3L4AA

Crystal structure of an anopheles gambiae odorant-binding protein 22a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
134
structure length
121
Chain Sequence
NESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMYQNNNELWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein (AGAP010409-PA)
publication title The Crystal Structure of an Anopheles gambiae Odorant-binding Protein AgamOBP22a and complexes with Bound Odorants
rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 46
structure length 121
sequence length 134
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3l4aA00
1P28A 1OW4A 3R72A 4INXA 3R1PA 1TUJA 2WCKA 3L4AA 2WC5A 2GTEA 3B86A 1OOHA 4PT1A 3DXLA 2WCJA 3BJHA 1OOFA 3CZ1A 3D74A 3R1VA 2JPOA 3NHIA 2L2CA 3QMEA 1T14A 3L47A 1C3ZA 3Q8IA 2WCHA 2WCMA 3S0DA 1LS8A 2H8VA 3CABA 3DZTA 4INWA 3BFHA 3PJIA 1GM0A 3N7HA 3K1EA 3BFAA 3D73A 3S0AA 2WCLA 3DY9A 2QEBA 3CZ0A 3D76A 1OOIX 2QDIA 2PQLA 1TWOA 3FE8A 3NHTA 2QEVA 3D77A 2QEOA 3L4LA 3B88A 5DICA 3FE9A 3CZ2A 3S0GA 1ORGA 1QWVA 1DQEA 4F7FA 3BFBA 2WC6A 4OZDA 3DYEA 3R1OA 1OOGA 4FQTA 2FJYA 2P71A 1C3YA 2QEHA 4JD9A 3V2LA 3D78A 3CYZA 3OGNA 2ERBA 3D75A 3S0EA 3VB1A 3CDNA 3NGVA 3B87A 3B6XA 3FE6A 5EL2A 3S0BA 3S0FA 2P70A 3B7AA 2KPHA 1XFRA 3RZSA
chains in the Genus database with same CATH superfamily
1NPQA 3TDZA 3NSOA 1MHOA 1LA3A 1G33A 1EH2A 1OMVA 3AAJA 2K7OA 4PE4A 1TUJA 2WCKA 1B4CA 2H61C 2EC6C 2RGIA 3B86A 4HRHA 1CNPA 1SCMC 4UPGA 3DXLA 2HQWA 3SS5A 1C7WA 2WCJA 1UHJA 2LVJA 3BJHA 3NSKA 2JZIA 3CZ1A 4WQ2A 3PM2A 1J55A 2M7LA 1IGVA 1K90D 3EVUA 2LC5A 3DVEA 1RWYA 1M63B 3NXAA 3NHIA 4AQIA 1OZOA 1B1GA 2BBNA 1YTZC 1MF8B 2Q91A 2Q4UA 3TZ1A 1B8CA 2BECA 1PRWA 1RTP1 4M2PA 5K89A 4YI8A 1OQPA 3BUNB 1J1EA 1T14A 5BPJA 1SCVA 1DF0B 1MXLC 1SL8A 2F2PA 2LLUA 2ZKMX 4WQ3A 1BMOA 1C7VA 4GUKA 1CMGA 2MJWB 1C3ZA 1EG3A 1JSAA 1MUXA 5CSNA 4MZJA 2KAYA 1JUOA 1WRLA 3BQ3A 1LS8A 3TUYC 2KAVA 2L5XB 1QTXA 3DZTA 1NCYA 2K0JA 3WHUB 1SMGA 2L4IA 1A2XA 1QX7A 3FWBA 2JT0A 2CTNA 1WRZA 1DC1A 1CDNA 2FOTA 2WOSA 1CB1A 1TNXA 2KLEA 1AJ4A 1SYMA 1QX5B 3BFAA 3UNWA 1HQVA 3IQOA 1KFUL 3LLEA 2WCLA 1NCXA 1TIZA 2F8PA 3I5HB 3D76A 2JTZA 3ZWHA 5KSZA 1DJGA 3CZTX 2K2FA 3PALA 2M7NA 1AP4A 2KYCA 1J7OA 2G9BA 4GPLB 5GQQC 2JT8A 3L4LA 4XYNA 1IQ5A 4QJ3B 1PVBA 4C0LA 4I5KA 1LA0A 1DJHA 3IQQA 1JF2A 1WLZA 4IJ7A 3FE9A 2L2EA 2H2KA 2M8UA 1KFUS 1TNPA 1MQ1A 1XFZO 1LKJA 4DRWA 2LHLA 1SPYA 1A75A 3BOWB 1QWVA 1YVLA 2JTTA 4XJKB 5CSJA 1WDCB 5AERA 3GK4X 1CMFA 3BFBA 2WC6A 2PVBA 3DD4A 3R1OA 4NDBA 1ZFSA 1S26D 5IBWA 1B47A 3ZNIA 4OR9B 4F0ZB 2L4HA 4HREE 4ZCVA 2QPTA 3OX5A 2D8NA 1SY9A 2LCPA 2JOJA 5FI2A 1UHNA 2LANA 4E68A 1NX2A 3V2LA 1F54A 3D78A 4PHKA 5HKZA 1KK7Y 3OBVA 2KFGA 3A8RA 1K93D 3O4YA 3IVTA 2KGBC 2JU0A 3CYZA 3ICBA 1BLQA 2I94A 1ZMZA 3BXKA 1QLSA 2LHIA 5FYXA 5HLVA 2M1UA 3VB1A 1WLMA 2MAZA 1SW8A 2LUXA 2LM5A 3EK4A 1AK8A 3DVJA 2HF5A 4TNCA 2Y1NA 3BYAA 5I94A 3B6XA 3SIBA 3CLNA 1NWDA 1SSEB 2CT9A 2LMVA 4ZCUA 5DKRA 2KFHA 3EK8A 4JQ0D 1YUSA 2PMYA 1K2HA 1PULA 5HYDA 4INXA 3R72A 1SRAA 3I5HC 1YUUA 2OTGB 2WC5A 2F3YA 2GTEA 2OS8C 1TRFA 1DJXA 1IQ3A 1N65A 2F2OA 1DJWA 1SK6D 5DKQA 3CR4X 1OOFA 3BUMB 5ER5A 2BE4A 2F33A 2BCBA 1WY9A 1XFYO 1DGUA 2HPSA 2O60A 1RECA 1V1FA 2K61A 1IH0A 2O5GA 3QMEA 4OCIA 4YGEB 1BJFA 3FIAA 3VRPA 5HL1A 4OV2A 1ALWA 1LVCD 1DTLA 2KBIA 2CXJA 1SR6B 2LAPA 1TOPA 1PSRA 3I5GC 4P2YB 4DIRA 3PSRA 1BOCA 3HCMA 2M3WA 4AOMA 1PK0D 2NZ0A 3Q8IA 2WCHA 1OMRA 2K60A 2WCMA 3EG5B 1XA5A 1LXFC 4QJ4B 2IS9A 3CABA 1CFDA 2L5YA 4DCKA 3PJIA 3JVTB 5I2LA 2K8MB 2E6WA 4YBHB 1M46A 1S36A 5HKYA 3I5IC 1CM1A 1ODBA 3K1EA 3S0AA 1OOJA 2L0PA 3DY9A 5I2OA 1NP8A 2OPOA 1QX2A 1KK7Z 2CBLA 2M97A 3CWGA 3SG2A 4BY5A 1M45A 3VRQA 2GGMA 3A4UB 1DF0A 1V1GA 3RM1A 4MLWA 3FWCA 1FF1A 1DJIA 3UO9A 1RK9A 1JFJA 1S6JA 3D0YB 3D77A 4NDCA 2G2BA 2BL0B 3HX4A 4MZLA 4OVNF 4PHMA 2L50A 2VRGA 3B88A 4M2OA 3O2PA 4YGDB 1KK8B 2KGRA 2OTGC 4GGFA 1XYDA 1YX8A 1OSAA 2M29A 4MZKA 1C07A 1F55A 3KO0A 3FS7A 2BKIB 1NYAA 3PM8A 1BG1A 1ZOTB 5FI6A 1B9AA 1FI6A 3S0GA 2M0RA 1DELA 1ORGA 2K7CA 3MSEB 1H8BA 1DEKA 1Y1XA 3TS5C 4F7FA 3EKJA 2R2IA 3PN7C 2LMUA 1Y1AA 2COLB 3AAKA 1M31A 1OOGA 1S1EA 2GGZA 1TNWA 3JTDC 4YI9A 2KLDA 4I5JA 1RFJA 1KQMC 5ER4X 3KEVA 2I7AA 2TN4A 5AANA 2QEHA 2KAXA 2KI4B 4JD9A 1GJYA 2MLFC 2ZN9A 2KI6D 3LL8B 4HRGA 1NCZA 1SL9A 1FBVA 1GGZA 1S6IA 3AKBA 1D1OA 1CKKA 4FTGA 3NGVA 2L98A 3B87A 4AQJA 1XFVO 2KI6C 2ZRSA 2BCXA 3BOWA 4XJKA 5EL2A 2I18A 1JBAA 2P70A 2ZN8A 5CPVA 1XFRA 1HT9A 1N0YA 2ZNEA 1P28A 2KOTA 1A4PA 1OW4A 1S5GY 1JF0A 2BBMA 2KQYA 3BUXB 1EL4A 3OHMB 3L4AA 1EXRA 4ORBB 3SS3A 3QRXA 2FCEA 1CFCA 1OOHA 1QATA 5CSFA 1AJ5A 1X02A 3NSIA 2ZRTA 2JPOA 4GGFC 1K9PA 1QVIY 1KWOB 3WHTB 1NX3A 3LCPC 3SIAA 1B7TZ 1FW4A 2L2CA 2MHHA 4CFRA 4GAOA 1GGWA 2GV5A 1CFPA 2WORA 3SG5A 1R6PA 2HETA 2KYFA 1PALA 4IL1A 1N2DA 1RROA 5HKWA 1DJZA 2EC6B 2LVVA 4MEWA 5AFPA 1SCMB 1E8AA 3OP0A 4GBAA 3L47A 2KFFA 3VGOA 4A4CA 2KHNA 4USLA 1QIVA 2I2RE 1UHKA 2AAOA 2E30A 4PHNA 1NSHA 1NIWA 1K9KA 4HSZA 1CLMA 4C0JA 1IKUA 2LP2A 4Q04A 2LMTA 4R1EA 5D3OA 1J7RA 3NSLA 2B1UA 4DUQA 4INWA 3TDIA 1U5IA 1U5IB 2P6BB 2BAPA 3PFVA 2PSRA 3EVRA 4D1EA 2CNPA 3I5FB 3N7HA 2WCFA 1YVHA 1GM0A 5AXIA 1CDMA 1W9ZA 1GQMA 2Y4QA 3D73A 3OB1B 1BT6A 1FI5A 2NXQA 2QEBA 4YRUA 2PYQA 3TDUA 5PALA 4NDDA 1WDCC 1XFWO 3BUOB 1OOIX 1XK4A 1S3PA 1UWOA 3TUYB 1TWOA 1EJ3A 3FE8A 3PLFB 2SCPA 3CTNA 1UHIA 4BY4A 1Y1UA 3CR5X 2PALA 1DJYA 2Y5IA 5D69A 5F6TA 4OKHA 1F8HA 4MRXA 1L2OB 5JOLA 3KF9A 1AVSA 4QJ5B 4N5XA 2LE9B 1MWNA 1F4OA 2LLSA 3E3RA 1S5GZ 4U8DA 1DQEA 2JNFA 3K21A 4OZDA 3CGAA 1QV0A 1BR1B 2KBMA 3DYEA 1KFXL 1WRKA 3DVKA 4GNKB 4PDZA 4PALA 2LNKA 3M0WA 4N1FA 3KHEA 1DT7B 2K7BA 3KPXA 1H4BA 2WCEA 1ZUZA 1Y6WA 4JPZB 4FQOA 2P71A 1B8LA 3VROA 1KSMA 1A03A 1C3YA 2JNXA 1B7TY 1TCOB 2EHBA 5DKNA 1DMOA 3D0YA 1QIWA 1QLKA 2WC8A 1QVIZ 3SS4A 1XO5A 3O4XA 4CLNA 1AHRA 1PVAA 3OGNA 2ZFDA 2LUCA 4MBEA 1TUZA 3S0EA 1JWDA 5AEQA 1K96A 1K94A 1QXPA 1ALVA 1YRTB 4P5OE 1KFXS 2V53A 1KCYA 4KYNA 1IJ6A 1CLLA 5I8NA 3FE6A 3S0BA 2BCAA 1W7JB 1F4QA 4L9MA 1NX1A 3I5FC 3B7AA 3EKHA 2KPHA 2LVKA 2LLTA 2MLEC 3VRRA 4PCWA 1R2UA 3SG3A 1DGVA 2K2AA 3R1PA 2JXCA 1TTXA 3AKAA 1SBJA 2KNEA 4JWQA 1SR6C 1XK4C 2LVIA 2SASA 4PT1A 2KDHA 4N1GA 1F71A 1KQVA 3CS1A 1K9UA 2ISDA 1IG5A 1CFFA 4MN0A 4ORAB 2HQ8A 3OX6A 3D74A 4GFTA 4MVFA 3VRNA 1XFXO 5KTYA 3R1VA 3SG4A 3O78A 1L2OC 3GK1A 4YGAA 2NCOA 1SL7A 1L7ZA 3DF0A 4CIDA 2L51A 3DF0B 3JVTC 1J7QA 5CSIA 2JQ6A 1RJVA 3IF7A 2JT3A 5FI7A 2OS8B 1BR4B 1W7IB 1M39A 1B8RA 2FCDA 2M1KB 4M2QA 3GK2A 2QACA 1S6CA 5I2QA 1SKTA 3C1VA 5KU1A 5JJGA 1BODA 2BNXA 1OMDA 3S0DA 1YRUB 2H8VA 2BL0C 2M9GA 1SNLA 2JPTA 3BFHA 3O6BA 2Y1MA 4C0KA 1A75B 1KK8C 1LINA 2LP3A 1YUTA 5TNCA 2MA2A 1EG4A 3SG6A 2JC2A 1JFKA 3I5GB 4I5NB 1CTRA 3BUWB 3CZ0A 3LK1A 3EVVA 1ZACA 2WCBA 2KQ6A 1F70A 1Z4HA 1VRKA 2H61A 1MXEA 4ORCB 1TN4A 2QDIA 2PQLA 1CDLA 1KSOA 1CDPA 1MR8A 1K95A 1UHHA 1OE9B 1NX0A 1YURA 2QEVA 2YGUA 2QEOA 3EK7A 3NHTA 4GGNA 3CR2A 4CPVA 2BKHB 4YGBB 5G08A 4ETOA 1J1DA 1DVIA 3SG7A 1IIOA 2JULA 4PE0A 1QASA 2PASA 5B8IB 4PE7A 2KI4C 2DOQA 5DICA 2KSPA 1XFUO 3I5IB 2NLNA 4PE1A 3CZ2A 3PATA 3SJSA 1JC2A 1XVJA 4WRIA 1OZSA 1PSBA 1QS7A 1TNQA 1FPWA 3WXAA 2CCMA 1CM4A 2JRFA 3F45A 1A29A 4FQTA 1QV1A 4YGCB 4DS7A 5D7FA 1TCFA 1K8UA 4ICBA 3WNXB 2FJYA 1Z2CB 3H4SE 5HLOA 1BF5A 4MRYA 1Q80A 3GOFA 4CFQA 1UUSA 3D10A 2A4JA 1BU3A 2AMIA 2NCPA 3DVMA 1YX7A 4MSPA 1J7PA 1UURA 5J3XA 3LK0A 1UP5A 2MRDA 2ERBA 3D75A 4NQGA 4PHJA 2LV7A 1AUIB 3TS5B 3CDNA 2MBXA 2JXLA 3PN7B 2BE6A 2AUCA 1QJTA 2ZNDA 3OB2B 1G4YR 2F3ZA 2M49B 2JWWA 4I5LB 4A4BA 1Y0VH 3JTDB 2K7DA 2WNDA 1YR5A 1CLBA 4JKTA 3S0FA 1IRJA 2PRUA 1KQMB 1KWOC 1IWQA 1NUBA 2EGDA 3RZSA 1IJ5A 3RLZA 2FJUB 1G8IA
chains in the Genus database with same CATH topology
1P28A 1OW4A 3R72A 4INXA 3R1PA 1TUJA 2WCKA 3L4AA 2WC5A 2GTEA 3B86A 1OOHA 4PT1A 3DXLA 2WCJA 3BJHA 1OOFA 3CZ1A 3D74A 3R1VA 2JPOA 3NHIA 2L2CA 3QMEA 1T14A 3L47A 1C3ZA 3Q8IA 2WCHA 2WCMA 3S0DA 1LS8A 2H8VA 3CABA 3DZTA 4INWA 3BFHA 3PJIA 1GM0A 3N7HA 3K1EA 3BFAA 3D73A 3S0AA 2WCLA 3DY9A 2QEBA 3CZ0A 3D76A 1OOIX 2QDIA 2PQLA 1TWOA 3FE8A 3NHTA 2QEVA 3D77A 2QEOA 3L4LA 3B88A 5DICA 3FE9A 3CZ2A 3S0GA 1ORGA 1QWVA 1DQEA 4F7FA 3BFBA 2WC6A 4OZDA 3DYEA 3R1OA 1OOGA 4FQTA 2FJYA 2P71A 1C3YA 2QEHA 4JD9A 3V2LA 3D78A 3CYZA 3OGNA 2ERBA 3D75A 3S0EA 3VB1A 3CDNA 3NGVA 3B87A 3B6XA 3FE6A 5EL2A 3S0BA 3S0FA 2P70A 3B7AA 2KPHA 1XFRA 3RZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P28 A;  1OW4 A;  3R72 A;  4INX A;  3R1P A;  1TUJ A;  2WCK A;  3L4A A;  2WC5 A;  2GTE A;  3B86 A;  1OOH A;  4PT1 A;  3DXL A;  2WCJ A;  3BJH A;  1OOF A;  3CZ1 A;  3D74 A;  3R1V A;  2JPO A;  3NHI A;  2L2C A;  3QME A;  1T14 A;  3L47 A;  1C3Z A;  3Q8I A;  2WCH A;  2WCM A;  3S0D A;  1LS8 A;  2H8V A;  3CAB A;  3DZT A;  4INW A;  3BFH A;  3PJI A;  1GM0 A;  3N7H A;  3K1E A;  3BFA A;  3D73 A;  3S0A A;  2WCL A;  3DY9 A;  2QEB A;  3CZ0 A;  3D76 A;  1OOI X;  2QDI A;  2PQL A;  1TWO A;  3FE8 A;  3NHT A;  2QEV A;  3D77 A;  2QEO A;  3L4L A;  3B88 A;  5DIC A;  3FE9 A;  3CZ2 A;  3S0G A;  1ORG A;  1QWV A;  1DQE A;  4F7F A;  3BFB A;  2WC6 A;  4OZD A;  3DYE A;  3R1O A;  1OOG A;  4FQT A;  2FJY A;  2P71 A;  1C3Y A;  2QEH A;  4JD9 A;  3V2L A;  3D78 A;  3CYZ A;  3OGN A;  2ERB A;  3D75 A;  3S0E A;  3VB1 A;  3CDN A;  3NGV A;  3B87 A;  3B6X A;  3FE6 A;  5EL2 A;  3S0B A;  3S0F A;  2P70 A;  3B7A A;  2KPH A;  1XFR A;  3RZS A; 
#chains in the Genus database with same CATH topology
 1NPQ A;  3TDZ A;  3NSO A;  1MHO A;  1LA3 A;  1G33 A;  1EH2 A;  1OMV A;  3AAJ A;  2K7O A;  4PE4 A;  1TUJ A;  2WCK A;  1B4C A;  2H61 C;  2EC6 C;  2RGI A;  3B86 A;  4HRH A;  1CNP A;  1SCM C;  4UPG A;  3DXL A;  2HQW A;  3SS5 A;  1C7W A;  2WCJ A;  1UHJ A;  2LVJ A;  3BJH A;  3NSK A;  2JZI A;  3CZ1 A;  4WQ2 A;  3PM2 A;  1J55 A;  2M7L A;  1IGV A;  1K90 D;  3EVU A;  2LC5 A;  3DVE A;  1RWY A;  1M63 B;  3NXA A;  3NHI A;  4AQI A;  1OZO A;  1B1G A;  2BBN A;  1YTZ C;  1MF8 B;  2Q91 A;  2Q4U A;  3TZ1 A;  1B8C A;  2BEC A;  1PRW A;  1RTP 1;  4M2P A;  5K89 A;  4YI8 A;  1OQP A;  3BUN B;  1J1E A;  1T14 A;  5BPJ A;  1SCV A;  1DF0 B;  1MXL C;  1SL8 A;  2F2P A;  2LLU A;  2ZKM X;  4WQ3 A;  1BMO A;  1C7V A;  4GUK A;  1CMG A;  2MJW B;  1C3Z A;  1EG3 A;  1JSA A;  1MUX A;  5CSN A;  4MZJ A;  2KAY A;  1JUO A;  1WRL A;  3BQ3 A;  1LS8 A;  3TUY C;  2KAV A;  2L5X B;  1QTX A;  3DZT A;  1NCY A;  2K0J A;  3WHU B;  1SMG A;  2L4I A;  1A2X A;  1QX7 A;  3FWB A;  2JT0 A;  2CTN A;  1WRZ A;  1DC1 A;  1CDN A;  2FOT A;  2WOS A;  1CB1 A;  1TNX A;  2KLE A;  1AJ4 A;  1SYM A;  1QX5 B;  3BFA A;  3UNW A;  1HQV A;  3IQO A;  1KFU L;  3LLE A;  2WCL A;  1NCX A;  1TIZ A;  2F8P A;  3I5H B;  3D76 A;  2JTZ A;  3ZWH A;  5KSZ A;  1DJG A;  3CZT X;  2K2F A;  3PAL A;  2M7N A;  1AP4 A;  2KYC A;  1J7O A;  2G9B A;  4GPL B;  5GQQ C;  2JT8 A;  3L4L A;  4XYN A;  1IQ5 A;  4QJ3 B;  1PVB A;  4C0L A;  4I5K A;  1LA0 A;  1DJH A;  3IQQ A;  1JF2 A;  1WLZ A;  4IJ7 A;  3FE9 A;  2L2E A;  2H2K A;  2M8U A;  1KFU S;  1TNP A;  1MQ1 A;  1XFZ O;  1LKJ A;  4DRW A;  2LHL A;  1SPY A;  1A75 A;  3BOW B;  1QWV A;  1YVL A;  2JTT A;  4XJK B;  5CSJ A;  1WDC B;  5AER A;  3GK4 X;  1CMF A;  3BFB A;  2WC6 A;  2PVB A;  3DD4 A;  3R1O A;  4NDB A;  1ZFS A;  1S26 D;  5IBW A;  1B47 A;  3ZNI A;  4OR9 B;  4F0Z B;  2L4H A;  4HRE E;  4ZCV A;  2QPT A;  3OX5 A;  2D8N A;  1SY9 A;  2LCP A;  2JOJ A;  5FI2 A;  1UHN A;  2LAN A;  4E68 A;  1NX2 A;  3V2L A;  1F54 A;  3D78 A;  4PHK A;  5HKZ A;  1KK7 Y;  3OBV A;  2KFG A;  3A8R A;  1K93 D;  3O4Y A;  3IVT A;  2KGB C;  2JU0 A;  3CYZ A;  3ICB A;  1BLQ A;  2I94 A;  1ZMZ A;  3BXK A;  1QLS A;  2LHI A;  5FYX A;  5HLV A;  2M1U A;  3VB1 A;  1WLM A;  2MAZ A;  1SW8 A;  2LUX A;  2LM5 A;  3EK4 A;  1AK8 A;  3DVJ A;  2HF5 A;  4TNC A;  2Y1N A;  3BYA A;  5I94 A;  3B6X A;  3SIB A;  3CLN A;  1NWD A;  1SSE B;  2CT9 A;  2LMV A;  4ZCU A;  5DKR A;  2KFH A;  3EK8 A;  4JQ0 D;  1YUS A;  2PMY A;  1K2H A;  1PUL A;  5HYD A;  4INX A;  3R72 A;  1SRA A;  3I5H C;  1YUU A;  2OTG B;  2WC5 A;  2F3Y A;  2GTE A;  2OS8 C;  1TRF A;  1DJX A;  1IQ3 A;  1N65 A;  2F2O A;  1DJW A;  1SK6 D;  5DKQ A;  3CR4 X;  1OOF A;  3BUM B;  5ER5 A;  2BE4 A;  2F33 A;  2BCB A;  1WY9 A;  1XFY O;  1DGU A;  2HPS A;  2O60 A;  1REC A;  1V1F A;  2K61 A;  1IH0 A;  2O5G A;  3QME A;  4OCI A;  4YGE B;  1BJF A;  3FIA A;  3VRP A;  5HL1 A;  4OV2 A;  1ALW A;  1LVC D;  1DTL A;  2KBI A;  2CXJ A;  1SR6 B;  2LAP A;  1TOP A;  1PSR A;  3I5G C;  4P2Y B;  4DIR A;  3PSR A;  1BOC A;  3HCM A;  2M3W A;  4AOM A;  1PK0 D;  2NZ0 A;  3Q8I A;  2WCH A;  1OMR A;  2K60 A;  2WCM A;  3EG5 B;  1XA5 A;  1LXF C;  4QJ4 B;  2IS9 A;  3CAB A;  1CFD A;  2L5Y A;  4DCK A;  3PJI A;  3JVT B;  5I2L A;  2K8M B;  2E6W A;  4YBH B;  1M46 A;  1S36 A;  5HKY A;  3I5I C;  1CM1 A;  1ODB A;  3K1E A;  3S0A A;  1OOJ A;  2L0P A;  3DY9 A;  5I2O A;  1NP8 A;  2OPO A;  1QX2 A;  1KK7 Z;  2CBL A;  2M97 A;  3CWG A;  3SG2 A;  4BY5 A;  1M45 A;  3VRQ A;  2GGM A;  3A4U B;  1DF0 A;  1V1G A;  3RM1 A;  4MLW A;  3FWC A;  1FF1 A;  1DJI A;  3UO9 A;  1RK9 A;  1JFJ A;  1S6J A;  3D0Y B;  3D77 A;  4NDC A;  2G2B A;  2BL0 B;  3HX4 A;  4MZL A;  4OVN F;  4PHM A;  2L50 A;  2VRG A;  3B88 A;  4M2O A;  3O2P A;  4YGD B;  1KK8 B;  2KGR A;  2OTG C;  4GGF A;  1XYD A;  1YX8 A;  1OSA A;  2M29 A;  4MZK A;  1C07 A;  1F55 A;  3KO0 A;  3FS7 A;  2BKI B;  1NYA A;  3PM8 A;  1BG1 A;  1ZOT B;  5FI6 A;  1B9A A;  1FI6 A;  3S0G A;  2M0R A;  1DEL A;  1ORG A;  2K7C A;  3MSE B;  1H8B A;  1DEK A;  1Y1X A;  3TS5 C;  4F7F A;  3EKJ A;  2R2I A;  3PN7 C;  2LMU A;  1Y1A A;  2COL B;  3AAK A;  1M31 A;  1OOG A;  1S1E A;  2GGZ A;  1TNW A;  3JTD C;  4YI9 A;  2KLD A;  4I5J A;  1RFJ A;  1KQM C;  5ER4 X;  3KEV A;  2I7A A;  2TN4 A;  5AAN A;  2QEH A;  2KAX A;  2KI4 B;  4JD9 A;  1GJY A;  2MLF C;  2ZN9 A;  2KI6 D;  3LL8 B;  4HRG A;  1NCZ A;  1SL9 A;  1FBV A;  1GGZ A;  1S6I A;  3AKB A;  1D1O A;  1CKK A;  4FTG A;  3NGV A;  2L98 A;  3B87 A;  4AQJ A;  1XFV O;  2KI6 C;  2ZRS A;  2BCX A;  3BOW A;  4XJK A;  5EL2 A;  2I18 A;  1JBA A;  2P70 A;  2ZN8 A;  5CPV A;  1XFR A;  1HT9 A;  1N0Y A;  2ZNE A;  1P28 A;  2KOT A;  1A4P A;  1OW4 A;  1S5G Y;  1JF0 A;  2BBM A;  2KQY A;  3BUX B;  1EL4 A;  3OHM B;  3L4A A;  1EXR A;  4ORB B;  3SS3 A;  3QRX A;  2FCE A;  1CFC A;  1OOH A;  1QAT A;  5CSF A;  1AJ5 A;  1X02 A;  3NSI A;  2ZRT A;  2JPO A;  4GGF C;  1K9P A;  1QVI Y;  1KWO B;  3WHT B;  1NX3 A;  3LCP C;  3SIA A;  1B7T Z;  1FW4 A;  2L2C A;  2MHH A;  4CFR A;  4GAO A;  1GGW A;  2GV5 A;  1CFP A;  2WOR A;  3SG5 A;  1R6P A;  2HET A;  2KYF A;  1PAL A;  4IL1 A;  1N2D A;  1RRO A;  5HKW A;  1DJZ A;  2EC6 B;  2LVV A;  4MEW A;  5AFP A;  1SCM B;  1E8A A;  3OP0 A;  4GBA A;  3L47 A;  2KFF A;  3VGO A;  4A4C A;  2KHN A;  4USL A;  1QIV A;  2I2R E;  1UHK A;  2AAO A;  2E30 A;  4PHN A;  1NSH A;  1NIW A;  1K9K A;  4HSZ A;  1CLM A;  4C0J A;  1IKU A;  2LP2 A;  4Q04 A;  2LMT A;  4R1E A;  5D3O A;  1J7R A;  3NSL A;  2B1U A;  4DUQ A;  4INW A;  3TDI A;  1U5I A;  1U5I B;  2P6B B;  2BAP A;  3PFV A;  2PSR A;  3EVR A;  4D1E A;  2CNP A;  3I5F B;  3N7H A;  2WCF A;  1YVH A;  1GM0 A;  5AXI A;  1CDM A;  1W9Z A;  1GQM A;  2Y4Q A;  3D73 A;  3OB1 B;  1BT6 A;  1FI5 A;  2NXQ A;  2QEB A;  4YRU A;  2PYQ A;  3TDU A;  5PAL A;  4NDD A;  1WDC C;  1XFW O;  3BUO B;  1OOI X;  1XK4 A;  1S3P A;  1UWO A;  3TUY B;  1TWO A;  1EJ3 A;  3FE8 A;  3PLF B;  2SCP A;  3CTN A;  1UHI A;  4BY4 A;  1Y1U A;  3CR5 X;  2PAL A;  1DJY A;  2Y5I A;  5D69 A;  5F6T A;  4OKH A;  1F8H A;  4MRX A;  1L2O B;  5JOL A;  3KF9 A;  1AVS A;  4QJ5 B;  4N5X A;  2LE9 B;  1MWN A;  1F4O A;  2LLS A;  3E3R A;  1S5G Z;  4U8D A;  1DQE A;  2JNF A;  3K21 A;  4OZD A;  3CGA A;  1QV0 A;  1BR1 B;  2KBM A;  3DYE A;  1KFX L;  1WRK A;  3DVK A;  4GNK B;  4PDZ A;  4PAL A;  2LNK A;  3M0W A;  4N1F A;  3KHE A;  1DT7 B;  2K7B A;  3KPX A;  1H4B A;  2WCE A;  1ZUZ A;  1Y6W A;  4JPZ B;  4FQO A;  2P71 A;  1B8L A;  3VRO A;  1KSM A;  1A03 A;  1C3Y A;  2JNX A;  1B7T Y;  1TCO B;  2EHB A;  5DKN A;  1DMO A;  3D0Y A;  1QIW A;  1QLK A;  2WC8 A;  1QVI Z;  3SS4 A;  1XO5 A;  3O4X A;  4CLN A;  1AHR A;  1PVA A;  3OGN A;  2ZFD A;  2LUC A;  4MBE A;  1TUZ A;  3S0E A;  1JWD A;  5AEQ A;  1K96 A;  1K94 A;  1QXP A;  1ALV A;  1YRT B;  4P5O E;  1KFX S;  2V53 A;  1KCY A;  4KYN A;  1IJ6 A;  1CLL A;  5I8N A;  3FE6 A;  3S0B A;  2BCA A;  1W7J B;  1F4Q A;  4L9M A;  1NX1 A;  3I5F C;  3B7A A;  3EKH A;  2KPH A;  2LVK A;  2LLT A;  2MLE C;  3VRR A;  4PCW A;  1R2U A;  3SG3 A;  1DGV A;  2K2A A;  3R1P A;  2JXC A;  1TTX A;  3AKA A;  1SBJ A;  2KNE A;  4JWQ A;  1SR6 C;  1XK4 C;  2LVI A;  2SAS A;  4PT1 A;  2KDH A;  4N1G A;  1F71 A;  1KQV A;  3CS1 A;  1K9U A;  2ISD A;  1IG5 A;  1CFF A;  4MN0 A;  4ORA B;  2HQ8 A;  3OX6 A;  3D74 A;  4GFT A;  4MVF A;  3VRN A;  1XFX O;  5KTY A;  3R1V A;  3SG4 A;  3O78 A;  1L2O C;  3GK1 A;  4YGA A;  2NCO A;  1SL7 A;  1L7Z A;  3DF0 A;  4CID A;  2L51 A;  3DF0 B;  3JVT C;  1J7Q A;  5CSI A;  2JQ6 A;  1RJV A;  3IF7 A;  2JT3 A;  5FI7 A;  2OS8 B;  1BR4 B;  1W7I B;  1M39 A;  1B8R A;  2FCD A;  2M1K B;  4M2Q A;  3GK2 A;  2QAC A;  1S6C A;  5I2Q A;  1SKT A;  3C1V A;  5KU1 A;  5JJG A;  1BOD A;  2BNX A;  1OMD A;  3S0D A;  1YRU B;  2H8V A;  2BL0 C;  2M9G A;  1SNL A;  2JPT A;  3BFH A;  3O6B A;  2Y1M A;  4C0K A;  1A75 B;  1KK8 C;  1LIN A;  2LP3 A;  1YUT A;  5TNC A;  2MA2 A;  1EG4 A;  3SG6 A;  2JC2 A;  1JFK A;  3I5G B;  4I5N B;  1CTR A;  3BUW B;  3CZ0 A;  3LK1 A;  3EVV A;  1ZAC A;  2WCB A;  2KQ6 A;  1F70 A;  1Z4H A;  1VRK A;  2H61 A;  1MXE A;  4ORC B;  1TN4 A;  2QDI A;  2PQL A;  1CDL A;  1KSO A;  1CDP A;  1MR8 A;  1K95 A;  1UHH A;  1OE9 B;  1NX0 A;  1YUR A;  2QEV A;  2YGU A;  2QEO A;  3EK7 A;  3NHT A;  4GGN A;  3CR2 A;  4CPV A;  2BKH B;  4YGB B;  5G08 A;  4ETO A;  1J1D A;  1DVI A;  3SG7 A;  1IIO A;  2JUL A;  4PE0 A;  1QAS A;  2PAS A;  5B8I B;  4PE7 A;  2KI4 C;  2DOQ A;  5DIC A;  2KSP A;  1XFU O;  3I5I B;  2NLN A;  4PE1 A;  3CZ2 A;  3PAT A;  3SJS A;  1JC2 A;  1XVJ A;  4WRI A;  1OZS A;  1PSB A;  1QS7 A;  1TNQ A;  1FPW A;  3WXA A;  2CCM A;  1CM4 A;  2JRF A;  3F45 A;  1A29 A;  4FQT A;  1QV1 A;  4YGC B;  4DS7 A;  5D7F A;  1TCF A;  1K8U A;  4ICB A;  3WNX B;  2FJY A;  1Z2C B;  3H4S E;  5HLO A;  1BF5 A;  4MRY A;  1Q80 A;  3GOF A;  4CFQ A;  1UUS A;  3D10 A;  2A4J A;  1BU3 A;  2AMI A;  2NCP A;  3DVM A;  1YX7 A;  4MSP A;  1J7P A;  1UUR A;  5J3X A;  3LK0 A;  1UP5 A;  2MRD A;  2ERB A;  3D75 A;  4NQG A;  4PHJ A;  2LV7 A;  1AUI B;  3TS5 B;  3CDN A;  2MBX A;  2JXL A;  3PN7 B;  2BE6 A;  2AUC A;  1QJT A;  2ZND A;  3OB2 B;  1G4Y R;  2F3Z A;  2M49 B;  2JWW A;  4I5L B;  4A4B A;  1Y0V H;  3JTD B;  2K7D A;  2WND A;  1YR5 A;  1CLB A;  4JKT A;  3S0F A;  1IRJ A;  2PRU A;  1KQM B;  1KWO C;  1IWQ A;  1NUB A;  2EGD A;  3RZS A;  1IJ5 A;  3RLZ A;  2FJU B;  1G8I A; 
#chains in the Genus database with same CATH homology
 1P28 A;  1OW4 A;  3R72 A;  4INX A;  3R1P A;  1TUJ A;  2WCK A;  3L4A A;  2WC5 A;  2GTE A;  3B86 A;  1OOH A;  4PT1 A;  3DXL A;  2WCJ A;  3BJH A;  1OOF A;  3CZ1 A;  3D74 A;  3R1V A;  2JPO A;  3NHI A;  2L2C A;  3QME A;  1T14 A;  3L47 A;  1C3Z A;  3Q8I A;  2WCH A;  2WCM A;  3S0D A;  1LS8 A;  2H8V A;  3CAB A;  3DZT A;  4INW A;  3BFH A;  3PJI A;  1GM0 A;  3N7H A;  3K1E A;  3BFA A;  3D73 A;  3S0A A;  2WCL A;  3DY9 A;  2QEB A;  3CZ0 A;  3D76 A;  1OOI X;  2QDI A;  2PQL A;  1TWO A;  3FE8 A;  3NHT A;  2QEV A;  3D77 A;  2QEO A;  3L4L A;  3B88 A;  5DIC A;  3FE9 A;  3CZ2 A;  3S0G A;  1ORG A;  1QWV A;  1DQE A;  4F7F A;  3BFB A;  2WC6 A;  4OZD A;  3DYE A;  3R1O A;  1OOG A;  4FQT A;  2FJY A;  2P71 A;  1C3Y A;  2QEH A;  4JD9 A;  3V2L A;  3D78 A;  3CYZ A;  3OGN A;  2ERB A;  3D75 A;  3S0E A;  3VB1 A;  3CDN A;  3NGV A;  3B87 A;  3B6X A;  3FE6 A;  5EL2 A;  3S0B A;  3S0F A;  2P70 A;  3B7A A;  2KPH A;  1XFR A;  3RZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...