3L4AA

Crystal structure of an anopheles gambiae odorant-binding protein 22a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
134
structure length
121
Chain Sequence
NESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMYQNNNELWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein (AGAP010409-PA)
publication title The Crystal Structure of an Anopheles gambiae Odorant-binding Protein AgamOBP22a and complexes with Bound Odorants
rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 46
structure length 121
sequence length 134
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3l4aA00
3S0EA 4INWA 2ERBA 2WC5A 4FQTA 2WC6A 3Q8IA 2WCMA 3V2LA 3R1VA 3R1OA 4PT1A 3B87A 1QWVA 3B7AA 3B88A 3D77A 2H8VA 3RZSA 1LS8A 3NHIA 3CZ2A 3DY9A 3L4AA 3CDNA 1OOFA 3S0FA 3BJHA 3R1PA 3DXLA 3D76A 3D75A 2QEVA 1GM0A 1ORGA 3QMEA 3NHTA 3FE6A 2JPOA 2QEOA 3S0DA 2QEHA 3DYEA 4INXA 2PQLA 3S0GA 3BFAA 3D78A 2GTEA 3S0BA 1OOIX 3OGNA 1DQEA 4JD9A 3BFHA 1P28A 3L4LA 3CABA 3FE8A 3FE9A 2L2CA 3D74A 3CZ0A 4F7FA 3N7HA 2WCHA 1TUJA 1TWOA 3B86A 5DICA 1OOHA 3CYZA 3VB1A 1C3YA 1C3ZA 1XFRA 3DZTA 2P70A 2QDIA 4OZDA 2QEBA 3D73A 3NGVA 2WCKA 1T14A 2FJYA 3PJIA 3R72A 2P71A 3L47A 1OW4A 1OOGA 3CZ1A 3S0AA 3K1EA 2KPHA 5EL2A 3B6XA 3BFBA 2WCLA 2WCJA
chains in the Genus database with same CATH superfamily
5I2OA 5ER4X 3IQOA 1QIWA 2WC5A 3NSIA 2BNXA 2GGMA 2F3ZA 1G33A 1XK4C 3TS5B 1DTLA 1UHJA 2WC6A 2Y1NA 1DJZA 3Q8IA 3BUWB 1XO5A 2K7BA 4GGNA 4OV2A 5HKZA 1CB1A 1R6PA 3AAJA 1M31A 1PALA 1XFWO 1TNWA 1AJ5A 1F4OA 2BBNA 2LLSA 1TCOB 3R1OA 1UHIA 2Q91A 1ZFSA 2JOJA 4DS7A 3B87A 2JNFA 3O78A 5AXIA 2K2AA 3PFVA 4QJ5B 4GUKA 4HREE 5HYDA 1QWVA 3ZNIA 1KK7Y 1CMFA 3DVKA 1PRWA 2NXQA 2H8VA 1S26D 4BY4A 3SG5A 4OR9B 2BL0C 1LVCD 1XFUO 1NPQA 3CZ2A 2K0JA 4MN0A 3CS1A 1RJVA 3D10A 3EG5B 2HETA 2I7AA 1H4BA 4OKHA 4M2OA 2GV5A 4CLNA 3DVJA 3L4AA 1L7ZA 5K89A 1MXEA 1E8AA 4PE7A 5KSZA 3S0FA 3FWCA 2CTNA 3PM8A 4A4CA 2IS9A 1CDNA 1ZUZA 4U8DA 2MLEC 1FI5A 1QVIY 2LVIA 1KFUL 1OSAA 3D76A 3D75A 4ZCVA 2KHNA 4QJ4B 2LMTA 2LVKA 1HT9A 3EKJA 3QMEA 5CSNA 4NDCA 1TTXA 1YVLA 2KDHA 2LP2A 2CT9A 1IQ3A 1OMDA 1M45A 2LVVA 3OX6A 5AERA 2QEOA 4WQ2A 2RGIA 3DYEA 1OMVA 2ZFDA 1FW4A 1YTZC 1DGUA 1N65A 4ORCB 4XJKA 1GQMA 1C7VA 1DF0A 1XA5A 2R2IA 1NSHA 5B8IB 1Y1XA 2BCAA 2BKIB 2LP3A 3DD4A 2KOTA 1J7RA 2AMIA 3FIAA 3IVTA 1F70A 2TN4A 4JD9A 5IBWA 2CNPA 1P28A 2QACA 2FCEA 3L4LA 1S3PA 3OB2B 4GPLB 4PE1A 3TDIA 2OTGC 1YR5A 2LUCA 1JFJA 1J1DA 1EH2A 1KSOA 4YBHB 2JT3A 2O5GA 3M0WA 3NSOA 1UP5A 1NCXA 3CZ0A 2KFGA 4P2YB 4PHKA 4F7FA 1S36A 2COLB 1TUJA 1DVIA 2JXLA 3PLFB 2H2KA 1CM1A 1QATA 1NX0A 3BUXB 4AQIA 2JZIA 1B8LA 2BE6A 2CCMA 3TDUA 3NSLA 1DMOA 1CDMA 2Y1MA 5JOLA 1K94A 1CTRA 3C1VA 1XFRA 1GJYA 1ALWA 1QX2A 4XJKB 1TNPA 1DF0B 1UUSA 2L50A 1RFJA 2HPSA 4I5KA 1L2OB 3BQ3A 3TUYB 4CFRA 2BCXA 2KGRA 1N2DA 4FQOA 4GGFA 3AKBA 1DJHA 2AUCA 2L98A 1G4YR 3DF0A 4MEWA 1NWDA 1KFXL 2MHHA 4YGCB 2PYQA 1SMGA 4AOMA 1PSBA 3GK1A 1SKTA 3CWGA 2KYFA 1JC2A 2BE4A 4MZJA 1B7TY 3WXAA 1IG5A 1SL8A 4N1FA 1JWDA 1OOGA 3S0AA 5TNCA 1CLLA 3OBVA 3WHTB 1AJ4A 3PM2A 2KI4B 3B6XA 3K21A 1JBAA 5GQQC 2ZRSA 2LMVA 2F33A 4PHJA 5I8NA 1NUBA 1C7WA 2GGZA 4C0KA 1JUOA 3PN7C 1G8IA 4FQTA 3E3RA 1WRLA 3KEVA 4YI9A 5D69A 5DKQA 1IJ6A 3V2LA 3DF0B 1MWNA 1VRKA 3NSKA 4PALA 4PT1A 1KQMB 1PVAA 2NCOA 1B7TZ 1SY9A 2M97A 1M46A 1AUIB 1WDCB 3A8RA 1SSEB 3B88A 2KFHA 1BMOA 1DC1A 2OPOA 1QTXA 2E6WA 1LKJA 3OHMB 2VRGA 1CFCA 1MUXA 2H61A 2MBXA 1ZMZA 3SG3A 3LK1A 1K8UA 3JVTB 2DOQA 1QV1A 3DY9A 1A4PA 1DGVA 1SR6C 2L0PA 5F6TA 2MJWB 1YX7A 1GGWA 1DELA 1XFXO 2KQ6A 1XK4A 3BUMB 1AVSA 2PMYA 1K93D 1QXPA 3TDZA 4FTGA 1QIVA 1A29A 1BG1A 1B8RA 1SRAA 2K60A 5HLOA 2HF5A 4L9MA 1W9ZA 1AP4A 1GM0A 3JTDB 4I5LB 5CSFA 1LA3A 1SCMC 1SCVA 1B47A 3SG4A 2WCFA 1UWOA 3CZTX 4M2QA 1V1GA 2BCBA 2L5YA 1F54A 4Q04A 2QEHA 2KBIA 1NIWA 1KQVA 5HKYA 1Y0VH 1Y6WA 3I5GC 1QX7A 3S0GA 1S6CA 3BFAA 1XFVO 2A4JA 2AAOA 3BUOB 1M63B 1CFPA 1OOIX 2K7OA 3BOWA 3SS4A 4MZLA 3I5FC 1DEKA 1KWOC 4QJ3B 4YGDB 3KO0A 4ORAB 3FE9A 2LM5A 2FJUB 1DJWA 1R2UA 3QRXA 4DCKA 1LINA 3RM1A 3OX5A 1IGVA 1V1FA 3SIBA 2M29A 1TWOA 5KTYA 5DICA 4PE4A 1OOHA 2M1KB 5DKRA 2BL0B 1DJYA 3VB1A 2M9GA 1C3ZA 3DZTA 3UNWA 1TNQA 1C3YA 2P70A 4HRGA 1OZSA 2QEBA 2BECA 2M1UA 2PVBA 3BOWB 1QJTA 2M7NA 4MVFA 1OZOA 3ZWHA 2QPTA 1IWQA 1X02A 2JU0A 3DVMA 2WCEA 5I2LA 4USLA 1YRUB 2KLDA 1CFFA 1JSAA 2WCKA 1T14A 3I5IC 4MLWA 5J3XA 2WNDA 2M8UA 1F4QA 3PJIA 3SG7A 1AHRA 1EG3A 2KLEA 2LNKA 1BLQA 2ISDA 2ZRTA 2M0RA 1OW4A 3CZ1A 1CKKA 1W7JB 3IF7A 2G9BA 2BAPA 4PDZA 1NYAA 1CFDA 3PSRA 2KI6C 1DJGA 5JJGA 1RECA 3S0EA 2LVJA 4INWA 2ERBA 3FWBA 4WRIA 4YRUA 2P6BB 1KK8C 2K7DA 2I2RE 1SL9A 2M7LA 2FCDA 2F8PA 3LK0A 1N0YA 2LLTA 2O60A 2WCMA 2M49B 1UHKA 2PALA 3R1VA 4PE0A 3SS5A 3D0YA 5HKWA 1AK8A 1WRZA 2LMUA 1MQ1A 2LV7A 1DT7B 3BYAA 1QX5B 2OTGB 2EGDA 5FYXA 2BBMA 2OS8C 2JWWA 3D77A 3AAKA 2FOTA 1XFZO 2JNXA 1PK0D 4PHNA 3MSEB 3LL8B 1IH0A 1YRTB 3GK4X 1LS8A 1H8BA 3CTNA 1YUUA 2KYCA 2L5XB 2ZN8A 2K8MB 5D3OA 1SW8A 1KFUS 4A4BA 1KSMA 2EC6C 1Z2CB 1B8CA 2KAYA 4WQ3A 4D1EA 5FI7A 2MAZA 5I2QA 3IQQA 1RROA 5AEQA 1IKUA 2CXJA 1WY9A 1ALVA 4ZCUA 4DUQA 3D0YB 3R1PA 2WCBA 4HSZA 4CIDA 2KAVA 4JKTA 1A03A 3DXLA 4R1EA 3VGOA 5I94A 3EK7A 3I5HC 1MHOA 2KNEA 2MA2A 2MLFC 3NXAA 4PCWA 4YGBB 1BOCA 2KQYA 1RWYA 1FBVA 1ZOTB 1QLKA 4C0LA 3A4UB 1F55A 1SBJA 3NHTA 2WC8A 2JTZA 3KPXA 2BKHB 4MZKA 1M39A 1NCYA 4MSPA 4INXA 4N1GA 2PQLA 1S6IA 1UURA 1YURA 1CMGA 2K7CA 2V53A 4GBAA 5HLVA 3TS5C 1B1GA 3F45A 3D78A 3PN7B 1BT6A 2GTEA 5PALA 2Q4UA 2M3WA 3S0BA 3OGNA 2JPTA 1DQEA 1WRKA 3BFHA 3SG2A 1WLMA 4I5JA 3CABA 3FE8A 2ZKMX 3FS7A 1SL7A 3KF9A 3VRRA 3O4YA 1J7PA 1U5IA 1Z4HA 3EVVA 4PHMA 1K9PA 3CGAA 3N7HA 3EVRA 4IL1A 5FI2A 1C07A 1KFXS 3EK8A 1BODA 1PSRA 1Y1UA 1FF1A 3GOFA 3EKHA 1SNLA 4NDDA 2JT8A 5ER5A 1J55A 1KCYA 3CYZA 3O6BA 2LCPA 1MR8A 1F8HA 1EXRA 1BR1B 3VROA 2QDIA 4IJ7A 3D73A 1SR6B 4OVNF 1BR4B 3SIAA 1IJ5A 5CSJA 2SCPA 3WHUB 1DJXA 3NGVA 1TRFA 1IQ5A 3CLNA 2HQ8A 2LANA 2FJYA 2LHLA 2LHIA 4KYNA 3R72A 2P71A 3WNXB 1U5IB 3HX4A 3L47A 1K96A 5AFPA 3HCMA 1YX8A 3EK4A 1NX1A 1IIOA 1Q80A 1SCMB 3K1EA 4JWQA 1OMRA 5EL2A 1SK6D 5KU1A 1CDPA 1PVBA 1UHHA 2JT0A 5FI6A 1J7OA 2KI6D 1IRJA 2KPHA 2LLUA 2WCLA 2WCJA 4YGAA 2PSRA 1K2HA 2WOSA 1RTP1 4YI8A 4YGEB 2JTTA 2PRUA 1TOPA 4OCIA 2L4HA 3I5GB 4XYNA 1UHNA 1CM4A 4BY5A 2I18A 4ICBA 1HQVA 5D7FA 1A75A 2KGBC 3I5FB 1KWOB 1K9KA 1FI6A 2MRDA 1JF2A 2Y4QA 1KK7Z 1OQPA 2PASA 1K90D 3B7AA 2G2BA 1EG4A 2JQ6A 2LE9B 2YGUA 3BXKA 1OE9B 1J1EA 3OB1B 2JULA 3RZSA 1S1EA 4CFQA 2Y5IA 3NHIA 2JRFA 1J7QA 4UPGA 2EHBA 2ZNDA 3TUYC 1BU3A 1L2OC 1NX2A 1EL4A 4JPZB 3O2PA 2KAXA 3SJSA 4NQGA 3CDNA 5AANA 1OOFA 1TN4A 3AKAA 1YVHA 2K2FA 5DKNA 1A75B 1GGZA 1XYDA 1TCFA 1NX3A 3BJHA 3VRNA 2F2OA 3H4SE 2D8NA 1LXFC 4ORBB 3SG6A 1QVIZ 4MRYA 1D1OA 4TNCA 2L2EA 1S5GY 3I5IB 1SPYA 3TZ1A 2QEVA 1ORGA 1WLZA 2HQWA 1DJIA 1EJ3A 1XVJA 4GFTA 4C0JA 2KI4C 5CPVA 2JC2A 4AQJA 1OOJA 3FE6A 2B1UA 2JPOA 4HRHA 1F71A 4N5XA 4MRXA 3S0DA 3PATA 3PALA 3OP0A 5HL1A 1FPWA 4GGFC 2NLNA 2KFFA 1JF0A 1Y1AA 1KK8B 2L51A 1PULA 1YUTA 4GAOA 3DVEA 2F2PA 1YUSA 3KHEA 2JXCA 1ZACA 1JFKA 1S5GZ 1KQMC 1TIZA 3CR4X 4MBEA 1XFYO 1B4CA 3ICBA 1WDCC 2ZN9A 3SS3A 2L2CA 4E68A 3D74A 2OS8B 3EVUA 1MXLC 2CBLA 1K95A 1LA0A 2LUXA 4NDBA 3VRQA 1BF5A 2WCHA 1RK9A 3LLEA 4DRWA 3B86A 3BUNB 1QLSA 3O4XA 2F3YA 1CLMA 2SASA 3CR2A 2E30A 2KSPA 3JVTC 1B9AA 5CSIA 1MF8B 1QV0A 1W7IB 2KBMA 1TUZA 2EC6B 4GNKB 4P5OE 4OZDA 1NCZA 1QASA 3LCPC 4JQ0D 2I94A 3GK2A 1NP8A 5BPJA 2WORA 2ZNEA 4CPVA 1SYMA 3VRPA 4F0ZB 1QS7A 1S6JA 1BJFA 2L4IA 3JTDC 4I5NB 3RLZA 5G08A 3I5HB 2NZ0A 1A2XA 4M2PA 1K9UA 2K61A 4ETOA 1CNPA 3UO9A 2NCPA 3CR5X 2H61C 3BFBA 1CLBA 1CDLA 4DIRA 2LAPA 2LC5A 1TNXA 1ODBA
chains in the Genus database with same CATH topology
3S0EA 4INWA 2ERBA 2WC5A 4FQTA 2WC6A 3Q8IA 2WCMA 3V2LA 3R1VA 3R1OA 4PT1A 3B87A 1QWVA 3B7AA 3B88A 3D77A 2H8VA 3RZSA 1LS8A 3NHIA 3CZ2A 3DY9A 3L4AA 3CDNA 1OOFA 3S0FA 3BJHA 3R1PA 3DXLA 3D76A 3D75A 2QEVA 1GM0A 1ORGA 3QMEA 3NHTA 3FE6A 2JPOA 2QEOA 3S0DA 2QEHA 3DYEA 4INXA 2PQLA 3S0GA 3BFAA 3D78A 2GTEA 3S0BA 1OOIX 3OGNA 1DQEA 4JD9A 3BFHA 1P28A 3L4LA 3CABA 3FE8A 3FE9A 2L2CA 3D74A 3CZ0A 4F7FA 3N7HA 2WCHA 1TUJA 1TWOA 3B86A 5DICA 1OOHA 3CYZA 3VB1A 1C3YA 1C3ZA 1XFRA 3DZTA 2P70A 2QDIA 4OZDA 2QEBA 3D73A 3NGVA 2WCKA 1T14A 2FJYA 3PJIA 3R72A 2P71A 3L47A 1OW4A 1OOGA 3CZ1A 3S0AA 3K1EA 2KPHA 5EL2A 3B6XA 3BFBA 2WCLA 2WCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0E A;  4INW A;  2ERB A;  2WC5 A;  4FQT A;  2WC6 A;  3Q8I A;  2WCM A;  3V2L A;  3R1V A;  3R1O A;  4PT1 A;  3B87 A;  1QWV A;  3B7A A;  3B88 A;  3D77 A;  2H8V A;  3RZS A;  1LS8 A;  3NHI A;  3CZ2 A;  3DY9 A;  3L4A A;  3CDN A;  1OOF A;  3S0F A;  3BJH A;  3R1P A;  3DXL A;  3D76 A;  3D75 A;  2QEV A;  1GM0 A;  1ORG A;  3QME A;  3NHT A;  3FE6 A;  2JPO A;  2QEO A;  3S0D A;  2QEH A;  3DYE A;  4INX A;  2PQL A;  3S0G A;  3BFA A;  3D78 A;  2GTE A;  3S0B A;  1OOI X;  3OGN A;  1DQE A;  4JD9 A;  3BFH A;  1P28 A;  3L4L A;  3CAB A;  3FE8 A;  3FE9 A;  2L2C A;  3D74 A;  3CZ0 A;  4F7F A;  3N7H A;  2WCH A;  1TUJ A;  1TWO A;  3B86 A;  5DIC A;  1OOH A;  3CYZ A;  3VB1 A;  1C3Y A;  1C3Z A;  1XFR A;  3DZT A;  2P70 A;  2QDI A;  4OZD A;  2QEB A;  3D73 A;  3NGV A;  2WCK A;  1T14 A;  2FJY A;  3PJI A;  3R72 A;  2P71 A;  3L47 A;  1OW4 A;  1OOG A;  3CZ1 A;  3S0A A;  3K1E A;  2KPH A;  5EL2 A;  3B6X A;  3BFB A;  2WCL A;  2WCJ A; 
#chains in the Genus database with same CATH topology
 5I2O A;  5ER4 X;  3IQO A;  1QIW A;  2WC5 A;  3NSI A;  2BNX A;  2GGM A;  2F3Z A;  1G33 A;  1XK4 C;  3TS5 B;  1DTL A;  1UHJ A;  2WC6 A;  2Y1N A;  1DJZ A;  3Q8I A;  3BUW B;  1XO5 A;  2K7B A;  4GGN A;  4OV2 A;  5HKZ A;  1CB1 A;  1R6P A;  3AAJ A;  1M31 A;  1PAL A;  1XFW O;  1TNW A;  1AJ5 A;  1F4O A;  2BBN A;  2LLS A;  1TCO B;  3R1O A;  1UHI A;  2Q91 A;  1ZFS A;  2JOJ A;  4DS7 A;  3B87 A;  2JNF A;  3O78 A;  5AXI A;  2K2A A;  3PFV A;  4QJ5 B;  4GUK A;  4HRE E;  5HYD A;  1QWV A;  3ZNI A;  1KK7 Y;  1CMF A;  3DVK A;  1PRW A;  2NXQ A;  2H8V A;  1S26 D;  4BY4 A;  3SG5 A;  4OR9 B;  2BL0 C;  1LVC D;  1XFU O;  1NPQ A;  3CZ2 A;  2K0J A;  4MN0 A;  3CS1 A;  1RJV A;  3D10 A;  3EG5 B;  2HET A;  2I7A A;  1H4B A;  4OKH A;  4M2O A;  2GV5 A;  4CLN A;  3DVJ A;  3L4A A;  1L7Z A;  5K89 A;  1MXE A;  1E8A A;  4PE7 A;  5KSZ A;  3S0F A;  3FWC A;  2CTN A;  3PM8 A;  4A4C A;  2IS9 A;  1CDN A;  1ZUZ A;  4U8D A;  2MLE C;  1FI5 A;  1QVI Y;  2LVI A;  1KFU L;  1OSA A;  3D76 A;  3D75 A;  4ZCV A;  2KHN A;  4QJ4 B;  2LMT A;  2LVK A;  1HT9 A;  3EKJ A;  3QME A;  5CSN A;  4NDC A;  1TTX A;  1YVL A;  2KDH A;  2LP2 A;  2CT9 A;  1IQ3 A;  1OMD A;  1M45 A;  2LVV A;  3OX6 A;  5AER A;  2QEO A;  4WQ2 A;  2RGI A;  3DYE A;  1OMV A;  2ZFD A;  1FW4 A;  1YTZ C;  1DGU A;  1N65 A;  4ORC B;  4XJK A;  1GQM A;  1C7V A;  1DF0 A;  1XA5 A;  2R2I A;  1NSH A;  5B8I B;  1Y1X A;  2BCA A;  2BKI B;  2LP3 A;  3DD4 A;  2KOT A;  1J7R A;  2AMI A;  3FIA A;  3IVT A;  1F70 A;  2TN4 A;  4JD9 A;  5IBW A;  2CNP A;  1P28 A;  2QAC A;  2FCE A;  3L4L A;  1S3P A;  3OB2 B;  4GPL B;  4PE1 A;  3TDI A;  2OTG C;  1YR5 A;  2LUC A;  1JFJ A;  1J1D A;  1EH2 A;  1KSO A;  4YBH B;  2JT3 A;  2O5G A;  3M0W A;  3NSO A;  1UP5 A;  1NCX A;  3CZ0 A;  2KFG A;  4P2Y B;  4PHK A;  4F7F A;  1S36 A;  2COL B;  1TUJ A;  1DVI A;  2JXL A;  3PLF B;  2H2K A;  1CM1 A;  1QAT A;  1NX0 A;  3BUX B;  4AQI A;  2JZI A;  1B8L A;  2BE6 A;  2CCM A;  3TDU A;  3NSL A;  1DMO A;  1CDM A;  2Y1M A;  5JOL A;  1K94 A;  1CTR A;  3C1V A;  1XFR A;  1GJY A;  1ALW A;  1QX2 A;  4XJK B;  1TNP A;  1DF0 B;  1UUS A;  2L50 A;  1RFJ A;  2HPS A;  4I5K A;  1L2O B;  3BQ3 A;  3TUY B;  4CFR A;  2BCX A;  2KGR A;  1N2D A;  4FQO A;  4GGF A;  3AKB A;  1DJH A;  2AUC A;  2L98 A;  1G4Y R;  3DF0 A;  4MEW A;  1NWD A;  1KFX L;  2MHH A;  4YGC B;  2PYQ A;  1SMG A;  4AOM A;  1PSB A;  3GK1 A;  1SKT A;  3CWG A;  2KYF A;  1JC2 A;  2BE4 A;  4MZJ A;  1B7T Y;  3WXA A;  1IG5 A;  1SL8 A;  4N1F A;  1JWD A;  1OOG A;  3S0A A;  5TNC A;  1CLL A;  3OBV A;  3WHT B;  1AJ4 A;  3PM2 A;  2KI4 B;  3B6X A;  3K21 A;  1JBA A;  5GQQ C;  2ZRS A;  2LMV A;  2F33 A;  4PHJ A;  5I8N A;  1NUB A;  1C7W A;  2GGZ A;  4C0K A;  1JUO A;  3PN7 C;  1G8I A;  4FQT A;  3E3R A;  1WRL A;  3KEV A;  4YI9 A;  5D69 A;  5DKQ A;  1IJ6 A;  3V2L A;  3DF0 B;  1MWN A;  1VRK A;  3NSK A;  4PAL A;  4PT1 A;  1KQM B;  1PVA A;  2NCO A;  1B7T Z;  1SY9 A;  2M97 A;  1M46 A;  1AUI B;  1WDC B;  3A8R A;  1SSE B;  3B88 A;  2KFH A;  1BMO A;  1DC1 A;  2OPO A;  1QTX A;  2E6W A;  1LKJ A;  3OHM B;  2VRG A;  1CFC A;  1MUX A;  2H61 A;  2MBX A;  1ZMZ A;  3SG3 A;  3LK1 A;  1K8U A;  3JVT B;  2DOQ A;  1QV1 A;  3DY9 A;  1A4P A;  1DGV A;  1SR6 C;  2L0P A;  5F6T A;  2MJW B;  1YX7 A;  1GGW A;  1DEL A;  1XFX O;  2KQ6 A;  1XK4 A;  3BUM B;  1AVS A;  2PMY A;  1K93 D;  1QXP A;  3TDZ A;  4FTG A;  1QIV A;  1A29 A;  1BG1 A;  1B8R A;  1SRA A;  2K60 A;  5HLO A;  2HF5 A;  4L9M A;  1W9Z A;  1AP4 A;  1GM0 A;  3JTD B;  4I5L B;  5CSF A;  1LA3 A;  1SCM C;  1SCV A;  1B47 A;  3SG4 A;  2WCF A;  1UWO A;  3CZT X;  4M2Q A;  1V1G A;  2BCB A;  2L5Y A;  1F54 A;  4Q04 A;  2QEH A;  2KBI A;  1NIW A;  1KQV A;  5HKY A;  1Y0V H;  1Y6W A;  3I5G C;  1QX7 A;  3S0G A;  1S6C A;  3BFA A;  1XFV O;  2A4J A;  2AAO A;  3BUO B;  1M63 B;  1CFP A;  1OOI X;  2K7O A;  3BOW A;  3SS4 A;  4MZL A;  3I5F C;  1DEK A;  1KWO C;  4QJ3 B;  4YGD B;  3KO0 A;  4ORA B;  3FE9 A;  2LM5 A;  2FJU B;  1DJW A;  1R2U A;  3QRX A;  4DCK A;  1LIN A;  3RM1 A;  3OX5 A;  1IGV A;  1V1F A;  3SIB A;  2M29 A;  1TWO A;  5KTY A;  5DIC A;  4PE4 A;  1OOH A;  2M1K B;  5DKR A;  2BL0 B;  1DJY A;  3VB1 A;  2M9G A;  1C3Z A;  3DZT A;  3UNW A;  1TNQ A;  1C3Y A;  2P70 A;  4HRG A;  1OZS A;  2QEB A;  2BEC A;  2M1U A;  2PVB A;  3BOW B;  1QJT A;  2M7N A;  4MVF A;  1OZO A;  3ZWH A;  2QPT A;  1IWQ A;  1X02 A;  2JU0 A;  3DVM A;  2WCE A;  5I2L A;  4USL A;  1YRU B;  2KLD A;  1CFF A;  1JSA A;  2WCK A;  1T14 A;  3I5I C;  4MLW A;  5J3X A;  2WND A;  2M8U A;  1F4Q A;  3PJI A;  3SG7 A;  1AHR A;  1EG3 A;  2KLE A;  2LNK A;  1BLQ A;  2ISD A;  2ZRT A;  2M0R A;  1OW4 A;  3CZ1 A;  1CKK A;  1W7J B;  3IF7 A;  2G9B A;  2BAP A;  4PDZ A;  1NYA A;  1CFD A;  3PSR A;  2KI6 C;  1DJG A;  5JJG A;  1REC A;  3S0E A;  2LVJ A;  4INW A;  2ERB A;  3FWB A;  4WRI A;  4YRU A;  2P6B B;  1KK8 C;  2K7D A;  2I2R E;  1SL9 A;  2M7L A;  2FCD A;  2F8P A;  3LK0 A;  1N0Y A;  2LLT A;  2O60 A;  2WCM A;  2M49 B;  1UHK A;  2PAL A;  3R1V A;  4PE0 A;  3SS5 A;  3D0Y A;  5HKW A;  1AK8 A;  1WRZ A;  2LMU A;  1MQ1 A;  2LV7 A;  1DT7 B;  3BYA A;  1QX5 B;  2OTG B;  2EGD A;  5FYX A;  2BBM A;  2OS8 C;  2JWW A;  3D77 A;  3AAK A;  2FOT A;  1XFZ O;  2JNX A;  1PK0 D;  4PHN A;  3MSE B;  3LL8 B;  1IH0 A;  1YRT B;  3GK4 X;  1LS8 A;  1H8B A;  3CTN A;  1YUU A;  2KYC A;  2L5X B;  2ZN8 A;  2K8M B;  5D3O A;  1SW8 A;  1KFU S;  4A4B A;  1KSM A;  2EC6 C;  1Z2C B;  1B8C A;  2KAY A;  4WQ3 A;  4D1E A;  5FI7 A;  2MAZ A;  5I2Q A;  3IQQ A;  1RRO A;  5AEQ A;  1IKU A;  2CXJ A;  1WY9 A;  1ALV A;  4ZCU A;  4DUQ A;  3D0Y B;  3R1P A;  2WCB A;  4HSZ A;  4CID A;  2KAV A;  4JKT A;  1A03 A;  3DXL A;  4R1E A;  3VGO A;  5I94 A;  3EK7 A;  3I5H C;  1MHO A;  2KNE A;  2MA2 A;  2MLF C;  3NXA A;  4PCW A;  4YGB B;  1BOC A;  2KQY A;  1RWY A;  1FBV A;  1ZOT B;  1QLK A;  4C0L A;  3A4U B;  1F55 A;  1SBJ A;  3NHT A;  2WC8 A;  2JTZ A;  3KPX A;  2BKH B;  4MZK A;  1M39 A;  1NCY A;  4MSP A;  4INX A;  4N1G A;  2PQL A;  1S6I A;  1UUR A;  1YUR A;  1CMG A;  2K7C A;  2V53 A;  4GBA A;  5HLV A;  3TS5 C;  1B1G A;  3F45 A;  3D78 A;  3PN7 B;  1BT6 A;  2GTE A;  5PAL A;  2Q4U A;  2M3W A;  3S0B A;  3OGN A;  2JPT A;  1DQE A;  1WRK A;  3BFH A;  3SG2 A;  1WLM A;  4I5J A;  3CAB A;  3FE8 A;  2ZKM X;  3FS7 A;  1SL7 A;  3KF9 A;  3VRR A;  3O4Y A;  1J7P A;  1U5I A;  1Z4H A;  3EVV A;  4PHM A;  1K9P A;  3CGA A;  3N7H A;  3EVR A;  4IL1 A;  5FI2 A;  1C07 A;  1KFX S;  3EK8 A;  1BOD A;  1PSR A;  1Y1U A;  1FF1 A;  3GOF A;  3EKH A;  1SNL A;  4NDD A;  2JT8 A;  5ER5 A;  1J55 A;  1KCY A;  3CYZ A;  3O6B A;  2LCP A;  1MR8 A;  1F8H A;  1EXR A;  1BR1 B;  3VRO A;  2QDI A;  4IJ7 A;  3D73 A;  1SR6 B;  4OVN F;  1BR4 B;  3SIA A;  1IJ5 A;  5CSJ A;  2SCP A;  3WHU B;  1DJX A;  3NGV A;  1TRF A;  1IQ5 A;  3CLN A;  2HQ8 A;  2LAN A;  2FJY A;  2LHL A;  2LHI A;  4KYN A;  3R72 A;  2P71 A;  3WNX B;  1U5I B;  3HX4 A;  3L47 A;  1K96 A;  5AFP A;  3HCM A;  1YX8 A;  3EK4 A;  1NX1 A;  1IIO A;  1Q80 A;  1SCM B;  3K1E A;  4JWQ A;  1OMR A;  5EL2 A;  1SK6 D;  5KU1 A;  1CDP A;  1PVB A;  1UHH A;  2JT0 A;  5FI6 A;  1J7O A;  2KI6 D;  1IRJ A;  2KPH A;  2LLU A;  2WCL A;  2WCJ A;  4YGA A;  2PSR A;  1K2H A;  2WOS A;  1RTP 1;  4YI8 A;  4YGE B;  2JTT A;  2PRU A;  1TOP A;  4OCI A;  2L4H A;  3I5G B;  4XYN A;  1UHN A;  1CM4 A;  4BY5 A;  2I18 A;  4ICB A;  1HQV A;  5D7F A;  1A75 A;  2KGB C;  3I5F B;  1KWO B;  1K9K A;  1FI6 A;  2MRD A;  1JF2 A;  2Y4Q A;  1KK7 Z;  1OQP A;  2PAS A;  1K90 D;  3B7A A;  2G2B A;  1EG4 A;  2JQ6 A;  2LE9 B;  2YGU A;  3BXK A;  1OE9 B;  1J1E A;  3OB1 B;  2JUL A;  3RZS A;  1S1E A;  4CFQ A;  2Y5I A;  3NHI A;  2JRF A;  1J7Q A;  4UPG A;  2EHB A;  2ZND A;  3TUY C;  1BU3 A;  1L2O C;  1NX2 A;  1EL4 A;  4JPZ B;  3O2P A;  2KAX A;  3SJS A;  4NQG A;  3CDN A;  5AAN A;  1OOF A;  1TN4 A;  3AKA A;  1YVH A;  2K2F A;  5DKN A;  1A75 B;  1GGZ A;  1XYD A;  1TCF A;  1NX3 A;  3BJH A;  3VRN A;  2F2O A;  3H4S E;  2D8N A;  1LXF C;  4ORB B;  3SG6 A;  1QVI Z;  4MRY A;  1D1O A;  4TNC A;  2L2E A;  1S5G Y;  3I5I B;  1SPY A;  3TZ1 A;  2QEV A;  1ORG A;  1WLZ A;  2HQW A;  1DJI A;  1EJ3 A;  1XVJ A;  4GFT A;  4C0J A;  2KI4 C;  5CPV A;  2JC2 A;  4AQJ A;  1OOJ A;  3FE6 A;  2B1U A;  2JPO A;  4HRH A;  1F71 A;  4N5X A;  4MRX A;  3S0D A;  3PAT A;  3PAL A;  3OP0 A;  5HL1 A;  1FPW A;  4GGF C;  2NLN A;  2KFF A;  1JF0 A;  1Y1A A;  1KK8 B;  2L51 A;  1PUL A;  1YUT A;  4GAO A;  3DVE A;  2F2P A;  1YUS A;  3KHE A;  2JXC A;  1ZAC A;  1JFK A;  1S5G Z;  1KQM C;  1TIZ A;  3CR4 X;  4MBE A;  1XFY O;  1B4C A;  3ICB A;  1WDC C;  2ZN9 A;  3SS3 A;  2L2C A;  4E68 A;  3D74 A;  2OS8 B;  3EVU A;  1MXL C;  2CBL A;  1K95 A;  1LA0 A;  2LUX A;  4NDB A;  3VRQ A;  1BF5 A;  2WCH A;  1RK9 A;  3LLE A;  4DRW A;  3B86 A;  3BUN B;  1QLS A;  3O4X A;  2F3Y A;  1CLM A;  2SAS A;  3CR2 A;  2E30 A;  2KSP A;  3JVT C;  1B9A A;  5CSI A;  1MF8 B;  1QV0 A;  1W7I B;  2KBM A;  1TUZ A;  2EC6 B;  4GNK B;  4P5O E;  4OZD A;  1NCZ A;  1QAS A;  3LCP C;  4JQ0 D;  2I94 A;  3GK2 A;  1NP8 A;  5BPJ A;  2WOR A;  2ZNE A;  4CPV A;  1SYM A;  3VRP A;  4F0Z B;  1QS7 A;  1S6J A;  1BJF A;  2L4I A;  3JTD C;  4I5N B;  3RLZ A;  5G08 A;  3I5H B;  2NZ0 A;  1A2X A;  4M2P A;  1K9U A;  2K61 A;  4ETO A;  1CNP A;  3UO9 A;  2NCP A;  3CR5 X;  2H61 C;  3BFB A;  1CLB A;  1CDL A;  4DIR A;  2LAP A;  2LC5 A;  1TNX A;  1ODB A; 
#chains in the Genus database with same CATH homology
 3S0E A;  4INW A;  2ERB A;  2WC5 A;  4FQT A;  2WC6 A;  3Q8I A;  2WCM A;  3V2L A;  3R1V A;  3R1O A;  4PT1 A;  3B87 A;  1QWV A;  3B7A A;  3B88 A;  3D77 A;  2H8V A;  3RZS A;  1LS8 A;  3NHI A;  3CZ2 A;  3DY9 A;  3L4A A;  3CDN A;  1OOF A;  3S0F A;  3BJH A;  3R1P A;  3DXL A;  3D76 A;  3D75 A;  2QEV A;  1GM0 A;  1ORG A;  3QME A;  3NHT A;  3FE6 A;  2JPO A;  2QEO A;  3S0D A;  2QEH A;  3DYE A;  4INX A;  2PQL A;  3S0G A;  3BFA A;  3D78 A;  2GTE A;  3S0B A;  1OOI X;  3OGN A;  1DQE A;  4JD9 A;  3BFH A;  1P28 A;  3L4L A;  3CAB A;  3FE8 A;  3FE9 A;  2L2C A;  3D74 A;  3CZ0 A;  4F7F A;  3N7H A;  2WCH A;  1TUJ A;  1TWO A;  3B86 A;  5DIC A;  1OOH A;  3CYZ A;  3VB1 A;  1C3Y A;  1C3Z A;  1XFR A;  3DZT A;  2P70 A;  2QDI A;  4OZD A;  2QEB A;  3D73 A;  3NGV A;  2WCK A;  1T14 A;  2FJY A;  3PJI A;  3R72 A;  2P71 A;  3L47 A;  1OW4 A;  1OOG A;  3CZ1 A;  3S0A A;  3K1E A;  2KPH A;  5EL2 A;  3B6X A;  3BFB A;  2WCL A;  2WCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...