3CR4X

X-ray structure of bovine pnt,ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Divalent metal ion complexes of S100B in the absence and presence of pentamidine.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 31
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cr4X00
1UP5A 4WRIA 2WCFA 1Y1XA 5DKRA 4IL1A 2OTGC 1RROA 1ODBA 2M49B 3JVTB 1KFXS 4OVNF 4YBHB 3CLNA 4QJ3B 1SY9A 1XFVO 1A4PA 1NX1A 4PE7A 5CSJA 2HPSA 1A75B 3D10A 5K89A 1JSAA 4U8DA 4YGBB 2ZN9A 1CDMA 3EK7A 1NIWA 2CCMA 2ISDA 4CFRA 1EXRA 1AK8A 1CB1A 1DJZA 3EVUA 2KAXA 1IWQA 2F3ZA 4MVFA 1J55A 1AJ4A 3O4YA 2KGRA 3JTDB 3A8RA 5HLOA 1QX7A 1DGVA 4YGAA 1TRFA 1D1OA 1NYAA 3PN7B 2LNKA 1K9PA 3O6BA 2HF5A 2L0PA 1G33A 1M45A 3LCPC 1B7TY 3KEVA 2MHHA 2ZN8A 1WRZA 2E6WA 2L5XB 3EVRA 1J7OA 1QX5B 2M29A 1WLMA 3OB2B 1EL4A 3KHEA 1TNQA 4CPVA 2JQ6A 3BUOB 2K7OA 1F70A 2LVJA 1H8BA 4OV2A 1PALA 2AMIA 1C07A 1QATA 1CFDA 1S26D 3A4UB 3BXKA 1FF1A 2JULA 2JWWA 2PSRA 1J1EA 2M1UA 1B1GA 2BCBA 4YGCB 2M7LA 3EK8A 2KYFA 3EKJA 1BR4B 3TZ1A 2L98A 1KK7Z 2JNXA 3EVVA 1DF0B 2F2PA 1UHIA 4I5JA 2LANA 2EGDA 3MSEB 2ZNEA 3KF9A 2F33A 1A75A 2NZ0A 4D1EA 1IQ3A 1Y6WA 1DJGA 3DF0A 1AHRA 1CLMA 1SW8A 3D0YA 5CSIA 1PSBA 2WCBA 1C7WA 3VRQA 1SCMB 2LP3A 1UWOA 3NSKA 4PHKA 1BR1B 1YTZC 1CTRA 1NX0A 3DVMA 1QTXA 1CMGA 1SL7A 3BOWA 3OB1B 5KTYA 1CM4A 1KFUS 4PE0A 2K61A 2M97A 2ZNDA 1CFFA 1KFXL 1LKJA 2CTNA 3I5FC 4N1GA 1XFYO 1YVLA 4GGFA 2BCAA 1YVHA 1K9KA 2MAZA 4HSZA 2PRUA 2OS8B 2Q4UA 2F8PA 4I5KA 4JQ0D 3BUMB 3TS5B 4DRWA 1ALVA 3I5HC 1PVBA 1SNLA 3FWCA 2V53A 5KSZA 1MUXA 2JOJA 1AP4A 1SR6B 3SG4A 4Q04A 3GOFA 1G4YR 2FOTA 3F45A 3VRNA 3M0WA 5GQQC 5PALA 1TIZA 1NCXA 4GNKB 2EC6B 1ALWA 1SYMA 1WY9A 4PE4A 2JTZA 2BL0C 2OPOA 1CDPA 5JOLA 3IF7A 1B9AA 3I5GB 5IBWA 2MJWB 3EKHA 1JUOA 1LVCD 2L2EA 1QS7A 1AUIB 4YI9A 1JF0A 1S3PA 1IJ5A 2LVIA 1BT6A 1V1GA 5ER4X 1S6JA 3GK4X 1L2OC 1J1DA 1WRKA 1DF0A 1F4OA 1PVAA 1S5GY 4MZJA 3TDIA 2OTGB 2K2FA 3CS1A 1PK0D 2L50A 3BUXB 1FBVA 2P6BB 4N5XA 3OP0A 1B8LA 1B7TZ 4WQ2A 2KI4B 3SG2A 1SL8A 5AXIA 1ZFSA 2I7AA 2K0JA 4USLA 2BCXA 2JTTA 2Q91A 1KQVA 3VRRA 2D8NA 1K93D 1LXFC 1XFWO 4GAOA 1KK8C 1QVIY 4MRYA 3DD4A 1QLKA 1TCFA 2LLSA 1NX3A 1BODA 5HKYA 2KHNA 2KNEA 4F0ZB 5AERA 5BPJA 1J7RA 3HCMA 2MLEC 1K8UA 2ZFDA 4PDZA 2JXLA 3CR5X 2M9GA 2HQ8A 4MSPA 4M2QA 2I2RE 4M2OA 3OHMB 5DKQA 1UHKA 2JZIA 3SJSA 5I2LA 3FS7A 1HQVA 3FIAA 1S36A 3DVEA 1BU3A 2KAYA 2LMVA 1LINA 3NSLA 2PMYA 2Y1MA 1Y1UA 5I2OA 4ORBB 3O2PA 2NCOA 1CKKA 3GK1A 2LC5A 2M0RA 3CR4X 2H61A 1KFUL 2LHIA 1N65A 4L9MA 1SMGA 3H4SE 1MWNA 1FI6A 4DIRA 4BY4A 4A4BA 2LAPA 3SG7A 1A03A 2BE6A 3AAJA 1SKTA 4XJKB 1PSRA 2KDHA 1B4CA 1XFUO 4DUQA 4OCIA 1RECA 1IQ5A 4AQIA 4DCKA 1KQMC 2Y1NA 4BY5A 1N2DA 1PRWA 1M46A 4P2YB 2NCPA 1EG4A 5D7FA 2KQYA 2L51A 1PULA 2M8UA 1DJWA 2KFHA 2ZRSA 1DTLA 4GGFC 3PSRA 5ER5A 4I5LB 2KAVA 3O78A 4HRGA 1QV1A 3LL8B 2JU0A 5CSNA 3BYAA 4FQOA 2MRDA 1CMFA 3FWBA 1J7PA 1XFZO 2GV5A 1LA3A 1L7ZA 1SBJA 5CSFA 2HQWA 2KI6D 2MA2A 3BUWB 4PHJA 1DMOA 4YI8A 1DJHA 1JBAA 3I5FB 2PVBA 3BQ3A 3PLFB 3K21A 1K90D 2JRFA 2KGBC 2HETA 2LV7A 3PATA 4PALA 1MR8A 1BMOA 1RJVA 3I5HB 1F4QA 3E3RA 3LLEA 1S5GZ 3KPXA 5I8NA 1CM1A 2R2IA 1KWOC 1M31A 3CWGA 2JNFA 2H2KA 2LVKA 2NLNA 3ICBA 4ORAB 3QRXA 1MHOA 5AFPA 1GGZA 2KOTA 1K95A 1TN4A 2JT0A 2BL0B 1QASA 2G9BA 2FCDA 1QVIZ 1AVSA 3C1VA 5HKWA 2K8MB 1C7VA 1TNXA 2BECA 4HRHA 3AKBA 4MZKA 4WQ3A 1BG1A 1R2UA 4MRXA 1Q80A 1YRUB 1KSMA 3VGOA 1NCZA 1A29A 2ZKMX 5HLVA 1QIWA 2CNPA 2KYCA 4QJ5B 2QACA 3PALA 1IKUA 5DKNA 3RLZA 3CZTX 1TCOB 1SK6D 1WDCC 2JT3A 2K2AA 2LE9B 2O5GA 1RFJA 3HX4A 1SPYA 2K7BA 2BKIB 1K9UA 2F2OA 2B1UA 3WHUB 1DVIA 1YX8A 5B8IB 1YRTB 4P5OE 1K96A 1DGUA 1QLSA 1MXEA 2CXJA 1YR5A 4MN0A 3TUYC 2LUXA 2QPTA 2L4IA 2LCPA 1EG3A 1KK8B 3BUNB 2IS9A 1OMRA 1OMDA 1Y1AA 1QJTA 1OOJA 2H61C 1S1EA 3AKAA 1XK4A 2L4HA 2LVVA 3WNXB 2JC2A 1EH2A 3I5GC 4GUKA 3OX5A 2AAOA 1GGWA 1NCYA 3WHTB 4YRUA 3I5IC 2LM5A 4R1EA 2SCPA 4XYNA 2M7NA 4C0LA 4PHNA 2FCEA 4FTGA 1XFXO 3CGAA 3SIAA 2O60A 1OMVA 1NUBA 2FJUB 1BOCA 2KFGA 1ZUZA 4JWQA 4AOMA 1S6IA 1W7IB 1TOPA 2Y4QA 1DJXA 2LLUA 1QV0A 5I2QA 2I18A 1H4BA 2KI4C 1G8IA 1IH0A 4MZLA 4MEWA 3JVTC 3DF0B 4JPZB 4CIDA 4I5NB 1ZOTB 3D0YB 4QJ4B 2F3YA 2JT8A 2WCEA 4GPLB 4OKHA 4YGDB 1KSOA 1IJ6A 1KCYA 1XO5A 2LHLA 1NWDA 1CFPA 1KQMB 1K94A 1B47A 3BOWB 1GQMA 2BBMA 2WC8A 1F8HA 1TNWA 1WLZA 2DOQA 2EHBA 2G2BA 2LP2A 4NQGA 4PCWA 4E68A 3CR2A 1CFCA 3GK2A 4MLWA 2JXCA 4ZCUA 4NDDA 4GBAA 3IQOA 3NSOA 3RM1A 1IGVA 1UHNA 3SG5A 4M2PA 3JTDC 4N1FA 2CT9A 4ZCVA 1SCVA 2WOSA 1LA0A 5JJGA 3PN7C 1IG5A 5CPVA 1NP8A 4PHMA 1B8CA 1HT9A 2BBNA 4MBEA 1K2HA 3EK4A 1MQ1A 2LLTA 1CNPA 1MF8B 1B8RA 4HREE 2SASA 2ZRTA 1F71A 1F54A 4PE1A 1DJYA 3PM8A 4TNCA 1U5IB 4AQJA 4A4CA 1M63B 2M3WA 1J7QA 5F6TA 1OZOA 1XVJA 2KFFA 3TDZA 1SRAA 2COLB 1F55A 1N0YA 2LMUA 2PASA 1QXPA 1BJFA 1YUUA 3NXAA 1V1FA 1KWOB 1CDLA 1CLLA 1TNPA 3DVKA 4NDCA 1YUSA 3SG3A 3VROA 3ZWHA 4ORCB 5D69A 4C0KA 1RWYA 1DT7B 2GGZA 5AEQA 1MXLC 1OQPA 1CDNA 3AAKA 3LK0A 1JF2A 5FYXA 2JPTA 2Y5IA 1ZMZA 3IQQA 3DVJA 1Y0VH 1QIVA 2NXQA 5G08A 4ICBA 2KSPA 2TN4A 4XJKA 1WDCB 1BF5A 1SCMC 1UHHA 1FI5A 2PALA 4OR9B 1NPQA 2A4JA 1XK4C 5J3XA 2MBXA 4ETOA 4UPGA 1JC2A 1S6CA 1EJ3A 1BLQA 2LUCA 2CBLA 1NSHA 3SG6A 1IRJA 1X02A 1L2OB 2LMTA 5HKZA 1CLBA 1OZSA 1JFKA 2E30A 2K7CA 1FPWA 3TUYB 1WRLA 1JWDA 3PFVA 1OE9B 2OS8C 1GJYA 3TS5C 1M39A 1ZACA 1KK7Y 1TTXA 2K7DA 2AUCA 2I94A 5KU1A 2MLFC 1UHJA 1YX7A 3SIBA 2RGIA 2KBIA 2KI6C 2M1KB 3CTNA 3OX6A 1JFJA 1SR6C 4C0JA 4DS7A 1AJ5A 4GGNA 1U5IA 2BKHB 4GFTA 5AANA 5HYDA 1DJIA 1UUSA 1XYDA 3ZNIA 2EC6C 3NSIA 1RK9A 2BE4A 3WXAA 5TNCA 3I5IB 3VRPA 1YUTA 4CFQA 3TDUA 1A2XA 1UURA 1W7JB 1RTP1 1R6PA 2WORA 1E8AA 1SL9A 4CLNA 1XA5A 2VRGA 1NX2A 1YURA 1QX2A 2GGMA 3KO0A 1OSAA 4YGEB 1VRKA 3LK1A 4NDBA 2KQ6A 1FW4A 2KBMA 2WNDA
chains in the Genus database with same CATH superfamily
1UP5A 4WRIA 2WCFA 1OOHA 1Y1XA 5DKRA 4IL1A 2OTGC 1RROA 1ODBA 2M49B 3JVTB 3K1EA 1KFXS 2WC5A 4INXA 4OVNF 4YBHB 3CLNA 2KLEA 4QJ3B 1SY9A 1XFVO 1A4PA 1NX1A 3B86A 4PE7A 5CSJA 2HPSA 1A75B 3D10A 3DZTA 5DICA 5K89A 1JSAA 4U8DA 4YGBB 2ZN9A 1CDMA 3EK7A 1NIWA 2CCMA 2ISDA 4CFRA 1EXRA 1AK8A 1CB1A 1DJZA 3EVUA 3B88A 2KAXA 1IWQA 2F3ZA 4MVFA 1J55A 1AJ4A 3O4YA 2KGRA 3JTDB 3A8RA 2GTEA 5HLOA 1QX7A 2H8VA 1DGVA 3FE6A 4YGAA 1TRFA 1D1OA 1NYAA 3PN7B 4INWA 2LNKA 1K9PA 3O6BA 2HF5A 2L0PA 1G33A 1M45A 3LCPC 1B7TY 3KEVA 3SS4A 2MHHA 2ZN8A 5I94A 1WRZA 2E6WA 3BJHA 2L5XB 3EVRA 1J7OA 1QX5B 3BFAA 2M29A 3PM2A 1WLMA 3OB2B 1EL4A 3KHEA 1TNQA 4CPVA 2JQ6A 3BUOB 2K7OA 1F70A 2LVJA 5EL2A 1H8BA 4OV2A 1PALA 2AMIA 2QEOA 1C07A 1QATA 1CFDA 1S26D 3A4UB 3BXKA 1FF1A 2JULA 1W9ZA 2JWWA 3FE9A 2PSRA 1J1EA 2M1UA 3N7HA 2BCBA 4YGCB 5D3OA 1B1GA 2M7LA 3EK8A 2KYFA 2YGUA 3EKJA 1BR4B 3TZ1A 2L98A 1KK7Z 2JNXA 3EVVA 1DF0B 2F2PA 1UHIA 4I5JA 2LANA 2EGDA 3MSEB 3D73A 2ZNEA 3KF9A 2F33A 1A75A 2NZ0A 4D1EA 1IQ3A 1Y6WA 1DJGA 3DF0A 1AHRA 1CLMA 3OGNA 1SW8A 3D0YA 5CSIA 1PSBA 1SSEB 1C7WA 2WCBA 1SCMB 3VB1A 2LP3A 3VRQA 1UWOA 3NSKA 4PHKA 1BR1B 1YTZC 1CTRA 4F7FA 1NX0A 3DVMA 1QTXA 1CMGA 1SL7A 3BOWA 3OB1B 2P70A 5KTYA 1CM4A 1KFUS 4PE0A 2K61A 2M97A 2ZNDA 2WC6A 1CFFA 3NHIA 1KFXL 5FI2A 1LKJA 3EG5B 2CTNA 3I5FC 4N1GA 1XFYO 1YVLA 4GGFA 2BCAA 1YVHA 1K9KA 2MAZA 4HSZA 2PRUA 2OS8B 2Q4UA 2F8PA 4I5KA 4JQ0D 3BUMB 3TS5B 4DRWA 1ALVA 3I5HC 3DY9A 1PVBA 1SNLA 3FWCA 2V53A 5KSZA 1MUXA 2JOJA 3S0BA 1SR6B 3SG4A 1AP4A 1GM0A 4Q04A 3GOFA 1G4YR 2FOTA 2QEVA 3F45A 3VRNA 3M0WA 5GQQC 5PALA 1TIZA 1NCXA 4GNKB 2EC6B 1ALWA 1SYMA 1WY9A 2PQLA 1OOIX 4PE4A 2JTZA 2BL0C 2OPOA 1CDPA 5JOLA 3IF7A 3S0FA 1B9AA 3I5GB 1TUZA 5IBWA 2MJWB 3EKHA 1JUOA 1LVCD 2L2EA 1QS7A 1AUIB 4YI9A 1JF0A 1S3PA 3S0DA 1IJ5A 2LVIA 1BT6A 1V1GA 4KYNA 5ER4X 1S6JA 3GK4X 3NHTA 1L2OC 1J1DA 1WRKA 1DF0A 1F4OA 1PVAA 1S5GY 4MZJA 3TDIA 2OTGB 2K2FA 3CS1A 1PK0D 2L50A 3BUXB 1FBVA 2P6BB 4N5XA 3OP0A 1B8LA 1B7TZ 4WQ2A 2KI4B 3SG2A 1SL8A 3SS5A 3R1PA 5AXIA 1ZFSA 1DELA 2I7AA 2K0JA 4USLA 2BCXA 2JTTA 2Q91A 1KQVA 3VRRA 2D8NA 1K93D 3D78A 1LXFC 1XFWO 4GAOA 1KK8C 1QVIY 4MRYA 3DD4A 1QLKA 1TCFA 2LLSA 1NX3A 3DXLA 1BODA 5HKYA 2KHNA 2KNEA 4F0ZB 3BFHA 3UO9A 5AERA 5BPJA 1J7RA 3HCMA 2MLEC 1K8UA 2ZFDA 4PDZA 2JXLA 3V2LA 3CR5X 2M9GA 2HQ8A 4MSPA 4M2QA 2I2RE 4M2OA 3OHMB 5DKQA 1UHKA 2JZIA 3L4AA 3SJSA 5I2LA 3FS7A 1HQVA 3FIAA 1S36A 3DVEA 1BU3A 2KAYA 2LMVA 1LINA 3NSLA 2PMYA 2Y1MA 1Y1UA 5I2OA 4ORBB 3O2PA 2NCOA 1CKKA 3GK1A 2LC5A 2M0RA 3CR4X 2H61A 1KFUL 2LHIA 1N65A 4L9MA 1SMGA 3H4SE 1MWNA 1FI6A 4DIRA 3CZ1A 4A4BA 4BY4A 2LAPA 3O4XA 3SG7A 2K60A 1A03A 2BE6A 3AAJA 1SKTA 4XJKB 1PSRA 2KDHA 1B4CA 1XFUO 4DUQA 4OCIA 1RECA 1IQ5A 4AQIA 4DCKA 1KQMC 2Y1NA 2WCMA 4BY5A 1N2DA 1PRWA 2QEHA 3QMEA 1M46A 4P2YB 2NCPA 1EG4A 5D7FA 2KQYA 2L51A 1PULA 2M8UA 1DJWA 2KFHA 2ZRSA 1DTLA 2BAPA 3PSRA 4GGFC 4I5LB 5ER5A 2KAVA 3L47A 3O78A 4HRGA 1QV1A 3LL8B 2JU0A 5CSNA 3BYAA 4FQOA 2MRDA 3D75A 1CMFA 3FWBA 1J7PA 2JPOA 1XFZO 2GV5A 1LA3A 1L7ZA 1SBJA 3PJIA 5CSFA 2HQWA 2KI6D 2MA2A 3BUWB 4PHJA 1DMOA 4YI8A 1DJHA 1JBAA 3I5FB 2PVBA 3BQ3A 3PLFB 3K21A 1K90D 2JRFA 2KGBC 2HETA 2LV7A 3PATA 4PALA 1MR8A 1BMOA 1RJVA 3I5HB 1F4QA 3E3RA 3LLEA 1S5GZ 3KPXA 5I8NA 1CM1A 1DEKA 2R2IA 1KWOC 2QDIA 1M31A 3CWGA 2JNFA 2H2KA 2LVKA 2NLNA 3S0EA 3ICBA 4ORAB 2QEBA 1MHOA 3QRXA 5AFPA 1GGZA 2KOTA 3D74A 1K95A 3UNWA 1TN4A 2L2CA 2JT0A 2BL0B 1QASA 2G9BA 2FCDA 1QVIZ 1AVSA 3C1VA 5HKWA 2K8MB 5FI7A 1C7VA 1TNXA 2BECA 4HRHA 3AKBA 4MZKA 4WQ3A 1BG1A 1R2UA 4MRXA 1Q80A 1YRUB 1KSMA 3VGOA 1NCZA 1A29A 2ZKMX 5HLVA 1QIWA 2CNPA 1QWVA 2KYCA 3CZ0A 4FQTA 3D77A 4QJ5B 2QACA 3PALA 3R1OA 5DKNA 3RLZA 3CZTX 1TCOB 1SK6D 1WDCC 3L4LA 1IKUA 2JT3A 2K2AA 2LE9B 2O5GA 1RFJA 3HX4A 1SPYA 2K7BA 2BKIB 1K9UA 1XFRA 2B1UA 2F2OA 3WHUB 1DVIA 1DC1A 1YX8A 5B8IB 1YRTB 4P5OE 1K96A 1DGUA 1QLSA 1MXEA 2CXJA 1YR5A 4MN0A 3TUYC 2LUXA 2QPTA 2L4IA 2LCPA 1EG3A 1KK8B 3BUNB 2IS9A 1OMRA 1OMDA 1Y1AA 1IIOA 1OOGA 1QJTA 4PT1A 1TWOA 1OOJA 3S0AA 2H61C 1S1EA 3AKAA 2BNXA 1XK4A 2L4HA 2LVVA 3SS3A 3WNXB 2JC2A 1EH2A 3B87A 2P71A 3I5GC 4GUKA 3OX5A 2WCHA 2AAOA 1GGWA 1NCYA 3WHTB 4YRUA 3I5IC 2LM5A 4R1EA 2SCPA 4XYNA 2M7NA 4C0LA 4IJ7A 4PHNA 2FCEA 1C3YA 3OBVA 4FTGA 1XFXO 3CGAA 2WCLA 4OZDA 2O60A 3SIAA 1OMVA 1NUBA 2FJUB 1BOCA 2KFGA 1ZUZA 4JWQA 4AOMA 1S6IA 1W7IB 1TOPA 2Y4QA 1DJXA 2LLUA 1QV0A 5I2QA 2I18A 1H4BA 3CABA 1P28A 2KI4C 1G8IA 4JD9A 1IH0A 4MZLA 4MEWA 3JVTC 3DF0B 4JPZB 4CIDA 4I5NB 3BFBA 1ZOTB 3D0YB 4QJ4B 2F3YA 2JT8A 2WCEA 4GPLB 4OKHA 4YGDB 1KSOA 1IJ6A 1KCYA 3DYEA 1XO5A 2LHLA 2WCKA 1NWDA 1CFPA 1KQMB 1K94A 1B47A 3BOWB 1GQMA 2BBMA 2WC8A 1F8HA 1TNWA 1WLZA 2DOQA 2EHBA 2G2BA 2LP2A 4NQGA 4PCWA 4E68A 3CR2A 1CFCA 3GK2A 4MLWA 2JXCA 4ZCUA 4NDDA 4GBAA 3CDNA 3IQOA 3NSOA 1IGVA 1UHNA 3RM1A 3SG5A 4M2PA 3JTDC 4N1FA 2CT9A 1T14A 4ZCVA 1SCVA 2WOSA 1LA0A 5JJGA 3PN7C 1IG5A 5CPVA 1NP8A 2KLDA 4PHMA 1B8CA 1HT9A 2BBNA 4MBEA 1OW4A 2FJYA 1K2HA 3EK4A 1MQ1A 2LLTA 1CNPA 1MF8B 1B8RA 1LS8A 3R1VA 2ERBA 4HREE 2SASA 2ZRTA 1F71A 1F54A 4PE1A 1DJYA 3PM8A 4TNCA 1U5IB 4AQJA 4A4CA 1M63B 2M3WA 1J7QA 2WCJA 5F6TA 1OZOA 1XVJA 4JKTA 2KFFA 3TDZA 1SRAA 2COLB 1F55A 1N0YA 2LMUA 2PASA 1QXPA 1BJFA 1YUUA 3NXAA 1V1FA 1DQEA 1CDLA 1CLLA 1KWOB 1TNPA 3DVKA 4NDCA 1YUSA 3FE8A 3SG3A 5HL1A 3VROA 2KPHA 3S0GA 3ZWHA 4ORCB 5D69A 4C0KA 1RWYA 1DT7B 2GGZA 5AEQA 1MXLC 1OQPA 1CDNA 1C3ZA 3AAKA 3CYZA 3B7AA 3LK0A 1JF2A 5FYXA 2JPTA 2Y5IA 1ZMZA 3IQQA 3DVJA 3R72A 1Y0VH 1QIVA 2NXQA 5G08A 4ICBA 2KSPA 1TUJA 2TN4A 4XJKA 1WDCB 1BF5A 1SCMC 1UHHA 1FI5A 2PALA 4OR9B 1NPQA 2A4JA 1XK4C 5J3XA 2MBXA 4ETOA 4UPGA 1JC2A 1S6CA 1EJ3A 1BLQA 2LUCA 2CBLA 1NSHA 3SG6A 1IRJA 1X02A 1L2OB 2LMTA 5HKZA 1CLBA 1OZSA 5FI6A 1JFKA 2E30A 2K7CA 1FPWA 3TUYB 1WRLA 1JWDA 3PFVA 1OE9B 2OS8C 1GJYA 3TS5C 1M39A 1ZACA 1KK7Y 1TTXA 2K7DA 2AUCA 2I94A 1ORGA 1Z4HA 5KU1A 2MLFC 1UHJA 2L5YA 3CZ2A 1YX7A 3SIBA 2RGIA 2KBIA 2KI6C 2M1KB 3CTNA 3OX6A 3Q8IA 1SR6C 1JFJA 3NGVA 4C0JA 4DS7A 1AJ5A 4GGNA 1U5IA 2BKHB 4GFTA 1Z2CB 3B6XA 5AANA 1DJIA 5HYDA 1UUSA 1XYDA 3ZNIA 2EC6C 3NSIA 1RK9A 2BE4A 3WXAA 5TNCA 3I5IB 3VRPA 1YUTA 4CFQA 3TDUA 1A2XA 1OOFA 2PYQA 1UURA 1W7JB 1RTP1 1R6PA 2WORA 1E8AA 1SL9A 4CLNA 1XA5A 2VRGA 1NX2A 1YURA 3IVTA 1QX2A 2GGMA 3D76A 3KO0A 1OSAA 4YGEB 1VRKA 3RZSA 3LK1A 4NDBA 2KQ6A 1FW4A 2KBMA 2WNDA
chains in the Genus database with same CATH topology
1UP5A 4WRIA 2WCFA 1Y1XA 5DKRA 4IL1A 2OTGC 1RROA 1ODBA 2M49B 3JVTB 1KFXS 4OVNF 4YBHB 3CLNA 4QJ3B 1SY9A 1XFVO 1A4PA 1NX1A 4PE7A 5CSJA 2HPSA 1A75B 3D10A 5K89A 1JSAA 4U8DA 4YGBB 2ZN9A 1CDMA 3EK7A 1NIWA 2CCMA 2ISDA 4CFRA 1EXRA 1AK8A 1CB1A 1DJZA 3EVUA 2KAXA 1IWQA 2F3ZA 4MVFA 1J55A 1AJ4A 3O4YA 2KGRA 3JTDB 3A8RA 5HLOA 1QX7A 1DGVA 4YGAA 1TRFA 1D1OA 1NYAA 3PN7B 2LNKA 1K9PA 3O6BA 2HF5A 2L0PA 1G33A 1M45A 3LCPC 1B7TY 3KEVA 2MHHA 2ZN8A 1WRZA 2E6WA 2L5XB 3EVRA 1J7OA 1QX5B 2M29A 1WLMA 3OB2B 1EL4A 3KHEA 1TNQA 4CPVA 2JQ6A 3BUOB 2K7OA 1F70A 2LVJA 1H8BA 4OV2A 1PALA 2AMIA 1C07A 1QATA 1CFDA 1S26D 3A4UB 3BXKA 1FF1A 2JULA 2JWWA 2PSRA 1J1EA 2M1UA 1B1GA 2BCBA 4YGCB 2M7LA 3EK8A 2KYFA 3EKJA 1BR4B 3TZ1A 2L98A 1KK7Z 2JNXA 3EVVA 1DF0B 2F2PA 1UHIA 4I5JA 2LANA 2EGDA 3MSEB 2ZNEA 3KF9A 2F33A 1A75A 2NZ0A 4D1EA 1IQ3A 1Y6WA 1DJGA 3DF0A 1AHRA 1CLMA 1SW8A 3D0YA 5CSIA 1PSBA 2WCBA 1C7WA 3VRQA 1SCMB 2LP3A 1UWOA 3NSKA 4PHKA 1BR1B 1YTZC 1CTRA 1NX0A 3DVMA 1QTXA 1CMGA 1SL7A 3BOWA 3OB1B 5KTYA 1CM4A 1KFUS 4PE0A 2K61A 2M97A 2ZNDA 1CFFA 1KFXL 1LKJA 2CTNA 3I5FC 4N1GA 1XFYO 1YVLA 4GGFA 2BCAA 1YVHA 1K9KA 2MAZA 4HSZA 2PRUA 2OS8B 2Q4UA 2F8PA 4I5KA 4JQ0D 3BUMB 3TS5B 4DRWA 1ALVA 3I5HC 1PVBA 1SNLA 3FWCA 2V53A 5KSZA 1MUXA 2JOJA 1AP4A 1SR6B 3SG4A 4Q04A 3GOFA 1G4YR 2FOTA 3F45A 3VRNA 3M0WA 5GQQC 5PALA 1TIZA 1NCXA 4GNKB 2EC6B 1ALWA 1SYMA 1WY9A 4PE4A 2JTZA 2BL0C 2OPOA 1CDPA 5JOLA 3IF7A 1B9AA 3I5GB 5IBWA 2MJWB 3EKHA 1JUOA 1LVCD 2L2EA 1QS7A 1AUIB 4YI9A 1JF0A 1S3PA 1IJ5A 2LVIA 1BT6A 1V1GA 5ER4X 1S6JA 3GK4X 1L2OC 1J1DA 1WRKA 1DF0A 1F4OA 1PVAA 1S5GY 4MZJA 3TDIA 2OTGB 2K2FA 3CS1A 1PK0D 2L50A 3BUXB 1FBVA 2P6BB 4N5XA 3OP0A 1B8LA 1B7TZ 4WQ2A 2KI4B 3SG2A 1SL8A 5AXIA 1ZFSA 2I7AA 2K0JA 4USLA 2BCXA 2JTTA 2Q91A 1KQVA 3VRRA 2D8NA 1K93D 1LXFC 1XFWO 4GAOA 1KK8C 1QVIY 4MRYA 3DD4A 1QLKA 1TCFA 2LLSA 1NX3A 1BODA 5HKYA 2KHNA 2KNEA 4F0ZB 5AERA 5BPJA 1J7RA 3HCMA 2MLEC 1K8UA 2ZFDA 4PDZA 2JXLA 3CR5X 2M9GA 2HQ8A 4MSPA 4M2QA 2I2RE 4M2OA 3OHMB 5DKQA 1UHKA 2JZIA 3SJSA 5I2LA 3FS7A 1HQVA 3FIAA 1S36A 3DVEA 1BU3A 2KAYA 2LMVA 1LINA 3NSLA 2PMYA 2Y1MA 1Y1UA 5I2OA 4ORBB 3O2PA 2NCOA 1CKKA 3GK1A 2LC5A 2M0RA 3CR4X 2H61A 1KFUL 2LHIA 1N65A 4L9MA 1SMGA 3H4SE 1MWNA 1FI6A 4DIRA 4BY4A 4A4BA 2LAPA 3SG7A 1A03A 2BE6A 3AAJA 1SKTA 4XJKB 1PSRA 2KDHA 1B4CA 1XFUO 4DUQA 4OCIA 1RECA 1IQ5A 4AQIA 4DCKA 1KQMC 2Y1NA 4BY5A 1N2DA 1PRWA 1M46A 4P2YB 2NCPA 1EG4A 5D7FA 2KQYA 2L51A 1PULA 2M8UA 1DJWA 2KFHA 2ZRSA 1DTLA 4GGFC 3PSRA 5ER5A 4I5LB 2KAVA 3O78A 4HRGA 1QV1A 3LL8B 2JU0A 5CSNA 3BYAA 4FQOA 2MRDA 1CMFA 3FWBA 1J7PA 1XFZO 2GV5A 1LA3A 1L7ZA 1SBJA 5CSFA 2HQWA 2KI6D 2MA2A 3BUWB 4PHJA 1DMOA 4YI8A 1DJHA 1JBAA 3I5FB 2PVBA 3BQ3A 3PLFB 3K21A 1K90D 2JRFA 2KGBC 2HETA 2LV7A 3PATA 4PALA 1MR8A 1BMOA 1RJVA 3I5HB 1F4QA 3E3RA 3LLEA 1S5GZ 3KPXA 5I8NA 1CM1A 2R2IA 1KWOC 1M31A 3CWGA 2JNFA 2H2KA 2LVKA 2NLNA 3ICBA 4ORAB 3QRXA 1MHOA 5AFPA 1GGZA 2KOTA 1K95A 1TN4A 2JT0A 2BL0B 1QASA 2G9BA 2FCDA 1QVIZ 1AVSA 3C1VA 5HKWA 2K8MB 1C7VA 1TNXA 2BECA 4HRHA 3AKBA 4MZKA 4WQ3A 1BG1A 1R2UA 4MRXA 1Q80A 1YRUB 1KSMA 3VGOA 1NCZA 1A29A 2ZKMX 5HLVA 1QIWA 2CNPA 2KYCA 4QJ5B 2QACA 3PALA 1IKUA 5DKNA 3RLZA 3CZTX 1TCOB 1SK6D 1WDCC 2JT3A 2K2AA 2LE9B 2O5GA 1RFJA 3HX4A 1SPYA 2K7BA 2BKIB 1K9UA 2F2OA 2B1UA 3WHUB 1DVIA 1YX8A 5B8IB 1YRTB 4P5OE 1K96A 1DGUA 1QLSA 1MXEA 2CXJA 1YR5A 4MN0A 3TUYC 2LUXA 2QPTA 2L4IA 2LCPA 1EG3A 1KK8B 3BUNB 2IS9A 1OMRA 1OMDA 1Y1AA 1QJTA 1OOJA 2H61C 1S1EA 3AKAA 1XK4A 2L4HA 2LVVA 3WNXB 2JC2A 1EH2A 3I5GC 4GUKA 3OX5A 2AAOA 1GGWA 1NCYA 3WHTB 4YRUA 3I5IC 2LM5A 4R1EA 2SCPA 4XYNA 2M7NA 4C0LA 4PHNA 2FCEA 4FTGA 1XFXO 3CGAA 3SIAA 2O60A 1OMVA 1NUBA 2FJUB 1BOCA 2KFGA 1ZUZA 4JWQA 4AOMA 1S6IA 1W7IB 1TOPA 2Y4QA 1DJXA 2LLUA 1QV0A 5I2QA 2I18A 1H4BA 2KI4C 1G8IA 1IH0A 4MZLA 4MEWA 3JVTC 3DF0B 4JPZB 4CIDA 4I5NB 1ZOTB 3D0YB 4QJ4B 2F3YA 2JT8A 2WCEA 4GPLB 4OKHA 4YGDB 1KSOA 1IJ6A 1KCYA 1XO5A 2LHLA 1NWDA 1CFPA 1KQMB 1K94A 1B47A 3BOWB 1GQMA 2BBMA 2WC8A 1F8HA 1TNWA 1WLZA 2DOQA 2EHBA 2G2BA 2LP2A 4NQGA 4PCWA 4E68A 3CR2A 1CFCA 3GK2A 4MLWA 2JXCA 4ZCUA 4NDDA 4GBAA 3IQOA 3NSOA 3RM1A 1IGVA 1UHNA 3SG5A 4M2PA 3JTDC 4N1FA 2CT9A 4ZCVA 1SCVA 2WOSA 1LA0A 5JJGA 3PN7C 1IG5A 5CPVA 1NP8A 4PHMA 1B8CA 1HT9A 2BBNA 4MBEA 1K2HA 3EK4A 1MQ1A 2LLTA 1CNPA 1MF8B 1B8RA 4HREE 2SASA 2ZRTA 1F71A 1F54A 4PE1A 1DJYA 3PM8A 4TNCA 1U5IB 4AQJA 4A4CA 1M63B 2M3WA 1J7QA 5F6TA 1OZOA 1XVJA 2KFFA 3TDZA 1SRAA 2COLB 1F55A 1N0YA 2LMUA 2PASA 1QXPA 1BJFA 1YUUA 3NXAA 1V1FA 1KWOB 1CDLA 1CLLA 1TNPA 3DVKA 4NDCA 1YUSA 3SG3A 3VROA 3ZWHA 4ORCB 5D69A 4C0KA 1RWYA 1DT7B 2GGZA 5AEQA 1MXLC 1OQPA 1CDNA 3AAKA 3LK0A 1JF2A 5FYXA 2JPTA 2Y5IA 1ZMZA 3IQQA 3DVJA 1Y0VH 1QIVA 2NXQA 5G08A 4ICBA 2KSPA 2TN4A 4XJKA 1WDCB 1BF5A 1SCMC 1UHHA 1FI5A 2PALA 4OR9B 1NPQA 2A4JA 1XK4C 5J3XA 2MBXA 4ETOA 4UPGA 1JC2A 1S6CA 1EJ3A 1BLQA 2LUCA 2CBLA 1NSHA 3SG6A 1IRJA 1X02A 1L2OB 2LMTA 5HKZA 1CLBA 1OZSA 1JFKA 2E30A 2K7CA 1FPWA 3TUYB 1WRLA 1JWDA 3PFVA 1OE9B 2OS8C 1GJYA 3TS5C 1M39A 1ZACA 1KK7Y 1TTXA 2K7DA 2AUCA 2I94A 5KU1A 2MLFC 1UHJA 1YX7A 3SIBA 2RGIA 2KBIA 2KI6C 2M1KB 3CTNA 3OX6A 1JFJA 1SR6C 4C0JA 4DS7A 1AJ5A 4GGNA 1U5IA 2BKHB 4GFTA 5AANA 5HYDA 1DJIA 1UUSA 1XYDA 3ZNIA 2EC6C 3NSIA 1RK9A 2BE4A 3WXAA 5TNCA 3I5IB 3VRPA 1YUTA 4CFQA 3TDUA 1A2XA 1UURA 1W7JB 1RTP1 1R6PA 2WORA 1E8AA 1SL9A 4CLNA 1XA5A 2VRGA 1NX2A 1YURA 1QX2A 2GGMA 3KO0A 1OSAA 4YGEB 1VRKA 3LK1A 4NDBA 2KQ6A 1FW4A 2KBMA 2WNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UP5 A;  4WRI A;  2WCF A;  1Y1X A;  5DKR A;  4IL1 A;  2OTG C;  1RRO A;  1ODB A;  2M49 B;  3JVT B;  1KFX S;  4OVN F;  4YBH B;  3CLN A;  4QJ3 B;  1SY9 A;  1XFV O;  1A4P A;  1NX1 A;  4PE7 A;  5CSJ A;  2HPS A;  1A75 B;  3D10 A;  5K89 A;  1JSA A;  4U8D A;  4YGB B;  2ZN9 A;  1CDM A;  3EK7 A;  1NIW A;  2CCM A;  2ISD A;  4CFR A;  1EXR A;  1AK8 A;  1CB1 A;  1DJZ A;  3EVU A;  2KAX A;  1IWQ A;  2F3Z A;  4MVF A;  1J55 A;  1AJ4 A;  3O4Y A;  2KGR A;  3JTD B;  3A8R A;  5HLO A;  1QX7 A;  1DGV A;  4YGA A;  1TRF A;  1D1O A;  1NYA A;  3PN7 B;  2LNK A;  1K9P A;  3O6B A;  2HF5 A;  2L0P A;  1G33 A;  1M45 A;  3LCP C;  1B7T Y;  3KEV A;  2MHH A;  2ZN8 A;  1WRZ A;  2E6W A;  2L5X B;  3EVR A;  1J7O A;  1QX5 B;  2M29 A;  1WLM A;  3OB2 B;  1EL4 A;  3KHE A;  1TNQ A;  4CPV A;  2JQ6 A;  3BUO B;  2K7O A;  1F70 A;  2LVJ A;  1H8B A;  4OV2 A;  1PAL A;  2AMI A;  1C07 A;  1QAT A;  1CFD A;  1S26 D;  3A4U B;  3BXK A;  1FF1 A;  2JUL A;  2JWW A;  2PSR A;  1J1E A;  2M1U A;  1B1G A;  2BCB A;  4YGC B;  2M7L A;  3EK8 A;  2KYF A;  3EKJ A;  1BR4 B;  3TZ1 A;  2L98 A;  1KK7 Z;  2JNX A;  3EVV A;  1DF0 B;  2F2P A;  1UHI A;  4I5J A;  2LAN A;  2EGD A;  3MSE B;  2ZNE A;  3KF9 A;  2F33 A;  1A75 A;  2NZ0 A;  4D1E A;  1IQ3 A;  1Y6W A;  1DJG A;  3DF0 A;  1AHR A;  1CLM A;  1SW8 A;  3D0Y A;  5CSI A;  1PSB A;  2WCB A;  1C7W A;  3VRQ A;  1SCM B;  2LP3 A;  1UWO A;  3NSK A;  4PHK A;  1BR1 B;  1YTZ C;  1CTR A;  1NX0 A;  3DVM A;  1QTX A;  1CMG A;  1SL7 A;  3BOW A;  3OB1 B;  5KTY A;  1CM4 A;  1KFU S;  4PE0 A;  2K61 A;  2M97 A;  2ZND A;  1CFF A;  1KFX L;  1LKJ A;  2CTN A;  3I5F C;  4N1G A;  1XFY O;  1YVL A;  4GGF A;  2BCA A;  1YVH A;  1K9K A;  2MAZ A;  4HSZ A;  2PRU A;  2OS8 B;  2Q4U A;  2F8P A;  4I5K A;  4JQ0 D;  3BUM B;  3TS5 B;  4DRW A;  1ALV A;  3I5H C;  1PVB A;  1SNL A;  3FWC A;  2V53 A;  5KSZ A;  1MUX A;  2JOJ A;  1AP4 A;  1SR6 B;  3SG4 A;  4Q04 A;  3GOF A;  1G4Y R;  2FOT A;  3F45 A;  3VRN A;  3M0W A;  5GQQ C;  5PAL A;  1TIZ A;  1NCX A;  4GNK B;  2EC6 B;  1ALW A;  1SYM A;  1WY9 A;  4PE4 A;  2JTZ A;  2BL0 C;  2OPO A;  1CDP A;  5JOL A;  3IF7 A;  1B9A A;  3I5G B;  5IBW A;  2MJW B;  3EKH A;  1JUO A;  1LVC D;  2L2E A;  1QS7 A;  1AUI B;  4YI9 A;  1JF0 A;  1S3P A;  1IJ5 A;  2LVI A;  1BT6 A;  1V1G A;  5ER4 X;  1S6J A;  3GK4 X;  1L2O C;  1J1D A;  1WRK A;  1DF0 A;  1F4O A;  1PVA A;  1S5G Y;  4MZJ A;  3TDI A;  2OTG B;  2K2F A;  3CS1 A;  1PK0 D;  2L50 A;  3BUX B;  1FBV A;  2P6B B;  4N5X A;  3OP0 A;  1B8L A;  1B7T Z;  4WQ2 A;  2KI4 B;  3SG2 A;  1SL8 A;  5AXI A;  1ZFS A;  2I7A A;  2K0J A;  4USL A;  2BCX A;  2JTT A;  2Q91 A;  1KQV A;  3VRR A;  2D8N A;  1K93 D;  1LXF C;  1XFW O;  4GAO A;  1KK8 C;  1QVI Y;  4MRY A;  3DD4 A;  1QLK A;  1TCF A;  2LLS A;  1NX3 A;  1BOD A;  5HKY A;  2KHN A;  2KNE A;  4F0Z B;  5AER A;  5BPJ A;  1J7R A;  3HCM A;  2MLE C;  1K8U A;  2ZFD A;  4PDZ A;  2JXL A;  3CR5 X;  2M9G A;  2HQ8 A;  4MSP A;  4M2Q A;  2I2R E;  4M2O A;  3OHM B;  5DKQ A;  1UHK A;  2JZI A;  3SJS A;  5I2L A;  3FS7 A;  1HQV A;  3FIA A;  1S36 A;  3DVE A;  1BU3 A;  2KAY A;  2LMV A;  1LIN A;  3NSL A;  2PMY A;  2Y1M A;  1Y1U A;  5I2O A;  4ORB B;  3O2P A;  2NCO A;  1CKK A;  3GK1 A;  2LC5 A;  2M0R A;  3CR4 X;  2H61 A;  1KFU L;  2LHI A;  1N65 A;  4L9M A;  1SMG A;  3H4S E;  1MWN A;  1FI6 A;  4DIR A;  4BY4 A;  4A4B A;  2LAP A;  3SG7 A;  1A03 A;  2BE6 A;  3AAJ A;  1SKT A;  4XJK B;  1PSR A;  2KDH A;  1B4C A;  1XFU O;  4DUQ A;  4OCI A;  1REC A;  1IQ5 A;  4AQI A;  4DCK A;  1KQM C;  2Y1N A;  4BY5 A;  1N2D A;  1PRW A;  1M46 A;  4P2Y B;  2NCP A;  1EG4 A;  5D7F A;  2KQY A;  2L51 A;  1PUL A;  2M8U A;  1DJW A;  2KFH A;  2ZRS A;  1DTL A;  4GGF C;  3PSR A;  5ER5 A;  4I5L B;  2KAV A;  3O78 A;  4HRG A;  1QV1 A;  3LL8 B;  2JU0 A;  5CSN A;  3BYA A;  4FQO A;  2MRD A;  1CMF A;  3FWB A;  1J7P A;  1XFZ O;  2GV5 A;  1LA3 A;  1L7Z A;  1SBJ A;  5CSF A;  2HQW A;  2KI6 D;  2MA2 A;  3BUW B;  4PHJ A;  1DMO A;  4YI8 A;  1DJH A;  1JBA A;  3I5F B;  2PVB A;  3BQ3 A;  3PLF B;  3K21 A;  1K90 D;  2JRF A;  2KGB C;  2HET A;  2LV7 A;  3PAT A;  4PAL A;  1MR8 A;  1BMO A;  1RJV A;  3I5H B;  1F4Q A;  3E3R A;  3LLE A;  1S5G Z;  3KPX A;  5I8N A;  1CM1 A;  2R2I A;  1KWO C;  1M31 A;  3CWG A;  2JNF A;  2H2K A;  2LVK A;  2NLN A;  3ICB A;  4ORA B;  3QRX A;  1MHO A;  5AFP A;  1GGZ A;  2KOT A;  1K95 A;  1TN4 A;  2JT0 A;  2BL0 B;  1QAS A;  2G9B A;  2FCD A;  1QVI Z;  1AVS A;  3C1V A;  5HKW A;  2K8M B;  1C7V A;  1TNX A;  2BEC A;  4HRH A;  3AKB A;  4MZK A;  4WQ3 A;  1BG1 A;  1R2U A;  4MRX A;  1Q80 A;  1YRU B;  1KSM A;  3VGO A;  1NCZ A;  1A29 A;  2ZKM X;  5HLV A;  1QIW A;  2CNP A;  2KYC A;  4QJ5 B;  2QAC A;  3PAL A;  1IKU A;  5DKN A;  3RLZ A;  3CZT X;  1TCO B;  1SK6 D;  1WDC C;  2JT3 A;  2K2A A;  2LE9 B;  2O5G A;  1RFJ A;  3HX4 A;  1SPY A;  2K7B A;  2BKI B;  1K9U A;  2F2O A;  2B1U A;  3WHU B;  1DVI A;  1YX8 A;  5B8I B;  1YRT B;  4P5O E;  1K96 A;  1DGU A;  1QLS A;  1MXE A;  2CXJ A;  1YR5 A;  4MN0 A;  3TUY C;  2LUX A;  2QPT A;  2L4I A;  2LCP A;  1EG3 A;  1KK8 B;  3BUN B;  2IS9 A;  1OMR A;  1OMD A;  1Y1A A;  1QJT A;  1OOJ A;  2H61 C;  1S1E A;  3AKA A;  1XK4 A;  2L4H A;  2LVV A;  3WNX B;  2JC2 A;  1EH2 A;  3I5G C;  4GUK A;  3OX5 A;  2AAO A;  1GGW A;  1NCY A;  3WHT B;  4YRU A;  3I5I C;  2LM5 A;  4R1E A;  2SCP A;  4XYN A;  2M7N A;  4C0L A;  4PHN A;  2FCE A;  4FTG A;  1XFX O;  3CGA A;  3SIA A;  2O60 A;  1OMV A;  1NUB A;  2FJU B;  1BOC A;  2KFG A;  1ZUZ A;  4JWQ A;  4AOM A;  1S6I A;  1W7I B;  1TOP A;  2Y4Q A;  1DJX A;  2LLU A;  1QV0 A;  5I2Q A;  2I18 A;  1H4B A;  2KI4 C;  1G8I A;  1IH0 A;  4MZL A;  4MEW A;  3JVT C;  3DF0 B;  4JPZ B;  4CID A;  4I5N B;  1ZOT B;  3D0Y B;  4QJ4 B;  2F3Y A;  2JT8 A;  2WCE A;  4GPL B;  4OKH A;  4YGD B;  1KSO A;  1IJ6 A;  1KCY A;  1XO5 A;  2LHL A;  1NWD A;  1CFP A;  1KQM B;  1K94 A;  1B47 A;  3BOW B;  1GQM A;  2BBM A;  2WC8 A;  1F8H A;  1TNW A;  1WLZ A;  2DOQ A;  2EHB A;  2G2B A;  2LP2 A;  4NQG A;  4PCW A;  4E68 A;  3CR2 A;  1CFC A;  3GK2 A;  4MLW A;  2JXC A;  4ZCU A;  4NDD A;  4GBA A;  3IQO A;  3NSO A;  3RM1 A;  1IGV A;  1UHN A;  3SG5 A;  4M2P A;  3JTD C;  4N1F A;  2CT9 A;  4ZCV A;  1SCV A;  2WOS A;  1LA0 A;  5JJG A;  3PN7 C;  1IG5 A;  5CPV A;  1NP8 A;  4PHM A;  1B8C A;  1HT9 A;  2BBN A;  4MBE A;  1K2H A;  3EK4 A;  1MQ1 A;  2LLT A;  1CNP A;  1MF8 B;  1B8R A;  4HRE E;  2SAS A;  2ZRT A;  1F71 A;  1F54 A;  4PE1 A;  1DJY A;  3PM8 A;  4TNC A;  1U5I B;  4AQJ A;  4A4C A;  1M63 B;  2M3W A;  1J7Q A;  5F6T A;  1OZO A;  1XVJ A;  2KFF A;  3TDZ A;  1SRA A;  2COL B;  1F55 A;  1N0Y A;  2LMU A;  2PAS A;  1QXP A;  1BJF A;  1YUU A;  3NXA A;  1V1F A;  1KWO B;  1CDL A;  1CLL A;  1TNP A;  3DVK A;  4NDC A;  1YUS A;  3SG3 A;  3VRO A;  3ZWH A;  4ORC B;  5D69 A;  4C0K A;  1RWY A;  1DT7 B;  2GGZ A;  5AEQ A;  1MXL C;  1OQP A;  1CDN A;  3AAK A;  3LK0 A;  1JF2 A;  5FYX A;  2JPT A;  2Y5I A;  1ZMZ A;  3IQQ A;  3DVJ A;  1Y0V H;  1QIV A;  2NXQ A;  5G08 A;  4ICB A;  2KSP A;  2TN4 A;  4XJK A;  1WDC B;  1BF5 A;  1SCM C;  1UHH A;  1FI5 A;  2PAL A;  4OR9 B;  1NPQ A;  2A4J A;  1XK4 C;  5J3X A;  2MBX A;  4ETO A;  4UPG A;  1JC2 A;  1S6C A;  1EJ3 A;  1BLQ A;  2LUC A;  2CBL A;  1NSH A;  3SG6 A;  1IRJ A;  1X02 A;  1L2O B;  2LMT A;  5HKZ A;  1CLB A;  1OZS A;  1JFK A;  2E30 A;  2K7C A;  1FPW A;  3TUY B;  1WRL A;  1JWD A;  3PFV A;  1OE9 B;  2OS8 C;  1GJY A;  3TS5 C;  1M39 A;  1ZAC A;  1KK7 Y;  1TTX A;  2K7D A;  2AUC A;  2I94 A;  5KU1 A;  2MLF C;  1UHJ A;  1YX7 A;  3SIB A;  2RGI A;  2KBI A;  2KI6 C;  2M1K B;  3CTN A;  3OX6 A;  1JFJ A;  1SR6 C;  4C0J A;  4DS7 A;  1AJ5 A;  4GGN A;  1U5I A;  2BKH B;  4GFT A;  5AAN A;  5HYD A;  1DJI A;  1UUS A;  1XYD A;  3ZNI A;  2EC6 C;  3NSI A;  1RK9 A;  2BE4 A;  3WXA A;  5TNC A;  3I5I B;  3VRP A;  1YUT A;  4CFQ A;  3TDU A;  1A2X A;  1UUR A;  1W7J B;  1RTP 1;  1R6P A;  2WOR A;  1E8A A;  1SL9 A;  4CLN A;  1XA5 A;  2VRG A;  1NX2 A;  1YUR A;  1QX2 A;  2GGM A;  3KO0 A;  1OSA A;  4YGE B;  1VRK A;  3LK1 A;  4NDB A;  2KQ6 A;  1FW4 A;  2KBM A;  2WND A; 
#chains in the Genus database with same CATH topology
 1UP5 A;  4WRI A;  2WCF A;  1OOH A;  1Y1X A;  5DKR A;  4IL1 A;  2OTG C;  1RRO A;  1ODB A;  2M49 B;  3JVT B;  3K1E A;  1KFX S;  2WC5 A;  4INX A;  4OVN F;  4YBH B;  3CLN A;  2KLE A;  4QJ3 B;  1SY9 A;  1XFV O;  1A4P A;  1NX1 A;  3B86 A;  4PE7 A;  5CSJ A;  2HPS A;  1A75 B;  3D10 A;  3DZT A;  5DIC A;  5K89 A;  1JSA A;  4U8D A;  4YGB B;  2ZN9 A;  1CDM A;  3EK7 A;  1NIW A;  2CCM A;  2ISD A;  4CFR A;  1EXR A;  1AK8 A;  1CB1 A;  1DJZ A;  3EVU A;  3B88 A;  2KAX A;  1IWQ A;  2F3Z A;  4MVF A;  1J55 A;  1AJ4 A;  3O4Y A;  2KGR A;  3JTD B;  3A8R A;  2GTE A;  5HLO A;  1QX7 A;  2H8V A;  1DGV A;  3FE6 A;  4YGA A;  1TRF A;  1D1O A;  1NYA A;  3PN7 B;  4INW A;  2LNK A;  1K9P A;  3O6B A;  2HF5 A;  2L0P A;  1G33 A;  1M45 A;  3LCP C;  1B7T Y;  3KEV A;  3SS4 A;  2MHH A;  2ZN8 A;  5I94 A;  1WRZ A;  2E6W A;  3BJH A;  2L5X B;  3EVR A;  1J7O A;  1QX5 B;  3BFA A;  2M29 A;  3PM2 A;  1WLM A;  3OB2 B;  1EL4 A;  3KHE A;  1TNQ A;  4CPV A;  2JQ6 A;  3BUO B;  2K7O A;  1F70 A;  2LVJ A;  5EL2 A;  1H8B A;  4OV2 A;  1PAL A;  2AMI A;  2QEO A;  1C07 A;  1QAT A;  1CFD A;  1S26 D;  3A4U B;  3BXK A;  1FF1 A;  2JUL A;  1W9Z A;  2JWW A;  3FE9 A;  2PSR A;  1J1E A;  2M1U A;  3N7H A;  2BCB A;  4YGC B;  5D3O A;  1B1G A;  2M7L A;  3EK8 A;  2KYF A;  2YGU A;  3EKJ A;  1BR4 B;  3TZ1 A;  2L98 A;  1KK7 Z;  2JNX A;  3EVV A;  1DF0 B;  2F2P A;  1UHI A;  4I5J A;  2LAN A;  2EGD A;  3MSE B;  3D73 A;  2ZNE A;  3KF9 A;  2F33 A;  1A75 A;  2NZ0 A;  4D1E A;  1IQ3 A;  1Y6W A;  1DJG A;  3DF0 A;  1AHR A;  1CLM A;  3OGN A;  1SW8 A;  3D0Y A;  5CSI A;  1PSB A;  1SSE B;  1C7W A;  2WCB A;  1SCM B;  3VB1 A;  2LP3 A;  3VRQ A;  1UWO A;  3NSK A;  4PHK A;  1BR1 B;  1YTZ C;  1CTR A;  4F7F A;  1NX0 A;  3DVM A;  1QTX A;  1CMG A;  1SL7 A;  3BOW A;  3OB1 B;  2P70 A;  5KTY A;  1CM4 A;  1KFU S;  4PE0 A;  2K61 A;  2M97 A;  2ZND A;  2WC6 A;  1CFF A;  3NHI A;  1KFX L;  5FI2 A;  1LKJ A;  3EG5 B;  2CTN A;  3I5F C;  4N1G A;  1XFY O;  1YVL A;  4GGF A;  2BCA A;  1YVH A;  1K9K A;  2MAZ A;  4HSZ A;  2PRU A;  2OS8 B;  2Q4U A;  2F8P A;  4I5K A;  4JQ0 D;  3BUM B;  3TS5 B;  4DRW A;  1ALV A;  3I5H C;  3DY9 A;  1PVB A;  1SNL A;  3FWC A;  2V53 A;  5KSZ A;  1MUX A;  2JOJ A;  3S0B A;  1SR6 B;  3SG4 A;  1AP4 A;  1GM0 A;  4Q04 A;  3GOF A;  1G4Y R;  2FOT A;  2QEV A;  3F45 A;  3VRN A;  3M0W A;  5GQQ C;  5PAL A;  1TIZ A;  1NCX A;  4GNK B;  2EC6 B;  1ALW A;  1SYM A;  1WY9 A;  2PQL A;  1OOI X;  4PE4 A;  2JTZ A;  2BL0 C;  2OPO A;  1CDP A;  5JOL A;  3IF7 A;  3S0F A;  1B9A A;  3I5G B;  1TUZ A;  5IBW A;  2MJW B;  3EKH A;  1JUO A;  1LVC D;  2L2E A;  1QS7 A;  1AUI B;  4YI9 A;  1JF0 A;  1S3P A;  3S0D A;  1IJ5 A;  2LVI A;  1BT6 A;  1V1G A;  4KYN A;  5ER4 X;  1S6J A;  3GK4 X;  3NHT A;  1L2O C;  1J1D A;  1WRK A;  1DF0 A;  1F4O A;  1PVA A;  1S5G Y;  4MZJ A;  3TDI A;  2OTG B;  2K2F A;  3CS1 A;  1PK0 D;  2L50 A;  3BUX B;  1FBV A;  2P6B B;  4N5X A;  3OP0 A;  1B8L A;  1B7T Z;  4WQ2 A;  2KI4 B;  3SG2 A;  1SL8 A;  3SS5 A;  3R1P A;  5AXI A;  1ZFS A;  1DEL A;  2I7A A;  2K0J A;  4USL A;  2BCX A;  2JTT A;  2Q91 A;  1KQV A;  3VRR A;  2D8N A;  1K93 D;  3D78 A;  1LXF C;  1XFW O;  4GAO A;  1KK8 C;  1QVI Y;  4MRY A;  3DD4 A;  1QLK A;  1TCF A;  2LLS A;  1NX3 A;  3DXL A;  1BOD A;  5HKY A;  2KHN A;  2KNE A;  4F0Z B;  3BFH A;  3UO9 A;  5AER A;  5BPJ A;  1J7R A;  3HCM A;  2MLE C;  1K8U A;  2ZFD A;  4PDZ A;  2JXL A;  3V2L A;  3CR5 X;  2M9G A;  2HQ8 A;  4MSP A;  4M2Q A;  2I2R E;  4M2O A;  3OHM B;  5DKQ A;  1UHK A;  2JZI A;  3L4A A;  3SJS A;  5I2L A;  3FS7 A;  1HQV A;  3FIA A;  1S36 A;  3DVE A;  1BU3 A;  2KAY A;  2LMV A;  1LIN A;  3NSL A;  2PMY A;  2Y1M A;  1Y1U A;  5I2O A;  4ORB B;  3O2P A;  2NCO A;  1CKK A;  3GK1 A;  2LC5 A;  2M0R A;  3CR4 X;  2H61 A;  1KFU L;  2LHI A;  1N65 A;  4L9M A;  1SMG A;  3H4S E;  1MWN A;  1FI6 A;  4DIR A;  3CZ1 A;  4A4B A;  4BY4 A;  2LAP A;  3O4X A;  3SG7 A;  2K60 A;  1A03 A;  2BE6 A;  3AAJ A;  1SKT A;  4XJK B;  1PSR A;  2KDH A;  1B4C A;  1XFU O;  4DUQ A;  4OCI A;  1REC A;  1IQ5 A;  4AQI A;  4DCK A;  1KQM C;  2Y1N A;  2WCM A;  4BY5 A;  1N2D A;  1PRW A;  2QEH A;  3QME A;  1M46 A;  4P2Y B;  2NCP A;  1EG4 A;  5D7F A;  2KQY A;  2L51 A;  1PUL A;  2M8U A;  1DJW A;  2KFH A;  2ZRS A;  1DTL A;  2BAP A;  3PSR A;  4GGF C;  4I5L B;  5ER5 A;  2KAV A;  3L47 A;  3O78 A;  4HRG A;  1QV1 A;  3LL8 B;  2JU0 A;  5CSN A;  3BYA A;  4FQO A;  2MRD A;  3D75 A;  1CMF A;  3FWB A;  1J7P A;  2JPO A;  1XFZ O;  2GV5 A;  1LA3 A;  1L7Z A;  1SBJ A;  3PJI A;  5CSF A;  2HQW A;  2KI6 D;  2MA2 A;  3BUW B;  4PHJ A;  1DMO A;  4YI8 A;  1DJH A;  1JBA A;  3I5F B;  2PVB A;  3BQ3 A;  3PLF B;  3K21 A;  1K90 D;  2JRF A;  2KGB C;  2HET A;  2LV7 A;  3PAT A;  4PAL A;  1MR8 A;  1BMO A;  1RJV A;  3I5H B;  1F4Q A;  3E3R A;  3LLE A;  1S5G Z;  3KPX A;  5I8N A;  1CM1 A;  1DEK A;  2R2I A;  1KWO C;  2QDI A;  1M31 A;  3CWG A;  2JNF A;  2H2K A;  2LVK A;  2NLN A;  3S0E A;  3ICB A;  4ORA B;  2QEB A;  1MHO A;  3QRX A;  5AFP A;  1GGZ A;  2KOT A;  3D74 A;  1K95 A;  3UNW A;  1TN4 A;  2L2C A;  2JT0 A;  2BL0 B;  1QAS A;  2G9B A;  2FCD A;  1QVI Z;  1AVS A;  3C1V A;  5HKW A;  2K8M B;  5FI7 A;  1C7V A;  1TNX A;  2BEC A;  4HRH A;  3AKB A;  4MZK A;  4WQ3 A;  1BG1 A;  1R2U A;  4MRX A;  1Q80 A;  1YRU B;  1KSM A;  3VGO A;  1NCZ A;  1A29 A;  2ZKM X;  5HLV A;  1QIW A;  2CNP A;  1QWV A;  2KYC A;  3CZ0 A;  4FQT A;  3D77 A;  4QJ5 B;  2QAC A;  3PAL A;  3R1O A;  5DKN A;  3RLZ A;  3CZT X;  1TCO B;  1SK6 D;  1WDC C;  3L4L A;  1IKU A;  2JT3 A;  2K2A A;  2LE9 B;  2O5G A;  1RFJ A;  3HX4 A;  1SPY A;  2K7B A;  2BKI B;  1K9U A;  1XFR A;  2B1U A;  2F2O A;  3WHU B;  1DVI A;  1DC1 A;  1YX8 A;  5B8I B;  1YRT B;  4P5O E;  1K96 A;  1DGU A;  1QLS A;  1MXE A;  2CXJ A;  1YR5 A;  4MN0 A;  3TUY C;  2LUX A;  2QPT A;  2L4I A;  2LCP A;  1EG3 A;  1KK8 B;  3BUN B;  2IS9 A;  1OMR A;  1OMD A;  1Y1A A;  1IIO A;  1OOG A;  1QJT A;  4PT1 A;  1TWO A;  1OOJ A;  3S0A A;  2H61 C;  1S1E A;  3AKA A;  2BNX A;  1XK4 A;  2L4H A;  2LVV A;  3SS3 A;  3WNX B;  2JC2 A;  1EH2 A;  3B87 A;  2P71 A;  3I5G C;  4GUK A;  3OX5 A;  2WCH A;  2AAO A;  1GGW A;  1NCY A;  3WHT B;  4YRU A;  3I5I C;  2LM5 A;  4R1E A;  2SCP A;  4XYN A;  2M7N A;  4C0L A;  4IJ7 A;  4PHN A;  2FCE A;  1C3Y A;  3OBV A;  4FTG A;  1XFX O;  3CGA A;  2WCL A;  4OZD A;  2O60 A;  3SIA A;  1OMV A;  1NUB A;  2FJU B;  1BOC A;  2KFG A;  1ZUZ A;  4JWQ A;  4AOM A;  1S6I A;  1W7I B;  1TOP A;  2Y4Q A;  1DJX A;  2LLU A;  1QV0 A;  5I2Q A;  2I18 A;  1H4B A;  3CAB A;  1P28 A;  2KI4 C;  1G8I A;  4JD9 A;  1IH0 A;  4MZL A;  4MEW A;  3JVT C;  3DF0 B;  4JPZ B;  4CID A;  4I5N B;  3BFB A;  1ZOT B;  3D0Y B;  4QJ4 B;  2F3Y A;  2JT8 A;  2WCE A;  4GPL B;  4OKH A;  4YGD B;  1KSO A;  1IJ6 A;  1KCY A;  3DYE A;  1XO5 A;  2LHL A;  2WCK A;  1NWD A;  1CFP A;  1KQM B;  1K94 A;  1B47 A;  3BOW B;  1GQM A;  2BBM A;  2WC8 A;  1F8H A;  1TNW A;  1WLZ A;  2DOQ A;  2EHB A;  2G2B A;  2LP2 A;  4NQG A;  4PCW A;  4E68 A;  3CR2 A;  1CFC A;  3GK2 A;  4MLW A;  2JXC A;  4ZCU A;  4NDD A;  4GBA A;  3CDN A;  3IQO A;  3NSO A;  1IGV A;  1UHN A;  3RM1 A;  3SG5 A;  4M2P A;  3JTD C;  4N1F A;  2CT9 A;  1T14 A;  4ZCV A;  1SCV A;  2WOS A;  1LA0 A;  5JJG A;  3PN7 C;  1IG5 A;  5CPV A;  1NP8 A;  2KLD A;  4PHM A;  1B8C A;  1HT9 A;  2BBN A;  4MBE A;  1OW4 A;  2FJY A;  1K2H A;  3EK4 A;  1MQ1 A;  2LLT A;  1CNP A;  1MF8 B;  1B8R A;  1LS8 A;  3R1V A;  2ERB A;  4HRE E;  2SAS A;  2ZRT A;  1F71 A;  1F54 A;  4PE1 A;  1DJY A;  3PM8 A;  4TNC A;  1U5I B;  4AQJ A;  4A4C A;  1M63 B;  2M3W A;  1J7Q A;  2WCJ A;  5F6T A;  1OZO A;  1XVJ A;  4JKT A;  2KFF A;  3TDZ A;  1SRA A;  2COL B;  1F55 A;  1N0Y A;  2LMU A;  2PAS A;  1QXP A;  1BJF A;  1YUU A;  3NXA A;  1V1F A;  1DQE A;  1CDL A;  1CLL A;  1KWO B;  1TNP A;  3DVK A;  4NDC A;  1YUS A;  3FE8 A;  3SG3 A;  5HL1 A;  3VRO A;  2KPH A;  3S0G A;  3ZWH A;  4ORC B;  5D69 A;  4C0K A;  1RWY A;  1DT7 B;  2GGZ A;  5AEQ A;  1MXL C;  1OQP A;  1CDN A;  1C3Z A;  3AAK A;  3CYZ A;  3B7A A;  3LK0 A;  1JF2 A;  5FYX A;  2JPT A;  2Y5I A;  1ZMZ A;  3IQQ A;  3DVJ A;  3R72 A;  1Y0V H;  1QIV A;  2NXQ A;  5G08 A;  4ICB A;  2KSP A;  1TUJ A;  2TN4 A;  4XJK A;  1WDC B;  1BF5 A;  1SCM C;  1UHH A;  1FI5 A;  2PAL A;  4OR9 B;  1NPQ A;  2A4J A;  1XK4 C;  5J3X A;  2MBX A;  4ETO A;  4UPG A;  1JC2 A;  1S6C A;  1EJ3 A;  1BLQ A;  2LUC A;  2CBL A;  1NSH A;  3SG6 A;  1IRJ A;  1X02 A;  1L2O B;  2LMT A;  5HKZ A;  1CLB A;  1OZS A;  5FI6 A;  1JFK A;  2E30 A;  2K7C A;  1FPW A;  3TUY B;  1WRL A;  1JWD A;  3PFV A;  1OE9 B;  2OS8 C;  1GJY A;  3TS5 C;  1M39 A;  1ZAC A;  1KK7 Y;  1TTX A;  2K7D A;  2AUC A;  2I94 A;  1ORG A;  1Z4H A;  5KU1 A;  2MLF C;  1UHJ A;  2L5Y A;  3CZ2 A;  1YX7 A;  3SIB A;  2RGI A;  2KBI A;  2KI6 C;  2M1K B;  3CTN A;  3OX6 A;  3Q8I A;  1SR6 C;  1JFJ A;  3NGV A;  4C0J A;  4DS7 A;  1AJ5 A;  4GGN A;  1U5I A;  2BKH B;  4GFT A;  1Z2C B;  3B6X A;  5AAN A;  1DJI A;  5HYD A;  1UUS A;  1XYD A;  3ZNI A;  2EC6 C;  3NSI A;  1RK9 A;  2BE4 A;  3WXA A;  5TNC A;  3I5I B;  3VRP A;  1YUT A;  4CFQ A;  3TDU A;  1A2X A;  1OOF A;  2PYQ A;  1UUR A;  1W7J B;  1RTP 1;  1R6P A;  2WOR A;  1E8A A;  1SL9 A;  4CLN A;  1XA5 A;  2VRG A;  1NX2 A;  1YUR A;  3IVT A;  1QX2 A;  2GGM A;  3D76 A;  3KO0 A;  1OSA A;  4YGE B;  1VRK A;  3RZS A;  3LK1 A;  4NDB A;  2KQ6 A;  1FW4 A;  2KBM A;  2WND A; 
#chains in the Genus database with same CATH homology
 1UP5 A;  4WRI A;  2WCF A;  1Y1X A;  5DKR A;  4IL1 A;  2OTG C;  1RRO A;  1ODB A;  2M49 B;  3JVT B;  1KFX S;  4OVN F;  4YBH B;  3CLN A;  4QJ3 B;  1SY9 A;  1XFV O;  1A4P A;  1NX1 A;  4PE7 A;  5CSJ A;  2HPS A;  1A75 B;  3D10 A;  5K89 A;  1JSA A;  4U8D A;  4YGB B;  2ZN9 A;  1CDM A;  3EK7 A;  1NIW A;  2CCM A;  2ISD A;  4CFR A;  1EXR A;  1AK8 A;  1CB1 A;  1DJZ A;  3EVU A;  2KAX A;  1IWQ A;  2F3Z A;  4MVF A;  1J55 A;  1AJ4 A;  3O4Y A;  2KGR A;  3JTD B;  3A8R A;  5HLO A;  1QX7 A;  1DGV A;  4YGA A;  1TRF A;  1D1O A;  1NYA A;  3PN7 B;  2LNK A;  1K9P A;  3O6B A;  2HF5 A;  2L0P A;  1G33 A;  1M45 A;  3LCP C;  1B7T Y;  3KEV A;  2MHH A;  2ZN8 A;  1WRZ A;  2E6W A;  2L5X B;  3EVR A;  1J7O A;  1QX5 B;  2M29 A;  1WLM A;  3OB2 B;  1EL4 A;  3KHE A;  1TNQ A;  4CPV A;  2JQ6 A;  3BUO B;  2K7O A;  1F70 A;  2LVJ A;  1H8B A;  4OV2 A;  1PAL A;  2AMI A;  1C07 A;  1QAT A;  1CFD A;  1S26 D;  3A4U B;  3BXK A;  1FF1 A;  2JUL A;  2JWW A;  2PSR A;  1J1E A;  2M1U A;  1B1G A;  2BCB A;  4YGC B;  2M7L A;  3EK8 A;  2KYF A;  3EKJ A;  1BR4 B;  3TZ1 A;  2L98 A;  1KK7 Z;  2JNX A;  3EVV A;  1DF0 B;  2F2P A;  1UHI A;  4I5J A;  2LAN A;  2EGD A;  3MSE B;  2ZNE A;  3KF9 A;  2F33 A;  1A75 A;  2NZ0 A;  4D1E A;  1IQ3 A;  1Y6W A;  1DJG A;  3DF0 A;  1AHR A;  1CLM A;  1SW8 A;  3D0Y A;  5CSI A;  1PSB A;  2WCB A;  1C7W A;  3VRQ A;  1SCM B;  2LP3 A;  1UWO A;  3NSK A;  4PHK A;  1BR1 B;  1YTZ C;  1CTR A;  1NX0 A;  3DVM A;  1QTX A;  1CMG A;  1SL7 A;  3BOW A;  3OB1 B;  5KTY A;  1CM4 A;  1KFU S;  4PE0 A;  2K61 A;  2M97 A;  2ZND A;  1CFF A;  1KFX L;  1LKJ A;  2CTN A;  3I5F C;  4N1G A;  1XFY O;  1YVL A;  4GGF A;  2BCA A;  1YVH A;  1K9K A;  2MAZ A;  4HSZ A;  2PRU A;  2OS8 B;  2Q4U A;  2F8P A;  4I5K A;  4JQ0 D;  3BUM B;  3TS5 B;  4DRW A;  1ALV A;  3I5H C;  1PVB A;  1SNL A;  3FWC A;  2V53 A;  5KSZ A;  1MUX A;  2JOJ A;  1AP4 A;  1SR6 B;  3SG4 A;  4Q04 A;  3GOF A;  1G4Y R;  2FOT A;  3F45 A;  3VRN A;  3M0W A;  5GQQ C;  5PAL A;  1TIZ A;  1NCX A;  4GNK B;  2EC6 B;  1ALW A;  1SYM A;  1WY9 A;  4PE4 A;  2JTZ A;  2BL0 C;  2OPO A;  1CDP A;  5JOL A;  3IF7 A;  1B9A A;  3I5G B;  5IBW A;  2MJW B;  3EKH A;  1JUO A;  1LVC D;  2L2E A;  1QS7 A;  1AUI B;  4YI9 A;  1JF0 A;  1S3P A;  1IJ5 A;  2LVI A;  1BT6 A;  1V1G A;  5ER4 X;  1S6J A;  3GK4 X;  1L2O C;  1J1D A;  1WRK A;  1DF0 A;  1F4O A;  1PVA A;  1S5G Y;  4MZJ A;  3TDI A;  2OTG B;  2K2F A;  3CS1 A;  1PK0 D;  2L50 A;  3BUX B;  1FBV A;  2P6B B;  4N5X A;  3OP0 A;  1B8L A;  1B7T Z;  4WQ2 A;  2KI4 B;  3SG2 A;  1SL8 A;  5AXI A;  1ZFS A;  2I7A A;  2K0J A;  4USL A;  2BCX A;  2JTT A;  2Q91 A;  1KQV A;  3VRR A;  2D8N A;  1K93 D;  1LXF C;  1XFW O;  4GAO A;  1KK8 C;  1QVI Y;  4MRY A;  3DD4 A;  1QLK A;  1TCF A;  2LLS A;  1NX3 A;  1BOD A;  5HKY A;  2KHN A;  2KNE A;  4F0Z B;  5AER A;  5BPJ A;  1J7R A;  3HCM A;  2MLE C;  1K8U A;  2ZFD A;  4PDZ A;  2JXL A;  3CR5 X;  2M9G A;  2HQ8 A;  4MSP A;  4M2Q A;  2I2R E;  4M2O A;  3OHM B;  5DKQ A;  1UHK A;  2JZI A;  3SJS A;  5I2L A;  3FS7 A;  1HQV A;  3FIA A;  1S36 A;  3DVE A;  1BU3 A;  2KAY A;  2LMV A;  1LIN A;  3NSL A;  2PMY A;  2Y1M A;  1Y1U A;  5I2O A;  4ORB B;  3O2P A;  2NCO A;  1CKK A;  3GK1 A;  2LC5 A;  2M0R A;  3CR4 X;  2H61 A;  1KFU L;  2LHI A;  1N65 A;  4L9M A;  1SMG A;  3H4S E;  1MWN A;  1FI6 A;  4DIR A;  4BY4 A;  4A4B A;  2LAP A;  3SG7 A;  1A03 A;  2BE6 A;  3AAJ A;  1SKT A;  4XJK B;  1PSR A;  2KDH A;  1B4C A;  1XFU O;  4DUQ A;  4OCI A;  1REC A;  1IQ5 A;  4AQI A;  4DCK A;  1KQM C;  2Y1N A;  4BY5 A;  1N2D A;  1PRW A;  1M46 A;  4P2Y B;  2NCP A;  1EG4 A;  5D7F A;  2KQY A;  2L51 A;  1PUL A;  2M8U A;  1DJW A;  2KFH A;  2ZRS A;  1DTL A;  4GGF C;  3PSR A;  5ER5 A;  4I5L B;  2KAV A;  3O78 A;  4HRG A;  1QV1 A;  3LL8 B;  2JU0 A;  5CSN A;  3BYA A;  4FQO A;  2MRD A;  1CMF A;  3FWB A;  1J7P A;  1XFZ O;  2GV5 A;  1LA3 A;  1L7Z A;  1SBJ A;  5CSF A;  2HQW A;  2KI6 D;  2MA2 A;  3BUW B;  4PHJ A;  1DMO A;  4YI8 A;  1DJH A;  1JBA A;  3I5F B;  2PVB A;  3BQ3 A;  3PLF B;  3K21 A;  1K90 D;  2JRF A;  2KGB C;  2HET A;  2LV7 A;  3PAT A;  4PAL A;  1MR8 A;  1BMO A;  1RJV A;  3I5H B;  1F4Q A;  3E3R A;  3LLE A;  1S5G Z;  3KPX A;  5I8N A;  1CM1 A;  2R2I A;  1KWO C;  1M31 A;  3CWG A;  2JNF A;  2H2K A;  2LVK A;  2NLN A;  3ICB A;  4ORA B;  3QRX A;  1MHO A;  5AFP A;  1GGZ A;  2KOT A;  1K95 A;  1TN4 A;  2JT0 A;  2BL0 B;  1QAS A;  2G9B A;  2FCD A;  1QVI Z;  1AVS A;  3C1V A;  5HKW A;  2K8M B;  1C7V A;  1TNX A;  2BEC A;  4HRH A;  3AKB A;  4MZK A;  4WQ3 A;  1BG1 A;  1R2U A;  4MRX A;  1Q80 A;  1YRU B;  1KSM A;  3VGO A;  1NCZ A;  1A29 A;  2ZKM X;  5HLV A;  1QIW A;  2CNP A;  2KYC A;  4QJ5 B;  2QAC A;  3PAL A;  1IKU A;  5DKN A;  3RLZ A;  3CZT X;  1TCO B;  1SK6 D;  1WDC C;  2JT3 A;  2K2A A;  2LE9 B;  2O5G A;  1RFJ A;  3HX4 A;  1SPY A;  2K7B A;  2BKI B;  1K9U A;  2F2O A;  2B1U A;  3WHU B;  1DVI A;  1YX8 A;  5B8I B;  1YRT B;  4P5O E;  1K96 A;  1DGU A;  1QLS A;  1MXE A;  2CXJ A;  1YR5 A;  4MN0 A;  3TUY C;  2LUX A;  2QPT A;  2L4I A;  2LCP A;  1EG3 A;  1KK8 B;  3BUN B;  2IS9 A;  1OMR A;  1OMD A;  1Y1A A;  1QJT A;  1OOJ A;  2H61 C;  1S1E A;  3AKA A;  1XK4 A;  2L4H A;  2LVV A;  3WNX B;  2JC2 A;  1EH2 A;  3I5G C;  4GUK A;  3OX5 A;  2AAO A;  1GGW A;  1NCY A;  3WHT B;  4YRU A;  3I5I C;  2LM5 A;  4R1E A;  2SCP A;  4XYN A;  2M7N A;  4C0L A;  4PHN A;  2FCE A;  4FTG A;  1XFX O;  3CGA A;  3SIA A;  2O60 A;  1OMV A;  1NUB A;  2FJU B;  1BOC A;  2KFG A;  1ZUZ A;  4JWQ A;  4AOM A;  1S6I A;  1W7I B;  1TOP A;  2Y4Q A;  1DJX A;  2LLU A;  1QV0 A;  5I2Q A;  2I18 A;  1H4B A;  2KI4 C;  1G8I A;  1IH0 A;  4MZL A;  4MEW A;  3JVT C;  3DF0 B;  4JPZ B;  4CID A;  4I5N B;  1ZOT B;  3D0Y B;  4QJ4 B;  2F3Y A;  2JT8 A;  2WCE A;  4GPL B;  4OKH A;  4YGD B;  1KSO A;  1IJ6 A;  1KCY A;  1XO5 A;  2LHL A;  1NWD A;  1CFP A;  1KQM B;  1K94 A;  1B47 A;  3BOW B;  1GQM A;  2BBM A;  2WC8 A;  1F8H A;  1TNW A;  1WLZ A;  2DOQ A;  2EHB A;  2G2B A;  2LP2 A;  4NQG A;  4PCW A;  4E68 A;  3CR2 A;  1CFC A;  3GK2 A;  4MLW A;  2JXC A;  4ZCU A;  4NDD A;  4GBA A;  3IQO A;  3NSO A;  3RM1 A;  1IGV A;  1UHN A;  3SG5 A;  4M2P A;  3JTD C;  4N1F A;  2CT9 A;  4ZCV A;  1SCV A;  2WOS A;  1LA0 A;  5JJG A;  3PN7 C;  1IG5 A;  5CPV A;  1NP8 A;  4PHM A;  1B8C A;  1HT9 A;  2BBN A;  4MBE A;  1K2H A;  3EK4 A;  1MQ1 A;  2LLT A;  1CNP A;  1MF8 B;  1B8R A;  4HRE E;  2SAS A;  2ZRT A;  1F71 A;  1F54 A;  4PE1 A;  1DJY A;  3PM8 A;  4TNC A;  1U5I B;  4AQJ A;  4A4C A;  1M63 B;  2M3W A;  1J7Q A;  5F6T A;  1OZO A;  1XVJ A;  2KFF A;  3TDZ A;  1SRA A;  2COL B;  1F55 A;  1N0Y A;  2LMU A;  2PAS A;  1QXP A;  1BJF A;  1YUU A;  3NXA A;  1V1F A;  1KWO B;  1CDL A;  1CLL A;  1TNP A;  3DVK A;  4NDC A;  1YUS A;  3SG3 A;  3VRO A;  3ZWH A;  4ORC B;  5D69 A;  4C0K A;  1RWY A;  1DT7 B;  2GGZ A;  5AEQ A;  1MXL C;  1OQP A;  1CDN A;  3AAK A;  3LK0 A;  1JF2 A;  5FYX A;  2JPT A;  2Y5I A;  1ZMZ A;  3IQQ A;  3DVJ A;  1Y0V H;  1QIV A;  2NXQ A;  5G08 A;  4ICB A;  2KSP A;  2TN4 A;  4XJK A;  1WDC B;  1BF5 A;  1SCM C;  1UHH A;  1FI5 A;  2PAL A;  4OR9 B;  1NPQ A;  2A4J A;  1XK4 C;  5J3X A;  2MBX A;  4ETO A;  4UPG A;  1JC2 A;  1S6C A;  1EJ3 A;  1BLQ A;  2LUC A;  2CBL A;  1NSH A;  3SG6 A;  1IRJ A;  1X02 A;  1L2O B;  2LMT A;  5HKZ A;  1CLB A;  1OZS A;  1JFK A;  2E30 A;  2K7C A;  1FPW A;  3TUY B;  1WRL A;  1JWD A;  3PFV A;  1OE9 B;  2OS8 C;  1GJY A;  3TS5 C;  1M39 A;  1ZAC A;  1KK7 Y;  1TTX A;  2K7D A;  2AUC A;  2I94 A;  5KU1 A;  2MLF C;  1UHJ A;  1YX7 A;  3SIB A;  2RGI A;  2KBI A;  2KI6 C;  2M1K B;  3CTN A;  3OX6 A;  1JFJ A;  1SR6 C;  4C0J A;  4DS7 A;  1AJ5 A;  4GGN A;  1U5I A;  2BKH B;  4GFT A;  5AAN A;  5HYD A;  1DJI A;  1UUS A;  1XYD A;  3ZNI A;  2EC6 C;  3NSI A;  1RK9 A;  2BE4 A;  3WXA A;  5TNC A;  3I5I B;  3VRP A;  1YUT A;  4CFQ A;  3TDU A;  1A2X A;  1UUR A;  1W7J B;  1RTP 1;  1R6P A;  2WOR A;  1E8A A;  1SL9 A;  4CLN A;  1XA5 A;  2VRG A;  1NX2 A;  1YUR A;  1QX2 A;  2GGM A;  3KO0 A;  1OSA A;  4YGE B;  1VRK A;  3LK1 A;  4NDB A;  2KQ6 A;  1FW4 A;  2KBM A;  2WND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...