4HRGA

Crystal structure of p11-annexin a2(n-terminal) fusion protein in complex with ahnak1 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQENLYFQGDSTVHEILSKLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords Protein S100-A10
publication title SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4hrgA00
2KI4C 4PHMA 1LA3A 2JNXA 1WRKA 1J7RA 2FCDA 2ZN9A 2M3WA 4GBAA 3TS5C 2K7DA 2PASA 2MHHA 5KU1A 1KCYA 1YURA 1QATA 4MSPA 3FS7A 1GGZA 5I2QA 2EC6B 3HX4A 1Y1XA 1JF0A 3OB1B 4PHNA 2BCXA 3I5HB 2PRUA 1KWOB 1M46A 4OV2A 1N2DA 2CXJA 1AP4A 3EK4A 4OCIA 4NDDA 1DF0A 1J55A 1XO5A 1KWOC 1DJYA 2SASA 3DF0B 5IBWA 4YGDB 1PRWA 3CR5X 4PCWA 2KAYA 4I5KA 2ZNEA 2JT8A 4XJKA 5BPJA 1XFZO 4JPZB 2L5XB 1J7PA 3CS1A 1QX2A 2I2RE 2NLNA 2BE6A 3WHUB 1PVAA 3E3RA 5B8IB 4MBEA 5DKRA 1EJ3A 2F2PA 1NCXA 1TNXA 1F55A 1IRJA 3NSLA 4BY5A 3WNXB 1HQVA 1DGUA 5F6TA 3I5IB 3VRQA 5CPVA 3TDZA 1N0YA 2COLB 1SBJA 1CM1A 1RJVA 1LA0A 2P6BB 3O78A 5GQQC 4L9MA 2NZ0A 1UP5A 2QACA 3DVKA 3JTDC 2WORA 1TNWA 3ZNIA 1AJ4A 4WRIA 2GV5A 2L98A 1EG4A 2BCAA 4ZCUA 1IG5A 2JT0A 1ZMZA 1CTRA 1K2HA 1YUTA 1VRKA 1MR8A 3AAJA 2E30A 1NPQA 1TCOB 4N1GA 1A03A 1CDPA 1V1FA 4MZLA 4I5JA 3SG7A 2LV7A 1ZFSA 2ZNDA 1F4QA 1JBAA 1YVLA 3ICBA 2JTZA 1X02A 2Q4UA 1NCZA 4FQOA 1V1GA 3OB2B 1IJ5A 5D7FA 2GGMA 4IL1A 1TCFA 1SRAA 1UHIA 2LUCA 5CSNA 1YRTB 1KK7Z 2JTTA 3DF0A 1XFVO 3GOFA 4N1FA 3DVMA 2V53A 1CLMA 2WNDA 1CDMA 2M49B 1QJTA 2Y1MA 5AXIA 4A4CA 5HYDA 1NX3A 3SJSA 4E68A 1NP8A 2K2FA 2KQ6A 4NDBA 4PE0A 1SK6D 2I18A 3EVVA 5I8NA 1IQ3A 4XYNA 4I5NB 5PALA 2F33A 1CB1A 1NYAA 3BYAA 2L4IA 1OZOA 1XVJA 4M2QA 1NSHA 4ORAB 4GAOA 2M0RA 2BBMA 2LHLA 1ALWA 1KK7Y 5HLVA 1QV0A 2KNEA 2K7CA 1CDLA 3BUXB 1KK8B 2RGIA 1K95A 2M1KB 3SIAA 3NSIA 1MWNA 1OMVA 2GGZA 1KK8C 4P2YB 1CMGA 2LMTA 4YGEB 1J7QA 4M2PA 1EH2A 1S6JA 4GFTA 1CDNA 1A75B 2EGDA 1CLBA 3CTNA 1BJFA 3K21A 1B7TZ 2PALA 4HREE 3LLEA 3I5GB 2CTNA 2Q91A 3M0WA 2L50A 3BUNB 5I2LA 1CLLA 1R6PA 3I5GC 3SG5A 2JOJA 2LMUA 1QV1A 2G2BA 3BUWB 4U8DA 2CT9A 2KI6D 3VGOA 1B8LA 3CR2A 1S36A 3I5FB 3DVEA 3DVJA 2DOQA 3D10A 3FWCA 2LC5A 1H8BA 2BKIB 4GGFA 2NXQA 3I5FC 1TTXA 1S5GZ 2L4HA 2KYCA 2MA2A 4MEWA 5CSIA 1CMFA 1BG1A 1FI5A 1RWYA 1N65A 3BQ3A 3CGAA 1JWDA 2EC6C 1DJWA 4Q04A 1SCMB 4DIRA 4MZJA 3I5HC 2E6WA 3PN7B 3AKBA 3SG4A 3EK8A 3EVUA 1CKKA 1Y0VH 4PDZA 2M29A 3PN7C 3A4UB 1SL7A 2ZRTA 2JC2A 2ISDA 2H61A 3VRNA 1BT6A 3NSKA 1W7JB 1B8CA 2KHNA 4YI8A 2ZKMX 1UURA 1K8UA 3A8RA 3PSRA 4NQGA 4YRUA 2JXLA 3LK0A 1BMOA 2MJWB 1L7ZA 2O60A 2ZFDA 4AOMA 1M31A 1TOPA 1OMRA 3D0YB 4MRYA 3WHTB 1Q80A 1XFUO 2M9GA 1QX7A 3IF7A 2JWWA 1DGVA 1G8IA 1SMGA 1AVSA 2SCPA 1K90D 3ZWHA 3TZ1A 1A75A 2MAZA 3LL8B 4R1EA 1JFJA 2HETA 1F70A 2LANA 4AQIA 3I5IC 4DS7A 5AFPA 1D1OA 3LK1A 3BOWB 1M39A 4D1EA 1E8AA 1MUXA 2ZRSA 2KDHA 3VROA 4ZCVA 1B4CA 5K89A 4QJ4B 3OHMB 1SPYA 3EK7A 3IQQA 1DJHA 5FYXA 3TUYB 1YVHA 2FCEA 2KSPA 4WQ2A 5JOLA 2K2AA 3O4YA 2LLUA 3KF9A 5TNCA 3TUYC 2L2EA 5HLOA 1OZSA 3QRXA 2AUCA 1WRLA 2HQ8A 1DJGA 1QXPA 1DVIA 4YBHB 3O6BA 1DJZA 1RK9A 1SCVA 2KBMA 5I2OA 2NCOA 5CSJA 1ZUZA 1C7VA 1KFUL 1ZACA 1QTXA 2KI6C 1A2XA 4DCKA 4QJ3B 1XFWO 2FJUB 4OVNF 4CIDA 1QIVA 3EVRA 4GGFC 1BF5A 1F54A 2LP2A 5KTYA 1TRFA 3PLFB 1J7OA 1IH0A 3GK2A 2B1UA 4YGBB 1A4PA 1PALA 2K7BA 2WOSA 2IS9A 2CBLA 1S6IA 4TNCA 1FPWA 1CM4A 1QVIZ 4C0LA 1F8HA 1OMDA 2WCFA 1CFDA 1DT7B 2LHIA 1WY9A 1K94A 2JQ6A 1XA5A 2K61A 3D0YA 3WXAA 5KSZA 1BU3A 2K8MB 5HKZA 1HT9A 4BY4A 1SYMA 2H61C 1DJXA 1EL4A 1UWOA 4MRXA 1YR5A 2LVIA 1PULA 1RTP1 2FOTA 3BOWA 3PATA 3CLNA 2BE4A 1U5IB 2LE9B 2LLTA 2KFGA 4CLNA 2LVKA 2LVVA 1C07A 2KGRA 2L0PA 2Y5IA 1UHHA 1YX7A 2M1UA 3SIBA 2MRDA 1QLKA 4OKHA 2JT3A 3F45A 4HSZA 1JC2A 1MF8B 2MLFC 2LAPA 1QS7A 1K96A 1NX1A 2KFFA 1OOJA 1SKTA 1FW4A 1FF1A 1WRZA 3LCPC 1PSBA 2KAVA 3CR4X 3DD4A 3OX6A 5D69A 5ER4X 3BXKA 1LINA 2TN4A 1BLQA 3SG6A 2KAXA 3GK1A 2Y1NA 1UUSA 2HF5A 1XFYO 3PM8A 1S1EA 1MQ1A 4DRWA 1NX0A 2LNKA 1Y1UA 1XFXO 4AQJA 2BKHB 3PFVA 2WC8A 2BL0B 1YUUA 3OP0A 1AK8A 1TNQA 1IKUA 1NCYA 1B7TY 1S6CA 5G08A 1BR1B 4NDCA 2BL0C 5J3XA 2JXCA 2Y4QA 1CFFA 2I7AA 5AEQA 2JPTA 4UPGA 3EKHA 4PALA 1LXFC 4WQ3A 1SCMC 2CNPA 1K93D 1NUBA 2LLSA 3FWBA 2M8UA 4PHKA 5HKYA 1Y1AA 2OPOA 5DKQA 1JF2A 1S5GY 5AANA 2BECA 1XK4A 2F2OA 2AMIA 1AUIB 3EKJA 4N5XA 4YGCB 1TIZA 4GNKB 3C1VA 3VRRA 4YGAA 1U5IA 1MXEA 4PHJA 4P5OE 3HCMA 3BUOB 1S26D 1OE9B 1IQ5A 1B9AA 1GGWA 4GPLB 2HPSA 4MLWA 4MZKA 3O2PA 1S3PA 1RROA 1NIWA 2F3YA 2AAOA 2L51A 4PE7A 1BOCA 2KYFA 4FTGA 3RM1A 1YX8A 1FBVA 1K9UA 4ETOA 2PVBA 2KQYA 3BUMB 4ORCB 1M63B 1UHKA 4A4BA 2LP3A 2PSRA 1H4BA 1NWDA 1RECA 1SR6B 2F3ZA 2OTGB 2R2IA 1WDCB 2K7OA 5DKNA 1UHNA 1QASA 1EG3A 2A4JA 4ICBA 5ER5A 1B47A 1SR6C 2MLEC 3GK4X 2OTGC 1WDCC 4M2OA 1ODBA 3JTDB 4CFRA 4PE1A 4JWQA 1WLMA 2BBNA 2LM5A 3RLZA 1CFCA 1IJ6A 1ALVA 1SL8A 3KHEA 1KQVA 1F4OA 4C0KA 2K0JA 4MN0A 1TNPA 2O5GA 1DJIA 1GJYA 1BR4B 1YTZC 3TDIA 1K9PA 1R2UA 1SL9A 2LUXA 1YUSA 3JVTB 1L2OB 3KO0A 3SG2A 1PK0D 2CCMA 1JSAA 4OR9B 2NCPA 3FIAA 3JVTC 2KFHA 1L2OC 1SY9A 1OQPA 1EXRA 2F8PA 1KFUS 2WCEA 4F0ZB 3NSOA 2M97A 4GUKA 2HQWA 1K9KA 3VRPA 1C7WA 1QLSA 4ORBB 1F71A 4JQ0D 1A29A 1LKJA 1OSAA 2JU0A 2LMVA 1RFJA 1DTLA 1XYDA 1JFKA 3AAKA 1G33A 4HRHA 3IQOA 4GGNA 1B8RA 4C0JA 1YRUB 2M7NA 4MVFA 4YI9A 4CPVA 3AKAA 1SNLA 1PSRA 1KQMB 3CZTX 1ZOTB 1G4YR 1IWQA 1NX2A 1KFXL 1CFPA 1W7IB 1XK4C 2OS8B 1KQMC 3PALA 1MHOA 1M45A 3KPXA 4HRGA 1TN4A 1KSOA 4I5LB 1DF0B 5HKWA 2OS8C 3MSEB 1BODA 4CFQA 1QVIY 1PVBA 1KSMA 2KBIA 2KOTA 3SG3A 1KFXS 5AERA 2MBXA 2G9BA 2VRGA 5CSFA 4XJKB 5JJGA 2BCBA 1AJ5A 1QIWA 4USLA 2WCBA 2EHBA 2D8NA 1J1EA 1FI6A 3KEVA 1UHJA 1IGVA 1B1GA 1LVCD 2PMYA 2QPTA 3H4SE 1GQMA 1SW8A 2JNFA 2KGBC 4PE4A 4QJ5B 1J1DA 3CWGA 3OX5A 4DUQA 2LCPA 2JULA 2LVJA 1JUOA 1MXLC 1Y6WA 1WLZA 2M7LA 2JRFA 1DMOA 2ZN8A 3TDUA 1CNPA 2H2KA 2I94A 2KI4B 1QX5B 2JZIA 3NXAA 1AHRA 3TS5B
chains in the Genus database with same CATH superfamily
2KI4C 3CZ0A 4PHMA 1LA3A 2JNXA 1WRKA 1J7RA 1P28A 2FCDA 2K60A 2ZN9A 2M3WA 4GBAA 3TS5C 2K7DA 2PASA 2MHHA 5KU1A 1KCYA 1YURA 1QATA 4MSPA 3FS7A 1GGZA 1ORGA 5I2QA 2EC6B 1OOHA 3HX4A 1Y1XA 1JF0A 1Z2CB 3OB1B 4PHNA 2BCXA 2P70A 3I5HB 4FQTA 2PRUA 1KWOB 1M46A 3CYZA 4OV2A 1N2DA 2CXJA 1AP4A 3EK4A 4OCIA 4NDDA 4OZDA 1DF0A 1J55A 1XO5A 3L47A 1KWOC 2QEOA 3R1OA 1DJYA 2SASA 3DF0B 5IBWA 5I94A 4YGDB 1PRWA 3CR5X 4PCWA 2KAYA 4I5KA 2ZNEA 2JT8A 4XJKA 5BPJA 3BFAA 1IIOA 2KPHA 1XFZO 4JPZB 2L5XB 1J7PA 3CS1A 1QX2A 2I2RE 2NLNA 1C3ZA 2BE6A 1PVAA 3E3RA 3WHUB 5B8IB 4MBEA 5DKRA 1EJ3A 2F2PA 1NCXA 2KLDA 1TNXA 1F55A 1IRJA 3NSLA 4BY5A 3WNXB 1HQVA 1DGUA 5F6TA 3I5IB 3VRQA 5CPVA 3TDZA 1N0YA 2COLB 1SBJA 4JD9A 1CM1A 1RJVA 1LA0A 2P6BB 3O78A 5GQQC 4L9MA 2NZ0A 1UP5A 2QACA 3B7AA 3DVKA 3JTDC 2WORA 1TNWA 3ZNIA 1AJ4A 4WRIA 2GV5A 2L98A 1EG4A 2BCAA 4ZCUA 1IG5A 2JT0A 1ZMZA 1CTRA 3D74A 1K2HA 1YUTA 1VRKA 1MR8A 3AAJA 2E30A 1NPQA 1TCOB 3PM2A 4N1GA 1A03A 1CDPA 1V1FA 4MZLA 4I5JA 3SG7A 2LV7A 1ZFSA 2ZNDA 1F4QA 3S0FA 1YVLA 1JBAA 3DY9A 3ICBA 2JTZA 2WC6A 1X02A 2Q4UA 1NCZA 2GTEA 3DYEA 4FQOA 1V1GA 3OB2B 1IJ5A 5D7FA 2GGMA 4IL1A 4IJ7A 1TCFA 1SRAA 1LS8A 1UHIA 2LUCA 5CSNA 1YRTB 1KK7Z 4INXA 2JTTA 3N7HA 1QWVA 3DF0A 1XFVO 3DXLA 3GOFA 3CDNA 4N1FA 3DVMA 2V53A 1CLMA 2WNDA 3O4XA 1CDMA 2M49B 1QJTA 2Y1MA 3QMEA 5AXIA 4A4CA 2WCMA 1NX3A 5HYDA 3SJSA 4E68A 1NP8A 2K2FA 2KQ6A 4NDBA 4PE0A 1SK6D 2I18A 3EVVA 5I8NA 1IQ3A 4XYNA 4I5NB 5PALA 2F33A 1CB1A 1NYAA 3BYAA 2L4IA 1OZOA 1XVJA 4M2QA 1NSHA 4ORAB 4GAOA 2M0RA 2BBMA 2LHLA 1ALWA 1KK7Y 5HLVA 3L4AA 1QV0A 2KNEA 2K7CA 1CDLA 3BUXB 1KK8B 2RGIA 1K95A 2M1KB 5EL2A 3SS3A 3SIAA 3NSIA 1MWNA 1OMVA 2GGZA 1KK8C 4P2YB 1CMGA 2LMTA 4YGEB 1J7QA 4M2PA 1EH2A 1S6JA 3B6XA 4GFTA 1CDNA 4PT1A 1A75B 3S0DA 2QEBA 2EGDA 1CLBA 3CTNA 1BJFA 3K21A 1B7TZ 2PALA 4HREE 3LLEA 3I5GB 3NHTA 2CTNA 1XFRA 2Q91A 3M0WA 2L50A 3BUNB 5I2LA 1CLLA 1R6PA 3I5GC 3SG5A 2JOJA 2LMUA 1QV1A 2G2BA 3B88A 3BUWB 3EG5B 4U8DA 2CT9A 2KI6D 3VGOA 1B8LA 3CR2A 1S36A 3I5FB 3DVEA 3DVJA 2DOQA 3D10A 3FWCA 2LC5A 1H8BA 2BKIB 4GGFA 2NXQA 3I5FC 1TTXA 2H8VA 1S5GZ 2L4HA 2BAPA 2KYCA 2MA2A 4MEWA 5CSIA 1CMFA 1BG1A 1FI5A 1RWYA 1N65A 3BQ3A 3CGAA 1JWDA 2EC6C 1DJWA 4F7FA 4Q04A 1SCMB 2PYQA 4DIRA 4MZJA 3I5HC 2E6WA 3PN7B 3AKBA 3BFBA 3SG4A 3EK8A 3EVUA 1CKKA 1TUZA 1Y0VH 4PDZA 2M29A 1DC1A 3PN7C 3S0EA 3A4UB 1SL7A 2PQLA 5D3OA 2ZRTA 2JC2A 4JKTA 2ISDA 2H61A 3VRNA 1BT6A 3NSKA 1W7JB 1B8CA 2KHNA 4YI8A 2ZKMX 1UURA 1K8UA 3A8RA 3PSRA 1GM0A 4NQGA 4YRUA 2JXLA 3LK0A 1BMOA 2MJWB 1L7ZA 2O60A 2ZFDA 4AOMA 1M31A 1TOPA 1OMRA 3D0YB 4MRYA 3WHTB 1Q80A 1XFUO 2M9GA 2QEVA 1QX7A 3IF7A 2JWWA 1DGVA 1G8IA 1SMGA 1AVSA 2SCPA 1K90D 3ZWHA 3TZ1A 1A75A 2MAZA 3LL8B 4R1EA 1JFJA 2HETA 1F70A 2LANA 4AQIA 3I5IC 4DS7A 5AFPA 2KLEA 1D1OA 3LK1A 3BOWB 1M39A 4D1EA 1E8AA 1MUXA 2ZRSA 2KDHA 3VROA 4ZCVA 1B4CA 5K89A 4QJ4B 3OHMB 1SPYA 3EK7A 3IQQA 1DJHA 3FE8A 5FYXA 3TUYB 1YVHA 2FCEA 2KSPA 4WQ2A 5JOLA 3RZSA 2K2AA 3O4YA 2LLUA 3KF9A 5TNCA 3TUYC 2L2EA 3SS5A 5HLOA 1OZSA 3QRXA 2AUCA 1WRLA 2HQ8A 1DJGA 1QXPA 1DVIA 4YBHB 3O6BA 1TUJA 1DJZA 1RK9A 1SCVA 3NGVA 2KBMA 5I2OA 2NCOA 5CSJA 1ZUZA 1C7VA 1KFUL 1ZACA 1QTXA 2KI6C 1A2XA 4DCKA 4QJ3B 1XFWO 2FJUB 4OVNF 4CIDA 1QIVA 3EVRA 4GGFC 1BF5A 1F54A 1OW4A 2LP2A 5KTYA 1TRFA 3PLFB 1J7OA 1IH0A 3GK2A 2B1UA 4YGBB 1A4PA 1PALA 2K7BA 2WOSA 2IS9A 1T14A 1S6IA 2CBLA 2YGUA 3FE6A 4TNCA 1FPWA 1CM4A 1QVIZ 4C0LA 1F8HA 1OMDA 2WCFA 1CFDA 3PJIA 4INWA 2LHIA 3UNWA 1WY9A 1K94A 1DT7B 2JQ6A 1XA5A 2K61A 3D0YA 5DICA 3WXAA 5KSZA 1BU3A 2K8MB 5HKZA 1HT9A 4BY4A 1SYMA 2H61C 1DJXA 1EL4A 1UWOA 4MRXA 1YR5A 2LVIA 1PULA 1RTP1 2FOTA 2QDIA 3BOWA 3PATA 3CLNA 3V2LA 2BE4A 1U5IB 2LE9B 2LLTA 2KFGA 4CLNA 2LVKA 2LVVA 1C07A 2KGRA 2L0PA 2Y5IA 1UHHA 1YX7A 2M1UA 3SIBA 2MRDA 1QLKA 3S0GA 4OKHA 2JT3A 3F45A 4HSZA 1JC2A 1MF8B 2MLFC 2LAPA 1QS7A 1K96A 1NX1A 2KFFA 3DZTA 1OOJA 1SKTA 1FW4A 3OGNA 1FF1A 3B87A 1WRZA 3LCPC 1PSBA 2KAVA 3CR4X 3DD4A 3OX6A 5D69A 5ER4X 3BXKA 1LINA 2TN4A 1BLQA 3SG6A 2KAXA 2FJYA 3GK1A 2Y1NA 1UUSA 2HF5A 4KYNA 1XFYO 3PM8A 1S1EA 1MQ1A 1W9ZA 1NX0A 2LNKA 5FI7A 4DRWA 1Y1UA 1XFXO 4AQJA 2BKHB 3PFVA 2WC8A 2QEHA 2BL0B 1YUUA 3OP0A 1AK8A 1TNQA 1IKUA 1NCYA 1B7TY 1S6CA 5G08A 1BR1B 4NDCA 3R1PA 5FI6A 2BL0C 5J3XA 2JXCA 2Y4QA 1CFFA 2I7AA 5AEQA 5FI2A 2JPTA 4UPGA 3EKHA 4PALA 1LXFC 4WQ3A 1SCMC 2CNPA 1K93D 1NUBA 2LLSA 3FWBA 2M8UA 4PHKA 5HKYA 1Y1AA 2OPOA 3NHIA 5DKQA 1JF2A 1S5GY 3R72A 5AANA 2BECA 1XK4A 2F2OA 2AMIA 1AUIB 3EKJA 4N5XA 4YGCB 1TIZA 4GNKB 3C1VA 3VRRA 4YGAA 1U5IA 1MXEA 4PHJA 4P5OE 3HCMA 1Z4HA 3BUOB 1S26D 2JPOA 1OE9B 1IQ5A 3BFHA 1B9AA 1GGWA 4GPLB 3SS4A 2HPSA 4MLWA 4MZKA 3O2PA 1S3PA 1RROA 1NIWA 2F3YA 2AAOA 2L51A 3S0BA 4PE7A 2P71A 1BOCA 2KYFA 4FTGA 3RM1A 5HL1A 1YX8A 1FBVA 1K9UA 3OBVA 4ETOA 2PVBA 2KQYA 3BUMB 4ORCB 1M63B 1UHKA 4A4BA 2LP3A 2PSRA 2WCKA 1H4BA 1NWDA 1RECA 3S0AA 1SR6B 2F3ZA 2OTGB 2R2IA 1WDCB 2L2CA 2K7OA 5DKNA 1UHNA 1QASA 1EG3A 2A4JA 1OOIX 4ICBA 1B47A 1SR6C 2MLEC 3GK4X 2OTGC 5ER5A 1WDCC 4M2OA 3CZ1A 1ODBA 3JTDB 4CFRA 4PE1A 4JWQA 3D78A 1WLMA 2BBNA 2LM5A 3RLZA 1CFCA 1IJ6A 1ALVA 1SL8A 3KHEA 1KQVA 3CZ2A 1F4OA 4C0KA 2K0JA 4MN0A 1TNPA 2O5GA 1DJIA 1BR4B 1GJYA 1YTZC 3TDIA 1K9PA 1R2UA 1SL9A 2LUXA 1YUSA 3JVTB 1L2OB 3KO0A 3SG2A 1DQEA 1PK0D 2CCMA 1OOFA 4OR9B 2NCPA 3FIAA 1JSAA 3JVTC 1SSEB 2KFHA 1L2OC 1SY9A 1OQPA 1EXRA 2F8PA 2WCHA 1KFUS 2WCEA 3VB1A 4F0ZB 2L5YA 3NSOA 2M97A 4GUKA 2HQWA 1K9KA 3VRPA 1C7WA 1QLSA 4ORBB 1C3YA 1F71A 3D73A 4JQ0D 2WCJA 1A29A 1LKJA 1OSAA 2JU0A 2LMVA 1RFJA 1DTLA 1XYDA 1JFKA 3AAKA 3IVTA 3UO9A 1DELA 1G33A 4HRHA 3IQOA 3D75A 4GGNA 1B8RA 4C0JA 1YRUB 2M7NA 4MVFA 4YI9A 4CPVA 3D77A 3AKAA 1SNLA 1PSRA 1KQMB 3CZTX 1ZOTB 1G4YR 3D76A 1IWQA 1NX2A 1KFXL 1CFPA 1W7IB 1XK4C 2OS8B 1KQMC 3FE9A 1MHOA 1M45A 3KPXA 3PALA 3Q8IA 4HRGA 1TN4A 1KSOA 4I5LB 1DF0B 5HKWA 2OS8C 3MSEB 1BODA 4CFQA 1QVIY 1PVBA 1KSMA 2KBIA 2ERBA 2KOTA 2WCLA 3SG3A 1KFXS 5AERA 2MBXA 2G9BA 2WC5A 2VRGA 3L4LA 4XJKB 5CSFA 5JJGA 2BCBA 1AJ5A 1QIWA 4USLA 2BNXA 1DEKA 2EHBA 2WCBA 2D8NA 1J1EA 1FI6A 3KEVA 1UHJA 1IGVA 3CABA 1B1GA 1LVCD 1OOGA 2PMYA 2QPTA 3B86A 3H4SE 1GQMA 1SW8A 2JNFA 2KGBC 4PE4A 4QJ5B 1J1DA 1TWOA 3CWGA 3OX5A 4DUQA 2LCPA 2JULA 3K1EA 2LVJA 1JUOA 1MXLC 1Y6WA 1WLZA 2M7LA 2JRFA 1DMOA 2ZN8A 3TDUA 1CNPA 3R1VA 2H2KA 2I94A 2KI4B 3BJHA 1QX5B 2JZIA 3NXAA 1AHRA 3TS5B
chains in the Genus database with same CATH topology
2KI4C 4PHMA 1LA3A 2JNXA 1WRKA 1J7RA 2FCDA 2ZN9A 2M3WA 4GBAA 3TS5C 2K7DA 2PASA 2MHHA 5KU1A 1KCYA 1YURA 1QATA 4MSPA 3FS7A 1GGZA 5I2QA 2EC6B 3HX4A 1Y1XA 1JF0A 3OB1B 4PHNA 2BCXA 3I5HB 2PRUA 1KWOB 1M46A 4OV2A 1N2DA 2CXJA 1AP4A 3EK4A 4OCIA 4NDDA 1DF0A 1J55A 1XO5A 1KWOC 1DJYA 2SASA 3DF0B 5IBWA 4YGDB 1PRWA 3CR5X 4PCWA 2KAYA 4I5KA 2ZNEA 2JT8A 4XJKA 5BPJA 1XFZO 4JPZB 2L5XB 1J7PA 3CS1A 1QX2A 2I2RE 2NLNA 2BE6A 3WHUB 1PVAA 3E3RA 5B8IB 4MBEA 5DKRA 1EJ3A 2F2PA 1NCXA 1TNXA 1F55A 1IRJA 3NSLA 4BY5A 3WNXB 1HQVA 1DGUA 5F6TA 3I5IB 3VRQA 5CPVA 3TDZA 1N0YA 2COLB 1SBJA 1CM1A 1RJVA 1LA0A 2P6BB 3O78A 5GQQC 4L9MA 2NZ0A 1UP5A 2QACA 3DVKA 3JTDC 2WORA 1TNWA 3ZNIA 1AJ4A 4WRIA 2GV5A 2L98A 1EG4A 2BCAA 4ZCUA 1IG5A 2JT0A 1ZMZA 1CTRA 1K2HA 1YUTA 1VRKA 1MR8A 3AAJA 2E30A 1NPQA 1TCOB 4N1GA 1A03A 1CDPA 1V1FA 4MZLA 4I5JA 3SG7A 2LV7A 1ZFSA 2ZNDA 1F4QA 1JBAA 1YVLA 3ICBA 2JTZA 1X02A 2Q4UA 1NCZA 4FQOA 1V1GA 3OB2B 1IJ5A 5D7FA 2GGMA 4IL1A 1TCFA 1SRAA 1UHIA 2LUCA 5CSNA 1YRTB 1KK7Z 2JTTA 3DF0A 1XFVO 3GOFA 4N1FA 3DVMA 2V53A 1CLMA 2WNDA 1CDMA 2M49B 1QJTA 2Y1MA 5AXIA 4A4CA 5HYDA 1NX3A 3SJSA 4E68A 1NP8A 2K2FA 2KQ6A 4NDBA 4PE0A 1SK6D 2I18A 3EVVA 5I8NA 1IQ3A 4XYNA 4I5NB 5PALA 2F33A 1CB1A 1NYAA 3BYAA 2L4IA 1OZOA 1XVJA 4M2QA 1NSHA 4ORAB 4GAOA 2M0RA 2BBMA 2LHLA 1ALWA 1KK7Y 5HLVA 1QV0A 2KNEA 2K7CA 1CDLA 3BUXB 1KK8B 2RGIA 1K95A 2M1KB 3SIAA 3NSIA 1MWNA 1OMVA 2GGZA 1KK8C 4P2YB 1CMGA 2LMTA 4YGEB 1J7QA 4M2PA 1EH2A 1S6JA 4GFTA 1CDNA 1A75B 2EGDA 1CLBA 3CTNA 1BJFA 3K21A 1B7TZ 2PALA 4HREE 3LLEA 3I5GB 2CTNA 2Q91A 3M0WA 2L50A 3BUNB 5I2LA 1CLLA 1R6PA 3I5GC 3SG5A 2JOJA 2LMUA 1QV1A 2G2BA 3BUWB 4U8DA 2CT9A 2KI6D 3VGOA 1B8LA 3CR2A 1S36A 3I5FB 3DVEA 3DVJA 2DOQA 3D10A 3FWCA 2LC5A 1H8BA 2BKIB 4GGFA 2NXQA 3I5FC 1TTXA 1S5GZ 2L4HA 2KYCA 2MA2A 4MEWA 5CSIA 1CMFA 1BG1A 1FI5A 1RWYA 1N65A 3BQ3A 3CGAA 1JWDA 2EC6C 1DJWA 4Q04A 1SCMB 4DIRA 4MZJA 3I5HC 2E6WA 3PN7B 3AKBA 3SG4A 3EK8A 3EVUA 1CKKA 1Y0VH 4PDZA 2M29A 3PN7C 3A4UB 1SL7A 2ZRTA 2JC2A 2ISDA 2H61A 3VRNA 1BT6A 3NSKA 1W7JB 1B8CA 2KHNA 4YI8A 2ZKMX 1UURA 1K8UA 3A8RA 3PSRA 4NQGA 4YRUA 2JXLA 3LK0A 1BMOA 2MJWB 1L7ZA 2O60A 2ZFDA 4AOMA 1M31A 1TOPA 1OMRA 3D0YB 4MRYA 3WHTB 1Q80A 1XFUO 2M9GA 1QX7A 3IF7A 2JWWA 1DGVA 1G8IA 1SMGA 1AVSA 2SCPA 1K90D 3ZWHA 3TZ1A 1A75A 2MAZA 3LL8B 4R1EA 1JFJA 2HETA 1F70A 2LANA 4AQIA 3I5IC 4DS7A 5AFPA 1D1OA 3LK1A 3BOWB 1M39A 4D1EA 1E8AA 1MUXA 2ZRSA 2KDHA 3VROA 4ZCVA 1B4CA 5K89A 4QJ4B 3OHMB 1SPYA 3EK7A 3IQQA 1DJHA 5FYXA 3TUYB 1YVHA 2FCEA 2KSPA 4WQ2A 5JOLA 2K2AA 3O4YA 2LLUA 3KF9A 5TNCA 3TUYC 2L2EA 5HLOA 1OZSA 3QRXA 2AUCA 1WRLA 2HQ8A 1DJGA 1QXPA 1DVIA 4YBHB 3O6BA 1DJZA 1RK9A 1SCVA 2KBMA 5I2OA 2NCOA 5CSJA 1ZUZA 1C7VA 1KFUL 1ZACA 1QTXA 2KI6C 1A2XA 4DCKA 4QJ3B 1XFWO 2FJUB 4OVNF 4CIDA 1QIVA 3EVRA 4GGFC 1BF5A 1F54A 2LP2A 5KTYA 1TRFA 3PLFB 1J7OA 1IH0A 3GK2A 2B1UA 4YGBB 1A4PA 1PALA 2K7BA 2WOSA 2IS9A 2CBLA 1S6IA 4TNCA 1FPWA 1CM4A 1QVIZ 4C0LA 1F8HA 1OMDA 2WCFA 1CFDA 1DT7B 2LHIA 1WY9A 1K94A 2JQ6A 1XA5A 2K61A 3D0YA 3WXAA 5KSZA 1BU3A 2K8MB 5HKZA 1HT9A 4BY4A 1SYMA 2H61C 1DJXA 1EL4A 1UWOA 4MRXA 1YR5A 2LVIA 1PULA 1RTP1 2FOTA 3BOWA 3PATA 3CLNA 2BE4A 1U5IB 2LE9B 2LLTA 2KFGA 4CLNA 2LVKA 2LVVA 1C07A 2KGRA 2L0PA 2Y5IA 1UHHA 1YX7A 2M1UA 3SIBA 2MRDA 1QLKA 4OKHA 2JT3A 3F45A 4HSZA 1JC2A 1MF8B 2MLFC 2LAPA 1QS7A 1K96A 1NX1A 2KFFA 1OOJA 1SKTA 1FW4A 1FF1A 1WRZA 3LCPC 1PSBA 2KAVA 3CR4X 3DD4A 3OX6A 5D69A 5ER4X 3BXKA 1LINA 2TN4A 1BLQA 3SG6A 2KAXA 3GK1A 2Y1NA 1UUSA 2HF5A 1XFYO 3PM8A 1S1EA 1MQ1A 4DRWA 1NX0A 2LNKA 1Y1UA 1XFXO 4AQJA 2BKHB 3PFVA 2WC8A 2BL0B 1YUUA 3OP0A 1AK8A 1TNQA 1IKUA 1NCYA 1B7TY 1S6CA 5G08A 1BR1B 4NDCA 2BL0C 5J3XA 2JXCA 2Y4QA 1CFFA 2I7AA 5AEQA 2JPTA 4UPGA 3EKHA 4PALA 1LXFC 4WQ3A 1SCMC 2CNPA 1K93D 1NUBA 2LLSA 3FWBA 2M8UA 4PHKA 5HKYA 1Y1AA 2OPOA 5DKQA 1JF2A 1S5GY 5AANA 2BECA 1XK4A 2F2OA 2AMIA 1AUIB 3EKJA 4N5XA 4YGCB 1TIZA 4GNKB 3C1VA 3VRRA 4YGAA 1U5IA 1MXEA 4PHJA 4P5OE 3HCMA 3BUOB 1S26D 1OE9B 1IQ5A 1B9AA 1GGWA 4GPLB 2HPSA 4MLWA 4MZKA 3O2PA 1S3PA 1RROA 1NIWA 2F3YA 2AAOA 2L51A 4PE7A 1BOCA 2KYFA 4FTGA 3RM1A 1YX8A 1FBVA 1K9UA 4ETOA 2PVBA 2KQYA 3BUMB 4ORCB 1M63B 1UHKA 4A4BA 2LP3A 2PSRA 1H4BA 1NWDA 1RECA 1SR6B 2F3ZA 2OTGB 2R2IA 1WDCB 2K7OA 5DKNA 1UHNA 1QASA 1EG3A 2A4JA 4ICBA 5ER5A 1B47A 1SR6C 2MLEC 3GK4X 2OTGC 1WDCC 4M2OA 1ODBA 3JTDB 4CFRA 4PE1A 4JWQA 1WLMA 2BBNA 2LM5A 3RLZA 1CFCA 1IJ6A 1ALVA 1SL8A 3KHEA 1KQVA 1F4OA 4C0KA 2K0JA 4MN0A 1TNPA 2O5GA 1DJIA 1GJYA 1BR4B 1YTZC 3TDIA 1K9PA 1R2UA 1SL9A 2LUXA 1YUSA 3JVTB 1L2OB 3KO0A 3SG2A 1PK0D 2CCMA 1JSAA 4OR9B 2NCPA 3FIAA 3JVTC 2KFHA 1L2OC 1SY9A 1OQPA 1EXRA 2F8PA 1KFUS 2WCEA 4F0ZB 3NSOA 2M97A 4GUKA 2HQWA 1K9KA 3VRPA 1C7WA 1QLSA 4ORBB 1F71A 4JQ0D 1A29A 1LKJA 1OSAA 2JU0A 2LMVA 1RFJA 1DTLA 1XYDA 1JFKA 3AAKA 1G33A 4HRHA 3IQOA 4GGNA 1B8RA 4C0JA 1YRUB 2M7NA 4MVFA 4YI9A 4CPVA 3AKAA 1SNLA 1PSRA 1KQMB 3CZTX 1ZOTB 1G4YR 1IWQA 1NX2A 1KFXL 1CFPA 1W7IB 1XK4C 2OS8B 1KQMC 3PALA 1MHOA 1M45A 3KPXA 4HRGA 1TN4A 1KSOA 4I5LB 1DF0B 5HKWA 2OS8C 3MSEB 1BODA 4CFQA 1QVIY 1PVBA 1KSMA 2KBIA 2KOTA 3SG3A 1KFXS 5AERA 2MBXA 2G9BA 2VRGA 5CSFA 4XJKB 5JJGA 2BCBA 1AJ5A 1QIWA 4USLA 2WCBA 2EHBA 2D8NA 1J1EA 1FI6A 3KEVA 1UHJA 1IGVA 1B1GA 1LVCD 2PMYA 2QPTA 3H4SE 1GQMA 1SW8A 2JNFA 2KGBC 4PE4A 4QJ5B 1J1DA 3CWGA 3OX5A 4DUQA 2LCPA 2JULA 2LVJA 1JUOA 1MXLC 1Y6WA 1WLZA 2M7LA 2JRFA 1DMOA 2ZN8A 3TDUA 1CNPA 2H2KA 2I94A 2KI4B 1QX5B 2JZIA 3NXAA 1AHRA 3TS5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI4 C;  4PHM A;  1LA3 A;  2JNX A;  1WRK A;  1J7R A;  2FCD A;  2ZN9 A;  2M3W A;  4GBA A;  3TS5 C;  2K7D A;  2PAS A;  2MHH A;  5KU1 A;  1KCY A;  1YUR A;  1QAT A;  4MSP A;  3FS7 A;  1GGZ A;  5I2Q A;  2EC6 B;  3HX4 A;  1Y1X A;  1JF0 A;  3OB1 B;  4PHN A;  2BCX A;  3I5H B;  2PRU A;  1KWO B;  1M46 A;  4OV2 A;  1N2D A;  2CXJ A;  1AP4 A;  3EK4 A;  4OCI A;  4NDD A;  1DF0 A;  1J55 A;  1XO5 A;  1KWO C;  1DJY A;  2SAS A;  3DF0 B;  5IBW A;  4YGD B;  1PRW A;  3CR5 X;  4PCW A;  2KAY A;  4I5K A;  2ZNE A;  2JT8 A;  4XJK A;  5BPJ A;  1XFZ O;  4JPZ B;  2L5X B;  1J7P A;  3CS1 A;  1QX2 A;  2I2R E;  2NLN A;  2BE6 A;  3WHU B;  1PVA A;  3E3R A;  5B8I B;  4MBE A;  5DKR A;  1EJ3 A;  2F2P A;  1NCX A;  1TNX A;  1F55 A;  1IRJ A;  3NSL A;  4BY5 A;  3WNX B;  1HQV A;  1DGU A;  5F6T A;  3I5I B;  3VRQ A;  5CPV A;  3TDZ A;  1N0Y A;  2COL B;  1SBJ A;  1CM1 A;  1RJV A;  1LA0 A;  2P6B B;  3O78 A;  5GQQ C;  4L9M A;  2NZ0 A;  1UP5 A;  2QAC A;  3DVK A;  3JTD C;  2WOR A;  1TNW A;  3ZNI A;  1AJ4 A;  4WRI A;  2GV5 A;  2L98 A;  1EG4 A;  2BCA A;  4ZCU A;  1IG5 A;  2JT0 A;  1ZMZ A;  1CTR A;  1K2H A;  1YUT A;  1VRK A;  1MR8 A;  3AAJ A;  2E30 A;  1NPQ A;  1TCO B;  4N1G A;  1A03 A;  1CDP A;  1V1F A;  4MZL A;  4I5J A;  3SG7 A;  2LV7 A;  1ZFS A;  2ZND A;  1F4Q A;  1JBA A;  1YVL A;  3ICB A;  2JTZ A;  1X02 A;  2Q4U A;  1NCZ A;  4FQO A;  1V1G A;  3OB2 B;  1IJ5 A;  5D7F A;  2GGM A;  4IL1 A;  1TCF A;  1SRA A;  1UHI A;  2LUC A;  5CSN A;  1YRT B;  1KK7 Z;  2JTT A;  3DF0 A;  1XFV O;  3GOF A;  4N1F A;  3DVM A;  2V53 A;  1CLM A;  2WND A;  1CDM A;  2M49 B;  1QJT A;  2Y1M A;  5AXI A;  4A4C A;  5HYD A;  1NX3 A;  3SJS A;  4E68 A;  1NP8 A;  2K2F A;  2KQ6 A;  4NDB A;  4PE0 A;  1SK6 D;  2I18 A;  3EVV A;  5I8N A;  1IQ3 A;  4XYN A;  4I5N B;  5PAL A;  2F33 A;  1CB1 A;  1NYA A;  3BYA A;  2L4I A;  1OZO A;  1XVJ A;  4M2Q A;  1NSH A;  4ORA B;  4GAO A;  2M0R A;  2BBM A;  2LHL A;  1ALW A;  1KK7 Y;  5HLV A;  1QV0 A;  2KNE A;  2K7C A;  1CDL A;  3BUX B;  1KK8 B;  2RGI A;  1K95 A;  2M1K B;  3SIA A;  3NSI A;  1MWN A;  1OMV A;  2GGZ A;  1KK8 C;  4P2Y B;  1CMG A;  2LMT A;  4YGE B;  1J7Q A;  4M2P A;  1EH2 A;  1S6J A;  4GFT A;  1CDN A;  1A75 B;  2EGD A;  1CLB A;  3CTN A;  1BJF A;  3K21 A;  1B7T Z;  2PAL A;  4HRE E;  3LLE A;  3I5G B;  2CTN A;  2Q91 A;  3M0W A;  2L50 A;  3BUN B;  5I2L A;  1CLL A;  1R6P A;  3I5G C;  3SG5 A;  2JOJ A;  2LMU A;  1QV1 A;  2G2B A;  3BUW B;  4U8D A;  2CT9 A;  2KI6 D;  3VGO A;  1B8L A;  3CR2 A;  1S36 A;  3I5F B;  3DVE A;  3DVJ A;  2DOQ A;  3D10 A;  3FWC A;  2LC5 A;  1H8B A;  2BKI B;  4GGF A;  2NXQ A;  3I5F C;  1TTX A;  1S5G Z;  2L4H A;  2KYC A;  2MA2 A;  4MEW A;  5CSI A;  1CMF A;  1BG1 A;  1FI5 A;  1RWY A;  1N65 A;  3BQ3 A;  3CGA A;  1JWD A;  2EC6 C;  1DJW A;  4Q04 A;  1SCM B;  4DIR A;  4MZJ A;  3I5H C;  2E6W A;  3PN7 B;  3AKB A;  3SG4 A;  3EK8 A;  3EVU A;  1CKK A;  1Y0V H;  4PDZ A;  2M29 A;  3PN7 C;  3A4U B;  1SL7 A;  2ZRT A;  2JC2 A;  2ISD A;  2H61 A;  3VRN A;  1BT6 A;  3NSK A;  1W7J B;  1B8C A;  2KHN A;  4YI8 A;  2ZKM X;  1UUR A;  1K8U A;  3A8R A;  3PSR A;  4NQG A;  4YRU A;  2JXL A;  3LK0 A;  1BMO A;  2MJW B;  1L7Z A;  2O60 A;  2ZFD A;  4AOM A;  1M31 A;  1TOP A;  1OMR A;  3D0Y B;  4MRY A;  3WHT B;  1Q80 A;  1XFU O;  2M9G A;  1QX7 A;  3IF7 A;  2JWW A;  1DGV A;  1G8I A;  1SMG A;  1AVS A;  2SCP A;  1K90 D;  3ZWH A;  3TZ1 A;  1A75 A;  2MAZ A;  3LL8 B;  4R1E A;  1JFJ A;  2HET A;  1F70 A;  2LAN A;  4AQI A;  3I5I C;  4DS7 A;  5AFP A;  1D1O A;  3LK1 A;  3BOW B;  1M39 A;  4D1E A;  1E8A A;  1MUX A;  2ZRS A;  2KDH A;  3VRO A;  4ZCV A;  1B4C A;  5K89 A;  4QJ4 B;  3OHM B;  1SPY A;  3EK7 A;  3IQQ A;  1DJH A;  5FYX A;  3TUY B;  1YVH A;  2FCE A;  2KSP A;  4WQ2 A;  5JOL A;  2K2A A;  3O4Y A;  2LLU A;  3KF9 A;  5TNC A;  3TUY C;  2L2E A;  5HLO A;  1OZS A;  3QRX A;  2AUC A;  1WRL A;  2HQ8 A;  1DJG A;  1QXP A;  1DVI A;  4YBH B;  3O6B A;  1DJZ A;  1RK9 A;  1SCV A;  2KBM A;  5I2O A;  2NCO A;  5CSJ A;  1ZUZ A;  1C7V A;  1KFU L;  1ZAC A;  1QTX A;  2KI6 C;  1A2X A;  4DCK A;  4QJ3 B;  1XFW O;  2FJU B;  4OVN F;  4CID A;  1QIV A;  3EVR A;  4GGF C;  1BF5 A;  1F54 A;  2LP2 A;  5KTY A;  1TRF A;  3PLF B;  1J7O A;  1IH0 A;  3GK2 A;  2B1U A;  4YGB B;  1A4P A;  1PAL A;  2K7B A;  2WOS A;  2IS9 A;  2CBL A;  1S6I A;  4TNC A;  1FPW A;  1CM4 A;  1QVI Z;  4C0L A;  1F8H A;  1OMD A;  2WCF A;  1CFD A;  1DT7 B;  2LHI A;  1WY9 A;  1K94 A;  2JQ6 A;  1XA5 A;  2K61 A;  3D0Y A;  3WXA A;  5KSZ A;  1BU3 A;  2K8M B;  5HKZ A;  1HT9 A;  4BY4 A;  1SYM A;  2H61 C;  1DJX A;  1EL4 A;  1UWO A;  4MRX A;  1YR5 A;  2LVI A;  1PUL A;  1RTP 1;  2FOT A;  3BOW A;  3PAT A;  3CLN A;  2BE4 A;  1U5I B;  2LE9 B;  2LLT A;  2KFG A;  4CLN A;  2LVK A;  2LVV A;  1C07 A;  2KGR A;  2L0P A;  2Y5I A;  1UHH A;  1YX7 A;  2M1U A;  3SIB A;  2MRD A;  1QLK A;  4OKH A;  2JT3 A;  3F45 A;  4HSZ A;  1JC2 A;  1MF8 B;  2MLF C;  2LAP A;  1QS7 A;  1K96 A;  1NX1 A;  2KFF A;  1OOJ A;  1SKT A;  1FW4 A;  1FF1 A;  1WRZ A;  3LCP C;  1PSB A;  2KAV A;  3CR4 X;  3DD4 A;  3OX6 A;  5D69 A;  5ER4 X;  3BXK A;  1LIN A;  2TN4 A;  1BLQ A;  3SG6 A;  2KAX A;  3GK1 A;  2Y1N A;  1UUS A;  2HF5 A;  1XFY O;  3PM8 A;  1S1E A;  1MQ1 A;  4DRW A;  1NX0 A;  2LNK A;  1Y1U A;  1XFX O;  4AQJ A;  2BKH B;  3PFV A;  2WC8 A;  2BL0 B;  1YUU A;  3OP0 A;  1AK8 A;  1TNQ A;  1IKU A;  1NCY A;  1B7T Y;  1S6C A;  5G08 A;  1BR1 B;  4NDC A;  2BL0 C;  5J3X A;  2JXC A;  2Y4Q A;  1CFF A;  2I7A A;  5AEQ A;  2JPT A;  4UPG A;  3EKH A;  4PAL A;  1LXF C;  4WQ3 A;  1SCM C;  2CNP A;  1K93 D;  1NUB A;  2LLS A;  3FWB A;  2M8U A;  4PHK A;  5HKY A;  1Y1A A;  2OPO A;  5DKQ A;  1JF2 A;  1S5G Y;  5AAN A;  2BEC A;  1XK4 A;  2F2O A;  2AMI A;  1AUI B;  3EKJ A;  4N5X A;  4YGC B;  1TIZ A;  4GNK B;  3C1V A;  3VRR A;  4YGA A;  1U5I A;  1MXE A;  4PHJ A;  4P5O E;  3HCM A;  3BUO B;  1S26 D;  1OE9 B;  1IQ5 A;  1B9A A;  1GGW A;  4GPL B;  2HPS A;  4MLW A;  4MZK A;  3O2P A;  1S3P A;  1RRO A;  1NIW A;  2F3Y A;  2AAO A;  2L51 A;  4PE7 A;  1BOC A;  2KYF A;  4FTG A;  3RM1 A;  1YX8 A;  1FBV A;  1K9U A;  4ETO A;  2PVB A;  2KQY A;  3BUM B;  4ORC B;  1M63 B;  1UHK A;  4A4B A;  2LP3 A;  2PSR A;  1H4B A;  1NWD A;  1REC A;  1SR6 B;  2F3Z A;  2OTG B;  2R2I A;  1WDC B;  2K7O A;  5DKN A;  1UHN A;  1QAS A;  1EG3 A;  2A4J A;  4ICB A;  5ER5 A;  1B47 A;  1SR6 C;  2MLE C;  3GK4 X;  2OTG C;  1WDC C;  4M2O A;  1ODB A;  3JTD B;  4CFR A;  4PE1 A;  4JWQ A;  1WLM A;  2BBN A;  2LM5 A;  3RLZ A;  1CFC A;  1IJ6 A;  1ALV A;  1SL8 A;  3KHE A;  1KQV A;  1F4O A;  4C0K A;  2K0J A;  4MN0 A;  1TNP A;  2O5G A;  1DJI A;  1GJY A;  1BR4 B;  1YTZ C;  3TDI A;  1K9P A;  1R2U A;  1SL9 A;  2LUX A;  1YUS A;  3JVT B;  1L2O B;  3KO0 A;  3SG2 A;  1PK0 D;  2CCM A;  1JSA A;  4OR9 B;  2NCP A;  3FIA A;  3JVT C;  2KFH A;  1L2O C;  1SY9 A;  1OQP A;  1EXR A;  2F8P A;  1KFU S;  2WCE A;  4F0Z B;  3NSO A;  2M97 A;  4GUK A;  2HQW A;  1K9K A;  3VRP A;  1C7W A;  1QLS A;  4ORB B;  1F71 A;  4JQ0 D;  1A29 A;  1LKJ A;  1OSA A;  2JU0 A;  2LMV A;  1RFJ A;  1DTL A;  1XYD A;  1JFK A;  3AAK A;  1G33 A;  4HRH A;  3IQO A;  4GGN A;  1B8R A;  4C0J A;  1YRU B;  2M7N A;  4MVF A;  4YI9 A;  4CPV A;  3AKA A;  1SNL A;  1PSR A;  1KQM B;  3CZT X;  1ZOT B;  1G4Y R;  1IWQ A;  1NX2 A;  1KFX L;  1CFP A;  1W7I B;  1XK4 C;  2OS8 B;  1KQM C;  3PAL A;  1MHO A;  1M45 A;  3KPX A;  4HRG A;  1TN4 A;  1KSO A;  4I5L B;  1DF0 B;  5HKW A;  2OS8 C;  3MSE B;  1BOD A;  4CFQ A;  1QVI Y;  1PVB A;  1KSM A;  2KBI A;  2KOT A;  3SG3 A;  1KFX S;  5AER A;  2MBX A;  2G9B A;  2VRG A;  5CSF A;  4XJK B;  5JJG A;  2BCB A;  1AJ5 A;  1QIW A;  4USL A;  2WCB A;  2EHB A;  2D8N A;  1J1E A;  1FI6 A;  3KEV A;  1UHJ A;  1IGV A;  1B1G A;  1LVC D;  2PMY A;  2QPT A;  3H4S E;  1GQM A;  1SW8 A;  2JNF A;  2KGB C;  4PE4 A;  4QJ5 B;  1J1D A;  3CWG A;  3OX5 A;  4DUQ A;  2LCP A;  2JUL A;  2LVJ A;  1JUO A;  1MXL C;  1Y6W A;  1WLZ A;  2M7L A;  2JRF A;  1DMO A;  2ZN8 A;  3TDU A;  1CNP A;  2H2K A;  2I94 A;  2KI4 B;  1QX5 B;  2JZI A;  3NXA A;  1AHR A;  3TS5 B; 
#chains in the Genus database with same CATH topology
 2KI4 C;  3CZ0 A;  4PHM A;  1LA3 A;  2JNX A;  1WRK A;  1J7R A;  1P28 A;  2FCD A;  2K60 A;  2ZN9 A;  2M3W A;  4GBA A;  3TS5 C;  2K7D A;  2PAS A;  2MHH A;  5KU1 A;  1KCY A;  1YUR A;  1QAT A;  4MSP A;  3FS7 A;  1GGZ A;  1ORG A;  5I2Q A;  2EC6 B;  1OOH A;  3HX4 A;  1Y1X A;  1JF0 A;  1Z2C B;  3OB1 B;  4PHN A;  2BCX A;  2P70 A;  3I5H B;  4FQT A;  2PRU A;  1KWO B;  1M46 A;  3CYZ A;  4OV2 A;  1N2D A;  2CXJ A;  1AP4 A;  3EK4 A;  4OCI A;  4NDD A;  4OZD A;  1DF0 A;  1J55 A;  1XO5 A;  3L47 A;  1KWO C;  2QEO A;  3R1O A;  1DJY A;  2SAS A;  3DF0 B;  5IBW A;  5I94 A;  4YGD B;  1PRW A;  3CR5 X;  4PCW A;  2KAY A;  4I5K A;  2ZNE A;  2JT8 A;  4XJK A;  5BPJ A;  3BFA A;  1IIO A;  2KPH A;  1XFZ O;  4JPZ B;  2L5X B;  1J7P A;  3CS1 A;  1QX2 A;  2I2R E;  2NLN A;  1C3Z A;  2BE6 A;  1PVA A;  3E3R A;  3WHU B;  5B8I B;  4MBE A;  5DKR A;  1EJ3 A;  2F2P A;  1NCX A;  2KLD A;  1TNX A;  1F55 A;  1IRJ A;  3NSL A;  4BY5 A;  3WNX B;  1HQV A;  1DGU A;  5F6T A;  3I5I B;  3VRQ A;  5CPV A;  3TDZ A;  1N0Y A;  2COL B;  1SBJ A;  4JD9 A;  1CM1 A;  1RJV A;  1LA0 A;  2P6B B;  3O78 A;  5GQQ C;  4L9M A;  2NZ0 A;  1UP5 A;  2QAC A;  3B7A A;  3DVK A;  3JTD C;  2WOR A;  1TNW A;  3ZNI A;  1AJ4 A;  4WRI A;  2GV5 A;  2L98 A;  1EG4 A;  2BCA A;  4ZCU A;  1IG5 A;  2JT0 A;  1ZMZ A;  1CTR A;  3D74 A;  1K2H A;  1YUT A;  1VRK A;  1MR8 A;  3AAJ A;  2E30 A;  1NPQ A;  1TCO B;  3PM2 A;  4N1G A;  1A03 A;  1CDP A;  1V1F A;  4MZL A;  4I5J A;  3SG7 A;  2LV7 A;  1ZFS A;  2ZND A;  1F4Q A;  3S0F A;  1YVL A;  1JBA A;  3DY9 A;  3ICB A;  2JTZ A;  2WC6 A;  1X02 A;  2Q4U A;  1NCZ A;  2GTE A;  3DYE A;  4FQO A;  1V1G A;  3OB2 B;  1IJ5 A;  5D7F A;  2GGM A;  4IL1 A;  4IJ7 A;  1TCF A;  1SRA A;  1LS8 A;  1UHI A;  2LUC A;  5CSN A;  1YRT B;  1KK7 Z;  4INX A;  2JTT A;  3N7H A;  1QWV A;  3DF0 A;  1XFV O;  3DXL A;  3GOF A;  3CDN A;  4N1F A;  3DVM A;  2V53 A;  1CLM A;  2WND A;  3O4X A;  1CDM A;  2M49 B;  1QJT A;  2Y1M A;  3QME A;  5AXI A;  4A4C A;  2WCM A;  1NX3 A;  5HYD A;  3SJS A;  4E68 A;  1NP8 A;  2K2F A;  2KQ6 A;  4NDB A;  4PE0 A;  1SK6 D;  2I18 A;  3EVV A;  5I8N A;  1IQ3 A;  4XYN A;  4I5N B;  5PAL A;  2F33 A;  1CB1 A;  1NYA A;  3BYA A;  2L4I A;  1OZO A;  1XVJ A;  4M2Q A;  1NSH A;  4ORA B;  4GAO A;  2M0R A;  2BBM A;  2LHL A;  1ALW A;  1KK7 Y;  5HLV A;  3L4A A;  1QV0 A;  2KNE A;  2K7C A;  1CDL A;  3BUX B;  1KK8 B;  2RGI A;  1K95 A;  2M1K B;  5EL2 A;  3SS3 A;  3SIA A;  3NSI A;  1MWN A;  1OMV A;  2GGZ A;  1KK8 C;  4P2Y B;  1CMG A;  2LMT A;  4YGE B;  1J7Q A;  4M2P A;  1EH2 A;  1S6J A;  3B6X A;  4GFT A;  1CDN A;  4PT1 A;  1A75 B;  3S0D A;  2QEB A;  2EGD A;  1CLB A;  3CTN A;  1BJF A;  3K21 A;  1B7T Z;  2PAL A;  4HRE E;  3LLE A;  3I5G B;  3NHT A;  2CTN A;  1XFR A;  2Q91 A;  3M0W A;  2L50 A;  3BUN B;  5I2L A;  1CLL A;  1R6P A;  3I5G C;  3SG5 A;  2JOJ A;  2LMU A;  1QV1 A;  2G2B A;  3B88 A;  3BUW B;  3EG5 B;  4U8D A;  2CT9 A;  2KI6 D;  3VGO A;  1B8L A;  3CR2 A;  1S36 A;  3I5F B;  3DVE A;  3DVJ A;  2DOQ A;  3D10 A;  3FWC A;  2LC5 A;  1H8B A;  2BKI B;  4GGF A;  2NXQ A;  3I5F C;  1TTX A;  2H8V A;  1S5G Z;  2L4H A;  2BAP A;  2KYC A;  2MA2 A;  4MEW A;  5CSI A;  1CMF A;  1BG1 A;  1FI5 A;  1RWY A;  1N65 A;  3BQ3 A;  3CGA A;  1JWD A;  2EC6 C;  1DJW A;  4F7F A;  4Q04 A;  1SCM B;  2PYQ A;  4DIR A;  4MZJ A;  3I5H C;  2E6W A;  3PN7 B;  3AKB A;  3BFB A;  3SG4 A;  3EK8 A;  3EVU A;  1CKK A;  1TUZ A;  1Y0V H;  4PDZ A;  2M29 A;  1DC1 A;  3PN7 C;  3S0E A;  3A4U B;  1SL7 A;  2PQL A;  5D3O A;  2ZRT A;  2JC2 A;  4JKT A;  2ISD A;  2H61 A;  3VRN A;  1BT6 A;  3NSK A;  1W7J B;  1B8C A;  2KHN A;  4YI8 A;  2ZKM X;  1UUR A;  1K8U A;  3A8R A;  3PSR A;  1GM0 A;  4NQG A;  4YRU A;  2JXL A;  3LK0 A;  1BMO A;  2MJW B;  1L7Z A;  2O60 A;  2ZFD A;  4AOM A;  1M31 A;  1TOP A;  1OMR A;  3D0Y B;  4MRY A;  3WHT B;  1Q80 A;  1XFU O;  2M9G A;  2QEV A;  1QX7 A;  3IF7 A;  2JWW A;  1DGV A;  1G8I A;  1SMG A;  1AVS A;  2SCP A;  1K90 D;  3ZWH A;  3TZ1 A;  1A75 A;  2MAZ A;  3LL8 B;  4R1E A;  1JFJ A;  2HET A;  1F70 A;  2LAN A;  4AQI A;  3I5I C;  4DS7 A;  5AFP A;  2KLE A;  1D1O A;  3LK1 A;  3BOW B;  1M39 A;  4D1E A;  1E8A A;  1MUX A;  2ZRS A;  2KDH A;  3VRO A;  4ZCV A;  1B4C A;  5K89 A;  4QJ4 B;  3OHM B;  1SPY A;  3EK7 A;  3IQQ A;  1DJH A;  3FE8 A;  5FYX A;  3TUY B;  1YVH A;  2FCE A;  2KSP A;  4WQ2 A;  5JOL A;  3RZS A;  2K2A A;  3O4Y A;  2LLU A;  3KF9 A;  5TNC A;  3TUY C;  2L2E A;  3SS5 A;  5HLO A;  1OZS A;  3QRX A;  2AUC A;  1WRL A;  2HQ8 A;  1DJG A;  1QXP A;  1DVI A;  4YBH B;  3O6B A;  1TUJ A;  1DJZ A;  1RK9 A;  1SCV A;  3NGV A;  2KBM A;  5I2O A;  2NCO A;  5CSJ A;  1ZUZ A;  1C7V A;  1KFU L;  1ZAC A;  1QTX A;  2KI6 C;  1A2X A;  4DCK A;  4QJ3 B;  1XFW O;  2FJU B;  4OVN F;  4CID A;  1QIV A;  3EVR A;  4GGF C;  1BF5 A;  1F54 A;  1OW4 A;  2LP2 A;  5KTY A;  1TRF A;  3PLF B;  1J7O A;  1IH0 A;  3GK2 A;  2B1U A;  4YGB B;  1A4P A;  1PAL A;  2K7B A;  2WOS A;  2IS9 A;  1T14 A;  1S6I A;  2CBL A;  2YGU A;  3FE6 A;  4TNC A;  1FPW A;  1CM4 A;  1QVI Z;  4C0L A;  1F8H A;  1OMD A;  2WCF A;  1CFD A;  3PJI A;  4INW A;  2LHI A;  3UNW A;  1WY9 A;  1K94 A;  1DT7 B;  2JQ6 A;  1XA5 A;  2K61 A;  3D0Y A;  5DIC A;  3WXA A;  5KSZ A;  1BU3 A;  2K8M B;  5HKZ A;  1HT9 A;  4BY4 A;  1SYM A;  2H61 C;  1DJX A;  1EL4 A;  1UWO A;  4MRX A;  1YR5 A;  2LVI A;  1PUL A;  1RTP 1;  2FOT A;  2QDI A;  3BOW A;  3PAT A;  3CLN A;  3V2L A;  2BE4 A;  1U5I B;  2LE9 B;  2LLT A;  2KFG A;  4CLN A;  2LVK A;  2LVV A;  1C07 A;  2KGR A;  2L0P A;  2Y5I A;  1UHH A;  1YX7 A;  2M1U A;  3SIB A;  2MRD A;  1QLK A;  3S0G A;  4OKH A;  2JT3 A;  3F45 A;  4HSZ A;  1JC2 A;  1MF8 B;  2MLF C;  2LAP A;  1QS7 A;  1K96 A;  1NX1 A;  2KFF A;  3DZT A;  1OOJ A;  1SKT A;  1FW4 A;  3OGN A;  1FF1 A;  3B87 A;  1WRZ A;  3LCP C;  1PSB A;  2KAV A;  3CR4 X;  3DD4 A;  3OX6 A;  5D69 A;  5ER4 X;  3BXK A;  1LIN A;  2TN4 A;  1BLQ A;  3SG6 A;  2KAX A;  2FJY A;  3GK1 A;  2Y1N A;  1UUS A;  2HF5 A;  4KYN A;  1XFY O;  3PM8 A;  1S1E A;  1MQ1 A;  1W9Z A;  1NX0 A;  2LNK A;  5FI7 A;  4DRW A;  1Y1U A;  1XFX O;  4AQJ A;  2BKH B;  3PFV A;  2WC8 A;  2QEH A;  2BL0 B;  1YUU A;  3OP0 A;  1AK8 A;  1TNQ A;  1IKU A;  1NCY A;  1B7T Y;  1S6C A;  5G08 A;  1BR1 B;  4NDC A;  3R1P A;  5FI6 A;  2BL0 C;  5J3X A;  2JXC A;  2Y4Q A;  1CFF A;  2I7A A;  5AEQ A;  5FI2 A;  2JPT A;  4UPG A;  3EKH A;  4PAL A;  1LXF C;  4WQ3 A;  1SCM C;  2CNP A;  1K93 D;  1NUB A;  2LLS A;  3FWB A;  2M8U A;  4PHK A;  5HKY A;  1Y1A A;  2OPO A;  3NHI A;  5DKQ A;  1JF2 A;  1S5G Y;  3R72 A;  5AAN A;  2BEC A;  1XK4 A;  2F2O A;  2AMI A;  1AUI B;  3EKJ A;  4N5X A;  4YGC B;  1TIZ A;  4GNK B;  3C1V A;  3VRR A;  4YGA A;  1U5I A;  1MXE A;  4PHJ A;  4P5O E;  3HCM A;  1Z4H A;  3BUO B;  1S26 D;  2JPO A;  1OE9 B;  1IQ5 A;  3BFH A;  1B9A A;  1GGW A;  4GPL B;  3SS4 A;  2HPS A;  4MLW A;  4MZK A;  3O2P A;  1S3P A;  1RRO A;  1NIW A;  2F3Y A;  2AAO A;  2L51 A;  3S0B A;  4PE7 A;  2P71 A;  1BOC A;  2KYF A;  4FTG A;  3RM1 A;  5HL1 A;  1YX8 A;  1FBV A;  1K9U A;  3OBV A;  4ETO A;  2PVB A;  2KQY A;  3BUM B;  4ORC B;  1M63 B;  1UHK A;  4A4B A;  2LP3 A;  2PSR A;  2WCK A;  1H4B A;  1NWD A;  1REC A;  3S0A A;  1SR6 B;  2F3Z A;  2OTG B;  2R2I A;  1WDC B;  2L2C A;  2K7O A;  5DKN A;  1UHN A;  1QAS A;  1EG3 A;  2A4J A;  1OOI X;  4ICB A;  1B47 A;  1SR6 C;  2MLE C;  3GK4 X;  2OTG C;  5ER5 A;  1WDC C;  4M2O A;  3CZ1 A;  1ODB A;  3JTD B;  4CFR A;  4PE1 A;  4JWQ A;  3D78 A;  1WLM A;  2BBN A;  2LM5 A;  3RLZ A;  1CFC A;  1IJ6 A;  1ALV A;  1SL8 A;  3KHE A;  1KQV A;  3CZ2 A;  1F4O A;  4C0K A;  2K0J A;  4MN0 A;  1TNP A;  2O5G A;  1DJI A;  1BR4 B;  1GJY A;  1YTZ C;  3TDI A;  1K9P A;  1R2U A;  1SL9 A;  2LUX A;  1YUS A;  3JVT B;  1L2O B;  3KO0 A;  3SG2 A;  1DQE A;  1PK0 D;  2CCM A;  1OOF A;  4OR9 B;  2NCP A;  3FIA A;  1JSA A;  3JVT C;  1SSE B;  2KFH A;  1L2O C;  1SY9 A;  1OQP A;  1EXR A;  2F8P A;  2WCH A;  1KFU S;  2WCE A;  3VB1 A;  4F0Z B;  2L5Y A;  3NSO A;  2M97 A;  4GUK A;  2HQW A;  1K9K A;  3VRP A;  1C7W A;  1QLS A;  4ORB B;  1C3Y A;  1F71 A;  3D73 A;  4JQ0 D;  2WCJ A;  1A29 A;  1LKJ A;  1OSA A;  2JU0 A;  2LMV A;  1RFJ A;  1DTL A;  1XYD A;  1JFK A;  3AAK A;  3IVT A;  3UO9 A;  1DEL A;  1G33 A;  4HRH A;  3IQO A;  3D75 A;  4GGN A;  1B8R A;  4C0J A;  1YRU B;  2M7N A;  4MVF A;  4YI9 A;  4CPV A;  3D77 A;  3AKA A;  1SNL A;  1PSR A;  1KQM B;  3CZT X;  1ZOT B;  1G4Y R;  3D76 A;  1IWQ A;  1NX2 A;  1KFX L;  1CFP A;  1W7I B;  1XK4 C;  2OS8 B;  1KQM C;  3FE9 A;  1MHO A;  1M45 A;  3KPX A;  3PAL A;  3Q8I A;  4HRG A;  1TN4 A;  1KSO A;  4I5L B;  1DF0 B;  5HKW A;  2OS8 C;  3MSE B;  1BOD A;  4CFQ A;  1QVI Y;  1PVB A;  1KSM A;  2KBI A;  2ERB A;  2KOT A;  2WCL A;  3SG3 A;  1KFX S;  5AER A;  2MBX A;  2G9B A;  2WC5 A;  2VRG A;  3L4L A;  4XJK B;  5CSF A;  5JJG A;  2BCB A;  1AJ5 A;  1QIW A;  4USL A;  2BNX A;  1DEK A;  2EHB A;  2WCB A;  2D8N A;  1J1E A;  1FI6 A;  3KEV A;  1UHJ A;  1IGV A;  3CAB A;  1B1G A;  1LVC D;  1OOG A;  2PMY A;  2QPT A;  3B86 A;  3H4S E;  1GQM A;  1SW8 A;  2JNF A;  2KGB C;  4PE4 A;  4QJ5 B;  1J1D A;  1TWO A;  3CWG A;  3OX5 A;  4DUQ A;  2LCP A;  2JUL A;  3K1E A;  2LVJ A;  1JUO A;  1MXL C;  1Y6W A;  1WLZ A;  2M7L A;  2JRF A;  1DMO A;  2ZN8 A;  3TDU A;  1CNP A;  3R1V A;  2H2K A;  2I94 A;  2KI4 B;  3BJH A;  1QX5 B;  2JZI A;  3NXA A;  1AHR A;  3TS5 B; 
#chains in the Genus database with same CATH homology
 2KI4 C;  4PHM A;  1LA3 A;  2JNX A;  1WRK A;  1J7R A;  2FCD A;  2ZN9 A;  2M3W A;  4GBA A;  3TS5 C;  2K7D A;  2PAS A;  2MHH A;  5KU1 A;  1KCY A;  1YUR A;  1QAT A;  4MSP A;  3FS7 A;  1GGZ A;  5I2Q A;  2EC6 B;  3HX4 A;  1Y1X A;  1JF0 A;  3OB1 B;  4PHN A;  2BCX A;  3I5H B;  2PRU A;  1KWO B;  1M46 A;  4OV2 A;  1N2D A;  2CXJ A;  1AP4 A;  3EK4 A;  4OCI A;  4NDD A;  1DF0 A;  1J55 A;  1XO5 A;  1KWO C;  1DJY A;  2SAS A;  3DF0 B;  5IBW A;  4YGD B;  1PRW A;  3CR5 X;  4PCW A;  2KAY A;  4I5K A;  2ZNE A;  2JT8 A;  4XJK A;  5BPJ A;  1XFZ O;  4JPZ B;  2L5X B;  1J7P A;  3CS1 A;  1QX2 A;  2I2R E;  2NLN A;  2BE6 A;  3WHU B;  1PVA A;  3E3R A;  5B8I B;  4MBE A;  5DKR A;  1EJ3 A;  2F2P A;  1NCX A;  1TNX A;  1F55 A;  1IRJ A;  3NSL A;  4BY5 A;  3WNX B;  1HQV A;  1DGU A;  5F6T A;  3I5I B;  3VRQ A;  5CPV A;  3TDZ A;  1N0Y A;  2COL B;  1SBJ A;  1CM1 A;  1RJV A;  1LA0 A;  2P6B B;  3O78 A;  5GQQ C;  4L9M A;  2NZ0 A;  1UP5 A;  2QAC A;  3DVK A;  3JTD C;  2WOR A;  1TNW A;  3ZNI A;  1AJ4 A;  4WRI A;  2GV5 A;  2L98 A;  1EG4 A;  2BCA A;  4ZCU A;  1IG5 A;  2JT0 A;  1ZMZ A;  1CTR A;  1K2H A;  1YUT A;  1VRK A;  1MR8 A;  3AAJ A;  2E30 A;  1NPQ A;  1TCO B;  4N1G A;  1A03 A;  1CDP A;  1V1F A;  4MZL A;  4I5J A;  3SG7 A;  2LV7 A;  1ZFS A;  2ZND A;  1F4Q A;  1JBA A;  1YVL A;  3ICB A;  2JTZ A;  1X02 A;  2Q4U A;  1NCZ A;  4FQO A;  1V1G A;  3OB2 B;  1IJ5 A;  5D7F A;  2GGM A;  4IL1 A;  1TCF A;  1SRA A;  1UHI A;  2LUC A;  5CSN A;  1YRT B;  1KK7 Z;  2JTT A;  3DF0 A;  1XFV O;  3GOF A;  4N1F A;  3DVM A;  2V53 A;  1CLM A;  2WND A;  1CDM A;  2M49 B;  1QJT A;  2Y1M A;  5AXI A;  4A4C A;  5HYD A;  1NX3 A;  3SJS A;  4E68 A;  1NP8 A;  2K2F A;  2KQ6 A;  4NDB A;  4PE0 A;  1SK6 D;  2I18 A;  3EVV A;  5I8N A;  1IQ3 A;  4XYN A;  4I5N B;  5PAL A;  2F33 A;  1CB1 A;  1NYA A;  3BYA A;  2L4I A;  1OZO A;  1XVJ A;  4M2Q A;  1NSH A;  4ORA B;  4GAO A;  2M0R A;  2BBM A;  2LHL A;  1ALW A;  1KK7 Y;  5HLV A;  1QV0 A;  2KNE A;  2K7C A;  1CDL A;  3BUX B;  1KK8 B;  2RGI A;  1K95 A;  2M1K B;  3SIA A;  3NSI A;  1MWN A;  1OMV A;  2GGZ A;  1KK8 C;  4P2Y B;  1CMG A;  2LMT A;  4YGE B;  1J7Q A;  4M2P A;  1EH2 A;  1S6J A;  4GFT A;  1CDN A;  1A75 B;  2EGD A;  1CLB A;  3CTN A;  1BJF A;  3K21 A;  1B7T Z;  2PAL A;  4HRE E;  3LLE A;  3I5G B;  2CTN A;  2Q91 A;  3M0W A;  2L50 A;  3BUN B;  5I2L A;  1CLL A;  1R6P A;  3I5G C;  3SG5 A;  2JOJ A;  2LMU A;  1QV1 A;  2G2B A;  3BUW B;  4U8D A;  2CT9 A;  2KI6 D;  3VGO A;  1B8L A;  3CR2 A;  1S36 A;  3I5F B;  3DVE A;  3DVJ A;  2DOQ A;  3D10 A;  3FWC A;  2LC5 A;  1H8B A;  2BKI B;  4GGF A;  2NXQ A;  3I5F C;  1TTX A;  1S5G Z;  2L4H A;  2KYC A;  2MA2 A;  4MEW A;  5CSI A;  1CMF A;  1BG1 A;  1FI5 A;  1RWY A;  1N65 A;  3BQ3 A;  3CGA A;  1JWD A;  2EC6 C;  1DJW A;  4Q04 A;  1SCM B;  4DIR A;  4MZJ A;  3I5H C;  2E6W A;  3PN7 B;  3AKB A;  3SG4 A;  3EK8 A;  3EVU A;  1CKK A;  1Y0V H;  4PDZ A;  2M29 A;  3PN7 C;  3A4U B;  1SL7 A;  2ZRT A;  2JC2 A;  2ISD A;  2H61 A;  3VRN A;  1BT6 A;  3NSK A;  1W7J B;  1B8C A;  2KHN A;  4YI8 A;  2ZKM X;  1UUR A;  1K8U A;  3A8R A;  3PSR A;  4NQG A;  4YRU A;  2JXL A;  3LK0 A;  1BMO A;  2MJW B;  1L7Z A;  2O60 A;  2ZFD A;  4AOM A;  1M31 A;  1TOP A;  1OMR A;  3D0Y B;  4MRY A;  3WHT B;  1Q80 A;  1XFU O;  2M9G A;  1QX7 A;  3IF7 A;  2JWW A;  1DGV A;  1G8I A;  1SMG A;  1AVS A;  2SCP A;  1K90 D;  3ZWH A;  3TZ1 A;  1A75 A;  2MAZ A;  3LL8 B;  4R1E A;  1JFJ A;  2HET A;  1F70 A;  2LAN A;  4AQI A;  3I5I C;  4DS7 A;  5AFP A;  1D1O A;  3LK1 A;  3BOW B;  1M39 A;  4D1E A;  1E8A A;  1MUX A;  2ZRS A;  2KDH A;  3VRO A;  4ZCV A;  1B4C A;  5K89 A;  4QJ4 B;  3OHM B;  1SPY A;  3EK7 A;  3IQQ A;  1DJH A;  5FYX A;  3TUY B;  1YVH A;  2FCE A;  2KSP A;  4WQ2 A;  5JOL A;  2K2A A;  3O4Y A;  2LLU A;  3KF9 A;  5TNC A;  3TUY C;  2L2E A;  5HLO A;  1OZS A;  3QRX A;  2AUC A;  1WRL A;  2HQ8 A;  1DJG A;  1QXP A;  1DVI A;  4YBH B;  3O6B A;  1DJZ A;  1RK9 A;  1SCV A;  2KBM A;  5I2O A;  2NCO A;  5CSJ A;  1ZUZ A;  1C7V A;  1KFU L;  1ZAC A;  1QTX A;  2KI6 C;  1A2X A;  4DCK A;  4QJ3 B;  1XFW O;  2FJU B;  4OVN F;  4CID A;  1QIV A;  3EVR A;  4GGF C;  1BF5 A;  1F54 A;  2LP2 A;  5KTY A;  1TRF A;  3PLF B;  1J7O A;  1IH0 A;  3GK2 A;  2B1U A;  4YGB B;  1A4P A;  1PAL A;  2K7B A;  2WOS A;  2IS9 A;  2CBL A;  1S6I A;  4TNC A;  1FPW A;  1CM4 A;  1QVI Z;  4C0L A;  1F8H A;  1OMD A;  2WCF A;  1CFD A;  1DT7 B;  2LHI A;  1WY9 A;  1K94 A;  2JQ6 A;  1XA5 A;  2K61 A;  3D0Y A;  3WXA A;  5KSZ A;  1BU3 A;  2K8M B;  5HKZ A;  1HT9 A;  4BY4 A;  1SYM A;  2H61 C;  1DJX A;  1EL4 A;  1UWO A;  4MRX A;  1YR5 A;  2LVI A;  1PUL A;  1RTP 1;  2FOT A;  3BOW A;  3PAT A;  3CLN A;  2BE4 A;  1U5I B;  2LE9 B;  2LLT A;  2KFG A;  4CLN A;  2LVK A;  2LVV A;  1C07 A;  2KGR A;  2L0P A;  2Y5I A;  1UHH A;  1YX7 A;  2M1U A;  3SIB A;  2MRD A;  1QLK A;  4OKH A;  2JT3 A;  3F45 A;  4HSZ A;  1JC2 A;  1MF8 B;  2MLF C;  2LAP A;  1QS7 A;  1K96 A;  1NX1 A;  2KFF A;  1OOJ A;  1SKT A;  1FW4 A;  1FF1 A;  1WRZ A;  3LCP C;  1PSB A;  2KAV A;  3CR4 X;  3DD4 A;  3OX6 A;  5D69 A;  5ER4 X;  3BXK A;  1LIN A;  2TN4 A;  1BLQ A;  3SG6 A;  2KAX A;  3GK1 A;  2Y1N A;  1UUS A;  2HF5 A;  1XFY O;  3PM8 A;  1S1E A;  1MQ1 A;  4DRW A;  1NX0 A;  2LNK A;  1Y1U A;  1XFX O;  4AQJ A;  2BKH B;  3PFV A;  2WC8 A;  2BL0 B;  1YUU A;  3OP0 A;  1AK8 A;  1TNQ A;  1IKU A;  1NCY A;  1B7T Y;  1S6C A;  5G08 A;  1BR1 B;  4NDC A;  2BL0 C;  5J3X A;  2JXC A;  2Y4Q A;  1CFF A;  2I7A A;  5AEQ A;  2JPT A;  4UPG A;  3EKH A;  4PAL A;  1LXF C;  4WQ3 A;  1SCM C;  2CNP A;  1K93 D;  1NUB A;  2LLS A;  3FWB A;  2M8U A;  4PHK A;  5HKY A;  1Y1A A;  2OPO A;  5DKQ A;  1JF2 A;  1S5G Y;  5AAN A;  2BEC A;  1XK4 A;  2F2O A;  2AMI A;  1AUI B;  3EKJ A;  4N5X A;  4YGC B;  1TIZ A;  4GNK B;  3C1V A;  3VRR A;  4YGA A;  1U5I A;  1MXE A;  4PHJ A;  4P5O E;  3HCM A;  3BUO B;  1S26 D;  1OE9 B;  1IQ5 A;  1B9A A;  1GGW A;  4GPL B;  2HPS A;  4MLW A;  4MZK A;  3O2P A;  1S3P A;  1RRO A;  1NIW A;  2F3Y A;  2AAO A;  2L51 A;  4PE7 A;  1BOC A;  2KYF A;  4FTG A;  3RM1 A;  1YX8 A;  1FBV A;  1K9U A;  4ETO A;  2PVB A;  2KQY A;  3BUM B;  4ORC B;  1M63 B;  1UHK A;  4A4B A;  2LP3 A;  2PSR A;  1H4B A;  1NWD A;  1REC A;  1SR6 B;  2F3Z A;  2OTG B;  2R2I A;  1WDC B;  2K7O A;  5DKN A;  1UHN A;  1QAS A;  1EG3 A;  2A4J A;  4ICB A;  5ER5 A;  1B47 A;  1SR6 C;  2MLE C;  3GK4 X;  2OTG C;  1WDC C;  4M2O A;  1ODB A;  3JTD B;  4CFR A;  4PE1 A;  4JWQ A;  1WLM A;  2BBN A;  2LM5 A;  3RLZ A;  1CFC A;  1IJ6 A;  1ALV A;  1SL8 A;  3KHE A;  1KQV A;  1F4O A;  4C0K A;  2K0J A;  4MN0 A;  1TNP A;  2O5G A;  1DJI A;  1GJY A;  1BR4 B;  1YTZ C;  3TDI A;  1K9P A;  1R2U A;  1SL9 A;  2LUX A;  1YUS A;  3JVT B;  1L2O B;  3KO0 A;  3SG2 A;  1PK0 D;  2CCM A;  1JSA A;  4OR9 B;  2NCP A;  3FIA A;  3JVT C;  2KFH A;  1L2O C;  1SY9 A;  1OQP A;  1EXR A;  2F8P A;  1KFU S;  2WCE A;  4F0Z B;  3NSO A;  2M97 A;  4GUK A;  2HQW A;  1K9K A;  3VRP A;  1C7W A;  1QLS A;  4ORB B;  1F71 A;  4JQ0 D;  1A29 A;  1LKJ A;  1OSA A;  2JU0 A;  2LMV A;  1RFJ A;  1DTL A;  1XYD A;  1JFK A;  3AAK A;  1G33 A;  4HRH A;  3IQO A;  4GGN A;  1B8R A;  4C0J A;  1YRU B;  2M7N A;  4MVF A;  4YI9 A;  4CPV A;  3AKA A;  1SNL A;  1PSR A;  1KQM B;  3CZT X;  1ZOT B;  1G4Y R;  1IWQ A;  1NX2 A;  1KFX L;  1CFP A;  1W7I B;  1XK4 C;  2OS8 B;  1KQM C;  3PAL A;  1MHO A;  1M45 A;  3KPX A;  4HRG A;  1TN4 A;  1KSO A;  4I5L B;  1DF0 B;  5HKW A;  2OS8 C;  3MSE B;  1BOD A;  4CFQ A;  1QVI Y;  1PVB A;  1KSM A;  2KBI A;  2KOT A;  3SG3 A;  1KFX S;  5AER A;  2MBX A;  2G9B A;  2VRG A;  5CSF A;  4XJK B;  5JJG A;  2BCB A;  1AJ5 A;  1QIW A;  4USL A;  2WCB A;  2EHB A;  2D8N A;  1J1E A;  1FI6 A;  3KEV A;  1UHJ A;  1IGV A;  1B1G A;  1LVC D;  2PMY A;  2QPT A;  3H4S E;  1GQM A;  1SW8 A;  2JNF A;  2KGB C;  4PE4 A;  4QJ5 B;  1J1D A;  3CWG A;  3OX5 A;  4DUQ A;  2LCP A;  2JUL A;  2LVJ A;  1JUO A;  1MXL C;  1Y6W A;  1WLZ A;  2M7L A;  2JRF A;  1DMO A;  2ZN8 A;  3TDU A;  1CNP A;  2H2K A;  2I94 A;  2KI4 B;  1QX5 B;  2JZI A;  3NXA A;  1AHR A;  3TS5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...