3CR4X

X-ray structure of bovine pnt,ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Divalent metal ion complexes of S100B in the absence and presence of pentamidine.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 31
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cr4X00
2H61A 2F3ZA 1ODBA 1RECA 3AKBA 1S36A 2JT0A 4BY5A 3DVEA 4OR9B 4I5JA 2JT3A 2L4IA 4WRIA 4MEWA 3TS5C 1NCYA 4D1EA 1K90D 1QIWA 1SY9A 2BBMA 1SBJA 3ICBA 2MLFC 2M9GA 2F33A 3JVTC 1TIZA 4JWQA 3I5HB 4A4CA 2F2OA 1JBAA 1M46A 2D8NA 1AJ4A 2CT9A 4FQOA 3SIAA 3OB1B 1UHJA 3TDZA 4MRYA 1BODA 1SPYA 4MSPA 1S3PA 3PLFB 4AOMA 2QACA 1DTLA 5AFPA 1GJYA 2LMUA 1F4QA 1QTXA 1CTRA 3K21A 3SG2A 2SCPA 3I5HC 4IL1A 1YVHA 1FI5A 4QJ4B 1UP5A 3CLNA 1RJVA 5F6TA 1R6PA 1CFPA 1OE9B 4PE7A 5I2QA 1VRKA 1MQ1A 3D10A 1DVIA 2QPTA 2GV5A 1C7VA 2EGDA 2MAZA 2LP3A 1DGUA 1A4PA 2FJUB 4YGEB 5B8IB 5I8NA 4PHKA 1TRFA 1B8CA 1ZFSA 1B9AA 4CPVA 1YRTB 4GAOA 1H4BA 2DOQA 1M63B 1WLZA 1CFCA 2LM5A 1QX5B 1SCVA 4NQGA 2WCEA 1BR4B 3D0YB 3FWBA 3PN7C 1RTP1 2LAPA 1S5GZ 3BYAA 1CM1A 3KF9A 2Q4UA 1LVCD 1NP8A 2MHHA 1QLKA 2E6WA 5KSZA 5CPVA 3I5GB 1K2HA 1KSMA 2JNXA 2VRGA 1V1GA 4ICBA 4QJ5B 3PFVA 2I18A 2BKHB 1K94A 4MZJA 1TOPA 4AQIA 1A29A 1NWDA 1XA5A 4NDBA 3O6BA 3LK1A 2ZN8A 1YVLA 4WQ2A 4DCKA 4C0LA 4DUQA 2JT8A 3I5GC 1PALA 3BXKA 1CB1A 2A4JA 4GGFC 3EKHA 3TUYB 1IH0A 1MR8A 4XYNA 4NDDA 1QV1A 4MN0A 2BE4A 2BCXA 1M45A 1PVBA 3IF7A 3BUWB 1OZOA 1DJXA 3PALA 4PCWA 1ALVA 3HCMA 4TNCA 3CGAA 5DKNA 3H4SE 2NCPA 1F70A 5AEQA 2NXQA 2M0RA 4XJKB 1GGZA 1PK0D 2EC6B 3DVMA 5JOLA 2LE9B 4CIDA 2Y5IA 1MWNA 1Y1XA 4ZCUA 1NSHA 2LLTA 2LP2A 2O60A 3TUYC 1OMDA 1Q80A 4QJ3B 1TCFA 1DJWA 1B1GA 1KQMB 2BE6A 2KI4C 1W7IB 1TNPA 1KCYA 1ZMZA 2M1KB 1DGVA 2JRFA 2JULA 4MBEA 2EC6C 1QS7A 2KHNA 2Q91A 2PMYA 1CLBA 2MRDA 1WRLA 1A03A 1QIVA 3RM1A 2KQ6A 2JTZA 1CM4A 2R2IA 2LUXA 3BOWB 5KU1A 1NX0A 5AXIA 2PRUA 1J7QA 1IWQA 1ZOTB 1NCZA 1J7RA 4CFQA 1KQMC 3NSOA 1OSAA 2CXJA 4ETOA 1SR6C 4U8DA 2NLNA 3OX6A 1EH2A 1B8LA 2H2KA 1B8RA 4HREE 1PRWA 1KFUS 3CTNA 2KAXA 5CSFA 1BLQA 4ZCVA 1CLLA 4PHJA 5HKZA 3EK4A 3SG7A 2EHBA 1YRUB 1DJIA 1UUSA 1SCMC 2O5GA 4PDZA 2KFFA 2F2PA 3SG6A 1OQPA 2KAVA 3LL8B 1IQ5A 1UHHA 4MLWA 2WOSA 1OZSA 2WCBA 1L2OB 3SG4A 5I2OA 2KFGA 1YR5A 2Y1NA 1IKUA 1CNPA 2K61A 4M2OA 2IS9A 2L50A 1J7OA 2NZ0A 1YTZC 2L0PA 1N65A 1W7JB 2LHIA 1RROA 4GBAA 1Y6WA 2KYFA 3LCPC 4WQ3A 1WY9A 2L2EA 1YUTA 1CLMA 1YUSA 2K0JA 2LCPA 3MSEB 1L2OC 1DMOA 3CR5X 1PVAA 1NIWA 1WLMA 3SJSA 2V53A 2PALA 1A2XA 4USLA 3PN7B 2K2AA 4C0KA 1GQMA 4FTGA 2HF5A 4NDCA 1J55A 5CSNA 3NSIA 1SYMA 1XYDA 2WORA 1J1EA 2JXLA 1MF8B 4C0JA 4M2PA 5IBWA 1CKKA 1EL4A 1EG3A 2I2RE 2K2FA 2PSRA 2FOTA 3NXAA 1N0YA 4JPZB 1AJ5A 1Y1UA 1TNWA 2JQ6A 2KNEA 3BUXB 1JC2A 3JTDB 4HSZA 3VRRA 1CMFA 3VROA 3D0YA 1TN4A 2JU0A 4P5OE 3O2PA 2M8UA 2LHLA 4YI9A 1SK6D 4YRUA 4HRHA 1XO5A 1X02A 1EXRA 1U5IB 5ER4X 1QVIZ 1YX7A 3DF0B 1LINA 3C1VA 1MHOA 4JQ0D 1RK9A 2KBMA 1XFXO 1PSBA 2OPOA 5CSIA 2WC8A 4CLNA 3JTDC 1IGVA 1F8HA 4MZKA 3LLEA 5G08A 5AANA 4CFRA 1KK7Z 2OS8B 1HQVA 1CDLA 1DJHA 4AQJA 1BMOA 1BF5A 2L98A 4YGAA 4GNKB 4GUKA 1WDCC 1NUBA 1J7PA 3AAJA 1S6JA 1QLSA 5AERA 2CCMA 3WHUB 1CFFA 4GGNA 2PVBA 2BL0C 1F55A 1ZACA 2CTNA 2GGZA 2KI4B 1NCXA 1UWOA 2OS8C 2NCOA 1CMGA 2KGBC 2HPSA 2LMTA 5HYDA 2JOJA 3LK0A 3HX4A 4I5NB 1QX7A 4PE0A 1CDNA 5HKYA 1AP4A 1BJFA 4XJKA 2WNDA 4ORCB 1DJYA 3GK4X 2K7CA 3E3RA 4HRGA 1K96A 2ZN9A 4YBHB 3CR2A 5HLVA 2PASA 3CS1A 4I5KA 3OX5A 2M49B 2LVIA 3FWCA 1SR6B 2BKIB 1K8UA 2Y1MA 3SG5A 3ZNIA 5I2LA 1G4YR 1D1OA 1F4OA 2G9BA 3A4UB 1SW8A 1XK4A 2ZKMX 1R2UA 3NSKA 1AUIB 1MUXA 1KK8B 3BOWA 1SL7A 1LKJA 1V1FA 1SCMB 2KDHA 4GFTA 2FCDA 1JSAA 1BR1B 1S26D 1GGWA 2L4HA 2K7OA 4A4BA 1BT6A 2KBIA 1B7TY 1FBVA 4MVFA 2M7NA 1FF1A 1BU3A 2BCBA 1DF0B 2LANA 3OHMB 1KK8C 2AUCA 2LLUA 4DS7A 1LA3A 2M97A 3DVJA 5D7FA 1QJTA 3OP0A 2I7AA 2LNKA 5TNCA 2AMIA 1J1DA 4N1FA 1XFWO 2RGIA 1YX8A 2L51A 1JWDA 4OCIA 1B4CA 2CBLA 4ORBB 4I5LB 1K95A 4YGCB 2MJWB 2G2BA 1AHRA 1KFXS 2SASA 5DKQA 1KQVA 1UHIA 1LA0A 3KHEA 3BUMB 1HT9A 4YI8A 2E30A 1IJ6A 3PSRA 1ZUZA 1XFVO 3EK7A 3ZWHA 2HETA 3KO0A 1M39A 4PE4A 2BCAA 1TNQA 1YUUA 2ZRTA 5FYXA 2H61C 1OMVA 2ZNDA 3CWGA 3FIAA 1NX1A 3DD4A 2LMVA 3AKAA 3GK1A 1WRZA 1B47A 4E68A 2KI6D 1K9PA 2TN4A 1S6CA 3IQQA 1SNLA 1JFKA 1SKTA 2HQ8A 4MRXA 4OVNF 3EKJA 5HLOA 4GPLB 5K89A 4PE1A 2L5XB 2M3WA 1K9KA 3CR4X 3TDUA 4Q04A 4PHMA 2JXCA 1BOCA 2KI6C 5HKWA 1UHKA 1Y1AA 4PALA 1M31A 2KSPA 1BG1A 1SRAA 2CNPA 1QV0A 1NX3A 3BUNB 2I94A 1C7WA 5DKRA 3VRQA 1WDCB 2MA2A 3GOFA 3QRXA 3AAKA 1NPQA 5GQQC 1RWYA 1YURA 2K8MB 3NSLA 4OKHA 1U5IA 1XFUO 1B7TZ 1ALWA 3F45A 1MXEA 3DF0A 3SG3A 5JJGA 4GGFA 1QXPA 2BL0B 1E8AA 1H8BA 3CZTX 1TNXA 2JNFA 2KYCA 2JZIA 1EJ3A 3VRNA 1S1EA 2M1UA 1XFYO 2ISDA 2COLB 3GK2A 1DJGA 2HQWA 4N5XA 1PSRA 4N1GA 5KTYA 1NX2A 1FW4A 1XVJA 4L9MA 1KFUL 1QX2A 3I5IB 2JTTA 1XFZO 4MZLA 2ZFDA 3IQOA 3SIBA 1DT7B 3EK8A 3WHTB 3EVRA 2LC5A 2KAYA 1Y0VH 1JF0A 5BPJA 2KQYA 1SL8A 1QASA 3M0WA 2FCEA 1AVSA 2LVJA 4M2QA 2M7LA 2ZNEA 1AK8A 3I5IC 2ZRSA 1A75B 2LLSA 2LUCA 2JPTA 3OB2B 1G8IA 1A75A 1SMGA 1UHNA 4OV2A 4R1EA 4DRWA 4UPGA 1IJ5A 3VRPA 1TCOB 1KFXL 1KSOA 2GGMA 3O4YA 1S6IA 2BBNA 3PM8A 5J3XA 1SL9A 1C07A 2MLEC 3BQ3A 1RFJA 2LV7A 2JC2A 1CDPA 5D69A 1IRJA 2KFHA 1L7ZA 1CFDA 1KWOB 4P2YB 4YGDB 2LVKA 2LVVA 3BUOB 5CSJA 1WRKA 2OTGB 3KEVA 1F71A 2BECA 2F8PA 2MBXA 2WCFA 3EVUA 4YGBB 1G33A 2K7DA 3I5FB 1FI6A 3O78A 4BY4A 4F0ZB 1CDMA 1EG4A 1JF2A 1KWOC 2F3YA 1DF0A 4PHNA 3PATA 3KPXA 1QATA 1K93D 1S5GY 1OMRA 1LXFC 1N2DA 4DIRA 1K9UA 2OTGC 2P6BB 1F54A 3TZ1A 2B1UA 1IG5A 2JWWA 3TS5B 1UURA 3TDIA 1QVIY 3I5FC 3WXAA 1NYAA 1XK4C 4ORAB 5PALA 2K7BA 2KOTA 3DVKA 3JVTB 1IQ3A 2AAOA 1TTXA 3WNXB 1OOJA 1DJZA 1JUOA 3EVVA 2KGRA 1PULA 1FPWA 5ER5A 3RLZA 3A8RA 3VGOA 2Y4QA 1JFJA 1MXLC 3FS7A 1KK7Y 2M29A
chains in the Genus database with same CATH superfamily
2H61A 2F3ZA 1ODBA 1RECA 3AKBA 1S36A 2JT0A 4BY5A 3DVEA 4OR9B 4I5JA 2JT3A 2L4IA 4WRIA 4MEWA 3TS5C 1NCYA 4D1EA 1K90D 1QIWA 1SY9A 3Q8IA 2BBMA 1SBJA 3ICBA 2MLFC 2M9GA 2F33A 3JVTC 1TIZA 4JWQA 3I5HB 4A4CA 2F2OA 1JBAA 1M46A 3DZTA 2D8NA 1AJ4A 2CT9A 4FQOA 3SIAA 3OB1B 1UHJA 3TDZA 4MRYA 1BODA 3BFHA 1SPYA 4MSPA 1S3PA 3PLFB 4AOMA 2QACA 1DTLA 5AFPA 1GJYA 2LMUA 1F4QA 1QTXA 1CTRA 3K21A 3SG2A 2SCPA 3I5HC 4IL1A 1YVHA 1FI5A 4QJ4B 1DEKA 1UP5A 2L5YA 3CLNA 1RJVA 5F6TA 1R6PA 1CFPA 3OGNA 1OE9B 4PE7A 5I2QA 2ERBA 1VRKA 4JKTA 1MQ1A 3D10A 1DVIA 2QPTA 2GV5A 1C7VA 2EGDA 2MAZA 2LP3A 1DGUA 1A4PA 2FJUB 2JPOA 4YGEB 5B8IB 5I8NA 4PHKA 1TRFA 3QMEA 1B8CA 3CZ2A 1ZFSA 1B9AA 5DICA 4CPVA 1YRTB 4GAOA 1H4BA 2DOQA 1M63B 1WLZA 1CFCA 3FE6A 2LM5A 1QX5B 1SCVA 1OOFA 2H8VA 4NQGA 3FE8A 2WCEA 1BR4B 3D0YB 3FWBA 3PN7C 1RTP1 2LAPA 1S5GZ 3BYAA 1CM1A 3KF9A 2Q4UA 1LVCD 1NP8A 2MHHA 1QLKA 2E6WA 3B87A 3IVTA 5KSZA 5CPVA 3I5GB 3VB1A 1K2HA 1KSMA 3B88A 2JNXA 2VRGA 1V1GA 4ICBA 4QJ5B 3PFVA 2I18A 2BKHB 1K94A 4MZJA 1TOPA 4AQIA 1C3ZA 1A29A 1NWDA 2QEHA 1XA5A 4NDBA 3O6BA 3LK1A 2ZN8A 1YVLA 4WQ2A 4DCKA 4C0LA 4DUQA 2JT8A 3I5GC 1PALA 3BXKA 1CB1A 2A4JA 3RZSA 3R1PA 4GGFC 3EKHA 3BFAA 3TUYB 1IH0A 1MR8A 5EL2A 4XYNA 4NDDA 1QV1A 4MN0A 2BE4A 2BCXA 1PVBA 1M45A 3IF7A 3BUWB 1OZOA 1DJXA 1OW4A 3PALA 4PCWA 2QEBA 1ALVA 3HCMA 4TNCA 3CGAA 5DKNA 3H4SE 1DC1A 2NCPA 1F70A 5AEQA 2NXQA 2M0RA 4XJKB 1GGZA 1PK0D 2EC6B 3DVMA 5JOLA 2LE9B 4CIDA 2Y5IA 1MWNA 1OOHA 1Y1XA 3K1EA 4ZCUA 1NSHA 2K60A 2LLTA 2LP2A 2O60A 3TUYC 1OMDA 1Q80A 4QJ3B 1TCFA 1DJWA 1B1GA 1KQMB 2BE6A 4FQTA 2KI4C 1W7IB 1TNPA 1KCYA 3S0AA 1ZMZA 2M1KB 1DGVA 2JRFA 2JULA 4MBEA 3UNWA 1IIOA 2EC6C 1QS7A 2KHNA 2Q91A 2PMYA 4JD9A 1CLBA 2MRDA 1WRLA 2KLDA 1A03A 1QIVA 3RM1A 2KQ6A 2JTZA 1CM4A 2R2IA 2LUXA 3BOWB 5KU1A 1W9ZA 1NX0A 5AXIA 2PRUA 1J7QA 1IWQA 1ZOTB 1NCZA 1J7RA 4CFQA 1KQMC 3NSOA 2WCKA 1OSAA 3CZ0A 2CXJA 4ETOA 1OOIX 3D74A 1SR6C 4U8DA 3S0BA 1Z4HA 2NLNA 3OX6A 1EH2A 1B8LA 2H2KA 1B8RA 4HREE 1PRWA 1KFUS 3CTNA 2KAXA 5CSFA 1BLQA 4ZCVA 1CLLA 5D3OA 4PHJA 5HKZA 3DYEA 3EK4A 3SG7A 3SS5A 2EHBA 1YRUB 1DJIA 1TUZA 1UUSA 1SCMC 2O5GA 4PDZA 1Z2CB 2KFFA 2F2PA 3SG6A 2L2CA 1OQPA 2KAVA 3LL8B 1IQ5A 1UHHA 4MLWA 2WOSA 1OZSA 2WCBA 1L2OB 3SG4A 5I2OA 2KFGA 1SSEB 1YR5A 2Y1NA 1IKUA 1CNPA 2K61A 3CYZA 2IS9A 2L50A 4M2OA 1J7OA 2NZ0A 1YTZC 2L0PA 1N65A 1W7JB 2LHIA 4INXA 1LS8A 3B7AA 1RROA 4GBAA 1Y6WA 2KYFA 3LCPC 4WQ3A 1WY9A 2L2EA 1YUTA 1CLMA 1YUSA 2K0JA 2LCPA 3MSEB 2PYQA 2WCJA 1L2OC 5HL1A 1DMOA 3CR5X 1PVAA 1NIWA 1WLMA 3SJSA 2V53A 2PALA 1A2XA 4INWA 4USLA 1ORGA 2K2AA 3PN7B 4C0KA 1GQMA 4FTGA 2HF5A 2WC5A 1J55A 4NDCA 5CSNA 3D75A 3NSIA 2PQLA 1SYMA 1XYDA 2WORA 1J1EA 2JXLA 1MF8B 4C0JA 4M2PA 5IBWA 1CKKA 1GM0A 1EL4A 1EG3A 2I2RE 2K2FA 2PSRA 2FOTA 3B86A 3NXAA 1N0YA 4JPZB 1AJ5A 1Y1UA 1TNWA 1XFRA 2JQ6A 2KNEA 3BUXB 1JC2A 3UO9A 2WCLA 3JTDB 4HSZA 3VRRA 1CMFA 3VROA 3D0YA 1TN4A 2JU0A 4P5OE 3O2PA 3R1OA 1TWOA 2LHLA 2M8UA 1SK6D 4YI9A 4YRUA 4HRHA 1XO5A 1X02A 3V2LA 1EXRA 3CZ1A 1U5IB 5ER4X 1QVIZ 1YX7A 3L4AA 3DF0B 1LINA 3C1VA 1MHOA 4JQ0D 1RK9A 2KBMA 1XFXO 1PSBA 2OPOA 5CSIA 2WC8A 4CLNA 3JTDC 1IGVA 4KYNA 3NGVA 3DXLA 1F8HA 4MZKA 3LLEA 5G08A 5AANA 4CFRA 1DQEA 1KK7Z 1CDLA 1DJHA 1HQVA 2OS8B 1BMOA 4AQJA 1BF5A 2L98A 4YGAA 4GNKB 3OBVA 4GUKA 1WDCC 1NUBA 1J7PA 3AAJA 1S6JA 1QLSA 1TUJA 3CABA 4IJ7A 2CCMA 2QEOA 3WHUB 5AERA 1CFFA 4GGNA 2PVBA 2BL0C 1F55A 1ZACA 2CTNA 2GGZA 2KI4B 1NCXA 1UWOA 2OS8C 2NCOA 3D73A 1CMGA 2KGBC 2HPSA 2LMTA 5HYDA 2JOJA 3LK0A 3HX4A 4I5NB 1QX7A 4PE0A 1CDNA 5HKYA 1AP4A 1BJFA 4XJKA 2WNDA 4ORCB 1DJYA 4OZDA 3GK4X 2K7CA 3E3RA 4HRGA 1K96A 2ZN9A 4YBHB 3CR2A 5HLVA 2PASA 3CS1A 4I5KA 3OX5A 1OOGA 2M49B 2LVIA 2WCHA 3FWCA 1SR6B 2BKIB 1K8UA 2Y1MA 3SG5A 2WC6A 3ZNIA 5I2LA 2QDIA 1G4YR 1D1OA 1F4OA 2G9BA 3A4UB 1SW8A 1XK4A 2ZKMX 1R2UA 3NSKA 1AUIB 1MUXA 1KK8B 3BFBA 3BOWA 1SL7A 1LKJA 1V1FA 1SCMB 2KDHA 4GFTA 3EG5B 2FCDA 1JSAA 1BR1B 1S26D 5FI2A 2L4HA 1GGWA 2K7OA 4A4BA 1BT6A 2KBIA 1B7TY 1FBVA 4MVFA 2M7NA 1FF1A 1BU3A 2BCBA 1DF0B 2LANA 3OHMB 1QWVA 1KK8C 2AUCA 3L47A 2LLUA 1C3YA 4DS7A 1LA3A 2M97A 3DVJA 5D7FA 1QJTA 3OP0A 2I7AA 2LNKA 5TNCA 2AMIA 1J1DA 4N1FA 1XFWO 2RGIA 1YX8A 2L51A 2WCMA 1JWDA 4OCIA 1B4CA 2CBLA 4ORBB 5FI7A 4I5LB 1K95A 4YGCB 2MJWB 2G2BA 1AHRA 1KFXS 2SASA 5DKQA 1KQVA 1UHIA 1LA0A 3KHEA 3S0GA 3BUMB 1HT9A 4YI8A 2E30A 1IJ6A 3PSRA 3FE9A 5I94A 1ZUZA 1XFVO 3EK7A 3ZWHA 2HETA 4PT1A 3SS3A 3KO0A 1M39A 4PE4A 2BCAA 1TNQA 1YUUA 2ZRTA 5FYXA 3D76A 2YGUA 2H61C 1OMVA 3PM2A 2ZNDA 3CWGA 3FIAA 3L4LA 1NX1A 3DD4A 2LMVA 3AKAA 3GK1A 1WRZA 1B47A 4E68A 3D78A 2KI6D 1K9PA 2TN4A 1S6CA 3IQQA 1SNLA 1JFKA 1SKTA 2HQ8A 3PJIA 4MRXA 3EKJA 2BNXA 4OVNF 5HLOA 2KLEA 4GPLB 3S0EA 5K89A 4PE1A 2L5XB 1DELA 2M3WA 1K9KA 3CR4X 3TDUA 4Q04A 4PHMA 2JXCA 1BOCA 2KI6C 3R72A 5HKWA 1UHKA 1Y1AA 4F7FA 4PALA 1M31A 2KSPA 1BG1A 1SRAA 2CNPA 1QV0A 1NX3A 3BUNB 2I94A 1C7WA 5DKRA 3VRQA 1WDCB 2MA2A 3GOFA 3QRXA 3AAKA 1NPQA 5GQQC 1RWYA 1YURA 2K8MB 3NSLA 4OKHA 1U5IA 1XFUO 1B7TZ 1ALWA 2BAPA 3F45A 1MXEA 3DF0A 3SG3A 5JJGA 4GGFA 1QXPA 2BL0B 1E8AA 3NHIA 3CZTX 1H8BA 1TNXA 2JNFA 2KYCA 2JZIA 1EJ3A 3VRNA 3R1VA 1S1EA 2M1UA 1XFYO 2ISDA 2COLB 3GK2A 1DJGA 2HQWA 3SS4A 4N5XA 1PSRA 4N1GA 5KTYA 1NX2A 1FW4A 1XVJA 4L9MA 1KFUL 1QX2A 3I5IB 2JTTA 1XFZO 4MZLA 2ZFDA 3IQOA 3SIBA 1DT7B 3N7HA 3EK8A 3WHTB 3EVRA 2LC5A 1T14A 2KAYA 1Y0VH 1JF0A 5BPJA 2KQYA 1SL8A 2P71A 1QASA 3M0WA 2FCEA 1AVSA 2LVJA 4M2QA 2M7LA 2ZNEA 1AK8A 3I5IC 2ZRSA 1A75B 2LLSA 2LUCA 2JPTA 3OB2B 1G8IA 2GTEA 1A75A 1SMGA 1UHNA 4OV2A 4R1EA 4DRWA 4UPGA 1IJ5A 3VRPA 1TCOB 1KFXL 1KSOA 2GGMA 3O4YA 1S6IA 2BBNA 3PM8A 5J3XA 1SL9A 1C07A 2MLEC 3BJHA 3BQ3A 1RFJA 3B6XA 2LV7A 2JC2A 1CDPA 5D69A 1IRJA 2KFHA 3DY9A 1L7ZA 1CFDA 1KWOB 4P2YB 3NHTA 4YGDB 2LVKA 2LVVA 3BUOB 5CSJA 1WRKA 2OTGB 3KEVA 1F71A 2BECA 2F8PA 2MBXA 2WCFA 3EVUA 4YGBB 1G33A 2K7DA 3I5FB 1FI6A 3O78A 3S0FA 4BY4A 4F0ZB 2P70A 2QEVA 5FI6A 1CDMA 1EG4A 1JF2A 1KWOC 2F3YA 1P28A 1DF0A 2KPHA 4PHNA 3CDNA 3PATA 3KPXA 1QATA 1K93D 1S5GY 1OMRA 1LXFC 1N2DA 4DIRA 1K9UA 2OTGC 2P6BB 1F54A 3TZ1A 2B1UA 1IG5A 3S0DA 2FJYA 2JWWA 3TS5B 1UURA 3TDIA 1QVIY 3I5FC 3WXAA 1NYAA 1XK4C 3D77A 3O4XA 4ORAB 5PALA 2K7BA 2KOTA 3DVKA 3JVTB 1IQ3A 2AAOA 1TTXA 3WNXB 1OOJA 1DJZA 1JUOA 3EVVA 2KGRA 1PULA 1FPWA 5ER5A 3RLZA 3A8RA 3VGOA 2Y4QA 1JFJA 1MXLC 3FS7A 1KK7Y 2M29A
chains in the Genus database with same CATH topology
2H61A 2F3ZA 1ODBA 1RECA 3AKBA 1S36A 2JT0A 4BY5A 3DVEA 4OR9B 4I5JA 2JT3A 2L4IA 4WRIA 4MEWA 3TS5C 1NCYA 4D1EA 1K90D 1QIWA 1SY9A 2BBMA 1SBJA 3ICBA 2MLFC 2M9GA 2F33A 3JVTC 1TIZA 4JWQA 3I5HB 4A4CA 2F2OA 1JBAA 1M46A 2D8NA 1AJ4A 2CT9A 4FQOA 3SIAA 3OB1B 1UHJA 3TDZA 4MRYA 1BODA 1SPYA 4MSPA 1S3PA 3PLFB 4AOMA 2QACA 1DTLA 5AFPA 1GJYA 2LMUA 1F4QA 1QTXA 1CTRA 3K21A 3SG2A 2SCPA 3I5HC 4IL1A 1YVHA 1FI5A 4QJ4B 1UP5A 3CLNA 1RJVA 5F6TA 1R6PA 1CFPA 1OE9B 4PE7A 5I2QA 1VRKA 1MQ1A 3D10A 1DVIA 2QPTA 2GV5A 1C7VA 2EGDA 2MAZA 2LP3A 1DGUA 1A4PA 2FJUB 4YGEB 5B8IB 5I8NA 4PHKA 1TRFA 1B8CA 1ZFSA 1B9AA 4CPVA 1YRTB 4GAOA 1H4BA 2DOQA 1M63B 1WLZA 1CFCA 2LM5A 1QX5B 1SCVA 4NQGA 2WCEA 1BR4B 3D0YB 3FWBA 3PN7C 1RTP1 2LAPA 1S5GZ 3BYAA 1CM1A 3KF9A 2Q4UA 1LVCD 1NP8A 2MHHA 1QLKA 2E6WA 5KSZA 5CPVA 3I5GB 1K2HA 1KSMA 2JNXA 2VRGA 1V1GA 4ICBA 4QJ5B 3PFVA 2I18A 2BKHB 1K94A 4MZJA 1TOPA 4AQIA 1A29A 1NWDA 1XA5A 4NDBA 3O6BA 3LK1A 2ZN8A 1YVLA 4WQ2A 4DCKA 4C0LA 4DUQA 2JT8A 3I5GC 1PALA 3BXKA 1CB1A 2A4JA 4GGFC 3EKHA 3TUYB 1IH0A 1MR8A 4XYNA 4NDDA 1QV1A 4MN0A 2BE4A 2BCXA 1M45A 1PVBA 3IF7A 3BUWB 1OZOA 1DJXA 3PALA 4PCWA 1ALVA 3HCMA 4TNCA 3CGAA 5DKNA 3H4SE 2NCPA 1F70A 5AEQA 2NXQA 2M0RA 4XJKB 1GGZA 1PK0D 2EC6B 3DVMA 5JOLA 2LE9B 4CIDA 2Y5IA 1MWNA 1Y1XA 4ZCUA 1NSHA 2LLTA 2LP2A 2O60A 3TUYC 1OMDA 1Q80A 4QJ3B 1TCFA 1DJWA 1B1GA 1KQMB 2BE6A 2KI4C 1W7IB 1TNPA 1KCYA 1ZMZA 2M1KB 1DGVA 2JRFA 2JULA 4MBEA 2EC6C 1QS7A 2KHNA 2Q91A 2PMYA 1CLBA 2MRDA 1WRLA 1A03A 1QIVA 3RM1A 2KQ6A 2JTZA 1CM4A 2R2IA 2LUXA 3BOWB 5KU1A 1NX0A 5AXIA 2PRUA 1J7QA 1IWQA 1ZOTB 1NCZA 1J7RA 4CFQA 1KQMC 3NSOA 1OSAA 2CXJA 4ETOA 1SR6C 4U8DA 2NLNA 3OX6A 1EH2A 1B8LA 2H2KA 1B8RA 4HREE 1PRWA 1KFUS 3CTNA 2KAXA 5CSFA 1BLQA 4ZCVA 1CLLA 4PHJA 5HKZA 3EK4A 3SG7A 2EHBA 1YRUB 1DJIA 1UUSA 1SCMC 2O5GA 4PDZA 2KFFA 2F2PA 3SG6A 1OQPA 2KAVA 3LL8B 1IQ5A 1UHHA 4MLWA 2WOSA 1OZSA 2WCBA 1L2OB 3SG4A 5I2OA 2KFGA 1YR5A 2Y1NA 1IKUA 1CNPA 2K61A 4M2OA 2IS9A 2L50A 1J7OA 2NZ0A 1YTZC 2L0PA 1N65A 1W7JB 2LHIA 1RROA 4GBAA 1Y6WA 2KYFA 3LCPC 4WQ3A 1WY9A 2L2EA 1YUTA 1CLMA 1YUSA 2K0JA 2LCPA 3MSEB 1L2OC 1DMOA 3CR5X 1PVAA 1NIWA 1WLMA 3SJSA 2V53A 2PALA 1A2XA 4USLA 3PN7B 2K2AA 4C0KA 1GQMA 4FTGA 2HF5A 4NDCA 1J55A 5CSNA 3NSIA 1SYMA 1XYDA 2WORA 1J1EA 2JXLA 1MF8B 4C0JA 4M2PA 5IBWA 1CKKA 1EL4A 1EG3A 2I2RE 2K2FA 2PSRA 2FOTA 3NXAA 1N0YA 4JPZB 1AJ5A 1Y1UA 1TNWA 2JQ6A 2KNEA 3BUXB 1JC2A 3JTDB 4HSZA 3VRRA 1CMFA 3VROA 3D0YA 1TN4A 2JU0A 4P5OE 3O2PA 2M8UA 2LHLA 4YI9A 1SK6D 4YRUA 4HRHA 1XO5A 1X02A 1EXRA 1U5IB 5ER4X 1QVIZ 1YX7A 3DF0B 1LINA 3C1VA 1MHOA 4JQ0D 1RK9A 2KBMA 1XFXO 1PSBA 2OPOA 5CSIA 2WC8A 4CLNA 3JTDC 1IGVA 1F8HA 4MZKA 3LLEA 5G08A 5AANA 4CFRA 1KK7Z 2OS8B 1HQVA 1CDLA 1DJHA 4AQJA 1BMOA 1BF5A 2L98A 4YGAA 4GNKB 4GUKA 1WDCC 1NUBA 1J7PA 3AAJA 1S6JA 1QLSA 5AERA 2CCMA 3WHUB 1CFFA 4GGNA 2PVBA 2BL0C 1F55A 1ZACA 2CTNA 2GGZA 2KI4B 1NCXA 1UWOA 2OS8C 2NCOA 1CMGA 2KGBC 2HPSA 2LMTA 5HYDA 2JOJA 3LK0A 3HX4A 4I5NB 1QX7A 4PE0A 1CDNA 5HKYA 1AP4A 1BJFA 4XJKA 2WNDA 4ORCB 1DJYA 3GK4X 2K7CA 3E3RA 4HRGA 1K96A 2ZN9A 4YBHB 3CR2A 5HLVA 2PASA 3CS1A 4I5KA 3OX5A 2M49B 2LVIA 3FWCA 1SR6B 2BKIB 1K8UA 2Y1MA 3SG5A 3ZNIA 5I2LA 1G4YR 1D1OA 1F4OA 2G9BA 3A4UB 1SW8A 1XK4A 2ZKMX 1R2UA 3NSKA 1AUIB 1MUXA 1KK8B 3BOWA 1SL7A 1LKJA 1V1FA 1SCMB 2KDHA 4GFTA 2FCDA 1JSAA 1BR1B 1S26D 1GGWA 2L4HA 2K7OA 4A4BA 1BT6A 2KBIA 1B7TY 1FBVA 4MVFA 2M7NA 1FF1A 1BU3A 2BCBA 1DF0B 2LANA 3OHMB 1KK8C 2AUCA 2LLUA 4DS7A 1LA3A 2M97A 3DVJA 5D7FA 1QJTA 3OP0A 2I7AA 2LNKA 5TNCA 2AMIA 1J1DA 4N1FA 1XFWO 2RGIA 1YX8A 2L51A 1JWDA 4OCIA 1B4CA 2CBLA 4ORBB 4I5LB 1K95A 4YGCB 2MJWB 2G2BA 1AHRA 1KFXS 2SASA 5DKQA 1KQVA 1UHIA 1LA0A 3KHEA 3BUMB 1HT9A 4YI8A 2E30A 1IJ6A 3PSRA 1ZUZA 1XFVO 3EK7A 3ZWHA 2HETA 3KO0A 1M39A 4PE4A 2BCAA 1TNQA 1YUUA 2ZRTA 5FYXA 2H61C 1OMVA 2ZNDA 3CWGA 3FIAA 1NX1A 3DD4A 2LMVA 3AKAA 3GK1A 1WRZA 1B47A 4E68A 2KI6D 1K9PA 2TN4A 1S6CA 3IQQA 1SNLA 1JFKA 1SKTA 2HQ8A 4MRXA 4OVNF 3EKJA 5HLOA 4GPLB 5K89A 4PE1A 2L5XB 2M3WA 1K9KA 3CR4X 3TDUA 4Q04A 4PHMA 2JXCA 1BOCA 2KI6C 5HKWA 1UHKA 1Y1AA 4PALA 1M31A 2KSPA 1BG1A 1SRAA 2CNPA 1QV0A 1NX3A 3BUNB 2I94A 1C7WA 5DKRA 3VRQA 1WDCB 2MA2A 3GOFA 3QRXA 3AAKA 1NPQA 5GQQC 1RWYA 1YURA 2K8MB 3NSLA 4OKHA 1U5IA 1XFUO 1B7TZ 1ALWA 3F45A 1MXEA 3DF0A 3SG3A 5JJGA 4GGFA 1QXPA 2BL0B 1E8AA 1H8BA 3CZTX 1TNXA 2JNFA 2KYCA 2JZIA 1EJ3A 3VRNA 1S1EA 2M1UA 1XFYO 2ISDA 2COLB 3GK2A 1DJGA 2HQWA 4N5XA 1PSRA 4N1GA 5KTYA 1NX2A 1FW4A 1XVJA 4L9MA 1KFUL 1QX2A 3I5IB 2JTTA 1XFZO 4MZLA 2ZFDA 3IQOA 3SIBA 1DT7B 3EK8A 3WHTB 3EVRA 2LC5A 2KAYA 1Y0VH 1JF0A 5BPJA 2KQYA 1SL8A 1QASA 3M0WA 2FCEA 1AVSA 2LVJA 4M2QA 2M7LA 2ZNEA 1AK8A 3I5IC 2ZRSA 1A75B 2LLSA 2LUCA 2JPTA 3OB2B 1G8IA 1A75A 1SMGA 1UHNA 4OV2A 4R1EA 4DRWA 4UPGA 1IJ5A 3VRPA 1TCOB 1KFXL 1KSOA 2GGMA 3O4YA 1S6IA 2BBNA 3PM8A 5J3XA 1SL9A 1C07A 2MLEC 3BQ3A 1RFJA 2LV7A 2JC2A 1CDPA 5D69A 1IRJA 2KFHA 1L7ZA 1CFDA 1KWOB 4P2YB 4YGDB 2LVKA 2LVVA 3BUOB 5CSJA 1WRKA 2OTGB 3KEVA 1F71A 2BECA 2F8PA 2MBXA 2WCFA 3EVUA 4YGBB 1G33A 2K7DA 3I5FB 1FI6A 3O78A 4BY4A 4F0ZB 1CDMA 1EG4A 1JF2A 1KWOC 2F3YA 1DF0A 4PHNA 3PATA 3KPXA 1QATA 1K93D 1S5GY 1OMRA 1LXFC 1N2DA 4DIRA 1K9UA 2OTGC 2P6BB 1F54A 3TZ1A 2B1UA 1IG5A 2JWWA 3TS5B 1UURA 3TDIA 1QVIY 3I5FC 3WXAA 1NYAA 1XK4C 4ORAB 5PALA 2K7BA 2KOTA 3DVKA 3JVTB 1IQ3A 2AAOA 1TTXA 3WNXB 1OOJA 1DJZA 1JUOA 3EVVA 2KGRA 1PULA 1FPWA 5ER5A 3RLZA 3A8RA 3VGOA 2Y4QA 1JFJA 1MXLC 3FS7A 1KK7Y 2M29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H61 A;  2F3Z A;  1ODB A;  1REC A;  3AKB A;  1S36 A;  2JT0 A;  4BY5 A;  3DVE A;  4OR9 B;  4I5J A;  2JT3 A;  2L4I A;  4WRI A;  4MEW A;  3TS5 C;  1NCY A;  4D1E A;  1K90 D;  1QIW A;  1SY9 A;  2BBM A;  1SBJ A;  3ICB A;  2MLF C;  2M9G A;  2F33 A;  3JVT C;  1TIZ A;  4JWQ A;  3I5H B;  4A4C A;  2F2O A;  1JBA A;  1M46 A;  2D8N A;  1AJ4 A;  2CT9 A;  4FQO A;  3SIA A;  3OB1 B;  1UHJ A;  3TDZ A;  4MRY A;  1BOD A;  1SPY A;  4MSP A;  1S3P A;  3PLF B;  4AOM A;  2QAC A;  1DTL A;  5AFP A;  1GJY A;  2LMU A;  1F4Q A;  1QTX A;  1CTR A;  3K21 A;  3SG2 A;  2SCP A;  3I5H C;  4IL1 A;  1YVH A;  1FI5 A;  4QJ4 B;  1UP5 A;  3CLN A;  1RJV A;  5F6T A;  1R6P A;  1CFP A;  1OE9 B;  4PE7 A;  5I2Q A;  1VRK A;  1MQ1 A;  3D10 A;  1DVI A;  2QPT A;  2GV5 A;  1C7V A;  2EGD A;  2MAZ A;  2LP3 A;  1DGU A;  1A4P A;  2FJU B;  4YGE B;  5B8I B;  5I8N A;  4PHK A;  1TRF A;  1B8C A;  1ZFS A;  1B9A A;  4CPV A;  1YRT B;  4GAO A;  1H4B A;  2DOQ A;  1M63 B;  1WLZ A;  1CFC A;  2LM5 A;  1QX5 B;  1SCV A;  4NQG A;  2WCE A;  1BR4 B;  3D0Y B;  3FWB A;  3PN7 C;  1RTP 1;  2LAP A;  1S5G Z;  3BYA A;  1CM1 A;  3KF9 A;  2Q4U A;  1LVC D;  1NP8 A;  2MHH A;  1QLK A;  2E6W A;  5KSZ A;  5CPV A;  3I5G B;  1K2H A;  1KSM A;  2JNX A;  2VRG A;  1V1G A;  4ICB A;  4QJ5 B;  3PFV A;  2I18 A;  2BKH B;  1K94 A;  4MZJ A;  1TOP A;  4AQI A;  1A29 A;  1NWD A;  1XA5 A;  4NDB A;  3O6B A;  3LK1 A;  2ZN8 A;  1YVL A;  4WQ2 A;  4DCK A;  4C0L A;  4DUQ A;  2JT8 A;  3I5G C;  1PAL A;  3BXK A;  1CB1 A;  2A4J A;  4GGF C;  3EKH A;  3TUY B;  1IH0 A;  1MR8 A;  4XYN A;  4NDD A;  1QV1 A;  4MN0 A;  2BE4 A;  2BCX A;  1M45 A;  1PVB A;  3IF7 A;  3BUW B;  1OZO A;  1DJX A;  3PAL A;  4PCW A;  1ALV A;  3HCM A;  4TNC A;  3CGA A;  5DKN A;  3H4S E;  2NCP A;  1F70 A;  5AEQ A;  2NXQ A;  2M0R A;  4XJK B;  1GGZ A;  1PK0 D;  2EC6 B;  3DVM A;  5JOL A;  2LE9 B;  4CID A;  2Y5I A;  1MWN A;  1Y1X A;  4ZCU A;  1NSH A;  2LLT A;  2LP2 A;  2O60 A;  3TUY C;  1OMD A;  1Q80 A;  4QJ3 B;  1TCF A;  1DJW A;  1B1G A;  1KQM B;  2BE6 A;  2KI4 C;  1W7I B;  1TNP A;  1KCY A;  1ZMZ A;  2M1K B;  1DGV A;  2JRF A;  2JUL A;  4MBE A;  2EC6 C;  1QS7 A;  2KHN A;  2Q91 A;  2PMY A;  1CLB A;  2MRD A;  1WRL A;  1A03 A;  1QIV A;  3RM1 A;  2KQ6 A;  2JTZ A;  1CM4 A;  2R2I A;  2LUX A;  3BOW B;  5KU1 A;  1NX0 A;  5AXI A;  2PRU A;  1J7Q A;  1IWQ A;  1ZOT B;  1NCZ A;  1J7R A;  4CFQ A;  1KQM C;  3NSO A;  1OSA A;  2CXJ A;  4ETO A;  1SR6 C;  4U8D A;  2NLN A;  3OX6 A;  1EH2 A;  1B8L A;  2H2K A;  1B8R A;  4HRE E;  1PRW A;  1KFU S;  3CTN A;  2KAX A;  5CSF A;  1BLQ A;  4ZCV A;  1CLL A;  4PHJ A;  5HKZ A;  3EK4 A;  3SG7 A;  2EHB A;  1YRU B;  1DJI A;  1UUS A;  1SCM C;  2O5G A;  4PDZ A;  2KFF A;  2F2P A;  3SG6 A;  1OQP A;  2KAV A;  3LL8 B;  1IQ5 A;  1UHH A;  4MLW A;  2WOS A;  1OZS A;  2WCB A;  1L2O B;  3SG4 A;  5I2O A;  2KFG A;  1YR5 A;  2Y1N A;  1IKU A;  1CNP A;  2K61 A;  4M2O A;  2IS9 A;  2L50 A;  1J7O A;  2NZ0 A;  1YTZ C;  2L0P A;  1N65 A;  1W7J B;  2LHI A;  1RRO A;  4GBA A;  1Y6W A;  2KYF A;  3LCP C;  4WQ3 A;  1WY9 A;  2L2E A;  1YUT A;  1CLM A;  1YUS A;  2K0J A;  2LCP A;  3MSE B;  1L2O C;  1DMO A;  3CR5 X;  1PVA A;  1NIW A;  1WLM A;  3SJS A;  2V53 A;  2PAL A;  1A2X A;  4USL A;  3PN7 B;  2K2A A;  4C0K A;  1GQM A;  4FTG A;  2HF5 A;  4NDC A;  1J55 A;  5CSN A;  3NSI A;  1SYM A;  1XYD A;  2WOR A;  1J1E A;  2JXL A;  1MF8 B;  4C0J A;  4M2P A;  5IBW A;  1CKK A;  1EL4 A;  1EG3 A;  2I2R E;  2K2F A;  2PSR A;  2FOT A;  3NXA A;  1N0Y A;  4JPZ B;  1AJ5 A;  1Y1U A;  1TNW A;  2JQ6 A;  2KNE A;  3BUX B;  1JC2 A;  3JTD B;  4HSZ A;  3VRR A;  1CMF A;  3VRO A;  3D0Y A;  1TN4 A;  2JU0 A;  4P5O E;  3O2P A;  2M8U A;  2LHL A;  4YI9 A;  1SK6 D;  4YRU A;  4HRH A;  1XO5 A;  1X02 A;  1EXR A;  1U5I B;  5ER4 X;  1QVI Z;  1YX7 A;  3DF0 B;  1LIN A;  3C1V A;  1MHO A;  4JQ0 D;  1RK9 A;  2KBM A;  1XFX O;  1PSB A;  2OPO A;  5CSI A;  2WC8 A;  4CLN A;  3JTD C;  1IGV A;  1F8H A;  4MZK A;  3LLE A;  5G08 A;  5AAN A;  4CFR A;  1KK7 Z;  2OS8 B;  1HQV A;  1CDL A;  1DJH A;  4AQJ A;  1BMO A;  1BF5 A;  2L98 A;  4YGA A;  4GNK B;  4GUK A;  1WDC C;  1NUB A;  1J7P A;  3AAJ A;  1S6J A;  1QLS A;  5AER A;  2CCM A;  3WHU B;  1CFF A;  4GGN A;  2PVB A;  2BL0 C;  1F55 A;  1ZAC A;  2CTN A;  2GGZ A;  2KI4 B;  1NCX A;  1UWO A;  2OS8 C;  2NCO A;  1CMG A;  2KGB C;  2HPS A;  2LMT A;  5HYD A;  2JOJ A;  3LK0 A;  3HX4 A;  4I5N B;  1QX7 A;  4PE0 A;  1CDN A;  5HKY A;  1AP4 A;  1BJF A;  4XJK A;  2WND A;  4ORC B;  1DJY A;  3GK4 X;  2K7C A;  3E3R A;  4HRG A;  1K96 A;  2ZN9 A;  4YBH B;  3CR2 A;  5HLV A;  2PAS A;  3CS1 A;  4I5K A;  3OX5 A;  2M49 B;  2LVI A;  3FWC A;  1SR6 B;  2BKI B;  1K8U A;  2Y1M A;  3SG5 A;  3ZNI A;  5I2L A;  1G4Y R;  1D1O A;  1F4O A;  2G9B A;  3A4U B;  1SW8 A;  1XK4 A;  2ZKM X;  1R2U A;  3NSK A;  1AUI B;  1MUX A;  1KK8 B;  3BOW A;  1SL7 A;  1LKJ A;  1V1F A;  1SCM B;  2KDH A;  4GFT A;  2FCD A;  1JSA A;  1BR1 B;  1S26 D;  1GGW A;  2L4H A;  2K7O A;  4A4B A;  1BT6 A;  2KBI A;  1B7T Y;  1FBV A;  4MVF A;  2M7N A;  1FF1 A;  1BU3 A;  2BCB A;  1DF0 B;  2LAN A;  3OHM B;  1KK8 C;  2AUC A;  2LLU A;  4DS7 A;  1LA3 A;  2M97 A;  3DVJ A;  5D7F A;  1QJT A;  3OP0 A;  2I7A A;  2LNK A;  5TNC A;  2AMI A;  1J1D A;  4N1F A;  1XFW O;  2RGI A;  1YX8 A;  2L51 A;  1JWD A;  4OCI A;  1B4C A;  2CBL A;  4ORB B;  4I5L B;  1K95 A;  4YGC B;  2MJW B;  2G2B A;  1AHR A;  1KFX S;  2SAS A;  5DKQ A;  1KQV A;  1UHI A;  1LA0 A;  3KHE A;  3BUM B;  1HT9 A;  4YI8 A;  2E30 A;  1IJ6 A;  3PSR A;  1ZUZ A;  1XFV O;  3EK7 A;  3ZWH A;  2HET A;  3KO0 A;  1M39 A;  4PE4 A;  2BCA A;  1TNQ A;  1YUU A;  2ZRT A;  5FYX A;  2H61 C;  1OMV A;  2ZND A;  3CWG A;  3FIA A;  1NX1 A;  3DD4 A;  2LMV A;  3AKA A;  3GK1 A;  1WRZ A;  1B47 A;  4E68 A;  2KI6 D;  1K9P A;  2TN4 A;  1S6C A;  3IQQ A;  1SNL A;  1JFK A;  1SKT A;  2HQ8 A;  4MRX A;  4OVN F;  3EKJ A;  5HLO A;  4GPL B;  5K89 A;  4PE1 A;  2L5X B;  2M3W A;  1K9K A;  3CR4 X;  3TDU A;  4Q04 A;  4PHM A;  2JXC A;  1BOC A;  2KI6 C;  5HKW A;  1UHK A;  1Y1A A;  4PAL A;  1M31 A;  2KSP A;  1BG1 A;  1SRA A;  2CNP A;  1QV0 A;  1NX3 A;  3BUN B;  2I94 A;  1C7W A;  5DKR A;  3VRQ A;  1WDC B;  2MA2 A;  3GOF A;  3QRX A;  3AAK A;  1NPQ A;  5GQQ C;  1RWY A;  1YUR A;  2K8M B;  3NSL A;  4OKH A;  1U5I A;  1XFU O;  1B7T Z;  1ALW A;  3F45 A;  1MXE A;  3DF0 A;  3SG3 A;  5JJG A;  4GGF A;  1QXP A;  2BL0 B;  1E8A A;  1H8B A;  3CZT X;  1TNX A;  2JNF A;  2KYC A;  2JZI A;  1EJ3 A;  3VRN A;  1S1E A;  2M1U A;  1XFY O;  2ISD A;  2COL B;  3GK2 A;  1DJG A;  2HQW A;  4N5X A;  1PSR A;  4N1G A;  5KTY A;  1NX2 A;  1FW4 A;  1XVJ A;  4L9M A;  1KFU L;  1QX2 A;  3I5I B;  2JTT A;  1XFZ O;  4MZL A;  2ZFD A;  3IQO A;  3SIB A;  1DT7 B;  3EK8 A;  3WHT B;  3EVR A;  2LC5 A;  2KAY A;  1Y0V H;  1JF0 A;  5BPJ A;  2KQY A;  1SL8 A;  1QAS A;  3M0W A;  2FCE A;  1AVS A;  2LVJ A;  4M2Q A;  2M7L A;  2ZNE A;  1AK8 A;  3I5I C;  2ZRS A;  1A75 B;  2LLS A;  2LUC A;  2JPT A;  3OB2 B;  1G8I A;  1A75 A;  1SMG A;  1UHN A;  4OV2 A;  4R1E A;  4DRW A;  4UPG A;  1IJ5 A;  3VRP A;  1TCO B;  1KFX L;  1KSO A;  2GGM A;  3O4Y A;  1S6I A;  2BBN A;  3PM8 A;  5J3X A;  1SL9 A;  1C07 A;  2MLE C;  3BQ3 A;  1RFJ A;  2LV7 A;  2JC2 A;  1CDP A;  5D69 A;  1IRJ A;  2KFH A;  1L7Z A;  1CFD A;  1KWO B;  4P2Y B;  4YGD B;  2LVK A;  2LVV A;  3BUO B;  5CSJ A;  1WRK A;  2OTG B;  3KEV A;  1F71 A;  2BEC A;  2F8P A;  2MBX A;  2WCF A;  3EVU A;  4YGB B;  1G33 A;  2K7D A;  3I5F B;  1FI6 A;  3O78 A;  4BY4 A;  4F0Z B;  1CDM A;  1EG4 A;  1JF2 A;  1KWO C;  2F3Y A;  1DF0 A;  4PHN A;  3PAT A;  3KPX A;  1QAT A;  1K93 D;  1S5G Y;  1OMR A;  1LXF C;  1N2D A;  4DIR A;  1K9U A;  2OTG C;  2P6B B;  1F54 A;  3TZ1 A;  2B1U A;  1IG5 A;  2JWW A;  3TS5 B;  1UUR A;  3TDI A;  1QVI Y;  3I5F C;  3WXA A;  1NYA A;  1XK4 C;  4ORA B;  5PAL A;  2K7B A;  2KOT A;  3DVK A;  3JVT B;  1IQ3 A;  2AAO A;  1TTX A;  3WNX B;  1OOJ A;  1DJZ A;  1JUO A;  3EVV A;  2KGR A;  1PUL A;  1FPW A;  5ER5 A;  3RLZ A;  3A8R A;  3VGO A;  2Y4Q A;  1JFJ A;  1MXL C;  3FS7 A;  1KK7 Y;  2M29 A; 
#chains in the Genus database with same CATH topology
 2H61 A;  2F3Z A;  1ODB A;  1REC A;  3AKB A;  1S36 A;  2JT0 A;  4BY5 A;  3DVE A;  4OR9 B;  4I5J A;  2JT3 A;  2L4I A;  4WRI A;  4MEW A;  3TS5 C;  1NCY A;  4D1E A;  1K90 D;  1QIW A;  1SY9 A;  3Q8I A;  2BBM A;  1SBJ A;  3ICB A;  2MLF C;  2M9G A;  2F33 A;  3JVT C;  1TIZ A;  4JWQ A;  3I5H B;  4A4C A;  2F2O A;  1JBA A;  1M46 A;  3DZT A;  2D8N A;  1AJ4 A;  2CT9 A;  4FQO A;  3SIA A;  3OB1 B;  1UHJ A;  3TDZ A;  4MRY A;  1BOD A;  3BFH A;  1SPY A;  4MSP A;  1S3P A;  3PLF B;  4AOM A;  2QAC A;  1DTL A;  5AFP A;  1GJY A;  2LMU A;  1F4Q A;  1QTX A;  1CTR A;  3K21 A;  3SG2 A;  2SCP A;  3I5H C;  4IL1 A;  1YVH A;  1FI5 A;  4QJ4 B;  1DEK A;  1UP5 A;  2L5Y A;  3CLN A;  1RJV A;  5F6T A;  1R6P A;  1CFP A;  3OGN A;  1OE9 B;  4PE7 A;  5I2Q A;  2ERB A;  1VRK A;  4JKT A;  1MQ1 A;  3D10 A;  1DVI A;  2QPT A;  2GV5 A;  1C7V A;  2EGD A;  2MAZ A;  2LP3 A;  1DGU A;  1A4P A;  2FJU B;  2JPO A;  4YGE B;  5B8I B;  5I8N A;  4PHK A;  1TRF A;  3QME A;  1B8C A;  3CZ2 A;  1ZFS A;  1B9A A;  5DIC A;  4CPV A;  1YRT B;  4GAO A;  1H4B A;  2DOQ A;  1M63 B;  1WLZ A;  1CFC A;  3FE6 A;  2LM5 A;  1QX5 B;  1SCV A;  1OOF A;  2H8V A;  4NQG A;  3FE8 A;  2WCE A;  1BR4 B;  3D0Y B;  3FWB A;  3PN7 C;  1RTP 1;  2LAP A;  1S5G Z;  3BYA A;  1CM1 A;  3KF9 A;  2Q4U A;  1LVC D;  1NP8 A;  2MHH A;  1QLK A;  2E6W A;  3B87 A;  3IVT A;  5KSZ A;  5CPV A;  3I5G B;  3VB1 A;  1K2H A;  1KSM A;  3B88 A;  2JNX A;  2VRG A;  1V1G A;  4ICB A;  4QJ5 B;  3PFV A;  2I18 A;  2BKH B;  1K94 A;  4MZJ A;  1TOP A;  4AQI A;  1C3Z A;  1A29 A;  1NWD A;  2QEH A;  1XA5 A;  4NDB A;  3O6B A;  3LK1 A;  2ZN8 A;  1YVL A;  4WQ2 A;  4DCK A;  4C0L A;  4DUQ A;  2JT8 A;  3I5G C;  1PAL A;  3BXK A;  1CB1 A;  2A4J A;  3RZS A;  3R1P A;  4GGF C;  3EKH A;  3BFA A;  3TUY B;  1IH0 A;  1MR8 A;  5EL2 A;  4XYN A;  4NDD A;  1QV1 A;  4MN0 A;  2BE4 A;  2BCX A;  1PVB A;  1M45 A;  3IF7 A;  3BUW B;  1OZO A;  1DJX A;  1OW4 A;  3PAL A;  4PCW A;  2QEB A;  1ALV A;  3HCM A;  4TNC A;  3CGA A;  5DKN A;  3H4S E;  1DC1 A;  2NCP A;  1F70 A;  5AEQ A;  2NXQ A;  2M0R A;  4XJK B;  1GGZ A;  1PK0 D;  2EC6 B;  3DVM A;  5JOL A;  2LE9 B;  4CID A;  2Y5I A;  1MWN A;  1OOH A;  1Y1X A;  3K1E A;  4ZCU A;  1NSH A;  2K60 A;  2LLT A;  2LP2 A;  2O60 A;  3TUY C;  1OMD A;  1Q80 A;  4QJ3 B;  1TCF A;  1DJW A;  1B1G A;  1KQM B;  2BE6 A;  4FQT A;  2KI4 C;  1W7I B;  1TNP A;  1KCY A;  3S0A A;  1ZMZ A;  2M1K B;  1DGV A;  2JRF A;  2JUL A;  4MBE A;  3UNW A;  1IIO A;  2EC6 C;  1QS7 A;  2KHN A;  2Q91 A;  2PMY A;  4JD9 A;  1CLB A;  2MRD A;  1WRL A;  2KLD A;  1A03 A;  1QIV A;  3RM1 A;  2KQ6 A;  2JTZ A;  1CM4 A;  2R2I A;  2LUX A;  3BOW B;  5KU1 A;  1W9Z A;  1NX0 A;  5AXI A;  2PRU A;  1J7Q A;  1IWQ A;  1ZOT B;  1NCZ A;  1J7R A;  4CFQ A;  1KQM C;  3NSO A;  2WCK A;  1OSA A;  3CZ0 A;  2CXJ A;  4ETO A;  1OOI X;  3D74 A;  1SR6 C;  4U8D A;  3S0B A;  1Z4H A;  2NLN A;  3OX6 A;  1EH2 A;  1B8L A;  2H2K A;  1B8R A;  4HRE E;  1PRW A;  1KFU S;  3CTN A;  2KAX A;  5CSF A;  1BLQ A;  4ZCV A;  1CLL A;  5D3O A;  4PHJ A;  5HKZ A;  3DYE A;  3EK4 A;  3SG7 A;  3SS5 A;  2EHB A;  1YRU B;  1DJI A;  1TUZ A;  1UUS A;  1SCM C;  2O5G A;  4PDZ A;  1Z2C B;  2KFF A;  2F2P A;  3SG6 A;  2L2C A;  1OQP A;  2KAV A;  3LL8 B;  1IQ5 A;  1UHH A;  4MLW A;  2WOS A;  1OZS A;  2WCB A;  1L2O B;  3SG4 A;  5I2O A;  2KFG A;  1SSE B;  1YR5 A;  2Y1N A;  1IKU A;  1CNP A;  2K61 A;  3CYZ A;  2IS9 A;  2L50 A;  4M2O A;  1J7O A;  2NZ0 A;  1YTZ C;  2L0P A;  1N65 A;  1W7J B;  2LHI A;  4INX A;  1LS8 A;  3B7A A;  1RRO A;  4GBA A;  1Y6W A;  2KYF A;  3LCP C;  4WQ3 A;  1WY9 A;  2L2E A;  1YUT A;  1CLM A;  1YUS A;  2K0J A;  2LCP A;  3MSE B;  2PYQ A;  2WCJ A;  1L2O C;  5HL1 A;  1DMO A;  3CR5 X;  1PVA A;  1NIW A;  1WLM A;  3SJS A;  2V53 A;  2PAL A;  1A2X A;  4INW A;  4USL A;  1ORG A;  2K2A A;  3PN7 B;  4C0K A;  1GQM A;  4FTG A;  2HF5 A;  2WC5 A;  1J55 A;  4NDC A;  5CSN A;  3D75 A;  3NSI A;  2PQL A;  1SYM A;  1XYD A;  2WOR A;  1J1E A;  2JXL A;  1MF8 B;  4C0J A;  4M2P A;  5IBW A;  1CKK A;  1GM0 A;  1EL4 A;  1EG3 A;  2I2R E;  2K2F A;  2PSR A;  2FOT A;  3B86 A;  3NXA A;  1N0Y A;  4JPZ B;  1AJ5 A;  1Y1U A;  1TNW A;  1XFR A;  2JQ6 A;  2KNE A;  3BUX B;  1JC2 A;  3UO9 A;  2WCL A;  3JTD B;  4HSZ A;  3VRR A;  1CMF A;  3VRO A;  3D0Y A;  1TN4 A;  2JU0 A;  4P5O E;  3O2P A;  3R1O A;  1TWO A;  2LHL A;  2M8U A;  1SK6 D;  4YI9 A;  4YRU A;  4HRH A;  1XO5 A;  1X02 A;  3V2L A;  1EXR A;  3CZ1 A;  1U5I B;  5ER4 X;  1QVI Z;  1YX7 A;  3L4A A;  3DF0 B;  1LIN A;  3C1V A;  1MHO A;  4JQ0 D;  1RK9 A;  2KBM A;  1XFX O;  1PSB A;  2OPO A;  5CSI A;  2WC8 A;  4CLN A;  3JTD C;  1IGV A;  4KYN A;  3NGV A;  3DXL A;  1F8H A;  4MZK A;  3LLE A;  5G08 A;  5AAN A;  4CFR A;  1DQE A;  1KK7 Z;  1CDL A;  1DJH A;  1HQV A;  2OS8 B;  1BMO A;  4AQJ A;  1BF5 A;  2L98 A;  4YGA A;  4GNK B;  3OBV A;  4GUK A;  1WDC C;  1NUB A;  1J7P A;  3AAJ A;  1S6J A;  1QLS A;  1TUJ A;  3CAB A;  4IJ7 A;  2CCM A;  2QEO A;  3WHU B;  5AER A;  1CFF A;  4GGN A;  2PVB A;  2BL0 C;  1F55 A;  1ZAC A;  2CTN A;  2GGZ A;  2KI4 B;  1NCX A;  1UWO A;  2OS8 C;  2NCO A;  3D73 A;  1CMG A;  2KGB C;  2HPS A;  2LMT A;  5HYD A;  2JOJ A;  3LK0 A;  3HX4 A;  4I5N B;  1QX7 A;  4PE0 A;  1CDN A;  5HKY A;  1AP4 A;  1BJF A;  4XJK A;  2WND A;  4ORC B;  1DJY A;  4OZD A;  3GK4 X;  2K7C A;  3E3R A;  4HRG A;  1K96 A;  2ZN9 A;  4YBH B;  3CR2 A;  5HLV A;  2PAS A;  3CS1 A;  4I5K A;  3OX5 A;  1OOG A;  2M49 B;  2LVI A;  2WCH A;  3FWC A;  1SR6 B;  2BKI B;  1K8U A;  2Y1M A;  3SG5 A;  2WC6 A;  3ZNI A;  5I2L A;  2QDI A;  1G4Y R;  1D1O A;  1F4O A;  2G9B A;  3A4U B;  1SW8 A;  1XK4 A;  2ZKM X;  1R2U A;  3NSK A;  1AUI B;  1MUX A;  1KK8 B;  3BFB A;  3BOW A;  1SL7 A;  1LKJ A;  1V1F A;  1SCM B;  2KDH A;  4GFT A;  3EG5 B;  2FCD A;  1JSA A;  1BR1 B;  1S26 D;  5FI2 A;  2L4H A;  1GGW A;  2K7O A;  4A4B A;  1BT6 A;  2KBI A;  1B7T Y;  1FBV A;  4MVF A;  2M7N A;  1FF1 A;  1BU3 A;  2BCB A;  1DF0 B;  2LAN A;  3OHM B;  1QWV A;  1KK8 C;  2AUC A;  3L47 A;  2LLU A;  1C3Y A;  4DS7 A;  1LA3 A;  2M97 A;  3DVJ A;  5D7F A;  1QJT A;  3OP0 A;  2I7A A;  2LNK A;  5TNC A;  2AMI A;  1J1D A;  4N1F A;  1XFW O;  2RGI A;  1YX8 A;  2L51 A;  2WCM A;  1JWD A;  4OCI A;  1B4C A;  2CBL A;  4ORB B;  5FI7 A;  4I5L B;  1K95 A;  4YGC B;  2MJW B;  2G2B A;  1AHR A;  1KFX S;  2SAS A;  5DKQ A;  1KQV A;  1UHI A;  1LA0 A;  3KHE A;  3S0G A;  3BUM B;  1HT9 A;  4YI8 A;  2E30 A;  1IJ6 A;  3PSR A;  3FE9 A;  5I94 A;  1ZUZ A;  1XFV O;  3EK7 A;  3ZWH A;  2HET A;  4PT1 A;  3SS3 A;  3KO0 A;  1M39 A;  4PE4 A;  2BCA A;  1TNQ A;  1YUU A;  2ZRT A;  5FYX A;  3D76 A;  2YGU A;  2H61 C;  1OMV A;  3PM2 A;  2ZND A;  3CWG A;  3FIA A;  3L4L A;  1NX1 A;  3DD4 A;  2LMV A;  3AKA A;  3GK1 A;  1WRZ A;  1B47 A;  4E68 A;  3D78 A;  2KI6 D;  1K9P A;  2TN4 A;  1S6C A;  3IQQ A;  1SNL A;  1JFK A;  1SKT A;  2HQ8 A;  3PJI A;  4MRX A;  3EKJ A;  2BNX A;  4OVN F;  5HLO A;  2KLE A;  4GPL B;  3S0E A;  5K89 A;  4PE1 A;  2L5X B;  1DEL A;  2M3W A;  1K9K A;  3CR4 X;  3TDU A;  4Q04 A;  4PHM A;  2JXC A;  1BOC A;  2KI6 C;  3R72 A;  5HKW A;  1UHK A;  1Y1A A;  4F7F A;  4PAL A;  1M31 A;  2KSP A;  1BG1 A;  1SRA A;  2CNP A;  1QV0 A;  1NX3 A;  3BUN B;  2I94 A;  1C7W A;  5DKR A;  3VRQ A;  1WDC B;  2MA2 A;  3GOF A;  3QRX A;  3AAK A;  1NPQ A;  5GQQ C;  1RWY A;  1YUR A;  2K8M B;  3NSL A;  4OKH A;  1U5I A;  1XFU O;  1B7T Z;  1ALW A;  2BAP A;  3F45 A;  1MXE A;  3DF0 A;  3SG3 A;  5JJG A;  4GGF A;  1QXP A;  2BL0 B;  1E8A A;  3NHI A;  3CZT X;  1H8B A;  1TNX A;  2JNF A;  2KYC A;  2JZI A;  1EJ3 A;  3VRN A;  3R1V A;  1S1E A;  2M1U A;  1XFY O;  2ISD A;  2COL B;  3GK2 A;  1DJG A;  2HQW A;  3SS4 A;  4N5X A;  1PSR A;  4N1G A;  5KTY A;  1NX2 A;  1FW4 A;  1XVJ A;  4L9M A;  1KFU L;  1QX2 A;  3I5I B;  2JTT A;  1XFZ O;  4MZL A;  2ZFD A;  3IQO A;  3SIB A;  1DT7 B;  3N7H A;  3EK8 A;  3WHT B;  3EVR A;  2LC5 A;  1T14 A;  2KAY A;  1Y0V H;  1JF0 A;  5BPJ A;  2KQY A;  1SL8 A;  2P71 A;  1QAS A;  3M0W A;  2FCE A;  1AVS A;  2LVJ A;  4M2Q A;  2M7L A;  2ZNE A;  1AK8 A;  3I5I C;  2ZRS A;  1A75 B;  2LLS A;  2LUC A;  2JPT A;  3OB2 B;  1G8I A;  2GTE A;  1A75 A;  1SMG A;  1UHN A;  4OV2 A;  4R1E A;  4DRW A;  4UPG A;  1IJ5 A;  3VRP A;  1TCO B;  1KFX L;  1KSO A;  2GGM A;  3O4Y A;  1S6I A;  2BBN A;  3PM8 A;  5J3X A;  1SL9 A;  1C07 A;  2MLE C;  3BJH A;  3BQ3 A;  1RFJ A;  3B6X A;  2LV7 A;  2JC2 A;  1CDP A;  5D69 A;  1IRJ A;  2KFH A;  3DY9 A;  1L7Z A;  1CFD A;  1KWO B;  4P2Y B;  3NHT A;  4YGD B;  2LVK A;  2LVV A;  3BUO B;  5CSJ A;  1WRK A;  2OTG B;  3KEV A;  1F71 A;  2BEC A;  2F8P A;  2MBX A;  2WCF A;  3EVU A;  4YGB B;  1G33 A;  2K7D A;  3I5F B;  1FI6 A;  3O78 A;  3S0F A;  4BY4 A;  4F0Z B;  2P70 A;  2QEV A;  5FI6 A;  1CDM A;  1EG4 A;  1JF2 A;  1KWO C;  2F3Y A;  1P28 A;  1DF0 A;  2KPH A;  4PHN A;  3CDN A;  3PAT A;  3KPX A;  1QAT A;  1K93 D;  1S5G Y;  1OMR A;  1LXF C;  1N2D A;  4DIR A;  1K9U A;  2OTG C;  2P6B B;  1F54 A;  3TZ1 A;  2B1U A;  1IG5 A;  3S0D A;  2FJY A;  2JWW A;  3TS5 B;  1UUR A;  3TDI A;  1QVI Y;  3I5F C;  3WXA A;  1NYA A;  1XK4 C;  3D77 A;  3O4X A;  4ORA B;  5PAL A;  2K7B A;  2KOT A;  3DVK A;  3JVT B;  1IQ3 A;  2AAO A;  1TTX A;  3WNX B;  1OOJ A;  1DJZ A;  1JUO A;  3EVV A;  2KGR A;  1PUL A;  1FPW A;  5ER5 A;  3RLZ A;  3A8R A;  3VGO A;  2Y4Q A;  1JFJ A;  1MXL C;  3FS7 A;  1KK7 Y;  2M29 A; 
#chains in the Genus database with same CATH homology
 2H61 A;  2F3Z A;  1ODB A;  1REC A;  3AKB A;  1S36 A;  2JT0 A;  4BY5 A;  3DVE A;  4OR9 B;  4I5J A;  2JT3 A;  2L4I A;  4WRI A;  4MEW A;  3TS5 C;  1NCY A;  4D1E A;  1K90 D;  1QIW A;  1SY9 A;  2BBM A;  1SBJ A;  3ICB A;  2MLF C;  2M9G A;  2F33 A;  3JVT C;  1TIZ A;  4JWQ A;  3I5H B;  4A4C A;  2F2O A;  1JBA A;  1M46 A;  2D8N A;  1AJ4 A;  2CT9 A;  4FQO A;  3SIA A;  3OB1 B;  1UHJ A;  3TDZ A;  4MRY A;  1BOD A;  1SPY A;  4MSP A;  1S3P A;  3PLF B;  4AOM A;  2QAC A;  1DTL A;  5AFP A;  1GJY A;  2LMU A;  1F4Q A;  1QTX A;  1CTR A;  3K21 A;  3SG2 A;  2SCP A;  3I5H C;  4IL1 A;  1YVH A;  1FI5 A;  4QJ4 B;  1UP5 A;  3CLN A;  1RJV A;  5F6T A;  1R6P A;  1CFP A;  1OE9 B;  4PE7 A;  5I2Q A;  1VRK A;  1MQ1 A;  3D10 A;  1DVI A;  2QPT A;  2GV5 A;  1C7V A;  2EGD A;  2MAZ A;  2LP3 A;  1DGU A;  1A4P A;  2FJU B;  4YGE B;  5B8I B;  5I8N A;  4PHK A;  1TRF A;  1B8C A;  1ZFS A;  1B9A A;  4CPV A;  1YRT B;  4GAO A;  1H4B A;  2DOQ A;  1M63 B;  1WLZ A;  1CFC A;  2LM5 A;  1QX5 B;  1SCV A;  4NQG A;  2WCE A;  1BR4 B;  3D0Y B;  3FWB A;  3PN7 C;  1RTP 1;  2LAP A;  1S5G Z;  3BYA A;  1CM1 A;  3KF9 A;  2Q4U A;  1LVC D;  1NP8 A;  2MHH A;  1QLK A;  2E6W A;  5KSZ A;  5CPV A;  3I5G B;  1K2H A;  1KSM A;  2JNX A;  2VRG A;  1V1G A;  4ICB A;  4QJ5 B;  3PFV A;  2I18 A;  2BKH B;  1K94 A;  4MZJ A;  1TOP A;  4AQI A;  1A29 A;  1NWD A;  1XA5 A;  4NDB A;  3O6B A;  3LK1 A;  2ZN8 A;  1YVL A;  4WQ2 A;  4DCK A;  4C0L A;  4DUQ A;  2JT8 A;  3I5G C;  1PAL A;  3BXK A;  1CB1 A;  2A4J A;  4GGF C;  3EKH A;  3TUY B;  1IH0 A;  1MR8 A;  4XYN A;  4NDD A;  1QV1 A;  4MN0 A;  2BE4 A;  2BCX A;  1M45 A;  1PVB A;  3IF7 A;  3BUW B;  1OZO A;  1DJX A;  3PAL A;  4PCW A;  1ALV A;  3HCM A;  4TNC A;  3CGA A;  5DKN A;  3H4S E;  2NCP A;  1F70 A;  5AEQ A;  2NXQ A;  2M0R A;  4XJK B;  1GGZ A;  1PK0 D;  2EC6 B;  3DVM A;  5JOL A;  2LE9 B;  4CID A;  2Y5I A;  1MWN A;  1Y1X A;  4ZCU A;  1NSH A;  2LLT A;  2LP2 A;  2O60 A;  3TUY C;  1OMD A;  1Q80 A;  4QJ3 B;  1TCF A;  1DJW A;  1B1G A;  1KQM B;  2BE6 A;  2KI4 C;  1W7I B;  1TNP A;  1KCY A;  1ZMZ A;  2M1K B;  1DGV A;  2JRF A;  2JUL A;  4MBE A;  2EC6 C;  1QS7 A;  2KHN A;  2Q91 A;  2PMY A;  1CLB A;  2MRD A;  1WRL A;  1A03 A;  1QIV A;  3RM1 A;  2KQ6 A;  2JTZ A;  1CM4 A;  2R2I A;  2LUX A;  3BOW B;  5KU1 A;  1NX0 A;  5AXI A;  2PRU A;  1J7Q A;  1IWQ A;  1ZOT B;  1NCZ A;  1J7R A;  4CFQ A;  1KQM C;  3NSO A;  1OSA A;  2CXJ A;  4ETO A;  1SR6 C;  4U8D A;  2NLN A;  3OX6 A;  1EH2 A;  1B8L A;  2H2K A;  1B8R A;  4HRE E;  1PRW A;  1KFU S;  3CTN A;  2KAX A;  5CSF A;  1BLQ A;  4ZCV A;  1CLL A;  4PHJ A;  5HKZ A;  3EK4 A;  3SG7 A;  2EHB A;  1YRU B;  1DJI A;  1UUS A;  1SCM C;  2O5G A;  4PDZ A;  2KFF A;  2F2P A;  3SG6 A;  1OQP A;  2KAV A;  3LL8 B;  1IQ5 A;  1UHH A;  4MLW A;  2WOS A;  1OZS A;  2WCB A;  1L2O B;  3SG4 A;  5I2O A;  2KFG A;  1YR5 A;  2Y1N A;  1IKU A;  1CNP A;  2K61 A;  4M2O A;  2IS9 A;  2L50 A;  1J7O A;  2NZ0 A;  1YTZ C;  2L0P A;  1N65 A;  1W7J B;  2LHI A;  1RRO A;  4GBA A;  1Y6W A;  2KYF A;  3LCP C;  4WQ3 A;  1WY9 A;  2L2E A;  1YUT A;  1CLM A;  1YUS A;  2K0J A;  2LCP A;  3MSE B;  1L2O C;  1DMO A;  3CR5 X;  1PVA A;  1NIW A;  1WLM A;  3SJS A;  2V53 A;  2PAL A;  1A2X A;  4USL A;  3PN7 B;  2K2A A;  4C0K A;  1GQM A;  4FTG A;  2HF5 A;  4NDC A;  1J55 A;  5CSN A;  3NSI A;  1SYM A;  1XYD A;  2WOR A;  1J1E A;  2JXL A;  1MF8 B;  4C0J A;  4M2P A;  5IBW A;  1CKK A;  1EL4 A;  1EG3 A;  2I2R E;  2K2F A;  2PSR A;  2FOT A;  3NXA A;  1N0Y A;  4JPZ B;  1AJ5 A;  1Y1U A;  1TNW A;  2JQ6 A;  2KNE A;  3BUX B;  1JC2 A;  3JTD B;  4HSZ A;  3VRR A;  1CMF A;  3VRO A;  3D0Y A;  1TN4 A;  2JU0 A;  4P5O E;  3O2P A;  2M8U A;  2LHL A;  4YI9 A;  1SK6 D;  4YRU A;  4HRH A;  1XO5 A;  1X02 A;  1EXR A;  1U5I B;  5ER4 X;  1QVI Z;  1YX7 A;  3DF0 B;  1LIN A;  3C1V A;  1MHO A;  4JQ0 D;  1RK9 A;  2KBM A;  1XFX O;  1PSB A;  2OPO A;  5CSI A;  2WC8 A;  4CLN A;  3JTD C;  1IGV A;  1F8H A;  4MZK A;  3LLE A;  5G08 A;  5AAN A;  4CFR A;  1KK7 Z;  2OS8 B;  1HQV A;  1CDL A;  1DJH A;  4AQJ A;  1BMO A;  1BF5 A;  2L98 A;  4YGA A;  4GNK B;  4GUK A;  1WDC C;  1NUB A;  1J7P A;  3AAJ A;  1S6J A;  1QLS A;  5AER A;  2CCM A;  3WHU B;  1CFF A;  4GGN A;  2PVB A;  2BL0 C;  1F55 A;  1ZAC A;  2CTN A;  2GGZ A;  2KI4 B;  1NCX A;  1UWO A;  2OS8 C;  2NCO A;  1CMG A;  2KGB C;  2HPS A;  2LMT A;  5HYD A;  2JOJ A;  3LK0 A;  3HX4 A;  4I5N B;  1QX7 A;  4PE0 A;  1CDN A;  5HKY A;  1AP4 A;  1BJF A;  4XJK A;  2WND A;  4ORC B;  1DJY A;  3GK4 X;  2K7C A;  3E3R A;  4HRG A;  1K96 A;  2ZN9 A;  4YBH B;  3CR2 A;  5HLV A;  2PAS A;  3CS1 A;  4I5K A;  3OX5 A;  2M49 B;  2LVI A;  3FWC A;  1SR6 B;  2BKI B;  1K8U A;  2Y1M A;  3SG5 A;  3ZNI A;  5I2L A;  1G4Y R;  1D1O A;  1F4O A;  2G9B A;  3A4U B;  1SW8 A;  1XK4 A;  2ZKM X;  1R2U A;  3NSK A;  1AUI B;  1MUX A;  1KK8 B;  3BOW A;  1SL7 A;  1LKJ A;  1V1F A;  1SCM B;  2KDH A;  4GFT A;  2FCD A;  1JSA A;  1BR1 B;  1S26 D;  1GGW A;  2L4H A;  2K7O A;  4A4B A;  1BT6 A;  2KBI A;  1B7T Y;  1FBV A;  4MVF A;  2M7N A;  1FF1 A;  1BU3 A;  2BCB A;  1DF0 B;  2LAN A;  3OHM B;  1KK8 C;  2AUC A;  2LLU A;  4DS7 A;  1LA3 A;  2M97 A;  3DVJ A;  5D7F A;  1QJT A;  3OP0 A;  2I7A A;  2LNK A;  5TNC A;  2AMI A;  1J1D A;  4N1F A;  1XFW O;  2RGI A;  1YX8 A;  2L51 A;  1JWD A;  4OCI A;  1B4C A;  2CBL A;  4ORB B;  4I5L B;  1K95 A;  4YGC B;  2MJW B;  2G2B A;  1AHR A;  1KFX S;  2SAS A;  5DKQ A;  1KQV A;  1UHI A;  1LA0 A;  3KHE A;  3BUM B;  1HT9 A;  4YI8 A;  2E30 A;  1IJ6 A;  3PSR A;  1ZUZ A;  1XFV O;  3EK7 A;  3ZWH A;  2HET A;  3KO0 A;  1M39 A;  4PE4 A;  2BCA A;  1TNQ A;  1YUU A;  2ZRT A;  5FYX A;  2H61 C;  1OMV A;  2ZND A;  3CWG A;  3FIA A;  1NX1 A;  3DD4 A;  2LMV A;  3AKA A;  3GK1 A;  1WRZ A;  1B47 A;  4E68 A;  2KI6 D;  1K9P A;  2TN4 A;  1S6C A;  3IQQ A;  1SNL A;  1JFK A;  1SKT A;  2HQ8 A;  4MRX A;  4OVN F;  3EKJ A;  5HLO A;  4GPL B;  5K89 A;  4PE1 A;  2L5X B;  2M3W A;  1K9K A;  3CR4 X;  3TDU A;  4Q04 A;  4PHM A;  2JXC A;  1BOC A;  2KI6 C;  5HKW A;  1UHK A;  1Y1A A;  4PAL A;  1M31 A;  2KSP A;  1BG1 A;  1SRA A;  2CNP A;  1QV0 A;  1NX3 A;  3BUN B;  2I94 A;  1C7W A;  5DKR A;  3VRQ A;  1WDC B;  2MA2 A;  3GOF A;  3QRX A;  3AAK A;  1NPQ A;  5GQQ C;  1RWY A;  1YUR A;  2K8M B;  3NSL A;  4OKH A;  1U5I A;  1XFU O;  1B7T Z;  1ALW A;  3F45 A;  1MXE A;  3DF0 A;  3SG3 A;  5JJG A;  4GGF A;  1QXP A;  2BL0 B;  1E8A A;  1H8B A;  3CZT X;  1TNX A;  2JNF A;  2KYC A;  2JZI A;  1EJ3 A;  3VRN A;  1S1E A;  2M1U A;  1XFY O;  2ISD A;  2COL B;  3GK2 A;  1DJG A;  2HQW A;  4N5X A;  1PSR A;  4N1G A;  5KTY A;  1NX2 A;  1FW4 A;  1XVJ A;  4L9M A;  1KFU L;  1QX2 A;  3I5I B;  2JTT A;  1XFZ O;  4MZL A;  2ZFD A;  3IQO A;  3SIB A;  1DT7 B;  3EK8 A;  3WHT B;  3EVR A;  2LC5 A;  2KAY A;  1Y0V H;  1JF0 A;  5BPJ A;  2KQY A;  1SL8 A;  1QAS A;  3M0W A;  2FCE A;  1AVS A;  2LVJ A;  4M2Q A;  2M7L A;  2ZNE A;  1AK8 A;  3I5I C;  2ZRS A;  1A75 B;  2LLS A;  2LUC A;  2JPT A;  3OB2 B;  1G8I A;  1A75 A;  1SMG A;  1UHN A;  4OV2 A;  4R1E A;  4DRW A;  4UPG A;  1IJ5 A;  3VRP A;  1TCO B;  1KFX L;  1KSO A;  2GGM A;  3O4Y A;  1S6I A;  2BBN A;  3PM8 A;  5J3X A;  1SL9 A;  1C07 A;  2MLE C;  3BQ3 A;  1RFJ A;  2LV7 A;  2JC2 A;  1CDP A;  5D69 A;  1IRJ A;  2KFH A;  1L7Z A;  1CFD A;  1KWO B;  4P2Y B;  4YGD B;  2LVK A;  2LVV A;  3BUO B;  5CSJ A;  1WRK A;  2OTG B;  3KEV A;  1F71 A;  2BEC A;  2F8P A;  2MBX A;  2WCF A;  3EVU A;  4YGB B;  1G33 A;  2K7D A;  3I5F B;  1FI6 A;  3O78 A;  4BY4 A;  4F0Z B;  1CDM A;  1EG4 A;  1JF2 A;  1KWO C;  2F3Y A;  1DF0 A;  4PHN A;  3PAT A;  3KPX A;  1QAT A;  1K93 D;  1S5G Y;  1OMR A;  1LXF C;  1N2D A;  4DIR A;  1K9U A;  2OTG C;  2P6B B;  1F54 A;  3TZ1 A;  2B1U A;  1IG5 A;  2JWW A;  3TS5 B;  1UUR A;  3TDI A;  1QVI Y;  3I5F C;  3WXA A;  1NYA A;  1XK4 C;  4ORA B;  5PAL A;  2K7B A;  2KOT A;  3DVK A;  3JVT B;  1IQ3 A;  2AAO A;  1TTX A;  3WNX B;  1OOJ A;  1DJZ A;  1JUO A;  3EVV A;  2KGR A;  1PUL A;  1FPW A;  5ER5 A;  3RLZ A;  3A8R A;  3VGO A;  2Y4Q A;  1JFJ A;  1MXL C;  3FS7 A;  1KK7 Y;  2M29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...