3L4AA

Crystal structure of an anopheles gambiae odorant-binding protein 22a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
134
structure length
121
Chain Sequence
b'NESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMYQNNNELWSHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein (AGAP010409-PA)
publication title The Crystal Structure of an Anopheles gambiae Odorant-binding Protein AgamOBP22a and complexes with Bound Odorants
rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 46
structure length 121
sequence length 134
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3l4aA00
4JD9A 3BFBA 2QEVA 2QDIA 3R72A 1C3ZA 2WCHA 2P70A 3S0EA 3S0GA 3PJIA 3B86A 3CZ2A 3S0DA 1T14A 3FE6A 2GTEA 3B7AA 3L4AA 1C3YA 3L4LA 3CDNA 2WC6A 3DYEA 2FJYA 1QWVA 3S0FA 4OZDA 1XFRA 3FE8A 3BFAA 3B87A 4F7FA 1GM0A 1OW4A 3CYZA 4INWA 2H8VA 1ORGA 1TWOA 2L2CA 3BFHA 2KPHA 4PT1A 3RZSA 1P28A 3B88A 1LS8A 2WCKA 3D77A 3QMEA 2JPOA 3B6XA 3R1PA 3S0BA 4INXA 2ERBA 2P71A 3FE9A 2WC5A 1OOIX 2PQLA 3D74A 5EL2A 3D75A 3D76A 1DQEA 3DY9A 3D78A 2WCLA 4FQTA 3NGVA 2WCJA 1TUJA 3N7HA 3R1VA 3Q8IA 3BJHA 3VB1A 3DZTA 3R1OA 3CZ1A 2WCMA 3D73A 3NHTA 2QEBA 3NHIA 3OGNA 3DXLA 1OOGA 2QEOA 3V2LA 3S0AA 3CZ0A 1OOFA 3CABA 5DICA 3L47A 1OOHA 3K1EA 2QEHA
chains in the Genus database with same CATH superfamily
1NX2A 4CFRA 1LINA 2LHLA 1C7VA 1BR4B 3KHEA 1Y1XA 2EHBA 4GAOA 5J3XA 1KFXS 1YUSA 2HETA 1XVJA 1CDMA 1RK9A 1NCXA 1J1EA 1DEKA 2LUXA 1IIOA 3DVKA 3LL8B 4MEWA 1SCVA 1UHHA 1M63B 2K7OA 2SCPA 2I2RE 4PE7A 5F6TA 1WLMA 4PE1A 1KSOA 1N2DA 1SPYA 3GK4X 2JTZA 1BOCA 1QIVA 3KF9A 1XK4C 2ZNEA 1K9KA 1S26D 1A4PA 3B7AA 1QXPA 1J7RA 3L4AA 1C3YA 4GPLB 4GGNA 5I2OA 1DJGA 4MZJA 1UHJA 5CPVA 4N1GA 2CT9A 3QRXA 5ER5A 1QWVA 1CB1A 1OOJA 2O60A 4NDCA 5I94A 4WRIA 1MXEA 2LVKA 3M0WA 4FTGA 5HLOA 3AKAA 3FE8A 3AKBA 3DVMA 4F7FA 1CFPA 2EC6B 2LMTA 4M2QA 1IQ3A 2WCEA 1QTXA 2BBNA 1J55A 2M8UA 2ISDA 1L2OC 1EJ3A 4CLNA 1ORGA 3HX4A 4PHMA 1SRAA 2BE4A 4M2PA 3SG7A 1M46A 2MAZA 2KQ6A 4CPVA 1KK7Z 1VRKA 1KK8B 1PVAA 1YX7A 2BAPA 3IF7A 2K60A 3SS5A 1TNQA 1IJ5A 2KOTA 1DJIA 2KAYA 4JKTA 2LE9B 1ZMZA 2M3WA 2KFFA 1Q80A 1B9AA 2L5XB 3I5IB 4R1EA 4PCWA 1BG1A 4NDDA 2JPOA 3FS7A 3B6XA 3I5HC 2CTNA 3KEVA 1Y1AA 4HSZA 4INXA 4D1EA 3D10A 4YGDB 4BY4A 1EL4A 2P71A 2NCPA 1UWOA 1WRKA 4A4CA 1R2UA 1NX3A 4PHNA 3TZ1A 4C0JA 1KFUL 4MRXA 4Q04A 1DJHA 1CDPA 1IG5A 1DGUA 2JPTA 5I2LA 1B8RA 2F3ZA 3SG6A 1B7TZ 3MSEB 4YGBB 2QPTA 1IH0A 1GGWA 1OMRA 2NXQA 2COLB 1YX8A 3BUNB 3EKHA 4DS7A 2FCDA 1K2HA 3BQ3A 2F2OA 3GK2A 1KFXL 1CKKA 1FW4A 2B1UA 1GQMA 1ZOTB 4HREE 1AP4A 1SR6B 1YR5A 2WCJA 2KGRA 1E8AA 2KLDA 1WRZA 3WHTB 1SK6D 5AEQA 1FF1A 1G33A 3BUMB 3SIAA 5KSZA 4NQGA 3VROA 3BJHA 4AOMA 1LKJA 3SJSA 4JQ0D 3VB1A 2JU0A 2E6WA 1F4QA 2AMIA 2M1UA 3FWCA 5CSFA 4PHJA 1TN4A 3BOWA 3NHTA 3NHIA 3NSLA 4A4BA 1G8IA 2LANA 3SIBA 1SNLA 1IQ5A 3SS3A 4IL1A 2H61C 3O78A 1B8CA 1KSMA 1QX7A 2K61A 3H4SE 1XA5A 2RGIA 1TRFA 2ZN8A 3UO9A 1SL8A 1QVIY 3CLNA 4MN0A 2EC6C 4ETOA 3HCMA 1DMOA 2NZ0A 3LLEA 3NSKA 1JUOA 2OS8B 2JRFA 1XK4A 1LXFC 1WDCB 3EK7A 3WXAA 5B8IB 5K89A 1V1GA 3D0YB 4GGFA 3RM1A 1C7WA 2WC8A 4E68A 1M31A 1BJFA 2MBXA 1NYAA 4XYNA 2ZFDA 2G2BA 1KK8C 2GGZA 2O5GA 4I5JA 1AJ5A 1AHRA 3VRPA 3B86A 2PMYA 1FBVA 2KAVA 4F0ZB 1QLSA 3I5IC 2MHHA 2KFGA 1B8LA 2V53A 1LVCD 5KU1A 3EKJA 2Y1NA 3LK0A 1A29A 4PE0A 4KYNA 1ZUZA 1N65A 3PSRA 4MSPA 2KBIA 4DCKA 3IVTA 2D8NA 3OP0A 3EVRA 1NX0A 2BCXA 2PSRA 1TIZA 4YGEB 3S0FA 1DVIA 1YRUB 3IQQA 2KBMA 1JF2A 1RJVA 1NSHA 2H8VA 3C1VA 2K0JA 2JC2A 4PE4A 2Y5IA 2BKHB 2JXLA 1RTP1 3AAJA 2LP3A 3VRRA 3SS4A 3SG5A 2HF5A 1QATA 1SR6C 2F3YA 4BY5A 1H8BA 3TS5C 5CSJA 1QS7A 1QV0A 1DF0A 3NSIA 1OMDA 2KYCA 4GGFC 1P28A 1CMGA 1JBAA 2NLNA 1QV1A 1LA0A 5AANA 2WCKA 5DKNA 4HRGA 2JOJA 2SASA 2M1KB 2K8MB 1SMGA 4MZKA 2ZRTA 1S5GY 2LM5A 2LVJA 1PULA 1TNPA 1FPWA 2HQWA 4I5KA 1X02A 2PQLA 2L98A 2KQYA 3O4YA 2K7DA 1K94A 3DF0B 4ICBA 4OCIA 5CSNA 2I18A 1GGZA 3JTDB 2LVVA 3D75A 3OX5A 1DQEA 1S6JA 3DY9A 2OS8C 2BL0B 1C07A 1Y6WA 4FQTA 1N0YA 1TTXA 2FOTA 2OTGB 3ICBA 1A2XA 1WDCC 3CWGA 3TUYB 1MQ1A 2KI6D 2M97A 1DT7B 1ALWA 1K9PA 1F4OA 4ORAB 2GV5A 1S6IA 1BMOA 1OQPA 1QLKA 1HQVA 3N7HA 1YVLA 5D3OA 3AAKA 2H61A 3OB2B 1J7QA 1F71A 3ZNIA 3Q8IA 2MLFC 3LK1A 4WQ2A 5JOLA 4N1FA 3VGOA 1UURA 1IKUA 2I94A 1NP8A 1L7ZA 1PRWA 2WCMA 4USLA 2QEBA 3DF0A 2K2FA 2R2IA 3DXLA 1OOGA 3BUXB 4CFQA 1K8UA 1CDNA 2LAPA 1QX2A 5D69A 1OOFA 2LP2A 1A03A 1CNPA 1CLBA 1W7IB 4OR9B 2TN4A 4JWQA 1CFDA 1CM1A 2JNXA 2WOSA 1SL9A 2Y1MA 2QEVA 3A8RA 3VRQA 1ZFSA 3R72A 1K93D 3DD4A 3PATA 2LMUA 2E30A 2L2EA 3A4UB 1PK0D 1YRTB 2JTTA 2K7CA 2LV7A 3PJIA 3NXAA 1CLLA 3PM8A 4MRYA 1F55A 2L0PA 1B47A 1FI5A 3CZ2A 2ZNDA 1W7JB 2JT8A 1J7PA 1XYDA 1XFYO 4DIRA 2GTEA 3KPXA 3K21A 1AK8A 5HKZA 3L4LA 4PHKA 2QACA 4YI9A 2LMVA 3CDNA 2LHIA 1OZSA 2BNXA 2BE6A 2FJYA 1NX1A 5AXIA 4XJKB 1UHKA 1SY9A 3PFVA 4PDZA 1JWDA 4N5XA 2LC5A 1F54A 1RWYA 2ZKMX 1QVIZ 2JZIA 3BFAA 3B87A 2EGDA 1SCMB 3CYZA 4INWA 3KO0A 2KLEA 2BBMA 3PALA 1AJ4A 1SL7A 1JSAA 2BL0C 1WLZA 5TNCA 2OTGC 3TUYC 1TWOA 2BCBA 2L2CA 3EG5B 1J7OA 1YURA 2KI4B 1NCYA 1NUBA 1PSRA 4IJ7A 1JF0A 5ER4X 1IRJA 1IWQA 2HQ8A 3RZSA 5FYXA 4L9MA 4MVFA 4UPGA 3BUOB 2Q4UA 3B88A 2JULA 3CGAA 3D77A 1ODBA 1SYMA 3QMEA 1F70A 2GGMA 1Y1UA 2M49B 1UP5A 2KDHA 1K96A 1S1EA 3R1PA 4U8DA 1CDLA 1KWOB 2ERBA 2IS9A 2L4IA 3FE9A 1AUIB 1W9ZA 3D0YA 1F8HA 1OOIX 4DRWA 1LA3A 1GJYA 2M7LA 3SG3A 4AQIA 1R6PA 5HL1A 2KSPA 1S6CA 1TNXA 2G9BA 1B4CA 2CNPA 2KFHA 2KI6C 1XFWO 4MZLA 1WY9A 2MA2A 1ZACA 5DKQA 3D76A 2ZN9A 1XFUO 3FWBA 3CS1A 5KTYA 2BKIB 2WCLA 5HKWA 4ZCUA 3NGVA 5GQQC 1OZOA 2L4HA 1DJYA 4OVNF 3CZTX 1DJZA 2JT3A 2WNDA 1Z4HA 2F8PA 1XFZO 4QJ3B 4MLWA 5I8NA 4OKHA 2M0RA 1S3PA 1U5IB 1S5GZ 1Y0VH 1OMVA 3I5FB 2L50A 3OX6A 3R1OA 4GFTA 1K95A 2FJUB 5HLVA 4C0LA 2Q91A 3CZ1A 1Z2CB 1MHOA 3BXKA 4MBEA 1XFXO 3JVTB 3CR2A 4I5LB 4AQJA 1KQMB 2QEOA 5I2QA 2I7AA 1MUXA 3V2LA 1RECA 2LLUA 3S0AA 1ALVA 3O2PA 3TDZA 1CMFA 4ORCB 1RFJA 5PALA 1SCMC 2KYFA 1UHNA 1BT6A 1NCZA 1QJTA 2MLEC 1OOHA 2QEHA 4JD9A 1DJWA 2LLTA 4GUKA 1FI6A 3BFBA 1K9UA 1WRLA 1BF5A 1TCOB 1RROA 2NCOA 2QDIA 1NPQA 1DC1A 2JXCA 2L5YA 3EK8A 1KCYA 1MF8B 2H2KA 1QIWA 1C3ZA 2WCHA 2P70A 3BYAA 2KGBC 2KI4C 5JJGA 1MXLC 1KK7Y 1PALA 1QASA 1S36A 1YUUA 2BCAA 2DOQA 3S0GA 3S0EA 4WQ3A 1U5IA 2LCPA 3BUWB 4YBHB 2F2PA 3S0DA 1T14A 2M29A 1DJXA 3FE6A 5FI7A 3I5GB 5HYDA 3TDUA 2JT0A 3PN7B 1KQVA 2PRUA 3L47A 1KWOC 1BU3A 2MRDA 4TNCA 4C0KA 2WC6A 3DYEA 1HT9A 3UNWA 3VRNA 4GBAA 3WNXB 2Y4QA 3SG2A 5G08A 2JQ6A 4OZDA 1XFRA 4YRUA 1SSEB 2KNEA 3ZWHA 4FQOA 1A75B 2WCBA 5AERA 1GM0A 1OW4A 5AFPA 3EVVA 3GOFA 1IGVA 1YVHA 2CCMA 5BPJA 1B7TY 2JWWA 3SG4A 1QX5B 1TOPA 3BOWB 4DUQA 1UUSA 2KHNA 3E3RA 1CFCA 4QJ5B 4ORBB 1JFJA 4CIDA 1CM4A 4PALA 1BR1B 2FCEA 2KAXA 2YGUA 5FI2A 3EK4A 1EXRA 3DVEA 1IJ6A 3BFHA 1CTRA 1YTZC 4GNKB 2KPHA 2A4JA 3CR4X 3F45A 3PM2A 1J1DA 4P5OE 3OHMB 4PT1A 1DTLA 2K7BA 2PASA 3O6BA 4P2YB 2BECA 2PALA 3PLFB 4HRHA 5IBWA 1LS8A 1BLQA 3TS5B 2CBLA 2F33A 3OB1B 3O4XA 1V1FA 5DKRA 3I5FC 1B1GA 2AUCA 2LNKA 3S0BA 1BODA 3LCPC 1PVBA 1EG3A 1K90D 2WC5A 1D1OA 4ZCVA 2L51A 1A75A 3JVTC 3JTDC 1TUZA 1KQMC 5CSIA 4NDBA 5FI6A 2MJWB 1SBJA 2P6BB 1TNWA 3D74A 4QJ4B 3GK1A 3WHUB 1JC2A 3DVJA 4M2OA 1M39A 2LVIA 3CR5X 3IQOA 5EL2A 2OPOA 1JFKA 5HKYA 1DELA 1L2OB 4YI8A 3D78A 1CFFA 4JPZB 1UHIA 1OSAA 2HPSA 2VRGA 4YGAA 1NIWA 2K2AA 4I5NB 1MWNA 1SW8A 2LLSA 3EVUA 3TDIA 1EG4A 1TUJA 2M7NA 3R1VA 1CLMA 1NWDA 1TCFA 1SKTA 4XJKA 1XO5A 3NSOA 2PVBA 3I5GC 2JNFA 3DZTA 2AAOA 3FIAA 3I5HB 1PSBA 3PN7C 2WCFA 1H4BA 1XFVO 3CTNA 1AVSA 3D73A 3RLZA 1DF0B 2ZRSA 2M9GA 4YGCB 3OGNA 1G4YR 3OBVA 4OV2A 1M45A 1KFUS 1MR8A 3CZ0A 2WORA 1EH2A 3CABA 5D7FA 2LUCA 2PYQA 2CXJA 5DICA 1OE9B 1YUTA 1DGVA 3K1EA
chains in the Genus database with same CATH topology
4JD9A 3BFBA 2QEVA 2QDIA 3R72A 1C3ZA 2WCHA 2P70A 3S0EA 3S0GA 3PJIA 3B86A 3CZ2A 3S0DA 1T14A 3FE6A 2GTEA 3B7AA 3L4AA 1C3YA 3L4LA 3CDNA 2WC6A 3DYEA 2FJYA 1QWVA 3S0FA 4OZDA 1XFRA 3FE8A 3BFAA 3B87A 4F7FA 1GM0A 1OW4A 3CYZA 4INWA 2H8VA 1ORGA 1TWOA 2L2CA 3BFHA 2KPHA 4PT1A 3RZSA 1P28A 3B88A 1LS8A 2WCKA 3D77A 3QMEA 2JPOA 3B6XA 3R1PA 3S0BA 4INXA 2ERBA 2P71A 3FE9A 2WC5A 1OOIX 2PQLA 3D74A 5EL2A 3D75A 3D76A 1DQEA 3DY9A 3D78A 2WCLA 4FQTA 3NGVA 2WCJA 1TUJA 3N7HA 3R1VA 3Q8IA 3BJHA 3VB1A 3DZTA 3R1OA 3CZ1A 2WCMA 3D73A 3NHTA 2QEBA 3NHIA 3OGNA 3DXLA 1OOGA 2QEOA 3V2LA 3S0AA 3CZ0A 1OOFA 3CABA 5DICA 3L47A 1OOHA 3K1EA 2QEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD9 A;  3BFB A;  2QEV A;  2QDI A;  3R72 A;  1C3Z A;  2WCH A;  2P70 A;  3S0E A;  3S0G A;  3PJI A;  3B86 A;  3CZ2 A;  3S0D A;  1T14 A;  3FE6 A;  2GTE A;  3B7A A;  3L4A A;  1C3Y A;  3L4L A;  3CDN A;  2WC6 A;  3DYE A;  2FJY A;  1QWV A;  3S0F A;  4OZD A;  1XFR A;  3FE8 A;  3BFA A;  3B87 A;  4F7F A;  1GM0 A;  1OW4 A;  3CYZ A;  4INW A;  2H8V A;  1ORG A;  1TWO A;  2L2C A;  3BFH A;  2KPH A;  4PT1 A;  3RZS A;  1P28 A;  3B88 A;  1LS8 A;  2WCK A;  3D77 A;  3QME A;  2JPO A;  3B6X A;  3R1P A;  3S0B A;  4INX A;  2ERB A;  2P71 A;  3FE9 A;  2WC5 A;  1OOI X;  2PQL A;  3D74 A;  5EL2 A;  3D75 A;  3D76 A;  1DQE A;  3DY9 A;  3D78 A;  2WCL A;  4FQT A;  3NGV A;  2WCJ A;  1TUJ A;  3N7H A;  3R1V A;  3Q8I A;  3BJH A;  3VB1 A;  3DZT A;  3R1O A;  3CZ1 A;  2WCM A;  3D73 A;  3NHT A;  2QEB A;  3NHI A;  3OGN A;  3DXL A;  1OOG A;  2QEO A;  3V2L A;  3S0A A;  3CZ0 A;  1OOF A;  3CAB A;  5DIC A;  3L47 A;  1OOH A;  3K1E A;  2QEH A; 
#chains in the Genus database with same CATH topology
 1NX2 A;  4CFR A;  1LIN A;  2LHL A;  1C7V A;  1BR4 B;  3KHE A;  1Y1X A;  2EHB A;  4GAO A;  5J3X A;  1KFX S;  1YUS A;  2HET A;  1XVJ A;  1CDM A;  1RK9 A;  1NCX A;  1J1E A;  1DEK A;  2LUX A;  1IIO A;  3DVK A;  3LL8 B;  4MEW A;  1SCV A;  1UHH A;  1M63 B;  2K7O A;  2SCP A;  2I2R E;  4PE7 A;  5F6T A;  1WLM A;  4PE1 A;  1KSO A;  1N2D A;  1SPY A;  3GK4 X;  2JTZ A;  1BOC A;  1QIV A;  3KF9 A;  1XK4 C;  2ZNE A;  1K9K A;  1S26 D;  1A4P A;  3B7A A;  1QXP A;  1J7R A;  3L4A A;  1C3Y A;  4GPL B;  4GGN A;  5I2O A;  1DJG A;  4MZJ A;  1UHJ A;  5CPV A;  4N1G A;  2CT9 A;  3QRX A;  5ER5 A;  1QWV A;  1CB1 A;  1OOJ A;  2O60 A;  4NDC A;  5I94 A;  4WRI A;  1MXE A;  2LVK A;  3M0W A;  4FTG A;  5HLO A;  3AKA A;  3FE8 A;  3AKB A;  3DVM A;  4F7F A;  1CFP A;  2EC6 B;  2LMT A;  4M2Q A;  1IQ3 A;  2WCE A;  1QTX A;  2BBN A;  1J55 A;  2M8U A;  2ISD A;  1L2O C;  1EJ3 A;  4CLN A;  1ORG A;  3HX4 A;  4PHM A;  1SRA A;  2BE4 A;  4M2P A;  3SG7 A;  1M46 A;  2MAZ A;  2KQ6 A;  4CPV A;  1KK7 Z;  1VRK A;  1KK8 B;  1PVA A;  1YX7 A;  2BAP A;  3IF7 A;  2K60 A;  3SS5 A;  1TNQ A;  1IJ5 A;  2KOT A;  1DJI A;  2KAY A;  4JKT A;  2LE9 B;  1ZMZ A;  2M3W A;  2KFF A;  1Q80 A;  1B9A A;  2L5X B;  3I5I B;  4R1E A;  4PCW A;  1BG1 A;  4NDD A;  2JPO A;  3FS7 A;  3B6X A;  3I5H C;  2CTN A;  3KEV A;  1Y1A A;  4HSZ A;  4INX A;  4D1E A;  3D10 A;  4YGD B;  4BY4 A;  1EL4 A;  2P71 A;  2NCP A;  1UWO A;  1WRK A;  4A4C A;  1R2U A;  1NX3 A;  4PHN A;  3TZ1 A;  4C0J A;  1KFU L;  4MRX A;  4Q04 A;  1DJH A;  1CDP A;  1IG5 A;  1DGU A;  2JPT A;  5I2L A;  1B8R A;  2F3Z A;  3SG6 A;  1B7T Z;  3MSE B;  4YGB B;  2QPT A;  1IH0 A;  1GGW A;  1OMR A;  2NXQ A;  2COL B;  1YX8 A;  3BUN B;  3EKH A;  4DS7 A;  2FCD A;  1K2H A;  3BQ3 A;  2F2O A;  3GK2 A;  1KFX L;  1CKK A;  1FW4 A;  2B1U A;  1GQM A;  1ZOT B;  4HRE E;  1AP4 A;  1SR6 B;  1YR5 A;  2WCJ A;  2KGR A;  1E8A A;  2KLD A;  1WRZ A;  3WHT B;  1SK6 D;  5AEQ A;  1FF1 A;  1G33 A;  3BUM B;  3SIA A;  5KSZ A;  4NQG A;  3VRO A;  3BJH A;  4AOM A;  1LKJ A;  3SJS A;  4JQ0 D;  3VB1 A;  2JU0 A;  2E6W A;  1F4Q A;  2AMI A;  2M1U A;  3FWC A;  5CSF A;  4PHJ A;  1TN4 A;  3BOW A;  3NHT A;  3NHI A;  3NSL A;  4A4B A;  1G8I A;  2LAN A;  3SIB A;  1SNL A;  1IQ5 A;  3SS3 A;  4IL1 A;  2H61 C;  3O78 A;  1B8C A;  1KSM A;  1QX7 A;  2K61 A;  3H4S E;  1XA5 A;  2RGI A;  1TRF A;  2ZN8 A;  3UO9 A;  1SL8 A;  1QVI Y;  3CLN A;  4MN0 A;  2EC6 C;  4ETO A;  3HCM A;  1DMO A;  2NZ0 A;  3LLE A;  3NSK A;  1JUO A;  2OS8 B;  2JRF A;  1XK4 A;  1LXF C;  1WDC B;  3EK7 A;  3WXA A;  5B8I B;  5K89 A;  1V1G A;  3D0Y B;  4GGF A;  3RM1 A;  1C7W A;  2WC8 A;  4E68 A;  1M31 A;  1BJF A;  2MBX A;  1NYA A;  4XYN A;  2ZFD A;  2G2B A;  1KK8 C;  2GGZ A;  2O5G A;  4I5J A;  1AJ5 A;  1AHR A;  3VRP A;  3B86 A;  2PMY A;  1FBV A;  2KAV A;  4F0Z B;  1QLS A;  3I5I C;  2MHH A;  2KFG A;  1B8L A;  2V53 A;  1LVC D;  5KU1 A;  3EKJ A;  2Y1N A;  3LK0 A;  1A29 A;  4PE0 A;  4KYN A;  1ZUZ A;  1N65 A;  3PSR A;  4MSP A;  2KBI A;  4DCK A;  3IVT A;  2D8N A;  3OP0 A;  3EVR A;  1NX0 A;  2BCX A;  2PSR A;  1TIZ A;  4YGE B;  3S0F A;  1DVI A;  1YRU B;  3IQQ A;  2KBM A;  1JF2 A;  1RJV A;  1NSH A;  2H8V A;  3C1V A;  2K0J A;  2JC2 A;  4PE4 A;  2Y5I A;  2BKH B;  2JXL A;  1RTP 1;  3AAJ A;  2LP3 A;  3VRR A;  3SS4 A;  3SG5 A;  2HF5 A;  1QAT A;  1SR6 C;  2F3Y A;  4BY5 A;  1H8B A;  3TS5 C;  5CSJ A;  1QS7 A;  1QV0 A;  1DF0 A;  3NSI A;  1OMD A;  2KYC A;  4GGF C;  1P28 A;  1CMG A;  1JBA A;  2NLN A;  1QV1 A;  1LA0 A;  5AAN A;  2WCK A;  5DKN A;  4HRG A;  2JOJ A;  2SAS A;  2M1K B;  2K8M B;  1SMG A;  4MZK A;  2ZRT A;  1S5G Y;  2LM5 A;  2LVJ A;  1PUL A;  1TNP A;  1FPW A;  2HQW A;  4I5K A;  1X02 A;  2PQL A;  2L98 A;  2KQY A;  3O4Y A;  2K7D A;  1K94 A;  3DF0 B;  4ICB A;  4OCI A;  5CSN A;  2I18 A;  1GGZ A;  3JTD B;  2LVV A;  3D75 A;  3OX5 A;  1DQE A;  1S6J A;  3DY9 A;  2OS8 C;  2BL0 B;  1C07 A;  1Y6W A;  4FQT A;  1N0Y A;  1TTX A;  2FOT A;  2OTG B;  3ICB A;  1A2X A;  1WDC C;  3CWG A;  3TUY B;  1MQ1 A;  2KI6 D;  2M97 A;  1DT7 B;  1ALW A;  1K9P A;  1F4O A;  4ORA B;  2GV5 A;  1S6I A;  1BMO A;  1OQP A;  1QLK A;  1HQV A;  3N7H A;  1YVL A;  5D3O A;  3AAK A;  2H61 A;  3OB2 B;  1J7Q A;  1F71 A;  3ZNI A;  3Q8I A;  2MLF C;  3LK1 A;  4WQ2 A;  5JOL A;  4N1F A;  3VGO A;  1UUR A;  1IKU A;  2I94 A;  1NP8 A;  1L7Z A;  1PRW A;  2WCM A;  4USL A;  2QEB A;  3DF0 A;  2K2F A;  2R2I A;  3DXL A;  1OOG A;  3BUX B;  4CFQ A;  1K8U A;  1CDN A;  2LAP A;  1QX2 A;  5D69 A;  1OOF A;  2LP2 A;  1A03 A;  1CNP A;  1CLB A;  1W7I B;  4OR9 B;  2TN4 A;  4JWQ A;  1CFD A;  1CM1 A;  2JNX A;  2WOS A;  1SL9 A;  2Y1M A;  2QEV A;  3A8R A;  3VRQ A;  1ZFS A;  3R72 A;  1K93 D;  3DD4 A;  3PAT A;  2LMU A;  2E30 A;  2L2E A;  3A4U B;  1PK0 D;  1YRT B;  2JTT A;  2K7C A;  2LV7 A;  3PJI A;  3NXA A;  1CLL A;  3PM8 A;  4MRY A;  1F55 A;  2L0P A;  1B47 A;  1FI5 A;  3CZ2 A;  2ZND A;  1W7J B;  2JT8 A;  1J7P A;  1XYD A;  1XFY O;  4DIR A;  2GTE A;  3KPX A;  3K21 A;  1AK8 A;  5HKZ A;  3L4L A;  4PHK A;  2QAC A;  4YI9 A;  2LMV A;  3CDN A;  2LHI A;  1OZS A;  2BNX A;  2BE6 A;  2FJY A;  1NX1 A;  5AXI A;  4XJK B;  1UHK A;  1SY9 A;  3PFV A;  4PDZ A;  1JWD A;  4N5X A;  2LC5 A;  1F54 A;  1RWY A;  2ZKM X;  1QVI Z;  2JZI A;  3BFA A;  3B87 A;  2EGD A;  1SCM B;  3CYZ A;  4INW A;  3KO0 A;  2KLE A;  2BBM A;  3PAL A;  1AJ4 A;  1SL7 A;  1JSA A;  2BL0 C;  1WLZ A;  5TNC A;  2OTG C;  3TUY C;  1TWO A;  2BCB A;  2L2C A;  3EG5 B;  1J7O A;  1YUR A;  2KI4 B;  1NCY A;  1NUB A;  1PSR A;  4IJ7 A;  1JF0 A;  5ER4 X;  1IRJ A;  1IWQ A;  2HQ8 A;  3RZS A;  5FYX A;  4L9M A;  4MVF A;  4UPG A;  3BUO B;  2Q4U A;  3B88 A;  2JUL A;  3CGA A;  3D77 A;  1ODB A;  1SYM A;  3QME A;  1F70 A;  2GGM A;  1Y1U A;  2M49 B;  1UP5 A;  2KDH A;  1K96 A;  1S1E A;  3R1P A;  4U8D A;  1CDL A;  1KWO B;  2ERB A;  2IS9 A;  2L4I A;  3FE9 A;  1AUI B;  1W9Z A;  3D0Y A;  1F8H A;  1OOI X;  4DRW A;  1LA3 A;  1GJY A;  2M7L A;  3SG3 A;  4AQI A;  1R6P A;  5HL1 A;  2KSP A;  1S6C A;  1TNX A;  2G9B A;  1B4C A;  2CNP A;  2KFH A;  2KI6 C;  1XFW O;  4MZL A;  1WY9 A;  2MA2 A;  1ZAC A;  5DKQ A;  3D76 A;  2ZN9 A;  1XFU O;  3FWB A;  3CS1 A;  5KTY A;  2BKI B;  2WCL A;  5HKW A;  4ZCU A;  3NGV A;  5GQQ C;  1OZO A;  2L4H A;  1DJY A;  4OVN F;  3CZT X;  1DJZ A;  2JT3 A;  2WND A;  1Z4H A;  2F8P A;  1XFZ O;  4QJ3 B;  4MLW A;  5I8N A;  4OKH A;  2M0R A;  1S3P A;  1U5I B;  1S5G Z;  1Y0V H;  1OMV A;  3I5F B;  2L50 A;  3OX6 A;  3R1O A;  4GFT A;  1K95 A;  2FJU B;  5HLV A;  4C0L A;  2Q91 A;  3CZ1 A;  1Z2C B;  1MHO A;  3BXK A;  4MBE A;  1XFX O;  3JVT B;  3CR2 A;  4I5L B;  4AQJ A;  1KQM B;  2QEO A;  5I2Q A;  2I7A A;  1MUX A;  3V2L A;  1REC A;  2LLU A;  3S0A A;  1ALV A;  3O2P A;  3TDZ A;  1CMF A;  4ORC B;  1RFJ A;  5PAL A;  1SCM C;  2KYF A;  1UHN A;  1BT6 A;  1NCZ A;  1QJT A;  2MLE C;  1OOH A;  2QEH A;  4JD9 A;  1DJW A;  2LLT A;  4GUK A;  1FI6 A;  3BFB A;  1K9U A;  1WRL A;  1BF5 A;  1TCO B;  1RRO A;  2NCO A;  2QDI A;  1NPQ A;  1DC1 A;  2JXC A;  2L5Y A;  3EK8 A;  1KCY A;  1MF8 B;  2H2K A;  1QIW A;  1C3Z A;  2WCH A;  2P70 A;  3BYA A;  2KGB C;  2KI4 C;  5JJG A;  1MXL C;  1KK7 Y;  1PAL A;  1QAS A;  1S36 A;  1YUU A;  2BCA A;  2DOQ A;  3S0G A;  3S0E A;  4WQ3 A;  1U5I A;  2LCP A;  3BUW B;  4YBH B;  2F2P A;  3S0D A;  1T14 A;  2M29 A;  1DJX A;  3FE6 A;  5FI7 A;  3I5G B;  5HYD A;  3TDU A;  2JT0 A;  3PN7 B;  1KQV A;  2PRU A;  3L47 A;  1KWO C;  1BU3 A;  2MRD A;  4TNC A;  4C0K A;  2WC6 A;  3DYE A;  1HT9 A;  3UNW A;  3VRN A;  4GBA A;  3WNX B;  2Y4Q A;  3SG2 A;  5G08 A;  2JQ6 A;  4OZD A;  1XFR A;  4YRU A;  1SSE B;  2KNE A;  3ZWH A;  4FQO A;  1A75 B;  2WCB A;  5AER A;  1GM0 A;  1OW4 A;  5AFP A;  3EVV A;  3GOF A;  1IGV A;  1YVH A;  2CCM A;  5BPJ A;  1B7T Y;  2JWW A;  3SG4 A;  1QX5 B;  1TOP A;  3BOW B;  4DUQ A;  1UUS A;  2KHN A;  3E3R A;  1CFC A;  4QJ5 B;  4ORB B;  1JFJ A;  4CID A;  1CM4 A;  4PAL A;  1BR1 B;  2FCE A;  2KAX A;  2YGU A;  5FI2 A;  3EK4 A;  1EXR A;  3DVE A;  1IJ6 A;  3BFH A;  1CTR A;  1YTZ C;  4GNK B;  2KPH A;  2A4J A;  3CR4 X;  3F45 A;  3PM2 A;  1J1D A;  4P5O E;  3OHM B;  4PT1 A;  1DTL A;  2K7B A;  2PAS A;  3O6B A;  4P2Y B;  2BEC A;  2PAL A;  3PLF B;  4HRH A;  5IBW A;  1LS8 A;  1BLQ A;  3TS5 B;  2CBL A;  2F33 A;  3OB1 B;  3O4X A;  1V1F A;  5DKR A;  3I5F C;  1B1G A;  2AUC A;  2LNK A;  3S0B A;  1BOD A;  3LCP C;  1PVB A;  1EG3 A;  1K90 D;  2WC5 A;  1D1O A;  4ZCV A;  2L51 A;  1A75 A;  3JVT C;  3JTD C;  1TUZ A;  1KQM C;  5CSI A;  4NDB A;  5FI6 A;  2MJW B;  1SBJ A;  2P6B B;  1TNW A;  3D74 A;  4QJ4 B;  3GK1 A;  3WHU B;  1JC2 A;  3DVJ A;  4M2O A;  1M39 A;  2LVI A;  3CR5 X;  3IQO A;  5EL2 A;  2OPO A;  1JFK A;  5HKY A;  1DEL A;  1L2O B;  4YI8 A;  3D78 A;  1CFF A;  4JPZ B;  1UHI A;  1OSA A;  2HPS A;  2VRG A;  4YGA A;  1NIW A;  2K2A A;  4I5N B;  1MWN A;  1SW8 A;  2LLS A;  3EVU A;  3TDI A;  1EG4 A;  1TUJ A;  2M7N A;  3R1V A;  1CLM A;  1NWD A;  1TCF A;  1SKT A;  4XJK A;  1XO5 A;  3NSO A;  2PVB A;  3I5G C;  2JNF A;  3DZT A;  2AAO A;  3FIA A;  3I5H B;  1PSB A;  3PN7 C;  2WCF A;  1H4B A;  1XFV O;  3CTN A;  1AVS A;  3D73 A;  3RLZ A;  1DF0 B;  2ZRS A;  2M9G A;  4YGC B;  3OGN A;  1G4Y R;  3OBV A;  4OV2 A;  1M45 A;  1KFU S;  1MR8 A;  3CZ0 A;  2WOR A;  1EH2 A;  3CAB A;  5D7F A;  2LUC A;  2PYQ A;  2CXJ A;  5DIC A;  1OE9 B;  1YUT A;  1DGV A;  3K1E A; 
#chains in the Genus database with same CATH homology
 4JD9 A;  3BFB A;  2QEV A;  2QDI A;  3R72 A;  1C3Z A;  2WCH A;  2P70 A;  3S0E A;  3S0G A;  3PJI A;  3B86 A;  3CZ2 A;  3S0D A;  1T14 A;  3FE6 A;  2GTE A;  3B7A A;  3L4A A;  1C3Y A;  3L4L A;  3CDN A;  2WC6 A;  3DYE A;  2FJY A;  1QWV A;  3S0F A;  4OZD A;  1XFR A;  3FE8 A;  3BFA A;  3B87 A;  4F7F A;  1GM0 A;  1OW4 A;  3CYZ A;  4INW A;  2H8V A;  1ORG A;  1TWO A;  2L2C A;  3BFH A;  2KPH A;  4PT1 A;  3RZS A;  1P28 A;  3B88 A;  1LS8 A;  2WCK A;  3D77 A;  3QME A;  2JPO A;  3B6X A;  3R1P A;  3S0B A;  4INX A;  2ERB A;  2P71 A;  3FE9 A;  2WC5 A;  1OOI X;  2PQL A;  3D74 A;  5EL2 A;  3D75 A;  3D76 A;  1DQE A;  3DY9 A;  3D78 A;  2WCL A;  4FQT A;  3NGV A;  2WCJ A;  1TUJ A;  3N7H A;  3R1V A;  3Q8I A;  3BJH A;  3VB1 A;  3DZT A;  3R1O A;  3CZ1 A;  2WCM A;  3D73 A;  3NHT A;  2QEB A;  3NHI A;  3OGN A;  3DXL A;  1OOG A;  2QEO A;  3V2L A;  3S0A A;  3CZ0 A;  1OOF A;  3CAB A;  5DIC A;  3L47 A;  1OOH A;  3K1E A;  2QEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...