1TN4A

Four calcium tnc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
157
structure length
157
Chain Sequence
TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Structures of four Ca2+-bound troponin C at 2.0 A resolution: further insights into the Ca2+-switch in the calmodulin superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Contractile system protein
total genus 63
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 1997-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tn4A00
4PE7A 1JFKA 1F54A 2EC6B 3VGOA 2JTZA 2MLEC 4ORAB 1BODA 1XVJA 1SKTA 3BXKA 4M2QA 3VROA 1QX7A 1GGZA 1ZMZA 3TUYC 4YGAA 1OZSA 4MBEA 1N65A 1SRAA 1B47A 2WNDA 3VRNA 3EK8A 2KGBC 4I5KA 4GGFC 4GGNA 1ODBA 2LUXA 3AKBA 3D0YA 4XYNA 2MHHA 1H4BA 3TDIA 1TOPA 3MSEB 3I5HB 2L51A 3OB1B 1B7TZ 1KK8B 1X02A 2E6WA 3EKJA 2M49B 3EK4A 3RM1A 3CR2A 2M7NA 1BJFA 1IKUA 2KBIA 3BUWB 4NDBA 1GQMA 2JT8A 1C7WA 4MZJA 3TZ1A 4MLWA 1QX2A 3LK0A 3TDUA 2HPSA 1UP5A 2GV5A 1NX0A 2JQ6A 1QIWA 1A75B 4WQ2A 2FOTA 1DVIA 1PSRA 4N1GA 2JT3A 2A4JA 2LC5A 3M0WA 2WCBA 2M97A 1K94A 1C7VA 1B9AA 1DF0A 4GGFA 5AERA 1SCVA 1JWDA 2F3ZA 2F3YA 1F70A 1YURA 1E8AA 1EL4A 2K8MB 4OVNF 4WQ3A 1AHRA 1LVCD 4M2OA 4CPVA 1RECA 5I2LA 1U5IB 1S26D 3KPXA 4GBAA 1HT9A 1SPYA 2FCEA 3HCMA 1XO5A 4FQOA 4WRIA 2M7LA 2LVKA 2EGDA 4ETOA 5AFPA 4A4BA 2BCAA 1NSHA 2NXQA 3BUOB 1QATA 4XJKB 1SCMC 1ZOTB 4C0JA 1J7OA 2ISDA 1KQMC 1K90D 3EVUA 1K93D 3F45A 4CFRA 1YUSA 2VRGA 5CPVA 2KOTA 3I5IB 3AAJA 1AUIB 1YUTA 4I5NB 3OP0A 5FYXA 2L4IA 2WC8A 1CLLA 3O4YA 1TNXA 4N5XA 2MJWB 1NX2A 3SG7A 2LHLA 1K8UA 1K95A 2LNKA 2NCOA 4P5OE 3TS5C 3DVJA 4C0LA 1Q80A 1WDCB 2KQ6A 3VRRA 4PHJA 1QVIZ 3DVMA 1K2HA 1XA5A 3OX5A 2LMUA 2KI4B 2RGIA 3DVEA 3O2PA 4FTGA 4MN0A 5IBWA 2P6BB 3I5FB 3I5GC 1VRKA 3IF7A 3BYAA 2HQWA 5CSJA 1B4CA 2JZIA 2OTGC 4OV2A 3RLZA 1G8IA 3KF9A 3LLEA 1WRZA 1NCYA 1R6PA 1Y1UA 3C1VA 4A4CA 4CLNA 2HF5A 2MAZA 1DJHA 2JWWA 2F2PA 1KFUL 1TCOB 2OPOA 1SR6B 4YGDB 2L0PA 1KSMA 1Y1AA 1OZOA 1FPWA 1BOCA 2OS8C 3IQOA 4ZCVA 2Q91A 1FBVA 1YX7A 2K7CA 3KO0A 1PVBA 1TRFA 2LHIA 4MRYA 4GNKB 2LVIA 1PK0D 2I7AA 1QX5B 2COLB 1TN4A 1G4YR 2KNEA 1EH2A 2NLNA 3H4SE 4PE0A 2LVJA 2GGMA 5CSFA 2KFHA 3BOWB 3WHUB 2NZ0A 2WCFA 5JJGA 2R2IA 4YGCB 5HLOA 1OQPA 3PATA 1JC2A 2JU0A 2JC2A 3AAKA 1K9PA 1L2OC 2JTTA 2CCMA 4YGEB 2KYCA 2KAYA 1QASA 3QRXA 1UHNA 2JRFA 5F6TA 2KYFA 2MBXA 3SG5A 1FI6A 4MVFA 1NUBA 2CT9A 1S36A 4YI9A 2K7OA 1JSAA 4OCIA 4PCWA 1M39A 1QTXA 4GFTA 3HX4A 1EG3A 3WNXB 1S6JA 1JF0A 5DKRA 5HYDA 2F8PA 3CR4X 5AEQA 3NSLA 3JVTB 1IH0A 2K61A 2KQYA 3GK4X 1DTLA 1GJYA 4NQGA 2K2AA 2LLTA 1V1FA 1LKJA 1MXEA 3NSOA 4I5JA 1G33A 3PSRA 3OB2B 5J3XA 2FJUB 1JUOA 1KWOC 2LE9B 1AVSA 1N2DA 2PRUA 1L7ZA 1CMGA 4PE1A 1J7QA 2JNXA 2HETA 5DKQA 1WRLA 1AJ5A 1RK9A 2K2FA 4PDZA 1CLBA 3GOFA 1JF2A 2K0JA 1CDLA 1TNPA 2G2BA 1J55A 2BKIB 3BQ3A 3DF0B 3SJSA 4C0KA 1KK7Z 1R2UA 1UHKA 3PN7C 4HREE 1EXRA 1CFDA 1TTXA 1LA3A 1M63B 1S5GZ 1IRJA 4YBHB 2LLSA 2ZNEA 3LL8B 1QLSA 1SL9A 3KEVA 2EC6C 1BT6A 2LVVA 1A4PA 1KFXS 2EHBA 3AKAA 1MUXA 2BL0B 2NCPA 3O6BA 2JXLA 3LK1A 1AK8A 3ZWHA 1PULA 1YR5A 1K96A 5BPJA 4NDDA 2KI6D 1DGVA 1J7PA 2Q4UA 1YVHA 1BMOA 1SMGA 1NCZA 1F4OA 1CDPA 5HLVA 3PALA 1MXLC 1PRWA 1LXFC 2SASA 2JULA 1UUSA 2Y1NA 1QV1A 2SCPA 1DJIA 4HRGA 4PHKA 5G08A 1CDNA 1CB1A 3A4UB 1LA0A 2V53A 1CM4A 3WHTB 1EG4A 1OMRA 1C07A 1DJYA 2I94A 1DJZA 2WCEA 4TNCA 3D0YB 2LAPA 1Y0VH 1CFCA 2WORA 2ZNDA 3EK7A 1KQVA 2JNFA 3I5HC 5AANA 5D69A 1KK8C 1RROA 3E3RA 1QIVA 1KCYA 2D8NA 3CGAA 1XFZO 2MRDA 1CDMA 1IJ5A 3DD4A 3FS7A 2MA2A 4DCKA 4DIRA 1NCXA 1CFPA 1BLQA 3FWCA 4HSZA 4ORCB 3VRPA 2CNPA 4I5LB 1A2XA 3JTDC 4QJ5B 1UHIA 3TUYB 1B1GA 3BUMB 2ZRTA 1B8LA 1JFJA 2KBMA 2BKHB 1UHHA 1B7TY 1PALA 1SL8A 4PHNA 2Y4QA 4AQJA 3OX6A 1DF0B 2L5XB 2LUCA 1AJ4A 1F55A 4D1EA 1YX8A 1S1EA 3FWBA 5TNCA 1K9UA 3PLFB 4YI8A 3IQQA 5CSNA 1MR8A 1NIWA 1OSAA 2KFGA 1CMFA 5JOLA 1NPQA 3CZTX 3SG6A 2KI6C 4ZCUA 4F0ZB 1WY9A 3GK2A 1FF1A 1SY9A 2O5GA 2PMYA 3EVVA 2ZN9A 4ORBB 1DMOA 4YGBB 1CNPA 2KDHA 4BY4A 2QPTA 1IWQA 2CBLA 1YTZC 3LCPC 1A75A 1TIZA 2TN4A 2Y1MA 1JBAA 2M9GA 4OKHA 4DUQA 3I5IC 2AMIA 3ICBA 1XK4C 5I2OA 1RTP1 1QXPA 1QJTA 2M3WA 1SK6D 5ER4X 1NYAA 1SYMA 2LMTA 2ZFDA 5CSIA 2L98A 1ALVA 1B8RA 2L2EA 2M0RA 1WDCC 2K7BA 4PE4A 4PHMA 1BG1A 1U5IA 3WXAA 2MLFC 1WLMA 1BR4B 1IQ5A 2LM5A 2LCPA 2M1UA 2ZKMX 3FIAA 4AQIA 4U8DA 2KI4C 5K89A 1MF8B 1TNQA 4MRXA 4DS7A 1RJVA 3K21A 4PALA 1XYDA 3I5FC 4XJKA 2E30A 1IQ3A 5HKYA 1NP8A 1SCMB 1CFFA 4JPZB 1DT7B 1DGUA 1KQMB 1M31A 3NXAA 1QV0A 2PSRA 1KSOA 1UWOA 1AP4A 1S3PA 3CTNA 2PASA 1XK4A 2KFFA 2M29A 1BU3A 1SW8A 1TCFA 1SR6C 1MQ1A 4YRUA 1QVIY 2Y5IA 1D1OA 4ICBA 2H61C 1QLKA 1CKKA 1V1GA 3TS5B 4Q04A 5AXIA 5GQQC 1YRTB 4USLA 2B1UA 1RFJA 2JOJA 1XFXO 1HQVA 1UURA 1BR1B 2JT0A 2WOSA 3VRQA 4E68A 1ZUZA 1A03A 4P2YB 1DJXA 2AUCA 2I18A 1XFUO 4CIDA 1SBJA 1J1DA 2G9BA 2LP2A 4CFQA 1OMVA 1RWYA 5KU1A 1XFYO 1Y6WA 3CR5X 3EKHA 1TNWA 4QJ4B 1Y1XA 2GGZA 3I5GB 3JTDB 2KAXA 3BUNB 1OOJA 1MWNA 2L50A 2OTGB 2O60A 1DJGA 1MHOA 1M46A 5I8NA 3O78A 3SIAA 2JPTA 4OR9B 1GGWA 5KTYA 2I2RE 1ALWA 1FW4A 1XFWO 1PSBA 3SIBA 3NSIA 4MSPA 1H8BA 2H61A 1NWDA 1SL7A 1KFUS 5B8IB 2OS8B 1SNLA 3OHMB 2JXCA 1OMDA 2KSPA 3JVTC 1A29A 2BBMA 2K7DA 5D7FA 1ZACA 3PFVA 2F33A 1IGVA 2AAOA 1IG5A 1K9KA 4IL1A 5HKWA 4GPLB 3BOWA 1UHJA 2BE6A 1NX3A 2M1KB 2CXJA 2M8UA 1W7IB 1CM1A 4M2PA 1N0YA 3BUXB 1YUUA 4GAOA 1CTRA 1ZFSA 2BCXA 2BECA 5HKZA 1L2OB 1F4QA 3ZNIA 1S6IA 2KGRA 2KAVA 1NX1A 4QJ3B 1EJ3A 2DOQA 4MZLA 1W7JB 5PALA 2CTNA 2BE4A 1PVAA 5ER5A 1B8CA 3NSKA 3EVRA 1OE9B 4BY5A 2H2KA 1KFXL 1WRKA 2LV7A 2HQ8A 3D10A 4AOMA 1FI5A 2BCBA 1YVLA 4JWQA 5I2QA 3CS1A 2ZN8A 3DVKA 2ZRSA 2LP3A 1YRUB 1WLZA 1DJWA 4GUKA 2BL0C 1J1EA 2PVBA 1CLMA 2QACA 3A8RA 2PALA 1IJ6A 3CLNA 3PM8A 4R1EA 2F2OA 2FCDA 4JQ0D 1KWOB 4HRHA 4NDCA 1BF5A 1XFVO 4MEWA 1KK7Y 4MZKA 3KHEA 3SG3A 1S6CA 4UPGA 4N1FA 2KHNA 2L4HA 3SG2A 1S5GY 2LANA 5DKNA 1F8HA 1J7RA 1M45A 2IS9A 3DF0A 3GK1A 2LLUA 2LMVA 4L9MA 3TDZA 1LINA 3PN7B 5KSZA 1QS7A 4DRWA 1F71A 2BBNA 3SG4A 3CWGA
chains in the Genus database with same CATH superfamily
4PE7A 1JFKA 1F54A 2EC6B 1C3ZA 3B87A 3VGOA 2JTZA 2MLEC 4ORAB 1BODA 1XVJA 1SKTA 3BXKA 3OBVA 4M2QA 3VROA 1QX7A 1GGZA 1ZMZA 3TUYC 4YGAA 1OZSA 4MBEA 1N65A 1SRAA 1B47A 2WNDA 3VRNA 3EK8A 2KGBC 4I5KA 3S0BA 4GGFC 4GGNA 1ODBA 2LUXA 3AKBA 3PM2A 3D0YA 4XYNA 2MHHA 1H4BA 4E68A 3TDIA 1TOPA 3MSEB 3I5HB 2L51A 3OB1B 1B7TZ 1KK8B 1X02A 2E6WA 3EKJA 2M49B 2H8VA 3BFHA 3EK4A 3RM1A 3CR2A 2M7NA 1BJFA 4KYNA 1IKUA 2KBIA 3BUWB 4NDBA 2QDIA 1GQMA 2JT8A 1C7WA 4MZJA 3TZ1A 4MLWA 3UO9A 1QX2A 3LK0A 3TDUA 2FJYA 2HPSA 1UP5A 2GV5A 1NX0A 2JQ6A 1QIWA 1A75B 4WQ2A 2FOTA 1DVIA 1PSRA 4N1GA 2JT3A 2A4JA 2LC5A 3M0WA 2WCBA 2M97A 1K94A 1C7VA 1B9AA 1DF0A 4GGFA 5AERA 1SCVA 1JWDA 3B86A 2F3ZA 2F3YA 1F70A 1YURA 1E8AA 1EL4A 2ERBA 2K8MB 4OVNF 4WQ3A 1AHRA 1LVCD 4M2OA 4CPVA 1RECA 5I2LA 1U5IB 1S26D 3KPXA 4GBAA 1HT9A 1SPYA 2FCEA 3HCMA 1XO5A 4FQOA 4WRIA 2M7LA 2LVKA 2EGDA 2WCLA 4ETOA 5AFPA 4A4BA 2BCAA 1NSHA 2NXQA 3BUOB 4INWA 1LS8A 1QATA 4XJKB 3EG5B 1SCMC 1ZOTB 4C0JA 1J7OA 2ISDA 1KQMC 1K90D 3EVUA 1K93D 3F45A 4CFRA 1YUSA 2VRGA 5CPVA 1OOIX 2KOTA 3I5IB 3AAJA 1AUIB 3IVTA 1YUTA 4I5NB 3OP0A 4PHKA 5FYXA 2L4IA 2WC8A 1CLLA 3O4YA 3B88A 1TNXA 4N5XA 2MJWB 1NX2A 3SG7A 2LHLA 1K8UA 4OZDA 1K95A 2LNKA 2NCOA 4P5OE 3TS5C 3DVJA 3CZ0A 1QWVA 4C0LA 1Q80A 3S0GA 1WDCB 2KQ6A 3VRRA 4PHJA 3RZSA 1QVIZ 3D76A 3DVMA 1K2HA 1XA5A 3OX5A 2LMUA 2KI4B 2RGIA 3DVEA 3O2PA 4FTGA 4MN0A 5IBWA 2P6BB 5D3OA 3CYZA 3I5FB 3I5GC 1VRKA 3IF7A 3BYAA 2HQWA 5CSJA 1B4CA 2JZIA 2OTGC 4OV2A 3RLZA 1G8IA 3KF9A 3LLEA 1WRZA 1NCYA 1R6PA 1Y1UA 3C1VA 4A4CA 4CLNA 2HF5A 2MAZA 1DJHA 2JWWA 2F2PA 1KFUL 1TCOB 2OPOA 1SR6B 3L4AA 4YGDB 2L0PA 1KSMA 1Y1AA 1OZOA 1FPWA 1BOCA 2OS8C 3IQOA 4ZCVA 2Q91A 1FBVA 1YX7A 2K7CA 3KO0A 1PVBA 1TRFA 2LHIA 4MRYA 4GNKB 2LVIA 1PK0D 2I7AA 1QX5B 1TN4A 2COLB 1G4YR 2KNEA 5DICA 1EH2A 2NLNA 3H4SE 4PE0A 2LVJA 2GGMA 5CSFA 2KFHA 3BOWB 3WHUB 2NZ0A 3BFBA 2WCFA 5JJGA 2R2IA 4YGCB 5HLOA 1DC1A 1OQPA 3PATA 1JC2A 2JU0A 2JC2A 3AAKA 1K9PA 3CZ1A 1L2OC 2JTTA 2CCMA 3B7AA 4YGEB 2JPOA 2KYCA 1IIOA 1OOHA 2KAYA 1QASA 3QRXA 1UHNA 2JRFA 5F6TA 5FI7A 2KYFA 3UNWA 2MBXA 3SG5A 1FI6A 4MVFA 1NUBA 2CT9A 1S36A 4YI9A 2K7OA 1JSAA 4OCIA 4PCWA 1TUZA 1M39A 1QTXA 4GFTA 4FQTA 3HX4A 1XFRA 1EG3A 3WNXB 1S6JA 1JF0A 5DKRA 5HYDA 4IJ7A 2F8PA 3CR4X 5AEQA 3NSLA 3JVTB 1IH0A 2K61A 2KQYA 3GK4X 3DY9A 1DTLA 1GJYA 4NQGA 2K2AA 2LLTA 1V1FA 1LKJA 1MXEA 3NSOA 4I5JA 1G33A 3PSRA 3OB2B 3NGVA 2FJUB 5J3XA 1JUOA 1KWOC 2LE9B 3PJIA 1AVSA 1N2DA 2PRUA 1L7ZA 1CMGA 4PE1A 2P71A 1J7QA 2JNXA 2HETA 4PT1A 1WRLA 5DKQA 1AJ5A 1RK9A 2KPHA 3BFAA 2K2FA 2BNXA 4PDZA 1CLBA 3GOFA 1JF2A 2K0JA 1CDLA 1TNPA 2G2BA 1J55A 2BKIB 3BQ3A 3DF0B 3SJSA 4C0KA 1KK7Z 1R2UA 1UHKA 3PN7C 4HREE 1EXRA 5FI6A 1CFDA 1TTXA 2BAPA 1LA3A 1M63B 1S5GZ 1IRJA 4YBHB 2LLSA 2ZNEA 3LL8B 1QLSA 1SL9A 3KEVA 2EC6C 1OOGA 1BT6A 2LVVA 1A4PA 1KFXS 2EHBA 3AKAA 1MUXA 2BL0B 2NCPA 2PYQA 3O6BA 2JXLA 3LK1A 1AK8A 3ZWHA 1PULA 1YR5A 1K96A 5BPJA 4NDDA 2KI6D 1TWOA 1DGVA 1J7PA 2Q4UA 1YVHA 1BMOA 1SMGA 1NCZA 1F4OA 2WCMA 1CDPA 5HLVA 3D78A 3PALA 1MXLC 1PRWA 1LXFC 2SASA 2JULA 1UUSA 2Y1NA 1QV1A 2SCPA 1DJIA 2WCJA 4HRGA 5G08A 1CDNA 1CB1A 3A4UB 1LA0A 2V53A 1CM4A 3WHTB 1EG4A 1OMRA 1C07A 1DJYA 2I94A 1DJZA 2WCEA 4TNCA 3D0YB 2LAPA 1Y0VH 1CFCA 2WORA 2ZNDA 3EK7A 1KQVA 2JNFA 3I5HC 5AANA 5D69A 1KK8C 1RROA 3E3RA 1QIVA 5I94A 2D8NA 1KCYA 3CGAA 1XFZO 2WCHA 2MRDA 2QEHA 1CDMA 5EL2A 1IJ5A 3DD4A 3FS7A 2MA2A 4DCKA 4DIRA 3VB1A 1NCXA 1CFPA 1BLQA 3FWCA 4HSZA 4ORCB 3VRPA 2CNPA 4I5LB 1A2XA 3JTDC 4QJ5B 1UHIA 3TUYB 1B1GA 3BUMB 2ZRTA 1B8LA 1JFJA 2KBMA 2BKHB 1UHHA 1B7TY 1PALA 1SL8A 4PHNA 2Y4QA 4AQJA 3OX6A 1DF0B 2L5XB 2LUCA 1AJ4A 3D74A 3OGNA 1F55A 4D1EA 1YX8A 1S1EA 3FWBA 3CDNA 3NHTA 1K9UA 2P70A 3PLFB 4YI8A 5TNCA 2K60A 3IQQA 5CSNA 1MR8A 1NIWA 1OSAA 2KFGA 1CMFA 5JOLA 1NPQA 3CZTX 3SG6A 2KI6C 4ZCUA 4F0ZB 1WY9A 3GK2A 3L4LA 1FF1A 1SY9A 2O5GA 2PMYA 3EVVA 3FE6A 2ZN9A 4ORBB 1DMOA 4YGBB 3CABA 1CNPA 3DYEA 2KDHA 4BY4A 2QPTA 1IWQA 2CBLA 1YTZC 3LCPC 1A75A 1TIZA 2QEOA 2TN4A 2Y1MA 2M9GA 4OKHA 4DUQA 1JBAA 3I5IC 2AMIA 3ICBA 1XK4C 5I2OA 1RTP1 1QXPA 1QJTA 2M3WA 1SK6D 5ER4X 1NYAA 1SYMA 2KLEA 2LMTA 2ZFDA 5CSIA 2L98A 5FI2A 1ALVA 1B8RA 2L2EA 2M0RA 1WDCC 2K7BA 3S0FA 4PE4A 4PHMA 1BG1A 1U5IA 3WXAA 2MLFC 1OW4A 1WLMA 1BR4B 1IQ5A 2LM5A 2LCPA 2M1UA 2ZKMX 3D73A 3FIAA 4AQIA 4U8DA 2KI4C 2L2CA 5K89A 1MF8B 1TNQA 4MRXA 2WCKA 4DS7A 1RJVA 1SSEB 3K21A 1XYDA 3I5FC 4PALA 2E30A 4XJKA 1IQ3A 1GM0A 5HKYA 1NP8A 1SCMB 1CFFA 4JPZB 1DT7B 1DGUA 1KQMB 1M31A 3NXAA 3O4XA 1QV0A 1P28A 2PSRA 1KSOA 2PQLA 1UWOA 2WC5A 1AP4A 1S3PA 2QEBA 3CTNA 2PASA 1XK4A 2KFFA 2M29A 1BU3A 1SW8A 1TCFA 1SR6C 1MQ1A 4YRUA 1QVIY 2Y5IA 1D1OA 4ICBA 4INXA 2H61C 1QLKA 1CKKA 1V1GA 2WC6A 3TS5B 4Q04A 5AXIA 5GQQC 1YRTB 4USLA 2B1UA 3S0EA 1DEKA 1RFJA 2JOJA 1XFXO 1HQVA 1UURA 1BR1B 2JT0A 2L5YA 2WOSA 3NHIA 1ZUZA 3VRQA 1A03A 4P2YB 1DJXA 2AUCA 2I18A 1XFUO 3R1PA 4CIDA 1SBJA 1J1DA 3SS5A 2G9BA 2LP2A 4CFQA 1OMVA 1RWYA 3N7HA 1XFYO 1Y6WA 4JD9A 5KU1A 3CR5X 3EKHA 1TNWA 3S0DA 4QJ4B 1Y1XA 2GGZA 3I5GB 3JTDB 2KAXA 3BUNB 1OOJA 1MWNA 2L50A 2OTGB 2O60A 3BJHA 1DJGA 1C3YA 1MHOA 3Q8IA 1M46A 4F7FA 5I8NA 3DXLA 3O78A 3SIAA 2JPTA 4OR9B 1GGWA 5KTYA 2I2RE 1ALWA 1FW4A 1XFWO 1PSBA 3SIBA 3NSIA 4MSPA 1H8BA 2H61A 1NWDA 1SL7A 1KFUS 1DQEA 5B8IB 2OS8B 3V2LA 1SNLA 3D75A 2JXCA 1OMDA 2KSPA 3JVTC 3OHMB 1A29A 2BBMA 2K7DA 3QMEA 1ZACA 5D7FA 1W9ZA 2F33A 3PFVA 1IGVA 2AAOA 1IG5A 1K9KA 4IL1A 5HKWA 4GPLB 3BOWA 1UHJA 2KLDA 3D77A 2BE6A 1NX3A 2M1KB 2CXJA 2M8UA 1W7IB 1CM1A 4M2PA 1N0YA 1T14A 3BUXB 1YUUA 4GAOA 1Z4HA 1CTRA 1ZFSA 2BCXA 2BECA 5HKZA 1L2OB 5HL1A 1F4QA 3DZTA 3R72A 1S6IA 2KGRA 3ZNIA 1Z2CB 2KAVA 1NX1A 4QJ3B 1EJ3A 2DOQA 4MZLA 1W7JB 5PALA 2CTNA 2BE4A 1PVAA 5ER5A 1B8CA 3NSKA 3EVRA 3K1EA 1OE9B 4BY5A 2H2KA 1KFXL 1WRKA 2LV7A 2HQ8A 3D10A 3SS4A 4AOMA 1FI5A 2BCBA 4JKTA 1YVLA 4JWQA 2YGUA 5I2QA 3CS1A 2ZN8A 3DVKA 3FE9A 2ZRSA 3R1OA 2LP3A 1YRUB 1WLZA 1DJWA 4GUKA 2BL0C 1J1EA 2PVBA 1CLMA 1TUJA 2QACA 3L47A 3A8RA 2PALA 1IJ6A 3CLNA 3PM8A 4R1EA 3SS3A 2F2OA 2FCDA 1DELA 4JQ0D 1KWOB 4HRHA 1OOFA 4NDCA 1BF5A 1XFVO 4MEWA 1KK7Y 3R1VA 3KHEA 3FE8A 4MZKA 2QEVA 1S6CA 3SG3A 4UPGA 4N1FA 2KHNA 2L4HA 3SG2A 3S0AA 2GTEA 1S5GY 2LANA 5DKNA 3B6XA 1F8HA 1J7RA 1M45A 2IS9A 3DF0A 3GK1A 2LLUA 2LMVA 1ORGA 4L9MA 3TDZA 1LINA 3PN7B 5KSZA 1QS7A 4DRWA 1F71A 3CZ2A 2BBNA 3SG4A 3CWGA
chains in the Genus database with same CATH topology
4PE7A 1JFKA 1F54A 2EC6B 3VGOA 2JTZA 2MLEC 4ORAB 1BODA 1XVJA 1SKTA 3BXKA 4M2QA 3VROA 1QX7A 1GGZA 1ZMZA 3TUYC 4YGAA 1OZSA 4MBEA 1N65A 1SRAA 1B47A 2WNDA 3VRNA 3EK8A 2KGBC 4I5KA 4GGFC 4GGNA 1ODBA 2LUXA 3AKBA 3D0YA 4XYNA 2MHHA 1H4BA 3TDIA 1TOPA 3MSEB 3I5HB 2L51A 3OB1B 1B7TZ 1KK8B 1X02A 2E6WA 3EKJA 2M49B 3EK4A 3RM1A 3CR2A 2M7NA 1BJFA 1IKUA 2KBIA 3BUWB 4NDBA 1GQMA 2JT8A 1C7WA 4MZJA 3TZ1A 4MLWA 1QX2A 3LK0A 3TDUA 2HPSA 1UP5A 2GV5A 1NX0A 2JQ6A 1QIWA 1A75B 4WQ2A 2FOTA 1DVIA 1PSRA 4N1GA 2JT3A 2A4JA 2LC5A 3M0WA 2WCBA 2M97A 1K94A 1C7VA 1B9AA 1DF0A 4GGFA 5AERA 1SCVA 1JWDA 2F3ZA 2F3YA 1F70A 1YURA 1E8AA 1EL4A 2K8MB 4OVNF 4WQ3A 1AHRA 1LVCD 4M2OA 4CPVA 1RECA 5I2LA 1U5IB 1S26D 3KPXA 4GBAA 1HT9A 1SPYA 2FCEA 3HCMA 1XO5A 4FQOA 4WRIA 2M7LA 2LVKA 2EGDA 4ETOA 5AFPA 4A4BA 2BCAA 1NSHA 2NXQA 3BUOB 1QATA 4XJKB 1SCMC 1ZOTB 4C0JA 1J7OA 2ISDA 1KQMC 1K90D 3EVUA 1K93D 3F45A 4CFRA 1YUSA 2VRGA 5CPVA 2KOTA 3I5IB 3AAJA 1AUIB 1YUTA 4I5NB 3OP0A 5FYXA 2L4IA 2WC8A 1CLLA 3O4YA 1TNXA 4N5XA 2MJWB 1NX2A 3SG7A 2LHLA 1K8UA 1K95A 2LNKA 2NCOA 4P5OE 3TS5C 3DVJA 4C0LA 1Q80A 1WDCB 2KQ6A 3VRRA 4PHJA 1QVIZ 3DVMA 1K2HA 1XA5A 3OX5A 2LMUA 2KI4B 2RGIA 3DVEA 3O2PA 4FTGA 4MN0A 5IBWA 2P6BB 3I5FB 3I5GC 1VRKA 3IF7A 3BYAA 2HQWA 5CSJA 1B4CA 2JZIA 2OTGC 4OV2A 3RLZA 1G8IA 3KF9A 3LLEA 1WRZA 1NCYA 1R6PA 1Y1UA 3C1VA 4A4CA 4CLNA 2HF5A 2MAZA 1DJHA 2JWWA 2F2PA 1KFUL 1TCOB 2OPOA 1SR6B 4YGDB 2L0PA 1KSMA 1Y1AA 1OZOA 1FPWA 1BOCA 2OS8C 3IQOA 4ZCVA 2Q91A 1FBVA 1YX7A 2K7CA 3KO0A 1PVBA 1TRFA 2LHIA 4MRYA 4GNKB 2LVIA 1PK0D 2I7AA 1QX5B 2COLB 1TN4A 1G4YR 2KNEA 1EH2A 2NLNA 3H4SE 4PE0A 2LVJA 2GGMA 5CSFA 2KFHA 3BOWB 3WHUB 2NZ0A 2WCFA 5JJGA 2R2IA 4YGCB 5HLOA 1OQPA 3PATA 1JC2A 2JU0A 2JC2A 3AAKA 1K9PA 1L2OC 2JTTA 2CCMA 4YGEB 2KYCA 2KAYA 1QASA 3QRXA 1UHNA 2JRFA 5F6TA 2KYFA 2MBXA 3SG5A 1FI6A 4MVFA 1NUBA 2CT9A 1S36A 4YI9A 2K7OA 1JSAA 4OCIA 4PCWA 1M39A 1QTXA 4GFTA 3HX4A 1EG3A 3WNXB 1S6JA 1JF0A 5DKRA 5HYDA 2F8PA 3CR4X 5AEQA 3NSLA 3JVTB 1IH0A 2K61A 2KQYA 3GK4X 1DTLA 1GJYA 4NQGA 2K2AA 2LLTA 1V1FA 1LKJA 1MXEA 3NSOA 4I5JA 1G33A 3PSRA 3OB2B 5J3XA 2FJUB 1JUOA 1KWOC 2LE9B 1AVSA 1N2DA 2PRUA 1L7ZA 1CMGA 4PE1A 1J7QA 2JNXA 2HETA 5DKQA 1WRLA 1AJ5A 1RK9A 2K2FA 4PDZA 1CLBA 3GOFA 1JF2A 2K0JA 1CDLA 1TNPA 2G2BA 1J55A 2BKIB 3BQ3A 3DF0B 3SJSA 4C0KA 1KK7Z 1R2UA 1UHKA 3PN7C 4HREE 1EXRA 1CFDA 1TTXA 1LA3A 1M63B 1S5GZ 1IRJA 4YBHB 2LLSA 2ZNEA 3LL8B 1QLSA 1SL9A 3KEVA 2EC6C 1BT6A 2LVVA 1A4PA 1KFXS 2EHBA 3AKAA 1MUXA 2BL0B 2NCPA 3O6BA 2JXLA 3LK1A 1AK8A 3ZWHA 1PULA 1YR5A 1K96A 5BPJA 4NDDA 2KI6D 1DGVA 1J7PA 2Q4UA 1YVHA 1BMOA 1SMGA 1NCZA 1F4OA 1CDPA 5HLVA 3PALA 1MXLC 1PRWA 1LXFC 2SASA 2JULA 1UUSA 2Y1NA 1QV1A 2SCPA 1DJIA 4HRGA 4PHKA 5G08A 1CDNA 1CB1A 3A4UB 1LA0A 2V53A 1CM4A 3WHTB 1EG4A 1OMRA 1C07A 1DJYA 2I94A 1DJZA 2WCEA 4TNCA 3D0YB 2LAPA 1Y0VH 1CFCA 2WORA 2ZNDA 3EK7A 1KQVA 2JNFA 3I5HC 5AANA 5D69A 1KK8C 1RROA 3E3RA 1QIVA 1KCYA 2D8NA 3CGAA 1XFZO 2MRDA 1CDMA 1IJ5A 3DD4A 3FS7A 2MA2A 4DCKA 4DIRA 1NCXA 1CFPA 1BLQA 3FWCA 4HSZA 4ORCB 3VRPA 2CNPA 4I5LB 1A2XA 3JTDC 4QJ5B 1UHIA 3TUYB 1B1GA 3BUMB 2ZRTA 1B8LA 1JFJA 2KBMA 2BKHB 1UHHA 1B7TY 1PALA 1SL8A 4PHNA 2Y4QA 4AQJA 3OX6A 1DF0B 2L5XB 2LUCA 1AJ4A 1F55A 4D1EA 1YX8A 1S1EA 3FWBA 5TNCA 1K9UA 3PLFB 4YI8A 3IQQA 5CSNA 1MR8A 1NIWA 1OSAA 2KFGA 1CMFA 5JOLA 1NPQA 3CZTX 3SG6A 2KI6C 4ZCUA 4F0ZB 1WY9A 3GK2A 1FF1A 1SY9A 2O5GA 2PMYA 3EVVA 2ZN9A 4ORBB 1DMOA 4YGBB 1CNPA 2KDHA 4BY4A 2QPTA 1IWQA 2CBLA 1YTZC 3LCPC 1A75A 1TIZA 2TN4A 2Y1MA 1JBAA 2M9GA 4OKHA 4DUQA 3I5IC 2AMIA 3ICBA 1XK4C 5I2OA 1RTP1 1QXPA 1QJTA 2M3WA 1SK6D 5ER4X 1NYAA 1SYMA 2LMTA 2ZFDA 5CSIA 2L98A 1ALVA 1B8RA 2L2EA 2M0RA 1WDCC 2K7BA 4PE4A 4PHMA 1BG1A 1U5IA 3WXAA 2MLFC 1WLMA 1BR4B 1IQ5A 2LM5A 2LCPA 2M1UA 2ZKMX 3FIAA 4AQIA 4U8DA 2KI4C 5K89A 1MF8B 1TNQA 4MRXA 4DS7A 1RJVA 3K21A 4PALA 1XYDA 3I5FC 4XJKA 2E30A 1IQ3A 5HKYA 1NP8A 1SCMB 1CFFA 4JPZB 1DT7B 1DGUA 1KQMB 1M31A 3NXAA 1QV0A 2PSRA 1KSOA 1UWOA 1AP4A 1S3PA 3CTNA 2PASA 1XK4A 2KFFA 2M29A 1BU3A 1SW8A 1TCFA 1SR6C 1MQ1A 4YRUA 1QVIY 2Y5IA 1D1OA 4ICBA 2H61C 1QLKA 1CKKA 1V1GA 3TS5B 4Q04A 5AXIA 5GQQC 1YRTB 4USLA 2B1UA 1RFJA 2JOJA 1XFXO 1HQVA 1UURA 1BR1B 2JT0A 2WOSA 3VRQA 4E68A 1ZUZA 1A03A 4P2YB 1DJXA 2AUCA 2I18A 1XFUO 4CIDA 1SBJA 1J1DA 2G9BA 2LP2A 4CFQA 1OMVA 1RWYA 5KU1A 1XFYO 1Y6WA 3CR5X 3EKHA 1TNWA 4QJ4B 1Y1XA 2GGZA 3I5GB 3JTDB 2KAXA 3BUNB 1OOJA 1MWNA 2L50A 2OTGB 2O60A 1DJGA 1MHOA 1M46A 5I8NA 3O78A 3SIAA 2JPTA 4OR9B 1GGWA 5KTYA 2I2RE 1ALWA 1FW4A 1XFWO 1PSBA 3SIBA 3NSIA 4MSPA 1H8BA 2H61A 1NWDA 1SL7A 1KFUS 5B8IB 2OS8B 1SNLA 3OHMB 2JXCA 1OMDA 2KSPA 3JVTC 1A29A 2BBMA 2K7DA 5D7FA 1ZACA 3PFVA 2F33A 1IGVA 2AAOA 1IG5A 1K9KA 4IL1A 5HKWA 4GPLB 3BOWA 1UHJA 2BE6A 1NX3A 2M1KB 2CXJA 2M8UA 1W7IB 1CM1A 4M2PA 1N0YA 3BUXB 1YUUA 4GAOA 1CTRA 1ZFSA 2BCXA 2BECA 5HKZA 1L2OB 1F4QA 3ZNIA 1S6IA 2KGRA 2KAVA 1NX1A 4QJ3B 1EJ3A 2DOQA 4MZLA 1W7JB 5PALA 2CTNA 2BE4A 1PVAA 5ER5A 1B8CA 3NSKA 3EVRA 1OE9B 4BY5A 2H2KA 1KFXL 1WRKA 2LV7A 2HQ8A 3D10A 4AOMA 1FI5A 2BCBA 1YVLA 4JWQA 5I2QA 3CS1A 2ZN8A 3DVKA 2ZRSA 2LP3A 1YRUB 1WLZA 1DJWA 4GUKA 2BL0C 1J1EA 2PVBA 1CLMA 2QACA 3A8RA 2PALA 1IJ6A 3CLNA 3PM8A 4R1EA 2F2OA 2FCDA 4JQ0D 1KWOB 4HRHA 4NDCA 1BF5A 1XFVO 4MEWA 1KK7Y 4MZKA 3KHEA 3SG3A 1S6CA 4UPGA 4N1FA 2KHNA 2L4HA 3SG2A 1S5GY 2LANA 5DKNA 1F8HA 1J7RA 1M45A 2IS9A 3DF0A 3GK1A 2LLUA 2LMVA 4L9MA 3TDZA 1LINA 3PN7B 5KSZA 1QS7A 4DRWA 1F71A 2BBNA 3SG4A 3CWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PE7 A;  1JFK A;  1F54 A;  2EC6 B;  3VGO A;  2JTZ A;  2MLE C;  4ORA B;  1BOD A;  1XVJ A;  1SKT A;  3BXK A;  4M2Q A;  3VRO A;  1QX7 A;  1GGZ A;  1ZMZ A;  3TUY C;  4YGA A;  1OZS A;  4MBE A;  1N65 A;  1SRA A;  1B47 A;  2WND A;  3VRN A;  3EK8 A;  2KGB C;  4I5K A;  4GGF C;  4GGN A;  1ODB A;  2LUX A;  3AKB A;  3D0Y A;  4XYN A;  2MHH A;  1H4B A;  3TDI A;  1TOP A;  3MSE B;  3I5H B;  2L51 A;  3OB1 B;  1B7T Z;  1KK8 B;  1X02 A;  2E6W A;  3EKJ A;  2M49 B;  3EK4 A;  3RM1 A;  3CR2 A;  2M7N A;  1BJF A;  1IKU A;  2KBI A;  3BUW B;  4NDB A;  1GQM A;  2JT8 A;  1C7W A;  4MZJ A;  3TZ1 A;  4MLW A;  1QX2 A;  3LK0 A;  3TDU A;  2HPS A;  1UP5 A;  2GV5 A;  1NX0 A;  2JQ6 A;  1QIW A;  1A75 B;  4WQ2 A;  2FOT A;  1DVI A;  1PSR A;  4N1G A;  2JT3 A;  2A4J A;  2LC5 A;  3M0W A;  2WCB A;  2M97 A;  1K94 A;  1C7V A;  1B9A A;  1DF0 A;  4GGF A;  5AER A;  1SCV A;  1JWD A;  2F3Z A;  2F3Y A;  1F70 A;  1YUR A;  1E8A A;  1EL4 A;  2K8M B;  4OVN F;  4WQ3 A;  1AHR A;  1LVC D;  4M2O A;  4CPV A;  1REC A;  5I2L A;  1U5I B;  1S26 D;  3KPX A;  4GBA A;  1HT9 A;  1SPY A;  2FCE A;  3HCM A;  1XO5 A;  4FQO A;  4WRI A;  2M7L A;  2LVK A;  2EGD A;  4ETO A;  5AFP A;  4A4B A;  2BCA A;  1NSH A;  2NXQ A;  3BUO B;  1QAT A;  4XJK B;  1SCM C;  1ZOT B;  4C0J A;  1J7O A;  2ISD A;  1KQM C;  1K90 D;  3EVU A;  1K93 D;  3F45 A;  4CFR A;  1YUS A;  2VRG A;  5CPV A;  2KOT A;  3I5I B;  3AAJ A;  1AUI B;  1YUT A;  4I5N B;  3OP0 A;  5FYX A;  2L4I A;  2WC8 A;  1CLL A;  3O4Y A;  1TNX A;  4N5X A;  2MJW B;  1NX2 A;  3SG7 A;  2LHL A;  1K8U A;  1K95 A;  2LNK A;  2NCO A;  4P5O E;  3TS5 C;  3DVJ A;  4C0L A;  1Q80 A;  1WDC B;  2KQ6 A;  3VRR A;  4PHJ A;  1QVI Z;  3DVM A;  1K2H A;  1XA5 A;  3OX5 A;  2LMU A;  2KI4 B;  2RGI A;  3DVE A;  3O2P A;  4FTG A;  4MN0 A;  5IBW A;  2P6B B;  3I5F B;  3I5G C;  1VRK A;  3IF7 A;  3BYA A;  2HQW A;  5CSJ A;  1B4C A;  2JZI A;  2OTG C;  4OV2 A;  3RLZ A;  1G8I A;  3KF9 A;  3LLE A;  1WRZ A;  1NCY A;  1R6P A;  1Y1U A;  3C1V A;  4A4C A;  4CLN A;  2HF5 A;  2MAZ A;  1DJH A;  2JWW A;  2F2P A;  1KFU L;  1TCO B;  2OPO A;  1SR6 B;  4YGD B;  2L0P A;  1KSM A;  1Y1A A;  1OZO A;  1FPW A;  1BOC A;  2OS8 C;  3IQO A;  4ZCV A;  2Q91 A;  1FBV A;  1YX7 A;  2K7C A;  3KO0 A;  1PVB A;  1TRF A;  2LHI A;  4MRY A;  4GNK B;  2LVI A;  1PK0 D;  2I7A A;  1QX5 B;  2COL B;  1TN4 A;  1G4Y R;  2KNE A;  1EH2 A;  2NLN A;  3H4S E;  4PE0 A;  2LVJ A;  2GGM A;  5CSF A;  2KFH A;  3BOW B;  3WHU B;  2NZ0 A;  2WCF A;  5JJG A;  2R2I A;  4YGC B;  5HLO A;  1OQP A;  3PAT A;  1JC2 A;  2JU0 A;  2JC2 A;  3AAK A;  1K9P A;  1L2O C;  2JTT A;  2CCM A;  4YGE B;  2KYC A;  2KAY A;  1QAS A;  3QRX A;  1UHN A;  2JRF A;  5F6T A;  2KYF A;  2MBX A;  3SG5 A;  1FI6 A;  4MVF A;  1NUB A;  2CT9 A;  1S36 A;  4YI9 A;  2K7O A;  1JSA A;  4OCI A;  4PCW A;  1M39 A;  1QTX A;  4GFT A;  3HX4 A;  1EG3 A;  3WNX B;  1S6J A;  1JF0 A;  5DKR A;  5HYD A;  2F8P A;  3CR4 X;  5AEQ A;  3NSL A;  3JVT B;  1IH0 A;  2K61 A;  2KQY A;  3GK4 X;  1DTL A;  1GJY A;  4NQG A;  2K2A A;  2LLT A;  1V1F A;  1LKJ A;  1MXE A;  3NSO A;  4I5J A;  1G33 A;  3PSR A;  3OB2 B;  5J3X A;  2FJU B;  1JUO A;  1KWO C;  2LE9 B;  1AVS A;  1N2D A;  2PRU A;  1L7Z A;  1CMG A;  4PE1 A;  1J7Q A;  2JNX A;  2HET A;  5DKQ A;  1WRL A;  1AJ5 A;  1RK9 A;  2K2F A;  4PDZ A;  1CLB A;  3GOF A;  1JF2 A;  2K0J A;  1CDL A;  1TNP A;  2G2B A;  1J55 A;  2BKI B;  3BQ3 A;  3DF0 B;  3SJS A;  4C0K A;  1KK7 Z;  1R2U A;  1UHK A;  3PN7 C;  4HRE E;  1EXR A;  1CFD A;  1TTX A;  1LA3 A;  1M63 B;  1S5G Z;  1IRJ A;  4YBH B;  2LLS A;  2ZNE A;  3LL8 B;  1QLS A;  1SL9 A;  3KEV A;  2EC6 C;  1BT6 A;  2LVV A;  1A4P A;  1KFX S;  2EHB A;  3AKA A;  1MUX A;  2BL0 B;  2NCP A;  3O6B A;  2JXL A;  3LK1 A;  1AK8 A;  3ZWH A;  1PUL A;  1YR5 A;  1K96 A;  5BPJ A;  4NDD A;  2KI6 D;  1DGV A;  1J7P A;  2Q4U A;  1YVH A;  1BMO A;  1SMG A;  1NCZ A;  1F4O A;  1CDP A;  5HLV A;  3PAL A;  1MXL C;  1PRW A;  1LXF C;  2SAS A;  2JUL A;  1UUS A;  2Y1N A;  1QV1 A;  2SCP A;  1DJI A;  4HRG A;  4PHK A;  5G08 A;  1CDN A;  1CB1 A;  3A4U B;  1LA0 A;  2V53 A;  1CM4 A;  3WHT B;  1EG4 A;  1OMR A;  1C07 A;  1DJY A;  2I94 A;  1DJZ A;  2WCE A;  4TNC A;  3D0Y B;  2LAP A;  1Y0V H;  1CFC A;  2WOR A;  2ZND A;  3EK7 A;  1KQV A;  2JNF A;  3I5H C;  5AAN A;  5D69 A;  1KK8 C;  1RRO A;  3E3R A;  1QIV A;  1KCY A;  2D8N A;  3CGA A;  1XFZ O;  2MRD A;  1CDM A;  1IJ5 A;  3DD4 A;  3FS7 A;  2MA2 A;  4DCK A;  4DIR A;  1NCX A;  1CFP A;  1BLQ A;  3FWC A;  4HSZ A;  4ORC B;  3VRP A;  2CNP A;  4I5L B;  1A2X A;  3JTD C;  4QJ5 B;  1UHI A;  3TUY B;  1B1G A;  3BUM B;  2ZRT A;  1B8L A;  1JFJ A;  2KBM A;  2BKH B;  1UHH A;  1B7T Y;  1PAL A;  1SL8 A;  4PHN A;  2Y4Q A;  4AQJ A;  3OX6 A;  1DF0 B;  2L5X B;  2LUC A;  1AJ4 A;  1F55 A;  4D1E A;  1YX8 A;  1S1E A;  3FWB A;  5TNC A;  1K9U A;  3PLF B;  4YI8 A;  3IQQ A;  5CSN A;  1MR8 A;  1NIW A;  1OSA A;  2KFG A;  1CMF A;  5JOL A;  1NPQ A;  3CZT X;  3SG6 A;  2KI6 C;  4ZCU A;  4F0Z B;  1WY9 A;  3GK2 A;  1FF1 A;  1SY9 A;  2O5G A;  2PMY A;  3EVV A;  2ZN9 A;  4ORB B;  1DMO A;  4YGB B;  1CNP A;  2KDH A;  4BY4 A;  2QPT A;  1IWQ A;  2CBL A;  1YTZ C;  3LCP C;  1A75 A;  1TIZ A;  2TN4 A;  2Y1M A;  1JBA A;  2M9G A;  4OKH A;  4DUQ A;  3I5I C;  2AMI A;  3ICB A;  1XK4 C;  5I2O A;  1RTP 1;  1QXP A;  1QJT A;  2M3W A;  1SK6 D;  5ER4 X;  1NYA A;  1SYM A;  2LMT A;  2ZFD A;  5CSI A;  2L98 A;  1ALV A;  1B8R A;  2L2E A;  2M0R A;  1WDC C;  2K7B A;  4PE4 A;  4PHM A;  1BG1 A;  1U5I A;  3WXA A;  2MLF C;  1WLM A;  1BR4 B;  1IQ5 A;  2LM5 A;  2LCP A;  2M1U A;  2ZKM X;  3FIA A;  4AQI A;  4U8D A;  2KI4 C;  5K89 A;  1MF8 B;  1TNQ A;  4MRX A;  4DS7 A;  1RJV A;  3K21 A;  4PAL A;  1XYD A;  3I5F C;  4XJK A;  2E30 A;  1IQ3 A;  5HKY A;  1NP8 A;  1SCM B;  1CFF A;  4JPZ B;  1DT7 B;  1DGU A;  1KQM B;  1M31 A;  3NXA A;  1QV0 A;  2PSR A;  1KSO A;  1UWO A;  1AP4 A;  1S3P A;  3CTN A;  2PAS A;  1XK4 A;  2KFF A;  2M29 A;  1BU3 A;  1SW8 A;  1TCF A;  1SR6 C;  1MQ1 A;  4YRU A;  1QVI Y;  2Y5I A;  1D1O A;  4ICB A;  2H61 C;  1QLK A;  1CKK A;  1V1G A;  3TS5 B;  4Q04 A;  5AXI A;  5GQQ C;  1YRT B;  4USL A;  2B1U A;  1RFJ A;  2JOJ A;  1XFX O;  1HQV A;  1UUR A;  1BR1 B;  2JT0 A;  2WOS A;  3VRQ A;  4E68 A;  1ZUZ A;  1A03 A;  4P2Y B;  1DJX A;  2AUC A;  2I18 A;  1XFU O;  4CID A;  1SBJ A;  1J1D A;  2G9B A;  2LP2 A;  4CFQ A;  1OMV A;  1RWY A;  5KU1 A;  1XFY O;  1Y6W A;  3CR5 X;  3EKH A;  1TNW A;  4QJ4 B;  1Y1X A;  2GGZ A;  3I5G B;  3JTD B;  2KAX A;  3BUN B;  1OOJ A;  1MWN A;  2L50 A;  2OTG B;  2O60 A;  1DJG A;  1MHO A;  1M46 A;  5I8N A;  3O78 A;  3SIA A;  2JPT A;  4OR9 B;  1GGW A;  5KTY A;  2I2R E;  1ALW A;  1FW4 A;  1XFW O;  1PSB A;  3SIB A;  3NSI A;  4MSP A;  1H8B A;  2H61 A;  1NWD A;  1SL7 A;  1KFU S;  5B8I B;  2OS8 B;  1SNL A;  3OHM B;  2JXC A;  1OMD A;  2KSP A;  3JVT C;  1A29 A;  2BBM A;  2K7D A;  5D7F A;  1ZAC A;  3PFV A;  2F33 A;  1IGV A;  2AAO A;  1IG5 A;  1K9K A;  4IL1 A;  5HKW A;  4GPL B;  3BOW A;  1UHJ A;  2BE6 A;  1NX3 A;  2M1K B;  2CXJ A;  2M8U A;  1W7I B;  1CM1 A;  4M2P A;  1N0Y A;  3BUX B;  1YUU A;  4GAO A;  1CTR A;  1ZFS A;  2BCX A;  2BEC A;  5HKZ A;  1L2O B;  1F4Q A;  3ZNI A;  1S6I A;  2KGR A;  2KAV A;  1NX1 A;  4QJ3 B;  1EJ3 A;  2DOQ A;  4MZL A;  1W7J B;  5PAL A;  2CTN A;  2BE4 A;  1PVA A;  5ER5 A;  1B8C A;  3NSK A;  3EVR A;  1OE9 B;  4BY5 A;  2H2K A;  1KFX L;  1WRK A;  2LV7 A;  2HQ8 A;  3D10 A;  4AOM A;  1FI5 A;  2BCB A;  1YVL A;  4JWQ A;  5I2Q A;  3CS1 A;  2ZN8 A;  3DVK A;  2ZRS A;  2LP3 A;  1YRU B;  1WLZ A;  1DJW A;  4GUK A;  2BL0 C;  1J1E A;  2PVB A;  1CLM A;  2QAC A;  3A8R A;  2PAL A;  1IJ6 A;  3CLN A;  3PM8 A;  4R1E A;  2F2O A;  2FCD A;  4JQ0 D;  1KWO B;  4HRH A;  4NDC A;  1BF5 A;  1XFV O;  4MEW A;  1KK7 Y;  4MZK A;  3KHE A;  3SG3 A;  1S6C A;  4UPG A;  4N1F A;  2KHN A;  2L4H A;  3SG2 A;  1S5G Y;  2LAN A;  5DKN A;  1F8H A;  1J7R A;  1M45 A;  2IS9 A;  3DF0 A;  3GK1 A;  2LLU A;  2LMV A;  4L9M A;  3TDZ A;  1LIN A;  3PN7 B;  5KSZ A;  1QS7 A;  4DRW A;  1F71 A;  2BBN A;  3SG4 A;  3CWG A; 
#chains in the Genus database with same CATH topology
 4PE7 A;  1JFK A;  1F54 A;  2EC6 B;  1C3Z A;  3B87 A;  3VGO A;  2JTZ A;  2MLE C;  4ORA B;  1BOD A;  1XVJ A;  1SKT A;  3BXK A;  3OBV A;  4M2Q A;  3VRO A;  1QX7 A;  1GGZ A;  1ZMZ A;  3TUY C;  4YGA A;  1OZS A;  4MBE A;  1N65 A;  1SRA A;  1B47 A;  2WND A;  3VRN A;  3EK8 A;  2KGB C;  4I5K A;  3S0B A;  4GGF C;  4GGN A;  1ODB A;  2LUX A;  3AKB A;  3PM2 A;  3D0Y A;  4XYN A;  2MHH A;  1H4B A;  4E68 A;  3TDI A;  1TOP A;  3MSE B;  3I5H B;  2L51 A;  3OB1 B;  1B7T Z;  1KK8 B;  1X02 A;  2E6W A;  3EKJ A;  2M49 B;  2H8V A;  3BFH A;  3EK4 A;  3RM1 A;  3CR2 A;  2M7N A;  1BJF A;  4KYN A;  1IKU A;  2KBI A;  3BUW B;  4NDB A;  2QDI A;  1GQM A;  2JT8 A;  1C7W A;  4MZJ A;  3TZ1 A;  4MLW A;  3UO9 A;  1QX2 A;  3LK0 A;  3TDU A;  2FJY A;  2HPS A;  1UP5 A;  2GV5 A;  1NX0 A;  2JQ6 A;  1QIW A;  1A75 B;  4WQ2 A;  2FOT A;  1DVI A;  1PSR A;  4N1G A;  2JT3 A;  2A4J A;  2LC5 A;  3M0W A;  2WCB A;  2M97 A;  1K94 A;  1C7V A;  1B9A A;  1DF0 A;  4GGF A;  5AER A;  1SCV A;  1JWD A;  3B86 A;  2F3Z A;  2F3Y A;  1F70 A;  1YUR A;  1E8A A;  1EL4 A;  2ERB A;  2K8M B;  4OVN F;  4WQ3 A;  1AHR A;  1LVC D;  4M2O A;  4CPV A;  1REC A;  5I2L A;  1U5I B;  1S26 D;  3KPX A;  4GBA A;  1HT9 A;  1SPY A;  2FCE A;  3HCM A;  1XO5 A;  4FQO A;  4WRI A;  2M7L A;  2LVK A;  2EGD A;  2WCL A;  4ETO A;  5AFP A;  4A4B A;  2BCA A;  1NSH A;  2NXQ A;  3BUO B;  4INW A;  1LS8 A;  1QAT A;  4XJK B;  3EG5 B;  1SCM C;  1ZOT B;  4C0J A;  1J7O A;  2ISD A;  1KQM C;  1K90 D;  3EVU A;  1K93 D;  3F45 A;  4CFR A;  1YUS A;  2VRG A;  5CPV A;  1OOI X;  2KOT A;  3I5I B;  3AAJ A;  1AUI B;  3IVT A;  1YUT A;  4I5N B;  3OP0 A;  4PHK A;  5FYX A;  2L4I A;  2WC8 A;  1CLL A;  3O4Y A;  3B88 A;  1TNX A;  4N5X A;  2MJW B;  1NX2 A;  3SG7 A;  2LHL A;  1K8U A;  4OZD A;  1K95 A;  2LNK A;  2NCO A;  4P5O E;  3TS5 C;  3DVJ A;  3CZ0 A;  1QWV A;  4C0L A;  1Q80 A;  3S0G A;  1WDC B;  2KQ6 A;  3VRR A;  4PHJ A;  3RZS A;  1QVI Z;  3D76 A;  3DVM A;  1K2H A;  1XA5 A;  3OX5 A;  2LMU A;  2KI4 B;  2RGI A;  3DVE A;  3O2P A;  4FTG A;  4MN0 A;  5IBW A;  2P6B B;  5D3O A;  3CYZ A;  3I5F B;  3I5G C;  1VRK A;  3IF7 A;  3BYA A;  2HQW A;  5CSJ A;  1B4C A;  2JZI A;  2OTG C;  4OV2 A;  3RLZ A;  1G8I A;  3KF9 A;  3LLE A;  1WRZ A;  1NCY A;  1R6P A;  1Y1U A;  3C1V A;  4A4C A;  4CLN A;  2HF5 A;  2MAZ A;  1DJH A;  2JWW A;  2F2P A;  1KFU L;  1TCO B;  2OPO A;  1SR6 B;  3L4A A;  4YGD B;  2L0P A;  1KSM A;  1Y1A A;  1OZO A;  1FPW A;  1BOC A;  2OS8 C;  3IQO A;  4ZCV A;  2Q91 A;  1FBV A;  1YX7 A;  2K7C A;  3KO0 A;  1PVB A;  1TRF A;  2LHI A;  4MRY A;  4GNK B;  2LVI A;  1PK0 D;  2I7A A;  1QX5 B;  1TN4 A;  2COL B;  1G4Y R;  2KNE A;  5DIC A;  1EH2 A;  2NLN A;  3H4S E;  4PE0 A;  2LVJ A;  2GGM A;  5CSF A;  2KFH A;  3BOW B;  3WHU B;  2NZ0 A;  3BFB A;  2WCF A;  5JJG A;  2R2I A;  4YGC B;  5HLO A;  1DC1 A;  1OQP A;  3PAT A;  1JC2 A;  2JU0 A;  2JC2 A;  3AAK A;  1K9P A;  3CZ1 A;  1L2O C;  2JTT A;  2CCM A;  3B7A A;  4YGE B;  2JPO A;  2KYC A;  1IIO A;  1OOH A;  2KAY A;  1QAS A;  3QRX A;  1UHN A;  2JRF A;  5F6T A;  5FI7 A;  2KYF A;  3UNW A;  2MBX A;  3SG5 A;  1FI6 A;  4MVF A;  1NUB A;  2CT9 A;  1S36 A;  4YI9 A;  2K7O A;  1JSA A;  4OCI A;  4PCW A;  1TUZ A;  1M39 A;  1QTX A;  4GFT A;  4FQT A;  3HX4 A;  1XFR A;  1EG3 A;  3WNX B;  1S6J A;  1JF0 A;  5DKR A;  5HYD A;  4IJ7 A;  2F8P A;  3CR4 X;  5AEQ A;  3NSL A;  3JVT B;  1IH0 A;  2K61 A;  2KQY A;  3GK4 X;  3DY9 A;  1DTL A;  1GJY A;  4NQG A;  2K2A A;  2LLT A;  1V1F A;  1LKJ A;  1MXE A;  3NSO A;  4I5J A;  1G33 A;  3PSR A;  3OB2 B;  3NGV A;  2FJU B;  5J3X A;  1JUO A;  1KWO C;  2LE9 B;  3PJI A;  1AVS A;  1N2D A;  2PRU A;  1L7Z A;  1CMG A;  4PE1 A;  2P71 A;  1J7Q A;  2JNX A;  2HET A;  4PT1 A;  1WRL A;  5DKQ A;  1AJ5 A;  1RK9 A;  2KPH A;  3BFA A;  2K2F A;  2BNX A;  4PDZ A;  1CLB A;  3GOF A;  1JF2 A;  2K0J A;  1CDL A;  1TNP A;  2G2B A;  1J55 A;  2BKI B;  3BQ3 A;  3DF0 B;  3SJS A;  4C0K A;  1KK7 Z;  1R2U A;  1UHK A;  3PN7 C;  4HRE E;  1EXR A;  5FI6 A;  1CFD A;  1TTX A;  2BAP A;  1LA3 A;  1M63 B;  1S5G Z;  1IRJ A;  4YBH B;  2LLS A;  2ZNE A;  3LL8 B;  1QLS A;  1SL9 A;  3KEV A;  2EC6 C;  1OOG A;  1BT6 A;  2LVV A;  1A4P A;  1KFX S;  2EHB A;  3AKA A;  1MUX A;  2BL0 B;  2NCP A;  2PYQ A;  3O6B A;  2JXL A;  3LK1 A;  1AK8 A;  3ZWH A;  1PUL A;  1YR5 A;  1K96 A;  5BPJ A;  4NDD A;  2KI6 D;  1TWO A;  1DGV A;  1J7P A;  2Q4U A;  1YVH A;  1BMO A;  1SMG A;  1NCZ A;  1F4O A;  2WCM A;  1CDP A;  5HLV A;  3D78 A;  3PAL A;  1MXL C;  1PRW A;  1LXF C;  2SAS A;  2JUL A;  1UUS A;  2Y1N A;  1QV1 A;  2SCP A;  1DJI A;  2WCJ A;  4HRG A;  5G08 A;  1CDN A;  1CB1 A;  3A4U B;  1LA0 A;  2V53 A;  1CM4 A;  3WHT B;  1EG4 A;  1OMR A;  1C07 A;  1DJY A;  2I94 A;  1DJZ A;  2WCE A;  4TNC A;  3D0Y B;  2LAP A;  1Y0V H;  1CFC A;  2WOR A;  2ZND A;  3EK7 A;  1KQV A;  2JNF A;  3I5H C;  5AAN A;  5D69 A;  1KK8 C;  1RRO A;  3E3R A;  1QIV A;  5I94 A;  2D8N A;  1KCY A;  3CGA A;  1XFZ O;  2WCH A;  2MRD A;  2QEH A;  1CDM A;  5EL2 A;  1IJ5 A;  3DD4 A;  3FS7 A;  2MA2 A;  4DCK A;  4DIR A;  3VB1 A;  1NCX A;  1CFP A;  1BLQ A;  3FWC A;  4HSZ A;  4ORC B;  3VRP A;  2CNP A;  4I5L B;  1A2X A;  3JTD C;  4QJ5 B;  1UHI A;  3TUY B;  1B1G A;  3BUM B;  2ZRT A;  1B8L A;  1JFJ A;  2KBM A;  2BKH B;  1UHH A;  1B7T Y;  1PAL A;  1SL8 A;  4PHN A;  2Y4Q A;  4AQJ A;  3OX6 A;  1DF0 B;  2L5X B;  2LUC A;  1AJ4 A;  3D74 A;  3OGN A;  1F55 A;  4D1E A;  1YX8 A;  1S1E A;  3FWB A;  3CDN A;  3NHT A;  1K9U A;  2P70 A;  3PLF B;  4YI8 A;  5TNC A;  2K60 A;  3IQQ A;  5CSN A;  1MR8 A;  1NIW A;  1OSA A;  2KFG A;  1CMF A;  5JOL A;  1NPQ A;  3CZT X;  3SG6 A;  2KI6 C;  4ZCU A;  4F0Z B;  1WY9 A;  3GK2 A;  3L4L A;  1FF1 A;  1SY9 A;  2O5G A;  2PMY A;  3EVV A;  3FE6 A;  2ZN9 A;  4ORB B;  1DMO A;  4YGB B;  3CAB A;  1CNP A;  3DYE A;  2KDH A;  4BY4 A;  2QPT A;  1IWQ A;  2CBL A;  1YTZ C;  3LCP C;  1A75 A;  1TIZ A;  2QEO A;  2TN4 A;  2Y1M A;  2M9G A;  4OKH A;  4DUQ A;  1JBA A;  3I5I C;  2AMI A;  3ICB A;  1XK4 C;  5I2O A;  1RTP 1;  1QXP A;  1QJT A;  2M3W A;  1SK6 D;  5ER4 X;  1NYA A;  1SYM A;  2KLE A;  2LMT A;  2ZFD A;  5CSI A;  2L98 A;  5FI2 A;  1ALV A;  1B8R A;  2L2E A;  2M0R A;  1WDC C;  2K7B A;  3S0F A;  4PE4 A;  4PHM A;  1BG1 A;  1U5I A;  3WXA A;  2MLF C;  1OW4 A;  1WLM A;  1BR4 B;  1IQ5 A;  2LM5 A;  2LCP A;  2M1U A;  2ZKM X;  3D73 A;  3FIA A;  4AQI A;  4U8D A;  2KI4 C;  2L2C A;  5K89 A;  1MF8 B;  1TNQ A;  4MRX A;  2WCK A;  4DS7 A;  1RJV A;  1SSE B;  3K21 A;  1XYD A;  3I5F C;  4PAL A;  2E30 A;  4XJK A;  1IQ3 A;  1GM0 A;  5HKY A;  1NP8 A;  1SCM B;  1CFF A;  4JPZ B;  1DT7 B;  1DGU A;  1KQM B;  1M31 A;  3NXA A;  3O4X A;  1QV0 A;  1P28 A;  2PSR A;  1KSO A;  2PQL A;  1UWO A;  2WC5 A;  1AP4 A;  1S3P A;  2QEB A;  3CTN A;  2PAS A;  1XK4 A;  2KFF A;  2M29 A;  1BU3 A;  1SW8 A;  1TCF A;  1SR6 C;  1MQ1 A;  4YRU A;  1QVI Y;  2Y5I A;  1D1O A;  4ICB A;  4INX A;  2H61 C;  1QLK A;  1CKK A;  1V1G A;  2WC6 A;  3TS5 B;  4Q04 A;  5AXI A;  5GQQ C;  1YRT B;  4USL A;  2B1U A;  3S0E A;  1DEK A;  1RFJ A;  2JOJ A;  1XFX O;  1HQV A;  1UUR A;  1BR1 B;  2JT0 A;  2L5Y A;  2WOS A;  3NHI A;  1ZUZ A;  3VRQ A;  1A03 A;  4P2Y B;  1DJX A;  2AUC A;  2I18 A;  1XFU O;  3R1P A;  4CID A;  1SBJ A;  1J1D A;  3SS5 A;  2G9B A;  2LP2 A;  4CFQ A;  1OMV A;  1RWY A;  3N7H A;  1XFY O;  1Y6W A;  4JD9 A;  5KU1 A;  3CR5 X;  3EKH A;  1TNW A;  3S0D A;  4QJ4 B;  1Y1X A;  2GGZ A;  3I5G B;  3JTD B;  2KAX A;  3BUN B;  1OOJ A;  1MWN A;  2L50 A;  2OTG B;  2O60 A;  3BJH A;  1DJG A;  1C3Y A;  1MHO A;  3Q8I A;  1M46 A;  4F7F A;  5I8N A;  3DXL A;  3O78 A;  3SIA A;  2JPT A;  4OR9 B;  1GGW A;  5KTY A;  2I2R E;  1ALW A;  1FW4 A;  1XFW O;  1PSB A;  3SIB A;  3NSI A;  4MSP A;  1H8B A;  2H61 A;  1NWD A;  1SL7 A;  1KFU S;  1DQE A;  5B8I B;  2OS8 B;  3V2L A;  1SNL A;  3D75 A;  2JXC A;  1OMD A;  2KSP A;  3JVT C;  3OHM B;  1A29 A;  2BBM A;  2K7D A;  3QME A;  1ZAC A;  5D7F A;  1W9Z A;  2F33 A;  3PFV A;  1IGV A;  2AAO A;  1IG5 A;  1K9K A;  4IL1 A;  5HKW A;  4GPL B;  3BOW A;  1UHJ A;  2KLD A;  3D77 A;  2BE6 A;  1NX3 A;  2M1K B;  2CXJ A;  2M8U A;  1W7I B;  1CM1 A;  4M2P A;  1N0Y A;  1T14 A;  3BUX B;  1YUU A;  4GAO A;  1Z4H A;  1CTR A;  1ZFS A;  2BCX A;  2BEC A;  5HKZ A;  1L2O B;  5HL1 A;  1F4Q A;  3DZT A;  3R72 A;  1S6I A;  2KGR A;  3ZNI A;  1Z2C B;  2KAV A;  1NX1 A;  4QJ3 B;  1EJ3 A;  2DOQ A;  4MZL A;  1W7J B;  5PAL A;  2CTN A;  2BE4 A;  1PVA A;  5ER5 A;  1B8C A;  3NSK A;  3EVR A;  3K1E A;  1OE9 B;  4BY5 A;  2H2K A;  1KFX L;  1WRK A;  2LV7 A;  2HQ8 A;  3D10 A;  3SS4 A;  4AOM A;  1FI5 A;  2BCB A;  4JKT A;  1YVL A;  4JWQ A;  2YGU A;  5I2Q A;  3CS1 A;  2ZN8 A;  3DVK A;  3FE9 A;  2ZRS A;  3R1O A;  2LP3 A;  1YRU B;  1WLZ A;  1DJW A;  4GUK A;  2BL0 C;  1J1E A;  2PVB A;  1CLM A;  1TUJ A;  2QAC A;  3L47 A;  3A8R A;  2PAL A;  1IJ6 A;  3CLN A;  3PM8 A;  4R1E A;  3SS3 A;  2F2O A;  2FCD A;  1DEL A;  4JQ0 D;  1KWO B;  4HRH A;  1OOF A;  4NDC A;  1BF5 A;  1XFV O;  4MEW A;  1KK7 Y;  3R1V A;  3KHE A;  3FE8 A;  4MZK A;  2QEV A;  1S6C A;  3SG3 A;  4UPG A;  4N1F A;  2KHN A;  2L4H A;  3SG2 A;  3S0A A;  2GTE A;  1S5G Y;  2LAN A;  5DKN A;  3B6X A;  1F8H A;  1J7R A;  1M45 A;  2IS9 A;  3DF0 A;  3GK1 A;  2LLU A;  2LMV A;  1ORG A;  4L9M A;  3TDZ A;  1LIN A;  3PN7 B;  5KSZ A;  1QS7 A;  4DRW A;  1F71 A;  3CZ2 A;  2BBN A;  3SG4 A;  3CWG A; 
#chains in the Genus database with same CATH homology
 4PE7 A;  1JFK A;  1F54 A;  2EC6 B;  3VGO A;  2JTZ A;  2MLE C;  4ORA B;  1BOD A;  1XVJ A;  1SKT A;  3BXK A;  4M2Q A;  3VRO A;  1QX7 A;  1GGZ A;  1ZMZ A;  3TUY C;  4YGA A;  1OZS A;  4MBE A;  1N65 A;  1SRA A;  1B47 A;  2WND A;  3VRN A;  3EK8 A;  2KGB C;  4I5K A;  4GGF C;  4GGN A;  1ODB A;  2LUX A;  3AKB A;  3D0Y A;  4XYN A;  2MHH A;  1H4B A;  3TDI A;  1TOP A;  3MSE B;  3I5H B;  2L51 A;  3OB1 B;  1B7T Z;  1KK8 B;  1X02 A;  2E6W A;  3EKJ A;  2M49 B;  3EK4 A;  3RM1 A;  3CR2 A;  2M7N A;  1BJF A;  1IKU A;  2KBI A;  3BUW B;  4NDB A;  1GQM A;  2JT8 A;  1C7W A;  4MZJ A;  3TZ1 A;  4MLW A;  1QX2 A;  3LK0 A;  3TDU A;  2HPS A;  1UP5 A;  2GV5 A;  1NX0 A;  2JQ6 A;  1QIW A;  1A75 B;  4WQ2 A;  2FOT A;  1DVI A;  1PSR A;  4N1G A;  2JT3 A;  2A4J A;  2LC5 A;  3M0W A;  2WCB A;  2M97 A;  1K94 A;  1C7V A;  1B9A A;  1DF0 A;  4GGF A;  5AER A;  1SCV A;  1JWD A;  2F3Z A;  2F3Y A;  1F70 A;  1YUR A;  1E8A A;  1EL4 A;  2K8M B;  4OVN F;  4WQ3 A;  1AHR A;  1LVC D;  4M2O A;  4CPV A;  1REC A;  5I2L A;  1U5I B;  1S26 D;  3KPX A;  4GBA A;  1HT9 A;  1SPY A;  2FCE A;  3HCM A;  1XO5 A;  4FQO A;  4WRI A;  2M7L A;  2LVK A;  2EGD A;  4ETO A;  5AFP A;  4A4B A;  2BCA A;  1NSH A;  2NXQ A;  3BUO B;  1QAT A;  4XJK B;  1SCM C;  1ZOT B;  4C0J A;  1J7O A;  2ISD A;  1KQM C;  1K90 D;  3EVU A;  1K93 D;  3F45 A;  4CFR A;  1YUS A;  2VRG A;  5CPV A;  2KOT A;  3I5I B;  3AAJ A;  1AUI B;  1YUT A;  4I5N B;  3OP0 A;  5FYX A;  2L4I A;  2WC8 A;  1CLL A;  3O4Y A;  1TNX A;  4N5X A;  2MJW B;  1NX2 A;  3SG7 A;  2LHL A;  1K8U A;  1K95 A;  2LNK A;  2NCO A;  4P5O E;  3TS5 C;  3DVJ A;  4C0L A;  1Q80 A;  1WDC B;  2KQ6 A;  3VRR A;  4PHJ A;  1QVI Z;  3DVM A;  1K2H A;  1XA5 A;  3OX5 A;  2LMU A;  2KI4 B;  2RGI A;  3DVE A;  3O2P A;  4FTG A;  4MN0 A;  5IBW A;  2P6B B;  3I5F B;  3I5G C;  1VRK A;  3IF7 A;  3BYA A;  2HQW A;  5CSJ A;  1B4C A;  2JZI A;  2OTG C;  4OV2 A;  3RLZ A;  1G8I A;  3KF9 A;  3LLE A;  1WRZ A;  1NCY A;  1R6P A;  1Y1U A;  3C1V A;  4A4C A;  4CLN A;  2HF5 A;  2MAZ A;  1DJH A;  2JWW A;  2F2P A;  1KFU L;  1TCO B;  2OPO A;  1SR6 B;  4YGD B;  2L0P A;  1KSM A;  1Y1A A;  1OZO A;  1FPW A;  1BOC A;  2OS8 C;  3IQO A;  4ZCV A;  2Q91 A;  1FBV A;  1YX7 A;  2K7C A;  3KO0 A;  1PVB A;  1TRF A;  2LHI A;  4MRY A;  4GNK B;  2LVI A;  1PK0 D;  2I7A A;  1QX5 B;  2COL B;  1TN4 A;  1G4Y R;  2KNE A;  1EH2 A;  2NLN A;  3H4S E;  4PE0 A;  2LVJ A;  2GGM A;  5CSF A;  2KFH A;  3BOW B;  3WHU B;  2NZ0 A;  2WCF A;  5JJG A;  2R2I A;  4YGC B;  5HLO A;  1OQP A;  3PAT A;  1JC2 A;  2JU0 A;  2JC2 A;  3AAK A;  1K9P A;  1L2O C;  2JTT A;  2CCM A;  4YGE B;  2KYC A;  2KAY A;  1QAS A;  3QRX A;  1UHN A;  2JRF A;  5F6T A;  2KYF A;  2MBX A;  3SG5 A;  1FI6 A;  4MVF A;  1NUB A;  2CT9 A;  1S36 A;  4YI9 A;  2K7O A;  1JSA A;  4OCI A;  4PCW A;  1M39 A;  1QTX A;  4GFT A;  3HX4 A;  1EG3 A;  3WNX B;  1S6J A;  1JF0 A;  5DKR A;  5HYD A;  2F8P A;  3CR4 X;  5AEQ A;  3NSL A;  3JVT B;  1IH0 A;  2K61 A;  2KQY A;  3GK4 X;  1DTL A;  1GJY A;  4NQG A;  2K2A A;  2LLT A;  1V1F A;  1LKJ A;  1MXE A;  3NSO A;  4I5J A;  1G33 A;  3PSR A;  3OB2 B;  5J3X A;  2FJU B;  1JUO A;  1KWO C;  2LE9 B;  1AVS A;  1N2D A;  2PRU A;  1L7Z A;  1CMG A;  4PE1 A;  1J7Q A;  2JNX A;  2HET A;  5DKQ A;  1WRL A;  1AJ5 A;  1RK9 A;  2K2F A;  4PDZ A;  1CLB A;  3GOF A;  1JF2 A;  2K0J A;  1CDL A;  1TNP A;  2G2B A;  1J55 A;  2BKI B;  3BQ3 A;  3DF0 B;  3SJS A;  4C0K A;  1KK7 Z;  1R2U A;  1UHK A;  3PN7 C;  4HRE E;  1EXR A;  1CFD A;  1TTX A;  1LA3 A;  1M63 B;  1S5G Z;  1IRJ A;  4YBH B;  2LLS A;  2ZNE A;  3LL8 B;  1QLS A;  1SL9 A;  3KEV A;  2EC6 C;  1BT6 A;  2LVV A;  1A4P A;  1KFX S;  2EHB A;  3AKA A;  1MUX A;  2BL0 B;  2NCP A;  3O6B A;  2JXL A;  3LK1 A;  1AK8 A;  3ZWH A;  1PUL A;  1YR5 A;  1K96 A;  5BPJ A;  4NDD A;  2KI6 D;  1DGV A;  1J7P A;  2Q4U A;  1YVH A;  1BMO A;  1SMG A;  1NCZ A;  1F4O A;  1CDP A;  5HLV A;  3PAL A;  1MXL C;  1PRW A;  1LXF C;  2SAS A;  2JUL A;  1UUS A;  2Y1N A;  1QV1 A;  2SCP A;  1DJI A;  4HRG A;  4PHK A;  5G08 A;  1CDN A;  1CB1 A;  3A4U B;  1LA0 A;  2V53 A;  1CM4 A;  3WHT B;  1EG4 A;  1OMR A;  1C07 A;  1DJY A;  2I94 A;  1DJZ A;  2WCE A;  4TNC A;  3D0Y B;  2LAP A;  1Y0V H;  1CFC A;  2WOR A;  2ZND A;  3EK7 A;  1KQV A;  2JNF A;  3I5H C;  5AAN A;  5D69 A;  1KK8 C;  1RRO A;  3E3R A;  1QIV A;  1KCY A;  2D8N A;  3CGA A;  1XFZ O;  2MRD A;  1CDM A;  1IJ5 A;  3DD4 A;  3FS7 A;  2MA2 A;  4DCK A;  4DIR A;  1NCX A;  1CFP A;  1BLQ A;  3FWC A;  4HSZ A;  4ORC B;  3VRP A;  2CNP A;  4I5L B;  1A2X A;  3JTD C;  4QJ5 B;  1UHI A;  3TUY B;  1B1G A;  3BUM B;  2ZRT A;  1B8L A;  1JFJ A;  2KBM A;  2BKH B;  1UHH A;  1B7T Y;  1PAL A;  1SL8 A;  4PHN A;  2Y4Q A;  4AQJ A;  3OX6 A;  1DF0 B;  2L5X B;  2LUC A;  1AJ4 A;  1F55 A;  4D1E A;  1YX8 A;  1S1E A;  3FWB A;  5TNC A;  1K9U A;  3PLF B;  4YI8 A;  3IQQ A;  5CSN A;  1MR8 A;  1NIW A;  1OSA A;  2KFG A;  1CMF A;  5JOL A;  1NPQ A;  3CZT X;  3SG6 A;  2KI6 C;  4ZCU A;  4F0Z B;  1WY9 A;  3GK2 A;  1FF1 A;  1SY9 A;  2O5G A;  2PMY A;  3EVV A;  2ZN9 A;  4ORB B;  1DMO A;  4YGB B;  1CNP A;  2KDH A;  4BY4 A;  2QPT A;  1IWQ A;  2CBL A;  1YTZ C;  3LCP C;  1A75 A;  1TIZ A;  2TN4 A;  2Y1M A;  1JBA A;  2M9G A;  4OKH A;  4DUQ A;  3I5I C;  2AMI A;  3ICB A;  1XK4 C;  5I2O A;  1RTP 1;  1QXP A;  1QJT A;  2M3W A;  1SK6 D;  5ER4 X;  1NYA A;  1SYM A;  2LMT A;  2ZFD A;  5CSI A;  2L98 A;  1ALV A;  1B8R A;  2L2E A;  2M0R A;  1WDC C;  2K7B A;  4PE4 A;  4PHM A;  1BG1 A;  1U5I A;  3WXA A;  2MLF C;  1WLM A;  1BR4 B;  1IQ5 A;  2LM5 A;  2LCP A;  2M1U A;  2ZKM X;  3FIA A;  4AQI A;  4U8D A;  2KI4 C;  5K89 A;  1MF8 B;  1TNQ A;  4MRX A;  4DS7 A;  1RJV A;  3K21 A;  4PAL A;  1XYD A;  3I5F C;  4XJK A;  2E30 A;  1IQ3 A;  5HKY A;  1NP8 A;  1SCM B;  1CFF A;  4JPZ B;  1DT7 B;  1DGU A;  1KQM B;  1M31 A;  3NXA A;  1QV0 A;  2PSR A;  1KSO A;  1UWO A;  1AP4 A;  1S3P A;  3CTN A;  2PAS A;  1XK4 A;  2KFF A;  2M29 A;  1BU3 A;  1SW8 A;  1TCF A;  1SR6 C;  1MQ1 A;  4YRU A;  1QVI Y;  2Y5I A;  1D1O A;  4ICB A;  2H61 C;  1QLK A;  1CKK A;  1V1G A;  3TS5 B;  4Q04 A;  5AXI A;  5GQQ C;  1YRT B;  4USL A;  2B1U A;  1RFJ A;  2JOJ A;  1XFX O;  1HQV A;  1UUR A;  1BR1 B;  2JT0 A;  2WOS A;  3VRQ A;  4E68 A;  1ZUZ A;  1A03 A;  4P2Y B;  1DJX A;  2AUC A;  2I18 A;  1XFU O;  4CID A;  1SBJ A;  1J1D A;  2G9B A;  2LP2 A;  4CFQ A;  1OMV A;  1RWY A;  5KU1 A;  1XFY O;  1Y6W A;  3CR5 X;  3EKH A;  1TNW A;  4QJ4 B;  1Y1X A;  2GGZ A;  3I5G B;  3JTD B;  2KAX A;  3BUN B;  1OOJ A;  1MWN A;  2L50 A;  2OTG B;  2O60 A;  1DJG A;  1MHO A;  1M46 A;  5I8N A;  3O78 A;  3SIA A;  2JPT A;  4OR9 B;  1GGW A;  5KTY A;  2I2R E;  1ALW A;  1FW4 A;  1XFW O;  1PSB A;  3SIB A;  3NSI A;  4MSP A;  1H8B A;  2H61 A;  1NWD A;  1SL7 A;  1KFU S;  5B8I B;  2OS8 B;  1SNL A;  3OHM B;  2JXC A;  1OMD A;  2KSP A;  3JVT C;  1A29 A;  2BBM A;  2K7D A;  5D7F A;  1ZAC A;  3PFV A;  2F33 A;  1IGV A;  2AAO A;  1IG5 A;  1K9K A;  4IL1 A;  5HKW A;  4GPL B;  3BOW A;  1UHJ A;  2BE6 A;  1NX3 A;  2M1K B;  2CXJ A;  2M8U A;  1W7I B;  1CM1 A;  4M2P A;  1N0Y A;  3BUX B;  1YUU A;  4GAO A;  1CTR A;  1ZFS A;  2BCX A;  2BEC A;  5HKZ A;  1L2O B;  1F4Q A;  3ZNI A;  1S6I A;  2KGR A;  2KAV A;  1NX1 A;  4QJ3 B;  1EJ3 A;  2DOQ A;  4MZL A;  1W7J B;  5PAL A;  2CTN A;  2BE4 A;  1PVA A;  5ER5 A;  1B8C A;  3NSK A;  3EVR A;  1OE9 B;  4BY5 A;  2H2K A;  1KFX L;  1WRK A;  2LV7 A;  2HQ8 A;  3D10 A;  4AOM A;  1FI5 A;  2BCB A;  1YVL A;  4JWQ A;  5I2Q A;  3CS1 A;  2ZN8 A;  3DVK A;  2ZRS A;  2LP3 A;  1YRU B;  1WLZ A;  1DJW A;  4GUK A;  2BL0 C;  1J1E A;  2PVB A;  1CLM A;  2QAC A;  3A8R A;  2PAL A;  1IJ6 A;  3CLN A;  3PM8 A;  4R1E A;  2F2O A;  2FCD A;  4JQ0 D;  1KWO B;  4HRH A;  4NDC A;  1BF5 A;  1XFV O;  4MEW A;  1KK7 Y;  4MZK A;  3KHE A;  3SG3 A;  1S6C A;  4UPG A;  4N1F A;  2KHN A;  2L4H A;  3SG2 A;  1S5G Y;  2LAN A;  5DKN A;  1F8H A;  1J7R A;  1M45 A;  2IS9 A;  3DF0 A;  3GK1 A;  2LLU A;  2LMV A;  4L9M A;  3TDZ A;  1LIN A;  3PN7 B;  5KSZ A;  1QS7 A;  4DRW A;  1F71 A;  2BBN A;  3SG4 A;  3CWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...