2KYCA

Solution structure of ca-free chicken parvalbumin 3 (cpv3)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
108
structure length
108
Chain Sequence
SLTDILSPSDIAAALRDCQAPDSFSPKKFFQISGMSKKSSSQLKEIFRILDNDQSGFIEEDELKYFLQRFESGARVLTASETKTFLAAADHDGDGKIGAEEFQEMVQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Parvalbumin, thymic CPV3
publication title Solution structures of chicken parvalbumin 3 in the Ca(2+) -free and Ca(2+) -bound states.
pubmed doi rcsb
source organism Gallus gallus
total genus 10
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2010-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kycA00
1GJYA 5DKNA 2ZNDA 1A29A 5HKZA 1J1DA 5F6TA 1B8CA 1G4YR 1RFJA 3AAJA 4IL1A 5DKRA 1LVCD 1MXEA 1ALVA 2BKHB 4P2YB 1DJIA 1YX8A 3FWCA 4YGAA 4F0ZB 1EJ3A 2LHIA 1SK6D 2KFFA 2LMUA 1PK0D 1KWOC 1B7TY 1CMFA 2KYFA 1MWNA 2Y1MA 1MUXA 2F2OA 3OHMB 2KOTA 5I2LA 3MSEB 4PE0A 1CDMA 1BF5A 3KF9A 2B1UA 5ER5A 4HSZA 1D1OA 4WRIA 1RTP1 1TTXA 2H61C 1B1GA 2EHBA 3SG2A 2ZNEA 1AJ4A 1BR1B 1EH2A 1F4OA 1S6IA 1SBJA 1ZACA 4MLWA 4GGNA 1DMOA 1WLMA 3VROA 2Q4UA 3NSIA 2I18A 3AAKA 1IKUA 1Y1UA 2I94A 4NDBA 1LKJA 4HREE 1YRTB 1BG1A 2L98A 1W7JB 2JWWA 3TDZA 5JOLA 1SL8A 2MHHA 1KK8C 1ALWA 1B8LA 1UHNA 3KPXA 4NDDA 2CNPA 1QJTA 3OB2B 3FIAA 2IS9A 1J1EA 1F70A 5AFPA 2BECA 2CCMA 1A2XA 1K94A 2NCPA 5IBWA 4MSPA 1CFFA 4C0LA 3TUYB 1JC2A 3NSOA 1JSAA 4UPGA 5G08A 1HQVA 5AEQA 3EVVA 2JTTA 5PALA 2LVKA 4HRHA 4A4CA 2O5GA 3DD4A 1NYAA 2BCBA 3CZTX 1XVJA 1F8HA 4GUKA 3O4YA 1JBAA 4PE1A 1V1GA 2KGRA 3F45A 2JT8A 3BUOB 1JF2A 1FW4A 4MRYA 2JRFA 2L4HA 3NXAA 2I2RE 3I5FB 4MZKA 1YTZC 2K2FA 1IJ6A 3ZNIA 1EXRA 1MXLC 1E8AA 2H61A 1VRKA 2MLEC 3NSLA 1KSOA 1XO5A 4ZCUA 1PALA 1KWOB 1FPWA 2F2PA 4NDCA 1M39A 4ORBB 4PHNA 3I5GB 3O6BA 2M29A 3TS5C 2K7OA 4MRXA 2LVVA 2KYCA 1JFJA 2LE9B 4I5JA 1J7QA 2L4IA 4N1FA 1CDNA 1CDLA 1IG5A 1MHOA 4M2QA 2F33A 5CSFA 3PN7B 4PCWA 1TOPA 1Y6WA 2NCOA 2O60A 4XYNA 3BOWA 3EK4A 4MZJA 3LL8B 2LLTA 2FJUB 4GGFC 3LK0A 2KNEA 3D10A 2KQ6A 3BXKA 1LA3A 2M9GA 1AJ5A 1NCXA 2DOQA 1CLLA 1K2HA 1N65A 1TNQA 2M3WA 1CKKA 3LK1A 1RWYA 3BUWB 2PRUA 4DCKA 3PATA 1S5GZ 1IQ3A 5B8IB 3DVKA 1U5IA 3KHEA 4DRWA 1XFYO 3LCPC 1ZOTB 5D7FA 1SW8A 3PSRA 4OCIA 5CSJA 4WQ3A 1YRUB 2L5XB 1QLKA 1QVIY 2KI4C 2PALA 4I5LB 1F55A 2JXLA 3LLEA 1DJGA 1WRKA 1TNXA 2M8UA 1SKTA 1SY9A 3M0WA 2BCXA 4M2OA 1B4CA 1QV0A 1KK7Z 4ICBA 4YI9A 2M7LA 4QJ4B 5KU1A 4MN0A 3EVRA 1DJHA 1AUIB 1PRWA 4MVFA 4PHJA 1W7IB 3HX4A 3GK2A 2VRGA 4PE7A 3I5HC 1SL7A 2MA2A 3SG7A 1B47A 3BUXB 4N1GA 1NSHA 3SJSA 3D0YB 1K90D 1WY9A 4YRUA 1SCMB 4P5OE 3ZWHA 1TN4A 2KSPA 4I5KA 1EG3A 2JPTA 3KEVA 1XFXO 5HYDA 1BODA 1Y1XA 4GGFA 1XFZO 5CSNA 2BL0C 5JJGA 1CLBA 1K93D 5I2OA 3CWGA 1M45A 1SYMA 4ETOA 1QXPA 1RROA 2QACA 1TIZA 1SR6B 3BQ3A 1CFDA 2PASA 4YI8A 5AXIA 4CFRA 4AQJA 2LCPA 3I5IC 2COLB 2WORA 1LINA 5HKWA 2CBLA 4I5NB 3SG6A 1ZFSA 2AMIA 1QLSA 3GK4X 1SNLA 4JQ0D 1A03A 3WXAA 2JQ6A 4AOMA 5D69A 1JWDA 3K21A 1OZSA 5I2QA 1AVSA 1OE9B 2M49B 1J7PA 1IWQA 1L2OC 2K7BA 2L2EA 5CPVA 4PE4A 1DTLA 1IH0A 1OMDA 3O2PA 1EG4A 4MBEA 4BY4A 1NIWA 1WRZA 2KGBC 1YURA 4HRGA 2BE6A 1BU3A 2GV5A 2KAYA 4M2PA 4GBAA 5BPJA 2F3ZA 1YUUA 4BY5A 2L51A 5K89A 1FI6A 1TNWA 1F4QA 2LMTA 1K9KA 3O78A 1AK8A 2K0JA 4XJKA 2K8MB 3GOFA 2OTGC 3HCMA 4U8DA 1KQMB 3JTDC 2NLNA 2LHLA 1Y0VH 4GPLB 2CT9A 2Y1NA 4R1EA 3PALA 2KI4B 1OMRA 4PHKA 1GGWA 3DVEA 1B8RA 2JXCA 2HPSA 1S26D 1HT9A 1SMGA 4TNCA 3NSKA 4FQOA 1PVBA 3BUMB 3JVTC 4C0JA 1YUTA 1UUSA 2BKIB 1A75A 3FWBA 1DF0A 2WNDA 4YGDB 1G8IA 1TCFA 2LM5A 4A4BA 5AANA 2ZN9A 2BCAA 4GFTA 4YBHB 3TDIA 1H4BA 4Q04A 1ODBA 4CIDA 1M63B 4OR9B 1GGZA 3EKJA 4QJ3B 1PULA 5J3XA 2JNFA 3CR5X 1BOCA 2JT0A 1CLMA 3KO0A 1SPYA 2TN4A 3IQQA 1H8BA 1KQVA 1NCZA 1N2DA 2JU0A 2JZIA 1R2UA 1DF0B 4ORAB 4FTGA 2LUCA 4DS7A 5ER4X 1AP4A 1J7RA 2KAVA 1OMVA 1QTXA 3EK7A 2EGDA 5HLOA 4YGBB 1YVHA 2HQWA 2I7AA 5FYXA 3WHTB 4PDZA 3VRPA 2LVIA 1KK8B 4AQIA 1PVAA 1YR5A 1K96A 1YX7A 4YGCB 4E68A 1JUOA 3VRQA 4OKHA 1GQMA 1BR4B 1XA5A 1QV1A 3BOWB 1S6CA 1SL9A 1DJWA 1L2OB 2V53A 3CR2A 2KI6C 1NPQA 2Y5IA 4YGEB 1NX2A 3AKBA 2WCBA 1DT7B 4L9MA 3GK1A 2CTNA 1KFXL 2JC2A 4PHMA 2AAOA 3FS7A 1K8UA 3TDUA 2HQ8A 3WNXB 1C7WA 3H4SE 1KFUL 1X02A 1FF1A 1B7TZ 1DGUA 5CSIA 1S3PA 2D8NA 1G33A 2AUCA 2KBIA 2OTGB 2WOSA 3EVUA 4CPVA 1CFPA 1U5IB 1IJ5A 2G9BA 1LA0A 1CDPA 3VRRA 1CM4A 2OS8C 2ZRTA 4JPZB 1XK4C 1FI5A 1B9AA 1KFXS 1S5GY 1SCVA 3SG3A 1CB1A 1CTRA 1UHIA 2LP3A 4QJ5B 1KFUS 1QIWA 2EC6C 1YUSA 2FCDA 5TNCA 1J55A 3TZ1A 1S36A 2RGIA 1V1FA 2SCPA 2ISDA 3PM8A 2WC8A 2PVBA 1NX0A 4WQ2A 1KK7Y 3TS5B 2M1KB 2F8PA 1R6PA 2F3YA 3I5GC 1DJZA 1QX5B 1ZUZA 1NWDA 1QX2A 3PFVA 3OP0A 3CR4X 1RK9A 1UP5A 2LLUA 1M46A 2MRDA 1RECA 1MQ1A 5KSZA 3DF0A 3EKHA 3BUNB 1L7ZA 1DVIA 3CS1A 3PN7C 4NQGA 3SG4A 4DUQA 1SRAA 1IRJA 2HETA 4ORCB 2KFGA 1N0YA 2PMYA 4USLA 1UHHA 1WDCC 2G2BA 3C1VA 2LV7A 1BT6A 3BYAA 4N5XA 2NZ0A 1MF8B 1QASA 3ICBA 2H2KA 3DF0B 4OV2A 1CNPA 1JFKA 1JF0A 2Y4QA 1M31A 1NX1A 2P6BB 3IF7A 5I8NA 4CFQA 1XK4A 4JWQA 3SIAA 1J7OA 2A4JA 2WCFA 2M97A 1A4PA 1OZOA 4MEWA 2LP2A 1PSRA 2PSRA 1YVLA 4MZLA 3OB1B 5GQQC 1OSAA 2WCEA 2ZN8A 2ZFDA 1Q80A 1F71A 2LANA 3EK8A 1OOJA 4XJKB 2BE4A 2K7CA 1WRLA 5KTYA 2K2AA 3RLZA 3DVJA 2OS8B 1UWOA 2SASA 4GNKB 3AKAA 5HKYA 1TCOB 3I5HB 2GGMA 1QIVA 2MBXA 2KQYA 1DJYA 4DIRA 1RJVA 2EC6B 1UHJA 2M1UA 2M0RA 2LC5A 1F54A 1K9UA 1S1EA 2BBNA 1LXFC 1S6JA 2MLFC 1SCMC 1DGVA 2Q91A 3CLNA 3DVMA 3OX6A 4GAOA 3VRNA 2JTZA 5HLVA 1A75B 1BJFA 2GGZA 3WHUB 1UURA 2E6WA 4OVNF 2L50A 2E30A 2BL0B 1C07A 3E3RA 5DKQA 1ZMZA 2LUXA 4CLNA 1TRFA 2JNXA 2HF5A 1AHRA 3CTNA 4PALA 2LAPA 3PLFB 1KCYA 2K61A 1MR8A 2K7DA 2M7NA 3VGOA 2QPTA 3I5IB 5AERA 1CMGA 1SR6C 2BBMA 1XFVO 3A4UB 3OX5A 1IGVA 2ZRSA 2FCEA 1KSMA 1OQPA 1CFCA 2KDHA 2R2IA 1QVIZ 1UHKA 2LNKA 4ZCVA 4D1EA 1XFUO 1XFWO 4C0KA 2LLSA 1DJXA 1C7VA 1WDCB 3SIBA 3SG5A 3TUYC 2NXQA 2KHNA 1BLQA 1FBVA 2ZKMX 1QX7A 1NCYA 3IQOA 1EL4A 1NUBA 1IQ5A 2KBMA 2KAXA 3A8RA 1WLZA 3RM1A 1QATA 1NX3A 2JULA 3JTDB 2KFHA 1BMOA 1PSBA 2FOTA 2JT3A 3CGAA 1CM1A 1Y1AA 2CXJA 1KQMC 2OPOA 2KI6D 2MAZA 2L0PA 1TNPA 2LVJA 1K9PA 3QRXA 3I5FC 2LMVA 1K95A 1XYDA 2JOJA 2MJWB 3D0YA 3JVTB 1NP8A 1QS7A
chains in the Genus database with same CATH superfamily
3FE8A 1GJYA 5DKNA 2ZNDA 1A29A 5HKZA 1J1DA 5F6TA 1B8CA 1G4YR 1RFJA 3AAJA 4IL1A 5DKRA 1LVCD 1MXEA 1ALVA 2BKHB 4P2YB 1DJIA 1YX8A 3FWCA 4YGAA 4F0ZB 1EJ3A 2LHIA 1SK6D 2KFFA 2LMUA 1PK0D 1KWOC 2WCJA 1B7TY 1CMFA 2KYFA 1MWNA 2Y1MA 1MUXA 2F2OA 3O4XA 3OHMB 2KOTA 5I2LA 3CDNA 3MSEB 1CDMA 4PE0A 1BF5A 1C3ZA 3KF9A 2B1UA 5ER5A 4HSZA 1D1OA 4WRIA 1RTP1 1TTXA 2H61C 1B1GA 3BFHA 2EHBA 3DY9A 3SG2A 2ZNEA 1AJ4A 1BR1B 1EH2A 1F4OA 1T14A 1S6IA 1SBJA 3UNWA 1ZACA 4MLWA 4GGNA 1DMOA 1WLMA 3VROA 2Q4UA 3NSIA 2I18A 3AAKA 1IKUA 1Y1UA 2I94A 4NDBA 1LKJA 4HREE 1YRTB 1BG1A 2L98A 1W7JB 2JWWA 3TDZA 5JOLA 1SL8A 2MHHA 3B86A 1KK8C 3FE9A 1ALWA 4JKTA 1B8LA 1UHNA 3KPXA 4NDDA 2CNPA 1QJTA 3OB2B 3FIAA 2IS9A 1J1EA 1F70A 5AFPA 2BECA 3UO9A 2CCMA 1A2XA 1K94A 2NCPA 5IBWA 4MSPA 1CFFA 4C0LA 5D3OA 3TUYB 1JC2A 3NSOA 3S0DA 4UPGA 1JSAA 5G08A 1HQVA 5AEQA 3EVVA 2JTTA 5PALA 2LVKA 2P71A 2H8VA 2WCLA 4HRHA 4A4CA 2O5GA 3DD4A 1NYAA 2BCBA 3CZTX 1XVJA 3IVTA 1F8HA 1C3YA 4GUKA 3O4YA 1JBAA 4PE1A 1V1GA 2KGRA 3F45A 2JT8A 3BUOB 1JF2A 1FW4A 1LS8A 4MRYA 2JRFA 2L4HA 3NXAA 2I2RE 3I5FB 2L2CA 4MZKA 1YTZC 2K2FA 1IJ6A 3ZNIA 1EXRA 1MXLC 1E8AA 2H61A 1VRKA 1XFRA 2MLEC 3NSLA 1KSOA 1IIOA 1XO5A 4ZCUA 3R72A 1DEKA 1PALA 1KWOB 1FPWA 2F2PA 4NDCA 1M39A 4ORBB 4PHNA 3I5GB 3S0EA 3D77A 3O6BA 2M29A 3TS5C 3CZ2A 2K7OA 4MRXA 2LVVA 2KPHA 2KYCA 1JFJA 2LE9B 4I5JA 1J7QA 2L4IA 4N1FA 1CDNA 1CDLA 1IG5A 1MHOA 4M2QA 2F33A 5CSFA 3PN7B 2KLEA 4PCWA 1TOPA 1Y6WA 2NCOA 3NHTA 5FI6A 4PT1A 2O60A 4XYNA 3BOWA 3EK4A 4MZJA 3LL8B 2LLTA 2FJUB 4GGFC 3LK0A 2KNEA 3D10A 2KQ6A 3BXKA 1LA3A 2M9GA 2KLDA 1AJ5A 1NCXA 3S0BA 2DOQA 1CLLA 1K2HA 1N65A 1TNQA 2M3WA 3R1OA 1CKKA 3B88A 3LK1A 3NGVA 1RWYA 3BUWB 2PRUA 3VB1A 4DCKA 3PATA 1S5GZ 1IQ3A 4INWA 5B8IB 3DVKA 1U5IA 3KHEA 4DRWA 1XFYO 3LCPC 2PQLA 3S0AA 1ZOTB 5D7FA 1SW8A 3PSRA 5HL1A 4OCIA 5CSJA 4WQ3A 1YRUB 2L5XB 1QLKA 1QVIY 2KI4C 2PALA 4I5LB 1F55A 2JXLA 3LLEA 1DJGA 2ERBA 1WRKA 3L47A 1TNXA 3L4LA 2M8UA 1SKTA 1SY9A 3M0WA 2BCXA 4M2OA 1B4CA 1QV0A 1KK7Z 4ICBA 4YI9A 2M7LA 4QJ4B 5KU1A 4MN0A 3D73A 3EVRA 1DJHA 1AUIB 1PRWA 4MVFA 4PHJA 1W7IB 3HX4A 3GK2A 2VRGA 4PE7A 3I5HC 1SL7A 2MA2A 3SG7A 1B47A 3BUXB 4N1GA 1NSHA 3SJSA 3D0YB 1Z2CB 1K90D 1WY9A 4YRUA 1SCMB 4P5OE 3ZWHA 1TN4A 2KSPA 4I5KA 1EG3A 2JPTA 3KEVA 1XFXO 5HYDA 1BODA 1Y1XA 4GGFA 1XFZO 5CSNA 1OOFA 2BL0C 5JJGA 1CLBA 1K93D 5I2OA 3CWGA 1M45A 1SYMA 4ETOA 1QXPA 1RROA 2YGUA 2QACA 1TIZA 1SR6B 3BQ3A 1CFDA 2PASA 4YI8A 5AXIA 4CFRA 3QMEA 4AQJA 2LCPA 3I5IC 2COLB 2WORA 1LINA 5HKWA 2CBLA 4I5NB 3SG6A 1ZFSA 2AMIA 1QLSA 3GK4X 1SNLA 4JQ0D 1A03A 3WXAA 2JQ6A 4AOMA 5D69A 2GTEA 3K21A 1JWDA 1OZSA 3S0GA 5I2QA 1AVSA 1OE9B 2M49B 1J7PA 1IWQA 1L2OC 2K7BA 2L2EA 5CPVA 4PE4A 1DTLA 1IH0A 1OMDA 3BJHA 1EG4A 3O2PA 4MBEA 1NIWA 4BY4A 1WRZA 2KGBC 1YURA 4HRGA 2BE6A 2QEOA 1BU3A 2GV5A 2KAYA 4M2PA 2FJYA 4GBAA 2F3ZA 1YUUA 4BY5A 2L51A 5BPJA 5K89A 1FI6A 1TNWA 1F4QA 2LMTA 1K9KA 3O78A 1AK8A 2K0JA 4XJKA 1QWVA 2K8MB 2QEBA 3GOFA 2OTGC 3HCMA 4U8DA 1KQMB 3JTDC 2NLNA 2LHLA 1Y0VH 4GPLB 2CT9A 2Y1NA 4R1EA 3PALA 2KI4B 1OMRA 4PHKA 1GGWA 3DVEA 1B8RA 2JXCA 2HPSA 3DYEA 1OOGA 1S26D 1HT9A 1SMGA 4TNCA 3NSKA 4FQOA 1PVBA 3BUMB 3JVTC 4C0JA 1YUTA 1UUSA 2BKIB 1A75A 3FWBA 1DF0A 2WNDA 4YGDB 1G8IA 1TCFA 2LM5A 4A4BA 5AANA 2ZN9A 2BCAA 4GFTA 4YBHB 3TDIA 1H4BA 4Q04A 1ODBA 4CIDA 2JPOA 1M63B 4OR9B 1GGZA 3OGNA 3EKJA 4QJ3B 1PULA 5J3XA 2JNFA 3CR5X 1BOCA 1OW4A 2JT0A 3CZ0A 1CLMA 3KO0A 2QEHA 1SPYA 2TN4A 3IQQA 4OZDA 1H8BA 1NCZA 1N2DA 1KQVA 2JU0A 2JZIA 1R2UA 1DF0B 4ORAB 4FTGA 2LUCA 4DS7A 5ER4X 1AP4A 1J7RA 2KAVA 2WCMA 3K1EA 1OMVA 1QTXA 4F7FA 3EK7A 2EGDA 5HLOA 2QEVA 4YGBB 1YVHA 2HQWA 2I7AA 5FYXA 3WHTB 4PDZA 3VRPA 2LVIA 1KK8B 4AQIA 1PVAA 1YR5A 3SS5A 1K96A 1YX7A 4IJ7A 4YGCB 1JUOA 4E68A 3VRQA 4OKHA 1GQMA 1BR4B 1XA5A 1QV1A 3BOWB 3OBVA 1S6CA 1ORGA 1SL9A 4JD9A 1DJWA 1L2OB 2V53A 3CR2A 2KI6C 1NPQA 2Y5IA 4YGEB 1NX2A 3Q8IA 3AKBA 2WCBA 1DT7B 4L9MA 3GK1A 2CTNA 1KFXL 2JC2A 4PHMA 2AAOA 3FS7A 1K8UA 3TDUA 2HQ8A 3WNXB 1C7WA 3H4SE 1KFUL 3CYZA 1X02A 1FF1A 1B7TZ 1DGUA 5CSIA 1S3PA 2D8NA 1G33A 2AUCA 2KBIA 2OTGB 2WOSA 3EVUA 4CPVA 1CFPA 1U5IB 1IJ5A 2G9BA 1LA0A 1CDPA 3VRRA 1CM4A 2OS8C 2ZRTA 4JPZB 1XK4C 1FI5A 1B9AA 1GM0A 1KFXS 1S5GY 1SCVA 3SG3A 1Z4HA 1CTRA 1CB1A 1UHIA 1TUZA 1W9ZA 2LP3A 4QJ5B 1KFUS 1QIWA 2EC6C 1YUSA 2FCDA 5TNCA 1J55A 2QDIA 3TZ1A 1S36A 3SS4A 2RGIA 1V1FA 2SCPA 2ISDA 3PM8A 2WC8A 2PVBA 1NX0A 4WQ2A 1KK7Y 2BNXA 3TS5B 2M1KB 2F8PA 1R6PA 2F3YA 3I5GC 1DJZA 1OOIX 1QX5B 1ZUZA 1NWDA 1QX2A 3PFVA 3R1PA 3OP0A 3CR4X 1RK9A 1UP5A 2LLUA 1M46A 2MRDA 2P70A 1RECA 1MQ1A 5KSZA 3DF0A 5EL2A 3EKHA 3BUNB 1L7ZA 1DVIA 3CS1A 3PN7C 4FQTA 4NQGA 3SG4A 4DUQA 1SRAA 3R1VA 1IRJA 2HETA 4ORCB 4KYNA 1DELA 2WC6A 2KFGA 1N0YA 2PMYA 4USLA 2WCHA 1UHHA 1WDCC 2G2BA 3C1VA 2LV7A 1BT6A 3BYAA 4N5XA 2NZ0A 1MF8B 1QASA 3B87A 2H2KA 3ICBA 3DF0B 2L5YA 4OV2A 3N7HA 5I94A 3NHIA 1CNPA 1JFKA 1JF0A 2Y4QA 1M31A 1NX1A 2P6BB 3FE6A 3IF7A 3B6XA 3SS3A 5I8NA 4CFQA 1XK4A 4JWQA 3SIAA 1J7OA 2A4JA 2WCFA 2M97A 1A4PA 1OZOA 4MEWA 2LP2A 1PSRA 2PSRA 1YVLA 2K60A 4MZLA 3D76A 3OB1B 5GQQC 1OSAA 2WCEA 2ZN8A 3BFAA 3PJIA 2ZFDA 1Q80A 1SSEB 2LANA 3EK8A 1OOJA 4XJKB 1F71A 2BE4A 2K7CA 1WRLA 5KTYA 2K2AA 3B7AA 3RLZA 3PM2A 3DVJA 2OS8B 1UWOA 2SASA 4GNKB 3AKAA 5HKYA 1TCOB 3I5HB 2GGMA 1QIVA 2MBXA 2KQYA 1DJYA 4DIRA 3CZ1A 2WC5A 1OOHA 3D74A 1RJVA 2EC6B 1UHJA 2M1UA 2M0RA 2LC5A 1F54A 1K9UA 1S1EA 2BBNA 1LXFC 1S6JA 2MLFC 1SCMC 1DGVA 2Q91A 3CLNA 3DVMA 3OX6A 4GAOA 1DQEA 2JTZA 5HLVA 3VRNA 1A75B 1BJFA 2GGZA 3WHUB 1UURA 2E6WA 4OVNF 3RZSA 3V2LA 2L50A 2E30A 2BL0B 1C07A 3E3RA 5DKQA 2PYQA 1ZMZA 2LUXA 4CLNA 1TRFA 3DXLA 3S0FA 2JNXA 2HF5A 1AHRA 3CTNA 4PALA 5FI7A 2LAPA 3PLFB 1KCYA 2K61A 1MR8A 2K7DA 2M7NA 3EG5B 2QPTA 3I5IB 3VGOA 5AERA 1CMGA 1SR6C 2BBMA 1XFVO 3A4UB 3OX5A 1IGVA 5DICA 3L4AA 2ZRSA 2FCEA 1KSMA 5FI2A 1OQPA 1CFCA 2KDHA 2R2IA 1QVIZ 1UHKA 2LNKA 1TUJA 2WCKA 3CABA 4ZCVA 1TWOA 1XFUO 4D1EA 1XFWO 4C0KA 2LLSA 1DJXA 1C7VA 1WDCB 3SIBA 3SG5A 3TUYC 2NXQA 2KHNA 1BLQA 1FBVA 2ZKMX 1QX7A 1NCYA 3IQOA 1EL4A 1NUBA 1IQ5A 2KBMA 2KAXA 3A8RA 1WLZA 3RM1A 1QATA 1NX3A 2JULA 3D78A 3JTDB 2KFHA 3D75A 1BMOA 1PSBA 2FOTA 2JT3A 3CGAA 2BAPA 1CM1A 1P28A 1Y1AA 2CXJA 1KQMC 2OPOA 2KI6D 2MAZA 3BFBA 2L0PA 4INXA 1DC1A 1TNPA 2LVJA 3DZTA 1K9PA 3QRXA 3I5FC 2LMVA 1K95A 1XYDA 2JOJA 2MJWB 3D0YA 3JVTB 1NP8A 1QS7A
chains in the Genus database with same CATH topology
1GJYA 5DKNA 2ZNDA 1A29A 5HKZA 1J1DA 5F6TA 1B8CA 1G4YR 1RFJA 3AAJA 4IL1A 5DKRA 1LVCD 1MXEA 1ALVA 2BKHB 4P2YB 1DJIA 1YX8A 3FWCA 4YGAA 4F0ZB 1EJ3A 2LHIA 1SK6D 2KFFA 2LMUA 1PK0D 1KWOC 1B7TY 1CMFA 2KYFA 1MWNA 2Y1MA 1MUXA 2F2OA 3OHMB 2KOTA 5I2LA 3MSEB 4PE0A 1CDMA 1BF5A 3KF9A 2B1UA 5ER5A 4HSZA 1D1OA 4WRIA 1RTP1 1TTXA 2H61C 1B1GA 2EHBA 3SG2A 2ZNEA 1AJ4A 1BR1B 1EH2A 1F4OA 1S6IA 1SBJA 1ZACA 4MLWA 4GGNA 1DMOA 1WLMA 3VROA 2Q4UA 3NSIA 2I18A 3AAKA 1IKUA 1Y1UA 2I94A 4NDBA 1LKJA 4HREE 1YRTB 1BG1A 2L98A 1W7JB 2JWWA 3TDZA 5JOLA 1SL8A 2MHHA 1KK8C 1ALWA 1B8LA 1UHNA 3KPXA 4NDDA 2CNPA 1QJTA 3OB2B 3FIAA 2IS9A 1J1EA 1F70A 5AFPA 2BECA 2CCMA 1A2XA 1K94A 2NCPA 5IBWA 4MSPA 1CFFA 4C0LA 3TUYB 1JC2A 3NSOA 1JSAA 4UPGA 5G08A 1HQVA 5AEQA 3EVVA 2JTTA 5PALA 2LVKA 4HRHA 4A4CA 2O5GA 3DD4A 1NYAA 2BCBA 3CZTX 1XVJA 1F8HA 4GUKA 3O4YA 1JBAA 4PE1A 1V1GA 2KGRA 3F45A 2JT8A 3BUOB 1JF2A 1FW4A 4MRYA 2JRFA 2L4HA 3NXAA 2I2RE 3I5FB 4MZKA 1YTZC 2K2FA 1IJ6A 3ZNIA 1EXRA 1MXLC 1E8AA 2H61A 1VRKA 2MLEC 3NSLA 1KSOA 1XO5A 4ZCUA 1PALA 1KWOB 1FPWA 2F2PA 4NDCA 1M39A 4ORBB 4PHNA 3I5GB 3O6BA 2M29A 3TS5C 2K7OA 4MRXA 2LVVA 2KYCA 1JFJA 2LE9B 4I5JA 1J7QA 2L4IA 4N1FA 1CDNA 1CDLA 1IG5A 1MHOA 4M2QA 2F33A 5CSFA 3PN7B 4PCWA 1TOPA 1Y6WA 2NCOA 2O60A 4XYNA 3BOWA 3EK4A 4MZJA 3LL8B 2LLTA 2FJUB 4GGFC 3LK0A 2KNEA 3D10A 2KQ6A 3BXKA 1LA3A 2M9GA 1AJ5A 1NCXA 2DOQA 1CLLA 1K2HA 1N65A 1TNQA 2M3WA 1CKKA 3LK1A 1RWYA 3BUWB 2PRUA 4DCKA 3PATA 1S5GZ 1IQ3A 5B8IB 3DVKA 1U5IA 3KHEA 4DRWA 1XFYO 3LCPC 1ZOTB 5D7FA 1SW8A 3PSRA 4OCIA 5CSJA 4WQ3A 1YRUB 2L5XB 1QLKA 1QVIY 2KI4C 2PALA 4I5LB 1F55A 2JXLA 3LLEA 1DJGA 1WRKA 1TNXA 2M8UA 1SKTA 1SY9A 3M0WA 2BCXA 4M2OA 1B4CA 1QV0A 1KK7Z 4ICBA 4YI9A 2M7LA 4QJ4B 5KU1A 4MN0A 3EVRA 1DJHA 1AUIB 1PRWA 4MVFA 4PHJA 1W7IB 3HX4A 3GK2A 2VRGA 4PE7A 3I5HC 1SL7A 2MA2A 3SG7A 1B47A 3BUXB 4N1GA 1NSHA 3SJSA 3D0YB 1K90D 1WY9A 4YRUA 1SCMB 4P5OE 3ZWHA 1TN4A 2KSPA 4I5KA 1EG3A 2JPTA 3KEVA 1XFXO 5HYDA 1BODA 1Y1XA 4GGFA 1XFZO 5CSNA 2BL0C 5JJGA 1CLBA 1K93D 5I2OA 3CWGA 1M45A 1SYMA 4ETOA 1QXPA 1RROA 2QACA 1TIZA 1SR6B 3BQ3A 1CFDA 2PASA 4YI8A 5AXIA 4CFRA 4AQJA 2LCPA 3I5IC 2COLB 2WORA 1LINA 5HKWA 2CBLA 4I5NB 3SG6A 1ZFSA 2AMIA 1QLSA 3GK4X 1SNLA 4JQ0D 1A03A 3WXAA 2JQ6A 4AOMA 5D69A 1JWDA 3K21A 1OZSA 5I2QA 1AVSA 1OE9B 2M49B 1J7PA 1IWQA 1L2OC 2K7BA 2L2EA 5CPVA 4PE4A 1DTLA 1IH0A 1OMDA 3O2PA 1EG4A 4MBEA 4BY4A 1NIWA 1WRZA 2KGBC 1YURA 4HRGA 2BE6A 1BU3A 2GV5A 2KAYA 4M2PA 4GBAA 5BPJA 2F3ZA 1YUUA 4BY5A 2L51A 5K89A 1FI6A 1TNWA 1F4QA 2LMTA 1K9KA 3O78A 1AK8A 2K0JA 4XJKA 2K8MB 3GOFA 2OTGC 3HCMA 4U8DA 1KQMB 3JTDC 2NLNA 2LHLA 1Y0VH 4GPLB 2CT9A 2Y1NA 4R1EA 3PALA 2KI4B 1OMRA 4PHKA 1GGWA 3DVEA 1B8RA 2JXCA 2HPSA 1S26D 1HT9A 1SMGA 4TNCA 3NSKA 4FQOA 1PVBA 3BUMB 3JVTC 4C0JA 1YUTA 1UUSA 2BKIB 1A75A 3FWBA 1DF0A 2WNDA 4YGDB 1G8IA 1TCFA 2LM5A 4A4BA 5AANA 2ZN9A 2BCAA 4GFTA 4YBHB 3TDIA 1H4BA 4Q04A 1ODBA 4CIDA 1M63B 4OR9B 1GGZA 3EKJA 4QJ3B 1PULA 5J3XA 2JNFA 3CR5X 1BOCA 2JT0A 1CLMA 3KO0A 1SPYA 2TN4A 3IQQA 1H8BA 1KQVA 1NCZA 1N2DA 2JU0A 2JZIA 1R2UA 1DF0B 4ORAB 4FTGA 2LUCA 4DS7A 5ER4X 1AP4A 1J7RA 2KAVA 1OMVA 1QTXA 3EK7A 2EGDA 5HLOA 4YGBB 1YVHA 2HQWA 2I7AA 5FYXA 3WHTB 4PDZA 3VRPA 2LVIA 1KK8B 4AQIA 1PVAA 1YR5A 1K96A 1YX7A 4YGCB 4E68A 1JUOA 3VRQA 4OKHA 1GQMA 1BR4B 1XA5A 1QV1A 3BOWB 1S6CA 1SL9A 1DJWA 1L2OB 2V53A 3CR2A 2KI6C 1NPQA 2Y5IA 4YGEB 1NX2A 3AKBA 2WCBA 1DT7B 4L9MA 3GK1A 2CTNA 1KFXL 2JC2A 4PHMA 2AAOA 3FS7A 1K8UA 3TDUA 2HQ8A 3WNXB 1C7WA 3H4SE 1KFUL 1X02A 1FF1A 1B7TZ 1DGUA 5CSIA 1S3PA 2D8NA 1G33A 2AUCA 2KBIA 2OTGB 2WOSA 3EVUA 4CPVA 1CFPA 1U5IB 1IJ5A 2G9BA 1LA0A 1CDPA 3VRRA 1CM4A 2OS8C 2ZRTA 4JPZB 1XK4C 1FI5A 1B9AA 1KFXS 1S5GY 1SCVA 3SG3A 1CB1A 1CTRA 1UHIA 2LP3A 4QJ5B 1KFUS 1QIWA 2EC6C 1YUSA 2FCDA 5TNCA 1J55A 3TZ1A 1S36A 2RGIA 1V1FA 2SCPA 2ISDA 3PM8A 2WC8A 2PVBA 1NX0A 4WQ2A 1KK7Y 3TS5B 2M1KB 2F8PA 1R6PA 2F3YA 3I5GC 1DJZA 1QX5B 1ZUZA 1NWDA 1QX2A 3PFVA 3OP0A 3CR4X 1RK9A 1UP5A 2LLUA 1M46A 2MRDA 1RECA 1MQ1A 5KSZA 3DF0A 3EKHA 3BUNB 1L7ZA 1DVIA 3CS1A 3PN7C 4NQGA 3SG4A 4DUQA 1SRAA 1IRJA 2HETA 4ORCB 2KFGA 1N0YA 2PMYA 4USLA 1UHHA 1WDCC 2G2BA 3C1VA 2LV7A 1BT6A 3BYAA 4N5XA 2NZ0A 1MF8B 1QASA 3ICBA 2H2KA 3DF0B 4OV2A 1CNPA 1JFKA 1JF0A 2Y4QA 1M31A 1NX1A 2P6BB 3IF7A 5I8NA 4CFQA 1XK4A 4JWQA 3SIAA 1J7OA 2A4JA 2WCFA 2M97A 1A4PA 1OZOA 4MEWA 2LP2A 1PSRA 2PSRA 1YVLA 4MZLA 3OB1B 5GQQC 1OSAA 2WCEA 2ZN8A 2ZFDA 1Q80A 1F71A 2LANA 3EK8A 1OOJA 4XJKB 2BE4A 2K7CA 1WRLA 5KTYA 2K2AA 3RLZA 3DVJA 2OS8B 1UWOA 2SASA 4GNKB 3AKAA 5HKYA 1TCOB 3I5HB 2GGMA 1QIVA 2MBXA 2KQYA 1DJYA 4DIRA 1RJVA 2EC6B 1UHJA 2M1UA 2M0RA 2LC5A 1F54A 1K9UA 1S1EA 2BBNA 1LXFC 1S6JA 2MLFC 1SCMC 1DGVA 2Q91A 3CLNA 3DVMA 3OX6A 4GAOA 3VRNA 2JTZA 5HLVA 1A75B 1BJFA 2GGZA 3WHUB 1UURA 2E6WA 4OVNF 2L50A 2E30A 2BL0B 1C07A 3E3RA 5DKQA 1ZMZA 2LUXA 4CLNA 1TRFA 2JNXA 2HF5A 1AHRA 3CTNA 4PALA 2LAPA 3PLFB 1KCYA 2K61A 1MR8A 2K7DA 2M7NA 3VGOA 2QPTA 3I5IB 5AERA 1CMGA 1SR6C 2BBMA 1XFVO 3A4UB 3OX5A 1IGVA 2ZRSA 2FCEA 1KSMA 1OQPA 1CFCA 2KDHA 2R2IA 1QVIZ 1UHKA 2LNKA 4ZCVA 4D1EA 1XFUO 1XFWO 4C0KA 2LLSA 1DJXA 1C7VA 1WDCB 3SIBA 3SG5A 3TUYC 2NXQA 2KHNA 1BLQA 1FBVA 2ZKMX 1QX7A 1NCYA 3IQOA 1EL4A 1NUBA 1IQ5A 2KBMA 2KAXA 3A8RA 1WLZA 3RM1A 1QATA 1NX3A 2JULA 3JTDB 2KFHA 1BMOA 1PSBA 2FOTA 2JT3A 3CGAA 1CM1A 1Y1AA 2CXJA 1KQMC 2OPOA 2KI6D 2MAZA 2L0PA 1TNPA 2LVJA 1K9PA 3QRXA 3I5FC 2LMVA 1K95A 1XYDA 2JOJA 2MJWB 3D0YA 3JVTB 1NP8A 1QS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJY A;  5DKN A;  2ZND A;  1A29 A;  5HKZ A;  1J1D A;  5F6T A;  1B8C A;  1G4Y R;  1RFJ A;  3AAJ A;  4IL1 A;  5DKR A;  1LVC D;  1MXE A;  1ALV A;  2BKH B;  4P2Y B;  1DJI A;  1YX8 A;  3FWC A;  4YGA A;  4F0Z B;  1EJ3 A;  2LHI A;  1SK6 D;  2KFF A;  2LMU A;  1PK0 D;  1KWO C;  1B7T Y;  1CMF A;  2KYF A;  1MWN A;  2Y1M A;  1MUX A;  2F2O A;  3OHM B;  2KOT A;  5I2L A;  3MSE B;  4PE0 A;  1CDM A;  1BF5 A;  3KF9 A;  2B1U A;  5ER5 A;  4HSZ A;  1D1O A;  4WRI A;  1RTP 1;  1TTX A;  2H61 C;  1B1G A;  2EHB A;  3SG2 A;  2ZNE A;  1AJ4 A;  1BR1 B;  1EH2 A;  1F4O A;  1S6I A;  1SBJ A;  1ZAC A;  4MLW A;  4GGN A;  1DMO A;  1WLM A;  3VRO A;  2Q4U A;  3NSI A;  2I18 A;  3AAK A;  1IKU A;  1Y1U A;  2I94 A;  4NDB A;  1LKJ A;  4HRE E;  1YRT B;  1BG1 A;  2L98 A;  1W7J B;  2JWW A;  3TDZ A;  5JOL A;  1SL8 A;  2MHH A;  1KK8 C;  1ALW A;  1B8L A;  1UHN A;  3KPX A;  4NDD A;  2CNP A;  1QJT A;  3OB2 B;  3FIA A;  2IS9 A;  1J1E A;  1F70 A;  5AFP A;  2BEC A;  2CCM A;  1A2X A;  1K94 A;  2NCP A;  5IBW A;  4MSP A;  1CFF A;  4C0L A;  3TUY B;  1JC2 A;  3NSO A;  1JSA A;  4UPG A;  5G08 A;  1HQV A;  5AEQ A;  3EVV A;  2JTT A;  5PAL A;  2LVK A;  4HRH A;  4A4C A;  2O5G A;  3DD4 A;  1NYA A;  2BCB A;  3CZT X;  1XVJ A;  1F8H A;  4GUK A;  3O4Y A;  1JBA A;  4PE1 A;  1V1G A;  2KGR A;  3F45 A;  2JT8 A;  3BUO B;  1JF2 A;  1FW4 A;  4MRY A;  2JRF A;  2L4H A;  3NXA A;  2I2R E;  3I5F B;  4MZK A;  1YTZ C;  2K2F A;  1IJ6 A;  3ZNI A;  1EXR A;  1MXL C;  1E8A A;  2H61 A;  1VRK A;  2MLE C;  3NSL A;  1KSO A;  1XO5 A;  4ZCU A;  1PAL A;  1KWO B;  1FPW A;  2F2P A;  4NDC A;  1M39 A;  4ORB B;  4PHN A;  3I5G B;  3O6B A;  2M29 A;  3TS5 C;  2K7O A;  4MRX A;  2LVV A;  2KYC A;  1JFJ A;  2LE9 B;  4I5J A;  1J7Q A;  2L4I A;  4N1F A;  1CDN A;  1CDL A;  1IG5 A;  1MHO A;  4M2Q A;  2F33 A;  5CSF A;  3PN7 B;  4PCW A;  1TOP A;  1Y6W A;  2NCO A;  2O60 A;  4XYN A;  3BOW A;  3EK4 A;  4MZJ A;  3LL8 B;  2LLT A;  2FJU B;  4GGF C;  3LK0 A;  2KNE A;  3D10 A;  2KQ6 A;  3BXK A;  1LA3 A;  2M9G A;  1AJ5 A;  1NCX A;  2DOQ A;  1CLL A;  1K2H A;  1N65 A;  1TNQ A;  2M3W A;  1CKK A;  3LK1 A;  1RWY A;  3BUW B;  2PRU A;  4DCK A;  3PAT A;  1S5G Z;  1IQ3 A;  5B8I B;  3DVK A;  1U5I A;  3KHE A;  4DRW A;  1XFY O;  3LCP C;  1ZOT B;  5D7F A;  1SW8 A;  3PSR A;  4OCI A;  5CSJ A;  4WQ3 A;  1YRU B;  2L5X B;  1QLK A;  1QVI Y;  2KI4 C;  2PAL A;  4I5L B;  1F55 A;  2JXL A;  3LLE A;  1DJG A;  1WRK A;  1TNX A;  2M8U A;  1SKT A;  1SY9 A;  3M0W A;  2BCX A;  4M2O A;  1B4C A;  1QV0 A;  1KK7 Z;  4ICB A;  4YI9 A;  2M7L A;  4QJ4 B;  5KU1 A;  4MN0 A;  3EVR A;  1DJH A;  1AUI B;  1PRW A;  4MVF A;  4PHJ A;  1W7I B;  3HX4 A;  3GK2 A;  2VRG A;  4PE7 A;  3I5H C;  1SL7 A;  2MA2 A;  3SG7 A;  1B47 A;  3BUX B;  4N1G A;  1NSH A;  3SJS A;  3D0Y B;  1K90 D;  1WY9 A;  4YRU A;  1SCM B;  4P5O E;  3ZWH A;  1TN4 A;  2KSP A;  4I5K A;  1EG3 A;  2JPT A;  3KEV A;  1XFX O;  5HYD A;  1BOD A;  1Y1X A;  4GGF A;  1XFZ O;  5CSN A;  2BL0 C;  5JJG A;  1CLB A;  1K93 D;  5I2O A;  3CWG A;  1M45 A;  1SYM A;  4ETO A;  1QXP A;  1RRO A;  2QAC A;  1TIZ A;  1SR6 B;  3BQ3 A;  1CFD A;  2PAS A;  4YI8 A;  5AXI A;  4CFR A;  4AQJ A;  2LCP A;  3I5I C;  2COL B;  2WOR A;  1LIN A;  5HKW A;  2CBL A;  4I5N B;  3SG6 A;  1ZFS A;  2AMI A;  1QLS A;  3GK4 X;  1SNL A;  4JQ0 D;  1A03 A;  3WXA A;  2JQ6 A;  4AOM A;  5D69 A;  1JWD A;  3K21 A;  1OZS A;  5I2Q A;  1AVS A;  1OE9 B;  2M49 B;  1J7P A;  1IWQ A;  1L2O C;  2K7B A;  2L2E A;  5CPV A;  4PE4 A;  1DTL A;  1IH0 A;  1OMD A;  3O2P A;  1EG4 A;  4MBE A;  4BY4 A;  1NIW A;  1WRZ A;  2KGB C;  1YUR A;  4HRG A;  2BE6 A;  1BU3 A;  2GV5 A;  2KAY A;  4M2P A;  4GBA A;  5BPJ A;  2F3Z A;  1YUU A;  4BY5 A;  2L51 A;  5K89 A;  1FI6 A;  1TNW A;  1F4Q A;  2LMT A;  1K9K A;  3O78 A;  1AK8 A;  2K0J A;  4XJK A;  2K8M B;  3GOF A;  2OTG C;  3HCM A;  4U8D A;  1KQM B;  3JTD C;  2NLN A;  2LHL A;  1Y0V H;  4GPL B;  2CT9 A;  2Y1N A;  4R1E A;  3PAL A;  2KI4 B;  1OMR A;  4PHK A;  1GGW A;  3DVE A;  1B8R A;  2JXC A;  2HPS A;  1S26 D;  1HT9 A;  1SMG A;  4TNC A;  3NSK A;  4FQO A;  1PVB A;  3BUM B;  3JVT C;  4C0J A;  1YUT A;  1UUS A;  2BKI B;  1A75 A;  3FWB A;  1DF0 A;  2WND A;  4YGD B;  1G8I A;  1TCF A;  2LM5 A;  4A4B A;  5AAN A;  2ZN9 A;  2BCA A;  4GFT A;  4YBH B;  3TDI A;  1H4B A;  4Q04 A;  1ODB A;  4CID A;  1M63 B;  4OR9 B;  1GGZ A;  3EKJ A;  4QJ3 B;  1PUL A;  5J3X A;  2JNF A;  3CR5 X;  1BOC A;  2JT0 A;  1CLM A;  3KO0 A;  1SPY A;  2TN4 A;  3IQQ A;  1H8B A;  1KQV A;  1NCZ A;  1N2D A;  2JU0 A;  2JZI A;  1R2U A;  1DF0 B;  4ORA B;  4FTG A;  2LUC A;  4DS7 A;  5ER4 X;  1AP4 A;  1J7R A;  2KAV A;  1OMV A;  1QTX A;  3EK7 A;  2EGD A;  5HLO A;  4YGB B;  1YVH A;  2HQW A;  2I7A A;  5FYX A;  3WHT B;  4PDZ A;  3VRP A;  2LVI A;  1KK8 B;  4AQI A;  1PVA A;  1YR5 A;  1K96 A;  1YX7 A;  4YGC B;  4E68 A;  1JUO A;  3VRQ A;  4OKH A;  1GQM A;  1BR4 B;  1XA5 A;  1QV1 A;  3BOW B;  1S6C A;  1SL9 A;  1DJW A;  1L2O B;  2V53 A;  3CR2 A;  2KI6 C;  1NPQ A;  2Y5I A;  4YGE B;  1NX2 A;  3AKB A;  2WCB A;  1DT7 B;  4L9M A;  3GK1 A;  2CTN A;  1KFX L;  2JC2 A;  4PHM A;  2AAO A;  3FS7 A;  1K8U A;  3TDU A;  2HQ8 A;  3WNX B;  1C7W A;  3H4S E;  1KFU L;  1X02 A;  1FF1 A;  1B7T Z;  1DGU A;  5CSI A;  1S3P A;  2D8N A;  1G33 A;  2AUC A;  2KBI A;  2OTG B;  2WOS A;  3EVU A;  4CPV A;  1CFP A;  1U5I B;  1IJ5 A;  2G9B A;  1LA0 A;  1CDP A;  3VRR A;  1CM4 A;  2OS8 C;  2ZRT A;  4JPZ B;  1XK4 C;  1FI5 A;  1B9A A;  1KFX S;  1S5G Y;  1SCV A;  3SG3 A;  1CB1 A;  1CTR A;  1UHI A;  2LP3 A;  4QJ5 B;  1KFU S;  1QIW A;  2EC6 C;  1YUS A;  2FCD A;  5TNC A;  1J55 A;  3TZ1 A;  1S36 A;  2RGI A;  1V1F A;  2SCP A;  2ISD A;  3PM8 A;  2WC8 A;  2PVB A;  1NX0 A;  4WQ2 A;  1KK7 Y;  3TS5 B;  2M1K B;  2F8P A;  1R6P A;  2F3Y A;  3I5G C;  1DJZ A;  1QX5 B;  1ZUZ A;  1NWD A;  1QX2 A;  3PFV A;  3OP0 A;  3CR4 X;  1RK9 A;  1UP5 A;  2LLU A;  1M46 A;  2MRD A;  1REC A;  1MQ1 A;  5KSZ A;  3DF0 A;  3EKH A;  3BUN B;  1L7Z A;  1DVI A;  3CS1 A;  3PN7 C;  4NQG A;  3SG4 A;  4DUQ A;  1SRA A;  1IRJ A;  2HET A;  4ORC B;  2KFG A;  1N0Y A;  2PMY A;  4USL A;  1UHH A;  1WDC C;  2G2B A;  3C1V A;  2LV7 A;  1BT6 A;  3BYA A;  4N5X A;  2NZ0 A;  1MF8 B;  1QAS A;  3ICB A;  2H2K A;  3DF0 B;  4OV2 A;  1CNP A;  1JFK A;  1JF0 A;  2Y4Q A;  1M31 A;  1NX1 A;  2P6B B;  3IF7 A;  5I8N A;  4CFQ A;  1XK4 A;  4JWQ A;  3SIA A;  1J7O A;  2A4J A;  2WCF A;  2M97 A;  1A4P A;  1OZO A;  4MEW A;  2LP2 A;  1PSR A;  2PSR A;  1YVL A;  4MZL A;  3OB1 B;  5GQQ C;  1OSA A;  2WCE A;  2ZN8 A;  2ZFD A;  1Q80 A;  1F71 A;  2LAN A;  3EK8 A;  1OOJ A;  4XJK B;  2BE4 A;  2K7C A;  1WRL A;  5KTY A;  2K2A A;  3RLZ A;  3DVJ A;  2OS8 B;  1UWO A;  2SAS A;  4GNK B;  3AKA A;  5HKY A;  1TCO B;  3I5H B;  2GGM A;  1QIV A;  2MBX A;  2KQY A;  1DJY A;  4DIR A;  1RJV A;  2EC6 B;  1UHJ A;  2M1U A;  2M0R A;  2LC5 A;  1F54 A;  1K9U A;  1S1E A;  2BBN A;  1LXF C;  1S6J A;  2MLF C;  1SCM C;  1DGV A;  2Q91 A;  3CLN A;  3DVM A;  3OX6 A;  4GAO A;  3VRN A;  2JTZ A;  5HLV A;  1A75 B;  1BJF A;  2GGZ A;  3WHU B;  1UUR A;  2E6W A;  4OVN F;  2L50 A;  2E30 A;  2BL0 B;  1C07 A;  3E3R A;  5DKQ A;  1ZMZ A;  2LUX A;  4CLN A;  1TRF A;  2JNX A;  2HF5 A;  1AHR A;  3CTN A;  4PAL A;  2LAP A;  3PLF B;  1KCY A;  2K61 A;  1MR8 A;  2K7D A;  2M7N A;  3VGO A;  2QPT A;  3I5I B;  5AER A;  1CMG A;  1SR6 C;  2BBM A;  1XFV O;  3A4U B;  3OX5 A;  1IGV A;  2ZRS A;  2FCE A;  1KSM A;  1OQP A;  1CFC A;  2KDH A;  2R2I A;  1QVI Z;  1UHK A;  2LNK A;  4ZCV A;  4D1E A;  1XFU O;  1XFW O;  4C0K A;  2LLS A;  1DJX A;  1C7V A;  1WDC B;  3SIB A;  3SG5 A;  3TUY C;  2NXQ A;  2KHN A;  1BLQ A;  1FBV A;  2ZKM X;  1QX7 A;  1NCY A;  3IQO A;  1EL4 A;  1NUB A;  1IQ5 A;  2KBM A;  2KAX A;  3A8R A;  1WLZ A;  3RM1 A;  1QAT A;  1NX3 A;  2JUL A;  3JTD B;  2KFH A;  1BMO A;  1PSB A;  2FOT A;  2JT3 A;  3CGA A;  1CM1 A;  1Y1A A;  2CXJ A;  1KQM C;  2OPO A;  2KI6 D;  2MAZ A;  2L0P A;  1TNP A;  2LVJ A;  1K9P A;  3QRX A;  3I5F C;  2LMV A;  1K95 A;  1XYD A;  2JOJ A;  2MJW B;  3D0Y A;  3JVT B;  1NP8 A;  1QS7 A; 
#chains in the Genus database with same CATH topology
 3FE8 A;  1GJY A;  5DKN A;  2ZND A;  1A29 A;  5HKZ A;  1J1D A;  5F6T A;  1B8C A;  1G4Y R;  1RFJ A;  3AAJ A;  4IL1 A;  5DKR A;  1LVC D;  1MXE A;  1ALV A;  2BKH B;  4P2Y B;  1DJI A;  1YX8 A;  3FWC A;  4YGA A;  4F0Z B;  1EJ3 A;  2LHI A;  1SK6 D;  2KFF A;  2LMU A;  1PK0 D;  1KWO C;  2WCJ A;  1B7T Y;  1CMF A;  2KYF A;  1MWN A;  2Y1M A;  1MUX A;  2F2O A;  3O4X A;  3OHM B;  2KOT A;  5I2L A;  3CDN A;  3MSE B;  1CDM A;  4PE0 A;  1BF5 A;  1C3Z A;  3KF9 A;  2B1U A;  5ER5 A;  4HSZ A;  1D1O A;  4WRI A;  1RTP 1;  1TTX A;  2H61 C;  1B1G A;  3BFH A;  2EHB A;  3DY9 A;  3SG2 A;  2ZNE A;  1AJ4 A;  1BR1 B;  1EH2 A;  1F4O A;  1T14 A;  1S6I A;  1SBJ A;  3UNW A;  1ZAC A;  4MLW A;  4GGN A;  1DMO A;  1WLM A;  3VRO A;  2Q4U A;  3NSI A;  2I18 A;  3AAK A;  1IKU A;  1Y1U A;  2I94 A;  4NDB A;  1LKJ A;  4HRE E;  1YRT B;  1BG1 A;  2L98 A;  1W7J B;  2JWW A;  3TDZ A;  5JOL A;  1SL8 A;  2MHH A;  3B86 A;  1KK8 C;  3FE9 A;  1ALW A;  4JKT A;  1B8L A;  1UHN A;  3KPX A;  4NDD A;  2CNP A;  1QJT A;  3OB2 B;  3FIA A;  2IS9 A;  1J1E A;  1F70 A;  5AFP A;  2BEC A;  3UO9 A;  2CCM A;  1A2X A;  1K94 A;  2NCP A;  5IBW A;  4MSP A;  1CFF A;  4C0L A;  5D3O A;  3TUY B;  1JC2 A;  3NSO A;  3S0D A;  4UPG A;  1JSA A;  5G08 A;  1HQV A;  5AEQ A;  3EVV A;  2JTT A;  5PAL A;  2LVK A;  2P71 A;  2H8V A;  2WCL A;  4HRH A;  4A4C A;  2O5G A;  3DD4 A;  1NYA A;  2BCB A;  3CZT X;  1XVJ A;  3IVT A;  1F8H A;  1C3Y A;  4GUK A;  3O4Y A;  1JBA A;  4PE1 A;  1V1G A;  2KGR A;  3F45 A;  2JT8 A;  3BUO B;  1JF2 A;  1FW4 A;  1LS8 A;  4MRY A;  2JRF A;  2L4H A;  3NXA A;  2I2R E;  3I5F B;  2L2C A;  4MZK A;  1YTZ C;  2K2F A;  1IJ6 A;  3ZNI A;  1EXR A;  1MXL C;  1E8A A;  2H61 A;  1VRK A;  1XFR A;  2MLE C;  3NSL A;  1KSO A;  1IIO A;  1XO5 A;  4ZCU A;  3R72 A;  1DEK A;  1PAL A;  1KWO B;  1FPW A;  2F2P A;  4NDC A;  1M39 A;  4ORB B;  4PHN A;  3I5G B;  3S0E A;  3D77 A;  3O6B A;  2M29 A;  3TS5 C;  3CZ2 A;  2K7O A;  4MRX A;  2LVV A;  2KPH A;  2KYC A;  1JFJ A;  2LE9 B;  4I5J A;  1J7Q A;  2L4I A;  4N1F A;  1CDN A;  1CDL A;  1IG5 A;  1MHO A;  4M2Q A;  2F33 A;  5CSF A;  3PN7 B;  2KLE A;  4PCW A;  1TOP A;  1Y6W A;  2NCO A;  3NHT A;  5FI6 A;  4PT1 A;  2O60 A;  4XYN A;  3BOW A;  3EK4 A;  4MZJ A;  3LL8 B;  2LLT A;  2FJU B;  4GGF C;  3LK0 A;  2KNE A;  3D10 A;  2KQ6 A;  3BXK A;  1LA3 A;  2M9G A;  2KLD A;  1AJ5 A;  1NCX A;  3S0B A;  2DOQ A;  1CLL A;  1K2H A;  1N65 A;  1TNQ A;  2M3W A;  3R1O A;  1CKK A;  3B88 A;  3LK1 A;  3NGV A;  1RWY A;  3BUW B;  2PRU A;  3VB1 A;  4DCK A;  3PAT A;  1S5G Z;  1IQ3 A;  4INW A;  5B8I B;  3DVK A;  1U5I A;  3KHE A;  4DRW A;  1XFY O;  3LCP C;  2PQL A;  3S0A A;  1ZOT B;  5D7F A;  1SW8 A;  3PSR A;  5HL1 A;  4OCI A;  5CSJ A;  4WQ3 A;  1YRU B;  2L5X B;  1QLK A;  1QVI Y;  2KI4 C;  2PAL A;  4I5L B;  1F55 A;  2JXL A;  3LLE A;  1DJG A;  2ERB A;  1WRK A;  3L47 A;  1TNX A;  3L4L A;  2M8U A;  1SKT A;  1SY9 A;  3M0W A;  2BCX A;  4M2O A;  1B4C A;  1QV0 A;  1KK7 Z;  4ICB A;  4YI9 A;  2M7L A;  4QJ4 B;  5KU1 A;  4MN0 A;  3D73 A;  3EVR A;  1DJH A;  1AUI B;  1PRW A;  4MVF A;  4PHJ A;  1W7I B;  3HX4 A;  3GK2 A;  2VRG A;  4PE7 A;  3I5H C;  1SL7 A;  2MA2 A;  3SG7 A;  1B47 A;  3BUX B;  4N1G A;  1NSH A;  3SJS A;  3D0Y B;  1Z2C B;  1K90 D;  1WY9 A;  4YRU A;  1SCM B;  4P5O E;  3ZWH A;  1TN4 A;  2KSP A;  4I5K A;  1EG3 A;  2JPT A;  3KEV A;  1XFX O;  5HYD A;  1BOD A;  1Y1X A;  4GGF A;  1XFZ O;  5CSN A;  1OOF A;  2BL0 C;  5JJG A;  1CLB A;  1K93 D;  5I2O A;  3CWG A;  1M45 A;  1SYM A;  4ETO A;  1QXP A;  1RRO A;  2YGU A;  2QAC A;  1TIZ A;  1SR6 B;  3BQ3 A;  1CFD A;  2PAS A;  4YI8 A;  5AXI A;  4CFR A;  3QME A;  4AQJ A;  2LCP A;  3I5I C;  2COL B;  2WOR A;  1LIN A;  5HKW A;  2CBL A;  4I5N B;  3SG6 A;  1ZFS A;  2AMI A;  1QLS A;  3GK4 X;  1SNL A;  4JQ0 D;  1A03 A;  3WXA A;  2JQ6 A;  4AOM A;  5D69 A;  2GTE A;  3K21 A;  1JWD A;  1OZS A;  3S0G A;  5I2Q A;  1AVS A;  1OE9 B;  2M49 B;  1J7P A;  1IWQ A;  1L2O C;  2K7B A;  2L2E A;  5CPV A;  4PE4 A;  1DTL A;  1IH0 A;  1OMD A;  3BJH A;  1EG4 A;  3O2P A;  4MBE A;  1NIW A;  4BY4 A;  1WRZ A;  2KGB C;  1YUR A;  4HRG A;  2BE6 A;  2QEO A;  1BU3 A;  2GV5 A;  2KAY A;  4M2P A;  2FJY A;  4GBA A;  2F3Z A;  1YUU A;  4BY5 A;  2L51 A;  5BPJ A;  5K89 A;  1FI6 A;  1TNW A;  1F4Q A;  2LMT A;  1K9K A;  3O78 A;  1AK8 A;  2K0J A;  4XJK A;  1QWV A;  2K8M B;  2QEB A;  3GOF A;  2OTG C;  3HCM A;  4U8D A;  1KQM B;  3JTD C;  2NLN A;  2LHL A;  1Y0V H;  4GPL B;  2CT9 A;  2Y1N A;  4R1E A;  3PAL A;  2KI4 B;  1OMR A;  4PHK A;  1GGW A;  3DVE A;  1B8R A;  2JXC A;  2HPS A;  3DYE A;  1OOG A;  1S26 D;  1HT9 A;  1SMG A;  4TNC A;  3NSK A;  4FQO A;  1PVB A;  3BUM B;  3JVT C;  4C0J A;  1YUT A;  1UUS A;  2BKI B;  1A75 A;  3FWB A;  1DF0 A;  2WND A;  4YGD B;  1G8I A;  1TCF A;  2LM5 A;  4A4B A;  5AAN A;  2ZN9 A;  2BCA A;  4GFT A;  4YBH B;  3TDI A;  1H4B A;  4Q04 A;  1ODB A;  4CID A;  2JPO A;  1M63 B;  4OR9 B;  1GGZ A;  3OGN A;  3EKJ A;  4QJ3 B;  1PUL A;  5J3X A;  2JNF A;  3CR5 X;  1BOC A;  1OW4 A;  2JT0 A;  3CZ0 A;  1CLM A;  3KO0 A;  2QEH A;  1SPY A;  2TN4 A;  3IQQ A;  4OZD A;  1H8B A;  1NCZ A;  1N2D A;  1KQV A;  2JU0 A;  2JZI A;  1R2U A;  1DF0 B;  4ORA B;  4FTG A;  2LUC A;  4DS7 A;  5ER4 X;  1AP4 A;  1J7R A;  2KAV A;  2WCM A;  3K1E A;  1OMV A;  1QTX A;  4F7F A;  3EK7 A;  2EGD A;  5HLO A;  2QEV A;  4YGB B;  1YVH A;  2HQW A;  2I7A A;  5FYX A;  3WHT B;  4PDZ A;  3VRP A;  2LVI A;  1KK8 B;  4AQI A;  1PVA A;  1YR5 A;  3SS5 A;  1K96 A;  1YX7 A;  4IJ7 A;  4YGC B;  1JUO A;  4E68 A;  3VRQ A;  4OKH A;  1GQM A;  1BR4 B;  1XA5 A;  1QV1 A;  3BOW B;  3OBV A;  1S6C A;  1ORG A;  1SL9 A;  4JD9 A;  1DJW A;  1L2O B;  2V53 A;  3CR2 A;  2KI6 C;  1NPQ A;  2Y5I A;  4YGE B;  1NX2 A;  3Q8I A;  3AKB A;  2WCB A;  1DT7 B;  4L9M A;  3GK1 A;  2CTN A;  1KFX L;  2JC2 A;  4PHM A;  2AAO A;  3FS7 A;  1K8U A;  3TDU A;  2HQ8 A;  3WNX B;  1C7W A;  3H4S E;  1KFU L;  3CYZ A;  1X02 A;  1FF1 A;  1B7T Z;  1DGU A;  5CSI A;  1S3P A;  2D8N A;  1G33 A;  2AUC A;  2KBI A;  2OTG B;  2WOS A;  3EVU A;  4CPV A;  1CFP A;  1U5I B;  1IJ5 A;  2G9B A;  1LA0 A;  1CDP A;  3VRR A;  1CM4 A;  2OS8 C;  2ZRT A;  4JPZ B;  1XK4 C;  1FI5 A;  1B9A A;  1GM0 A;  1KFX S;  1S5G Y;  1SCV A;  3SG3 A;  1Z4H A;  1CTR A;  1CB1 A;  1UHI A;  1TUZ A;  1W9Z A;  2LP3 A;  4QJ5 B;  1KFU S;  1QIW A;  2EC6 C;  1YUS A;  2FCD A;  5TNC A;  1J55 A;  2QDI A;  3TZ1 A;  1S36 A;  3SS4 A;  2RGI A;  1V1F A;  2SCP A;  2ISD A;  3PM8 A;  2WC8 A;  2PVB A;  1NX0 A;  4WQ2 A;  1KK7 Y;  2BNX A;  3TS5 B;  2M1K B;  2F8P A;  1R6P A;  2F3Y A;  3I5G C;  1DJZ A;  1OOI X;  1QX5 B;  1ZUZ A;  1NWD A;  1QX2 A;  3PFV A;  3R1P A;  3OP0 A;  3CR4 X;  1RK9 A;  1UP5 A;  2LLU A;  1M46 A;  2MRD A;  2P70 A;  1REC A;  1MQ1 A;  5KSZ A;  3DF0 A;  5EL2 A;  3EKH A;  3BUN B;  1L7Z A;  1DVI A;  3CS1 A;  3PN7 C;  4FQT A;  4NQG A;  3SG4 A;  4DUQ A;  1SRA A;  3R1V A;  1IRJ A;  2HET A;  4ORC B;  4KYN A;  1DEL A;  2WC6 A;  2KFG A;  1N0Y A;  2PMY A;  4USL A;  2WCH A;  1UHH A;  1WDC C;  2G2B A;  3C1V A;  2LV7 A;  1BT6 A;  3BYA A;  4N5X A;  2NZ0 A;  1MF8 B;  1QAS A;  3B87 A;  2H2K A;  3ICB A;  3DF0 B;  2L5Y A;  4OV2 A;  3N7H A;  5I94 A;  3NHI A;  1CNP A;  1JFK A;  1JF0 A;  2Y4Q A;  1M31 A;  1NX1 A;  2P6B B;  3FE6 A;  3IF7 A;  3B6X A;  3SS3 A;  5I8N A;  4CFQ A;  1XK4 A;  4JWQ A;  3SIA A;  1J7O A;  2A4J A;  2WCF A;  2M97 A;  1A4P A;  1OZO A;  4MEW A;  2LP2 A;  1PSR A;  2PSR A;  1YVL A;  2K60 A;  4MZL A;  3D76 A;  3OB1 B;  5GQQ C;  1OSA A;  2WCE A;  2ZN8 A;  3BFA A;  3PJI A;  2ZFD A;  1Q80 A;  1SSE B;  2LAN A;  3EK8 A;  1OOJ A;  4XJK B;  1F71 A;  2BE4 A;  2K7C A;  1WRL A;  5KTY A;  2K2A A;  3B7A A;  3RLZ A;  3PM2 A;  3DVJ A;  2OS8 B;  1UWO A;  2SAS A;  4GNK B;  3AKA A;  5HKY A;  1TCO B;  3I5H B;  2GGM A;  1QIV A;  2MBX A;  2KQY A;  1DJY A;  4DIR A;  3CZ1 A;  2WC5 A;  1OOH A;  3D74 A;  1RJV A;  2EC6 B;  1UHJ A;  2M1U A;  2M0R A;  2LC5 A;  1F54 A;  1K9U A;  1S1E A;  2BBN A;  1LXF C;  1S6J A;  2MLF C;  1SCM C;  1DGV A;  2Q91 A;  3CLN A;  3DVM A;  3OX6 A;  4GAO A;  1DQE A;  2JTZ A;  5HLV A;  3VRN A;  1A75 B;  1BJF A;  2GGZ A;  3WHU B;  1UUR A;  2E6W A;  4OVN F;  3RZS A;  3V2L A;  2L50 A;  2E30 A;  2BL0 B;  1C07 A;  3E3R A;  5DKQ A;  2PYQ A;  1ZMZ A;  2LUX A;  4CLN A;  1TRF A;  3DXL A;  3S0F A;  2JNX A;  2HF5 A;  1AHR A;  3CTN A;  4PAL A;  5FI7 A;  2LAP A;  3PLF B;  1KCY A;  2K61 A;  1MR8 A;  2K7D A;  2M7N A;  3EG5 B;  2QPT A;  3I5I B;  3VGO A;  5AER A;  1CMG A;  1SR6 C;  2BBM A;  1XFV O;  3A4U B;  3OX5 A;  1IGV A;  5DIC A;  3L4A A;  2ZRS A;  2FCE A;  1KSM A;  5FI2 A;  1OQP A;  1CFC A;  2KDH A;  2R2I A;  1QVI Z;  1UHK A;  2LNK A;  1TUJ A;  2WCK A;  3CAB A;  4ZCV A;  1TWO A;  1XFU O;  4D1E A;  1XFW O;  4C0K A;  2LLS A;  1DJX A;  1C7V A;  1WDC B;  3SIB A;  3SG5 A;  3TUY C;  2NXQ A;  2KHN A;  1BLQ A;  1FBV A;  2ZKM X;  1QX7 A;  1NCY A;  3IQO A;  1EL4 A;  1NUB A;  1IQ5 A;  2KBM A;  2KAX A;  3A8R A;  1WLZ A;  3RM1 A;  1QAT A;  1NX3 A;  2JUL A;  3D78 A;  3JTD B;  2KFH A;  3D75 A;  1BMO A;  1PSB A;  2FOT A;  2JT3 A;  3CGA A;  2BAP A;  1CM1 A;  1P28 A;  1Y1A A;  2CXJ A;  1KQM C;  2OPO A;  2KI6 D;  2MAZ A;  3BFB A;  2L0P A;  4INX A;  1DC1 A;  1TNP A;  2LVJ A;  3DZT A;  1K9P A;  3QRX A;  3I5F C;  2LMV A;  1K95 A;  1XYD A;  2JOJ A;  2MJW B;  3D0Y A;  3JVT B;  1NP8 A;  1QS7 A; 
#chains in the Genus database with same CATH homology
 1GJY A;  5DKN A;  2ZND A;  1A29 A;  5HKZ A;  1J1D A;  5F6T A;  1B8C A;  1G4Y R;  1RFJ A;  3AAJ A;  4IL1 A;  5DKR A;  1LVC D;  1MXE A;  1ALV A;  2BKH B;  4P2Y B;  1DJI A;  1YX8 A;  3FWC A;  4YGA A;  4F0Z B;  1EJ3 A;  2LHI A;  1SK6 D;  2KFF A;  2LMU A;  1PK0 D;  1KWO C;  1B7T Y;  1CMF A;  2KYF A;  1MWN A;  2Y1M A;  1MUX A;  2F2O A;  3OHM B;  2KOT A;  5I2L A;  3MSE B;  4PE0 A;  1CDM A;  1BF5 A;  3KF9 A;  2B1U A;  5ER5 A;  4HSZ A;  1D1O A;  4WRI A;  1RTP 1;  1TTX A;  2H61 C;  1B1G A;  2EHB A;  3SG2 A;  2ZNE A;  1AJ4 A;  1BR1 B;  1EH2 A;  1F4O A;  1S6I A;  1SBJ A;  1ZAC A;  4MLW A;  4GGN A;  1DMO A;  1WLM A;  3VRO A;  2Q4U A;  3NSI A;  2I18 A;  3AAK A;  1IKU A;  1Y1U A;  2I94 A;  4NDB A;  1LKJ A;  4HRE E;  1YRT B;  1BG1 A;  2L98 A;  1W7J B;  2JWW A;  3TDZ A;  5JOL A;  1SL8 A;  2MHH A;  1KK8 C;  1ALW A;  1B8L A;  1UHN A;  3KPX A;  4NDD A;  2CNP A;  1QJT A;  3OB2 B;  3FIA A;  2IS9 A;  1J1E A;  1F70 A;  5AFP A;  2BEC A;  2CCM A;  1A2X A;  1K94 A;  2NCP A;  5IBW A;  4MSP A;  1CFF A;  4C0L A;  3TUY B;  1JC2 A;  3NSO A;  1JSA A;  4UPG A;  5G08 A;  1HQV A;  5AEQ A;  3EVV A;  2JTT A;  5PAL A;  2LVK A;  4HRH A;  4A4C A;  2O5G A;  3DD4 A;  1NYA A;  2BCB A;  3CZT X;  1XVJ A;  1F8H A;  4GUK A;  3O4Y A;  1JBA A;  4PE1 A;  1V1G A;  2KGR A;  3F45 A;  2JT8 A;  3BUO B;  1JF2 A;  1FW4 A;  4MRY A;  2JRF A;  2L4H A;  3NXA A;  2I2R E;  3I5F B;  4MZK A;  1YTZ C;  2K2F A;  1IJ6 A;  3ZNI A;  1EXR A;  1MXL C;  1E8A A;  2H61 A;  1VRK A;  2MLE C;  3NSL A;  1KSO A;  1XO5 A;  4ZCU A;  1PAL A;  1KWO B;  1FPW A;  2F2P A;  4NDC A;  1M39 A;  4ORB B;  4PHN A;  3I5G B;  3O6B A;  2M29 A;  3TS5 C;  2K7O A;  4MRX A;  2LVV A;  2KYC A;  1JFJ A;  2LE9 B;  4I5J A;  1J7Q A;  2L4I A;  4N1F A;  1CDN A;  1CDL A;  1IG5 A;  1MHO A;  4M2Q A;  2F33 A;  5CSF A;  3PN7 B;  4PCW A;  1TOP A;  1Y6W A;  2NCO A;  2O60 A;  4XYN A;  3BOW A;  3EK4 A;  4MZJ A;  3LL8 B;  2LLT A;  2FJU B;  4GGF C;  3LK0 A;  2KNE A;  3D10 A;  2KQ6 A;  3BXK A;  1LA3 A;  2M9G A;  1AJ5 A;  1NCX A;  2DOQ A;  1CLL A;  1K2H A;  1N65 A;  1TNQ A;  2M3W A;  1CKK A;  3LK1 A;  1RWY A;  3BUW B;  2PRU A;  4DCK A;  3PAT A;  1S5G Z;  1IQ3 A;  5B8I B;  3DVK A;  1U5I A;  3KHE A;  4DRW A;  1XFY O;  3LCP C;  1ZOT B;  5D7F A;  1SW8 A;  3PSR A;  4OCI A;  5CSJ A;  4WQ3 A;  1YRU B;  2L5X B;  1QLK A;  1QVI Y;  2KI4 C;  2PAL A;  4I5L B;  1F55 A;  2JXL A;  3LLE A;  1DJG A;  1WRK A;  1TNX A;  2M8U A;  1SKT A;  1SY9 A;  3M0W A;  2BCX A;  4M2O A;  1B4C A;  1QV0 A;  1KK7 Z;  4ICB A;  4YI9 A;  2M7L A;  4QJ4 B;  5KU1 A;  4MN0 A;  3EVR A;  1DJH A;  1AUI B;  1PRW A;  4MVF A;  4PHJ A;  1W7I B;  3HX4 A;  3GK2 A;  2VRG A;  4PE7 A;  3I5H C;  1SL7 A;  2MA2 A;  3SG7 A;  1B47 A;  3BUX B;  4N1G A;  1NSH A;  3SJS A;  3D0Y B;  1K90 D;  1WY9 A;  4YRU A;  1SCM B;  4P5O E;  3ZWH A;  1TN4 A;  2KSP A;  4I5K A;  1EG3 A;  2JPT A;  3KEV A;  1XFX O;  5HYD A;  1BOD A;  1Y1X A;  4GGF A;  1XFZ O;  5CSN A;  2BL0 C;  5JJG A;  1CLB A;  1K93 D;  5I2O A;  3CWG A;  1M45 A;  1SYM A;  4ETO A;  1QXP A;  1RRO A;  2QAC A;  1TIZ A;  1SR6 B;  3BQ3 A;  1CFD A;  2PAS A;  4YI8 A;  5AXI A;  4CFR A;  4AQJ A;  2LCP A;  3I5I C;  2COL B;  2WOR A;  1LIN A;  5HKW A;  2CBL A;  4I5N B;  3SG6 A;  1ZFS A;  2AMI A;  1QLS A;  3GK4 X;  1SNL A;  4JQ0 D;  1A03 A;  3WXA A;  2JQ6 A;  4AOM A;  5D69 A;  1JWD A;  3K21 A;  1OZS A;  5I2Q A;  1AVS A;  1OE9 B;  2M49 B;  1J7P A;  1IWQ A;  1L2O C;  2K7B A;  2L2E A;  5CPV A;  4PE4 A;  1DTL A;  1IH0 A;  1OMD A;  3O2P A;  1EG4 A;  4MBE A;  4BY4 A;  1NIW A;  1WRZ A;  2KGB C;  1YUR A;  4HRG A;  2BE6 A;  1BU3 A;  2GV5 A;  2KAY A;  4M2P A;  4GBA A;  5BPJ A;  2F3Z A;  1YUU A;  4BY5 A;  2L51 A;  5K89 A;  1FI6 A;  1TNW A;  1F4Q A;  2LMT A;  1K9K A;  3O78 A;  1AK8 A;  2K0J A;  4XJK A;  2K8M B;  3GOF A;  2OTG C;  3HCM A;  4U8D A;  1KQM B;  3JTD C;  2NLN A;  2LHL A;  1Y0V H;  4GPL B;  2CT9 A;  2Y1N A;  4R1E A;  3PAL A;  2KI4 B;  1OMR A;  4PHK A;  1GGW A;  3DVE A;  1B8R A;  2JXC A;  2HPS A;  1S26 D;  1HT9 A;  1SMG A;  4TNC A;  3NSK A;  4FQO A;  1PVB A;  3BUM B;  3JVT C;  4C0J A;  1YUT A;  1UUS A;  2BKI B;  1A75 A;  3FWB A;  1DF0 A;  2WND A;  4YGD B;  1G8I A;  1TCF A;  2LM5 A;  4A4B A;  5AAN A;  2ZN9 A;  2BCA A;  4GFT A;  4YBH B;  3TDI A;  1H4B A;  4Q04 A;  1ODB A;  4CID A;  1M63 B;  4OR9 B;  1GGZ A;  3EKJ A;  4QJ3 B;  1PUL A;  5J3X A;  2JNF A;  3CR5 X;  1BOC A;  2JT0 A;  1CLM A;  3KO0 A;  1SPY A;  2TN4 A;  3IQQ A;  1H8B A;  1KQV A;  1NCZ A;  1N2D A;  2JU0 A;  2JZI A;  1R2U A;  1DF0 B;  4ORA B;  4FTG A;  2LUC A;  4DS7 A;  5ER4 X;  1AP4 A;  1J7R A;  2KAV A;  1OMV A;  1QTX A;  3EK7 A;  2EGD A;  5HLO A;  4YGB B;  1YVH A;  2HQW A;  2I7A A;  5FYX A;  3WHT B;  4PDZ A;  3VRP A;  2LVI A;  1KK8 B;  4AQI A;  1PVA A;  1YR5 A;  1K96 A;  1YX7 A;  4YGC B;  4E68 A;  1JUO A;  3VRQ A;  4OKH A;  1GQM A;  1BR4 B;  1XA5 A;  1QV1 A;  3BOW B;  1S6C A;  1SL9 A;  1DJW A;  1L2O B;  2V53 A;  3CR2 A;  2KI6 C;  1NPQ A;  2Y5I A;  4YGE B;  1NX2 A;  3AKB A;  2WCB A;  1DT7 B;  4L9M A;  3GK1 A;  2CTN A;  1KFX L;  2JC2 A;  4PHM A;  2AAO A;  3FS7 A;  1K8U A;  3TDU A;  2HQ8 A;  3WNX B;  1C7W A;  3H4S E;  1KFU L;  1X02 A;  1FF1 A;  1B7T Z;  1DGU A;  5CSI A;  1S3P A;  2D8N A;  1G33 A;  2AUC A;  2KBI A;  2OTG B;  2WOS A;  3EVU A;  4CPV A;  1CFP A;  1U5I B;  1IJ5 A;  2G9B A;  1LA0 A;  1CDP A;  3VRR A;  1CM4 A;  2OS8 C;  2ZRT A;  4JPZ B;  1XK4 C;  1FI5 A;  1B9A A;  1KFX S;  1S5G Y;  1SCV A;  3SG3 A;  1CB1 A;  1CTR A;  1UHI A;  2LP3 A;  4QJ5 B;  1KFU S;  1QIW A;  2EC6 C;  1YUS A;  2FCD A;  5TNC A;  1J55 A;  3TZ1 A;  1S36 A;  2RGI A;  1V1F A;  2SCP A;  2ISD A;  3PM8 A;  2WC8 A;  2PVB A;  1NX0 A;  4WQ2 A;  1KK7 Y;  3TS5 B;  2M1K B;  2F8P A;  1R6P A;  2F3Y A;  3I5G C;  1DJZ A;  1QX5 B;  1ZUZ A;  1NWD A;  1QX2 A;  3PFV A;  3OP0 A;  3CR4 X;  1RK9 A;  1UP5 A;  2LLU A;  1M46 A;  2MRD A;  1REC A;  1MQ1 A;  5KSZ A;  3DF0 A;  3EKH A;  3BUN B;  1L7Z A;  1DVI A;  3CS1 A;  3PN7 C;  4NQG A;  3SG4 A;  4DUQ A;  1SRA A;  1IRJ A;  2HET A;  4ORC B;  2KFG A;  1N0Y A;  2PMY A;  4USL A;  1UHH A;  1WDC C;  2G2B A;  3C1V A;  2LV7 A;  1BT6 A;  3BYA A;  4N5X A;  2NZ0 A;  1MF8 B;  1QAS A;  3ICB A;  2H2K A;  3DF0 B;  4OV2 A;  1CNP A;  1JFK A;  1JF0 A;  2Y4Q A;  1M31 A;  1NX1 A;  2P6B B;  3IF7 A;  5I8N A;  4CFQ A;  1XK4 A;  4JWQ A;  3SIA A;  1J7O A;  2A4J A;  2WCF A;  2M97 A;  1A4P A;  1OZO A;  4MEW A;  2LP2 A;  1PSR A;  2PSR A;  1YVL A;  4MZL A;  3OB1 B;  5GQQ C;  1OSA A;  2WCE A;  2ZN8 A;  2ZFD A;  1Q80 A;  1F71 A;  2LAN A;  3EK8 A;  1OOJ A;  4XJK B;  2BE4 A;  2K7C A;  1WRL A;  5KTY A;  2K2A A;  3RLZ A;  3DVJ A;  2OS8 B;  1UWO A;  2SAS A;  4GNK B;  3AKA A;  5HKY A;  1TCO B;  3I5H B;  2GGM A;  1QIV A;  2MBX A;  2KQY A;  1DJY A;  4DIR A;  1RJV A;  2EC6 B;  1UHJ A;  2M1U A;  2M0R A;  2LC5 A;  1F54 A;  1K9U A;  1S1E A;  2BBN A;  1LXF C;  1S6J A;  2MLF C;  1SCM C;  1DGV A;  2Q91 A;  3CLN A;  3DVM A;  3OX6 A;  4GAO A;  3VRN A;  2JTZ A;  5HLV A;  1A75 B;  1BJF A;  2GGZ A;  3WHU B;  1UUR A;  2E6W A;  4OVN F;  2L50 A;  2E30 A;  2BL0 B;  1C07 A;  3E3R A;  5DKQ A;  1ZMZ A;  2LUX A;  4CLN A;  1TRF A;  2JNX A;  2HF5 A;  1AHR A;  3CTN A;  4PAL A;  2LAP A;  3PLF B;  1KCY A;  2K61 A;  1MR8 A;  2K7D A;  2M7N A;  3VGO A;  2QPT A;  3I5I B;  5AER A;  1CMG A;  1SR6 C;  2BBM A;  1XFV O;  3A4U B;  3OX5 A;  1IGV A;  2ZRS A;  2FCE A;  1KSM A;  1OQP A;  1CFC A;  2KDH A;  2R2I A;  1QVI Z;  1UHK A;  2LNK A;  4ZCV A;  4D1E A;  1XFU O;  1XFW O;  4C0K A;  2LLS A;  1DJX A;  1C7V A;  1WDC B;  3SIB A;  3SG5 A;  3TUY C;  2NXQ A;  2KHN A;  1BLQ A;  1FBV A;  2ZKM X;  1QX7 A;  1NCY A;  3IQO A;  1EL4 A;  1NUB A;  1IQ5 A;  2KBM A;  2KAX A;  3A8R A;  1WLZ A;  3RM1 A;  1QAT A;  1NX3 A;  2JUL A;  3JTD B;  2KFH A;  1BMO A;  1PSB A;  2FOT A;  2JT3 A;  3CGA A;  1CM1 A;  1Y1A A;  2CXJ A;  1KQM C;  2OPO A;  2KI6 D;  2MAZ A;  2L0P A;  1TNP A;  2LVJ A;  1K9P A;  3QRX A;  3I5F C;  2LMV A;  1K95 A;  1XYD A;  2JOJ A;  2MJW B;  3D0Y A;  3JVT B;  1NP8 A;  1QS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...