4HRGA

Crystal structure of p11-annexin a2(n-terminal) fusion protein in complex with ahnak1 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQENLYFQGDSTVHEILSKLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
molecule keywords Protein S100-A10
total genus 37
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4hrgA00
4XJKA 1SL9A 3TZ1A 1JF0A 3AKAA 1PVBA 3I5HC 1A75B 2PASA 4GGNA 2LLUA 4AOMA 2BCBA 2B1UA 3CR2A 1ODBA 2I7AA 5HKYA 1OMDA 1AHRA 1HQVA 2QACA 3WHTB 1CLMA 1Y0VH 3VRPA 4GNKB 4MBEA 2K8MB 1YTZC 1GJYA 3RM1A 2HF5A 1W7JB 4ORAB 1CB1A 2JRFA 4D1EA 2I2RE 5I2QA 1MQ1A 2K7CA 4IL1A 1IQ3A 1RECA 1TRFA 1XFWO 2KI6C 1JBAA 2BBMA 4OV2A 1MWNA 1K94A 4YI9A 3TUYB 1DF0A 4YBHB 1K8UA 1DJWA 1F4QA 1CFPA 1N2DA 4MLWA 2BKHB 1MR8A 1KK7Z 1NX2A 3CR4X 2M7LA 2KHNA 2ZN8A 3LCPC 1UHIA 1AVSA 1IQ5A 3EK7A 4M2OA 3BXKA 1SL8A 2LMUA 2K61A 2LP2A 1WRKA 2OTGC 4QJ3B 3VGOA 5AFPA 4PE4A 3DVKA 1XFZO 2JNXA 2ZFDA 3SG6A 3ZWHA 3HX4A 1XYDA 4ORBB 1XA5A 5CSNA 1CMFA 4ORCB 1NCXA 1U5IB 4OR9B 4PE0A 2IS9A 1PULA 2JT3A 3A4UB 3EK4A 2QPTA 2BECA 4P2YB 1XFYO 2LVIA 1QIWA 1QV1A 1DJYA 2KYCA 1YX8A 2L4IA 4A4BA 4USLA 1SR6B 5HLVA 2ZRSA 1FI5A 1AJ4A 1OOJA 1FBVA 1K9UA 1DTLA 4YGAA 1XFVO 3RLZA 1IH0A 1MHOA 1OE9B 1QVIY 1QATA 3M0WA 4PE1A 1JF2A 2H2KA 1CTRA 1WDCB 2BE4A 2F2PA 2OTGB 1EJ3A 1M45A 1UHNA 1YVHA 4ICBA 2BE6A 1KWOC 2M1KB 4QJ5B 5AERA 1SL7A 1C7WA 3JVTB 2JQ6A 1LA3A 1DGVA 1XO5A 4I5JA 1QS7A 3C1VA 4HRGA 4NDDA 3TS5B 1CNPA 1CDMA 1IRJA 3GOFA 4MRXA 1YX7A 4FTGA 2CXJA 1MF8B 1CKKA 5KTYA 2KFHA 4MZKA 1ZMZA 1XVJA 2COLB 1TCOB 3SG4A 2LUXA 1GQMA 1WRLA 2LUCA 2MAZA 1H8BA 2K2AA 2CTNA 1SK6D 1QJTA 4PHKA 1SY9A 2LAPA 3EKJA 2LMTA 1G4YR 3CS1A 1PALA 4XJKB 1JFKA 2EC6B 2F3YA 4YI8A 3I5FC 3OHMB 4C0JA 1Q80A 1TN4A 2H61A 3SG3A 2KNEA 5ER5A 2L50A 1KK8B 4WQ3A 1TNQA 3KEVA 1W7IB 4MVFA 3H4SE 1DJGA 3DVMA 4U8DA 1PSRA 1XK4A 2KGBC 3K21A 2BCAA 2LLSA 2E30A 5HKWA 2MRDA 3I5GC 2LHLA 1SKTA 1PSBA 2JC2A 3DVEA 3PN7B 1FI6A 5DKQA 3BUOB 1F71A 1S3PA 3PM8A 5I8NA 1KQMC 1M39A 2K7DA 2KI4C 5HLOA 3CLNA 1ALVA 1NP8A 2ZRTA 3BQ3A 1FF1A 1ZFSA 3KHEA 2O60A 2EC6C 1ZUZA 2L4HA 1JC2A 2KQ6A 1R6PA 3WNXB 4M2QA 4TNCA 1RWYA 3O2PA 2GGZA 1X02A 3WXAA 1JUOA 2E6WA 3JTDB 2NXQA 1UHJA 1S5GZ 2CNPA 4AQJA 2JTZA 2LV7A 1SW8A 1AK8A 1H4BA 1BLQA 1KFUL 2KBIA 2L5XB 2HPSA 3CWGA 2LC5A 5KSZA 1CFCA 3PATA 1CM4A 1B8CA 3CGAA 3WHUB 1B9AA 1DF0B 2LVVA 2JTTA 1KQMB 2JXCA 1PK0D 1A03A 1J7QA 2KI4B 2P6BB 2KI6D 1UURA 1SCMC 3NSKA 3OP0A 1N0YA 4PHMA 5IBWA 2KAVA 4DUQA 1CDPA 2HQ8A 2LANA 2M9GA 4MZJA 1B7TZ 1DJXA 2BCXA 3OB2B 2K7OA 4DRWA 1YRUB 1SBJA 1KWOB 1UP5A 1DJIA 1RROA 5DKRA 1BODA 2WOSA 1NIWA 1F54A 2BL0C 4MSPA 1BG1A 1M31A 4WRIA 1NCZA 1WLZA 2M49B 1IJ5A 1OQPA 2NZ0A 2JOJA 1QTXA 2ZNDA 5D7FA 2MLFC 3DVJA 4I5LB 1BT6A 4CPVA 1DGUA 1XK4C 2L98A 4N1GA 5CSIA 1BR4B 1IKUA 1A75A 5BPJA 3PLFB 1MXLC 1R2UA 2CBLA 2KFFA 4CFRA 4HREE 3MSEB 3OB1B 1FW4A 2LMVA 4MRYA 3D0YB 4YGDB 1BR1B 4DS7A 3NSIA 2KAYA 1LKJA 1TTXA 1AUIB 1YUUA 2JULA 3E3RA 1NX3A 3BOWB 3NXAA 3TDUA 1E8AA 3OX5A 3VROA 3KPXA 3NSLA 3QRXA 1DJZA 1KK7Y 2WCBA 1J55A 4GPLB 1K90D 1S6JA 2I94A 3VRNA 2K7BA 1QXPA 1L2OB 2GV5A 4PE7A 1A2XA 1IG5A 1MUXA 2BBNA 2M0RA 1CM1A 1FPWA 2ISDA 3SG7A 4I5NB 4OKHA 4OCIA 1SR6C 2HQWA 2L51A 2OS8C 1M63B 1YVLA 1J1EA 2LHIA 2G9BA 3AAJA 2SASA 1QIVA 1NX0A 2NLNA 5PALA 4A4CA 1LA0A 2LVJA 1SPYA 1B1GA 5K89A 1SRAA 3GK1A 3FWBA 4PALA 4PDZA 2KGRA 2WCFA 1ZACA 2PRUA 2Y5IA 4MZLA 1U5IA 1YUTA 1J7PA 1G8IA 2FCDA 4OVNF 3PALA 4HSZA 1OSAA 1WY9A 1QVIZ 1EXRA 5CSJA 1EH2A 2PSRA 1K9PA 2PALA 2LVKA 5B8IB 2F8PA 1QLSA 1A29A 4YGCB 2K2FA 2KAXA 2Y1NA 4N1FA 1AP4A 2FJUB 2WCEA 3SG2A 4GBAA 1Y1XA 1TNPA 2MBXA 1CLBA 1SYMA 1K2HA 1GGZA 3IQQA 5AXIA 3I5IC 1SCVA 3SJSA 1BU3A 5CSFA 2JPTA 2M8UA 3BUNB 4CFQA 1C7VA 3HCMA 2H61C 3F45A 1Y1AA 1NUBA 1WDCC 1XFUO 3EKHA 2KDHA 4GAOA 3D10A 2WORA 3EK8A 3O78A 1NPQA 3PFVA 1NSHA 1YR5A 2LLTA 3AAKA 1TIZA 2GGMA 4QJ4B 5ER4X 3CZTX 1NCYA 5HYDA 2OPOA 4NQGA 4BY5A 4C0LA 2JWWA 2Y1MA 1IWQA 2AMIA 4E68A 1RTP1 2O5GA 3PN7C 5FYXA 2V53A 2SCPA 4MN0A 1EG4A 1JFJA 1S1EA 2DOQA 2JNFA 3TUYC 3VRRA 1KFXL 3FIAA 1L7ZA 3EVVA 5F6TA 1LXFC 1ALWA 1QLKA 3I5IB 5JJGA 1F55A 3TDIA 3GK2A 1B8LA 1RJVA 3BYAA 1KSMA 1NX1A 2EHBA 3I5FB 4PCWA 2M1UA 1B8RA 1PRWA 2JZIA 1TOPA 3D0YA 2LP3A 1YUSA 2ZNEA 1TCFA 3BUWB 1NWDA 4P5OE 2MLEC 3JTDC 4I5KA 2CCMA 1JSAA 1J1DA 4C0KA 4GUKA 1Y6WA 1QASA 2KFGA 2KQYA 1JWDA 2M3WA 2PMYA 2Q4UA 1D1OA 1IJ6A 2JU0A 4Q04A 5J3XA 5I2OA 1MXEA 3KF9A 1K95A 1N65A 2Q91A 2KYFA 1CDNA 2KBMA 1S5GY 3LK0A 4M2PA 3FWCA 4FQOA 1CDLA 4ZCUA 4JWQA 3I5HB 5GQQC 3GK4X 1UUSA 1YRTB 4HRHA 2RGIA 4PHJA 1F70A 3LLEA 1S26D 2JT8A 3SIBA 3BUMB 2L2EA 3BOWA 4MEWA 5AANA 2FCEA 2AUCA 2KSPA 4L9MA 4N5XA 1KK8C 4YGEB 3DD4A 5AEQA 1RK9A 3ICBA 3SG5A 1F8HA 1VRKA 1G33A 5G08A 5JOLA 1EL4A 1J7OA 3TDZA 2M29A 1S6CA 1DMOA 1KFUS 1XFXO 1KCYA 1B4CA 3VRQA 2PVBA 3PSRA 2CT9A 2BKIB 4YGBB 4ZCVA 2NCPA 3EVUA 1B47A 1OZSA 3LK1A 4F0ZB 3O6BA 1QX5B 4BY4A 1Y1UA 3NSOA 3SIAA 3O4YA 3ZNIA 2G2BA 2LM5A 1SCMB 1S6IA 2EGDA 2F3ZA 3OX6A 4GGFA 1LINA 1OMVA 1IGVA 1V1GA 1DVIA 2A4JA 1S36A 1YURA 2AAOA 1BOCA 4GGFC 1CFFA 3CR5X 1SNLA 4ETOA 5I2LA 4CIDA 2JT0A 2BL0B 2LNKA 2MA2A 1C07A 2MHHA 2WNDA 4GFTA 4PHNA 1BJFA 1CFDA 2M97A 4CLNA 1L2OC 3CTNA 1KQVA 1WLMA 1F4OA 2ZKMX 2D8NA 4JPZB 1QX2A 3I5GB 1DT7B 5D69A 4NDBA 3FS7A 2OS8B 4YRUA 2LE9B 5HKZA 1ZOTB 2I18A 2FOTA 1TNXA 1UHHA 2F2OA 1DJHA 2MJWB 1A4PA 3IF7A 1WRZA 1LVCD 1OZOA 1NYAA 2WC8A 3AKBA 2VRGA 4R1EA 2NCOA 2R2IA 4AQIA 1J7RA 2TN4A 2L0PA 1M46A 1QV0A 1K93D 2ZN9A 1BF5A 2HETA 2F33A 1V1FA 1RFJA 1EG3A 1HT9A 1UWOA 3EVRA 3IQOA 3BUXB 1GGWA 1CMGA 4DCKA 1TNWA 4XYNA 5CPVA 1K96A 2Y4QA 3JVTC 4UPGA 1PVAA 2LCPA 1KFXS 4WQ2A 5TNCA 2JXLA 1SMGA 3KO0A 1UHKA 4JQ0D 3TS5C 1CLLA 1QX7A 1BMOA 3A8RA 5KU1A 3LL8B 2KOTA 1KSOA 3DF0A 4NDCA 1B7TY 3DF0B 1K9KA 1AJ5A 2M7NA 5DKNA 1OMRA 4DIRA 2K0JA
chains in the Genus database with same CATH superfamily
4XJKA 1SL9A 3NHTA 3TZ1A 1JF0A 3AKAA 1PVBA 2FJYA 3I5HC 1A75B 2PASA 4GGNA 4OZDA 2LLUA 4AOMA 1OW4A 2BCBA 2B1UA 3CR2A 1ODBA 2I7AA 5HKYA 1OMDA 1AHRA 1HQVA 2QACA 3SS4A 3WHTB 1CLMA 1Y0VH 3VRPA 4GNKB 4MBEA 2K8MB 1YTZC 2L5YA 2QEVA 1GJYA 3RM1A 2BNXA 1W7JB 2HF5A 4ORAB 1CB1A 2JRFA 4D1EA 2I2RE 5I2QA 1Z2CB 1MQ1A 2K7CA 4IL1A 1IQ3A 1RECA 1TRFA 1XFWO 2KI6C 1JBAA 2BBMA 2P70A 4OV2A 1MWNA 1K94A 2KLDA 4YI9A 3TUYB 1DF0A 3DY9A 1K8UA 4YBHB 1DJWA 3EG5B 1F4QA 1CFPA 1N2DA 3L47A 2BKHB 1MR8A 1KK7Z 1NX2A 3CR4X 4MLWA 1DELA 2KHNA 2ZN8A 3LCPC 1UHIA 1AVSA 1IQ5A 3EK7A 4M2OA 3BXKA 1SL8A 2LMUA 2K61A 2LP2A 1WRKA 2OTGC 4QJ3B 3VGOA 5AFPA 4PE4A 3DVKA 1XFZO 2JNXA 2ZFDA 3SG6A 2PQLA 3ZWHA 3HX4A 1XYDA 4ORBB 3R72A 1XA5A 5CSNA 1CMFA 4ORCB 1NCXA 1U5IB 4OR9B 4PE0A 2IS9A 1PULA 3S0DA 2JT3A 3A4UB 3EK4A 2QPTA 2BECA 4P2YB 1XFYO 2LVIA 1QIWA 1QV1A 1DJYA 2KYCA 1YX8A 2L4IA 4A4BA 3RZSA 3R1VA 4USLA 1SR6B 5HLVA 2ZRSA 1FI5A 1AJ4A 1OOJA 1FBVA 1K9UA 1DTLA 4YGAA 1XFVO 3PJIA 3Q8IA 3RLZA 3CZ0A 1IH0A 1MHOA 1OE9B 1QVIY 1QATA 3M0WA 4PE1A 1JF2A 2H2KA 1CTRA 1WDCB 2BE4A 2F2PA 2OTGB 1EJ3A 1M45A 3D78A 1UHNA 1YVHA 4ICBA 2BE6A 1KWOC 2M1KB 4QJ5B 5AERA 1SL7A 1C7WA 3JVTB 1P28A 2JQ6A 1LA3A 3B86A 1DGVA 1XO5A 4I5JA 1QS7A 3C1VA 4HRGA 4NDDA 3SS3A 3TS5B 1CNPA 1CDMA 1IRJA 3GOFA 4MRXA 1YX7A 3PM2A 4FTGA 2QEOA 2CXJA 1MF8B 1C3YA 1CKKA 5KTYA 2KFHA 4MZKA 1ZMZA 1XVJA 2COLB 1TCOB 3SG4A 2LUXA 1GQMA 1WRLA 2LUCA 2MAZA 1H8BA 2K2AA 2CTNA 1W9ZA 1SK6D 1QJTA 4PHKA 3CABA 1SY9A 2LAPA 3EKJA 2LMTA 1G4YR 3CS1A 1PALA 4XJKB 1JFKA 2EC6B 2F3YA 1LS8A 3CZ2A 3I5FC 3OHMB 4YI8A 4C0JA 1Q80A 1TN4A 2H61A 3SG3A 3FE8A 2QDIA 4F7FA 2KNEA 5ER5A 3D75A 2L50A 1KK8B 2P71A 1TNQA 4WQ3A 3BFHA 2WCLA 3KEVA 2GTEA 1ORGA 1W7IB 4MVFA 3H4SE 1DJGA 3DVMA 5FI2A 4U8DA 1IIOA 1PSRA 3DXLA 1XK4A 2KGBC 3K21A 2BCAA 2LLSA 2E30A 5HKWA 2MRDA 3I5GC 1DEKA 2LHLA 1SKTA 1PSBA 2JC2A 3DVEA 3PN7B 1FI6A 5DKQA 3BUOB 1F71A 1S3PA 3PM8A 5I8NA 1KQMC 1M39A 2K7DA 2KI4C 5HLOA 3CLNA 1ALVA 1NP8A 2ZRTA 3BQ3A 3UO9A 1ZFSA 1FF1A 3KHEA 2O60A 2EC6C 1ZUZA 2L4HA 1JC2A 2KQ6A 1R6PA 3WNXB 4M2QA 4TNCA 1RWYA 3O2PA 2GGZA 1X02A 3WXAA 1JUOA 2WCHA 2E6WA 3JTDB 2NXQA 1UHJA 1S5GZ 2CNPA 4AQJA 2JTZA 2LV7A 1SW8A 1AK8A 1H4BA 1BLQA 1KFUL 2KBIA 2L5XB 2HPSA 3CWGA 2LC5A 5KSZA 1CFCA 3PATA 1CM4A 1B8CA 3CGAA 3WHUB 1B9AA 1DF0B 2LVVA 2JTTA 1KQMB 2JXCA 1PK0D 1A03A 1J7QA 2KI4B 2P6BB 2QEBA 2KI6D 3D73A 1UURA 1SCMC 3NSKA 2ERBA 1N0YA 3OP0A 3CYZA 4PHMA 5IBWA 2KAVA 3D77A 4DUQA 1CDPA 3CDNA 2HQ8A 2LANA 2M9GA 4MZJA 1B7TZ 1DJXA 2BCXA 3BFBA 3OB2B 2K7OA 4DRWA 1YRUB 1SBJA 1KWOB 1UP5A 1DJIA 3SS5A 1RROA 5DKRA 1BODA 3OBVA 2WOSA 1NIWA 1F54A 2BL0C 4MSPA 1BG1A 1M31A 4WRIA 3FE9A 3QMEA 1NCZA 1WLZA 2M49B 1IJ5A 1OOGA 1OQPA 5HL1A 2NZ0A 3D76A 2JOJA 1QTXA 2ZNDA 5D7FA 2MLFC 3DVJA 4I5LB 1BT6A 4CPVA 1DGUA 1XK4C 4INXA 2L98A 4N1GA 5CSIA 1BR4B 3S0BA 1IKUA 1A75A 5BPJA 3PLFB 1MXLC 1R2UA 2CBLA 2KFFA 4CFRA 4HREE 3MSEB 3OB1B 1FW4A 2LMVA 1SSEB 4MRYA 3D0YB 4YGDB 1BR1B 3O4XA 4DS7A 3NSIA 2KAYA 1LKJA 1TTXA 1AUIB 1YUUA 2JULA 3E3RA 1NX3A 3BOWB 5DICA 3NXAA 3TDUA 1E8AA 3OX5A 3VROA 3KPXA 3NSLA 3QRXA 1DJZA 3NHIA 1KK7Y 3BJHA 2WCBA 1J55A 3DZTA 4INWA 4GPLB 1K90D 3R1PA 1S6JA 2I94A 3VRNA 2K7BA 1QXPA 4KYNA 1L2OB 2GV5A 4PE7A 1A2XA 1IG5A 1MUXA 2BBNA 5FI6A 2M0RA 1CM1A 1FPWA 2ISDA 3SG7A 4I5NB 4OKHA 4OCIA 1SR6C 2HQWA 2L51A 2OS8C 1M63B 1YVLA 1J1EA 2LHIA 2G9BA 2WC5A 3AAJA 3R1OA 2SASA 1QIVA 1NX0A 1OOIX 2NLNA 5PALA 4A4CA 1LA0A 2LVJA 1SPYA 3VB1A 1B1GA 5K89A 1SRAA 1C3ZA 4F0ZB 3GK1A 3FWBA 4PALA 4PDZA 3V2LA 2KGRA 2WCFA 1ZACA 2PRUA 2Y5IA 4MZLA 1U5IA 1YUTA 1J7PA 3D74A 1G8IA 2FCDA 4OVNF 3PALA 4HSZA 1OSAA 1WY9A 2JPOA 2WCMA 1QVIZ 1EXRA 5CSJA 1EH2A 2PSRA 1K9PA 2PALA 2LVKA 5B8IB 2F8PA 1QLSA 2KPHA 1A29A 4YGCB 2K2FA 2KAXA 2Y1NA 3B87A 4N1FA 2M7LA 1AP4A 2FJUB 2WCEA 3SG2A 4GBAA 1Y1XA 1TNPA 2MBXA 1CLBA 1SYMA 1K2HA 1GGZA 3IQQA 5AXIA 3I5IC 1SCVA 3SJSA 1BU3A 5CSFA 2JPTA 2M8UA 3BUNB 4CFQA 3BFAA 1C7VA 3HCMA 2H61C 3F45A 1Y1AA 1NUBA 1QWVA 1WDCC 1XFUO 3EKHA 2KDHA 4GAOA 3D10A 2WORA 3EK8A 3NGVA 3O78A 3UNWA 1NPQA 3DYEA 3PFVA 1NSHA 1YR5A 2LLTA 3K1EA 3AAKA 1TIZA 2GGMA 4QJ4B 5ER4X 2PYQA 3CZTX 1NCYA 3N7HA 2OPOA 5HYDA 2WCJA 4NQGA 4BY5A 4C0LA 3S0AA 2JWWA 2Y1MA 1IWQA 2AMIA 4E68A 1RTP1 2O5GA 3PN7C 5FYXA 2V53A 2SCPA 4MN0A 1EG4A 1JFJA 1S1EA 2DOQA 2JNFA 3TUYC 3VRRA 1KFXL 3FIAA 1L7ZA 3EVVA 5F6TA 1LXFC 1GM0A 1ALWA 1QLKA 3I5IB 5JJGA 1F55A 3TDIA 3GK2A 1B8LA 1RJVA 3BYAA 1KSMA 1NX1A 2EHBA 3S0EA 3I5FB 4PCWA 3B6XA 2M1UA 1B8RA 1Z4HA 4IJ7A 1PRWA 2JZIA 1TOPA 3D0YA 2LP3A 1YUSA 2YGUA 1TCFA 2ZNEA 1NWDA 3BUWB 2MLEC 3JTDC 4I5KA 4P5OE 2CCMA 3S0GA 3OGNA 1JSAA 1J1DA 2H8VA 2KLEA 4C0KA 4GUKA 1Y6WA 1QASA 3L4AA 2KFGA 2KQYA 1JWDA 2M3WA 2PMYA 2Q4UA 1D1OA 1IJ6A 2JU0A 3CZ1A 4Q04A 5J3XA 5I2OA 1MXEA 3KF9A 1K95A 1N65A 2Q91A 2K60A 2KYFA 1CDNA 5FI7A 2KBMA 1S5GY 1T14A 3LK0A 4M2PA 3FWCA 4FQOA 1CDLA 4ZCUA 4JWQA 3I5HB 5GQQC 3GK4X 2BAPA 1UUSA 1YRTB 4HRHA 2RGIA 4PHJA 1DC1A 1F70A 3LLEA 1S26D 2JT8A 3SIBA 3BUMB 2L2EA 3BOWA 4MEWA 5AANA 2FCEA 4JKTA 1DQEA 2AUCA 2KSPA 3FE6A 1TUZA 4L9MA 4N5XA 1KK8C 3L4LA 4YGEB 3DD4A 5AEQA 1RK9A 3ICBA 3SG5A 1F8HA 1VRKA 1G33A 5G08A 5JOLA 1EL4A 1J7OA 3TDZA 2M29A 1S6CA 1DMOA 1KFUS 1XFXO 1KCYA 1B4CA 3VRQA 2PVBA 3PSRA 2CT9A 2BKIB 3B7AA 4YGBB 2NCPA 3EVUA 1B47A 1OZSA 3LK1A 4ZCVA 3O6BA 1QX5B 2WC6A 4BY4A 1Y1UA 3IVTA 3NSOA 3SIAA 3O4YA 3ZNIA 2G2BA 2LM5A 1SCMB 1S6IA 2EGDA 2F3ZA 3OX6A 2QEHA 4GGFA 1LINA 1OOHA 1OMVA 1IGVA 1V1GA 1DVIA 2A4JA 1S36A 1YURA 2AAOA 1BOCA 4GGFC 1CFFA 5I94A 4JD9A 3CR5X 1SNLA 4ETOA 1OOFA 5I2LA 4CIDA 2JT0A 2BL0B 2LNKA 2MA2A 1C07A 2MHHA 2WNDA 4GFTA 4PHNA 1BJFA 1CFDA 2M97A 4CLNA 1L2OC 3CTNA 1KQVA 1WLMA 3S0FA 1F4OA 2ZKMX 2D8NA 4JPZB 1QX2A 3I5GB 1DT7B 5D69A 4NDBA 3FS7A 2OS8B 4YRUA 2LE9B 5HKZA 1ZOTB 2I18A 2FOTA 1TNXA 1UHHA 2F2OA 1DJHA 2MJWB 1A4PA 2WCKA 3IF7A 1WRZA 1LVCD 3B88A 1OZOA 1NYAA 2WC8A 3AKBA 2VRGA 4R1EA 2NCOA 2R2IA 4AQIA 1J7RA 2TN4A 2L0PA 1M46A 1QV0A 2L2CA 4PT1A 1K93D 1TWOA 2ZN9A 5EL2A 1BF5A 2HETA 2F33A 1V1FA 1RFJA 1EG3A 1HT9A 1UWOA 3EVRA 3IQOA 3BUXB 1XFRA 1GGWA 1CMGA 4DCKA 1TNWA 4XYNA 5CPVA 1K96A 2Y4QA 3JVTC 4UPGA 1PVAA 2LCPA 1KFXS 4WQ2A 5TNCA 2JXLA 1SMGA 3KO0A 5D3OA 1UHKA 4JQ0D 3TS5C 1CLLA 1QX7A 1BMOA 1TUJA 3A8RA 5KU1A 4FQTA 3LL8B 2KOTA 1KSOA 3DF0A 4NDCA 1B7TY 3DF0B 1K9KA 1AJ5A 2M7NA 5DKNA 1OMRA 4DIRA 2K0JA
chains in the Genus database with same CATH topology
4XJKA 1SL9A 3TZ1A 1JF0A 3AKAA 1PVBA 3I5HC 1A75B 2PASA 4GGNA 2LLUA 4AOMA 2BCBA 2B1UA 3CR2A 1ODBA 2I7AA 5HKYA 1OMDA 1AHRA 1HQVA 2QACA 3WHTB 1CLMA 1Y0VH 3VRPA 4GNKB 4MBEA 2K8MB 1YTZC 1GJYA 3RM1A 2HF5A 1W7JB 4ORAB 1CB1A 2JRFA 4D1EA 2I2RE 5I2QA 1MQ1A 2K7CA 4IL1A 1IQ3A 1RECA 1TRFA 1XFWO 2KI6C 1JBAA 2BBMA 4OV2A 1MWNA 1K94A 4YI9A 3TUYB 1DF0A 4YBHB 1K8UA 1DJWA 1F4QA 1CFPA 1N2DA 4MLWA 2BKHB 1MR8A 1KK7Z 1NX2A 3CR4X 2M7LA 2KHNA 2ZN8A 3LCPC 1UHIA 1AVSA 1IQ5A 3EK7A 4M2OA 3BXKA 1SL8A 2LMUA 2K61A 2LP2A 1WRKA 2OTGC 4QJ3B 3VGOA 5AFPA 4PE4A 3DVKA 1XFZO 2JNXA 2ZFDA 3SG6A 3ZWHA 3HX4A 1XYDA 4ORBB 1XA5A 5CSNA 1CMFA 4ORCB 1NCXA 1U5IB 4OR9B 4PE0A 2IS9A 1PULA 2JT3A 3A4UB 3EK4A 2QPTA 2BECA 4P2YB 1XFYO 2LVIA 1QIWA 1QV1A 1DJYA 2KYCA 1YX8A 2L4IA 4A4BA 4USLA 1SR6B 5HLVA 2ZRSA 1FI5A 1AJ4A 1OOJA 1FBVA 1K9UA 1DTLA 4YGAA 1XFVO 3RLZA 1IH0A 1MHOA 1OE9B 1QVIY 1QATA 3M0WA 4PE1A 1JF2A 2H2KA 1CTRA 1WDCB 2BE4A 2F2PA 2OTGB 1EJ3A 1M45A 1UHNA 1YVHA 4ICBA 2BE6A 1KWOC 2M1KB 4QJ5B 5AERA 1SL7A 1C7WA 3JVTB 2JQ6A 1LA3A 1DGVA 1XO5A 4I5JA 1QS7A 3C1VA 4HRGA 4NDDA 3TS5B 1CNPA 1CDMA 1IRJA 3GOFA 4MRXA 1YX7A 4FTGA 2CXJA 1MF8B 1CKKA 5KTYA 2KFHA 4MZKA 1ZMZA 1XVJA 2COLB 1TCOB 3SG4A 2LUXA 1GQMA 1WRLA 2LUCA 2MAZA 1H8BA 2K2AA 2CTNA 1SK6D 1QJTA 4PHKA 1SY9A 2LAPA 3EKJA 2LMTA 1G4YR 3CS1A 1PALA 4XJKB 1JFKA 2EC6B 2F3YA 4YI8A 3I5FC 3OHMB 4C0JA 1Q80A 1TN4A 2H61A 3SG3A 2KNEA 5ER5A 2L50A 1KK8B 4WQ3A 1TNQA 3KEVA 1W7IB 4MVFA 3H4SE 1DJGA 3DVMA 4U8DA 1PSRA 1XK4A 2KGBC 3K21A 2BCAA 2LLSA 2E30A 5HKWA 2MRDA 3I5GC 2LHLA 1SKTA 1PSBA 2JC2A 3DVEA 3PN7B 1FI6A 5DKQA 3BUOB 1F71A 1S3PA 3PM8A 5I8NA 1KQMC 1M39A 2K7DA 2KI4C 5HLOA 3CLNA 1ALVA 1NP8A 2ZRTA 3BQ3A 1FF1A 1ZFSA 3KHEA 2O60A 2EC6C 1ZUZA 2L4HA 1JC2A 2KQ6A 1R6PA 3WNXB 4M2QA 4TNCA 1RWYA 3O2PA 2GGZA 1X02A 3WXAA 1JUOA 2E6WA 3JTDB 2NXQA 1UHJA 1S5GZ 2CNPA 4AQJA 2JTZA 2LV7A 1SW8A 1AK8A 1H4BA 1BLQA 1KFUL 2KBIA 2L5XB 2HPSA 3CWGA 2LC5A 5KSZA 1CFCA 3PATA 1CM4A 1B8CA 3CGAA 3WHUB 1B9AA 1DF0B 2LVVA 2JTTA 1KQMB 2JXCA 1PK0D 1A03A 1J7QA 2KI4B 2P6BB 2KI6D 1UURA 1SCMC 3NSKA 3OP0A 1N0YA 4PHMA 5IBWA 2KAVA 4DUQA 1CDPA 2HQ8A 2LANA 2M9GA 4MZJA 1B7TZ 1DJXA 2BCXA 3OB2B 2K7OA 4DRWA 1YRUB 1SBJA 1KWOB 1UP5A 1DJIA 1RROA 5DKRA 1BODA 2WOSA 1NIWA 1F54A 2BL0C 4MSPA 1BG1A 1M31A 4WRIA 1NCZA 1WLZA 2M49B 1IJ5A 1OQPA 2NZ0A 2JOJA 1QTXA 2ZNDA 5D7FA 2MLFC 3DVJA 4I5LB 1BT6A 4CPVA 1DGUA 1XK4C 2L98A 4N1GA 5CSIA 1BR4B 1IKUA 1A75A 5BPJA 3PLFB 1MXLC 1R2UA 2CBLA 2KFFA 4CFRA 4HREE 3MSEB 3OB1B 1FW4A 2LMVA 4MRYA 3D0YB 4YGDB 1BR1B 4DS7A 3NSIA 2KAYA 1LKJA 1TTXA 1AUIB 1YUUA 2JULA 3E3RA 1NX3A 3BOWB 3NXAA 3TDUA 1E8AA 3OX5A 3VROA 3KPXA 3NSLA 3QRXA 1DJZA 1KK7Y 2WCBA 1J55A 4GPLB 1K90D 1S6JA 2I94A 3VRNA 2K7BA 1QXPA 1L2OB 2GV5A 4PE7A 1A2XA 1IG5A 1MUXA 2BBNA 2M0RA 1CM1A 1FPWA 2ISDA 3SG7A 4I5NB 4OKHA 4OCIA 1SR6C 2HQWA 2L51A 2OS8C 1M63B 1YVLA 1J1EA 2LHIA 2G9BA 3AAJA 2SASA 1QIVA 1NX0A 2NLNA 5PALA 4A4CA 1LA0A 2LVJA 1SPYA 1B1GA 5K89A 1SRAA 3GK1A 3FWBA 4PALA 4PDZA 2KGRA 2WCFA 1ZACA 2PRUA 2Y5IA 4MZLA 1U5IA 1YUTA 1J7PA 1G8IA 2FCDA 4OVNF 3PALA 4HSZA 1OSAA 1WY9A 1QVIZ 1EXRA 5CSJA 1EH2A 2PSRA 1K9PA 2PALA 2LVKA 5B8IB 2F8PA 1QLSA 1A29A 4YGCB 2K2FA 2KAXA 2Y1NA 4N1FA 1AP4A 2FJUB 2WCEA 3SG2A 4GBAA 1Y1XA 1TNPA 2MBXA 1CLBA 1SYMA 1K2HA 1GGZA 3IQQA 5AXIA 3I5IC 1SCVA 3SJSA 1BU3A 5CSFA 2JPTA 2M8UA 3BUNB 4CFQA 1C7VA 3HCMA 2H61C 3F45A 1Y1AA 1NUBA 1WDCC 1XFUO 3EKHA 2KDHA 4GAOA 3D10A 2WORA 3EK8A 3O78A 1NPQA 3PFVA 1NSHA 1YR5A 2LLTA 3AAKA 1TIZA 2GGMA 4QJ4B 5ER4X 3CZTX 1NCYA 5HYDA 2OPOA 4NQGA 4BY5A 4C0LA 2JWWA 2Y1MA 1IWQA 2AMIA 4E68A 1RTP1 2O5GA 3PN7C 5FYXA 2V53A 2SCPA 4MN0A 1EG4A 1JFJA 1S1EA 2DOQA 2JNFA 3TUYC 3VRRA 1KFXL 3FIAA 1L7ZA 3EVVA 5F6TA 1LXFC 1ALWA 1QLKA 3I5IB 5JJGA 1F55A 3TDIA 3GK2A 1B8LA 1RJVA 3BYAA 1KSMA 1NX1A 2EHBA 3I5FB 4PCWA 2M1UA 1B8RA 1PRWA 2JZIA 1TOPA 3D0YA 2LP3A 1YUSA 2ZNEA 1TCFA 3BUWB 1NWDA 4P5OE 2MLEC 3JTDC 4I5KA 2CCMA 1JSAA 1J1DA 4C0KA 4GUKA 1Y6WA 1QASA 2KFGA 2KQYA 1JWDA 2M3WA 2PMYA 2Q4UA 1D1OA 1IJ6A 2JU0A 4Q04A 5J3XA 5I2OA 1MXEA 3KF9A 1K95A 1N65A 2Q91A 2KYFA 1CDNA 2KBMA 1S5GY 3LK0A 4M2PA 3FWCA 4FQOA 1CDLA 4ZCUA 4JWQA 3I5HB 5GQQC 3GK4X 1UUSA 1YRTB 4HRHA 2RGIA 4PHJA 1F70A 3LLEA 1S26D 2JT8A 3SIBA 3BUMB 2L2EA 3BOWA 4MEWA 5AANA 2FCEA 2AUCA 2KSPA 4L9MA 4N5XA 1KK8C 4YGEB 3DD4A 5AEQA 1RK9A 3ICBA 3SG5A 1F8HA 1VRKA 1G33A 5G08A 5JOLA 1EL4A 1J7OA 3TDZA 2M29A 1S6CA 1DMOA 1KFUS 1XFXO 1KCYA 1B4CA 3VRQA 2PVBA 3PSRA 2CT9A 2BKIB 4YGBB 4ZCVA 2NCPA 3EVUA 1B47A 1OZSA 3LK1A 4F0ZB 3O6BA 1QX5B 4BY4A 1Y1UA 3NSOA 3SIAA 3O4YA 3ZNIA 2G2BA 2LM5A 1SCMB 1S6IA 2EGDA 2F3ZA 3OX6A 4GGFA 1LINA 1OMVA 1IGVA 1V1GA 1DVIA 2A4JA 1S36A 1YURA 2AAOA 1BOCA 4GGFC 1CFFA 3CR5X 1SNLA 4ETOA 5I2LA 4CIDA 2JT0A 2BL0B 2LNKA 2MA2A 1C07A 2MHHA 2WNDA 4GFTA 4PHNA 1BJFA 1CFDA 2M97A 4CLNA 1L2OC 3CTNA 1KQVA 1WLMA 1F4OA 2ZKMX 2D8NA 4JPZB 1QX2A 3I5GB 1DT7B 5D69A 4NDBA 3FS7A 2OS8B 4YRUA 2LE9B 5HKZA 1ZOTB 2I18A 2FOTA 1TNXA 1UHHA 2F2OA 1DJHA 2MJWB 1A4PA 3IF7A 1WRZA 1LVCD 1OZOA 1NYAA 2WC8A 3AKBA 2VRGA 4R1EA 2NCOA 2R2IA 4AQIA 1J7RA 2TN4A 2L0PA 1M46A 1QV0A 1K93D 2ZN9A 1BF5A 2HETA 2F33A 1V1FA 1RFJA 1EG3A 1HT9A 1UWOA 3EVRA 3IQOA 3BUXB 1GGWA 1CMGA 4DCKA 1TNWA 4XYNA 5CPVA 1K96A 2Y4QA 3JVTC 4UPGA 1PVAA 2LCPA 1KFXS 4WQ2A 5TNCA 2JXLA 1SMGA 3KO0A 1UHKA 4JQ0D 3TS5C 1CLLA 1QX7A 1BMOA 3A8RA 5KU1A 3LL8B 2KOTA 1KSOA 3DF0A 4NDCA 1B7TY 3DF0B 1K9KA 1AJ5A 2M7NA 5DKNA 1OMRA 4DIRA 2K0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJK A;  1SL9 A;  3TZ1 A;  1JF0 A;  3AKA A;  1PVB A;  3I5H C;  1A75 B;  2PAS A;  4GGN A;  2LLU A;  4AOM A;  2BCB A;  2B1U A;  3CR2 A;  1ODB A;  2I7A A;  5HKY A;  1OMD A;  1AHR A;  1HQV A;  2QAC A;  3WHT B;  1CLM A;  1Y0V H;  3VRP A;  4GNK B;  4MBE A;  2K8M B;  1YTZ C;  1GJY A;  3RM1 A;  2HF5 A;  1W7J B;  4ORA B;  1CB1 A;  2JRF A;  4D1E A;  2I2R E;  5I2Q A;  1MQ1 A;  2K7C A;  4IL1 A;  1IQ3 A;  1REC A;  1TRF A;  1XFW O;  2KI6 C;  1JBA A;  2BBM A;  4OV2 A;  1MWN A;  1K94 A;  4YI9 A;  3TUY B;  1DF0 A;  4YBH B;  1K8U A;  1DJW A;  1F4Q A;  1CFP A;  1N2D A;  4MLW A;  2BKH B;  1MR8 A;  1KK7 Z;  1NX2 A;  3CR4 X;  2M7L A;  2KHN A;  2ZN8 A;  3LCP C;  1UHI A;  1AVS A;  1IQ5 A;  3EK7 A;  4M2O A;  3BXK A;  1SL8 A;  2LMU A;  2K61 A;  2LP2 A;  1WRK A;  2OTG C;  4QJ3 B;  3VGO A;  5AFP A;  4PE4 A;  3DVK A;  1XFZ O;  2JNX A;  2ZFD A;  3SG6 A;  3ZWH A;  3HX4 A;  1XYD A;  4ORB B;  1XA5 A;  5CSN A;  1CMF A;  4ORC B;  1NCX A;  1U5I B;  4OR9 B;  4PE0 A;  2IS9 A;  1PUL A;  2JT3 A;  3A4U B;  3EK4 A;  2QPT A;  2BEC A;  4P2Y B;  1XFY O;  2LVI A;  1QIW A;  1QV1 A;  1DJY A;  2KYC A;  1YX8 A;  2L4I A;  4A4B A;  4USL A;  1SR6 B;  5HLV A;  2ZRS A;  1FI5 A;  1AJ4 A;  1OOJ A;  1FBV A;  1K9U A;  1DTL A;  4YGA A;  1XFV O;  3RLZ A;  1IH0 A;  1MHO A;  1OE9 B;  1QVI Y;  1QAT A;  3M0W A;  4PE1 A;  1JF2 A;  2H2K A;  1CTR A;  1WDC B;  2BE4 A;  2F2P A;  2OTG B;  1EJ3 A;  1M45 A;  1UHN A;  1YVH A;  4ICB A;  2BE6 A;  1KWO C;  2M1K B;  4QJ5 B;  5AER A;  1SL7 A;  1C7W A;  3JVT B;  2JQ6 A;  1LA3 A;  1DGV A;  1XO5 A;  4I5J A;  1QS7 A;  3C1V A;  4HRG A;  4NDD A;  3TS5 B;  1CNP A;  1CDM A;  1IRJ A;  3GOF A;  4MRX A;  1YX7 A;  4FTG A;  2CXJ A;  1MF8 B;  1CKK A;  5KTY A;  2KFH A;  4MZK A;  1ZMZ A;  1XVJ A;  2COL B;  1TCO B;  3SG4 A;  2LUX A;  1GQM A;  1WRL A;  2LUC A;  2MAZ A;  1H8B A;  2K2A A;  2CTN A;  1SK6 D;  1QJT A;  4PHK A;  1SY9 A;  2LAP A;  3EKJ A;  2LMT A;  1G4Y R;  3CS1 A;  1PAL A;  4XJK B;  1JFK A;  2EC6 B;  2F3Y A;  4YI8 A;  3I5F C;  3OHM B;  4C0J A;  1Q80 A;  1TN4 A;  2H61 A;  3SG3 A;  2KNE A;  5ER5 A;  2L50 A;  1KK8 B;  4WQ3 A;  1TNQ A;  3KEV A;  1W7I B;  4MVF A;  3H4S E;  1DJG A;  3DVM A;  4U8D A;  1PSR A;  1XK4 A;  2KGB C;  3K21 A;  2BCA A;  2LLS A;  2E30 A;  5HKW A;  2MRD A;  3I5G C;  2LHL A;  1SKT A;  1PSB A;  2JC2 A;  3DVE A;  3PN7 B;  1FI6 A;  5DKQ A;  3BUO B;  1F71 A;  1S3P A;  3PM8 A;  5I8N A;  1KQM C;  1M39 A;  2K7D A;  2KI4 C;  5HLO A;  3CLN A;  1ALV A;  1NP8 A;  2ZRT A;  3BQ3 A;  1FF1 A;  1ZFS A;  3KHE A;  2O60 A;  2EC6 C;  1ZUZ A;  2L4H A;  1JC2 A;  2KQ6 A;  1R6P A;  3WNX B;  4M2Q A;  4TNC A;  1RWY A;  3O2P A;  2GGZ A;  1X02 A;  3WXA A;  1JUO A;  2E6W A;  3JTD B;  2NXQ A;  1UHJ A;  1S5G Z;  2CNP A;  4AQJ A;  2JTZ A;  2LV7 A;  1SW8 A;  1AK8 A;  1H4B A;  1BLQ A;  1KFU L;  2KBI A;  2L5X B;  2HPS A;  3CWG A;  2LC5 A;  5KSZ A;  1CFC A;  3PAT A;  1CM4 A;  1B8C A;  3CGA A;  3WHU B;  1B9A A;  1DF0 B;  2LVV A;  2JTT A;  1KQM B;  2JXC A;  1PK0 D;  1A03 A;  1J7Q A;  2KI4 B;  2P6B B;  2KI6 D;  1UUR A;  1SCM C;  3NSK A;  3OP0 A;  1N0Y A;  4PHM A;  5IBW A;  2KAV A;  4DUQ A;  1CDP A;  2HQ8 A;  2LAN A;  2M9G A;  4MZJ A;  1B7T Z;  1DJX A;  2BCX A;  3OB2 B;  2K7O A;  4DRW A;  1YRU B;  1SBJ A;  1KWO B;  1UP5 A;  1DJI A;  1RRO A;  5DKR A;  1BOD A;  2WOS A;  1NIW A;  1F54 A;  2BL0 C;  4MSP A;  1BG1 A;  1M31 A;  4WRI A;  1NCZ A;  1WLZ A;  2M49 B;  1IJ5 A;  1OQP A;  2NZ0 A;  2JOJ A;  1QTX A;  2ZND A;  5D7F A;  2MLF C;  3DVJ A;  4I5L B;  1BT6 A;  4CPV A;  1DGU A;  1XK4 C;  2L98 A;  4N1G A;  5CSI A;  1BR4 B;  1IKU A;  1A75 A;  5BPJ A;  3PLF B;  1MXL C;  1R2U A;  2CBL A;  2KFF A;  4CFR A;  4HRE E;  3MSE B;  3OB1 B;  1FW4 A;  2LMV A;  4MRY A;  3D0Y B;  4YGD B;  1BR1 B;  4DS7 A;  3NSI A;  2KAY A;  1LKJ A;  1TTX A;  1AUI B;  1YUU A;  2JUL A;  3E3R A;  1NX3 A;  3BOW B;  3NXA A;  3TDU A;  1E8A A;  3OX5 A;  3VRO A;  3KPX A;  3NSL A;  3QRX A;  1DJZ A;  1KK7 Y;  2WCB A;  1J55 A;  4GPL B;  1K90 D;  1S6J A;  2I94 A;  3VRN A;  2K7B A;  1QXP A;  1L2O B;  2GV5 A;  4PE7 A;  1A2X A;  1IG5 A;  1MUX A;  2BBN A;  2M0R A;  1CM1 A;  1FPW A;  2ISD A;  3SG7 A;  4I5N B;  4OKH A;  4OCI A;  1SR6 C;  2HQW A;  2L51 A;  2OS8 C;  1M63 B;  1YVL A;  1J1E A;  2LHI A;  2G9B A;  3AAJ A;  2SAS A;  1QIV A;  1NX0 A;  2NLN A;  5PAL A;  4A4C A;  1LA0 A;  2LVJ A;  1SPY A;  1B1G A;  5K89 A;  1SRA A;  3GK1 A;  3FWB A;  4PAL A;  4PDZ A;  2KGR A;  2WCF A;  1ZAC A;  2PRU A;  2Y5I A;  4MZL A;  1U5I A;  1YUT A;  1J7P A;  1G8I A;  2FCD A;  4OVN F;  3PAL A;  4HSZ A;  1OSA A;  1WY9 A;  1QVI Z;  1EXR A;  5CSJ A;  1EH2 A;  2PSR A;  1K9P A;  2PAL A;  2LVK A;  5B8I B;  2F8P A;  1QLS A;  1A29 A;  4YGC B;  2K2F A;  2KAX A;  2Y1N A;  4N1F A;  1AP4 A;  2FJU B;  2WCE A;  3SG2 A;  4GBA A;  1Y1X A;  1TNP A;  2MBX A;  1CLB A;  1SYM A;  1K2H A;  1GGZ A;  3IQQ A;  5AXI A;  3I5I C;  1SCV A;  3SJS A;  1BU3 A;  5CSF A;  2JPT A;  2M8U A;  3BUN B;  4CFQ A;  1C7V A;  3HCM A;  2H61 C;  3F45 A;  1Y1A A;  1NUB A;  1WDC C;  1XFU O;  3EKH A;  2KDH A;  4GAO A;  3D10 A;  2WOR A;  3EK8 A;  3O78 A;  1NPQ A;  3PFV A;  1NSH A;  1YR5 A;  2LLT A;  3AAK A;  1TIZ A;  2GGM A;  4QJ4 B;  5ER4 X;  3CZT X;  1NCY A;  5HYD A;  2OPO A;  4NQG A;  4BY5 A;  4C0L A;  2JWW A;  2Y1M A;  1IWQ A;  2AMI A;  4E68 A;  1RTP 1;  2O5G A;  3PN7 C;  5FYX A;  2V53 A;  2SCP A;  4MN0 A;  1EG4 A;  1JFJ A;  1S1E A;  2DOQ A;  2JNF A;  3TUY C;  3VRR A;  1KFX L;  3FIA A;  1L7Z A;  3EVV A;  5F6T A;  1LXF C;  1ALW A;  1QLK A;  3I5I B;  5JJG A;  1F55 A;  3TDI A;  3GK2 A;  1B8L A;  1RJV A;  3BYA A;  1KSM A;  1NX1 A;  2EHB A;  3I5F B;  4PCW A;  2M1U A;  1B8R A;  1PRW A;  2JZI A;  1TOP A;  3D0Y A;  2LP3 A;  1YUS A;  2ZNE A;  1TCF A;  3BUW B;  1NWD A;  4P5O E;  2MLE C;  3JTD C;  4I5K A;  2CCM A;  1JSA A;  1J1D A;  4C0K A;  4GUK A;  1Y6W A;  1QAS A;  2KFG A;  2KQY A;  1JWD A;  2M3W A;  2PMY A;  2Q4U A;  1D1O A;  1IJ6 A;  2JU0 A;  4Q04 A;  5J3X A;  5I2O A;  1MXE A;  3KF9 A;  1K95 A;  1N65 A;  2Q91 A;  2KYF A;  1CDN A;  2KBM A;  1S5G Y;  3LK0 A;  4M2P A;  3FWC A;  4FQO A;  1CDL A;  4ZCU A;  4JWQ A;  3I5H B;  5GQQ C;  3GK4 X;  1UUS A;  1YRT B;  4HRH A;  2RGI A;  4PHJ A;  1F70 A;  3LLE A;  1S26 D;  2JT8 A;  3SIB A;  3BUM B;  2L2E A;  3BOW A;  4MEW A;  5AAN A;  2FCE A;  2AUC A;  2KSP A;  4L9M A;  4N5X A;  1KK8 C;  4YGE B;  3DD4 A;  5AEQ A;  1RK9 A;  3ICB A;  3SG5 A;  1F8H A;  1VRK A;  1G33 A;  5G08 A;  5JOL A;  1EL4 A;  1J7O A;  3TDZ A;  2M29 A;  1S6C A;  1DMO A;  1KFU S;  1XFX O;  1KCY A;  1B4C A;  3VRQ A;  2PVB A;  3PSR A;  2CT9 A;  2BKI B;  4YGB B;  4ZCV A;  2NCP A;  3EVU A;  1B47 A;  1OZS A;  3LK1 A;  4F0Z B;  3O6B A;  1QX5 B;  4BY4 A;  1Y1U A;  3NSO A;  3SIA A;  3O4Y A;  3ZNI A;  2G2B A;  2LM5 A;  1SCM B;  1S6I A;  2EGD A;  2F3Z A;  3OX6 A;  4GGF A;  1LIN A;  1OMV A;  1IGV A;  1V1G A;  1DVI A;  2A4J A;  1S36 A;  1YUR A;  2AAO A;  1BOC A;  4GGF C;  1CFF A;  3CR5 X;  1SNL A;  4ETO A;  5I2L A;  4CID A;  2JT0 A;  2BL0 B;  2LNK A;  2MA2 A;  1C07 A;  2MHH A;  2WND A;  4GFT A;  4PHN A;  1BJF A;  1CFD A;  2M97 A;  4CLN A;  1L2O C;  3CTN A;  1KQV A;  1WLM A;  1F4O A;  2ZKM X;  2D8N A;  4JPZ B;  1QX2 A;  3I5G B;  1DT7 B;  5D69 A;  4NDB A;  3FS7 A;  2OS8 B;  4YRU A;  2LE9 B;  5HKZ A;  1ZOT B;  2I18 A;  2FOT A;  1TNX A;  1UHH A;  2F2O A;  1DJH A;  2MJW B;  1A4P A;  3IF7 A;  1WRZ A;  1LVC D;  1OZO A;  1NYA A;  2WC8 A;  3AKB A;  2VRG A;  4R1E A;  2NCO A;  2R2I A;  4AQI A;  1J7R A;  2TN4 A;  2L0P A;  1M46 A;  1QV0 A;  1K93 D;  2ZN9 A;  1BF5 A;  2HET A;  2F33 A;  1V1F A;  1RFJ A;  1EG3 A;  1HT9 A;  1UWO A;  3EVR A;  3IQO A;  3BUX B;  1GGW A;  1CMG A;  4DCK A;  1TNW A;  4XYN A;  5CPV A;  1K96 A;  2Y4Q A;  3JVT C;  4UPG A;  1PVA A;  2LCP A;  1KFX S;  4WQ2 A;  5TNC A;  2JXL A;  1SMG A;  3KO0 A;  1UHK A;  4JQ0 D;  3TS5 C;  1CLL A;  1QX7 A;  1BMO A;  3A8R A;  5KU1 A;  3LL8 B;  2KOT A;  1KSO A;  3DF0 A;  4NDC A;  1B7T Y;  3DF0 B;  1K9K A;  1AJ5 A;  2M7N A;  5DKN A;  1OMR A;  4DIR A;  2K0J A; 
#chains in the Genus database with same CATH topology
 4XJK A;  1SL9 A;  3NHT A;  3TZ1 A;  1JF0 A;  3AKA A;  1PVB A;  2FJY A;  3I5H C;  1A75 B;  2PAS A;  4GGN A;  4OZD A;  2LLU A;  4AOM A;  1OW4 A;  2BCB A;  2B1U A;  3CR2 A;  1ODB A;  2I7A A;  5HKY A;  1OMD A;  1AHR A;  1HQV A;  2QAC A;  3SS4 A;  3WHT B;  1CLM A;  1Y0V H;  3VRP A;  4GNK B;  4MBE A;  2K8M B;  1YTZ C;  2L5Y A;  2QEV A;  1GJY A;  3RM1 A;  2BNX A;  1W7J B;  2HF5 A;  4ORA B;  1CB1 A;  2JRF A;  4D1E A;  2I2R E;  5I2Q A;  1Z2C B;  1MQ1 A;  2K7C A;  4IL1 A;  1IQ3 A;  1REC A;  1TRF A;  1XFW O;  2KI6 C;  1JBA A;  2BBM A;  2P70 A;  4OV2 A;  1MWN A;  1K94 A;  2KLD A;  4YI9 A;  3TUY B;  1DF0 A;  3DY9 A;  1K8U A;  4YBH B;  1DJW A;  3EG5 B;  1F4Q A;  1CFP A;  1N2D A;  3L47 A;  2BKH B;  1MR8 A;  1KK7 Z;  1NX2 A;  3CR4 X;  4MLW A;  1DEL A;  2KHN A;  2ZN8 A;  3LCP C;  1UHI A;  1AVS A;  1IQ5 A;  3EK7 A;  4M2O A;  3BXK A;  1SL8 A;  2LMU A;  2K61 A;  2LP2 A;  1WRK A;  2OTG C;  4QJ3 B;  3VGO A;  5AFP A;  4PE4 A;  3DVK A;  1XFZ O;  2JNX A;  2ZFD A;  3SG6 A;  2PQL A;  3ZWH A;  3HX4 A;  1XYD A;  4ORB B;  3R72 A;  1XA5 A;  5CSN A;  1CMF A;  4ORC B;  1NCX A;  1U5I B;  4OR9 B;  4PE0 A;  2IS9 A;  1PUL A;  3S0D A;  2JT3 A;  3A4U B;  3EK4 A;  2QPT A;  2BEC A;  4P2Y B;  1XFY O;  2LVI A;  1QIW A;  1QV1 A;  1DJY A;  2KYC A;  1YX8 A;  2L4I A;  4A4B A;  3RZS A;  3R1V A;  4USL A;  1SR6 B;  5HLV A;  2ZRS A;  1FI5 A;  1AJ4 A;  1OOJ A;  1FBV A;  1K9U A;  1DTL A;  4YGA A;  1XFV O;  3PJI A;  3Q8I A;  3RLZ A;  3CZ0 A;  1IH0 A;  1MHO A;  1OE9 B;  1QVI Y;  1QAT A;  3M0W A;  4PE1 A;  1JF2 A;  2H2K A;  1CTR A;  1WDC B;  2BE4 A;  2F2P A;  2OTG B;  1EJ3 A;  1M45 A;  3D78 A;  1UHN A;  1YVH A;  4ICB A;  2BE6 A;  1KWO C;  2M1K B;  4QJ5 B;  5AER A;  1SL7 A;  1C7W A;  3JVT B;  1P28 A;  2JQ6 A;  1LA3 A;  3B86 A;  1DGV A;  1XO5 A;  4I5J A;  1QS7 A;  3C1V A;  4HRG A;  4NDD A;  3SS3 A;  3TS5 B;  1CNP A;  1CDM A;  1IRJ A;  3GOF A;  4MRX A;  1YX7 A;  3PM2 A;  4FTG A;  2QEO A;  2CXJ A;  1MF8 B;  1C3Y A;  1CKK A;  5KTY A;  2KFH A;  4MZK A;  1ZMZ A;  1XVJ A;  2COL B;  1TCO B;  3SG4 A;  2LUX A;  1GQM A;  1WRL A;  2LUC A;  2MAZ A;  1H8B A;  2K2A A;  2CTN A;  1W9Z A;  1SK6 D;  1QJT A;  4PHK A;  3CAB A;  1SY9 A;  2LAP A;  3EKJ A;  2LMT A;  1G4Y R;  3CS1 A;  1PAL A;  4XJK B;  1JFK A;  2EC6 B;  2F3Y A;  1LS8 A;  3CZ2 A;  3I5F C;  3OHM B;  4YI8 A;  4C0J A;  1Q80 A;  1TN4 A;  2H61 A;  3SG3 A;  3FE8 A;  2QDI A;  4F7F A;  2KNE A;  5ER5 A;  3D75 A;  2L50 A;  1KK8 B;  2P71 A;  1TNQ A;  4WQ3 A;  3BFH A;  2WCL A;  3KEV A;  2GTE A;  1ORG A;  1W7I B;  4MVF A;  3H4S E;  1DJG A;  3DVM A;  5FI2 A;  4U8D A;  1IIO A;  1PSR A;  3DXL A;  1XK4 A;  2KGB C;  3K21 A;  2BCA A;  2LLS A;  2E30 A;  5HKW A;  2MRD A;  3I5G C;  1DEK A;  2LHL A;  1SKT A;  1PSB A;  2JC2 A;  3DVE A;  3PN7 B;  1FI6 A;  5DKQ A;  3BUO B;  1F71 A;  1S3P A;  3PM8 A;  5I8N A;  1KQM C;  1M39 A;  2K7D A;  2KI4 C;  5HLO A;  3CLN A;  1ALV A;  1NP8 A;  2ZRT A;  3BQ3 A;  3UO9 A;  1ZFS A;  1FF1 A;  3KHE A;  2O60 A;  2EC6 C;  1ZUZ A;  2L4H A;  1JC2 A;  2KQ6 A;  1R6P A;  3WNX B;  4M2Q A;  4TNC A;  1RWY A;  3O2P A;  2GGZ A;  1X02 A;  3WXA A;  1JUO A;  2WCH A;  2E6W A;  3JTD B;  2NXQ A;  1UHJ A;  1S5G Z;  2CNP A;  4AQJ A;  2JTZ A;  2LV7 A;  1SW8 A;  1AK8 A;  1H4B A;  1BLQ A;  1KFU L;  2KBI A;  2L5X B;  2HPS A;  3CWG A;  2LC5 A;  5KSZ A;  1CFC A;  3PAT A;  1CM4 A;  1B8C A;  3CGA A;  3WHU B;  1B9A A;  1DF0 B;  2LVV A;  2JTT A;  1KQM B;  2JXC A;  1PK0 D;  1A03 A;  1J7Q A;  2KI4 B;  2P6B B;  2QEB A;  2KI6 D;  3D73 A;  1UUR A;  1SCM C;  3NSK A;  2ERB A;  1N0Y A;  3OP0 A;  3CYZ A;  4PHM A;  5IBW A;  2KAV A;  3D77 A;  4DUQ A;  1CDP A;  3CDN A;  2HQ8 A;  2LAN A;  2M9G A;  4MZJ A;  1B7T Z;  1DJX A;  2BCX A;  3BFB A;  3OB2 B;  2K7O A;  4DRW A;  1YRU B;  1SBJ A;  1KWO B;  1UP5 A;  1DJI A;  3SS5 A;  1RRO A;  5DKR A;  1BOD A;  3OBV A;  2WOS A;  1NIW A;  1F54 A;  2BL0 C;  4MSP A;  1BG1 A;  1M31 A;  4WRI A;  3FE9 A;  3QME A;  1NCZ A;  1WLZ A;  2M49 B;  1IJ5 A;  1OOG A;  1OQP A;  5HL1 A;  2NZ0 A;  3D76 A;  2JOJ A;  1QTX A;  2ZND A;  5D7F A;  2MLF C;  3DVJ A;  4I5L B;  1BT6 A;  4CPV A;  1DGU A;  1XK4 C;  4INX A;  2L98 A;  4N1G A;  5CSI A;  1BR4 B;  3S0B A;  1IKU A;  1A75 A;  5BPJ A;  3PLF B;  1MXL C;  1R2U A;  2CBL A;  2KFF A;  4CFR A;  4HRE E;  3MSE B;  3OB1 B;  1FW4 A;  2LMV A;  1SSE B;  4MRY A;  3D0Y B;  4YGD B;  1BR1 B;  3O4X A;  4DS7 A;  3NSI A;  2KAY A;  1LKJ A;  1TTX A;  1AUI B;  1YUU A;  2JUL A;  3E3R A;  1NX3 A;  3BOW B;  5DIC A;  3NXA A;  3TDU A;  1E8A A;  3OX5 A;  3VRO A;  3KPX A;  3NSL A;  3QRX A;  1DJZ A;  3NHI A;  1KK7 Y;  3BJH A;  2WCB A;  1J55 A;  3DZT A;  4INW A;  4GPL B;  1K90 D;  3R1P A;  1S6J A;  2I94 A;  3VRN A;  2K7B A;  1QXP A;  4KYN A;  1L2O B;  2GV5 A;  4PE7 A;  1A2X A;  1IG5 A;  1MUX A;  2BBN A;  5FI6 A;  2M0R A;  1CM1 A;  1FPW A;  2ISD A;  3SG7 A;  4I5N B;  4OKH A;  4OCI A;  1SR6 C;  2HQW A;  2L51 A;  2OS8 C;  1M63 B;  1YVL A;  1J1E A;  2LHI A;  2G9B A;  2WC5 A;  3AAJ A;  3R1O A;  2SAS A;  1QIV A;  1NX0 A;  1OOI X;  2NLN A;  5PAL A;  4A4C A;  1LA0 A;  2LVJ A;  1SPY A;  3VB1 A;  1B1G A;  5K89 A;  1SRA A;  1C3Z A;  4F0Z B;  3GK1 A;  3FWB A;  4PAL A;  4PDZ A;  3V2L A;  2KGR A;  2WCF A;  1ZAC A;  2PRU A;  2Y5I A;  4MZL A;  1U5I A;  1YUT A;  1J7P A;  3D74 A;  1G8I A;  2FCD A;  4OVN F;  3PAL A;  4HSZ A;  1OSA A;  1WY9 A;  2JPO A;  2WCM A;  1QVI Z;  1EXR A;  5CSJ A;  1EH2 A;  2PSR A;  1K9P A;  2PAL A;  2LVK A;  5B8I B;  2F8P A;  1QLS A;  2KPH A;  1A29 A;  4YGC B;  2K2F A;  2KAX A;  2Y1N A;  3B87 A;  4N1F A;  2M7L A;  1AP4 A;  2FJU B;  2WCE A;  3SG2 A;  4GBA A;  1Y1X A;  1TNP A;  2MBX A;  1CLB A;  1SYM A;  1K2H A;  1GGZ A;  3IQQ A;  5AXI A;  3I5I C;  1SCV A;  3SJS A;  1BU3 A;  5CSF A;  2JPT A;  2M8U A;  3BUN B;  4CFQ A;  3BFA A;  1C7V A;  3HCM A;  2H61 C;  3F45 A;  1Y1A A;  1NUB A;  1QWV A;  1WDC C;  1XFU O;  3EKH A;  2KDH A;  4GAO A;  3D10 A;  2WOR A;  3EK8 A;  3NGV A;  3O78 A;  3UNW A;  1NPQ A;  3DYE A;  3PFV A;  1NSH A;  1YR5 A;  2LLT A;  3K1E A;  3AAK A;  1TIZ A;  2GGM A;  4QJ4 B;  5ER4 X;  2PYQ A;  3CZT X;  1NCY A;  3N7H A;  2OPO A;  5HYD A;  2WCJ A;  4NQG A;  4BY5 A;  4C0L A;  3S0A A;  2JWW A;  2Y1M A;  1IWQ A;  2AMI A;  4E68 A;  1RTP 1;  2O5G A;  3PN7 C;  5FYX A;  2V53 A;  2SCP A;  4MN0 A;  1EG4 A;  1JFJ A;  1S1E A;  2DOQ A;  2JNF A;  3TUY C;  3VRR A;  1KFX L;  3FIA A;  1L7Z A;  3EVV A;  5F6T A;  1LXF C;  1GM0 A;  1ALW A;  1QLK A;  3I5I B;  5JJG A;  1F55 A;  3TDI A;  3GK2 A;  1B8L A;  1RJV A;  3BYA A;  1KSM A;  1NX1 A;  2EHB A;  3S0E A;  3I5F B;  4PCW A;  3B6X A;  2M1U A;  1B8R A;  1Z4H A;  4IJ7 A;  1PRW A;  2JZI A;  1TOP A;  3D0Y A;  2LP3 A;  1YUS A;  2YGU A;  1TCF A;  2ZNE A;  1NWD A;  3BUW B;  2MLE C;  3JTD C;  4I5K A;  4P5O E;  2CCM A;  3S0G A;  3OGN A;  1JSA A;  1J1D A;  2H8V A;  2KLE A;  4C0K A;  4GUK A;  1Y6W A;  1QAS A;  3L4A A;  2KFG A;  2KQY A;  1JWD A;  2M3W A;  2PMY A;  2Q4U A;  1D1O A;  1IJ6 A;  2JU0 A;  3CZ1 A;  4Q04 A;  5J3X A;  5I2O A;  1MXE A;  3KF9 A;  1K95 A;  1N65 A;  2Q91 A;  2K60 A;  2KYF A;  1CDN A;  5FI7 A;  2KBM A;  1S5G Y;  1T14 A;  3LK0 A;  4M2P A;  3FWC A;  4FQO A;  1CDL A;  4ZCU A;  4JWQ A;  3I5H B;  5GQQ C;  3GK4 X;  2BAP A;  1UUS A;  1YRT B;  4HRH A;  2RGI A;  4PHJ A;  1DC1 A;  1F70 A;  3LLE A;  1S26 D;  2JT8 A;  3SIB A;  3BUM B;  2L2E A;  3BOW A;  4MEW A;  5AAN A;  2FCE A;  4JKT A;  1DQE A;  2AUC A;  2KSP A;  3FE6 A;  1TUZ A;  4L9M A;  4N5X A;  1KK8 C;  3L4L A;  4YGE B;  3DD4 A;  5AEQ A;  1RK9 A;  3ICB A;  3SG5 A;  1F8H A;  1VRK A;  1G33 A;  5G08 A;  5JOL A;  1EL4 A;  1J7O A;  3TDZ A;  2M29 A;  1S6C A;  1DMO A;  1KFU S;  1XFX O;  1KCY A;  1B4C A;  3VRQ A;  2PVB A;  3PSR A;  2CT9 A;  2BKI B;  3B7A A;  4YGB B;  2NCP A;  3EVU A;  1B47 A;  1OZS A;  3LK1 A;  4ZCV A;  3O6B A;  1QX5 B;  2WC6 A;  4BY4 A;  1Y1U A;  3IVT A;  3NSO A;  3SIA A;  3O4Y A;  3ZNI A;  2G2B A;  2LM5 A;  1SCM B;  1S6I A;  2EGD A;  2F3Z A;  3OX6 A;  2QEH A;  4GGF A;  1LIN A;  1OOH A;  1OMV A;  1IGV A;  1V1G A;  1DVI A;  2A4J A;  1S36 A;  1YUR A;  2AAO A;  1BOC A;  4GGF C;  1CFF A;  5I94 A;  4JD9 A;  3CR5 X;  1SNL A;  4ETO A;  1OOF A;  5I2L A;  4CID A;  2JT0 A;  2BL0 B;  2LNK A;  2MA2 A;  1C07 A;  2MHH A;  2WND A;  4GFT A;  4PHN A;  1BJF A;  1CFD A;  2M97 A;  4CLN A;  1L2O C;  3CTN A;  1KQV A;  1WLM A;  3S0F A;  1F4O A;  2ZKM X;  2D8N A;  4JPZ B;  1QX2 A;  3I5G B;  1DT7 B;  5D69 A;  4NDB A;  3FS7 A;  2OS8 B;  4YRU A;  2LE9 B;  5HKZ A;  1ZOT B;  2I18 A;  2FOT A;  1TNX A;  1UHH A;  2F2O A;  1DJH A;  2MJW B;  1A4P A;  2WCK A;  3IF7 A;  1WRZ A;  1LVC D;  3B88 A;  1OZO A;  1NYA A;  2WC8 A;  3AKB A;  2VRG A;  4R1E A;  2NCO A;  2R2I A;  4AQI A;  1J7R A;  2TN4 A;  2L0P A;  1M46 A;  1QV0 A;  2L2C A;  4PT1 A;  1K93 D;  1TWO A;  2ZN9 A;  5EL2 A;  1BF5 A;  2HET A;  2F33 A;  1V1F A;  1RFJ A;  1EG3 A;  1HT9 A;  1UWO A;  3EVR A;  3IQO A;  3BUX B;  1XFR A;  1GGW A;  1CMG A;  4DCK A;  1TNW A;  4XYN A;  5CPV A;  1K96 A;  2Y4Q A;  3JVT C;  4UPG A;  1PVA A;  2LCP A;  1KFX S;  4WQ2 A;  5TNC A;  2JXL A;  1SMG A;  3KO0 A;  5D3O A;  1UHK A;  4JQ0 D;  3TS5 C;  1CLL A;  1QX7 A;  1BMO A;  1TUJ A;  3A8R A;  5KU1 A;  4FQT A;  3LL8 B;  2KOT A;  1KSO A;  3DF0 A;  4NDC A;  1B7T Y;  3DF0 B;  1K9K A;  1AJ5 A;  2M7N A;  5DKN A;  1OMR A;  4DIR A;  2K0J A; 
#chains in the Genus database with same CATH homology
 4XJK A;  1SL9 A;  3TZ1 A;  1JF0 A;  3AKA A;  1PVB A;  3I5H C;  1A75 B;  2PAS A;  4GGN A;  2LLU A;  4AOM A;  2BCB A;  2B1U A;  3CR2 A;  1ODB A;  2I7A A;  5HKY A;  1OMD A;  1AHR A;  1HQV A;  2QAC A;  3WHT B;  1CLM A;  1Y0V H;  3VRP A;  4GNK B;  4MBE A;  2K8M B;  1YTZ C;  1GJY A;  3RM1 A;  2HF5 A;  1W7J B;  4ORA B;  1CB1 A;  2JRF A;  4D1E A;  2I2R E;  5I2Q A;  1MQ1 A;  2K7C A;  4IL1 A;  1IQ3 A;  1REC A;  1TRF A;  1XFW O;  2KI6 C;  1JBA A;  2BBM A;  4OV2 A;  1MWN A;  1K94 A;  4YI9 A;  3TUY B;  1DF0 A;  4YBH B;  1K8U A;  1DJW A;  1F4Q A;  1CFP A;  1N2D A;  4MLW A;  2BKH B;  1MR8 A;  1KK7 Z;  1NX2 A;  3CR4 X;  2M7L A;  2KHN A;  2ZN8 A;  3LCP C;  1UHI A;  1AVS A;  1IQ5 A;  3EK7 A;  4M2O A;  3BXK A;  1SL8 A;  2LMU A;  2K61 A;  2LP2 A;  1WRK A;  2OTG C;  4QJ3 B;  3VGO A;  5AFP A;  4PE4 A;  3DVK A;  1XFZ O;  2JNX A;  2ZFD A;  3SG6 A;  3ZWH A;  3HX4 A;  1XYD A;  4ORB B;  1XA5 A;  5CSN A;  1CMF A;  4ORC B;  1NCX A;  1U5I B;  4OR9 B;  4PE0 A;  2IS9 A;  1PUL A;  2JT3 A;  3A4U B;  3EK4 A;  2QPT A;  2BEC A;  4P2Y B;  1XFY O;  2LVI A;  1QIW A;  1QV1 A;  1DJY A;  2KYC A;  1YX8 A;  2L4I A;  4A4B A;  4USL A;  1SR6 B;  5HLV A;  2ZRS A;  1FI5 A;  1AJ4 A;  1OOJ A;  1FBV A;  1K9U A;  1DTL A;  4YGA A;  1XFV O;  3RLZ A;  1IH0 A;  1MHO A;  1OE9 B;  1QVI Y;  1QAT A;  3M0W A;  4PE1 A;  1JF2 A;  2H2K A;  1CTR A;  1WDC B;  2BE4 A;  2F2P A;  2OTG B;  1EJ3 A;  1M45 A;  1UHN A;  1YVH A;  4ICB A;  2BE6 A;  1KWO C;  2M1K B;  4QJ5 B;  5AER A;  1SL7 A;  1C7W A;  3JVT B;  2JQ6 A;  1LA3 A;  1DGV A;  1XO5 A;  4I5J A;  1QS7 A;  3C1V A;  4HRG A;  4NDD A;  3TS5 B;  1CNP A;  1CDM A;  1IRJ A;  3GOF A;  4MRX A;  1YX7 A;  4FTG A;  2CXJ A;  1MF8 B;  1CKK A;  5KTY A;  2KFH A;  4MZK A;  1ZMZ A;  1XVJ A;  2COL B;  1TCO B;  3SG4 A;  2LUX A;  1GQM A;  1WRL A;  2LUC A;  2MAZ A;  1H8B A;  2K2A A;  2CTN A;  1SK6 D;  1QJT A;  4PHK A;  1SY9 A;  2LAP A;  3EKJ A;  2LMT A;  1G4Y R;  3CS1 A;  1PAL A;  4XJK B;  1JFK A;  2EC6 B;  2F3Y A;  4YI8 A;  3I5F C;  3OHM B;  4C0J A;  1Q80 A;  1TN4 A;  2H61 A;  3SG3 A;  2KNE A;  5ER5 A;  2L50 A;  1KK8 B;  4WQ3 A;  1TNQ A;  3KEV A;  1W7I B;  4MVF A;  3H4S E;  1DJG A;  3DVM A;  4U8D A;  1PSR A;  1XK4 A;  2KGB C;  3K21 A;  2BCA A;  2LLS A;  2E30 A;  5HKW A;  2MRD A;  3I5G C;  2LHL A;  1SKT A;  1PSB A;  2JC2 A;  3DVE A;  3PN7 B;  1FI6 A;  5DKQ A;  3BUO B;  1F71 A;  1S3P A;  3PM8 A;  5I8N A;  1KQM C;  1M39 A;  2K7D A;  2KI4 C;  5HLO A;  3CLN A;  1ALV A;  1NP8 A;  2ZRT A;  3BQ3 A;  1FF1 A;  1ZFS A;  3KHE A;  2O60 A;  2EC6 C;  1ZUZ A;  2L4H A;  1JC2 A;  2KQ6 A;  1R6P A;  3WNX B;  4M2Q A;  4TNC A;  1RWY A;  3O2P A;  2GGZ A;  1X02 A;  3WXA A;  1JUO A;  2E6W A;  3JTD B;  2NXQ A;  1UHJ A;  1S5G Z;  2CNP A;  4AQJ A;  2JTZ A;  2LV7 A;  1SW8 A;  1AK8 A;  1H4B A;  1BLQ A;  1KFU L;  2KBI A;  2L5X B;  2HPS A;  3CWG A;  2LC5 A;  5KSZ A;  1CFC A;  3PAT A;  1CM4 A;  1B8C A;  3CGA A;  3WHU B;  1B9A A;  1DF0 B;  2LVV A;  2JTT A;  1KQM B;  2JXC A;  1PK0 D;  1A03 A;  1J7Q A;  2KI4 B;  2P6B B;  2KI6 D;  1UUR A;  1SCM C;  3NSK A;  3OP0 A;  1N0Y A;  4PHM A;  5IBW A;  2KAV A;  4DUQ A;  1CDP A;  2HQ8 A;  2LAN A;  2M9G A;  4MZJ A;  1B7T Z;  1DJX A;  2BCX A;  3OB2 B;  2K7O A;  4DRW A;  1YRU B;  1SBJ A;  1KWO B;  1UP5 A;  1DJI A;  1RRO A;  5DKR A;  1BOD A;  2WOS A;  1NIW A;  1F54 A;  2BL0 C;  4MSP A;  1BG1 A;  1M31 A;  4WRI A;  1NCZ A;  1WLZ A;  2M49 B;  1IJ5 A;  1OQP A;  2NZ0 A;  2JOJ A;  1QTX A;  2ZND A;  5D7F A;  2MLF C;  3DVJ A;  4I5L B;  1BT6 A;  4CPV A;  1DGU A;  1XK4 C;  2L98 A;  4N1G A;  5CSI A;  1BR4 B;  1IKU A;  1A75 A;  5BPJ A;  3PLF B;  1MXL C;  1R2U A;  2CBL A;  2KFF A;  4CFR A;  4HRE E;  3MSE B;  3OB1 B;  1FW4 A;  2LMV A;  4MRY A;  3D0Y B;  4YGD B;  1BR1 B;  4DS7 A;  3NSI A;  2KAY A;  1LKJ A;  1TTX A;  1AUI B;  1YUU A;  2JUL A;  3E3R A;  1NX3 A;  3BOW B;  3NXA A;  3TDU A;  1E8A A;  3OX5 A;  3VRO A;  3KPX A;  3NSL A;  3QRX A;  1DJZ A;  1KK7 Y;  2WCB A;  1J55 A;  4GPL B;  1K90 D;  1S6J A;  2I94 A;  3VRN A;  2K7B A;  1QXP A;  1L2O B;  2GV5 A;  4PE7 A;  1A2X A;  1IG5 A;  1MUX A;  2BBN A;  2M0R A;  1CM1 A;  1FPW A;  2ISD A;  3SG7 A;  4I5N B;  4OKH A;  4OCI A;  1SR6 C;  2HQW A;  2L51 A;  2OS8 C;  1M63 B;  1YVL A;  1J1E A;  2LHI A;  2G9B A;  3AAJ A;  2SAS A;  1QIV A;  1NX0 A;  2NLN A;  5PAL A;  4A4C A;  1LA0 A;  2LVJ A;  1SPY A;  1B1G A;  5K89 A;  1SRA A;  3GK1 A;  3FWB A;  4PAL A;  4PDZ A;  2KGR A;  2WCF A;  1ZAC A;  2PRU A;  2Y5I A;  4MZL A;  1U5I A;  1YUT A;  1J7P A;  1G8I A;  2FCD A;  4OVN F;  3PAL A;  4HSZ A;  1OSA A;  1WY9 A;  1QVI Z;  1EXR A;  5CSJ A;  1EH2 A;  2PSR A;  1K9P A;  2PAL A;  2LVK A;  5B8I B;  2F8P A;  1QLS A;  1A29 A;  4YGC B;  2K2F A;  2KAX A;  2Y1N A;  4N1F A;  1AP4 A;  2FJU B;  2WCE A;  3SG2 A;  4GBA A;  1Y1X A;  1TNP A;  2MBX A;  1CLB A;  1SYM A;  1K2H A;  1GGZ A;  3IQQ A;  5AXI A;  3I5I C;  1SCV A;  3SJS A;  1BU3 A;  5CSF A;  2JPT A;  2M8U A;  3BUN B;  4CFQ A;  1C7V A;  3HCM A;  2H61 C;  3F45 A;  1Y1A A;  1NUB A;  1WDC C;  1XFU O;  3EKH A;  2KDH A;  4GAO A;  3D10 A;  2WOR A;  3EK8 A;  3O78 A;  1NPQ A;  3PFV A;  1NSH A;  1YR5 A;  2LLT A;  3AAK A;  1TIZ A;  2GGM A;  4QJ4 B;  5ER4 X;  3CZT X;  1NCY A;  5HYD A;  2OPO A;  4NQG A;  4BY5 A;  4C0L A;  2JWW A;  2Y1M A;  1IWQ A;  2AMI A;  4E68 A;  1RTP 1;  2O5G A;  3PN7 C;  5FYX A;  2V53 A;  2SCP A;  4MN0 A;  1EG4 A;  1JFJ A;  1S1E A;  2DOQ A;  2JNF A;  3TUY C;  3VRR A;  1KFX L;  3FIA A;  1L7Z A;  3EVV A;  5F6T A;  1LXF C;  1ALW A;  1QLK A;  3I5I B;  5JJG A;  1F55 A;  3TDI A;  3GK2 A;  1B8L A;  1RJV A;  3BYA A;  1KSM A;  1NX1 A;  2EHB A;  3I5F B;  4PCW A;  2M1U A;  1B8R A;  1PRW A;  2JZI A;  1TOP A;  3D0Y A;  2LP3 A;  1YUS A;  2ZNE A;  1TCF A;  3BUW B;  1NWD A;  4P5O E;  2MLE C;  3JTD C;  4I5K A;  2CCM A;  1JSA A;  1J1D A;  4C0K A;  4GUK A;  1Y6W A;  1QAS A;  2KFG A;  2KQY A;  1JWD A;  2M3W A;  2PMY A;  2Q4U A;  1D1O A;  1IJ6 A;  2JU0 A;  4Q04 A;  5J3X A;  5I2O A;  1MXE A;  3KF9 A;  1K95 A;  1N65 A;  2Q91 A;  2KYF A;  1CDN A;  2KBM A;  1S5G Y;  3LK0 A;  4M2P A;  3FWC A;  4FQO A;  1CDL A;  4ZCU A;  4JWQ A;  3I5H B;  5GQQ C;  3GK4 X;  1UUS A;  1YRT B;  4HRH A;  2RGI A;  4PHJ A;  1F70 A;  3LLE A;  1S26 D;  2JT8 A;  3SIB A;  3BUM B;  2L2E A;  3BOW A;  4MEW A;  5AAN A;  2FCE A;  2AUC A;  2KSP A;  4L9M A;  4N5X A;  1KK8 C;  4YGE B;  3DD4 A;  5AEQ A;  1RK9 A;  3ICB A;  3SG5 A;  1F8H A;  1VRK A;  1G33 A;  5G08 A;  5JOL A;  1EL4 A;  1J7O A;  3TDZ A;  2M29 A;  1S6C A;  1DMO A;  1KFU S;  1XFX O;  1KCY A;  1B4C A;  3VRQ A;  2PVB A;  3PSR A;  2CT9 A;  2BKI B;  4YGB B;  4ZCV A;  2NCP A;  3EVU A;  1B47 A;  1OZS A;  3LK1 A;  4F0Z B;  3O6B A;  1QX5 B;  4BY4 A;  1Y1U A;  3NSO A;  3SIA A;  3O4Y A;  3ZNI A;  2G2B A;  2LM5 A;  1SCM B;  1S6I A;  2EGD A;  2F3Z A;  3OX6 A;  4GGF A;  1LIN A;  1OMV A;  1IGV A;  1V1G A;  1DVI A;  2A4J A;  1S36 A;  1YUR A;  2AAO A;  1BOC A;  4GGF C;  1CFF A;  3CR5 X;  1SNL A;  4ETO A;  5I2L A;  4CID A;  2JT0 A;  2BL0 B;  2LNK A;  2MA2 A;  1C07 A;  2MHH A;  2WND A;  4GFT A;  4PHN A;  1BJF A;  1CFD A;  2M97 A;  4CLN A;  1L2O C;  3CTN A;  1KQV A;  1WLM A;  1F4O A;  2ZKM X;  2D8N A;  4JPZ B;  1QX2 A;  3I5G B;  1DT7 B;  5D69 A;  4NDB A;  3FS7 A;  2OS8 B;  4YRU A;  2LE9 B;  5HKZ A;  1ZOT B;  2I18 A;  2FOT A;  1TNX A;  1UHH A;  2F2O A;  1DJH A;  2MJW B;  1A4P A;  3IF7 A;  1WRZ A;  1LVC D;  1OZO A;  1NYA A;  2WC8 A;  3AKB A;  2VRG A;  4R1E A;  2NCO A;  2R2I A;  4AQI A;  1J7R A;  2TN4 A;  2L0P A;  1M46 A;  1QV0 A;  1K93 D;  2ZN9 A;  1BF5 A;  2HET A;  2F33 A;  1V1F A;  1RFJ A;  1EG3 A;  1HT9 A;  1UWO A;  3EVR A;  3IQO A;  3BUX B;  1GGW A;  1CMG A;  4DCK A;  1TNW A;  4XYN A;  5CPV A;  1K96 A;  2Y4Q A;  3JVT C;  4UPG A;  1PVA A;  2LCP A;  1KFX S;  4WQ2 A;  5TNC A;  2JXL A;  1SMG A;  3KO0 A;  1UHK A;  4JQ0 D;  3TS5 C;  1CLL A;  1QX7 A;  1BMO A;  3A8R A;  5KU1 A;  3LL8 B;  2KOT A;  1KSO A;  3DF0 A;  4NDC A;  1B7T Y;  3DF0 B;  1K9K A;  1AJ5 A;  2M7N A;  5DKN A;  1OMR A;  4DIR A;  2K0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...