 A;  1SY9 A;  1J7O A;  1IJ5 A;  1Q80 A;  2GGZ A;  1XFU O;  1G4Y R;  2KYC A;  1KWO B;  4OCI A;  4XJK B;  3SJS A;  1B1G A;  3RM1 A;  1U5I A;  1B8R A;  3EK7 A;  1K96 A;  1S3P A;  1K2H A;  4OKH A;  1IWQ A;  2WND A;  1AVS A;  1UUR A;  1E8A A;  1KCY A;  2LMV A;  3BOW B;  1SR6 C;  5I2Q A;  1N2D A;  4MRX A;  1KQM C;  2JXC A;  1ZUZ A;  3C1V A;  1YRU B;  4HRH A;  2MAZ A;  3I5G B;  3LCP C;  2F2O A;  2JOJ A;  2EC6 B;  3A4U B;  1EG3 A;  2KFF A;  3SIA A;  1XO5 A;  5GQQ C;  4N1F A;  3O4Y A;  1KK8 C;  5DKR A;  3I5F C;  1J1E A;  3DF0 B;  3JVT B;  1QV0 A;  4YGC B;  2L5X B;  2FCE A;  3OP0 A;  2BE6 A;  1HT9 A;  1EH2 A;  4UPG A;  2FJU B;  3VGO A;  2F8P A;  2KFH A;  1XYD A;  5HKW A;  1F55 A;  1FF1 A;  1DF0 B;  4DRW A;  1DJG A;  4I5J A;  1JWD A;  3CS1 A;  4WRI A;  4MBE A;  4AQJ A;  2BCA A;  1S36 A;  2K8M B;  4ORB B;  2LHI A;  1CM1 A;  2B1U A;  4QJ5 B;  3GK1 A;  1IJ6 A;  1RK9 A;  3JTD B;  4USL A;  2IS9 A;  4P5O E;  1XFZ O;  2KQ6 A;  4GBA A;  3AKA A;  3I5I C;  1JFJ A;  1TTX A;  1SKT A;  2F33 A;  1MR8 A;  2O60 A;  3EK8 A;  1OMR A;  1EXR A;  1NPQ A;  2L98 A;  1FBV A;  1B9A A;  5PAL A;  4PE7 A;  1C7W A;  3GOF A;  1XK4 A;  2K61 A;  1SNL A;  3NXA A;  4PHK A;  3TS5 B;  2M3W A;  3KPX A;  1L2O B;  4DIR A;  2Y1N A;  1XFY O;  4N1G A;  5KU1 A;  2K2A A;  1HQV A;  1LA3 A;  1BR1 B;  1OQP A;  4MLW A;  1UHH A;  1NX0 A;  4M2O A;  5AEQ A;  2JT8 A;  3LL8 B;  4P2Y B;  4JWQ A;  4NDC A;  4A4B A;  2LMU A;  2OTG B;  1J7Q A;  2ZN8 A;  1DJY A;  1YRT B;  1NX3 A;  1UWO A;  2NCP A;  3EVU A;  1SCM C;  1BR4 B;  2JRF A;  4PAL A;  4PDZ A;  4JPZ B;  1S6C A;  1TCO B;  5DKN A;  1LXF C;  1TCF A;  4L9M A;  1ZAC A;  2O5G A;  5BPJ A;  3SIB A;  3IF7 A;  2MLF C;  1CLL A;  2JZI A;  3BUW B;  2NCO A;  4MSP A;  4E68 A;  3BUX B;  3DVM A;  2MRD A;  1SCV A;  2F3Z A;  1NWD A;  1UP5 A;  1ALV A;  2I18 A;  3VRP A;  4YGE B;  1DJX A;  3FIA A;  2R2I A;  2Q91 A;  1K9P A;  3I5H C;  4M2P A;  1BU3 A;  1K93 D;  4GPL B;  4JQ0 D;  5CSI A;  2BEC A;  4C0K A;  3EVR A;  2LM5 A;  2EGD A;  3BUM B;  2AAO A;  2M9G A;  1CM4 A;  1WY9 A;  1JC2 A;  3OHM B;  3WHT B;  2P6B B;  4MVF A;  1SL8 A;  2A4J A;  3F45 A;  4HRE E;  4YI9 A;  1QIV A;  1QVI Y;  3BQ3 A;  3DVK A;  5CPV A;  4Q04 A;  4YI8 A;  1BJF A;  1CKK A;  4GGF A;  3PM8 A;  4XJK A;  1CB1 A;  4BY5 A;  1XFV O;  2ZRS A;  3D0Y B;  1RFJ A;  1F8H A;  1W7I B;  1L7Z A;  1SMG A;  2HPS A;  1OSA A;  2MHH A;  1PVB A;  1YUU A;  3BOW A;  3CZT X;  2ZNE A;  3BXK A;  1OE9 B;  2LVJ A;  2CXJ A;  2JTT A;  2M7L A;  2H61 C;  3SG3 A;  2KAY A;  1TRF A;  3IQQ A;  4PCW A;  5JJG A;  2KBM A;  1KFX S;  1LVC D;  3DD4 A;  2OPO A;  3EK4 A;  3LLE A;  1IGV A;  1GJY A;  2M49 B;  1CNP A;  2LHL A;  5D69 A;  1DJH A;  3VRR A;  3QRX A;  1REC A;  1SR6 B;  2AMI A;  1DJI A;  2PMY A;  2HET A;  2OS8 C;  4DUQ A;  2KI4 C;  1KQM B;  1TNW A;  3OB1 B;  1YUT A;  4N5X A;  2NZ0 A;  3OB2 B;  4I5K A;  1TNP A;  2K2F A;  1QXP A;  1FW4 A;  3PN7 C;  3DVE A;  1QV1 A;  2E30 A;  3DF0 A;  1MWN A;  5JOL A;  3VRQ A;  2LVI A;  3EVV A;  2M1K B;  2HF5 A;  1CDP A;  2ZRT A;  1B4C A;  2LC5 A;  4AQI A;  2ZN9 A;  1CTR A;  1IG5 A;  3EKH A;  1PAL A;  3VRN A;  1J7R A;  4WQ2 A;  2K7C A;  4PHM A;  3I5F B;  1IKU A;  3D10 A;  4MZJ A;  3NSL A;  5CSN A;  3LK1 A;  1WDC C;  2LLS A;  1DJW A;  4GGN A;  1B8L A;  1CFF A;  1MF8 B;  4CPV A;  2KQY A;  2WOS A;  5AER A;  1UUS A;  1QX2 A;  2M29 A;  5HKZ A;  5TNC A;  1NX1 A;  3O78 A;  1Y6W A;  4HSZ A;  2PSR A;  5IBW A;  3KO0 A;  4ORA B;  1WRL A;  3SG2 A;  2KAV A;  1KFU L;  1RJV A;  2M97 A;  1SL7 A;  4TNC A;  3PFV A;  2MJW B;  1CDN A;  1FPW A;  3I5I B;  2LP2 A;  3WNX B;  4FTG A;  2CNP A;  4NQG A;  1A4P A;  1K90 D;  2M1U A;  2WCE A;  3OX6 A;  1S5G Z;  2JT3 A;  1F70 A;  2M7N A;  4QJ4 B;  2I94 A;  3NSI A;  5KTY A;  1XFX O;  5I2O A;  1JSA A;  4F0Z B;  3AAK A;  1CDM A;  1D1O A;  1RWY A;  2GGM A;  2HQW A;  4FQO A;  4D1E A;  2PVB A;  4ORC B;  1KK7 Z;  3SG4 A;  1PSB A;  1MXL C;  3TDU A;  1JBA A;  4I5N B;  1LKJ A;  2KNE A;  2WCF A;  4XYN A;  1DJZ A;  1OOJ A;  2LP3 A;  2F2P A;  2LMT A;  1B7T Z;  1FI5 A;  4QJ3 B;  1BG1 A;  3RLZ A;  3TUY C;  1Y1U A;  1AJ4 A;  1WRK A;  1XK4 C;  2G9B A;  3A8R A;  3TZ1 A;  1CLM A;  4C0J A;  1AK8 A;  1C7V A;  4MZK A;  3PAL A;  1QX5 B;  1BOC A;  1SCM B;  2LAN A;  1R2U A;  2JTZ A;  4WQ3 A;  1Y0V H;  4R1E A;  1NUB A;  2WOR A;  2ZFD A;  1XA5 A;  1KSO A;  4OVN F;  1PSR A;  1NCY A;  1V1F A;  1S6I A;  5G08 A;  1CFP A;  1OMV A;  3EKJ A;  1XFW O;  3WHU B;  3BUO B;  1ZOT B;  1UHN A;  3HX4 A;  5AXI A;  1A75 B;  1WLM A;  2F3Y A;  1QTX A;  4CID A;  2EHB A;  2CCM A;  2Y1M A;  2BCX A;  2BCB A;  1S5G Y;  1YX8 A;  2KHN A;  1W7J B;  3I5H B;  2JU0 A;  1QX7 A;  2L2E A;  2KBI A;  4DS7 A;  3TDI A;  2PRU A;  1ZMZ A;  3D0Y A;  2L51 A;  2LVV A;  1EL4 A;  2KI6 C;  2WC8 A;  4OR9 B;  5ER4 X;  1DGU A;  1KK7 Y;  2GV5 A;  4PE0 A;  3CR4 X;  4NDD A;  4ZCV A;  2BE4 A;  2BL0 C;  3CTN A;  4PE1 A;  5F6T A;  4ZCU A;  1SPY A;  3H4S E;  4AOM A;  2NLN A;  1QAT A;  3IQO A;  5I2L A;  1WLZ A;  2KGR A;  2CTN A;  3ZNI A;  2LV7 A;  5CSF A;  1DMO A;  1MQ1 A;  1H4B A;  1Y1A A;  1NSH A;  2LVK A;  3FWB A;  1M39 A;  1CFD A;  1YTZ C;  2SAS A;  4GAO A;  1X02 A;  1QLK A;  2JXL A;  4MRY A;  1CFC A;  4PE4 A;  1OMD A;  2G2B A;  3KF9 A;  4NDB A;  5HLO A;  2AUC A;  2DOQ A;  1KWO C;  2KI6 D;  2JQ6 A;  1SL9 A;  4BY4 A;  4GGF C;  1MXE A;  1ZFS A;  1N65 A;  2VRG A;  1RTP 1;  1F4O A;  1DTL A;  2KYF A;  1J7P A;  1K94 A;  1PVA A;  1SK6 D;  1XVJ A;  2K7B A;  2K7O A;  1OZO A;  1RRO A;  4YGB B;  4YRU A;  1EG4 A;  2OS8 B;  3BYA A;  2KI4 B;  3SG7 A;  4I5L B;  2L50 A;  2ISD A;  3K21 A;  4ETO A;  1CDL A;  1TNX A;  3KHE A;  3BUN B;  1NIW A;  1U5I B;  1MHO A;  3PN7 B;  1S26 D;  2BKH B;  2Y4Q A;  4YBH B;  3O6B A;  1JFK A;  2K0J A;  1NYA A;  3I5G C;  1IQ5 A;  1K95 A;  2QAC A;  5AFP A;  1KK8 B;  3NSO A;  4YGD B;  2SCP A;  1G8I A;  4U8D A;  2NXQ A;  1DF0 A;  2EC6 C;  1UHI A;  4PHN A;  1DVI A;  1F71 A;  2KSP A;  1AUI B;  1SRA A;  3WXA A;  2L0P A;  4GUK A;  1H8B A;  3FWC A;  1WDC B;  3VRO A;  1LA0 A;  1QS7 A;  1R6P A;  2LLT A;  2QPT A;  3JVT C;  1C07 A;  1F54 A;  1YR5 A;  4YGA A;  3TDZ A;  2LNK A;  2LUC A;  1YX7 A;  3SG5 A;  5B8I B;  1AP4 A;  2LE9 B;  1BMO A;  2JC2 A;  1TNQ A;  3HCM A;  1KSM A;  1NCZ A;  2KGB C;  2ZKM X;  1JUO A;  3E3R A;  3CGA A;  1PUL A;  4DCK A;  2BKI B;  1CMF A;  4PHJ A;  3GK2 A;  3JTD C;  1M46 A;  3SG6 A;  4CLN A;  5K89 A;  1NP8 A;  2Y5I A;  2KAX A;  4GFT A;  1QAS A;  5CSJ A;  2KOT A;  2FCD A;  2H2K A;  2FOT A;  1B8C A;  2WCB A;  3ICB A;  1UHJ A;  2JPT A;  3NSK A;  1G33 A;  3KEV A;  1YVL A;  1QLS A;  1TOP A;  2JNX A;  1QIW A;  1LIN A;  5DKQ A;  3TS5 C;  1Y1X A;  1BT6 A;  1PRW A;  1L2O C;  1PK0 D;  3LK0 A;  4A4C A;  1FI6 A;  2Q4U A;  2BBN A;  2JT0 A;  2PAL A;  3MSE B;  3AAJ A;  3PAT A;  4M2Q A;  1AHR A;  2JUL A;  2TN4 A;  5HKY A;  1QJT A;  4GNK B;  5I8N A;  1J1D A;  2E6W A;  2MA2 A;  3TUY B;  3CWG A;  1SW8 A;  4CFQ A;  2JWW A;  2L4I A;  4HRG A;  1KFU S;  1QVI Z;  3FS7 A;  2PAS A;  2LCP A;  1OZS A;  3CR5 X;  2CT9 A;  5HLV A;  2MBX A;  2OTG C;  1ALW A;  1IRJ A;  3CR2 A;  1A75 A;  2LLU A;  5J3X A;  2K7D A;  1JF0 A;  2LAP A;  3M0W A;  1GGW A;  1K9K A;  1TIZ A;  2D8N A;  4CFR A;  1IQ3 A;  2ZND A;  5HYD A;  2M0R A;  1CLB A;  3GK4 X;  1UHK A;  1K8U A;  2CBL A;  1V1G A;  2V53 A;  1NCX A;  2BBM A;  1S6J A;  1A03 A;  2JNF A;  1J55 A;  1SBJ A;  1DT7 B;  1YUR A;  2KFG A;  1TN4 A;  1BF5 A;  1BOD A;  4MZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...