3CR4X

X-ray structure of bovine pnt,ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divalent metal ion complexes of S100B in the absence and presence of pentamidine.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Protein S100-B
total genus 31
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cr4X00
4GUKA 1CLBA 5GQQC 2GGZA 1UHHA 1L7ZA 1OE9B 4GGFC 1FI6A 2F3YA 2EC6B 2F8PA 4GGNA 2LE9B 4N1GA 4MZKA 2LM5A 2WCEA 4MBEA 1YUSA 1JSAA 1XFXO 1J55A 5ER4X 1XK4A 1KSOA 1PVAA 1M31A 2F3ZA 3E3RA 2KQ6A 1KFXS 1ODBA 2BBMA 2PMYA 3NSLA 1OOJA 3NSKA 1KSMA 3A4UB 1IRJA 1QIVA 3GK4X 1EG3A 5HKWA 3JVTC 1QATA 1AJ5A 4ORCB 1J1DA 1IQ3A 2KGRA 1XO5A 3KHEA 2OS8B 1XFUO 3TDZA 2ZNEA 5AXIA 1OSAA 4I5NB 2F2PA 1SR6B 1SRAA 2BE4A 3LK1A 1NX1A 2KBIA 1U5IB 4PE7A 2LVVA 4PCWA 2K7DA 2KFHA 3TUYC 3CR4X 5JOLA 2ZNDA 3TZ1A 2H61C 2KI4C 2BKIB 1WDCC 3CTNA 1JF2A 2KI4B 3MSEB 4P2YB 3SG5A 2FOTA 2BL0B 1QLKA 2JU0A 4U8DA 4MEWA 4ZCVA 3WNXB 1NIWA 3AKAA 2KAVA 2EHBA 2WC8A 1K94A 1A4PA 1NWDA 1S6JA 2JPTA 2KOTA 1DJHA 4MZJA 1YURA 3PFVA 2HQ8A 4WQ2A 1SCVA 2K2FA 2MLEC 2LUCA 2NCPA 1KQMC 1CTRA 2L4HA 3LK0A 2MAZA 3BYAA 5DKNA 4YGEB 3WXAA 1TTXA 1IKUA 3BUMB 3PN7C 3SJSA 1R2UA 3EK7A 3PN7B 2JQ6A 2ZRTA 5DKRA 1BLQA 3VROA 2GV5A 1OZOA 3PLFB 1BR1B 1HQVA 2K2AA 3BOWA 3VGOA 2CNPA 2I2RE 1KK7Z 2R2IA 2A4JA 3FWBA 2K61A 2M3WA 4I5KA 1S1EA 2D8NA 1J7PA 3LLEA 2JXCA 1DJWA 2M7LA 3PATA 2WORA 1OZSA 1DJIA 3D0YA 1G4YR 1PRWA 2BECA 1B7TZ 2HETA 3DF0A 1TRFA 2EC6C 1B47A 3BQ3A 1XYDA 2LHIA 2KNEA 2ISDA 2BBNA 1QVIZ 1B8LA 1V1FA 2JNFA 1SNLA 2M9GA 1KFUL 4CFQA 1RJVA 4YGAA 1A29A 2L0PA 2HF5A 2I18A 3JTDC 5I2OA 5TNCA 3I5GB 3LL8B 4CFRA 1FBVA 1SL8A 1WDCB 4DS7A 1GGWA 2Q4UA 1YVHA 1DJXA 2TN4A 2VRGA 1QJTA 4HSZA 1DJZA 5PALA 1RROA 3NSOA 1MUXA 1LVCD 4JPZB 4PE0A 5F6TA 1FI5A 1YRUB 3HX4A 2LANA 1J7QA 1M45A 1XA5A 3KPXA 1BMOA 4PHKA 3TS5C 3GK1A 2M29A 1KFXL 3CS1A 1NPQA 1UHKA 1TNWA 2L5XB 4MRXA 5HKZA 1X02A 1XFVO 2BCAA 3LCPC 3EVVA 3IQQA 4GFTA 1NCZA 1IH0A 2MA2A 1MWNA 3O4YA 4R1EA 1BJFA 1BU3A 1K93D 1TCOB 1LKJA 1WRKA 2LCPA 4MVFA 4PE4A 4CPVA 3WHTB 4OR9B 1XFWO 5ER5A 2CT9A 1DF0A 2PVBA 3VRQA 3VRRA 1NSHA 4PE1A 5HKYA 4DIRA 1ZUZA 2SASA 4XYNA 2F2OA 1JFJA 1AUIB 4ORBB 4QJ3B 4ZCUA 3VRNA 2Y4QA 2JC2A 5I8NA 1RECA 4I5JA 1DJYA 1TIZA 1DVIA 2QPTA 1JBAA 2LHLA 2FCEA 1U5IA 2BL0C 2MBXA 2Y1MA 2BE6A 1SW8A 2CBLA 2L50A 1QX7A 1BF5A 1K8UA 4HREE 5CSFA 1SMGA 2K7BA 1EL4A 1QASA 1QV1A 1TNQA 1YX8A 1RTP1 1YVLA 3M0WA 2K0JA 2BCBA 1JF0A 3TDUA 4AOMA 1RFJA 4DUQA 2IS9A 2KBMA 3A8RA 4USLA 2MHHA 4NQGA 2Y1NA 1A75A 4YI9A 1WRLA 4HRHA 1TCFA 5HLVA 1BR4B 1LXFC 1NYAA 2JT3A 2ZFDA 3I5GC 1UWOA 3NXAA 3EK8A 2KI6D 2FCDA 3CR2A 1SCMB 5KU1A 3OX5A 3OHMB 3O6BA 1VRKA 2OPOA 1J1EA 1NCXA 4GGFA 4MN0A 4PDZA 4QJ5B 2LP3A 2I7AA 3ICBA 2V53A 2O60A 1EXRA 3SG2A 4TNCA 3SG3A 1Y1AA 1LINA 1MQ1A 1B9AA 1KK8B 1QX2A 4NDBA 2PSRA 3DD4A 2LMVA 1MXEA 1JFKA 2OTGC 3SG4A 1W7JB 4WQ3A 4GBAA 1SYMA 4ICBA 1CM4A 2KDHA 5HLOA 1PVBA 5D7FA 2JXLA 1BG1A 3OX6A 5K89A 1XFYO 2M7NA 1M63B 5DKQA 2WNDA 4YBHB 3FIAA 2E30A 2KAYA 2LVKA 3PM8A 2CXJA 3GK2A 3CZTX 1D1OA 1B4CA 1J7OA 1ALVA 1IWQA 1QVIY 2QACA 2JWWA 2EGDA 1JWDA 5IBWA 4PHNA 1MHOA 2Q91A 4XJKA 3EKJA 3JVTB 2AAOA 1WY9A 2RGIA 4PHMA 3H4SE 1UURA 1G33A 1IG5A 1PULA 2LP2A 2BCXA 3DVJA 4YGDB 1UHJA 2OTGB 1YTZC 1SKTA 1EG4A 1SR6C 1XK4C 2M1UA 3O78A 1PK0D 1WLMA 1F70A 1G8IA 1IJ5A 1OQPA 1B1GA 1K96A 1PALA 1CDMA 3FS7A 3DF0B 5B8IB 4YGBB 2WCBA 1S26D 1WLZA 2KYFA 2JULA 4MRYA 4FTGA 2MJWB 3EVRA 2HQWA 1SCMC 1GGZA 3F45A 5FYXA 2PRUA 3GOFA 3IQOA 5CPVA 2JZIA 1ZOTB 1ZACA 1CFPA 2OS8C 1KQMB 1L2OC 4AQJA 5BPJA 2G9BA 3TS5B 1SK6D 5I2QA 1NX3A 1CB1A 1QIWA 4F0ZB 1CDLA 4DCKA 1DF0B 1M39A 2KFFA 4GAOA 1CLMA 1ALWA 1QLSA 1ZFSA 1RK9A 2LVJA 2M49B 4I5LB 1A03A 1N2DA 2KGBC 2E6WA 2L51A 3FWCA 3I5IC 4HRGA 2JNXA 1F4OA 3AAKA 4CLNA 1DMOA 2KQYA 1LA3A 5JJGA 2LMUA 1SBJA 1CLLA 1W7IB 1QX5B 3BXKA 3TUYB 1GQMA 4MLWA 3RLZA 2JTTA 4YI8A 1FW4A 1Y0VH 1TN4A 4BY4A 1FF1A 1NUBA 4M2OA 2G2BA 2DOQA 1YUTA 3OB2B 1TOPA 3DVEA 2M0RA 4OKHA 3IF7A 4OV2A 4YGCB 2KSPA 1PSRA 1M46A 4NDDA 4CIDA 3I5HB 2F33A 2LLSA 1K90D 2NXQA 1Y1UA 1NP8A 1SL9A 1YRTB 2NCOA 1F71A 1S6CA 3WHUB 3CR5X 1AK8A 1N65A 1AHRA 4GNKB 4MSPA 3K21A 5AANA 4IL1A 1H8BA 1K9PA 1LA0A 4UPGA 1K9UA 2KHNA 3O2PA 5CSNA 3QRXA 3D0YB 2LUXA 3VRPA 2MRDA 2WOSA 3I5IB 2M97A 1RWYA 4GPLB 1H4BA 1OMDA 5D69A 2O5GA 1BT6A 1KWOB 2KYCA 2L2EA 3EK4A 4MZLA 2ZN9A 3EKHA 3EVUA 1XFZO 2JRFA 1AP4A 1KFUS 1CM1A 4A4CA 4QJ4B 1N0YA 1S5GY 1Y1XA 1OMRA 1CNPA 2M1KB 2LVIA 2MLFC 1C7VA 2PASA 3BUWB 3ZNIA 4A4BA 4AQIA 3BOWB 2H2KA 1CDNA 3I5FB 3KEVA 3TDIA 2I94A 4WRIA 4C0KA 1KK8C 2JT0A 3I5HC 1MXLC 5J3XA 4C0LA 4E68A 1SL7A 2H61A 5I2LA 1F8HA 4D1EA 3JTDB 3PSRA 1MR8A 2COLB 1S5GZ 1BOCA 2M8UA 2ZRSA 1CKKA 5CSJA 2Y5IA 1NX2A 5G08A 4N5XA 4FQOA 3CWGA 1QTXA 4N1FA 1DTLA 3SIAA 3HCMA 1TNXA 3C1VA 3SG7A 1DT7B 2P6BB 1J7RA 5HYDA 1CFDA 4C0JA 1CFFA 5AERA 2WCFA 3NSIA 2KAXA 3DVKA 4ORAB 3BUOB 1Y6WA 2SCPA 1F4QA 3DVMA 1SY9A 1UHIA 1C7WA 2AMIA 1K95A 1F55A 1UP5A 1A2XA 4OVNF 1C07A 1E8AA 1S6IA 4JQ0D 1IJ6A 5CSIA 1JUOA 1CDPA 1B8RA 1R6PA 2NZ0A 1XVJA 2L4IA 4Q04A 1UUSA 5KSZA 2GGMA 2LLUA 2NLNA 2LMTA 3OB1B 4M2QA 2JOJA 2FJUB 2K7CA 1JC2A 3AAJA 3ZWHA 2JT8A 1YX7A 3CGAA 1YUUA 2B1UA 1V1GA 1ZMZA 4OCIA 1HT9A 1F54A 1S3PA 1YR5A 2JTZA 3OP0A 4M2PA 1S36A 1EJ3A 1KWOC 1QS7A 2AUCA 2BKHB 1IGVA 4BY5A 3KF9A 1CFCA 1QV0A 1B7TY 2KFGA 1TNPA 2ZKMX 4YRUA 5KTYA 1FPWA 1NCYA 2LLTA 1CMFA 2LV7A 4XJKB 4L9MA 3BUNB 1K9KA 2L98A 4ETOA 3I5FC 2K8MB 1KCYA 4DRWA 1NX0A 1KQVA 1KK7Y 1CMGA 1SPYA 4JWQA 2PALA 3AKBA 2K7OA 2KI6C 1AJ4A 1WRZA 2LAPA 3RM1A 3CLNA 1DGVA 2CCMA 3SIBA 1Q80A 1K2HA 2HPSA 4PALA 1AVSA 4NDCA 1UHNA 1MF8B 1B8CA 1QXPA 1IQ5A 3KO0A 3BUXB 3PALA 1PSBA 2LNKA 2ZN8A 1DJGA 5AEQA 1GJYA 3SG6A 5AFPA 1A75B 1BODA 4P5OE 4PHJA 1L2OB 1OMVA 2LC5A 1EH2A 3D10A 2CTNA 1DGUA
chains in the Genus database with same CATH superfamily
4OZDA 1DC1A 4GUKA 1CLBA 5GQQC 1LS8A 2GGZA 1UHHA 1L7ZA 1OE9B 4GGFC 1FI6A 2F3YA 2EC6B 2F8PA 4GGNA 2LE9B 1DEKA 4N1GA 4MZKA 2LM5A 2WCEA 4MBEA 1YUSA 1JSAA 1XFXO 1J55A 3CZ2A 5ER4X 1XK4A 1KSOA 1PVAA 1M31A 2F3ZA 3E3RA 1OOGA 5FI2A 2KQ6A 3CDNA 1KFXS 1ODBA 2BBMA 2PMYA 3BFAA 1OOJA 3NHIA 3NSKA 1KSMA 3A4UB 3NSLA 3R1PA 1IRJA 1QIVA 3GK4X 1EG3A 5HKWA 3JVTC 1QATA 1AJ5A 1XFRA 4ORCB 1J1DA 1IQ3A 2KGRA 1XO5A 3KHEA 3S0DA 2OS8B 1XFUO 3TDZA 2ZNEA 5AXIA 1OSAA 4I5NB 2F2PA 1SR6B 1SRAA 2BE4A 3LK1A 1NX1A 2KBIA 1U5IB 4PE7A 2LVVA 4PCWA 3D78A 2K7DA 2KFHA 4INWA 3TUYC 2QEHA 3CR4X 5JOLA 2ZNDA 3TZ1A 3S0FA 2WCJA 2H61C 2KI4C 2BKIB 1WDCC 3CTNA 1JF2A 2KI4B 3MSEB 4P2YB 3SG5A 2FOTA 2BL0B 1QLKA 2JU0A 4U8DA 4MEWA 4ZCVA 3WNXB 2WCLA 1NIWA 3AKAA 2KAVA 2EHBA 2WC8A 1K94A 1A4PA 1NWDA 1S6JA 2JPTA 2KOTA 1DJHA 4MZJA 1YURA 3PFVA 2HQ8A 4WQ2A 1SCVA 2K2FA 2MLEC 2LUCA 2NCPA 1KQMC 1CTRA 2L4HA 3LK0A 2MAZA 2PYQA 3BYAA 5DKNA 4YGEB 3WXAA 1TTXA 5HL1A 1IKUA 3BUMB 3PN7C 3SJSA 1R2UA 3EK7A 3L4LA 3PN7B 2JQ6A 2QDIA 3B88A 2ZRTA 5DKRA 1BLQA 3VROA 3V2LA 2GV5A 1OZOA 3OGNA 3PLFB 1BR1B 1HQVA 2K2AA 3BOWA 3VGOA 2CNPA 2I2RE 1KK7Z 1C3YA 2QEBA 2R2IA 2A4JA 3B7AA 3FWBA 3O4XA 2L2CA 2K61A 2M3WA 4I5KA 4INXA 1S1EA 2D8NA 1J7PA 3PJIA 3LLEA 2JXCA 1DJWA 2M7LA 3B6XA 3PATA 2WORA 1OZSA 1DJIA 3D0YA 1G4YR 3DY9A 1PRWA 2BECA 1B7TZ 2HETA 3DF0A 1TRFA 1OW4A 2EC6C 1B47A 3BQ3A 1XYDA 3OBVA 2LHIA 2KNEA 2ISDA 2BBNA 1QVIZ 1B8LA 1V1FA 2JNFA 1SNLA 2M9GA 1KFUL 4CFQA 1RJVA 2BNXA 4YGAA 1A29A 2L0PA 2HF5A 2I18A 3JTDC 5I2OA 5TNCA 3I5GB 3LL8B 4CFRA 1FBVA 1SL8A 1WDCB 4DS7A 3D73A 1GGWA 2Q4UA 1YVHA 1DJXA 2TN4A 2VRGA 1QJTA 4HSZA 1DJZA 5PALA 3SS5A 1RROA 3NSOA 1MUXA 1LVCD 4JPZB 4PE0A 1TWOA 5F6TA 1FI5A 1YRUB 3HX4A 2LANA 2GTEA 1J7QA 1M45A 1XA5A 5DICA 3KPXA 1BMOA 4PHKA 3TS5C 3GK1A 2M29A 1KFXL 3CS1A 2KLEA 1NPQA 1UHKA 1TNWA 2L5XB 4MRXA 5HKZA 1X02A 1DQEA 1XFVO 2BCAA 3LCPC 4PT1A 3EVVA 3RZSA 1SSEB 3IQQA 4GFTA 1NCZA 1IH0A 2MA2A 1MWNA 3O4YA 4R1EA 1BJFA 1BU3A 1K93D 1TCOB 1LKJA 1WRKA 2LCPA 4MVFA 4PE4A 4CPVA 3FE6A 3WHTB 4OR9B 2WC5A 1XFWO 5ER5A 2CT9A 1DF0A 2PVBA 3VRQA 2YGUA 3VRRA 1NSHA 4PE1A 5HKYA 4DIRA 1ZUZA 5EL2A 2SASA 4XYNA 2F2OA 1JFJA 1AUIB 4ORBB 4QJ3B 4ZCUA 3VRNA 2Y4QA 2JC2A 4JD9A 5I8NA 1RECA 4I5JA 1DJYA 3B87A 1TIZA 1DVIA 2QPTA 1JBAA 2LHLA 2FCEA 1U5IA 2BL0C 2MBXA 2Y1MA 2BE6A 1SW8A 2CBLA 2L50A 1QX7A 1BF5A 3FE9A 1K8UA 4HREE 5CSFA 1SMGA 2K7BA 1EL4A 1QASA 1QV1A 1TNQA 1YX8A 1RTP1 1YVLA 3M0WA 3Q8IA 2K0JA 2BCBA 1JF0A 3TDUA 4AOMA 1RFJA 3S0GA 4DUQA 2IS9A 3D75A 2KBMA 4FQTA 3A8RA 4USLA 2MHHA 4NQGA 2Y1NA 1A75A 4YI9A 1TUJA 1WRLA 4HRHA 1TCFA 3VB1A 5HLVA 1BR4B 1LXFC 1NYAA 2JT3A 2ZFDA 3I5GC 1UWOA 3NXAA 3EK8A 3IVTA 2KI6D 2FCDA 3CR2A 1SCMB 5KU1A 1OOFA 3OX5A 2P70A 3OHMB 3O6BA 1VRKA 2OPOA 1J1EA 1NCXA 4GGFA 4MN0A 4PDZA 4QJ5B 2LP3A 2I7AA 3ICBA 2V53A 2O60A 1EXRA 3SG2A 3CABA 4TNCA 3D77A 3SG3A 1Y1AA 1LINA 1MQ1A 1B9AA 1KK8B 1QX2A 3CYZA 4NDBA 2PSRA 2WC6A 3DD4A 2LMVA 1MXEA 1JFKA 2OTGC 3SG4A 1W7JB 4WQ3A 4GBAA 1SYMA 4ICBA 3EG5B 1Z2CB 1CM4A 2KDHA 5HLOA 1PVBA 5D7FA 2JXLA 1BG1A 3OX6A 5K89A 1XFYO 2M7NA 2KPHA 1M63B 5DKQA 2WNDA 4YBHB 3FIAA 2E30A 2KAYA 2LVKA 3PM8A 2CXJA 3GK2A 3CZTX 1C3ZA 1D1OA 1B4CA 1J7OA 1ALVA 1IWQA 1QVIY 2QACA 2JWWA 2EGDA 1JWDA 3K1EA 4PHNA 1MHOA 5IBWA 2Q91A 4XJKA 3EKJA 3JVTB 2AAOA 3SS3A 3L4AA 1WY9A 2RGIA 4PHMA 3H4SE 1UURA 1G33A 1IG5A 1PULA 2LP2A 2BCXA 3DVJA 4YGDB 1UHJA 2OTGB 1YTZC 5I94A 1SKTA 1EG4A 1SR6C 1XK4C 2M1UA 3O78A 1PK0D 1WLMA 1F70A 1G8IA 1IJ5A 1OQPA 1B1GA 1K96A 1PALA 1CDMA 3FS7A 3DF0B 5B8IB 4YGBB 2WCBA 1S26D 1WLZA 2KYFA 2JULA 4MRYA 2FJYA 3NGVA 4FTGA 3DXLA 2MJWB 3EVRA 2HQWA 3S0EA 1SCMC 1GGZA 3F45A 5FYXA 2PRUA 3QMEA 3GOFA 3IQOA 5CPVA 2JZIA 3SS4A 1ZOTB 1ZACA 1CFPA 2OS8C 1KQMB 1L2OC 4AQJA 5BPJA 2G9BA 5D3OA 1SK6D 3TS5B 1NX3A 3R1OA 3UO9A 1QIWA 1CB1A 4F0ZB 1CDLA 4DCKA 1DF0B 1M39A 2KFFA 4GAOA 1CLMA 1ALWA 1QLSA 1ZFSA 4KYNA 1RK9A 2P71A 2LVJA 2M49B 4I5LB 1A03A 1N2DA 2KGBC 2E6WA 2L51A 2QEVA 3FWCA 3I5IC 4HRGA 2JNXA 1F4OA 1TUZA 3AAKA 4CLNA 2KQYA 1DMOA 1LA3A 5JJGA 2BAPA 2LMUA 1SBJA 1CLLA 1W7IB 3BJHA 3UNWA 1QX5B 3BXKA 3TUYB 1GQMA 1ORGA 4MLWA 3RLZA 2JTTA 4YI8A 1FW4A 1Y0VH 1TN4A 4BY4A 1FF1A 1NUBA 4M2OA 2G2BA 2DOQA 1YUTA 3OB2B 1TOPA 3DVEA 2M0RA 3PM2A 4OKHA 3IF7A 4OV2A 4YGCB 2KSPA 1PSRA 1M46A 4NDDA 4CIDA 3I5HB 2F33A 3CZ1A 2LLSA 1K90D 2NXQA 3D74A 1Y1UA 1NP8A 1SL9A 1YRTB 2H8VA 2NCOA 1F71A 1S6CA 3WHUB 3B86A 3CR5X 1N65A 1AK8A 3R72A 1IIOA 1AHRA 4GNKB 4MSPA 3K21A 5AANA 4IL1A 1H8BA 1K9PA 1LA0A 4UPGA 1K9UA 2KHNA 2QEOA 5FI6A 3O2PA 5CSNA 3QRXA 3D0YB 2LUXA 3VRPA 3NHTA 2MRDA 2WOSA 3I5IB 2M97A 1RWYA 3BFHA 4GPLB 1H4BA 1OMDA 3D76A 5D69A 2O5GA 1BT6A 1KWOB 2KYCA 2L2EA 2WCKA 3EK4A 4MZLA 2ZN9A 3EKHA 3EVUA 1XFZO 2JRFA 1AP4A 1KFUS 1CM1A 4A4CA 4QJ4B 1W9ZA 1N0YA 1S5GY 1Y1XA 1OMRA 2JPOA 1CNPA 2M1KB 3CZ0A 2LVIA 2MLFC 1C7VA 2PASA 3BUWB 3ZNIA 4A4BA 4AQIA 3BOWB 2H2KA 2ERBA 3I5FB 3KEVA 3TDIA 2I94A 4WRIA 4C0KA 1CDNA 1GM0A 1KK8C 2JT0A 3I5HC 1MXLC 5J3XA 4C0LA 4JKTA 4E68A 1SL7A 2H61A 5I2LA 1F8HA 4D1EA 1OOIX 3JTDB 3PSRA 1MR8A 4IJ7A 2COLB 1S5GZ 1BOCA 2M8UA 2ZRSA 1CKKA 5CSJA 2Y5IA 1NX2A 5G08A 4N5XA 4FQOA 3CWGA 1QTXA 4N1FA 1DELA 1DTLA 3SIAA 3HCMA 1TNXA 3C1VA 3SG7A 1DT7B 2P6BB 1J7RA 1OOHA 5HYDA 1CFDA 5FI7A 1P28A 2WCHA 4C0JA 1CFFA 5AERA 2WCFA 3NSIA 2KAXA 3DVKA 4ORAB 3BUOB 3L47A 1Y6WA 2SCPA 1F4QA 3DVMA 1SY9A 1UHIA 1C7WA 2WCMA 2AMIA 1K95A 1F55A 1UP5A 1A2XA 4OVNF 1C07A 1E8AA 1S6IA 4JQ0D 1IJ6A 5CSIA 1JUOA 1CDPA 1B8RA 1R6PA 2NZ0A 1XVJA 2L4IA 4Q04A 1UUSA 5KSZA 2GGMA 2LLUA 2NLNA 2LMTA 3OB1B 1Z4HA 4M2QA 2JOJA 2FJUB 2K7CA 1JC2A 3AAJA 3ZWHA 2JT8A 1YX7A 3CGAA 1YUUA 3S0AA 2B1UA 3BFBA 1V1GA 3R1VA 1ZMZA 4OCIA 1HT9A 1F54A 2L5YA 1S3PA 1YR5A 2JTZA 3OP0A 4M2PA 1S36A 5I2QA 1EJ3A 1KWOC 1QS7A 2AUCA 2BKHB 1IGVA 4BY5A 3KF9A 1CFCA 1QV0A 1B7TY 2KFGA 1TNPA 2ZKMX 4YRUA 5KTYA 1FPWA 1NCYA 3DYEA 2LLTA 1CMFA 2LV7A 4XJKB 4L9MA 3DZTA 3BUNB 1K9KA 2L98A 4ETOA 3I5FC 2K8MB 1KCYA 4DRWA 1NX0A 1KQVA 1KK7Y 1CMGA 2PQLA 1SPYA 4JWQA 2PALA 3AKBA 2KLDA 2K7OA 2KI6C 1AJ4A 1QWVA 1WRZA 2LAPA 3N7HA 3RM1A 3CLNA 1DGVA 2K60A 2CCMA 3SIBA 1Q80A 1K2HA 3S0BA 2HPSA 4PALA 1AVSA 3FE8A 4NDCA 1UHNA 1MF8B 1B8CA 1QXPA 1IQ5A 3KO0A 3BUXB 3PALA 1PSBA 2LNKA 2ZN8A 1DJGA 5AEQA 1GJYA 3SG6A 5AFPA 1A75B 1BODA 4P5OE 4PHJA 1L2OB 1OMVA 2LC5A 4F7FA 1T14A 1EH2A 3D10A 2CTNA 1DGUA
chains in the Genus database with same CATH topology
4GUKA 1CLBA 5GQQC 2GGZA 1UHHA 1L7ZA 1OE9B 4GGFC 1FI6A 2F3YA 2EC6B 2F8PA 4GGNA 2LE9B 4N1GA 4MZKA 2LM5A 2WCEA 4MBEA 1YUSA 1JSAA 1XFXO 1J55A 5ER4X 1XK4A 1KSOA 1PVAA 1M31A 2F3ZA 3E3RA 2KQ6A 1KFXS 1ODBA 2BBMA 2PMYA 3NSLA 1OOJA 3NSKA 1KSMA 3A4UB 1IRJA 1QIVA 3GK4X 1EG3A 5HKWA 3JVTC 1QATA 1AJ5A 4ORCB 1J1DA 1IQ3A 2KGRA 1XO5A 3KHEA 2OS8B 1XFUO 3TDZA 2ZNEA 5AXIA 1OSAA 4I5NB 2F2PA 1SR6B 1SRAA 2BE4A 3LK1A 1NX1A 2KBIA 1U5IB 4PE7A 2LVVA 4PCWA 2K7DA 2KFHA 3TUYC 3CR4X 5JOLA 2ZNDA 3TZ1A 2H61C 2KI4C 2BKIB 1WDCC 3CTNA 1JF2A 2KI4B 3MSEB 4P2YB 3SG5A 2FOTA 2BL0B 1QLKA 2JU0A 4U8DA 4MEWA 4ZCVA 3WNXB 1NIWA 3AKAA 2KAVA 2EHBA 2WC8A 1K94A 1A4PA 1NWDA 1S6JA 2JPTA 2KOTA 1DJHA 4MZJA 1YURA 3PFVA 2HQ8A 4WQ2A 1SCVA 2K2FA 2MLEC 2LUCA 2NCPA 1KQMC 1CTRA 2L4HA 3LK0A 2MAZA 3BYAA 5DKNA 4YGEB 3WXAA 1TTXA 1IKUA 3BUMB 3PN7C 3SJSA 1R2UA 3EK7A 3PN7B 2JQ6A 2ZRTA 5DKRA 1BLQA 3VROA 2GV5A 1OZOA 3PLFB 1BR1B 1HQVA 2K2AA 3BOWA 3VGOA 2CNPA 2I2RE 1KK7Z 2R2IA 2A4JA 3FWBA 2K61A 2M3WA 4I5KA 1S1EA 2D8NA 1J7PA 3LLEA 2JXCA 1DJWA 2M7LA 3PATA 2WORA 1OZSA 1DJIA 3D0YA 1G4YR 1PRWA 2BECA 1B7TZ 2HETA 3DF0A 1TRFA 2EC6C 1B47A 3BQ3A 1XYDA 2LHIA 2KNEA 2ISDA 2BBNA 1QVIZ 1B8LA 1V1FA 2JNFA 1SNLA 2M9GA 1KFUL 4CFQA 1RJVA 4YGAA 1A29A 2L0PA 2HF5A 2I18A 3JTDC 5I2OA 5TNCA 3I5GB 3LL8B 4CFRA 1FBVA 1SL8A 1WDCB 4DS7A 1GGWA 2Q4UA 1YVHA 1DJXA 2TN4A 2VRGA 1QJTA 4HSZA 1DJZA 5PALA 1RROA 3NSOA 1MUXA 1LVCD 4JPZB 4PE0A 5F6TA 1FI5A 1YRUB 3HX4A 2LANA 1J7QA 1M45A 1XA5A 3KPXA 1BMOA 4PHKA 3TS5C 3GK1A 2M29A 1KFXL 3CS1A 1NPQA 1UHKA 1TNWA 2L5XB 4MRXA 5HKZA 1X02A 1XFVO 2BCAA 3LCPC 3EVVA 3IQQA 4GFTA 1NCZA 1IH0A 2MA2A 1MWNA 3O4YA 4R1EA 1BJFA 1BU3A 1K93D 1TCOB 1LKJA 1WRKA 2LCPA 4MVFA 4PE4A 4CPVA 3WHTB 4OR9B 1XFWO 5ER5A 2CT9A 1DF0A 2PVBA 3VRQA 3VRRA 1NSHA 4PE1A 5HKYA 4DIRA 1ZUZA 2SASA 4XYNA 2F2OA 1JFJA 1AUIB 4ORBB 4QJ3B 4ZCUA 3VRNA 2Y4QA 2JC2A 5I8NA 1RECA 4I5JA 1DJYA 1TIZA 1DVIA 2QPTA 1JBAA 2LHLA 2FCEA 1U5IA 2BL0C 2MBXA 2Y1MA 2BE6A 1SW8A 2CBLA 2L50A 1QX7A 1BF5A 1K8UA 4HREE 5CSFA 1SMGA 2K7BA 1EL4A 1QASA 1QV1A 1TNQA 1YX8A 1RTP1 1YVLA 3M0WA 2K0JA 2BCBA 1JF0A 3TDUA 4AOMA 1RFJA 4DUQA 2IS9A 2KBMA 3A8RA 4USLA 2MHHA 4NQGA 2Y1NA 1A75A 4YI9A 1WRLA 4HRHA 1TCFA 5HLVA 1BR4B 1LXFC 1NYAA 2JT3A 2ZFDA 3I5GC 1UWOA 3NXAA 3EK8A 2KI6D 2FCDA 3CR2A 1SCMB 5KU1A 3OX5A 3OHMB 3O6BA 1VRKA 2OPOA 1J1EA 1NCXA 4GGFA 4MN0A 4PDZA 4QJ5B 2LP3A 2I7AA 3ICBA 2V53A 2O60A 1EXRA 3SG2A 4TNCA 3SG3A 1Y1AA 1LINA 1MQ1A 1B9AA 1KK8B 1QX2A 4NDBA 2PSRA 3DD4A 2LMVA 1MXEA 1JFKA 2OTGC 3SG4A 1W7JB 4WQ3A 4GBAA 1SYMA 4ICBA 1CM4A 2KDHA 5HLOA 1PVBA 5D7FA 2JXLA 1BG1A 3OX6A 5K89A 1XFYO 2M7NA 1M63B 5DKQA 2WNDA 4YBHB 3FIAA 2E30A 2KAYA 2LVKA 3PM8A 2CXJA 3GK2A 3CZTX 1D1OA 1B4CA 1J7OA 1ALVA 1IWQA 1QVIY 2QACA 2JWWA 2EGDA 1JWDA 5IBWA 4PHNA 1MHOA 2Q91A 4XJKA 3EKJA 3JVTB 2AAOA 1WY9A 2RGIA 4PHMA 3H4SE 1UURA 1G33A 1IG5A 1PULA 2LP2A 2BCXA 3DVJA 4YGDB 1UHJA 2OTGB 1YTZC 1SKTA 1EG4A 1SR6C 1XK4C 2M1UA 3O78A 1PK0D 1WLMA 1F70A 1G8IA 1IJ5A 1OQPA 1B1GA 1K96A 1PALA 1CDMA 3FS7A 3DF0B 5B8IB 4YGBB 2WCBA 1S26D 1WLZA 2KYFA 2JULA 4MRYA 4FTGA 2MJWB 3EVRA 2HQWA 1SCMC 1GGZA 3F45A 5FYXA 2PRUA 3GOFA 3IQOA 5CPVA 2JZIA 1ZOTB 1ZACA 1CFPA 2OS8C 1KQMB 1L2OC 4AQJA 5BPJA 2G9BA 3TS5B 1SK6D 5I2QA 1NX3A 1CB1A 1QIWA 4F0ZB 1CDLA 4DCKA 1DF0B 1M39A 2KFFA 4GAOA 1CLMA 1ALWA 1QLSA 1ZFSA 1RK9A 2LVJA 2M49B 4I5LB 1A03A 1N2DA 2KGBC 2E6WA 2L51A 3FWCA 3I5IC 4HRGA 2JNXA 1F4OA 3AAKA 4CLNA 1DMOA 2KQYA 1LA3A 5JJGA 2LMUA 1SBJA 1CLLA 1W7IB 1QX5B 3BXKA 3TUYB 1GQMA 4MLWA 3RLZA 2JTTA 4YI8A 1FW4A 1Y0VH 1TN4A 4BY4A 1FF1A 1NUBA 4M2OA 2G2BA 2DOQA 1YUTA 3OB2B 1TOPA 3DVEA 2M0RA 4OKHA 3IF7A 4OV2A 4YGCB 2KSPA 1PSRA 1M46A 4NDDA 4CIDA 3I5HB 2F33A 2LLSA 1K90D 2NXQA 1Y1UA 1NP8A 1SL9A 1YRTB 2NCOA 1F71A 1S6CA 3WHUB 3CR5X 1AK8A 1N65A 1AHRA 4GNKB 4MSPA 3K21A 5AANA 4IL1A 1H8BA 1K9PA 1LA0A 4UPGA 1K9UA 2KHNA 3O2PA 5CSNA 3QRXA 3D0YB 2LUXA 3VRPA 2MRDA 2WOSA 3I5IB 2M97A 1RWYA 4GPLB 1H4BA 1OMDA 5D69A 2O5GA 1BT6A 1KWOB 2KYCA 2L2EA 3EK4A 4MZLA 2ZN9A 3EKHA 3EVUA 1XFZO 2JRFA 1AP4A 1KFUS 1CM1A 4A4CA 4QJ4B 1N0YA 1S5GY 1Y1XA 1OMRA 1CNPA 2M1KB 2LVIA 2MLFC 1C7VA 2PASA 3BUWB 3ZNIA 4A4BA 4AQIA 3BOWB 2H2KA 1CDNA 3I5FB 3KEVA 3TDIA 2I94A 4WRIA 4C0KA 1KK8C 2JT0A 3I5HC 1MXLC 5J3XA 4C0LA 4E68A 1SL7A 2H61A 5I2LA 1F8HA 4D1EA 3JTDB 3PSRA 1MR8A 2COLB 1S5GZ 1BOCA 2M8UA 2ZRSA 1CKKA 5CSJA 2Y5IA 1NX2A 5G08A 4N5XA 4FQOA 3CWGA 1QTXA 4N1FA 1DTLA 3SIAA 3HCMA 1TNXA 3C1VA 3SG7A 1DT7B 2P6BB 1J7RA 5HYDA 1CFDA 4C0JA 1CFFA 5AERA 2WCFA 3NSIA 2KAXA 3DVKA 4ORAB 3BUOB 1Y6WA 2SCPA 1F4QA 3DVMA 1SY9A 1UHIA 1C7WA 2AMIA 1K95A 1F55A 1UP5A 1A2XA 4OVNF 1C07A 1E8AA 1S6IA 4JQ0D 1IJ6A 5CSIA 1JUOA 1CDPA 1B8RA 1R6PA 2NZ0A 1XVJA 2L4IA 4Q04A 1UUSA 5KSZA 2GGMA 2LLUA 2NLNA 2LMTA 3OB1B 4M2QA 2JOJA 2FJUB 2K7CA 1JC2A 3AAJA 3ZWHA 2JT8A 1YX7A 3CGAA 1YUUA 2B1UA 1V1GA 1ZMZA 4OCIA 1HT9A 1F54A 1S3PA 1YR5A 2JTZA 3OP0A 4M2PA 1S36A 1EJ3A 1KWOC 1QS7A 2AUCA 2BKHB 1IGVA 4BY5A 3KF9A 1CFCA 1QV0A 1B7TY 2KFGA 1TNPA 2ZKMX 4YRUA 5KTYA 1FPWA 1NCYA 2LLTA 1CMFA 2LV7A 4XJKB 4L9MA 3BUNB 1K9KA 2L98A 4ETOA 3I5FC 2K8MB 1KCYA 4DRWA 1NX0A 1KQVA 1KK7Y 1CMGA 1SPYA 4JWQA 2PALA 3AKBA 2K7OA 2KI6C 1AJ4A 1WRZA 2LAPA 3RM1A 3CLNA 1DGVA 2CCMA 3SIBA 1Q80A 1K2HA 2HPSA 4PALA 1AVSA 4NDCA 1UHNA 1MF8B 1B8CA 1QXPA 1IQ5A 3KO0A 3BUXB 3PALA 1PSBA 2LNKA 2ZN8A 1DJGA 5AEQA 1GJYA 3SG6A 5AFPA 1A75B 1BODA 4P5OE 4PHJA 1L2OB 1OMVA 2LC5A 1EH2A 3D10A 2CTNA 1DGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GUK A;  1CLB A;  5GQQ C;  2GGZ A;  1UHH A;  1L7Z A;  1OE9 B;  4GGF C;  1FI6 A;  2F3Y A;  2EC6 B;  2F8P A;  4GGN A;  2LE9 B;  4N1G A;  4MZK A;  2LM5 A;  2WCE A;  4MBE A;  1YUS A;  1JSA A;  1XFX O;  1J55 A;  5ER4 X;  1XK4 A;  1KSO A;  1PVA A;  1M31 A;  2F3Z A;  3E3R A;  2KQ6 A;  1KFX S;  1ODB A;  2BBM A;  2PMY A;  3NSL A;  1OOJ A;  3NSK A;  1KSM A;  3A4U B;  1IRJ A;  1QIV A;  3GK4 X;  1EG3 A;  5HKW A;  3JVT C;  1QAT A;  1AJ5 A;  4ORC B;  1J1D A;  1IQ3 A;  2KGR A;  1XO5 A;  3KHE A;  2OS8 B;  1XFU O;  3TDZ A;  2ZNE A;  5AXI A;  1OSA A;  4I5N B;  2F2P A;  1SR6 B;  1SRA A;  2BE4 A;  3LK1 A;  1NX1 A;  2KBI A;  1U5I B;  4PE7 A;  2LVV A;  4PCW A;  2K7D A;  2KFH A;  3TUY C;  3CR4 X;  5JOL A;  2ZND A;  3TZ1 A;  2H61 C;  2KI4 C;  2BKI B;  1WDC C;  3CTN A;  1JF2 A;  2KI4 B;  3MSE B;  4P2Y B;  3SG5 A;  2FOT A;  2BL0 B;  1QLK A;  2JU0 A;  4U8D A;  4MEW A;  4ZCV A;  3WNX B;  1NIW A;  3AKA A;  2KAV A;  2EHB A;  2WC8 A;  1K94 A;  1A4P A;  1NWD A;  1S6J A;  2JPT A;  2KOT A;  1DJH A;  4MZJ A;  1YUR A;  3PFV A;  2HQ8 A;  4WQ2 A;  1SCV A;  2K2F A;  2MLE C;  2LUC A;  2NCP A;  1KQM C;  1CTR A;  2L4H A;  3LK0 A;  2MAZ A;  3BYA A;  5DKN A;  4YGE B;  3WXA A;  1TTX A;  1IKU A;  3BUM B;  3PN7 C;  3SJS A;  1R2U A;  3EK7 A;  3PN7 B;  2JQ6 A;  2ZRT A;  5DKR A;  1BLQ A;  3VRO A;  2GV5 A;  1OZO A;  3PLF B;  1BR1 B;  1HQV A;  2K2A A;  3BOW A;  3VGO A;  2CNP A;  2I2R E;  1KK7 Z;  2R2I A;  2A4J A;  3FWB A;  2K61 A;  2M3W A;  4I5K A;  1S1E A;  2D8N A;  1J7P A;  3LLE A;  2JXC A;  1DJW A;  2M7L A;  3PAT A;  2WOR A;  1OZS A;  1DJI A;  3D0Y A;  1G4Y R;  1PRW A;  2BEC A;  1B7T Z;  2HET A;  3DF0 A;  1TRF A;  2EC6 C;  1B47 A;  3BQ3 A;  1XYD A;  2LHI A;  2KNE A;  2ISD A;  2BBN A;  1QVI Z;  1B8L A;  1V1F A;  2JNF A;  1SNL A;  2M9G A;  1KFU L;  4CFQ A;  1RJV A;  4YGA A;  1A29 A;  2L0P A;  2HF5 A;  2I18 A;  3JTD C;  5I2O A;  5TNC A;  3I5G B;  3LL8 B;  4CFR A;  1FBV A;  1SL8 A;  1WDC B;  4DS7 A;  1GGW A;  2Q4U A;  1YVH A;  1DJX A;  2TN4 A;  2VRG A;  1QJT A;  4HSZ A;  1DJZ A;  5PAL A;  1RRO A;  3NSO A;  1MUX A;  1LVC D;  4JPZ B;  4PE0 A;  5F6T A;  1FI5 A;  1YRU B;  3HX4 A;  2LAN A;  1J7Q A;  1M45 A;  1XA5 A;  3KPX A;  1BMO A;  4PHK A;  3TS5 C;  3GK1 A;  2M29 A;  1KFX L;  3CS1 A;  1NPQ A;  1UHK A;  1TNW A;  2L5X B;  4MRX A;  5HKZ A;  1X02 A;  1XFV O;  2BCA A;  3LCP C;  3EVV A;  3IQQ A;  4GFT A;  1NCZ A;  1IH0 A;  2MA2 A;  1MWN A;  3O4Y A;  4R1E A;  1BJF A;  1BU3 A;  1K93 D;  1TCO B;  1LKJ A;  1WRK A;  2LCP A;  4MVF A;  4PE4 A;  4CPV A;  3WHT B;  4OR9 B;  1XFW O;  5ER5 A;  2CT9 A;  1DF0 A;  2PVB A;  3VRQ A;  3VRR A;  1NSH A;  4PE1 A;  5HKY A;  4DIR A;  1ZUZ A;  2SAS A;  4XYN A;  2F2O A;  1JFJ A;  1AUI B;  4ORB B;  4QJ3 B;  4ZCU A;  3VRN A;  2Y4Q A;  2JC2 A;  5I8N A;  1REC A;  4I5J A;  1DJY A;  1TIZ A;  1DVI A;  2QPT A;  1JBA A;  2LHL A;  2FCE A;  1U5I A;  2BL0 C;  2MBX A;  2Y1M A;  2BE6 A;  1SW8 A;  2CBL A;  2L50 A;  1QX7 A;  1BF5 A;  1K8U A;  4HRE E;  5CSF A;  1SMG A;  2K7B A;  1EL4 A;  1QAS A;  1QV1 A;  1TNQ A;  1YX8 A;  1RTP 1;  1YVL A;  3M0W A;  2K0J A;  2BCB A;  1JF0 A;  3TDU A;  4AOM A;  1RFJ A;  4DUQ A;  2IS9 A;  2KBM A;  3A8R A;  4USL A;  2MHH A;  4NQG A;  2Y1N A;  1A75 A;  4YI9 A;  1WRL A;  4HRH A;  1TCF A;  5HLV A;  1BR4 B;  1LXF C;  1NYA A;  2JT3 A;  2ZFD A;  3I5G C;  1UWO A;  3NXA A;  3EK8 A;  2KI6 D;  2FCD A;  3CR2 A;  1SCM B;  5KU1 A;  3OX5 A;  3OHM B;  3O6B A;  1VRK A;  2OPO A;  1J1E A;  1NCX A;  4GGF A;  4MN0 A;  4PDZ A;  4QJ5 B;  2LP3 A;  2I7A A;  3ICB A;  2V53 A;  2O60 A;  1EXR A;  3SG2 A;  4TNC A;  3SG3 A;  1Y1A A;  1LIN A;  1MQ1 A;  1B9A A;  1KK8 B;  1QX2 A;  4NDB A;  2PSR A;  3DD4 A;  2LMV A;  1MXE A;  1JFK A;  2OTG C;  3SG4 A;  1W7J B;  4WQ3 A;  4GBA A;  1SYM A;  4ICB A;  1CM4 A;  2KDH A;  5HLO A;  1PVB A;  5D7F A;  2JXL A;  1BG1 A;  3OX6 A;  5K89 A;  1XFY O;  2M7N A;  1M63 B;  5DKQ A;  2WND A;  4YBH B;  3FIA A;  2E30 A;  2KAY A;  2LVK A;  3PM8 A;  2CXJ A;  3GK2 A;  3CZT X;  1D1O A;  1B4C A;  1J7O A;  1ALV A;  1IWQ A;  1QVI Y;  2QAC A;  2JWW A;  2EGD A;  1JWD A;  5IBW A;  4PHN A;  1MHO A;  2Q91 A;  4XJK A;  3EKJ A;  3JVT B;  2AAO A;  1WY9 A;  2RGI A;  4PHM A;  3H4S E;  1UUR A;  1G33 A;  1IG5 A;  1PUL A;  2LP2 A;  2BCX A;  3DVJ A;  4YGD B;  1UHJ A;  2OTG B;  1YTZ C;  1SKT A;  1EG4 A;  1SR6 C;  1XK4 C;  2M1U A;  3O78 A;  1PK0 D;  1WLM A;  1F70 A;  1G8I A;  1IJ5 A;  1OQP A;  1B1G A;  1K96 A;  1PAL A;  1CDM A;  3FS7 A;  3DF0 B;  5B8I B;  4YGB B;  2WCB A;  1S26 D;  1WLZ A;  2KYF A;  2JUL A;  4MRY A;  4FTG A;  2MJW B;  3EVR A;  2HQW A;  1SCM C;  1GGZ A;  3F45 A;  5FYX A;  2PRU A;  3GOF A;  3IQO A;  5CPV A;  2JZI A;  1ZOT B;  1ZAC A;  1CFP A;  2OS8 C;  1KQM B;  1L2O C;  4AQJ A;  5BPJ A;  2G9B A;  3TS5 B;  1SK6 D;  5I2Q A;  1NX3 A;  1CB1 A;  1QIW A;  4F0Z B;  1CDL A;  4DCK A;  1DF0 B;  1M39 A;  2KFF A;  4GAO A;  1CLM A;  1ALW A;  1QLS A;  1ZFS A;  1RK9 A;  2LVJ A;  2M49 B;  4I5L B;  1A03 A;  1N2D A;  2KGB C;  2E6W A;  2L51 A;  3FWC A;  3I5I C;  4HRG A;  2JNX A;  1F4O A;  3AAK A;  4CLN A;  1DMO A;  2KQY A;  1LA3 A;  5JJG A;  2LMU A;  1SBJ A;  1CLL A;  1W7I B;  1QX5 B;  3BXK A;  3TUY B;  1GQM A;  4MLW A;  3RLZ A;  2JTT A;  4YI8 A;  1FW4 A;  1Y0V H;  1TN4 A;  4BY4 A;  1FF1 A;  1NUB A;  4M2O A;  2G2B A;  2DOQ A;  1YUT A;  3OB2 B;  1TOP A;  3DVE A;  2M0R A;  4OKH A;  3IF7 A;  4OV2 A;  4YGC B;  2KSP A;  1PSR A;  1M46 A;  4NDD A;  4CID A;  3I5H B;  2F33 A;  2LLS A;  1K90 D;  2NXQ A;  1Y1U A;  1NP8 A;  1SL9 A;  1YRT B;  2NCO A;  1F71 A;  1S6C A;  3WHU B;  3CR5 X;  1AK8 A;  1N65 A;  1AHR A;  4GNK B;  4MSP A;  3K21 A;  5AAN A;  4IL1 A;  1H8B A;  1K9P A;  1LA0 A;  4UPG A;  1K9U A;  2KHN A;  3O2P A;  5CSN A;  3QRX A;  3D0Y B;  2LUX A;  3VRP A;  2MRD A;  2WOS A;  3I5I B;  2M97 A;  1RWY A;  4GPL B;  1H4B A;  1OMD A;  5D69 A;  2O5G A;  1BT6 A;  1KWO B;  2KYC A;  2L2E A;  3EK4 A;  4MZL A;  2ZN9 A;  3EKH A;  3EVU A;  1XFZ O;  2JRF A;  1AP4 A;  1KFU S;  1CM1 A;  4A4C A;  4QJ4 B;  1N0Y A;  1S5G Y;  1Y1X A;  1OMR A;  1CNP A;  2M1K B;  2LVI A;  2MLF C;  1C7V A;  2PAS A;  3BUW B;  3ZNI A;  4A4B A;  4AQI A;  3BOW B;  2H2K A;  1CDN A;  3I5F B;  3KEV A;  3TDI A;  2I94 A;  4WRI A;  4C0K A;  1KK8 C;  2JT0 A;  3I5H C;  1MXL C;  5J3X A;  4C0L A;  4E68 A;  1SL7 A;  2H61 A;  5I2L A;  1F8H A;  4D1E A;  3JTD B;  3PSR A;  1MR8 A;  2COL B;  1S5G Z;  1BOC A;  2M8U A;  2ZRS A;  1CKK A;  5CSJ A;  2Y5I A;  1NX2 A;  5G08 A;  4N5X A;  4FQO A;  3CWG A;  1QTX A;  4N1F A;  1DTL A;  3SIA A;  3HCM A;  1TNX A;  3C1V A;  3SG7 A;  1DT7 B;  2P6B B;  1J7R A;  5HYD A;  1CFD A;  4C0J A;  1CFF A;  5AER A;  2WCF A;  3NSI A;  2KAX A;  3DVK A;  4ORA B;  3BUO B;  1Y6W A;  2SCP A;  1F4Q A;  3DVM A;  1SY9 A;  1UHI A;  1C7W A;  2AMI A;  1K95 A;  1F55 A;  1UP5 A;  1A2X A;  4OVN F;  1C07 A;  1E8A A;  1S6I A;  4JQ0 D;  1IJ6 A;  5CSI A;  1JUO A;  1CDP A;  1B8R A;  1R6P A;  2NZ0 A;  1XVJ A;  2L4I A;  4Q04 A;  1UUS A;  5KSZ A;  2GGM A;  2LLU A;  2NLN A;  2LMT A;  3OB1 B;  4M2Q A;  2JOJ A;  2FJU B;  2K7C A;  1JC2 A;  3AAJ A;  3ZWH A;  2JT8 A;  1YX7 A;  3CGA A;  1YUU A;  2B1U A;  1V1G A;  1ZMZ A;  4OCI A;  1HT9 A;  1F54 A;  1S3P A;  1YR5 A;  2JTZ A;  3OP0 A;  4M2P A;  1S36 A;  1EJ3 A;  1KWO C;  1QS7 A;  2AUC A;  2BKH B;  1IGV A;  4BY5 A;  3KF9 A;  1CFC A;  1QV0 A;  1B7T Y;  2KFG A;  1TNP A;  2ZKM X;  4YRU A;  5KTY A;  1FPW A;  1NCY A;  2LLT A;  1CMF A;  2LV7 A;  4XJK B;  4L9M A;  3BUN B;  1K9K A;  2L98 A;  4ETO A;  3I5F C;  2K8M B;  1KCY A;  4DRW A;  1NX0 A;  1KQV A;  1KK7 Y;  1CMG A;  1SPY A;  4JWQ A;  2PAL A;  3AKB A;  2K7O A;  2KI6 C;  1AJ4 A;  1WRZ A;  2LAP A;  3RM1 A;  3CLN A;  1DGV A;  2CCM A;  3SIB A;  1Q80 A;  1K2H A;  2HPS A;  4PAL A;  1AVS A;  4NDC A;  1UHN A;  1MF8 B;  1B8C A;  1QXP A;  1IQ5 A;  3KO0 A;  3BUX B;  3PAL A;  1PSB A;  2LNK A;  2ZN8 A;  1DJG A;  5AEQ A;  1GJY A;  3SG6 A;  5AFP A;  1A75 B;  1BOD A;  4P5O E;  4PHJ A;  1L2O B;  1OMV A;  2LC5 A;  1EH2 A;  3D10 A;  2CTN A;  1DGU A; 
#chains in the Genus database with same CATH topology
 4OZD A;  1DC1 A;  4GUK A;  1CLB A;  5GQQ C;  1LS8 A;  2GGZ A;  1UHH A;  1L7Z A;  1OE9 B;  4GGF C;  1FI6 A;  2F3Y A;  2EC6 B;  2F8P A;  4GGN A;  2LE9 B;  1DEK A;  4N1G A;  4MZK A;  2LM5 A;  2WCE A;  4MBE A;  1YUS A;  1JSA A;  1XFX O;  1J55 A;  3CZ2 A;  5ER4 X;  1XK4 A;  1KSO A;  1PVA A;  1M31 A;  2F3Z A;  3E3R A;  1OOG A;  5FI2 A;  2KQ6 A;  3CDN A;  1KFX S;  1ODB A;  2BBM A;  2PMY A;  3BFA A;  1OOJ A;  3NHI A;  3NSK A;  1KSM A;  3A4U B;  3NSL A;  3R1P A;  1IRJ A;  1QIV A;  3GK4 X;  1EG3 A;  5HKW A;  3JVT C;  1QAT A;  1AJ5 A;  1XFR A;  4ORC B;  1J1D A;  1IQ3 A;  2KGR A;  1XO5 A;  3KHE A;  3S0D A;  2OS8 B;  1XFU O;  3TDZ A;  2ZNE A;  5AXI A;  1OSA A;  4I5N B;  2F2P A;  1SR6 B;  1SRA A;  2BE4 A;  3LK1 A;  1NX1 A;  2KBI A;  1U5I B;  4PE7 A;  2LVV A;  4PCW A;  3D78 A;  2K7D A;  2KFH A;  4INW A;  3TUY C;  2QEH A;  3CR4 X;  5JOL A;  2ZND A;  3TZ1 A;  3S0F A;  2WCJ A;  2H61 C;  2KI4 C;  2BKI B;  1WDC C;  3CTN A;  1JF2 A;  2KI4 B;  3MSE B;  4P2Y B;  3SG5 A;  2FOT A;  2BL0 B;  1QLK A;  2JU0 A;  4U8D A;  4MEW A;  4ZCV A;  3WNX B;  2WCL A;  1NIW A;  3AKA A;  2KAV A;  2EHB A;  2WC8 A;  1K94 A;  1A4P A;  1NWD A;  1S6J A;  2JPT A;  2KOT A;  1DJH A;  4MZJ A;  1YUR A;  3PFV A;  2HQ8 A;  4WQ2 A;  1SCV A;  2K2F A;  2MLE C;  2LUC A;  2NCP A;  1KQM C;  1CTR A;  2L4H A;  3LK0 A;  2MAZ A;  2PYQ A;  3BYA A;  5DKN A;  4YGE B;  3WXA A;  1TTX A;  5HL1 A;  1IKU A;  3BUM B;  3PN7 C;  3SJS A;  1R2U A;  3EK7 A;  3L4L A;  3PN7 B;  2JQ6 A;  2QDI A;  3B88 A;  2ZRT A;  5DKR A;  1BLQ A;  3VRO A;  3V2L A;  2GV5 A;  1OZO A;  3OGN A;  3PLF B;  1BR1 B;  1HQV A;  2K2A A;  3BOW A;  3VGO A;  2CNP A;  2I2R E;  1KK7 Z;  1C3Y A;  2QEB A;  2R2I A;  2A4J A;  3B7A A;  3FWB A;  3O4X A;  2L2C A;  2K61 A;  2M3W A;  4I5K A;  4INX A;  1S1E A;  2D8N A;  1J7P A;  3PJI A;  3LLE A;  2JXC A;  1DJW A;  2M7L A;  3B6X A;  3PAT A;  2WOR A;  1OZS A;  1DJI A;  3D0Y A;  1G4Y R;  3DY9 A;  1PRW A;  2BEC A;  1B7T Z;  2HET A;  3DF0 A;  1TRF A;  1OW4 A;  2EC6 C;  1B47 A;  3BQ3 A;  1XYD A;  3OBV A;  2LHI A;  2KNE A;  2ISD A;  2BBN A;  1QVI Z;  1B8L A;  1V1F A;  2JNF A;  1SNL A;  2M9G A;  1KFU L;  4CFQ A;  1RJV A;  2BNX A;  4YGA A;  1A29 A;  2L0P A;  2HF5 A;  2I18 A;  3JTD C;  5I2O A;  5TNC A;  3I5G B;  3LL8 B;  4CFR A;  1FBV A;  1SL8 A;  1WDC B;  4DS7 A;  3D73 A;  1GGW A;  2Q4U A;  1YVH A;  1DJX A;  2TN4 A;  2VRG A;  1QJT A;  4HSZ A;  1DJZ A;  5PAL A;  3SS5 A;  1RRO A;  3NSO A;  1MUX A;  1LVC D;  4JPZ B;  4PE0 A;  1TWO A;  5F6T A;  1FI5 A;  1YRU B;  3HX4 A;  2LAN A;  2GTE A;  1J7Q A;  1M45 A;  1XA5 A;  5DIC A;  3KPX A;  1BMO A;  4PHK A;  3TS5 C;  3GK1 A;  2M29 A;  1KFX L;  3CS1 A;  2KLE A;  1NPQ A;  1UHK A;  1TNW A;  2L5X B;  4MRX A;  5HKZ A;  1X02 A;  1DQE A;  1XFV O;  2BCA A;  3LCP C;  4PT1 A;  3EVV A;  3RZS A;  1SSE B;  3IQQ A;  4GFT A;  1NCZ A;  1IH0 A;  2MA2 A;  1MWN A;  3O4Y A;  4R1E A;  1BJF A;  1BU3 A;  1K93 D;  1TCO B;  1LKJ A;  1WRK A;  2LCP A;  4MVF A;  4PE4 A;  4CPV A;  3FE6 A;  3WHT B;  4OR9 B;  2WC5 A;  1XFW O;  5ER5 A;  2CT9 A;  1DF0 A;  2PVB A;  3VRQ A;  2YGU A;  3VRR A;  1NSH A;  4PE1 A;  5HKY A;  4DIR A;  1ZUZ A;  5EL2 A;  2SAS A;  4XYN A;  2F2O A;  1JFJ A;  1AUI B;  4ORB B;  4QJ3 B;  4ZCU A;  3VRN A;  2Y4Q A;  2JC2 A;  4JD9 A;  5I8N A;  1REC A;  4I5J A;  1DJY A;  3B87 A;  1TIZ A;  1DVI A;  2QPT A;  1JBA A;  2LHL A;  2FCE A;  1U5I A;  2BL0 C;  2MBX A;  2Y1M A;  2BE6 A;  1SW8 A;  2CBL A;  2L50 A;  1QX7 A;  1BF5 A;  3FE9 A;  1K8U A;  4HRE E;  5CSF A;  1SMG A;  2K7B A;  1EL4 A;  1QAS A;  1QV1 A;  1TNQ A;  1YX8 A;  1RTP 1;  1YVL A;  3M0W A;  3Q8I A;  2K0J A;  2BCB A;  1JF0 A;  3TDU A;  4AOM A;  1RFJ A;  3S0G A;  4DUQ A;  2IS9 A;  3D75 A;  2KBM A;  4FQT A;  3A8R A;  4USL A;  2MHH A;  4NQG A;  2Y1N A;  1A75 A;  4YI9 A;  1TUJ A;  1WRL A;  4HRH A;  1TCF A;  3VB1 A;  5HLV A;  1BR4 B;  1LXF C;  1NYA A;  2JT3 A;  2ZFD A;  3I5G C;  1UWO A;  3NXA A;  3EK8 A;  3IVT A;  2KI6 D;  2FCD A;  3CR2 A;  1SCM B;  5KU1 A;  1OOF A;  3OX5 A;  2P70 A;  3OHM B;  3O6B A;  1VRK A;  2OPO A;  1J1E A;  1NCX A;  4GGF A;  4MN0 A;  4PDZ A;  4QJ5 B;  2LP3 A;  2I7A A;  3ICB A;  2V53 A;  2O60 A;  1EXR A;  3SG2 A;  3CAB A;  4TNC A;  3D77 A;  3SG3 A;  1Y1A A;  1LIN A;  1MQ1 A;  1B9A A;  1KK8 B;  1QX2 A;  3CYZ A;  4NDB A;  2PSR A;  2WC6 A;  3DD4 A;  2LMV A;  1MXE A;  1JFK A;  2OTG C;  3SG4 A;  1W7J B;  4WQ3 A;  4GBA A;  1SYM A;  4ICB A;  3EG5 B;  1Z2C B;  1CM4 A;  2KDH A;  5HLO A;  1PVB A;  5D7F A;  2JXL A;  1BG1 A;  3OX6 A;  5K89 A;  1XFY O;  2M7N A;  2KPH A;  1M63 B;  5DKQ A;  2WND A;  4YBH B;  3FIA A;  2E30 A;  2KAY A;  2LVK A;  3PM8 A;  2CXJ A;  3GK2 A;  3CZT X;  1C3Z A;  1D1O A;  1B4C A;  1J7O A;  1ALV A;  1IWQ A;  1QVI Y;  2QAC A;  2JWW A;  2EGD A;  1JWD A;  3K1E A;  4PHN A;  1MHO A;  5IBW A;  2Q91 A;  4XJK A;  3EKJ A;  3JVT B;  2AAO A;  3SS3 A;  3L4A A;  1WY9 A;  2RGI A;  4PHM A;  3H4S E;  1UUR A;  1G33 A;  1IG5 A;  1PUL A;  2LP2 A;  2BCX A;  3DVJ A;  4YGD B;  1UHJ A;  2OTG B;  1YTZ C;  5I94 A;  1SKT A;  1EG4 A;  1SR6 C;  1XK4 C;  2M1U A;  3O78 A;  1PK0 D;  1WLM A;  1F70 A;  1G8I A;  1IJ5 A;  1OQP A;  1B1G A;  1K96 A;  1PAL A;  1CDM A;  3FS7 A;  3DF0 B;  5B8I B;  4YGB B;  2WCB A;  1S26 D;  1WLZ A;  2KYF A;  2JUL A;  4MRY A;  2FJY A;  3NGV A;  4FTG A;  3DXL A;  2MJW B;  3EVR A;  2HQW A;  3S0E A;  1SCM C;  1GGZ A;  3F45 A;  5FYX A;  2PRU A;  3QME A;  3GOF A;  3IQO A;  5CPV A;  2JZI A;  3SS4 A;  1ZOT B;  1ZAC A;  1CFP A;  2OS8 C;  1KQM B;  1L2O C;  4AQJ A;  5BPJ A;  2G9B A;  5D3O A;  1SK6 D;  3TS5 B;  1NX3 A;  3R1O A;  3UO9 A;  1QIW A;  1CB1 A;  4F0Z B;  1CDL A;  4DCK A;  1DF0 B;  1M39 A;  2KFF A;  4GAO A;  1CLM A;  1ALW A;  1QLS A;  1ZFS A;  4KYN A;  1RK9 A;  2P71 A;  2LVJ A;  2M49 B;  4I5L B;  1A03 A;  1N2D A;  2KGB C;  2E6W A;  2L51 A;  2QEV A;  3FWC A;  3I5I C;  4HRG A;  2JNX A;  1F4O A;  1TUZ A;  3AAK A;  4CLN A;  2KQY A;  1DMO A;  1LA3 A;  5JJG A;  2BAP A;  2LMU A;  1SBJ A;  1CLL A;  1W7I B;  3BJH A;  3UNW A;  1QX5 B;  3BXK A;  3TUY B;  1GQM A;  1ORG A;  4MLW A;  3RLZ A;  2JTT A;  4YI8 A;  1FW4 A;  1Y0V H;  1TN4 A;  4BY4 A;  1FF1 A;  1NUB A;  4M2O A;  2G2B A;  2DOQ A;  1YUT A;  3OB2 B;  1TOP A;  3DVE A;  2M0R A;  3PM2 A;  4OKH A;  3IF7 A;  4OV2 A;  4YGC B;  2KSP A;  1PSR A;  1M46 A;  4NDD A;  4CID A;  3I5H B;  2F33 A;  3CZ1 A;  2LLS A;  1K90 D;  2NXQ A;  3D74 A;  1Y1U A;  1NP8 A;  1SL9 A;  1YRT B;  2H8V A;  2NCO A;  1F71 A;  1S6C A;  3WHU B;  3B86 A;  3CR5 X;  1N65 A;  1AK8 A;  3R72 A;  1IIO A;  1AHR A;  4GNK B;  4MSP A;  3K21 A;  5AAN A;  4IL1 A;  1H8B A;  1K9P A;  1LA0 A;  4UPG A;  1K9U A;  2KHN A;  2QEO A;  5FI6 A;  3O2P A;  5CSN A;  3QRX A;  3D0Y B;  2LUX A;  3VRP A;  3NHT A;  2MRD A;  2WOS A;  3I5I B;  2M97 A;  1RWY A;  3BFH A;  4GPL B;  1H4B A;  1OMD A;  3D76 A;  5D69 A;  2O5G A;  1BT6 A;  1KWO B;  2KYC A;  2L2E A;  2WCK A;  3EK4 A;  4MZL A;  2ZN9 A;  3EKH A;  3EVU A;  1XFZ O;  2JRF A;  1AP4 A;  1KFU S;  1CM1 A;  4A4C A;  4QJ4 B;  1W9Z A;  1N0Y A;  1S5G Y;  1Y1X A;  1OMR A;  2JPO A;  1CNP A;  2M1K B;  3CZ0 A;  2LVI A;  2MLF C;  1C7V A;  2PAS A;  3BUW B;  3ZNI A;  4A4B A;  4AQI A;  3BOW B;  2H2K A;  2ERB A;  3I5F B;  3KEV A;  3TDI A;  2I94 A;  4WRI A;  4C0K A;  1CDN A;  1GM0 A;  1KK8 C;  2JT0 A;  3I5H C;  1MXL C;  5J3X A;  4C0L A;  4JKT A;  4E68 A;  1SL7 A;  2H61 A;  5I2L A;  1F8H A;  4D1E A;  1OOI X;  3JTD B;  3PSR A;  1MR8 A;  4IJ7 A;  2COL B;  1S5G Z;  1BOC A;  2M8U A;  2ZRS A;  1CKK A;  5CSJ A;  2Y5I A;  1NX2 A;  5G08 A;  4N5X A;  4FQO A;  3CWG A;  1QTX A;  4N1F A;  1DEL A;  1DTL A;  3SIA A;  3HCM A;  1TNX A;  3C1V A;  3SG7 A;  1DT7 B;  2P6B B;  1J7R A;  1OOH A;  5HYD A;  1CFD A;  5FI7 A;  1P28 A;  2WCH A;  4C0J A;  1CFF A;  5AER A;  2WCF A;  3NSI A;  2KAX A;  3DVK A;  4ORA B;  3BUO B;  3L47 A;  1Y6W A;  2SCP A;  1F4Q A;  3DVM A;  1SY9 A;  1UHI A;  1C7W A;  2WCM A;  2AMI A;  1K95 A;  1F55 A;  1UP5 A;  1A2X A;  4OVN F;  1C07 A;  1E8A A;  1S6I A;  4JQ0 D;  1IJ6 A;  5CSI A;  1JUO A;  1CDP A;  1B8R A;  1R6P A;  2NZ0 A;  1XVJ A;  2L4I A;  4Q04 A;  1UUS A;  5KSZ A;  2GGM A;  2LLU A;  2NLN A;  2LMT A;  3OB1 B;  1Z4H A;  4M2Q A;  2JOJ A;  2FJU B;  2K7C A;  1JC2 A;  3AAJ A;  3ZWH A;  2JT8 A;  1YX7 A;  3CGA A;  1YUU A;  3S0A A;  2B1U A;  3BFB A;  1V1G A;  3R1V A;  1ZMZ A;  4OCI A;  1HT9 A;  1F54 A;  2L5Y A;  1S3P A;  1YR5 A;  2JTZ A;  3OP0 A;  4M2P A;  1S36 A;  5I2Q A;  1EJ3 A;  1KWO C;  1QS7 A;  2AUC A;  2BKH B;  1IGV A;  4BY5 A;  3KF9 A;  1CFC A;  1QV0 A;  1B7T Y;  2KFG A;  1TNP A;  2ZKM X;  4YRU A;  5KTY A;  1FPW A;  1NCY A;  3DYE A;  2LLT A;  1CMF A;  2LV7 A;  4XJK B;  4L9M A;  3DZT A;  3BUN B;  1K9K A;  2L98 A;  4ETO A;  3I5F C;  2K8M B;  1KCY A;  4DRW A;  1NX0 A;  1KQV A;  1KK7 Y;  1CMG A;  2PQL A;  1SPY A;  4JWQ A;  2PAL A;  3AKB A;  2KLD A;  2K7O A;  2KI6 C;  1AJ4 A;  1QWV A;  1WRZ A;  2LAP A;  3N7H A;  3RM1 A;  3CLN A;  1DGV A;  2K60 A;  2CCM A;  3SIB A;  1Q80 A;  1K2H A;  3S0B A;  2HPS A;  4PAL A;  1AVS A;  3FE8 A;  4NDC A;  1UHN A;  1MF8 B;  1B8C A;  1QXP A;  1IQ5 A;  3KO0 A;  3BUX B;  3PAL A;  1PSB A;  2LNK A;  2ZN8 A;  1DJG A;  5AEQ A;  1GJY A;  3SG6 A;  5AFP A;  1A75 B;  1BOD A;  4P5O E;  4PHJ A;  1L2O B;  1OMV A;  2LC5 A;  4F7F A;  1T14 A;  1EH2 A;  3D10 A;  2CTN A;  1DGU A; 
#chains in the Genus database with same CATH homology
 4GUK A;  1CLB A;  5GQQ C;  2GGZ A;  1UHH A;  1L7Z A;  1OE9 B;  4GGF C;  1FI6 A;  2F3Y A;  2EC6 B;  2F8P A;  4GGN A;  2LE9 B;  4N1G A;  4MZK A;  2LM5 A;  2WCE A;  4MBE A;  1YUS A;  1JSA A;  1XFX O;  1J55 A;  5ER4 X;  1XK4 A;  1KSO A;  1PVA A;  1M31 A;  2F3Z A;  3E3R A;  2KQ6 A;  1KFX S;  1ODB A;  2BBM A;  2PMY A;  3NSL A;  1OOJ A;  3NSK A;  1KSM A;  3A4U B;  1IRJ A;  1QIV A;  3GK4 X;  1EG3 A;  5HKW A;  3JVT C;  1QAT A;  1AJ5 A;  4ORC B;  1J1D A;  1IQ3 A;  2KGR A;  1XO5 A;  3KHE A;  2OS8 B;  1XFU O;  3TDZ A;  2ZNE A;  5AXI A;  1OSA A;  4I5N B;  2F2P A;  1SR6 B;  1SRA A;  2BE4 A;  3LK1 A;  1NX1 A;  2KBI A;  1U5I B;  4PE7 A;  2LVV A;  4PCW A;  2K7D A;  2KFH A;  3TUY C;  3CR4 X;  5JOL A;  2ZND A;  3TZ1 A;  2H61 C;  2KI4 C;  2BKI B;  1WDC C;  3CTN A;  1JF2 A;  2KI4 B;  3MSE B;  4P2Y B;  3SG5 A;  2FOT A;  2BL0 B;  1QLK A;  2JU0 A;  4U8D A;  4MEW A;  4ZCV A;  3WNX B;  1NIW A;  3AKA A;  2KAV A;  2EHB A;  2WC8 A;  1K94 A;  1A4P A;  1NWD A;  1S6J A;  2JPT A;  2KOT A;  1DJH A;  4MZJ A;  1YUR A;  3PFV A;  2HQ8 A;  4WQ2 A;  1SCV A;  2K2F A;  2MLE C;  2LUC A;  2NCP A;  1KQM C;  1CTR A;  2L4H A;  3LK0 A;  2MAZ A;  3BYA A;  5DKN A;  4YGE B;  3WXA A;  1TTX A;  1IKU A;  3BUM B;  3PN7 C;  3SJS A;  1R2U A;  3EK7 A;  3PN7 B;  2JQ6 A;  2ZRT A;  5DKR A;  1BLQ A;  3VRO A;  2GV5 A;  1OZO A;  3PLF B;  1BR1 B;  1HQV A;  2K2A A;  3BOW A;  3VGO A;  2CNP A;  2I2R E;  1KK7 Z;  2R2I A;  2A4J A;  3FWB A;  2K61 A;  2M3W A;  4I5K A;  1S1E A;  2D8N A;  1J7P A;  3LLE A;  2JXC A;  1DJW A;  2M7L A;  3PAT A;  2WOR A;  1OZS A;  1DJI A;  3D0Y A;  1G4Y R;  1PRW A;  2BEC A;  1B7T Z;  2HET A;  3DF0 A;  1TRF A;  2EC6 C;  1B47 A;  3BQ3 A;  1XYD A;  2LHI A;  2KNE A;  2ISD A;  2BBN A;  1QVI Z;  1B8L A;  1V1F A;  2JNF A;  1SNL A;  2M9G A;  1KFU L;  4CFQ A;  1RJV A;  4YGA A;  1A29 A;  2L0P A;  2HF5 A;  2I18 A;  3JTD C;  5I2O A;  5TNC A;  3I5G B;  3LL8 B;  4CFR A;  1FBV A;  1SL8 A;  1WDC B;  4DS7 A;  1GGW A;  2Q4U A;  1YVH A;  1DJX A;  2TN4 A;  2VRG A;  1QJT A;  4HSZ A;  1DJZ A;  5PAL A;  1RRO A;  3NSO A;  1MUX A;  1LVC D;  4JPZ B;  4PE0 A;  5F6T A;  1FI5 A;  1YRU B;  3HX4 A;  2LAN A;  1J7Q A;  1M45 A;  1XA5 A;  3KPX A;  1BMO A;  4PHK A;  3TS5 C;  3GK1 A;  2M29 A;  1KFX L;  3CS1 A;  1NPQ A;  1UHK A;  1TNW A;  2L5X B;  4MRX A;  5HKZ A;  1X02 A;  1XFV O;  2BCA A;  3LCP C;  3EVV A;  3IQQ A;  4GFT A;  1NCZ A;  1IH0 A;  2MA2 A;  1MWN A;  3O4Y A;  4R1E A;  1BJF A;  1BU3 A;  1K93 D;  1TCO B;  1LKJ A;  1WRK A;  2LCP A;  4MVF A;  4PE4 A;  4CPV A;  3WHT B;  4OR9 B;  1XFW O;  5ER5 A;  2CT9 A;  1DF0 A;  2PVB A;  3VRQ A;  3VRR A;  1NSH A;  4PE1 A;  5HKY A;  4DIR A;  1ZUZ A;  2SAS A;  4XYN A;  2F2O A;  1JFJ A;  1AUI B;  4ORB B;  4QJ3 B;  4ZCU A;  3VRN A;  2Y4Q A;  2JC2 A;  5I8N A;  1REC A;  4I5J A;  1DJY A;  1TIZ A;  1DVI A;  2QPT A;  1JBA A;  2LHL A;  2FCE A;  1U5I A;  2BL0 C;  2MBX A;  2Y1M A;  2BE6 A;  1SW8 A;  2CBL A;  2L50 A;  1QX7 A;  1BF5 A;  1K8U A;  4HRE E;  5CSF A;  1SMG A;  2K7B A;  1EL4 A;  1QAS A;  1QV1 A;  1TNQ A;  1YX8 A;  1RTP 1;  1YVL A;  3M0W A;  2K0J A;  2BCB A;  1JF0 A;  3TDU A;  4AOM A;  1RFJ A;  4DUQ A;  2IS9 A;  2KBM A;  3A8R A;  4USL A;  2MHH A;  4NQG A;  2Y1N A;  1A75 A;  4YI9 A;  1WRL A;  4HRH A;  1TCF A;  5HLV A;  1BR4 B;  1LXF C;  1NYA A;  2JT3 A;  2ZFD A;  3I5G C;  1UWO A;  3NXA A;  3EK8 A;  2KI6 D;  2FCD A;  3CR2 A;  1SCM B;  5KU1 A;  3OX5 A;  3OHM B;  3O6B A;  1VRK A;  2OPO A;  1J1E A;  1NCX A;  4GGF A;  4MN0 A;  4PDZ A;  4QJ5 B;  2LP3 A;  2I7A A;  3ICB A;  2V53 A;  2O60 A;  1EXR A;  3SG2 A;  4TNC A;  3SG3 A;  1Y1A A;  1LIN A;  1MQ1 A;  1B9A A;  1KK8 B;  1QX2 A;  4NDB A;  2PSR A;  3DD4 A;  2LMV A;  1MXE A;  1JFK A;  2OTG C;  3SG4 A;  1W7J B;  4WQ3 A;  4GBA A;  1SYM A;  4ICB A;  1CM4 A;  2KDH A;  5HLO A;  1PVB A;  5D7F A;  2JXL A;  1BG1 A;  3OX6 A;  5K89 A;  1XFY O;  2M7N A;  1M63 B;  5DKQ A;  2WND A;  4YBH B;  3FIA A;  2E30 A;  2KAY A;  2LVK A;  3PM8 A;  2CXJ A;  3GK2 A;  3CZT X;  1D1O A;  1B4C A;  1J7O A;  1ALV A;  1IWQ A;  1QVI Y;  2QAC A;  2JWW A;  2EGD A;  1JWD A;  5IBW A;  4PHN A;  1MHO A;  2Q91 A;  4XJK A;  3EKJ A;  3JVT B;  2AAO A;  1WY9 A;  2RGI A;  4PHM A;  3H4S E;  1UUR A;  1G33 A;  1IG5 A;  1PUL A;  2LP2 A;  2BCX A;  3DVJ A;  4YGD B;  1UHJ A;  2OTG B;  1YTZ C;  1SKT A;  1EG4 A;  1SR6 C;  1XK4 C;  2M1U A;  3O78 A;  1PK0 D;  1WLM A;  1F70 A;  1G8I A;  1IJ5 A;  1OQP A;  1B1G A;  1K96 A;  1PAL A;  1CDM A;  3FS7 A;  3DF0 B;  5B8I B;  4YGB B;  2WCB A;  1S26 D;  1WLZ A;  2KYF A;  2JUL A;  4MRY A;  4FTG A;  2MJW B;  3EVR A;  2HQW A;  1SCM C;  1GGZ A;  3F45 A;  5FYX A;  2PRU A;  3GOF A;  3IQO A;  5CPV A;  2JZI A;  1ZOT B;  1ZAC A;  1CFP A;  2OS8 C;  1KQM B;  1L2O C;  4AQJ A;  5BPJ A;  2G9B A;  3TS5 B;  1SK6 D;  5I2Q A;  1NX3 A;  1CB1 A;  1QIW A;  4F0Z B;  1CDL A;  4DCK A;  1DF0 B;  1M39 A;  2KFF A;  4GAO A;  1CLM A;  1ALW A;  1QLS A;  1ZFS A;  1RK9 A;  2LVJ A;  2M49 B;  4I5L B;  1A03 A;  1N2D A;  2KGB C;  2E6W A;  2L51 A;  3FWC A;  3I5I C;  4HRG A;  2JNX A;  1F4O A;  3AAK A;  4CLN A;  1DMO A;  2KQY A;  1LA3 A;  5JJG A;  2LMU A;  1SBJ A;  1CLL A;  1W7I B;  1QX5 B;  3BXK A;  3TUY B;  1GQM A;  4MLW A;  3RLZ A;  2JTT A;  4YI8 A;  1FW4 A;  1Y0V H;  1TN4 A;  4BY4 A;  1FF1 A;  1NUB A;  4M2O A;  2G2B A;  2DOQ A;  1YUT A;  3OB2 B;  1TOP A;  3DVE A;  2M0R A;  4OKH A;  3IF7 A;  4OV2 A;  4YGC B;  2KSP A;  1PSR A;  1M46 A;  4NDD A;  4CID A;  3I5H B;  2F33 A;  2LLS A;  1K90 D;  2NXQ A;  1Y1U A;  1NP8 A;  1SL9 A;  1YRT B;  2NCO A;  1F71 A;  1S6C A;  3WHU B;  3CR5 X;  1AK8 A;  1N65 A;  1AHR A;  4GNK B;  4MSP A;  3K21 A;  5AAN A;  4IL1 A;  1H8B A;  1K9P A;  1LA0 A;  4UPG A;  1K9U A;  2KHN A;  3O2P A;  5CSN A;  3QRX A;  3D0Y B;  2LUX A;  3VRP A;  2MRD A;  2WOS A;  3I5I B;  2M97 A;  1RWY A;  4GPL B;  1H4B A;  1OMD A;  5D69 A;  2O5G A;  1BT6 A;  1KWO B;  2KYC A;  2L2E A;  3EK4 A;  4MZL A;  2ZN9 A;  3EKH A;  3EVU A;  1XFZ O;  2JRF A;  1AP4 A;  1KFU S;  1CM1 A;  4A4C A;  4QJ4 B;  1N0Y A;  1S5G Y;  1Y1X A;  1OMR A;  1CNP A;  2M1K B;  2LVI A;  2MLF C;  1C7V A;  2PAS A;  3BUW B;  3ZNI A;  4A4B A;  4AQI A;  3BOW B;  2H2K A;  1CDN A;  3I5F B;  3KEV A;  3TDI A;  2I94 A;  4WRI A;  4C0K A;  1KK8 C;  2JT0 A;  3I5H C;  1MXL C;  5J3X A;  4C0L A;  4E68 A;  1SL7 A;  2H61 A;  5I2L A;  1F8H A;  4D1E A;  3JTD B;  3PSR A;  1MR8 A;  2COL B;  1S5G Z;  1BOC A;  2M8U A;  2ZRS A;  1CKK A;  5CSJ A;  2Y5I A;  1NX2 A;  5G08 A;  4N5X A;  4FQO A;  3CWG A;  1QTX A;  4N1F A;  1DTL A;  3SIA A;  3HCM A;  1TNX A;  3C1V A;  3SG7 A;  1DT7 B;  2P6B B;  1J7R A;  5HYD A;  1CFD A;  4C0J A;  1CFF A;  5AER A;  2WCF A;  3NSI A;  2KAX A;  3DVK A;  4ORA B;  3BUO B;  1Y6W A;  2SCP A;  1F4Q A;  3DVM A;  1SY9 A;  1UHI A;  1C7W A;  2AMI A;  1K95 A;  1F55 A;  1UP5 A;  1A2X A;  4OVN F;  1C07 A;  1E8A A;  1S6I A;  4JQ0 D;  1IJ6 A;  5CSI A;  1JUO A;  1CDP A;  1B8R A;  1R6P A;  2NZ0 A;  1XVJ A;  2L4I A;  4Q04 A;  1UUS A;  5KSZ A;  2GGM A;  2LLU A;  2NLN A;  2LMT A;  3OB1 B;  4M2Q A;  2JOJ A;  2FJU B;  2K7C A;  1JC2 A;  3AAJ A;  3ZWH A;  2JT8 A;  1YX7 A;  3CGA A;  1YUU A;  2B1U A;  1V1G A;  1ZMZ A;  4OCI A;  1HT9 A;  1F54 A;  1S3P A;  1YR5 A;  2JTZ A;  3OP0 A;  4M2P A;  1S36 A;  1EJ3 A;  1KWO C;  1QS7 A;  2AUC A;  2BKH B;  1IGV A;  4BY5 A;  3KF9 A;  1CFC A;  1QV0 A;  1B7T Y;  2KFG A;  1TNP A;  2ZKM X;  4YRU A;  5KTY A;  1FPW A;  1NCY A;  2LLT A;  1CMF A;  2LV7 A;  4XJK B;  4L9M A;  3BUN B;  1K9K A;  2L98 A;  4ETO A;  3I5F C;  2K8M B;  1KCY A;  4DRW A;  1NX0 A;  1KQV A;  1KK7 Y;  1CMG A;  1SPY A;  4JWQ A;  2PAL A;  3AKB A;  2K7O A;  2KI6 C;  1AJ4 A;  1WRZ A;  2LAP A;  3RM1 A;  3CLN A;  1DGV A;  2CCM A;  3SIB A;  1Q80 A;  1K2H A;  2HPS A;  4PAL A;  1AVS A;  4NDC A;  1UHN A;  1MF8 B;  1B8C A;  1QXP A;  1IQ5 A;  3KO0 A;  3BUX B;  3PAL A;  1PSB A;  2LNK A;  2ZN8 A;  1DJG A;  5AEQ A;  1GJY A;  3SG6 A;  5AFP A;  1A75 B;  1BOD A;  4P5O E;  4PHJ A;  1L2O B;  1OMV A;  2LC5 A;  1EH2 A;  3D10 A;  2CTN A;  1DGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...