3L4AA

Crystal structure of an anopheles gambiae odorant-binding protein 22a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
134
structure length
121
Chain Sequence
NESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMYQNNNELWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of an Anopheles gambiae Odorant-binding Protein AgamOBP22a and complexes with Bound Odorants
rcsb
source organism Anopheles gambiae
molecule tags Transport protein
molecule keywords Odorant binding protein (AGAP010409-PA)
total genus 46
structure length 121
sequence length 134
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3l4aA00
2PQLA 3FE9A 3S0AA 3L4AA 1C3YA 3CYZA 2WCMA 1DQEA 3S0DA 3V2LA 3DYEA 3PJIA 3S0FA 3R1OA 5EL2A 3S0EA 1ORGA 3QMEA 2WC5A 3CABA 2P70A 2QEBA 3BJHA 3N7HA 2QEVA 1T14A 1XFRA 2GTEA 3BFAA 2QEHA 1TUJA 3D77A 1TWOA 2FJYA 2P71A 3RZSA 2JPOA 4FQTA 3D74A 3S0BA 3NGVA 4INXA 3VB1A 3D75A 3R1VA 1P28A 3L4LA 3K1EA 1LS8A 1OOIX 4F7FA 1OW4A 3B86A 3CZ1A 2WCHA 3CZ0A 1OOFA 1OOHA 4JD9A 3B88A 2QEOA 3CZ2A 3FE8A 3D76A 1OOGA 3Q8IA 3NHTA 3CDNA 5DICA 4PT1A 2L2CA 3B6XA 3DZTA 3FE6A 3BFHA 2WCKA 3R1PA 3D78A 2H8VA 1QWVA 3B87A 3R72A 3OGNA 3S0GA 2KPHA 2WCJA 3L47A 3NHIA 2ERBA 3DXLA 4OZDA 1C3ZA 2WCLA 3DY9A 2WC6A 3B7AA 3D73A 2QDIA 1GM0A 4INWA 3BFBA
chains in the Genus database with same CATH superfamily
5K89A 3IQOA 1YUSA 3VRRA 5IBWA 5JJGA 3PLFB 5ER5A 1YURA 3CR4X 2L51A 1YUUA 1MR8A 1M39A 5AFPA 1XK4A 4NDBA 1QVIY 4BY4A 2WNDA 4PHJA 1XFYO 4M2QA 3ZNIA 2WORA 3S0DA 1NUBA 3HX4A 1QXPA 1UHHA 3D10A 3SS3A 3K21A 1UHJA 1KQMB 3BUWB 2P6BB 3OB2B 3WNXB 2K7CA 5D7FA 1OMVA 2P70A 1SW8A 3BJHA 1YVLA 3BXKA 3O4XA 3TS5C 2KLDA 4QJ5B 1VRKA 3F45A 3EK7A 3FIAA 1E8AA 2JT3A 1CFDA 1XFVO 2G9BA 2GTEA 2KI4C 1DC1A 3AAJA 2QEHA 1DF0A 1A4PA 2LMVA 3CLNA 4MSPA 4MEWA 1CLLA 1A75A 4FQTA 5HKZA 3M0WA 1AVSA 1DEKA 3TDIA 1CFPA 2BNXA 4ZCVA 1K9UA 2KQYA 3KPXA 4F0ZB 1J7RA 1NSHA 1QTXA 3OX6A 4HREE 1F55A 3VB1A 1TCFA 3IF7A 3I5HB 5KSZA 2FOTA 3LLEA 4GFTA 1SRAA 1P28A 5I2OA 1BLQA 1SL8A 1A29A 3K1EA 3TDUA 1H8BA 1XK4C 1K94A 1SCVA 4Q04A 5CSJA 1BMOA 2BBMA 1NP8A 1XYDA 3PALA 4JD9A 1XFXO 1M46A 1S5GY 2M3WA 3B88A 4JPZB 2QEOA 1AK8A 3EKHA 1KFXS 1QX5B 1V1FA 5HLOA 1YR5A 1KCYA 1EXRA 2PMYA 4GGNA 1OOGA 1NIWA 1W7IB 2F3ZA 1IJ5A 1TUZA 1ZMZA 2LC5A 2ZNDA 2LP3A 4GGFA 3PN7B 2JNXA 1IIOA 2PRUA 2LVJA 1N0YA 5DKQA 5I2QA 1S36A 1YRTB 2GGZA 1RECA 1D1OA 2PVBA 3JVTB 1CM4A 3FE6A 1C7VA 2B1UA 1QS7A 1TOPA 2Q91A 2JZIA 3VGOA 1J1EA 3D78A 4FQOA 3SG7A 4E68A 4PE0A 3B87A 1L2OC 3A4UB 1CDLA 4KYNA 3OBVA 3S0GA 1K96A 1ZACA 1MXLC 1UP5A 1ZFSA 2K2FA 2PALA 4ETOA 4QJ4B 2MLEC 4ORAB 2EGDA 1R6PA 1NX1A 2ZRTA 2F8PA 5CSIA 1YVHA 4OZDA 1PULA 1PSRA 2EC6C 4JWQA 3WHUB 2L5XB 1KWOC 3EK8A 4A4CA 1EH2A 2M9GA 1WY9A 3DY9A 2LUCA 2FCEA 2KFFA 2NCPA 1BR1B 2E6WA 1Y0VH 4IL1A 4DUQA 1KFUS 1TTXA 2QDIA 1RJVA 2BCAA 1F4OA 2IS9A 2LNKA 3TDZA 1RFJA 2F33A 1BU3A 1S6JA 3EG5B 1S3PA 3BFBA 1W9ZA 2ZN9A 2BKIB 1LVCD 3ZWHA 2H61A 4DS7A 1CKKA 1SBJA 2KSPA 5HL1A 1EJ3A 3LCPC 1UHNA 2GGMA 1CM1A 4U8DA 1EG3A 2R2IA 1TNXA 5DKRA 5DKNA 4A4BA 3S0AA 2BL0B 4IJ7A 3DYEA 1RWYA 2JWWA 2CT9A 3BOWB 1TNQA 1BR4B 5FI7A 1Y1XA 1SMGA 2F3YA 4DIRA 4MLWA 1B7TY 3QMEA 2L5YA 4N1FA 4ICBA 2QEBA 1NPQA 1SL7A 2LVKA 3N7HA 2QEVA 1BODA 4XJKA 2HPSA 1XFZO 1SL9A 1WLMA 1FI5A 4YGCB 1DJIA 3DF0B 2ZKMX 1TUJA 3FWBA 1FI6A 2A4JA 2EC6B 1IQ5A 3RZSA 1LXFC 1SKTA 4MBEA 1S5GZ 4OVNF 3SS4A 3D74A 1KWOB 3O4YA 2MLFC 2KGRA 3NSIA 4M2PA 3PATA 1TRFA 1KSMA 3SG2A 1Q80A 3D75A 3EKJA 2BCXA 3C1VA 1QV1A 1JBAA 3L4LA 1LS8A 1OOIX 2H2KA 4F7FA 1K2HA 3FWCA 3BUMB 1JSAA 2HQ8A 1OOJA 1SNLA 1KK8B 1SCMB 1NX2A 2ZRSA 3PSRA 3RM1A 2WCHA 3CZ0A 4PHKA 2I2RE 4HRGA 4YGDB 2LAPA 4CPVA 3LK1A 2TN4A 3ICBA 1SYMA 1A75B 1WLZA 2K7DA 3CWGA 4OKHA 2CBLA 3TS5B 2I7AA 2JPTA 4I5NB 3DD4A 1ZOTB 3D76A 1GGZA 2ISDA 4BY5A 1S6IA 1ODBA 3A8RA 3Q8IA 2JTTA 4OCIA 2KYFA 2KAXA 3BYAA 1QV0A 1Y1UA 3OHMB 4CIDA 4DCKA 1X02A 2L2CA 2YGUA 3LK0A 3B6XA 2MRDA 5KTYA 1CFFA 1DT7B 3SG6A 2Y1MA 3KO0A 3BFHA 1QASA 1IRJA 1AP4A 1J7PA 3GK2A 1QLSA 2WCKA 1JUOA 3CS1A 2L2EA 3R1PA 1M31A 1DMOA 1DTLA 3CZTX 2L98A 3BUOB 4OR9B 3R72A 4JKTA 2JU0A 4GPLB 1RROA 2KPHA 1CDPA 2OTGB 2WCJA 3NHIA 2BKHB 1CDNA 4MZLA 1WRKA 2L50A 3JVTC 4MN0A 2G2BA 1TNPA 1AJ4A 4AOMA 4OV2A 4MZKA 1Z2CB 4XJKB 2LE9B 2LM5A 2QPTA 4YGBB 1W7JB 2MA2A 1J55A 1IKUA 1FBVA 5KU1A 1DJXA 2OS8B 4HSZA 1OZOA 3I5FB 1HT9A 1M63B 1CFCA 2CCMA 2KHNA 2LV7A 4PCWA 4R1EA 1CLBA 1DELA 4PDZA 2PASA 1H4BA 4M2OA 2L4HA 2K61A 4USLA 5AEQA 2AUCA 3DVEA 1SSEB 2HQWA 2L4IA 4UPGA 3BQ3A 4I5KA 1JC2A 1IJ6A 4WQ2A 1YTZC 1K9KA 2LVVA 5HKYA 2KNEA 1J7OA 4YRUA 1DF0B 1XA5A 3EVUA 3FE9A 4MZJA 3TZ1A 3L4AA 2OPOA 3KEVA 1IWQA 1C3YA 3CYZA 4P5OE 4YGEB 1YUTA 2I94A 1B8CA 2JNFA 4NDCA 1MUXA 4GNKB 2MBXA 2M97A 4NDDA 3PJIA 2LLSA 4I5JA 2KOTA 1K93D 1KFUL 1JWDA 1ORGA 1QX7A 2BL0C 2L0PA 2WC5A 2ZNEA 1GJYA 2JOJA 1YX8A 2LHIA 2KI4B 1L2OB 2M8UA 1BF5A 1MF8B 1PRWA 1YRUB 1T14A 1CB1A 2OTGC 2BBNA 1TIZA 5CSFA 1SY9A 4AQJA 3AKBA 1OSAA 2MAZA 1IGVA 2K7OA 2BCBA 2KBIA 1DJWA 1TWOA 5FI6A 1BOCA 2FJYA 1WRZA 2P71A 1UWOA 3OP0A 2VRGA 3DF0A 2JPOA 1CNPA 3DVKA 1PVBA 3NSKA 3S0BA 3JTDB 3I5IC 3NGVA 2KAYA 3UO9A 2BE4A 1SR6B 1ZUZA 3WXAA 1F8HA 2KFHA 1ALWA 1OMDA 1AHRA 3VRQA 3PM8A 3GK1A 4ORBB 1DGUA 2KI6D 2BAPA 2CXJA 2JQ6A 3B86A 5PALA 3CZ1A 3VRNA 1B8LA 1OOFA 1OOHA 1BG1A 2LCPA 2LANA 1FPWA 3KF9A 1MQ1A 1OE9B 1MHOA 1AJ5A 2K8MB 3CZ2A 3FE8A 1HQVA 1YX7A 3I5HC 1QLKA 2NLNA 2RGIA 3OB1B 4TNCA 1IQ3A 2LP2A 3CDNA 2KGBC 3IVTA 1NCZA 4YI9A 5DICA 3OX5A 1Z4HA 5AERA 2SASA 1XO5A 1LKJA 3CTNA 1SPYA 3DZTA 4D1EA 1QIVA 1TNWA 1IG5A 3UNWA 3EVVA 2K7BA 2V53A 4AQIA 1F4QA 1A2XA 1JF0A 2M49B 4ORCB 4GUKA 1F54A 2H8VA 2Y5IA 1KSOA 2WCFA 3LL8B 3TUYB 1B8RA 2OS8C 1MXEA 3OGNA 2AAOA 5BPJA 5B8IB 2MJWB 4GBAA 3L47A 1AUIB 3WHTB 2JC2A 2K2AA 5HYDA 3SG4A 1F70A 2KBMA 5I2LA 3DXLA 3HCMA 3RLZA 3BOWA 2NXQA 1CTRA 1JF2A 2M7LA 2ZFDA 5FYXA 1TN4A 2KFGA 2WCLA 1ALVA 2Q4UA 5D3OA 4C0KA 1EG4A 1DJGA 1J1DA 1FW4A 5J3XA 4CLNA 1NX3A 3EVRA 1PK0D 2Y4QA 2WCBA 1NX0A 2JT8A 2JTZA 1M45A 4YGAA 2LUXA 5F6TA 4PE4A 2FCDA 3H4SE 5HLVA 1CMFA 4PE1A 3CR2A 2MHHA 4YBHB 2JRFA 1G4YR 5EL2A 1XVJA 1Y6WA 4WRIA 3VROA 4PE7A 2LVIA 3I5IB 2PQLA 1XFWO 2AMIA 4P2YB 1JFJA 4MRYA 5I94A 1KK7Z 2JT0A 2DOQA 2WCMA 1DQEA 1Y1AA 2PYQA 3V2LA 1CDMA 3NSLA 3DVMA 3D0YB 2M0RA 3O2PA 2SCPA 3S0FA 1B47A 3R1OA 4PHNA 5GQQC 1C07A 3S0EA 1C7WA 2NZ0A 1S26D 2Y1NA 3CABA 4PALA 2LMTA 3I5GC 3KHEA 5AANA 1FF1A 2QACA 2O60A 2LHLA 4N5XA 1NCYA 2BE6A 1XFRA 3NSOA 1JFKA 1S6CA 1IH0A 2M1UA 3BFAA 1QVIZ 1U5IB 4MRXA 3D77A 1B1GA 3PN7C 3AKAA 2M7NA 2CNPA 3PM2A 4HRHA 1L7ZA 1KFXL 1MWNA 1SR6C 1WDCB 1N65A 4WQ3A 2K0JA 1OZSA 1K8UA 3O78A 1DJZA 1LA0A 1UURA 2M1KB 4INXA 5JOLA 1S1EA 3E3RA 4C0LA 5TNCA 3R1VA 1B9AA 3DVJA 1QIWA 3TUYC 2LLUA 1F71A 3BUNB 5G08A 1OW4A 2BECA 5HKWA 1LINA 2NCOA 3AAKA 4CFQA 1K9PA 1U5IA 1G8IA 4MVFA 4NQGA 3I5FC 2H61C 3SG3A 1OMRA 2KAVA 2KLEA 1CMGA 4N1GA 3SIBA 1XFUO 4QJ3B 5D69A 5CSNA 2JXLA 1N2DA 3EK4A 1QJTA 2O5GA 2PSRA 1QATA 1RTP1 2WC8A 3CGAA 4L9MA 4DRWA 3PFVA 1UUSA 3NXAA 3SJSA 1NWDA 1OQPA 3GOFA 3NHTA 2I18A 2COLB 5ER4X 2ZN8A 4FTGA 4PT1A 2D8NA 1KQVA 1K90D 1G33A 2F2PA 1BJFA 1TCOB 2KQ6A 2GV5A 3GK4X 4CFRA 1EL4A 1LA3A 1BT6A 2E30A 2WCEA 1A03A 3VRPA 2KDHA 3CR5X 2K60A 5CPVA 1UHKA 1QX2A 3SIAA 1QWVA 3MSEB 3I5GB 1CLMA 2CTNA 4I5LB 4ZCUA 1UHIA 2LLTA 3BUXB 2HF5A 5I8NA 3JTDC 2FJUB 4JQ0D 2ERBA 1DJYA 1K95A 3QRXA 5FI2A 5AXIA 1PSBA 1GGWA 1DGVA 2HETA 4GAOA 1GQMA 1KQMC 2EHBA 1C3ZA 4XYNA 2M29A 3O6BA 2WOSA 3SG5A 1WDCC 1J7QA 1V1GA 1KK7Y 2KI6C 2LMUA 1DVIA 1WRLA 1SK6D 2WC6A 1RK9A 1R2UA 3B7AA 3D73A 3FS7A 4GGFC 4YI8A 2KYCA 3D0YA 1NCXA 2JULA 1GM0A 1B4CA 1B7TZ 4PHMA 4INWA 3SS5A 3IQQA 1NYAA 1PALA 1PVAA 2JXCA 2F2OA 1DJHA 1KK8C 1SCMC 4C0JA
chains in the Genus database with same CATH topology
2PQLA 3FE9A 3S0AA 3L4AA 1C3YA 3CYZA 2WCMA 1DQEA 3S0DA 3V2LA 3DYEA 3PJIA 3S0FA 3R1OA 5EL2A 3S0EA 1ORGA 3QMEA 2WC5A 3CABA 2P70A 2QEBA 3BJHA 3N7HA 2QEVA 1T14A 1XFRA 2GTEA 3BFAA 2QEHA 1TUJA 3D77A 1TWOA 2FJYA 2P71A 3RZSA 2JPOA 4FQTA 3D74A 3S0BA 3NGVA 4INXA 3VB1A 3D75A 3R1VA 1P28A 3L4LA 3K1EA 1LS8A 1OOIX 4F7FA 1OW4A 3B86A 3CZ1A 2WCHA 3CZ0A 1OOFA 1OOHA 4JD9A 3B88A 2QEOA 3CZ2A 3FE8A 3D76A 1OOGA 3Q8IA 3NHTA 3CDNA 5DICA 4PT1A 2L2CA 3B6XA 3DZTA 3FE6A 3BFHA 2WCKA 3R1PA 3D78A 2H8VA 1QWVA 3B87A 3R72A 3OGNA 3S0GA 2KPHA 2WCJA 3L47A 3NHIA 2ERBA 3DXLA 4OZDA 1C3ZA 2WCLA 3DY9A 2WC6A 3B7AA 3D73A 2QDIA 1GM0A 4INWA 3BFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQL A;  3FE9 A;  3S0A A;  3L4A A;  1C3Y A;  3CYZ A;  2WCM A;  1DQE A;  3S0D A;  3V2L A;  3DYE A;  3PJI A;  3S0F A;  3R1O A;  5EL2 A;  3S0E A;  1ORG A;  3QME A;  2WC5 A;  3CAB A;  2P70 A;  2QEB A;  3BJH A;  3N7H A;  2QEV A;  1T14 A;  1XFR A;  2GTE A;  3BFA A;  2QEH A;  1TUJ A;  3D77 A;  1TWO A;  2FJY A;  2P71 A;  3RZS A;  2JPO A;  4FQT A;  3D74 A;  3S0B A;  3NGV A;  4INX A;  3VB1 A;  3D75 A;  3R1V A;  1P28 A;  3L4L A;  3K1E A;  1LS8 A;  1OOI X;  4F7F A;  1OW4 A;  3B86 A;  3CZ1 A;  2WCH A;  3CZ0 A;  1OOF A;  1OOH A;  4JD9 A;  3B88 A;  2QEO A;  3CZ2 A;  3FE8 A;  3D76 A;  1OOG A;  3Q8I A;  3NHT A;  3CDN A;  5DIC A;  4PT1 A;  2L2C A;  3B6X A;  3DZT A;  3FE6 A;  3BFH A;  2WCK A;  3R1P A;  3D78 A;  2H8V A;  1QWV A;  3B87 A;  3R72 A;  3OGN A;  3S0G A;  2KPH A;  2WCJ A;  3L47 A;  3NHI A;  2ERB A;  3DXL A;  4OZD A;  1C3Z A;  2WCL A;  3DY9 A;  2WC6 A;  3B7A A;  3D73 A;  2QDI A;  1GM0 A;  4INW A;  3BFB A; 
#chains in the Genus database with same CATH topology
 5K89 A;  3IQO A;  1YUS A;  3VRR A;  5IBW A;  5JJG A;  3PLF B;  5ER5 A;  1YUR A;  3CR4 X;  2L51 A;  1YUU A;  1MR8 A;  1M39 A;  5AFP A;  1XK4 A;  4NDB A;  1QVI Y;  4BY4 A;  2WND A;  4PHJ A;  1XFY O;  4M2Q A;  3ZNI A;  2WOR A;  3S0D A;  1NUB A;  3HX4 A;  1QXP A;  1UHH A;  3D10 A;  3SS3 A;  3K21 A;  1UHJ A;  1KQM B;  3BUW B;  2P6B B;  3OB2 B;  3WNX B;  2K7C A;  5D7F A;  1OMV A;  2P70 A;  1SW8 A;  3BJH A;  1YVL A;  3BXK A;  3O4X A;  3TS5 C;  2KLD A;  4QJ5 B;  1VRK A;  3F45 A;  3EK7 A;  3FIA A;  1E8A A;  2JT3 A;  1CFD A;  1XFV O;  2G9B A;  2GTE A;  2KI4 C;  1DC1 A;  3AAJ A;  2QEH A;  1DF0 A;  1A4P A;  2LMV A;  3CLN A;  4MSP A;  4MEW A;  1CLL A;  1A75 A;  4FQT A;  5HKZ A;  3M0W A;  1AVS A;  1DEK A;  3TDI A;  1CFP A;  2BNX A;  4ZCV A;  1K9U A;  2KQY A;  3KPX A;  4F0Z B;  1J7R A;  1NSH A;  1QTX A;  3OX6 A;  4HRE E;  1F55 A;  3VB1 A;  1TCF A;  3IF7 A;  3I5H B;  5KSZ A;  2FOT A;  3LLE A;  4GFT A;  1SRA A;  1P28 A;  5I2O A;  1BLQ A;  1SL8 A;  1A29 A;  3K1E A;  3TDU A;  1H8B A;  1XK4 C;  1K94 A;  1SCV A;  4Q04 A;  5CSJ A;  1BMO A;  2BBM A;  1NP8 A;  1XYD A;  3PAL A;  4JD9 A;  1XFX O;  1M46 A;  1S5G Y;  2M3W A;  3B88 A;  4JPZ B;  2QEO A;  1AK8 A;  3EKH A;  1KFX S;  1QX5 B;  1V1F A;  5HLO A;  1YR5 A;  1KCY A;  1EXR A;  2PMY A;  4GGN A;  1OOG A;  1NIW A;  1W7I B;  2F3Z A;  1IJ5 A;  1TUZ A;  1ZMZ A;  2LC5 A;  2ZND A;  2LP3 A;  4GGF A;  3PN7 B;  2JNX A;  1IIO A;  2PRU A;  2LVJ A;  1N0Y A;  5DKQ A;  5I2Q A;  1S36 A;  1YRT B;  2GGZ A;  1REC A;  1D1O A;  2PVB A;  3JVT B;  1CM4 A;  3FE6 A;  1C7V A;  2B1U A;  1QS7 A;  1TOP A;  2Q91 A;  2JZI A;  3VGO A;  1J1E A;  3D78 A;  4FQO A;  3SG7 A;  4E68 A;  4PE0 A;  3B87 A;  1L2O C;  3A4U B;  1CDL A;  4KYN A;  3OBV A;  3S0G A;  1K96 A;  1ZAC A;  1MXL C;  1UP5 A;  1ZFS A;  2K2F A;  2PAL A;  4ETO A;  4QJ4 B;  2MLE C;  4ORA B;  2EGD A;  1R6P A;  1NX1 A;  2ZRT A;  2F8P A;  5CSI A;  1YVH A;  4OZD A;  1PUL A;  1PSR A;  2EC6 C;  4JWQ A;  3WHU B;  2L5X B;  1KWO C;  3EK8 A;  4A4C A;  1EH2 A;  2M9G A;  1WY9 A;  3DY9 A;  2LUC A;  2FCE A;  2KFF A;  2NCP A;  1BR1 B;  2E6W A;  1Y0V H;  4IL1 A;  4DUQ A;  1KFU S;  1TTX A;  2QDI A;  1RJV A;  2BCA A;  1F4O A;  2IS9 A;  2LNK A;  3TDZ A;  1RFJ A;  2F33 A;  1BU3 A;  1S6J A;  3EG5 B;  1S3P A;  3BFB A;  1W9Z A;  2ZN9 A;  2BKI B;  1LVC D;  3ZWH A;  2H61 A;  4DS7 A;  1CKK A;  1SBJ A;  2KSP A;  5HL1 A;  1EJ3 A;  3LCP C;  1UHN A;  2GGM A;  1CM1 A;  4U8D A;  1EG3 A;  2R2I A;  1TNX A;  5DKR A;  5DKN A;  4A4B A;  3S0A A;  2BL0 B;  4IJ7 A;  3DYE A;  1RWY A;  2JWW A;  2CT9 A;  3BOW B;  1TNQ A;  1BR4 B;  5FI7 A;  1Y1X A;  1SMG A;  2F3Y A;  4DIR A;  4MLW A;  1B7T Y;  3QME A;  2L5Y A;  4N1F A;  4ICB A;  2QEB A;  1NPQ A;  1SL7 A;  2LVK A;  3N7H A;  2QEV A;  1BOD A;  4XJK A;  2HPS A;  1XFZ O;  1SL9 A;  1WLM A;  1FI5 A;  4YGC B;  1DJI A;  3DF0 B;  2ZKM X;  1TUJ A;  3FWB A;  1FI6 A;  2A4J A;  2EC6 B;  1IQ5 A;  3RZS A;  1LXF C;  1SKT A;  4MBE A;  1S5G Z;  4OVN F;  3SS4 A;  3D74 A;  1KWO B;  3O4Y A;  2MLF C;  2KGR A;  3NSI A;  4M2P A;  3PAT A;  1TRF A;  1KSM A;  3SG2 A;  1Q80 A;  3D75 A;  3EKJ A;  2BCX A;  3C1V A;  1QV1 A;  1JBA A;  3L4L A;  1LS8 A;  1OOI X;  2H2K A;  4F7F A;  1K2H A;  3FWC A;  3BUM B;  1JSA A;  2HQ8 A;  1OOJ A;  1SNL A;  1KK8 B;  1SCM B;  1NX2 A;  2ZRS A;  3PSR A;  3RM1 A;  2WCH A;  3CZ0 A;  4PHK A;  2I2R E;  4HRG A;  4YGD B;  2LAP A;  4CPV A;  3LK1 A;  2TN4 A;  3ICB A;  1SYM A;  1A75 B;  1WLZ A;  2K7D A;  3CWG A;  4OKH A;  2CBL A;  3TS5 B;  2I7A A;  2JPT A;  4I5N B;  3DD4 A;  1ZOT B;  3D76 A;  1GGZ A;  2ISD A;  4BY5 A;  1S6I A;  1ODB A;  3A8R A;  3Q8I A;  2JTT A;  4OCI A;  2KYF A;  2KAX A;  3BYA A;  1QV0 A;  1Y1U A;  3OHM B;  4CID A;  4DCK A;  1X02 A;  2L2C A;  2YGU A;  3LK0 A;  3B6X A;  2MRD A;  5KTY A;  1CFF A;  1DT7 B;  3SG6 A;  2Y1M A;  3KO0 A;  3BFH A;  1QAS A;  1IRJ A;  1AP4 A;  1J7P A;  3GK2 A;  1QLS A;  2WCK A;  1JUO A;  3CS1 A;  2L2E A;  3R1P A;  1M31 A;  1DMO A;  1DTL A;  3CZT X;  2L98 A;  3BUO B;  4OR9 B;  3R72 A;  4JKT A;  2JU0 A;  4GPL B;  1RRO A;  2KPH A;  1CDP A;  2OTG B;  2WCJ A;  3NHI A;  2BKH B;  1CDN A;  4MZL A;  1WRK A;  2L50 A;  3JVT C;  4MN0 A;  2G2B A;  1TNP A;  1AJ4 A;  4AOM A;  4OV2 A;  4MZK A;  1Z2C B;  4XJK B;  2LE9 B;  2LM5 A;  2QPT A;  4YGB B;  1W7J B;  2MA2 A;  1J55 A;  1IKU A;  1FBV A;  5KU1 A;  1DJX A;  2OS8 B;  4HSZ A;  1OZO A;  3I5F B;  1HT9 A;  1M63 B;  1CFC A;  2CCM A;  2KHN A;  2LV7 A;  4PCW A;  4R1E A;  1CLB A;  1DEL A;  4PDZ A;  2PAS A;  1H4B A;  4M2O A;  2L4H A;  2K61 A;  4USL A;  5AEQ A;  2AUC A;  3DVE A;  1SSE B;  2HQW A;  2L4I A;  4UPG A;  3BQ3 A;  4I5K A;  1JC2 A;  1IJ6 A;  4WQ2 A;  1YTZ C;  1K9K A;  2LVV A;  5HKY A;  2KNE A;  1J7O A;  4YRU A;  1DF0 B;  1XA5 A;  3EVU A;  3FE9 A;  4MZJ A;  3TZ1 A;  3L4A A;  2OPO A;  3KEV A;  1IWQ A;  1C3Y A;  3CYZ A;  4P5O E;  4YGE B;  1YUT A;  2I94 A;  1B8C A;  2JNF A;  4NDC A;  1MUX A;  4GNK B;  2MBX A;  2M97 A;  4NDD A;  3PJI A;  2LLS A;  4I5J A;  2KOT A;  1K93 D;  1KFU L;  1JWD A;  1ORG A;  1QX7 A;  2BL0 C;  2L0P A;  2WC5 A;  2ZNE A;  1GJY A;  2JOJ A;  1YX8 A;  2LHI A;  2KI4 B;  1L2O B;  2M8U A;  1BF5 A;  1MF8 B;  1PRW A;  1YRU B;  1T14 A;  1CB1 A;  2OTG C;  2BBN A;  1TIZ A;  5CSF A;  1SY9 A;  4AQJ A;  3AKB A;  1OSA A;  2MAZ A;  1IGV A;  2K7O A;  2BCB A;  2KBI A;  1DJW A;  1TWO A;  5FI6 A;  1BOC A;  2FJY A;  1WRZ A;  2P71 A;  1UWO A;  3OP0 A;  2VRG A;  3DF0 A;  2JPO A;  1CNP A;  3DVK A;  1PVB A;  3NSK A;  3S0B A;  3JTD B;  3I5I C;  3NGV A;  2KAY A;  3UO9 A;  2BE4 A;  1SR6 B;  1ZUZ A;  3WXA A;  1F8H A;  2KFH A;  1ALW A;  1OMD A;  1AHR A;  3VRQ A;  3PM8 A;  3GK1 A;  4ORB B;  1DGU A;  2KI6 D;  2BAP A;  2CXJ A;  2JQ6 A;  3B86 A;  5PAL A;  3CZ1 A;  3VRN A;  1B8L A;  1OOF A;  1OOH A;  1BG1 A;  2LCP A;  2LAN A;  1FPW A;  3KF9 A;  1MQ1 A;  1OE9 B;  1MHO A;  1AJ5 A;  2K8M B;  3CZ2 A;  3FE8 A;  1HQV A;  1YX7 A;  3I5H C;  1QLK A;  2NLN A;  2RGI A;  3OB1 B;  4TNC A;  1IQ3 A;  2LP2 A;  3CDN A;  2KGB C;  3IVT A;  1NCZ A;  4YI9 A;  5DIC A;  3OX5 A;  1Z4H A;  5AER A;  2SAS A;  1XO5 A;  1LKJ A;  3CTN A;  1SPY A;  3DZT A;  4D1E A;  1QIV A;  1TNW A;  1IG5 A;  3UNW A;  3EVV A;  2K7B A;  2V53 A;  4AQI A;  1F4Q A;  1A2X A;  1JF0 A;  2M49 B;  4ORC B;  4GUK A;  1F54 A;  2H8V A;  2Y5I A;  1KSO A;  2WCF A;  3LL8 B;  3TUY B;  1B8R A;  2OS8 C;  1MXE A;  3OGN A;  2AAO A;  5BPJ A;  5B8I B;  2MJW B;  4GBA A;  3L47 A;  1AUI B;  3WHT B;  2JC2 A;  2K2A A;  5HYD A;  3SG4 A;  1F70 A;  2KBM A;  5I2L A;  3DXL A;  3HCM A;  3RLZ A;  3BOW A;  2NXQ A;  1CTR A;  1JF2 A;  2M7L A;  2ZFD A;  5FYX A;  1TN4 A;  2KFG A;  2WCL A;  1ALV A;  2Q4U A;  5D3O A;  4C0K A;  1EG4 A;  1DJG A;  1J1D A;  1FW4 A;  5J3X A;  4CLN A;  1NX3 A;  3EVR A;  1PK0 D;  2Y4Q A;  2WCB A;  1NX0 A;  2JT8 A;  2JTZ A;  1M45 A;  4YGA A;  2LUX A;  5F6T A;  4PE4 A;  2FCD A;  3H4S E;  5HLV A;  1CMF A;  4PE1 A;  3CR2 A;  2MHH A;  4YBH B;  2JRF A;  1G4Y R;  5EL2 A;  1XVJ A;  1Y6W A;  4WRI A;  3VRO A;  4PE7 A;  2LVI A;  3I5I B;  2PQL A;  1XFW O;  2AMI A;  4P2Y B;  1JFJ A;  4MRY A;  5I94 A;  1KK7 Z;  2JT0 A;  2DOQ A;  2WCM A;  1DQE A;  1Y1A A;  2PYQ A;  3V2L A;  1CDM A;  3NSL A;  3DVM A;  3D0Y B;  2M0R A;  3O2P A;  2SCP A;  3S0F A;  1B47 A;  3R1O A;  4PHN A;  5GQQ C;  1C07 A;  3S0E A;  1C7W A;  2NZ0 A;  1S26 D;  2Y1N A;  3CAB A;  4PAL A;  2LMT A;  3I5G C;  3KHE A;  5AAN A;  1FF1 A;  2QAC A;  2O60 A;  2LHL A;  4N5X A;  1NCY A;  2BE6 A;  1XFR A;  3NSO A;  1JFK A;  1S6C A;  1IH0 A;  2M1U A;  3BFA A;  1QVI Z;  1U5I B;  4MRX A;  3D77 A;  1B1G A;  3PN7 C;  3AKA A;  2M7N A;  2CNP A;  3PM2 A;  4HRH A;  1L7Z A;  1KFX L;  1MWN A;  1SR6 C;  1WDC B;  1N65 A;  4WQ3 A;  2K0J A;  1OZS A;  1K8U A;  3O78 A;  1DJZ A;  1LA0 A;  1UUR A;  2M1K B;  4INX A;  5JOL A;  1S1E A;  3E3R A;  4C0L A;  5TNC A;  3R1V A;  1B9A A;  3DVJ A;  1QIW A;  3TUY C;  2LLU A;  1F71 A;  3BUN B;  5G08 A;  1OW4 A;  2BEC A;  5HKW A;  1LIN A;  2NCO A;  3AAK A;  4CFQ A;  1K9P A;  1U5I A;  1G8I A;  4MVF A;  4NQG A;  3I5F C;  2H61 C;  3SG3 A;  1OMR A;  2KAV A;  2KLE A;  1CMG A;  4N1G A;  3SIB A;  1XFU O;  4QJ3 B;  5D69 A;  5CSN A;  2JXL A;  1N2D A;  3EK4 A;  1QJT A;  2O5G A;  2PSR A;  1QAT A;  1RTP 1;  2WC8 A;  3CGA A;  4L9M A;  4DRW A;  3PFV A;  1UUS A;  3NXA A;  3SJS A;  1NWD A;  1OQP A;  3GOF A;  3NHT A;  2I18 A;  2COL B;  5ER4 X;  2ZN8 A;  4FTG A;  4PT1 A;  2D8N A;  1KQV A;  1K90 D;  1G33 A;  2F2P A;  1BJF A;  1TCO B;  2KQ6 A;  2GV5 A;  3GK4 X;  4CFR A;  1EL4 A;  1LA3 A;  1BT6 A;  2E30 A;  2WCE A;  1A03 A;  3VRP A;  2KDH A;  3CR5 X;  2K60 A;  5CPV A;  1UHK A;  1QX2 A;  3SIA A;  1QWV A;  3MSE B;  3I5G B;  1CLM A;  2CTN A;  4I5L B;  4ZCU A;  1UHI A;  2LLT A;  3BUX B;  2HF5 A;  5I8N A;  3JTD C;  2FJU B;  4JQ0 D;  2ERB A;  1DJY A;  1K95 A;  3QRX A;  5FI2 A;  5AXI A;  1PSB A;  1GGW A;  1DGV A;  2HET A;  4GAO A;  1GQM A;  1KQM C;  2EHB A;  1C3Z A;  4XYN A;  2M29 A;  3O6B A;  2WOS A;  3SG5 A;  1WDC C;  1J7Q A;  1V1G A;  1KK7 Y;  2KI6 C;  2LMU A;  1DVI A;  1WRL A;  1SK6 D;  2WC6 A;  1RK9 A;  1R2U A;  3B7A A;  3D73 A;  3FS7 A;  4GGF C;  4YI8 A;  2KYC A;  3D0Y A;  1NCX A;  2JUL A;  1GM0 A;  1B4C A;  1B7T Z;  4PHM A;  4INW A;  3SS5 A;  3IQQ A;  1NYA A;  1PAL A;  1PVA A;  2JXC A;  2F2O A;  1DJH A;  1KK8 C;  1SCM C;  4C0J A; 
#chains in the Genus database with same CATH homology
 2PQL A;  3FE9 A;  3S0A A;  3L4A A;  1C3Y A;  3CYZ A;  2WCM A;  1DQE A;  3S0D A;  3V2L A;  3DYE A;  3PJI A;  3S0F A;  3R1O A;  5EL2 A;  3S0E A;  1ORG A;  3QME A;  2WC5 A;  3CAB A;  2P70 A;  2QEB A;  3BJH A;  3N7H A;  2QEV A;  1T14 A;  1XFR A;  2GTE A;  3BFA A;  2QEH A;  1TUJ A;  3D77 A;  1TWO A;  2FJY A;  2P71 A;  3RZS A;  2JPO A;  4FQT A;  3D74 A;  3S0B A;  3NGV A;  4INX A;  3VB1 A;  3D75 A;  3R1V A;  1P28 A;  3L4L A;  3K1E A;  1LS8 A;  1OOI X;  4F7F A;  1OW4 A;  3B86 A;  3CZ1 A;  2WCH A;  3CZ0 A;  1OOF A;  1OOH A;  4JD9 A;  3B88 A;  2QEO A;  3CZ2 A;  3FE8 A;  3D76 A;  1OOG A;  3Q8I A;  3NHT A;  3CDN A;  5DIC A;  4PT1 A;  2L2C A;  3B6X A;  3DZT A;  3FE6 A;  3BFH A;  2WCK A;  3R1P A;  3D78 A;  2H8V A;  1QWV A;  3B87 A;  3R72 A;  3OGN A;  3S0G A;  2KPH A;  2WCJ A;  3L47 A;  3NHI A;  2ERB A;  3DXL A;  4OZD A;  1C3Z A;  2WCL A;  3DY9 A;  2WC6 A;  3B7A A;  3D73 A;  2QDI A;  1GM0 A;  4INW A;  3BFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...