1TN4A

Four calcium tnc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
157
structure length
157
Chain Sequence
TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Structures of four Ca2+-bound troponin C at 2.0 A resolution: further insights into the Ca2+-switch in the calmodulin superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Contractile system protein
total genus 63
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 1997-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tn4A00
1TCOB 2JNXA 3DVEA 3KEVA 1H4BA 2JQ6A 5CSIA 1OE9B 2LC5A 2WORA 2M1KB 3OP0A 3CR2A 5HKZA 1V1GA 1W7IB 2LVJA 3PSRA 2KSPA 4ZCUA 1ALWA 1PVAA 1NX2A 1QASA 1B7TY 1Y1AA 1KWOC 3PN7C 3VGOA 2VRGA 1SK6D 4BY4A 4MRXA 2LE9B 3OX5A 1DT7B 2BCXA 3D10A 5J3XA 4ICBA 2LLUA 3BUOB 1DJXA 4MSPA 2L0PA 3A8RA 1QX7A 4CLNA 1XFWO 3RM1A 1BF5A 2WCEA 1SPYA 1HT9A 1MXEA 2WC8A 2MLFC 4F0ZB 4YGCB 2K0JA 2JWWA 5F6TA 5JJGA 1WRKA 2CNPA 1RJVA 4YI9A 1ZACA 2FJUB 3RLZA 1NCZA 3TDIA 1YURA 1A03A 1B47A 1F55A 1OMVA 2Y5IA 1TNPA 4WQ3A 3SG6A 3WHUB 1DJGA 1IRJA 5HKWA 1B8RA 1XFVO 1MHOA 1CFCA 3FS7A 5G08A 2BE4A 1V1FA 1CDNA 1AJ4A 3I5FC 2KI6D 2L50A 1GGZA 1KK8C 3HCMA 4XJKA 4A4CA 1IGVA 1M31A 1U5IB 5I2OA 2LANA 1YX7A 1TIZA 2OS8B 3EVUA 1JWDA 3EK8A 1K96A 2LUCA 4CIDA 2EC6B 1CKKA 3OB1B 2P6BB 1KFXL 1XFXO 3DF0A 2CTNA 1PULA 2K8MB 2LNKA 2L4HA 1PVBA 1B9AA 2K7BA 1CMGA 3TDZA 3CZTX 1AK8A 3D0YA 1ALVA 1OSAA 1SNLA 4NDBA 1A75A 2WCFA 3IQOA 4PHMA 3F45A 5DKQA 1MUXA 1NYAA 2H2KA 1Y6WA 5CSJA 3SG7A 3CTNA 2WOSA 3NSOA 1KFUS 4ZCVA 2JNFA 1YVHA 2IS9A 2M7LA 2L2EA 1RROA 1C7VA 2O60A 3E3RA 3PLFB 1MWNA 4N1GA 2PALA 4YGEB 2M1UA 1K95A 1ZFSA 1QV1A 4MLWA 4PALA 4QJ3B 1K93D 1WDCC 3VRQA 2D8NA 4PE7A 2CT9A 2KYFA 3NSIA 3CR4X 1A4PA 1IJ5A 3NSKA 4N1FA 2MAZA 1KQMC 3I5HB 1G4YR 4YGBB 5IBWA 1BU3A 2Y1MA 1YTZC 3DVJA 2MBXA 2OPOA 3JTDC 2K2AA 3O6BA 1GQMA 4CPVA 1FPWA 3TS5B 1QATA 4PHNA 2QACA 1YVLA 1BMOA 3BOWA 1YR5A 3CLNA 2M97A 3TDUA 2HPSA 2LM5A 2FCDA 4MEWA 1NSHA 4I5NB 1BODA 1GJYA 1LVCD 1J1DA 1SW8A 1KK7Y 2K7DA 2KGBC 2ZRSA 1M45A 2LMVA 3JVTB 2ZN8A 1TCFA 5I2LA 2KDHA 4GNKB 3DVMA 1J7OA 3AKAA 3GK4X 2LAPA 2BKIB 3ZWHA 4QJ4B 4MBEA 1JC2A 4A4BA 1QVIZ 2BL0B 2ZN9A 1JFKA 2L51A 2NCOA 3WHTB 4OV2A 5KTYA 1L2OB 1VRKA 3BUWB 1DTLA 2JU0A 3NXAA 4ORAB 4ETOA 3PFVA 1R2UA 5FYXA 1RECA 1SL9A 4YI8A 1SL7A 3BUNB 4USLA 3O78A 4MN0A 3VRRA 3KF9A 2PASA 1FBVA 2KAVA 2OTGB 1F54A 2MA2A 4PE0A 2JTZA 1EXRA 2JOJA 1B4CA 1CDLA 3ICBA 2BKHB 3CWGA 3CGAA 4GGFA 1DGVA 1PSBA 1N65A 1KWOB 1N2DA 2KI4C 1M63B 3PN7B 1U5IA 2JPTA 2DOQA 3CS1A 1JFJA 1NX3A 2JXCA 4NDCA 4MRYA 4MZLA 1SCMC 2KFGA 2K2FA 5AEQA 1NP8A 2AAOA 2GGMA 5HKYA 5AXIA 1EJ3A 3SJSA 4YBHB 2HETA 3DD4A 2ZFDA 1TTXA 1S3PA 4PE1A 2M9GA 2HF5A 1S26D 5DKNA 2G9BA 2KOTA 2M49B 3EVRA 1C07A 1B7TZ 1OMRA 5TNCA 5I8NA 2FOTA 4OR9B 1CLMA 2HQ8A 4BY5A 2EHBA 1XFZO 1KFXS 1UWOA 4GFTA 1G33A 1D1OA 2G2BA 2F2OA 1J1EA 2GV5A 2KAXA 1WRZA 1SMGA 4PDZA 2PVBA 4UPGA 4NQGA 3I5FB 4OVNF 3GK2A 3LCPC 4QJ5B 4C0JA 1K2HA 2MLEC 2KI6C 4AQIA 1K90D 1OQPA 4IL1A 2I94A 3AKBA 1JUOA 3VROA 1A2XA 3TZ1A 1Y1XA 2LP3A 2PRUA 1YRUB 1JSAA 1SY9A 1RTP1 1UHNA 2E6WA 1DJIA 2H61A 3DVKA 1NCYA 1C7WA 4GBAA 1K9PA 2BCAA 2KFFA 4JQ0D 2K7CA 1E8AA 4FQOA 3TUYC 2K61A 2LV7A 2KYCA 4GGNA 2A4JA 5I2QA 4MZJA 2EGDA 2JC2A 2O5GA 2Q4UA 3C1VA 2JULA 4MVFA 1LXFC 2WCBA 1YUUA 3I5IB 3KO0A 4L9MA 1F8HA 1EH2A 1QS7A 3CR5X 3PALA 1OMDA 2PMYA 4JPZB 4E68A 1UUSA 2TN4A 2M0RA 3SIAA 3ZNIA 5AFPA 2F8PA 2KGRA 4PCWA 4DS7A 1DGUA 2F2PA 1SR6B 1WRLA 1F70A 1N0YA 1QIVA 1EG3A 3GOFA 4PE4A 2LVKA 1A29A 1S5GZ 1ZUZA 2H61C 3O4YA 2RGIA 2I2RE 2BCBA 1PK0D 1NWDA 2ZRTA 4N5XA 1X02A 4YGDB 2LUXA 1CLLA 2CXJA 3LK0A 4GUKA 1KQMB 2KBIA 2KQ6A 1BR4B 1WLMA 3D0YB 5PALA 2WNDA 1CMFA 3JTDB 2BBMA 3EK7A 1QLSA 4XYNA 4DIRA 1AVSA 1LA3A 4NDDA 1HQVA 3SG3A 3TS5C 1OZSA 5AERA 1SL8A 3I5GC 5B8IB 3FWBA 1H8BA 1DF0B 2COLB 1XO5A 1YUTA 1CFPA 3IQQA 1EL4A 1L7ZA 1QIWA 1UHKA 2NZ0A 1CTRA 1CFDA 1KSMA 3FIAA 3WXAA 1TNWA 1RFJA 1IQ3A 5D69A 2KHNA 2MHHA 1EG4A 1LA0A 1M39A 1CNPA 3JVTC 2LLTA 5HLVA 5HLOA 1NCXA 1IKUA 1QX2A 2LVVA 1KCYA 2JTTA 3EKHA 5DKRA 1FF1A 1ODBA 4HREE 1SYMA 2JT3A 3PATA 1F4QA 1S36A 1SBJA 1PALA 2L5XB 1QV0A 1B8CA 4TNCA 2PSRA 1L2OC 2M29A 5ER5A 4GAOA 4ORBB 5ER4X 2Y4QA 5K89A 2JT8A 2F3YA 1AP4A 2R2IA 1KK7Z 4R1EA 3PM8A 2MRDA 1JF2A 1OZOA 3FWCA 3MSEB 3O2PA 2OTGC 3K21A 1NX1A 2JZIA 3BOWB 1KQVA 1UURA 1W7JB 2JXLA 5KU1A 2LCPA 1FW4A 3EK4A 1NIWA 1J7RA 2KI4B 1NPQA 4OKHA 2I18A 1XYDA 1K9UA 4I5JA 1SCMB 2K7OA 1K94A 1F71A 1TNXA 2SASA 4U8DA 1MQ1A 1XK4A 1CFFA 4CFQA 2Y1NA 2L4IA 4C0LA 4I5LB 1F4OA 1YX8A 1CB1A 2F3ZA 2LLSA 1G8IA 3OX6A 4PHKA 5D7FA 2CBLA 2LMUA 2SCPA 1QX5B 3OHMB 4ORCB 2JT0A 1PRWA 4P5OE 1DJYA 3M0WA 1GGWA 1SCVA 3SG4A 1FI5A 2LMTA 2M3WA 1YUSA 1B8LA 4GGFC 1KK8B 2MJWB 2HQWA 3AAJA 1BG1A 4HRGA 1NX0A 2BBNA 1JBAA 1S6CA 1K8UA 2OS8C 1ZMZA 1WY9A 5KSZA 2EC6C 1DVIA 1DJHA 5GQQC 1WLZA 1QTXA 1J7PA 2LHLA 1FI6A 1KSOA 1IG5A 1TNQA 4CFRA 1CDPA 4YGAA 1YRTB 2LHIA 1BJFA 1S6JA 1DJZA 2NCPA 1CDMA 3H4SE 1XK4C 3KPXA 1IWQA 3AAKA 1XFYO 1LINA 2M7NA 1K9KA 1MXLC 3TUYB 4I5KA 3BUMB 5CSFA 3SG5A 1IH0A 1RK9A 1XA5A 3GK1A 1S5GY 1AUIB 1XVJA 1XFUO 2ZNEA 2F33A 3BQ3A 4XJKB 2V53A 4HRHA 1UHIA 2Q91A 2BE6A 3I5IC 5AANA 5JOLA 1TRFA 4JWQA 1TN4A 3QRXA 4GPLB 1UHJA 1WDCB 4AQJA 2NLNA 2KAYA 2LVIA 3SG2A 1AHRA 3DF0B 1Y1UA 4D1EA 5HYDA 1BLQA 1DF0A 1Y0VH 1KFUL 2M8UA 3IF7A 2FCEA 1IQ5A 5CSNA 1MF8B 1SR6C 1JF0A 3A4UB 3WNXB 3LK1A 5CPVA 4Q04A 3I5HC 4PHJA 4C0KA 2LP2A 1R6PA 2I7AA 1A75B 4WRIA 5BPJA 1LKJA 1J55A 3EKJA 2AMIA 3LLEA 4OCIA 1CM1A 1AJ5A 1M46A 1TOPA 1QLKA 1QVIY 1RWYA 1CM4A 4M2QA 1PSRA 2JRFA 1ZOTB 1IJ6A 1BOCA 1SKTA 3HX4A 2ISDA 3SIBA 2CCMA 1S6IA 3BXKA 2GGZA 2QPTA 1B1GA 2L98A 4DRWA 1CLBA 3BUXB 1SRAA 4AOMA 3LL8B 4FTGA 1BT6A 1DMOA 3I5GB 2ZNDA 2E30A 1Q80A 2ZKMX 2KNEA 3BYAA 1J7QA 2AUCA 4DUQA 1NUBA 1BR1B 3EVVA 3NSLA 2KQYA 1S1EA 4DCKA 2BL0C 2B1UA 2KFHA 3KHEA 1DJWA 1QJTA 1UHHA 1OOJA 2KBMA 4YRUA 4MZKA 3OB2B 4M2PA 1MR8A 4M2OA 1QXPA 1UP5A 2NXQA 3VRPA 4P2YB 3VRNA 2BECA 4HSZA 4WQ2A
chains in the Genus database with same CATH superfamily
1TCOB 2JNXA 3DVEA 3KEVA 1H4BA 2JQ6A 5CSIA 1OE9B 2LC5A 2WORA 2M1KB 3OP0A 3CR2A 5HKZA 1V1GA 1W7IB 2LVJA 3PSRA 2KSPA 2WCMA 1ALWA 1PVAA 1NX2A 1QASA 2JPOA 3D78A 4ZCUA 1B7TY 1Y1AA 1KWOC 2GTEA 3PN7C 3VGOA 2VRGA 1SK6D 4BY4A 4MRXA 2LE9B 3OX5A 1DT7B 2BCXA 3D10A 5J3XA 3BJHA 4ICBA 2LLUA 3BUOB 1DJXA 4MSPA 1OOHA 2L0PA 3FE9A 3R1OA 3A8RA 3NHTA 3R1VA 1QX7A 4CLNA 1XFWO 3RM1A 1BF5A 2WCEA 1SPYA 1HT9A 1MXEA 2WC8A 2MLFC 4F0ZB 1DQEA 4YGCB 2K0JA 2JWWA 5F6TA 5JJGA 1WRKA 2CNPA 3D77A 1RJVA 4YI9A 1ZACA 2FJUB 3RLZA 1NCZA 3TDIA 1YURA 1A03A 1B47A 4JD9A 1F55A 1OMVA 2Y5IA 1TNPA 4WQ3A 3SG6A 3WHUB 1DJGA 4INXA 1IRJA 5HKWA 1B8RA 1XFVO 1MHOA 3O4XA 3FE8A 3FS7A 2BE4A 1V1FA 5G08A 3RZSA 1CFCA 1CDNA 1AJ4A 3I5FC 2KI6D 2L50A 1GGZA 1KK8C 3HCMA 4XJKA 4A4CA 1IGVA 1M31A 1U5IB 1TUJA 5I2OA 2LANA 1YX7A 1TIZA 2OS8B 3EVUA 1JWDA 3EK8A 1K96A 2LUCA 4CIDA 2EC6B 1CKKA 3OB1B 2P6BB 1KFXL 1XFXO 3DF0A 2CTNA 1PULA 3B86A 2K8MB 2LNKA 2L4HA 1PVBA 1B9AA 2ERBA 2K7BA 1CMGA 3TDZA 3CZTX 1AK8A 3D0YA 1ALVA 1OSAA 1SNLA 4NDBA 1A75A 2WCFA 3IQOA 4PHMA 3F45A 5D3OA 3CDNA 5DKQA 1MUXA 1NYAA 2H2KA 1Y6WA 5CSJA 3SG7A 3CTNA 1T14A 2WOSA 1OOIX 3NSOA 1KFUS 3BFHA 4ZCVA 2JNFA 1YVHA 2IS9A 2M7LA 2L2EA 1RROA 1C7VA 2O60A 3E3RA 3PLFB 1MWNA 2QDIA 4N1GA 2PALA 4YGEB 2M1UA 1K95A 1ZFSA 1QV1A 4MLWA 4PALA 4QJ3B 1K93D 1WDCC 3VRQA 4OZDA 2D8NA 4PE7A 2CT9A 2KYFA 3NSIA 3CR4X 1A4PA 1IJ5A 3NSKA 4N1FA 2MAZA 3L4LA 1KQMC 3BFAA 1G4YR 3I5HB 3CABA 4YGBB 5IBWA 1BU3A 2Y1MA 4FQTA 1YTZC 3DVJA 2WC5A 2MBXA 2OPOA 3JTDC 2K2AA 3O6BA 1GQMA 4CPVA 1FPWA 3TS5B 1QATA 1C3ZA 2QACA 4PHNA 1YVLA 1DC1A 1BMOA 3BOWA 1YR5A 3CLNA 2M97A 3TDUA 2HPSA 2LM5A 2FCDA 4MEWA 1NSHA 4I5NB 1BODA 1GJYA 1LVCD 1J1DA 1SW8A 1KK7Y 2K7DA 2KGBC 2ZRSA 4JKTA 1M45A 2LMVA 3JVTB 5HL1A 2ZN8A 1TCFA 5I2LA 2KDHA 4GNKB 3DVMA 1J7OA 3AKAA 3GK4X 2LAPA 2BKIB 3ZWHA 4QJ4B 3R72A 3PJIA 4MBEA 3V2LA 4A4BA 1QVIZ 1JC2A 1IIOA 2BL0B 2ZN9A 1JFKA 2L51A 2NCOA 3WHTB 4OV2A 5KTYA 1TUZA 1L2OB 1VRKA 3BUWB 1DTLA 2JU0A 3NXAA 4ORAB 3UO9A 3PFVA 4ETOA 1R2UA 5FYXA 3L4AA 1RECA 1SL9A 4YI8A 1SL7A 3BUNB 4USLA 3O78A 4MN0A 3VRRA 3KF9A 2PASA 1DEKA 1FBVA 2KAVA 2OTGB 1F54A 1QWVA 2MA2A 4PE0A 2JTZA 1EXRA 2JOJA 1B4CA 1CDLA 3ICBA 2BKHB 1SSEB 3CWGA 3FE6A 3CGAA 4GGFA 1DGVA 1PSBA 1N65A 1KWOB 1N2DA 2KI4C 1M63B 3PN7B 1U5IA 2JPTA 2DOQA 3CS1A 1JFJA 1NX3A 3CYZA 2JXCA 4NDCA 4MRYA 4MZLA 1SCMC 2KFGA 3S0BA 2K2FA 5AEQA 1NP8A 2AAOA 2GGMA 5HKYA 5AXIA 1EJ3A 2WCKA 1ORGA 3SJSA 4YBHB 2HETA 3DD4A 2ZFDA 1TTXA 1P28A 1S3PA 4PE1A 2M9GA 3SS3A 2HF5A 1S26D 5DKNA 2G9BA 2KOTA 2KLDA 2M49B 3EVRA 1C07A 1B7TZ 1OMRA 5TNCA 5I8NA 2FOTA 4OR9B 1CLMA 2HQ8A 4IJ7A 4BY5A 2EHBA 1XFZO 3B87A 1KFXS 2K60A 1UWOA 4GFTA 1G33A 4INWA 2G2BA 2F2OA 1J1EA 2GV5A 2KAXA 1WRZA 1D1OA 1SMGA 4PDZA 1DELA 2PVBA 4UPGA 4NQGA 2P70A 3I5FB 4OVNF 3GK2A 3LCPC 4QJ5B 4C0JA 1K2HA 2MLEC 2KI6C 4AQIA 1Z2CB 1K90D 1OQPA 4IL1A 1GM0A 2I94A 3AKBA 1JUOA 2YGUA 3VROA 1A2XA 3TZ1A 3D76A 1Y1XA 2LP3A 2PRUA 1YRUB 1JSAA 1SY9A 1RTP1 1UHNA 2E6WA 1DJIA 2H61A 3DVKA 1NCYA 1C7WA 4GBAA 1K9PA 2BCAA 2KFFA 3B6XA 2K7CA 1E8AA 4FQOA 4JQ0D 3VB1A 2K61A 2LV7A 3TUYC 2KYCA 4GGNA 2A4JA 5I2QA 4MZJA 2EGDA 2JC2A 2O5GA 2Q4UA 3C1VA 2JULA 4MVFA 5EL2A 1LXFC 2WCBA 1YUUA 3I5IB 3KO0A 4L9MA 1F8HA 1EH2A 1QS7A 3CR5X 2H8VA 3DXLA 3PALA 1OMDA 2PMYA 4JPZB 4E68A 1UUSA 2TN4A 2M0RA 3NGVA 3PM2A 3SIAA 3ZNIA 5AFPA 2F8PA 2KGRA 4PCWA 4DS7A 1DGUA 2F2PA 1SR6B 3CZ0A 5FI7A 1WRLA 1F70A 1N0YA 1QIVA 1EG3A 3GOFA 4PE4A 2LVKA 1A29A 1OW4A 1S5GZ 1ZUZA 2H61C 3O4YA 2RGIA 2I2RE 2BCBA 1PK0D 3OBVA 1NWDA 2ZRTA 4N5XA 1X02A 2BNXA 4YGDB 2LUXA 1CLLA 2PYQA 2CXJA 2BAPA 3LK0A 4GUKA 1KQMB 2WCHA 2KBIA 2KQ6A 1BR4B 1WLMA 3D0YB 3S0EA 2WCJA 5PALA 2WNDA 1CMFA 3JTDB 2BBMA 3EK7A 1QLSA 4XYNA 4DIRA 1AVSA 1LA3A 4NDDA 1HQVA 3SG3A 3TS5C 1OZSA 5AERA 1SL8A 3I5GC 5B8IB 3FWBA 1H8BA 1DF0B 2COLB 1XO5A 1YUTA 1CFPA 3IQQA 1Z4HA 1EL4A 1L7ZA 1QIWA 1UHKA 2NZ0A 1CTRA 1CFDA 1KSMA 3BFBA 3FIAA 3WXAA 1TNWA 1RFJA 1IQ3A 5D69A 2KHNA 2MHHA 1EG4A 1LA0A 1M39A 1CNPA 3JVTC 2LLTA 2WCLA 3R1PA 5HLVA 5HLOA 1NCXA 1IKUA 1QX2A 2KPHA 2LVVA 2JTTA 3EKHA 5DKRA 1KCYA 1FF1A 1ODBA 4HREE 1SYMA 2JT3A 3PATA 1F4QA 1S36A 1SBJA 1PALA 2L5XB 3DY9A 1QV0A 1B8CA 1TWOA 4TNCA 2PSRA 1L2OC 2M29A 1LS8A 5ER5A 4GAOA 4ORBB 5ER4X 2Y4QA 5K89A 2JT8A 3N7HA 2F3YA 1AP4A 2R2IA 1KK7Z 4R1EA 3CZ1A 3PM8A 3K1EA 2MRDA 1JF2A 1OZOA 3FWCA 3MSEB 2KLEA 2OTGC 3O2PA 3K21A 1NX1A 2JZIA 3BOWB 1KQVA 1UURA 1W7JB 2JXLA 2L2CA 3B88A 5KU1A 2LCPA 1FW4A 3EK4A 1NIWA 1J7RA 2KI4B 1NPQA 3EG5B 4OKHA 2L5YA 2I18A 1XYDA 4F7FA 1K9UA 4I5JA 1SCMB 2K7OA 1K94A 1F71A 1TNXA 2PQLA 3CZ2A 2SASA 4U8DA 1MQ1A 1XK4A 3D73A 1CFFA 4CFQA 2Y1NA 2L4IA 4C0LA 4I5LB 1F4OA 1YX8A 1CB1A 2F3ZA 2LLSA 1G8IA 3OX6A 4PHKA 5D7FA 2CBLA 2LMUA 2SCPA 3IVTA 1QX5B 3OHMB 4ORCB 2JT0A 1PRWA 4P5OE 1DJYA 3M0WA 1GGWA 1SCVA 3SG4A 1FI5A 2LMTA 2M3WA 3D75A 1YUSA 1B8LA 4GGFC 1KK8B 2MJWB 2HQWA 3AAJA 1BG1A 4HRGA 1NX0A 2BBNA 1JBAA 1S6CA 1K8UA 2OS8C 1ZMZA 1WY9A 5KSZA 2EC6C 1DVIA 1DJHA 5GQQC 1WLZA 1QTXA 1J7PA 2LHLA 1FI6A 1KSOA 2WC6A 1IG5A 1TNQA 4CFRA 1C3YA 1CDPA 4YGAA 1YRTB 2LHIA 1BJFA 3NHIA 1S6JA 1DJZA 2NCPA 3DYEA 1CDMA 3H4SE 1XK4C 3L47A 3KPXA 1IWQA 3AAKA 1XFYO 1LINA 2FJYA 4PT1A 2M7NA 1K9KA 1MXLC 3TUYB 5FI2A 4I5KA 3Q8IA 3BUMB 5CSFA 3SG5A 1IH0A 1RK9A 1XA5A 3GK1A 1S5GY 1AUIB 3S0GA 3SS4A 1XVJA 1XFUO 2ZNEA 3S0AA 2F33A 3BQ3A 4XJKB 2V53A 4HRHA 1UHIA 2Q91A 2BE6A 3I5IC 5AANA 5JOLA 1TRFA 4JWQA 1TN4A 3QRXA 4GPLB 3SS5A 1UHJA 1WDCB 4AQJA 2NLNA 2KAYA 2LVIA 3SG2A 1AHRA 3DF0B 1Y1UA 4D1EA 5HYDA 1BLQA 1DF0A 1Y0VH 3B7AA 2QEVA 1KFUL 2M8UA 3IF7A 5DICA 2FCEA 1IQ5A 5CSNA 1MF8B 1SR6C 5FI6A 1JF0A 1XFRA 3A4UB 3QMEA 3WNXB 3LK1A 5CPVA 4Q04A 3OGNA 3I5HC 4PHJA 4C0KA 2LP2A 1R6PA 2QEBA 2I7AA 1A75B 4WRIA 5BPJA 1LKJA 1J55A 3EKJA 2AMIA 3LLEA 4OCIA 1CM1A 1W9ZA 3D74A 1AJ5A 1M46A 1TOPA 1QLKA 1QVIY 1RWYA 1CM4A 4M2QA 1PSRA 2JRFA 1ZOTB 1IJ6A 3UNWA 1SKTA 1BOCA 3HX4A 2ISDA 3SIBA 2CCMA 1S6IA 2QEHA 3BXKA 2GGZA 2QPTA 1B1GA 2L98A 4DRWA 1CLBA 3BUXB 1SRAA 2P71A 4AOMA 3LL8B 4FTGA 1BT6A 1DMOA 1OOFA 3I5GB 2ZNDA 2E30A 1Q80A 2ZKMX 2KNEA 3BYAA 1J7QA 2AUCA 4DUQA 1NUBA 1BR1B 3EVVA 3NSLA 2KQYA 1S1EA 4DCKA 2BL0C 1OOGA 2B1UA 2KFHA 3KHEA 1DJWA 3S0FA 1QJTA 1UHHA 2QEOA 1OOJA 2KBMA 4YRUA 4MZKA 3OB2B 4M2PA 1MR8A 4M2OA 1QXPA 1UP5A 2NXQA 3S0DA 3VRPA 3DZTA 4P2YB 3VRNA 4KYNA 2BECA 5I94A 4HSZA 4WQ2A
chains in the Genus database with same CATH topology
1TCOB 2JNXA 3DVEA 3KEVA 1H4BA 2JQ6A 5CSIA 1OE9B 2LC5A 2WORA 2M1KB 3OP0A 3CR2A 5HKZA 1V1GA 1W7IB 2LVJA 3PSRA 2KSPA 4ZCUA 1ALWA 1PVAA 1NX2A 1QASA 1B7TY 1Y1AA 1KWOC 3PN7C 3VGOA 2VRGA 1SK6D 4BY4A 4MRXA 2LE9B 3OX5A 1DT7B 2BCXA 3D10A 5J3XA 4ICBA 2LLUA 3BUOB 1DJXA 4MSPA 2L0PA 3A8RA 1QX7A 4CLNA 1XFWO 3RM1A 1BF5A 2WCEA 1SPYA 1HT9A 1MXEA 2WC8A 2MLFC 4F0ZB 4YGCB 2K0JA 2JWWA 5F6TA 5JJGA 1WRKA 2CNPA 1RJVA 4YI9A 1ZACA 2FJUB 3RLZA 1NCZA 3TDIA 1YURA 1A03A 1B47A 1F55A 1OMVA 2Y5IA 1TNPA 4WQ3A 3SG6A 3WHUB 1DJGA 1IRJA 5HKWA 1B8RA 1XFVO 1MHOA 1CFCA 3FS7A 5G08A 2BE4A 1V1FA 1CDNA 1AJ4A 3I5FC 2KI6D 2L50A 1GGZA 1KK8C 3HCMA 4XJKA 4A4CA 1IGVA 1M31A 1U5IB 5I2OA 2LANA 1YX7A 1TIZA 2OS8B 3EVUA 1JWDA 3EK8A 1K96A 2LUCA 4CIDA 2EC6B 1CKKA 3OB1B 2P6BB 1KFXL 1XFXO 3DF0A 2CTNA 1PULA 2K8MB 2LNKA 2L4HA 1PVBA 1B9AA 2K7BA 1CMGA 3TDZA 3CZTX 1AK8A 3D0YA 1ALVA 1OSAA 1SNLA 4NDBA 1A75A 2WCFA 3IQOA 4PHMA 3F45A 5DKQA 1MUXA 1NYAA 2H2KA 1Y6WA 5CSJA 3SG7A 3CTNA 2WOSA 3NSOA 1KFUS 4ZCVA 2JNFA 1YVHA 2IS9A 2M7LA 2L2EA 1RROA 1C7VA 2O60A 3E3RA 3PLFB 1MWNA 4N1GA 2PALA 4YGEB 2M1UA 1K95A 1ZFSA 1QV1A 4MLWA 4PALA 4QJ3B 1K93D 1WDCC 3VRQA 2D8NA 4PE7A 2CT9A 2KYFA 3NSIA 3CR4X 1A4PA 1IJ5A 3NSKA 4N1FA 2MAZA 1KQMC 3I5HB 1G4YR 4YGBB 5IBWA 1BU3A 2Y1MA 1YTZC 3DVJA 2MBXA 2OPOA 3JTDC 2K2AA 3O6BA 1GQMA 4CPVA 1FPWA 3TS5B 1QATA 4PHNA 2QACA 1YVLA 1BMOA 3BOWA 1YR5A 3CLNA 2M97A 3TDUA 2HPSA 2LM5A 2FCDA 4MEWA 1NSHA 4I5NB 1BODA 1GJYA 1LVCD 1J1DA 1SW8A 1KK7Y 2K7DA 2KGBC 2ZRSA 1M45A 2LMVA 3JVTB 2ZN8A 1TCFA 5I2LA 2KDHA 4GNKB 3DVMA 1J7OA 3AKAA 3GK4X 2LAPA 2BKIB 3ZWHA 4QJ4B 4MBEA 1JC2A 4A4BA 1QVIZ 2BL0B 2ZN9A 1JFKA 2L51A 2NCOA 3WHTB 4OV2A 5KTYA 1L2OB 1VRKA 3BUWB 1DTLA 2JU0A 3NXAA 4ORAB 4ETOA 3PFVA 1R2UA 5FYXA 1RECA 1SL9A 4YI8A 1SL7A 3BUNB 4USLA 3O78A 4MN0A 3VRRA 3KF9A 2PASA 1FBVA 2KAVA 2OTGB 1F54A 2MA2A 4PE0A 2JTZA 1EXRA 2JOJA 1B4CA 1CDLA 3ICBA 2BKHB 3CWGA 3CGAA 4GGFA 1DGVA 1PSBA 1N65A 1KWOB 1N2DA 2KI4C 1M63B 3PN7B 1U5IA 2JPTA 2DOQA 3CS1A 1JFJA 1NX3A 2JXCA 4NDCA 4MRYA 4MZLA 1SCMC 2KFGA 2K2FA 5AEQA 1NP8A 2AAOA 2GGMA 5HKYA 5AXIA 1EJ3A 3SJSA 4YBHB 2HETA 3DD4A 2ZFDA 1TTXA 1S3PA 4PE1A 2M9GA 2HF5A 1S26D 5DKNA 2G9BA 2KOTA 2M49B 3EVRA 1C07A 1B7TZ 1OMRA 5TNCA 5I8NA 2FOTA 4OR9B 1CLMA 2HQ8A 4BY5A 2EHBA 1XFZO 1KFXS 1UWOA 4GFTA 1G33A 1D1OA 2G2BA 2F2OA 1J1EA 2GV5A 2KAXA 1WRZA 1SMGA 4PDZA 2PVBA 4UPGA 4NQGA 3I5FB 4OVNF 3GK2A 3LCPC 4QJ5B 4C0JA 1K2HA 2MLEC 2KI6C 4AQIA 1K90D 1OQPA 4IL1A 2I94A 3AKBA 1JUOA 3VROA 1A2XA 3TZ1A 1Y1XA 2LP3A 2PRUA 1YRUB 1JSAA 1SY9A 1RTP1 1UHNA 2E6WA 1DJIA 2H61A 3DVKA 1NCYA 1C7WA 4GBAA 1K9PA 2BCAA 2KFFA 4JQ0D 2K7CA 1E8AA 4FQOA 3TUYC 2K61A 2LV7A 2KYCA 4GGNA 2A4JA 5I2QA 4MZJA 2EGDA 2JC2A 2O5GA 2Q4UA 3C1VA 2JULA 4MVFA 1LXFC 2WCBA 1YUUA 3I5IB 3KO0A 4L9MA 1F8HA 1EH2A 1QS7A 3CR5X 3PALA 1OMDA 2PMYA 4JPZB 4E68A 1UUSA 2TN4A 2M0RA 3SIAA 3ZNIA 5AFPA 2F8PA 2KGRA 4PCWA 4DS7A 1DGUA 2F2PA 1SR6B 1WRLA 1F70A 1N0YA 1QIVA 1EG3A 3GOFA 4PE4A 2LVKA 1A29A 1S5GZ 1ZUZA 2H61C 3O4YA 2RGIA 2I2RE 2BCBA 1PK0D 1NWDA 2ZRTA 4N5XA 1X02A 4YGDB 2LUXA 1CLLA 2CXJA 3LK0A 4GUKA 1KQMB 2KBIA 2KQ6A 1BR4B 1WLMA 3D0YB 5PALA 2WNDA 1CMFA 3JTDB 2BBMA 3EK7A 1QLSA 4XYNA 4DIRA 1AVSA 1LA3A 4NDDA 1HQVA 3SG3A 3TS5C 1OZSA 5AERA 1SL8A 3I5GC 5B8IB 3FWBA 1H8BA 1DF0B 2COLB 1XO5A 1YUTA 1CFPA 3IQQA 1EL4A 1L7ZA 1QIWA 1UHKA 2NZ0A 1CTRA 1CFDA 1KSMA 3FIAA 3WXAA 1TNWA 1RFJA 1IQ3A 5D69A 2KHNA 2MHHA 1EG4A 1LA0A 1M39A 1CNPA 3JVTC 2LLTA 5HLVA 5HLOA 1NCXA 1IKUA 1QX2A 2LVVA 1KCYA 2JTTA 3EKHA 5DKRA 1FF1A 1ODBA 4HREE 1SYMA 2JT3A 3PATA 1F4QA 1S36A 1SBJA 1PALA 2L5XB 1QV0A 1B8CA 4TNCA 2PSRA 1L2OC 2M29A 5ER5A 4GAOA 4ORBB 5ER4X 2Y4QA 5K89A 2JT8A 2F3YA 1AP4A 2R2IA 1KK7Z 4R1EA 3PM8A 2MRDA 1JF2A 1OZOA 3FWCA 3MSEB 3O2PA 2OTGC 3K21A 1NX1A 2JZIA 3BOWB 1KQVA 1UURA 1W7JB 2JXLA 5KU1A 2LCPA 1FW4A 3EK4A 1NIWA 1J7RA 2KI4B 1NPQA 4OKHA 2I18A 1XYDA 1K9UA 4I5JA 1SCMB 2K7OA 1K94A 1F71A 1TNXA 2SASA 4U8DA 1MQ1A 1XK4A 1CFFA 4CFQA 2Y1NA 2L4IA 4C0LA 4I5LB 1F4OA 1YX8A 1CB1A 2F3ZA 2LLSA 1G8IA 3OX6A 4PHKA 5D7FA 2CBLA 2LMUA 2SCPA 1QX5B 3OHMB 4ORCB 2JT0A 1PRWA 4P5OE 1DJYA 3M0WA 1GGWA 1SCVA 3SG4A 1FI5A 2LMTA 2M3WA 1YUSA 1B8LA 4GGFC 1KK8B 2MJWB 2HQWA 3AAJA 1BG1A 4HRGA 1NX0A 2BBNA 1JBAA 1S6CA 1K8UA 2OS8C 1ZMZA 1WY9A 5KSZA 2EC6C 1DVIA 1DJHA 5GQQC 1WLZA 1QTXA 1J7PA 2LHLA 1FI6A 1KSOA 1IG5A 1TNQA 4CFRA 1CDPA 4YGAA 1YRTB 2LHIA 1BJFA 1S6JA 1DJZA 2NCPA 1CDMA 3H4SE 1XK4C 3KPXA 1IWQA 3AAKA 1XFYO 1LINA 2M7NA 1K9KA 1MXLC 3TUYB 4I5KA 3BUMB 5CSFA 3SG5A 1IH0A 1RK9A 1XA5A 3GK1A 1S5GY 1AUIB 1XVJA 1XFUO 2ZNEA 2F33A 3BQ3A 4XJKB 2V53A 4HRHA 1UHIA 2Q91A 2BE6A 3I5IC 5AANA 5JOLA 1TRFA 4JWQA 1TN4A 3QRXA 4GPLB 1UHJA 1WDCB 4AQJA 2NLNA 2KAYA 2LVIA 3SG2A 1AHRA 3DF0B 1Y1UA 4D1EA 5HYDA 1BLQA 1DF0A 1Y0VH 1KFUL 2M8UA 3IF7A 2FCEA 1IQ5A 5CSNA 1MF8B 1SR6C 1JF0A 3A4UB 3WNXB 3LK1A 5CPVA 4Q04A 3I5HC 4PHJA 4C0KA 2LP2A 1R6PA 2I7AA 1A75B 4WRIA 5BPJA 1LKJA 1J55A 3EKJA 2AMIA 3LLEA 4OCIA 1CM1A 1AJ5A 1M46A 1TOPA 1QLKA 1QVIY 1RWYA 1CM4A 4M2QA 1PSRA 2JRFA 1ZOTB 1IJ6A 1BOCA 1SKTA 3HX4A 2ISDA 3SIBA 2CCMA 1S6IA 3BXKA 2GGZA 2QPTA 1B1GA 2L98A 4DRWA 1CLBA 3BUXB 1SRAA 4AOMA 3LL8B 4FTGA 1BT6A 1DMOA 3I5GB 2ZNDA 2E30A 1Q80A 2ZKMX 2KNEA 3BYAA 1J7QA 2AUCA 4DUQA 1NUBA 1BR1B 3EVVA 3NSLA 2KQYA 1S1EA 4DCKA 2BL0C 2B1UA 2KFHA 3KHEA 1DJWA 1QJTA 1UHHA 1OOJA 2KBMA 4YRUA 4MZKA 3OB2B 4M2PA 1MR8A 4M2OA 1QXPA 1UP5A 2NXQA 3VRPA 4P2YB 3VRNA 2BECA 4HSZA 4WQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TCO B;  2JNX A;  3DVE A;  3KEV A;  1H4B A;  2JQ6 A;  5CSI A;  1OE9 B;  2LC5 A;  2WOR A;  2M1K B;  3OP0 A;  3CR2 A;  5HKZ A;  1V1G A;  1W7I B;  2LVJ A;  3PSR A;  2KSP A;  4ZCU A;  1ALW A;  1PVA A;  1NX2 A;  1QAS A;  1B7T Y;  1Y1A A;  1KWO C;  3PN7 C;  3VGO A;  2VRG A;  1SK6 D;  4BY4 A;  4MRX A;  2LE9 B;  3OX5 A;  1DT7 B;  2BCX A;  3D10 A;  5J3X A;  4ICB A;  2LLU A;  3BUO B;  1DJX A;  4MSP A;  2L0P A;  3A8R A;  1QX7 A;  4CLN A;  1XFW O;  3RM1 A;  1BF5 A;  2WCE A;  1SPY A;  1HT9 A;  1MXE A;  2WC8 A;  2MLF C;  4F0Z B;  4YGC B;  2K0J A;  2JWW A;  5F6T A;  5JJG A;  1WRK A;  2CNP A;  1RJV A;  4YI9 A;  1ZAC A;  2FJU B;  3RLZ A;  1NCZ A;  3TDI A;  1YUR A;  1A03 A;  1B47 A;  1F55 A;  1OMV A;  2Y5I A;  1TNP A;  4WQ3 A;  3SG6 A;  3WHU B;  1DJG A;  1IRJ A;  5HKW A;  1B8R A;  1XFV O;  1MHO A;  1CFC A;  3FS7 A;  5G08 A;  2BE4 A;  1V1F A;  1CDN A;  1AJ4 A;  3I5F C;  2KI6 D;  2L50 A;  1GGZ A;  1KK8 C;  3HCM A;  4XJK A;  4A4C A;  1IGV A;  1M31 A;  1U5I B;  5I2O A;  2LAN A;  1YX7 A;  1TIZ A;  2OS8 B;  3EVU A;  1JWD A;  3EK8 A;  1K96 A;  2LUC A;  4CID A;  2EC6 B;  1CKK A;  3OB1 B;  2P6B B;  1KFX L;  1XFX O;  3DF0 A;  2CTN A;  1PUL A;  2K8M B;  2LNK A;  2L4H A;  1PVB A;  1B9A A;  2K7B A;  1CMG A;  3TDZ A;  3CZT X;  1AK8 A;  3D0Y A;  1ALV A;  1OSA A;  1SNL A;  4NDB A;  1A75 A;  2WCF A;  3IQO A;  4PHM A;  3F45 A;  5DKQ A;  1MUX A;  1NYA A;  2H2K A;  1Y6W A;  5CSJ A;  3SG7 A;  3CTN A;  2WOS A;  3NSO A;  1KFU S;  4ZCV A;  2JNF A;  1YVH A;  2IS9 A;  2M7L A;  2L2E A;  1RRO A;  1C7V A;  2O60 A;  3E3R A;  3PLF B;  1MWN A;  4N1G A;  2PAL A;  4YGE B;  2M1U A;  1K95 A;  1ZFS A;  1QV1 A;  4MLW A;  4PAL A;  4QJ3 B;  1K93 D;  1WDC C;  3VRQ A;  2D8N A;  4PE7 A;  2CT9 A;  2KYF A;  3NSI A;  3CR4 X;  1A4P A;  1IJ5 A;  3NSK A;  4N1F A;  2MAZ A;  1KQM C;  3I5H B;  1G4Y R;  4YGB B;  5IBW A;  1BU3 A;  2Y1M A;  1YTZ C;  3DVJ A;  2MBX A;  2OPO A;  3JTD C;  2K2A A;  3O6B A;  1GQM A;  4CPV A;  1FPW A;  3TS5 B;  1QAT A;  4PHN A;  2QAC A;  1YVL A;  1BMO A;  3BOW A;  1YR5 A;  3CLN A;  2M97 A;  3TDU A;  2HPS A;  2LM5 A;  2FCD A;  4MEW A;  1NSH A;  4I5N B;  1BOD A;  1GJY A;  1LVC D;  1J1D A;  1SW8 A;  1KK7 Y;  2K7D A;  2KGB C;  2ZRS A;  1M45 A;  2LMV A;  3JVT B;  2ZN8 A;  1TCF A;  5I2L A;  2KDH A;  4GNK B;  3DVM A;  1J7O A;  3AKA A;  3GK4 X;  2LAP A;  2BKI B;  3ZWH A;  4QJ4 B;  4MBE A;  1JC2 A;  4A4B A;  1QVI Z;  2BL0 B;  2ZN9 A;  1JFK A;  2L51 A;  2NCO A;  3WHT B;  4OV2 A;  5KTY A;  1L2O B;  1VRK A;  3BUW B;  1DTL A;  2JU0 A;  3NXA A;  4ORA B;  4ETO A;  3PFV A;  1R2U A;  5FYX A;  1REC A;  1SL9 A;  4YI8 A;  1SL7 A;  3BUN B;  4USL A;  3O78 A;  4MN0 A;  3VRR A;  3KF9 A;  2PAS A;  1FBV A;  2KAV A;  2OTG B;  1F54 A;  2MA2 A;  4PE0 A;  2JTZ A;  1EXR A;  2JOJ A;  1B4C A;  1CDL A;  3ICB A;  2BKH B;  3CWG A;  3CGA A;  4GGF A;  1DGV A;  1PSB A;  1N65 A;  1KWO B;  1N2D A;  2KI4 C;  1M63 B;  3PN7 B;  1U5I A;  2JPT A;  2DOQ A;  3CS1 A;  1JFJ A;  1NX3 A;  2JXC A;  4NDC A;  4MRY A;  4MZL A;  1SCM C;  2KFG A;  2K2F A;  5AEQ A;  1NP8 A;  2AAO A;  2GGM A;  5HKY A;  5AXI A;  1EJ3 A;  3SJS A;  4YBH B;  2HET A;  3DD4 A;  2ZFD A;  1TTX A;  1S3P A;  4PE1 A;  2M9G A;  2HF5 A;  1S26 D;  5DKN A;  2G9B A;  2KOT A;  2M49 B;  3EVR A;  1C07 A;  1B7T Z;  1OMR A;  5TNC A;  5I8N A;  2FOT A;  4OR9 B;  1CLM A;  2HQ8 A;  4BY5 A;  2EHB A;  1XFZ O;  1KFX S;  1UWO A;  4GFT A;  1G33 A;  1D1O A;  2G2B A;  2F2O A;  1J1E A;  2GV5 A;  2KAX A;  1WRZ A;  1SMG A;  4PDZ A;  2PVB A;  4UPG A;  4NQG A;  3I5F B;  4OVN F;  3GK2 A;  3LCP C;  4QJ5 B;  4C0J A;  1K2H A;  2MLE C;  2KI6 C;  4AQI A;  1K90 D;  1OQP A;  4IL1 A;  2I94 A;  3AKB A;  1JUO A;  3VRO A;  1A2X A;  3TZ1 A;  1Y1X A;  2LP3 A;  2PRU A;  1YRU B;  1JSA A;  1SY9 A;  1RTP 1;  1UHN A;  2E6W A;  1DJI A;  2H61 A;  3DVK A;  1NCY A;  1C7W A;  4GBA A;  1K9P A;  2BCA A;  2KFF A;  4JQ0 D;  2K7C A;  1E8A A;  4FQO A;  3TUY C;  2K61 A;  2LV7 A;  2KYC A;  4GGN A;  2A4J A;  5I2Q A;  4MZJ A;  2EGD A;  2JC2 A;  2O5G A;  2Q4U A;  3C1V A;  2JUL A;  4MVF A;  1LXF C;  2WCB A;  1YUU A;  3I5I B;  3KO0 A;  4L9M A;  1F8H A;  1EH2 A;  1QS7 A;  3CR5 X;  3PAL A;  1OMD A;  2PMY A;  4JPZ B;  4E68 A;  1UUS A;  2TN4 A;  2M0R A;  3SIA A;  3ZNI A;  5AFP A;  2F8P A;  2KGR A;  4PCW A;  4DS7 A;  1DGU A;  2F2P A;  1SR6 B;  1WRL A;  1F70 A;  1N0Y A;  1QIV A;  1EG3 A;  3GOF A;  4PE4 A;  2LVK A;  1A29 A;  1S5G Z;  1ZUZ A;  2H61 C;  3O4Y A;  2RGI A;  2I2R E;  2BCB A;  1PK0 D;  1NWD A;  2ZRT A;  4N5X A;  1X02 A;  4YGD B;  2LUX A;  1CLL A;  2CXJ A;  3LK0 A;  4GUK A;  1KQM B;  2KBI A;  2KQ6 A;  1BR4 B;  1WLM A;  3D0Y B;  5PAL A;  2WND A;  1CMF A;  3JTD B;  2BBM A;  3EK7 A;  1QLS A;  4XYN A;  4DIR A;  1AVS A;  1LA3 A;  4NDD A;  1HQV A;  3SG3 A;  3TS5 C;  1OZS A;  5AER A;  1SL8 A;  3I5G C;  5B8I B;  3FWB A;  1H8B A;  1DF0 B;  2COL B;  1XO5 A;  1YUT A;  1CFP A;  3IQQ A;  1EL4 A;  1L7Z A;  1QIW A;  1UHK A;  2NZ0 A;  1CTR A;  1CFD A;  1KSM A;  3FIA A;  3WXA A;  1TNW A;  1RFJ A;  1IQ3 A;  5D69 A;  2KHN A;  2MHH A;  1EG4 A;  1LA0 A;  1M39 A;  1CNP A;  3JVT C;  2LLT A;  5HLV A;  5HLO A;  1NCX A;  1IKU A;  1QX2 A;  2LVV A;  1KCY A;  2JTT A;  3EKH A;  5DKR A;  1FF1 A;  1ODB A;  4HRE E;  1SYM A;  2JT3 A;  3PAT A;  1F4Q A;  1S36 A;  1SBJ A;  1PAL A;  2L5X B;  1QV0 A;  1B8C A;  4TNC A;  2PSR A;  1L2O C;  2M29 A;  5ER5 A;  4GAO A;  4ORB B;  5ER4 X;  2Y4Q A;  5K89 A;  2JT8 A;  2F3Y A;  1AP4 A;  2R2I A;  1KK7 Z;  4R1E A;  3PM8 A;  2MRD A;  1JF2 A;  1OZO A;  3FWC A;  3MSE B;  3O2P A;  2OTG C;  3K21 A;  1NX1 A;  2JZI A;  3BOW B;  1KQV A;  1UUR A;  1W7J B;  2JXL A;  5KU1 A;  2LCP A;  1FW4 A;  3EK4 A;  1NIW A;  1J7R A;  2KI4 B;  1NPQ A;  4OKH A;  2I18 A;  1XYD A;  1K9U A;  4I5J A;  1SCM B;  2K7O A;  1K94 A;  1F71 A;  1TNX A;  2SAS A;  4U8D A;  1MQ1 A;  1XK4 A;  1CFF A;  4CFQ A;  2Y1N A;  2L4I A;  4C0L A;  4I5L B;  1F4O A;  1YX8 A;  1CB1 A;  2F3Z A;  2LLS A;  1G8I A;  3OX6 A;  4PHK A;  5D7F A;  2CBL A;  2LMU A;  2SCP A;  1QX5 B;  3OHM B;  4ORC B;  2JT0 A;  1PRW A;  4P5O E;  1DJY A;  3M0W A;  1GGW A;  1SCV A;  3SG4 A;  1FI5 A;  2LMT A;  2M3W A;  1YUS A;  1B8L A;  4GGF C;  1KK8 B;  2MJW B;  2HQW A;  3AAJ A;  1BG1 A;  4HRG A;  1NX0 A;  2BBN A;  1JBA A;  1S6C A;  1K8U A;  2OS8 C;  1ZMZ A;  1WY9 A;  5KSZ A;  2EC6 C;  1DVI A;  1DJH A;  5GQQ C;  1WLZ A;  1QTX A;  1J7P A;  2LHL A;  1FI6 A;  1KSO A;  1IG5 A;  1TNQ A;  4CFR A;  1CDP A;  4YGA A;  1YRT B;  2LHI A;  1BJF A;  1S6J A;  1DJZ A;  2NCP A;  1CDM A;  3H4S E;  1XK4 C;  3KPX A;  1IWQ A;  3AAK A;  1XFY O;  1LIN A;  2M7N A;  1K9K A;  1MXL C;  3TUY B;  4I5K A;  3BUM B;  5CSF A;  3SG5 A;  1IH0 A;  1RK9 A;  1XA5 A;  3GK1 A;  1S5G Y;  1AUI B;  1XVJ A;  1XFU O;  2ZNE A;  2F33 A;  3BQ3 A;  4XJK B;  2V53 A;  4HRH A;  1UHI A;  2Q91 A;  2BE6 A;  3I5I C;  5AAN A;  5JOL A;  1TRF A;  4JWQ A;  1TN4 A;  3QRX A;  4GPL B;  1UHJ A;  1WDC B;  4AQJ A;  2NLN A;  2KAY A;  2LVI A;  3SG2 A;  1AHR A;  3DF0 B;  1Y1U A;  4D1E A;  5HYD A;  1BLQ A;  1DF0 A;  1Y0V H;  1KFU L;  2M8U A;  3IF7 A;  2FCE A;  1IQ5 A;  5CSN A;  1MF8 B;  1SR6 C;  1JF0 A;  3A4U B;  3WNX B;  3LK1 A;  5CPV A;  4Q04 A;  3I5H C;  4PHJ A;  4C0K A;  2LP2 A;  1R6P A;  2I7A A;  1A75 B;  4WRI A;  5BPJ A;  1LKJ A;  1J55 A;  3EKJ A;  2AMI A;  3LLE A;  4OCI A;  1CM1 A;  1AJ5 A;  1M46 A;  1TOP A;  1QLK A;  1QVI Y;  1RWY A;  1CM4 A;  4M2Q A;  1PSR A;  2JRF A;  1ZOT B;  1IJ6 A;  1BOC A;  1SKT A;  3HX4 A;  2ISD A;  3SIB A;  2CCM A;  1S6I A;  3BXK A;  2GGZ A;  2QPT A;  1B1G A;  2L98 A;  4DRW A;  1CLB A;  3BUX B;  1SRA A;  4AOM A;  3LL8 B;  4FTG A;  1BT6 A;  1DMO A;  3I5G B;  2ZND A;  2E30 A;  1Q80 A;  2ZKM X;  2KNE A;  3BYA A;  1J7Q A;  2AUC A;  4DUQ A;  1NUB A;  1BR1 B;  3EVV A;  3NSL A;  2KQY A;  1S1E A;  4DCK A;  2BL0 C;  2B1U A;  2KFH A;  3KHE A;  1DJW A;  1QJT A;  1UHH A;  1OOJ A;  2KBM A;  4YRU A;  4MZK A;  3OB2 B;  4M2P A;  1MR8 A;  4M2O A;  1QXP A;  1UP5 A;  2NXQ A;  3VRP A;  4P2Y B;  3VRN A;  2BEC A;  4HSZ A;  4WQ2 A; 
#chains in the Genus database with same CATH topology
 1TCO B;  2JNX A;  3DVE A;  3KEV A;  1H4B A;  2JQ6 A;  5CSI A;  1OE9 B;  2LC5 A;  2WOR A;  2M1K B;  3OP0 A;  3CR2 A;  5HKZ A;  1V1G A;  1W7I B;  2LVJ A;  3PSR A;  2KSP A;  2WCM A;  1ALW A;  1PVA A;  1NX2 A;  1QAS A;  2JPO A;  3D78 A;  4ZCU A;  1B7T Y;  1Y1A A;  1KWO C;  2GTE A;  3PN7 C;  3VGO A;  2VRG A;  1SK6 D;  4BY4 A;  4MRX A;  2LE9 B;  3OX5 A;  1DT7 B;  2BCX A;  3D10 A;  5J3X A;  3BJH A;  4ICB A;  2LLU A;  3BUO B;  1DJX A;  4MSP A;  1OOH A;  2L0P A;  3FE9 A;  3R1O A;  3A8R A;  3NHT A;  3R1V A;  1QX7 A;  4CLN A;  1XFW O;  3RM1 A;  1BF5 A;  2WCE A;  1SPY A;  1HT9 A;  1MXE A;  2WC8 A;  2MLF C;  4F0Z B;  1DQE A;  4YGC B;  2K0J A;  2JWW A;  5F6T A;  5JJG A;  1WRK A;  2CNP A;  3D77 A;  1RJV A;  4YI9 A;  1ZAC A;  2FJU B;  3RLZ A;  1NCZ A;  3TDI A;  1YUR A;  1A03 A;  1B47 A;  4JD9 A;  1F55 A;  1OMV A;  2Y5I A;  1TNP A;  4WQ3 A;  3SG6 A;  3WHU B;  1DJG A;  4INX A;  1IRJ A;  5HKW A;  1B8R A;  1XFV O;  1MHO A;  3O4X A;  3FE8 A;  3FS7 A;  2BE4 A;  1V1F A;  5G08 A;  3RZS A;  1CFC A;  1CDN A;  1AJ4 A;  3I5F C;  2KI6 D;  2L50 A;  1GGZ A;  1KK8 C;  3HCM A;  4XJK A;  4A4C A;  1IGV A;  1M31 A;  1U5I B;  1TUJ A;  5I2O A;  2LAN A;  1YX7 A;  1TIZ A;  2OS8 B;  3EVU A;  1JWD A;  3EK8 A;  1K96 A;  2LUC A;  4CID A;  2EC6 B;  1CKK A;  3OB1 B;  2P6B B;  1KFX L;  1XFX O;  3DF0 A;  2CTN A;  1PUL A;  3B86 A;  2K8M B;  2LNK A;  2L4H A;  1PVB A;  1B9A A;  2ERB A;  2K7B A;  1CMG A;  3TDZ A;  3CZT X;  1AK8 A;  3D0Y A;  1ALV A;  1OSA A;  1SNL A;  4NDB A;  1A75 A;  2WCF A;  3IQO A;  4PHM A;  3F45 A;  5D3O A;  3CDN A;  5DKQ A;  1MUX A;  1NYA A;  2H2K A;  1Y6W A;  5CSJ A;  3SG7 A;  3CTN A;  1T14 A;  2WOS A;  1OOI X;  3NSO A;  1KFU S;  3BFH A;  4ZCV A;  2JNF A;  1YVH A;  2IS9 A;  2M7L A;  2L2E A;  1RRO A;  1C7V A;  2O60 A;  3E3R A;  3PLF B;  1MWN A;  2QDI A;  4N1G A;  2PAL A;  4YGE B;  2M1U A;  1K95 A;  1ZFS A;  1QV1 A;  4MLW A;  4PAL A;  4QJ3 B;  1K93 D;  1WDC C;  3VRQ A;  4OZD A;  2D8N A;  4PE7 A;  2CT9 A;  2KYF A;  3NSI A;  3CR4 X;  1A4P A;  1IJ5 A;  3NSK A;  4N1F A;  2MAZ A;  3L4L A;  1KQM C;  3BFA A;  1G4Y R;  3I5H B;  3CAB A;  4YGB B;  5IBW A;  1BU3 A;  2Y1M A;  4FQT A;  1YTZ C;  3DVJ A;  2WC5 A;  2MBX A;  2OPO A;  3JTD C;  2K2A A;  3O6B A;  1GQM A;  4CPV A;  1FPW A;  3TS5 B;  1QAT A;  1C3Z A;  2QAC A;  4PHN A;  1YVL A;  1DC1 A;  1BMO A;  3BOW A;  1YR5 A;  3CLN A;  2M97 A;  3TDU A;  2HPS A;  2LM5 A;  2FCD A;  4MEW A;  1NSH A;  4I5N B;  1BOD A;  1GJY A;  1LVC D;  1J1D A;  1SW8 A;  1KK7 Y;  2K7D A;  2KGB C;  2ZRS A;  4JKT A;  1M45 A;  2LMV A;  3JVT B;  5HL1 A;  2ZN8 A;  1TCF A;  5I2L A;  2KDH A;  4GNK B;  3DVM A;  1J7O A;  3AKA A;  3GK4 X;  2LAP A;  2BKI B;  3ZWH A;  4QJ4 B;  3R72 A;  3PJI A;  4MBE A;  3V2L A;  4A4B A;  1QVI Z;  1JC2 A;  1IIO A;  2BL0 B;  2ZN9 A;  1JFK A;  2L51 A;  2NCO A;  3WHT B;  4OV2 A;  5KTY A;  1TUZ A;  1L2O B;  1VRK A;  3BUW B;  1DTL A;  2JU0 A;  3NXA A;  4ORA B;  3UO9 A;  3PFV A;  4ETO A;  1R2U A;  5FYX A;  3L4A A;  1REC A;  1SL9 A;  4YI8 A;  1SL7 A;  3BUN B;  4USL A;  3O78 A;  4MN0 A;  3VRR A;  3KF9 A;  2PAS A;  1DEK A;  1FBV A;  2KAV A;  2OTG B;  1F54 A;  1QWV A;  2MA2 A;  4PE0 A;  2JTZ A;  1EXR A;  2JOJ A;  1B4C A;  1CDL A;  3ICB A;  2BKH B;  1SSE B;  3CWG A;  3FE6 A;  3CGA A;  4GGF A;  1DGV A;  1PSB A;  1N65 A;  1KWO B;  1N2D A;  2KI4 C;  1M63 B;  3PN7 B;  1U5I A;  2JPT A;  2DOQ A;  3CS1 A;  1JFJ A;  1NX3 A;  3CYZ A;  2JXC A;  4NDC A;  4MRY A;  4MZL A;  1SCM C;  2KFG A;  3S0B A;  2K2F A;  5AEQ A;  1NP8 A;  2AAO A;  2GGM A;  5HKY A;  5AXI A;  1EJ3 A;  2WCK A;  1ORG A;  3SJS A;  4YBH B;  2HET A;  3DD4 A;  2ZFD A;  1TTX A;  1P28 A;  1S3P A;  4PE1 A;  2M9G A;  3SS3 A;  2HF5 A;  1S26 D;  5DKN A;  2G9B A;  2KOT A;  2KLD A;  2M49 B;  3EVR A;  1C07 A;  1B7T Z;  1OMR A;  5TNC A;  5I8N A;  2FOT A;  4OR9 B;  1CLM A;  2HQ8 A;  4IJ7 A;  4BY5 A;  2EHB A;  1XFZ O;  3B87 A;  1KFX S;  2K60 A;  1UWO A;  4GFT A;  1G33 A;  4INW A;  2G2B A;  2F2O A;  1J1E A;  2GV5 A;  2KAX A;  1WRZ A;  1D1O A;  1SMG A;  4PDZ A;  1DEL A;  2PVB A;  4UPG A;  4NQG A;  2P70 A;  3I5F B;  4OVN F;  3GK2 A;  3LCP C;  4QJ5 B;  4C0J A;  1K2H A;  2MLE C;  2KI6 C;  4AQI A;  1Z2C B;  1K90 D;  1OQP A;  4IL1 A;  1GM0 A;  2I94 A;  3AKB A;  1JUO A;  2YGU A;  3VRO A;  1A2X A;  3TZ1 A;  3D76 A;  1Y1X A;  2LP3 A;  2PRU A;  1YRU B;  1JSA A;  1SY9 A;  1RTP 1;  1UHN A;  2E6W A;  1DJI A;  2H61 A;  3DVK A;  1NCY A;  1C7W A;  4GBA A;  1K9P A;  2BCA A;  2KFF A;  3B6X A;  2K7C A;  1E8A A;  4FQO A;  4JQ0 D;  3VB1 A;  2K61 A;  2LV7 A;  3TUY C;  2KYC A;  4GGN A;  2A4J A;  5I2Q A;  4MZJ A;  2EGD A;  2JC2 A;  2O5G A;  2Q4U A;  3C1V A;  2JUL A;  4MVF A;  5EL2 A;  1LXF C;  2WCB A;  1YUU A;  3I5I B;  3KO0 A;  4L9M A;  1F8H A;  1EH2 A;  1QS7 A;  3CR5 X;  2H8V A;  3DXL A;  3PAL A;  1OMD A;  2PMY A;  4JPZ B;  4E68 A;  1UUS A;  2TN4 A;  2M0R A;  3NGV A;  3PM2 A;  3SIA A;  3ZNI A;  5AFP A;  2F8P A;  2KGR A;  4PCW A;  4DS7 A;  1DGU A;  2F2P A;  1SR6 B;  3CZ0 A;  5FI7 A;  1WRL A;  1F70 A;  1N0Y A;  1QIV A;  1EG3 A;  3GOF A;  4PE4 A;  2LVK A;  1A29 A;  1OW4 A;  1S5G Z;  1ZUZ A;  2H61 C;  3O4Y A;  2RGI A;  2I2R E;  2BCB A;  1PK0 D;  3OBV A;  1NWD A;  2ZRT A;  4N5X A;  1X02 A;  2BNX A;  4YGD B;  2LUX A;  1CLL A;  2PYQ A;  2CXJ A;  2BAP A;  3LK0 A;  4GUK A;  1KQM B;  2WCH A;  2KBI A;  2KQ6 A;  1BR4 B;  1WLM A;  3D0Y B;  3S0E A;  2WCJ A;  5PAL A;  2WND A;  1CMF A;  3JTD B;  2BBM A;  3EK7 A;  1QLS A;  4XYN A;  4DIR A;  1AVS A;  1LA3 A;  4NDD A;  1HQV A;  3SG3 A;  3TS5 C;  1OZS A;  5AER A;  1SL8 A;  3I5G C;  5B8I B;  3FWB A;  1H8B A;  1DF0 B;  2COL B;  1XO5 A;  1YUT A;  1CFP A;  3IQQ A;  1Z4H A;  1EL4 A;  1L7Z A;  1QIW A;  1UHK A;  2NZ0 A;  1CTR A;  1CFD A;  1KSM A;  3BFB A;  3FIA A;  3WXA A;  1TNW A;  1RFJ A;  1IQ3 A;  5D69 A;  2KHN A;  2MHH A;  1EG4 A;  1LA0 A;  1M39 A;  1CNP A;  3JVT C;  2LLT A;  2WCL A;  3R1P A;  5HLV A;  5HLO A;  1NCX A;  1IKU A;  1QX2 A;  2KPH A;  2LVV A;  2JTT A;  3EKH A;  5DKR A;  1KCY A;  1FF1 A;  1ODB A;  4HRE E;  1SYM A;  2JT3 A;  3PAT A;  1F4Q A;  1S36 A;  1SBJ A;  1PAL A;  2L5X B;  3DY9 A;  1QV0 A;  1B8C A;  1TWO A;  4TNC A;  2PSR A;  1L2O C;  2M29 A;  1LS8 A;  5ER5 A;  4GAO A;  4ORB B;  5ER4 X;  2Y4Q A;  5K89 A;  2JT8 A;  3N7H A;  2F3Y A;  1AP4 A;  2R2I A;  1KK7 Z;  4R1E A;  3CZ1 A;  3PM8 A;  3K1E A;  2MRD A;  1JF2 A;  1OZO A;  3FWC A;  3MSE B;  2KLE A;  2OTG C;  3O2P A;  3K21 A;  1NX1 A;  2JZI A;  3BOW B;  1KQV A;  1UUR A;  1W7J B;  2JXL A;  2L2C A;  3B88 A;  5KU1 A;  2LCP A;  1FW4 A;  3EK4 A;  1NIW A;  1J7R A;  2KI4 B;  1NPQ A;  3EG5 B;  4OKH A;  2L5Y A;  2I18 A;  1XYD A;  4F7F A;  1K9U A;  4I5J A;  1SCM B;  2K7O A;  1K94 A;  1F71 A;  1TNX A;  2PQL A;  3CZ2 A;  2SAS A;  4U8D A;  1MQ1 A;  1XK4 A;  3D73 A;  1CFF A;  4CFQ A;  2Y1N A;  2L4I A;  4C0L A;  4I5L B;  1F4O A;  1YX8 A;  1CB1 A;  2F3Z A;  2LLS A;  1G8I A;  3OX6 A;  4PHK A;  5D7F A;  2CBL A;  2LMU A;  2SCP A;  3IVT A;  1QX5 B;  3OHM B;  4ORC B;  2JT0 A;  1PRW A;  4P5O E;  1DJY A;  3M0W A;  1GGW A;  1SCV A;  3SG4 A;  1FI5 A;  2LMT A;  2M3W A;  3D75 A;  1YUS A;  1B8L A;  4GGF C;  1KK8 B;  2MJW B;  2HQW A;  3AAJ A;  1BG1 A;  4HRG A;  1NX0 A;  2BBN A;  1JBA A;  1S6C A;  1K8U A;  2OS8 C;  1ZMZ A;  1WY9 A;  5KSZ A;  2EC6 C;  1DVI A;  1DJH A;  5GQQ C;  1WLZ A;  1QTX A;  1J7P A;  2LHL A;  1FI6 A;  1KSO A;  2WC6 A;  1IG5 A;  1TNQ A;  4CFR A;  1C3Y A;  1CDP A;  4YGA A;  1YRT B;  2LHI A;  1BJF A;  3NHI A;  1S6J A;  1DJZ A;  2NCP A;  3DYE A;  1CDM A;  3H4S E;  1XK4 C;  3L47 A;  3KPX A;  1IWQ A;  3AAK A;  1XFY O;  1LIN A;  2FJY A;  4PT1 A;  2M7N A;  1K9K A;  1MXL C;  3TUY B;  5FI2 A;  4I5K A;  3Q8I A;  3BUM B;  5CSF A;  3SG5 A;  1IH0 A;  1RK9 A;  1XA5 A;  3GK1 A;  1S5G Y;  1AUI B;  3S0G A;  3SS4 A;  1XVJ A;  1XFU O;  2ZNE A;  3S0A A;  2F33 A;  3BQ3 A;  4XJK B;  2V53 A;  4HRH A;  1UHI A;  2Q91 A;  2BE6 A;  3I5I C;  5AAN A;  5JOL A;  1TRF A;  4JWQ A;  1TN4 A;  3QRX A;  4GPL B;  3SS5 A;  1UHJ A;  1WDC B;  4AQJ A;  2NLN A;  2KAY A;  2LVI A;  3SG2 A;  1AHR A;  3DF0 B;  1Y1U A;  4D1E A;  5HYD A;  1BLQ A;  1DF0 A;  1Y0V H;  3B7A A;  2QEV A;  1KFU L;  2M8U A;  3IF7 A;  5DIC A;  2FCE A;  1IQ5 A;  5CSN A;  1MF8 B;  1SR6 C;  5FI6 A;  1JF0 A;  1XFR A;  3A4U B;  3QME A;  3WNX B;  3LK1 A;  5CPV A;  4Q04 A;  3OGN A;  3I5H C;  4PHJ A;  4C0K A;  2LP2 A;  1R6P A;  2QEB A;  2I7A A;  1A75 B;  4WRI A;  5BPJ A;  1LKJ A;  1J55 A;  3EKJ A;  2AMI A;  3LLE A;  4OCI A;  1CM1 A;  1W9Z A;  3D74 A;  1AJ5 A;  1M46 A;  1TOP A;  1QLK A;  1QVI Y;  1RWY A;  1CM4 A;  4M2Q A;  1PSR A;  2JRF A;  1ZOT B;  1IJ6 A;  3UNW A;  1SKT A;  1BOC A;  3HX4 A;  2ISD A;  3SIB A;  2CCM A;  1S6I A;  2QEH A;  3BXK A;  2GGZ A;  2QPT A;  1B1G A;  2L98 A;  4DRW A;  1CLB A;  3BUX B;  1SRA A;  2P71 A;  4AOM A;  3LL8 B;  4FTG A;  1BT6 A;  1DMO A;  1OOF A;  3I5G B;  2ZND A;  2E30 A;  1Q80 A;  2ZKM X;  2KNE A;  3BYA A;  1J7Q A;  2AUC A;  4DUQ A;  1NUB A;  1BR1 B;  3EVV A;  3NSL A;  2KQY A;  1S1E A;  4DCK A;  2BL0 C;  1OOG A;  2B1U A;  2KFH A;  3KHE A;  1DJW A;  3S0F A;  1QJT A;  1UHH A;  2QEO A;  1OOJ A;  2KBM A;  4YRU A;  4MZK A;  3OB2 B;  4M2P A;  1MR8 A;  4M2O A;  1QXP A;  1UP5 A;  2NXQ A;  3S0D A;  3VRP A;  3DZT A;  4P2Y B;  3VRN A;  4KYN A;  2BEC A;  5I94 A;  4HSZ A;  4WQ2 A; 
#chains in the Genus database with same CATH homology
 1TCO B;  2JNX A;  3DVE A;  3KEV A;  1H4B A;  2JQ6 A;  5CSI A;  1OE9 B;  2LC5 A;  2WOR A;  2M1K B;  3OP0 A;  3CR2 A;  5HKZ A;  1V1G A;  1W7I B;  2LVJ A;  3PSR A;  2KSP A;  4ZCU A;  1ALW A;  1PVA A;  1NX2 A;  1QAS A;  1B7T Y;  1Y1A A;  1KWO C;  3PN7 C;  3VGO A;  2VRG A;  1SK6 D;  4BY4 A;  4MRX A;  2LE9 B;  3OX5 A;  1DT7 B;  2BCX A;  3D10 A;  5J3X A;  4ICB A;  2LLU A;  3BUO B;  1DJX A;  4MSP A;  2L0P A;  3A8R A;  1QX7 A;  4CLN A;  1XFW O;  3RM1 A;  1BF5 A;  2WCE A;  1SPY A;  1HT9 A;  1MXE A;  2WC8 A;  2MLF C;  4F0Z B;  4YGC B;  2K0J A;  2JWW A;  5F6T A;  5JJG A;  1WRK A;  2CNP A;  1RJV A;  4YI9 A;  1ZAC A;  2FJU B;  3RLZ A;  1NCZ A;  3TDI A;  1YUR A;  1A03 A;  1B47 A;  1F55 A;  1OMV A;  2Y5I A;  1TNP A;  4WQ3 A;  3SG6 A;  3WHU B;  1DJG A;  1IRJ A;  5HKW A;  1B8R A;  1XFV O;  1MHO A;  1CFC A;  3FS7 A;  5G08 A;  2BE4 A;  1V1F A;  1CDN A;  1AJ4 A;  3I5F C;  2KI6 D;  2L50 A;  1GGZ A;  1KK8 C;  3HCM A;  4XJK A;  4A4C A;  1IGV A;  1M31 A;  1U5I B;  5I2O A;  2LAN A;  1YX7 A;  1TIZ A;  2OS8 B;  3EVU A;  1JWD A;  3EK8 A;  1K96 A;  2LUC A;  4CID A;  2EC6 B;  1CKK A;  3OB1 B;  2P6B B;  1KFX L;  1XFX O;  3DF0 A;  2CTN A;  1PUL A;  2K8M B;  2LNK A;  2L4H A;  1PVB A;  1B9A A;  2K7B A;  1CMG A;  3TDZ A;  3CZT X;  1AK8 A;  3D0Y A;  1ALV A;  1OSA A;  1SNL A;  4NDB A;  1A75 A;  2WCF A;  3IQO A;  4PHM A;  3F45 A;  5DKQ A;  1MUX A;  1NYA A;  2H2K A;  1Y6W A;  5CSJ A;  3SG7 A;  3CTN A;  2WOS A;  3NSO A;  1KFU S;  4ZCV A;  2JNF A;  1YVH A;  2IS9 A;  2M7L A;  2L2E A;  1RRO A;  1C7V A;  2O60 A;  3E3R A;  3PLF B;  1MWN A;  4N1G A;  2PAL A;  4YGE B;  2M1U A;  1K95 A;  1ZFS A;  1QV1 A;  4MLW A;  4PAL A;  4QJ3 B;  1K93 D;  1WDC C;  3VRQ A;  2D8N A;  4PE7 A;  2CT9 A;  2KYF A;  3NSI A;  3CR4 X;  1A4P A;  1IJ5 A;  3NSK A;  4N1F A;  2MAZ A;  1KQM C;  3I5H B;  1G4Y R;  4YGB B;  5IBW A;  1BU3 A;  2Y1M A;  1YTZ C;  3DVJ A;  2MBX A;  2OPO A;  3JTD C;  2K2A A;  3O6B A;  1GQM A;  4CPV A;  1FPW A;  3TS5 B;  1QAT A;  4PHN A;  2QAC A;  1YVL A;  1BMO A;  3BOW A;  1YR5 A;  3CLN A;  2M97 A;  3TDU A;  2HPS A;  2LM5 A;  2FCD A;  4MEW A;  1NSH A;  4I5N B;  1BOD A;  1GJY A;  1LVC D;  1J1D A;  1SW8 A;  1KK7 Y;  2K7D A;  2KGB C;  2ZRS A;  1M45 A;  2LMV A;  3JVT B;  2ZN8 A;  1TCF A;  5I2L A;  2KDH A;  4GNK B;  3DVM A;  1J7O A;  3AKA A;  3GK4 X;  2LAP A;  2BKI B;  3ZWH A;  4QJ4 B;  4MBE A;  1JC2 A;  4A4B A;  1QVI Z;  2BL0 B;  2ZN9 A;  1JFK A;  2L51 A;  2NCO A;  3WHT B;  4OV2 A;  5KTY A;  1L2O B;  1VRK A;  3BUW B;  1DTL A;  2JU0 A;  3NXA A;  4ORA B;  4ETO A;  3PFV A;  1R2U A;  5FYX A;  1REC A;  1SL9 A;  4YI8 A;  1SL7 A;  3BUN B;  4USL A;  3O78 A;  4MN0 A;  3VRR A;  3KF9 A;  2PAS A;  1FBV A;  2KAV A;  2OTG B;  1F54 A;  2MA2 A;  4PE0 A;  2JTZ A;  1EXR A;  2JOJ A;  1B4C A;  1CDL A;  3ICB A;  2BKH B;  3CWG A;  3CGA A;  4GGF A;  1DGV A;  1PSB A;  1N65 A;  1KWO B;  1N2D A;  2KI4 C;  1M63 B;  3PN7 B;  1U5I A;  2JPT A;  2DOQ A;  3CS1 A;  1JFJ A;  1NX3 A;  2JXC A;  4NDC A;  4MRY A;  4MZL A;  1SCM C;  2KFG A;  2K2F A;  5AEQ A;  1NP8 A;  2AAO A;  2GGM A;  5HKY A;  5AXI A;  1EJ3 A;  3SJS A;  4YBH B;  2HET A;  3DD4 A;  2ZFD A;  1TTX A;  1S3P A;  4PE1 A;  2M9G A;  2HF5 A;  1S26 D;  5DKN A;  2G9B A;  2KOT A;  2M49 B;  3EVR A;  1C07 A;  1B7T Z;  1OMR A;  5TNC A;  5I8N A;  2FOT A;  4OR9 B;  1CLM A;  2HQ8 A;  4BY5 A;  2EHB A;  1XFZ O;  1KFX S;  1UWO A;  4GFT A;  1G33 A;  1D1O A;  2G2B A;  2F2O A;  1J1E A;  2GV5 A;  2KAX A;  1WRZ A;  1SMG A;  4PDZ A;  2PVB A;  4UPG A;  4NQG A;  3I5F B;  4OVN F;  3GK2 A;  3LCP C;  4QJ5 B;  4C0J A;  1K2H A;  2MLE C;  2KI6 C;  4AQI A;  1K90 D;  1OQP A;  4IL1 A;  2I94 A;  3AKB A;  1JUO A;  3VRO A;  1A2X A;  3TZ1 A;  1Y1X A;  2LP3 A;  2PRU A;  1YRU B;  1JSA A;  1SY9 A;  1RTP 1;  1UHN A;  2E6W A;  1DJI A;  2H61 A;  3DVK A;  1NCY A;  1C7W A;  4GBA A;  1K9P A;  2BCA A;  2KFF A;  4JQ0 D;  2K7C A;  1E8A A;  4FQO A;  3TUY C;  2K61 A;  2LV7 A;  2KYC A;  4GGN A;  2A4J A;  5I2Q A;  4MZJ A;  2EGD A;  2JC2 A;  2O5G A;  2Q4U A;  3C1V A;  2JUL A;  4MVF A;  1LXF C;  2WCB A;  1YUU A;  3I5I B;  3KO0 A;  4L9M A;  1F8H A;  1EH2 A;  1QS7 A;  3CR5 X;  3PAL A;  1OMD A;  2PMY A;  4JPZ B;  4E68 A;  1UUS A;  2TN4 A;  2M0R A;  3SIA A;  3ZNI A;  5AFP A;  2F8P A;  2KGR A;  4PCW A;  4DS7 A;  1DGU A;  2F2P A;  1SR6 B;  1WRL A;  1F70 A;  1N0Y A;  1QIV A;  1EG3 A;  3GOF A;  4PE4 A;  2LVK A;  1A29 A;  1S5G Z;  1ZUZ A;  2H61 C;  3O4Y A;  2RGI A;  2I2R E;  2BCB A;  1PK0 D;  1NWD A;  2ZRT A;  4N5X A;  1X02 A;  4YGD B;  2LUX A;  1CLL A;  2CXJ A;  3LK0 A;  4GUK A;  1KQM B;  2KBI A;  2KQ6 A;  1BR4 B;  1WLM A;  3D0Y B;  5PAL A;  2WND A;  1CMF A;  3JTD B;  2BBM A;  3EK7 A;  1QLS A;  4XYN A;  4DIR A;  1AVS A;  1LA3 A;  4NDD A;  1HQV A;  3SG3 A;  3TS5 C;  1OZS A;  5AER A;  1SL8 A;  3I5G C;  5B8I B;  3FWB A;  1H8B A;  1DF0 B;  2COL B;  1XO5 A;  1YUT A;  1CFP A;  3IQQ A;  1EL4 A;  1L7Z A;  1QIW A;  1UHK A;  2NZ0 A;  1CTR A;  1CFD A;  1KSM A;  3FIA A;  3WXA A;  1TNW A;  1RFJ A;  1IQ3 A;  5D69 A;  2KHN A;  2MHH A;  1EG4 A;  1LA0 A;  1M39 A;  1CNP A;  3JVT C;  2LLT A;  5HLV A;  5HLO A;  1NCX A;  1IKU A;  1QX2 A;  2LVV A;  1KCY A;  2JTT A;  3EKH A;  5DKR A;  1FF1 A;  1ODB A;  4HRE E;  1SYM A;  2JT3 A;  3PAT A;  1F4Q A;  1S36 A;  1SBJ A;  1PAL A;  2L5X B;  1QV0 A;  1B8C A;  4TNC A;  2PSR A;  1L2O C;  2M29 A;  5ER5 A;  4GAO A;  4ORB B;  5ER4 X;  2Y4Q A;  5K89 A;  2JT8 A;  2F3Y A;  1AP4 A;  2R2I A;  1KK7 Z;  4R1E A;  3PM8 A;  2MRD A;  1JF2 A;  1OZO A;  3FWC A;  3MSE B;  3O2P A;  2OTG C;  3K21 A;  1NX1 A;  2JZI A;  3BOW B;  1KQV A;  1UUR A;  1W7J B;  2JXL A;  5KU1 A;  2LCP A;  1FW4 A;  3EK4 A;  1NIW A;  1J7R A;  2KI4 B;  1NPQ A;  4OKH A;  2I18 A;  1XYD A;  1K9U A;  4I5J A;  1SCM B;  2K7O A;  1K94 A;  1F71 A;  1TNX A;  2SAS A;  4U8D A;  1MQ1 A;  1XK4 A;  1CFF A;  4CFQ A;  2Y1N A;  2L4I A;  4C0L A;  4I5L B;  1F4O A;  1YX8 A;  1CB1 A;  2F3Z A;  2LLS A;  1G8I A;  3OX6 A;  4PHK A;  5D7F A;  2CBL A;  2LMU A;  2SCP A;  1QX5 B;  3OHM B;  4ORC B;  2JT0 A;  1PRW A;  4P5O E;  1DJY A;  3M0W A;  1GGW A;  1SCV A;  3SG4 A;  1FI5 A;  2LMT A;  2M3W A;  1YUS A;  1B8L A;  4GGF C;  1KK8 B;  2MJW B;  2HQW A;  3AAJ A;  1BG1 A;  4HRG A;  1NX0 A;  2BBN A;  1JBA A;  1S6C A;  1K8U A;  2OS8 C;  1ZMZ A;  1WY9 A;  5KSZ A;  2EC6 C;  1DVI A;  1DJH A;  5GQQ C;  1WLZ A;  1QTX A;  1J7P A;  2LHL A;  1FI6 A;  1KSO A;  1IG5 A;  1TNQ A;  4CFR A;  1CDP A;  4YGA A;  1YRT B;  2LHI A;  1BJF A;  1S6J A;  1DJZ A;  2NCP A;  1CDM A;  3H4S E;  1XK4 C;  3KPX A;  1IWQ A;  3AAK A;  1XFY O;  1LIN A;  2M7N A;  1K9K A;  1MXL C;  3TUY B;  4I5K A;  3BUM B;  5CSF A;  3SG5 A;  1IH0 A;  1RK9 A;  1XA5 A;  3GK1 A;  1S5G Y;  1AUI B;  1XVJ A;  1XFU O;  2ZNE A;  2F33 A;  3BQ3 A;  4XJK B;  2V53 A;  4HRH A;  1UHI A;  2Q91 A;  2BE6 A;  3I5I C;  5AAN A;  5JOL A;  1TRF A;  4JWQ A;  1TN4 A;  3QRX A;  4GPL B;  1UHJ A;  1WDC B;  4AQJ A;  2NLN A;  2KAY A;  2LVI A;  3SG2 A;  1AHR A;  3DF0 B;  1Y1U A;  4D1E A;  5HYD A;  1BLQ A;  1DF0 A;  1Y0V H;  1KFU L;  2M8U A;  3IF7 A;  2FCE A;  1IQ5 A;  5CSN A;  1MF8 B;  1SR6 C;  1JF0 A;  3A4U B;  3WNX B;  3LK1 A;  5CPV A;  4Q04 A;  3I5H C;  4PHJ A;  4C0K A;  2LP2 A;  1R6P A;  2I7A A;  1A75 B;  4WRI A;  5BPJ A;  1LKJ A;  1J55 A;  3EKJ A;  2AMI A;  3LLE A;  4OCI A;  1CM1 A;  1AJ5 A;  1M46 A;  1TOP A;  1QLK A;  1QVI Y;  1RWY A;  1CM4 A;  4M2Q A;  1PSR A;  2JRF A;  1ZOT B;  1IJ6 A;  1BOC A;  1SKT A;  3HX4 A;  2ISD A;  3SIB A;  2CCM A;  1S6I A;  3BXK A;  2GGZ A;  2QPT A;  1B1G A;  2L98 A;  4DRW A;  1CLB A;  3BUX B;  1SRA A;  4AOM A;  3LL8 B;  4FTG A;  1BT6 A;  1DMO A;  3I5G B;  2ZND A;  2E30 A;  1Q80 A;  2ZKM X;  2KNE A;  3BYA A;  1J7Q A;  2AUC A;  4DUQ A;  1NUB A;  1BR1 B;  3EVV A;  3NSL A;  2KQY A;  1S1E A;  4DCK A;  2BL0 C;  2B1U A;  2KFH A;  3KHE A;  1DJW A;  1QJT A;  1UHH A;  1OOJ A;  2KBM A;  4YRU A;  4MZK A;  3OB2 B;  4M2P A;  1MR8 A;  4M2O A;  1QXP A;  1UP5 A;  2NXQ A;  3VRP A;  4P2Y B;  3VRN A;  2BEC A;  4HSZ A;  4WQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...