3BOWB

Structure of m-calpain in complex with calpastatin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
174
structure length
174
Chain Sequence
SEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain-2 catalytic subunit
publication title Calcium-bound structure of calpain and its mechanism of inhibition by calpastatin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3bowB00
1GGWA 2KQ6A 1SPYA 1A75B 2M0RA 4I5JA 4ORCB 3EKJA 2AMIA 2FOTA 4QJ3B 5CSIA 1NX2A 2LNKA 3VRNA 4FQOA 2EGDA 1UHHA 2LUCA 4PCWA 1QV0A 1YUSA 1SCMC 4MZKA 5HKWA 3C1VA 4YGBB 3BUNB 5DKNA 2LLSA 4AQIA 1EL4A 1NYAA 2L4HA 1Q80A 2JT0A 2ZFDA 2K7DA 1DGUA 3K21A 5DKRA 5AANA 1PALA 2DOQA 1TNWA 1KCYA 4R1EA 1GJYA 1CLMA 2EHBA 2OS8C 1IKUA 2I94A 3RLZA 2M97A 3CR5X 4MN0A 1AJ4A 1L7ZA 1F70A 2JXLA 3H4SE 3I5GC 1IH0A 4MZLA 1CDLA 1AJ5A 1QV1A 1TNPA 4OV2A 3AAKA 1EH2A 4N1GA 3GOFA 5AEQA 1FI5A 3D0YB 2F33A 2L50A 1MXEA 3FWCA 2K7BA 1W7JB 3TZ1A 1LINA 1NSHA 1KFXL 4GUKA 1S5GY 4DCKA 1IJ6A 1XYDA 2B1UA 2KFFA 3AKBA 2OS8B 3DVMA 1PK0D 2JZIA 4WRIA 1SL9A 1N0YA 2MLEC 4XYNA 3O2PA 1L2OC 1SMGA 1V1FA 4TNCA 3I5GB 2LVKA 2BCXA 3PFVA 1TCOB 3CTNA 3BXKA 3MSEB 2WCEA 3TS5B 1S6CA 1OMRA 5PALA 1UUSA 4WQ2A 2LVVA 5KSZA 1KFUS 4N1FA 4CPVA 1BMOA 2BCBA 1XK4C 1CFDA 2KI4B 4YGAA 1OOJA 2I2RE 1NCZA 2WC8A 2M1UA 3RM1A 2ZNEA 1WRKA 1YRTB 4HRGA 3BUWB 1AP4A 1CLBA 2GGZA 1F4QA 3A8RA 1MXLC 4ICBA 3ZNIA 4YI9A 1FF1A 2JQ6A 1L2OB 2NXQA 5B8IB 1QX7A 3SG4A 1RWYA 1ZFSA 2M8UA 2V53A 1YVLA 2OPOA 1XK4A 3KPXA 4CFRA 1DJZA 3IQOA 4YGDB 4MRYA 2LMUA 4PHJA 1QS7A 1BG1A 1MF8B 2MJWB 1J1DA 1IRJA 1A4PA 4GPLB 4C0KA 1OMDA 1NX1A 1TTXA 4ZCUA 3VRRA 2KSPA 2NLNA 1B7TY 3EVVA 3HCMA 2KDHA 3M0WA 5D7FA 4USLA 3DF0B 5DKQA 5KTYA 1LA0A 1FI6A 1YVHA 1CTRA 2LVIA 3SG3A 2CCMA 1GQMA 3JTDC 2LCPA 2RGIA 1N65A 1Y0VH 3I5HB 1CFCA 2ZN8A 4YGCB 4QJ4B 2I7AA 2PVBA 1KFXS 1J7QA 1CKKA 3SG5A 2K0JA 2LMTA 1CMFA 2JT3A 2KAVA 1UWOA 2KBIA 1BR1B 2MHHA 3SJSA 3ZWHA 2BKIB 5JOLA 4YI8A 1F54A 1OQPA 3DVKA 1A75A 1BF5A 1F4OA 1NWDA 2LHIA 2BE6A 1W7IB 2MBXA 1C07A 2HPSA 1CDPA 1IWQA 2M9GA 1IJ5A 1SR6C 1IQ3A 1KSOA 3TDIA 2P6BB 5HKYA 3JTDB 2LV7A 2LP3A 1LKJA 1NIWA 3BUMB 1LXFC 1LVCD 4PE1A 2K7OA 2KYFA 1ZACA 3EK4A 3TDZA 2MLFC 4PHKA 3OX5A 4PHNA 1PSBA 1R6PA 1ZMZA 1K93D 1S5GZ 1RK9A 2ZKMX 4JQ0D 2R2IA 1SY9A 3I5FB 2WORA 3SG6A 1A03A 2TN4A 1S1EA 1M45A 4PALA 3GK2A 1B8RA 3O78A 3KF9A 1TRFA 2HQ8A 1BOCA 4M2QA 2M49B 4M2PA 1SKTA 1SR6B 1UHNA 1DGVA 4DS7A 3OX6A 2BL0B 2A4JA 1PVBA 1F71A 4C0LA 4CIDA 1TNXA 3D0YA 4HRHA 1OMVA 2NCOA 1JBAA 1JSAA 1Y1UA 3LK0A 1LA3A 3SG7A 2H2KA 1YUTA 3NSIA 3TS5C 2LM5A 3KHEA 2OTGB 4E68A 3ICBA 4JWQA 1UP5A 2I18A 3I5IB 3SG2A 4YGEB 1F55A 2F8PA 2KBMA 2KI4C 1FBVA 3VRPA 1B47A 4BY5A 2BKHB 3EVUA 3PSRA 5HKZA 1SK6D 1WRLA 1QX5B 3NSOA 4I5LB 2CTNA 5I2OA 1JF0A 2KAYA 1G8IA 3QRXA 4AOMA 2JTTA 1C7WA 1DJXA 1Y1XA 2K7CA 3HX4A 2BBNA 1BT6A 1DJIA 1MWNA 4UPGA 1H8BA 1WRZA 1OZSA 2E6WA 3FS7A 3BOWB 1CLLA 3NSLA 2PRUA 3WNXB 1M46A 1HQVA 4NDCA 2NZ0A 5I8NA 3FIAA 1S36A 4MEWA 2SCPA 5AXIA 1YRUB 1DJYA 2KFGA 1AVSA 1DF0A 1K90D 2KAXA 2ZRTA 1B7TZ 2LLTA 3LCPC 4ORBB 1QLKA 1ZUZA 1HT9A 1FPWA 1GGZA 3SIBA 2LHLA 2G9BA 4JPZB 3BQ3A 1BODA 1SBJA 2EC6B 1DF0B 2JPTA 2Q4UA 1XFXO 1KQMC 2O5GA 1X02A 1DJHA 4YBHB 3O6BA 1B8CA 2JWWA 2PASA 2IS9A 2COLB 5CPVA 3TUYC 3I5HC 3KEVA 2AUCA 4MLWA 5TNCA 1NCXA 4CLNA 1G33A 1UHKA 3BUXB 5HYDA 5CSNA 2HF5A 3WHTB 1J7PA 3GK1A 2FCDA 1B4CA 5FYXA 2PALA 1QIWA 1MHOA 1XFZO 1KQVA 1YURA 1DTLA 2JU0A 3BUOB 3CR4X 3AKAA 3DF0A 1NX0A 3D10A 1DT7B 2CT9A 1QATA 3EK8A 1V1GA 2PMYA 1MQ1A 2QACA 1KWOB 1NP8A 1M63B 5I2QA 1KQMB 4M2OA 1JFJA 2MAZA 1YX7A 1IG5A 1AUIB 4OKHA 2KYCA 1S6JA 2WNDA 1CM4A 2SASA 4NDBA 4ZCVA 4PE7A 2ZRSA 2NCPA 2HQWA 2CBLA 4XJKB 1XFYO 2JOJA 3TUYB 4OVNF 1G4YR 1SW8A 4U8DA 2GGMA 2Y1NA 2E30A 1RTP1 3GK4X 3O4YA 4DUQA 1E8AA 1BLQA 4MZJA 1N2DA 1U5IB 1J1EA 1KSMA 3CS1A 3DVEA 3EKHA 4A4CA 3I5FC 4A4BA 1C7VA 2KQYA 1KK7Y 3DD4A 1QVIY 3EK7A 1B1GA 1OSAA 4FTGA 2M3WA 2LVJA 1EJ3A 1A29A 5K89A 4P2YB 3A4UB 3PN7C 4I5KA 1RROA 2BL0C 1DMOA 2KHNA 1JWDA 3OB1B 3WHUB 3CZTX 3OP0A 4YRUA 1CFFA 2Y4QA 2BE4A 2JRFA 2OTGC 4PE4A 1PSRA 3NSKA 2M7NA 4D1EA 2KFHA 2F3ZA 2LP2A 4ETOA 1CB1A 3I5IC 2VRGA 3LLEA 2JULA 2LC5A 3IF7A 1NX3A 2K2AA 1K95A 3NXAA 2GV5A 1K9UA 1ALVA 4HSZA 1DJWA 1CFPA 3DVJA 1K9KA 1KK8C 1QX2A 1J7RA 1JC2A 1MUXA 1Y6WA 1YR5A 3PALA 3AAJA 5HLOA 2H61C 4PE0A 4OCIA 1UHIA 5ER5A 2MA2A 5AERA 2HETA 1XO5A 3PN7B 1K96A 1A2XA 4F0ZB 1WLZA 3CLNA 4PHMA 4PDZA 2BCAA 5CSFA 2JNFA 2M7LA 5JJGA 2L5XB 2LUXA 1TNQA 5ER4X 4NQGA 5IBWA 1K9PA 2KI6D 1B9AA 2H61A 1QLSA 2O60A 3VGOA 1K8UA 2AAOA 3SIAA 4MRXA 1AHRA 1KK8B 2EC6C 3BOWA 2ZN9A 3PM8A 3LK1A 2KGBC 5KU1A 1SCVA 1K2HA 2LLUA 2JNXA 1F8HA 1PVAA 1YUUA 4P5OE 2LE9B 2WCBA 1XFWO 3JVTC 1WY9A 1B8LA 3BYAA 4DRWA 1CM1A 1XA5A 2F2OA 1SCMB 1TOPA 4GBAA 1YX8A 2BECA 2KNEA 1S3PA 2JT8A 1AK8A 5G08A 3CWGA 3FWBA 2CXJA 2FCEA 2KOTA 4GAOA 1ALWA 1DVIA 1QASA 3E3RA 2F2PA 1Y1AA 1EG4A 1K94A 2FJUB 4GGFC 1RJVA 1KWOC 1PRWA 1TN4A 4Q04A 1J7OA 1ODBA 2K61A 1XFUO 2CNPA 2D8NA 4GFTA 5BPJA 1NUBA 3KO0A 4ORAB 3PLFB 2K8MB 4CFQA 5CSJA 1R2UA 3JVTB 1CDMA 4DIRA 4IL1A 5HLVA 1SNLA 1H4BA 2JXCA 2WCFA 3TDUA 2ISDA 1KK7Z 1QVIZ 2Y5IA 5D69A 5I2LA 1NPQA 2L51A 2M29A 4GNKB 1S6IA 4GGFA 2JTZA 1RECA 1D1OA 1OZOA 1TCFA 1WDCC 1CNPA 4BY4A 1BJFA 1IQ5A 1IGVA 4QJ5B 1NCYA 4XJKA 4C0JA 1CDNA 1SL8A 1UURA 1EG3A 2JC2A 4HREE 5AFPA 1YTZC 2Q91A 3WXAA 2L98A 2LMVA 3F45A 1VRKA 2ZNDA 1U5IA 1BU3A 1MR8A 3CR2A 1DJGA 1JF2A 2F3YA 1SL7A 4MVFA 1M31A 1SYMA 3OHMB 1PULA 1QJTA 2L2EA 1XVJA 4GGNA 2K2FA 1M39A 2Y1MA 3EVRA 1CMGA 1J55A 1WDCB 1SRAA 1EXRA 1QTXA 5J3XA 1RFJA 4AQJA 4NDDA 2QPTA 2WOSA 1S26D 4MBEA 2KGRA 1QIVA 1WLMA 2PSRA 2LANA 3PATA 5F6TA 3VROA 4L9MA 2KI6C 1XFVO 4I5NB 1OE9B 3CGAA 1ZOTB 3OB2B 4N5XA 1JFKA 3VRQA 5GQQC 3LL8B 1JUOA 1QXPA 1UHJA 4MSPA 2BBMA 2L4IA 1BR4B 2M1KB 2MRDA 1TIZA 2LAPA 3IQQA 2L0PA 4WQ3A 4OR9B 1FW4A 2G2BA 1KFUL
chains in the Genus database with same CATH superfamily
1GGWA 2KQ6A 1SPYA 1A75B 2M0RA 4I5JA 4ORCB 3EKJA 5DICA 2AMIA 2FOTA 1OW4A 4QJ3B 5CSIA 1NX2A 2LNKA 3VRNA 4FQOA 2EGDA 1UHHA 2LUCA 4PCWA 1QV0A 1TUJA 1YUSA 1SCMC 4MZKA 3D78A 5HKWA 3C1VA 1LS8A 4YGBB 3BUNB 5DKNA 2LLSA 4AQIA 1EL4A 1NYAA 2L4HA 1Q80A 2JT0A 2ZFDA 2K7DA 1DGUA 3K21A 3OBVA 3RZSA 5DKRA 5AANA 1PALA 2DOQA 1TNWA 1KCYA 4R1EA 1CLMA 1GJYA 2EHBA 2OS8C 1IKUA 3PJIA 2I94A 3RLZA 2M97A 3CR5X 4MN0A 1AJ4A 3L47A 1L7ZA 1F70A 2JXLA 3H4SE 3I5GC 3D76A 2H8VA 1IH0A 1DQEA 4MZLA 1CDLA 1AJ5A 1QV1A 1TNPA 4OV2A 3AAKA 4PT1A 3R72A 4N1GA 3GOFA 1EH2A 5AEQA 1FI5A 3D0YB 3DY9A 2F33A 2L50A 1MXEA 3FWCA 2K7BA 1W7JB 3N7HA 3TZ1A 1LINA 5FI7A 1NSHA 1KFXL 2GTEA 4GUKA 1S5GY 3B88A 4DCKA 1IJ6A 1XYDA 2B1UA 2KFFA 3AKBA 2OS8B 5D3OA 3DVMA 1PK0D 2QEOA 2JZIA 4WRIA 1SL9A 1N0YA 2MLEC 4XYNA 3O2PA 1L2OC 1SMGA 1V1FA 4TNCA 3I5GB 3O4XA 2QEHA 2LVKA 2BCXA 1XFRA 3PFVA 1TCOB 3CTNA 3BXKA 3MSEB 2WCEA 3TS5B 1S6CA 1OMRA 5PALA 1UUSA 4WQ2A 2LVVA 5KSZA 1KFUS 4N1FA 4CPVA 1BMOA 2BCBA 2QEBA 1XK4C 1CFDA 2KI4B 4YGAA 1OOJA 2I2RE 1NCZA 2WC8A 2M1UA 3RM1A 2ZNEA 1WRKA 1YRTB 4HRGA 2WCHA 2WCLA 3BUWB 1AP4A 1CLBA 2GGZA 1F4QA 3A8RA 1MXLC 4ICBA 3ZNIA 4YI9A 1FF1A 2JQ6A 1L2OB 2NXQA 5B8IB 1QX7A 3SG4A 1RWYA 1ZFSA 2M8UA 2V53A 1YVLA 2WCMA 2OPOA 1XK4A 3KPXA 4CFRA 1DJZA 3IQOA 4YGDB 2L2CA 3VB1A 4MRYA 2LMUA 4PHJA 1ORGA 1QS7A 1DELA 1BG1A 1MF8B 2MJWB 2PQLA 1J1DA 1IRJA 1A4PA 4GPLB 2WCKA 4C0KA 1OMDA 1NX1A 1TTXA 4ZCUA 3VRRA 2KSPA 2NLNA 1B7TY 3EVVA 3HCMA 2KDHA 3M0WA 5D7FA 4USLA 3DF0B 5DKQA 5KTYA 3B87A 1LA0A 1FI6A 1YVHA 1CTRA 2LVIA 3BFBA 1C3ZA 3SG3A 2CCMA 1GQMA 3JTDC 2LCPA 2RGIA 1N65A 3S0DA 1Y0VH 3I5HB 1CFCA 2ZN8A 4YGCB 4QJ4B 2I7AA 2PVBA 1KFXS 5I94A 1J7QA 4JD9A 1CKKA 4INWA 3SG5A 2K0JA 2LMTA 1CMFA 2JT3A 2KAVA 1UWOA 2KBIA 2WC5A 1BR1B 2MHHA 3SJSA 3ZWHA 1OOHA 2BKIB 5JOLA 3NGVA 4YI8A 1F54A 1OQPA 3DVKA 1A75A 1BF5A 1F4OA 1NWDA 3SS5A 2LHIA 2BE6A 1W7IB 2MBXA 1C07A 2HPSA 1CDPA 1IWQA 2M9GA 1IJ5A 1SR6C 1IQ3A 1T14A 1KSOA 3TDIA 2P6BB 5HKYA 3JTDB 2LV7A 2LP3A 3D74A 1LKJA 1NIWA 3BUMB 2ERBA 1LXFC 1LVCD 4PE1A 2K7OA 2KYFA 1ZACA 3EK4A 3TDZA 2MLFC 4FQTA 4PHKA 3OX5A 4PHNA 1PSBA 1R6PA 1ZMZA 1K93D 1S5GZ 1RK9A 2ZKMX 4JQ0D 2R2IA 1SY9A 3I5FB 2WORA 3SG6A 3S0GA 1A03A 2BNXA 2TN4A 3DXLA 3UNWA 1S1EA 1M45A 1Z2CB 4PALA 3GK2A 1B8RA 3O78A 5FI2A 3KF9A 1TRFA 2HQ8A 1BOCA 4M2QA 2M49B 4M2PA 1SKTA 1SR6B 3QMEA 1UHNA 3R1OA 1DGVA 4DS7A 3OX6A 2BL0B 2A4JA 1PVBA 1F71A 2QDIA 4C0LA 4CIDA 1TNXA 3D0YA 4HRHA 1OMVA 2NCOA 1JBAA 1JSAA 1Y1UA 3LK0A 1LA3A 3SG7A 2H2KA 1YUTA 3NSIA 3TS5C 2LM5A 2P71A 3KHEA 2OTGB 4E68A 3ICBA 1DC1A 3S0EA 4JWQA 1UP5A 2I18A 3I5IB 3SG2A 4YGEB 1F55A 3CDNA 2F8PA 2KBMA 2FJYA 1FBVA 2KI4C 3VRPA 1B47A 4BY5A 2BKHB 3EVUA 3PSRA 5HKZA 1SK6D 1WRLA 1QX5B 3NSOA 4I5LB 2CTNA 5I2OA 1JF0A 2KAYA 1G8IA 3QRXA 4AOMA 2JTTA 1C7WA 1DJXA 1Y1XA 2K7CA 3HX4A 2BBNA 1BT6A 1DJIA 1MWNA 4UPGA 1H8BA 1WRZA 1OZSA 2E6WA 1OOFA 3FS7A 4KYNA 3BOWB 3V2LA 1CLLA 3NSLA 2PRUA 3WNXB 1M46A 1HQVA 4NDCA 2NZ0A 5I8NA 3FIAA 1S36A 2K60A 2SCPA 4MEWA 5AXIA 1YRUB 1DJYA 2KFGA 1AVSA 1DF0A 1K90D 2KAXA 2ZRTA 3Q8IA 1B7TZ 2LLTA 3BJHA 3LCPC 4ORBB 1QLKA 1ZUZA 1HT9A 1FPWA 1GGZA 3SIBA 2LHLA 2G9BA 4JPZB 3BQ3A 1BODA 1SBJA 2EC6B 1DF0B 2JPTA 2Q4UA 1XFXO 1KQMC 2O5GA 1X02A 1DJHA 4YBHB 3O6BA 1B8CA 2JWWA 2PASA 2IS9A 2COLB 5CPVA 3TUYC 3I5HC 3KEVA 2AUCA 4MLWA 1TUZA 1NCXA 5TNCA 4CLNA 1G33A 1UHKA 3BUXB 3L4LA 5HYDA 5CSNA 2HF5A 3WHTB 1J7PA 3GK1A 2FCDA 1B4CA 1IIOA 5FYXA 2PALA 1QIWA 1MHOA 1XFZO 2QEVA 1KQVA 1YURA 1DTLA 2JU0A 3BUOB 3CR4X 3AKAA 3DF0A 1NX0A 3BFAA 3D10A 1DT7B 2CT9A 1QATA 3EK8A 1V1GA 2PMYA 5EL2A 1MQ1A 2QACA 1KWOB 1NP8A 1M63B 5I2QA 1KQMB 4M2OA 3CZ2A 2MAZA 1JFJA 1YX7A 1IG5A 3IVTA 1AUIB 3SS4A 4OKHA 3L4AA 2KYCA 1S6JA 2WNDA 1CM4A 2SASA 4NDBA 4ZCVA 4PE7A 2ZRSA 2NCPA 2HQWA 2CBLA 3B6XA 4XJKB 1XFYO 2JOJA 2KPHA 3TUYB 4OVNF 1G4YR 1SW8A 4U8DA 2GGMA 2Y1NA 1OOIX 2E30A 1RTP1 3GK4X 3O4YA 4DUQA 1SSEB 1E8AA 3SS3A 1BLQA 4MZJA 1N2DA 1U5IB 2KLDA 1J1EA 1KSMA 3CS1A 3DVEA 3EKHA 4IJ7A 4A4CA 3I5FC 4A4BA 1C7VA 2KQYA 5HL1A 1KK7Y 3DD4A 1QVIY 3EK7A 4OZDA 1B1GA 1OSAA 4FTGA 2M3WA 2LVJA 3S0BA 1EJ3A 1A29A 5K89A 4P2YB 3D77A 2WCJA 3A4UB 3PN7C 4I5KA 1RROA 2BL0C 1DMOA 2KHNA 2BAPA 3OB1B 3WHUB 1JWDA 3CZTX 3OP0A 4YRUA 1CFFA 2Y4QA 2BE4A 2JRFA 2OTGC 4PE4A 1PSRA 3NSKA 2M7NA 4D1EA 4F7FA 2KFHA 2F3ZA 2LP2A 4ETOA 4JKTA 3I5IC 1CB1A 2PYQA 2VRGA 3LLEA 3NHIA 2JULA 2LC5A 1P28A 3IF7A 1NX3A 2K2AA 1K95A 3NXAA 2GV5A 1K9UA 1ALVA 3NHTA 4HSZA 1DJWA 1CFPA 3DVJA 1K9KA 1KK8C 1QX2A 1J7RA 1JC2A 1MUXA 3FE9A 1Y6WA 1YR5A 3PALA 3AAJA 5HLOA 2H61C 4PE0A 3CZ1A 4OCIA 1UHIA 5ER5A 2MA2A 5AERA 2HETA 1XO5A 3PN7B 1K96A 2WC6A 1A2XA 4F0ZB 1WLZA 3CLNA 4PHMA 4PDZA 2BCAA 5CSFA 3DYEA 2JNFA 2M7LA 5JJGA 3CABA 2L5XB 2LUXA 1TNQA 5ER4X 4NQGA 5IBWA 1K9PA 1C3YA 2KI6D 1B9AA 2H61A 1QLSA 2O60A 3VGOA 1K8UA 2AAOA 3SIAA 4MRXA 1AHRA 1KK8B 2EC6C 2L5YA 3BOWA 2ZN9A 3PM8A 3LK1A 2KGBC 5KU1A 1SCVA 1K2HA 2LLUA 2JNXA 1F8HA 1PVAA 1YUUA 4P5OE 2LE9B 2WCBA 1XFWO 3JVTC 1WY9A 3D73A 1B8LA 3BYAA 4DRWA 1CM1A 1XA5A 2F2OA 1SCMB 1TOPA 4GBAA 1YX8A 2BECA 2KNEA 1S3PA 2JT8A 1AK8A 5G08A 3CWGA 3FWBA 2CXJA 2FCEA 2KLEA 2KOTA 3DZTA 4GAOA 1ALWA 3S0AA 1DVIA 1QASA 3FE6A 3E3RA 2F2PA 1Y1AA 1EG4A 1K94A 2FJUB 3B86A 4GGFC 3UO9A 1RJVA 3D75A 1KWOC 1PRWA 1TN4A 4INXA 4Q04A 1J7OA 2YGUA 1ODBA 1QWVA 1XFUO 2CNPA 2D8NA 2K61A 4GFTA 1NUBA 3KO0A 4ORAB 5BPJA 3PLFB 2K8MB 4CFQA 5CSJA 1R2UA 3JVTB 1CDMA 4DIRA 4IL1A 5HLVA 1SNLA 1H4BA 3K1EA 2JXCA 2WCFA 3TDUA 2ISDA 1KK7Z 3CZ0A 1QVIZ 2Y5IA 5D69A 5I2LA 1NPQA 2L51A 2M29A 4GNKB 1S6IA 4GGFA 2JTZA 1RECA 1D1OA 1OZOA 1TCFA 1WDCC 3OGNA 1CNPA 4BY4A 1BJFA 1IQ5A 1IGVA 4QJ5B 1NCYA 4XJKA 4C0JA 1CDNA 3S0FA 1SL8A 1UURA 1EG3A 2JC2A 4HREE 5AFPA 1YTZC 2Q91A 3WXAA 2L98A 1TWOA 2LMVA 3PM2A 3F45A 1VRKA 2ZNDA 1U5IA 1BU3A 1MR8A 3CR2A 1DJGA 1JF2A 2F3YA 1SL7A 3R1PA 4MVFA 1M31A 1SYMA 3OHMB 1PULA 1QJTA 2L2EA 1XVJA 4GGNA 3R1VA 1KFUL 2K2FA 1M39A 2Y1MA 3EVRA 1CMGA 1J55A 1WDCB 2JPOA 1SRAA 1EXRA 1QTXA 5J3XA 1RFJA 4AQJA 4NDDA 2QPTA 2WOSA 1S26D 1DEKA 4MBEA 3FE8A 2KGRA 1QIVA 3EG5B 1WLMA 2PSRA 2LANA 3PATA 5F6TA 3VROA 4L9MA 2KI6C 1XFVO 4I5NB 1OE9B 1GM0A 3CGAA 1ZOTB 3OB2B 4N5XA 1JFKA 5FI6A 3VRQA 5GQQC 3LL8B 1W9ZA 3CYZA 1JUOA 1QXPA 1UHJA 3BFHA 2BBMA 2L4IA 1BR4B 2M1KB 2MRDA 4MSPA 1TIZA 2LAPA 3IQQA 2L0PA 1Z4HA 4WQ3A 4OR9B 1FW4A 2G2BA 2P70A 3B7AA 1OOGA
chains in the Genus database with same CATH topology
1GGWA 2KQ6A 1SPYA 1A75B 2M0RA 4I5JA 4ORCB 3EKJA 2AMIA 2FOTA 4QJ3B 5CSIA 1NX2A 2LNKA 3VRNA 4FQOA 2EGDA 1UHHA 2LUCA 4PCWA 1QV0A 1YUSA 1SCMC 4MZKA 5HKWA 3C1VA 4YGBB 3BUNB 5DKNA 2LLSA 4AQIA 1EL4A 1NYAA 2L4HA 1Q80A 2JT0A 2ZFDA 2K7DA 1DGUA 3K21A 5DKRA 5AANA 1PALA 2DOQA 1TNWA 1KCYA 4R1EA 1GJYA 1CLMA 2EHBA 2OS8C 1IKUA 2I94A 3RLZA 2M97A 3CR5X 4MN0A 1AJ4A 1L7ZA 1F70A 2JXLA 3H4SE 3I5GC 1IH0A 4MZLA 1CDLA 1AJ5A 1QV1A 1TNPA 4OV2A 3AAKA 1EH2A 4N1GA 3GOFA 5AEQA 1FI5A 3D0YB 2F33A 2L50A 1MXEA 3FWCA 2K7BA 1W7JB 3TZ1A 1LINA 1NSHA 1KFXL 4GUKA 1S5GY 4DCKA 1IJ6A 1XYDA 2B1UA 2KFFA 3AKBA 2OS8B 3DVMA 1PK0D 2JZIA 4WRIA 1SL9A 1N0YA 2MLEC 4XYNA 3O2PA 1L2OC 1SMGA 1V1FA 4TNCA 3I5GB 2LVKA 2BCXA 3PFVA 1TCOB 3CTNA 3BXKA 3MSEB 2WCEA 3TS5B 1S6CA 1OMRA 5PALA 1UUSA 4WQ2A 2LVVA 5KSZA 1KFUS 4N1FA 4CPVA 1BMOA 2BCBA 1XK4C 1CFDA 2KI4B 4YGAA 1OOJA 2I2RE 1NCZA 2WC8A 2M1UA 3RM1A 2ZNEA 1WRKA 1YRTB 4HRGA 3BUWB 1AP4A 1CLBA 2GGZA 1F4QA 3A8RA 1MXLC 4ICBA 3ZNIA 4YI9A 1FF1A 2JQ6A 1L2OB 2NXQA 5B8IB 1QX7A 3SG4A 1RWYA 1ZFSA 2M8UA 2V53A 1YVLA 2OPOA 1XK4A 3KPXA 4CFRA 1DJZA 3IQOA 4YGDB 4MRYA 2LMUA 4PHJA 1QS7A 1BG1A 1MF8B 2MJWB 1J1DA 1IRJA 1A4PA 4GPLB 4C0KA 1OMDA 1NX1A 1TTXA 4ZCUA 3VRRA 2KSPA 2NLNA 1B7TY 3EVVA 3HCMA 2KDHA 3M0WA 5D7FA 4USLA 3DF0B 5DKQA 5KTYA 1LA0A 1FI6A 1YVHA 1CTRA 2LVIA 3SG3A 2CCMA 1GQMA 3JTDC 2LCPA 2RGIA 1N65A 1Y0VH 3I5HB 1CFCA 2ZN8A 4YGCB 4QJ4B 2I7AA 2PVBA 1KFXS 1J7QA 1CKKA 3SG5A 2K0JA 2LMTA 1CMFA 2JT3A 2KAVA 1UWOA 2KBIA 1BR1B 2MHHA 3SJSA 3ZWHA 2BKIB 5JOLA 4YI8A 1F54A 1OQPA 3DVKA 1A75A 1BF5A 1F4OA 1NWDA 2LHIA 2BE6A 1W7IB 2MBXA 1C07A 2HPSA 1CDPA 1IWQA 2M9GA 1IJ5A 1SR6C 1IQ3A 1KSOA 3TDIA 2P6BB 5HKYA 3JTDB 2LV7A 2LP3A 1LKJA 1NIWA 3BUMB 1LXFC 1LVCD 4PE1A 2K7OA 2KYFA 1ZACA 3EK4A 3TDZA 2MLFC 4PHKA 3OX5A 4PHNA 1PSBA 1R6PA 1ZMZA 1K93D 1S5GZ 1RK9A 2ZKMX 4JQ0D 2R2IA 1SY9A 3I5FB 2WORA 3SG6A 1A03A 2TN4A 1S1EA 1M45A 4PALA 3GK2A 1B8RA 3O78A 3KF9A 1TRFA 2HQ8A 1BOCA 4M2QA 2M49B 4M2PA 1SKTA 1SR6B 1UHNA 1DGVA 4DS7A 3OX6A 2BL0B 2A4JA 1PVBA 1F71A 4C0LA 4CIDA 1TNXA 3D0YA 4HRHA 1OMVA 2NCOA 1JBAA 1JSAA 1Y1UA 3LK0A 1LA3A 3SG7A 2H2KA 1YUTA 3NSIA 3TS5C 2LM5A 3KHEA 2OTGB 4E68A 3ICBA 4JWQA 1UP5A 2I18A 3I5IB 3SG2A 4YGEB 1F55A 2F8PA 2KBMA 2KI4C 1FBVA 3VRPA 1B47A 4BY5A 2BKHB 3EVUA 3PSRA 5HKZA 1SK6D 1WRLA 1QX5B 3NSOA 4I5LB 2CTNA 5I2OA 1JF0A 2KAYA 1G8IA 3QRXA 4AOMA 2JTTA 1C7WA 1DJXA 1Y1XA 2K7CA 3HX4A 2BBNA 1BT6A 1DJIA 1MWNA 4UPGA 1H8BA 1WRZA 1OZSA 2E6WA 3FS7A 3BOWB 1CLLA 3NSLA 2PRUA 3WNXB 1M46A 1HQVA 4NDCA 2NZ0A 5I8NA 3FIAA 1S36A 4MEWA 2SCPA 5AXIA 1YRUB 1DJYA 2KFGA 1AVSA 1DF0A 1K90D 2KAXA 2ZRTA 1B7TZ 2LLTA 3LCPC 4ORBB 1QLKA 1ZUZA 1HT9A 1FPWA 1GGZA 3SIBA 2LHLA 2G9BA 4JPZB 3BQ3A 1BODA 1SBJA 2EC6B 1DF0B 2JPTA 2Q4UA 1XFXO 1KQMC 2O5GA 1X02A 1DJHA 4YBHB 3O6BA 1B8CA 2JWWA 2PASA 2IS9A 2COLB 5CPVA 3TUYC 3I5HC 3KEVA 2AUCA 4MLWA 5TNCA 1NCXA 4CLNA 1G33A 1UHKA 3BUXB 5HYDA 5CSNA 2HF5A 3WHTB 1J7PA 3GK1A 2FCDA 1B4CA 5FYXA 2PALA 1QIWA 1MHOA 1XFZO 1KQVA 1YURA 1DTLA 2JU0A 3BUOB 3CR4X 3AKAA 3DF0A 1NX0A 3D10A 1DT7B 2CT9A 1QATA 3EK8A 1V1GA 2PMYA 1MQ1A 2QACA 1KWOB 1NP8A 1M63B 5I2QA 1KQMB 4M2OA 1JFJA 2MAZA 1YX7A 1IG5A 1AUIB 4OKHA 2KYCA 1S6JA 2WNDA 1CM4A 2SASA 4NDBA 4ZCVA 4PE7A 2ZRSA 2NCPA 2HQWA 2CBLA 4XJKB 1XFYO 2JOJA 3TUYB 4OVNF 1G4YR 1SW8A 4U8DA 2GGMA 2Y1NA 2E30A 1RTP1 3GK4X 3O4YA 4DUQA 1E8AA 1BLQA 4MZJA 1N2DA 1U5IB 1J1EA 1KSMA 3CS1A 3DVEA 3EKHA 4A4CA 3I5FC 4A4BA 1C7VA 2KQYA 1KK7Y 3DD4A 1QVIY 3EK7A 1B1GA 1OSAA 4FTGA 2M3WA 2LVJA 1EJ3A 1A29A 5K89A 4P2YB 3A4UB 3PN7C 4I5KA 1RROA 2BL0C 1DMOA 2KHNA 1JWDA 3OB1B 3WHUB 3CZTX 3OP0A 4YRUA 1CFFA 2Y4QA 2BE4A 2JRFA 2OTGC 4PE4A 1PSRA 3NSKA 2M7NA 4D1EA 2KFHA 2F3ZA 2LP2A 4ETOA 1CB1A 3I5IC 2VRGA 3LLEA 2JULA 2LC5A 3IF7A 1NX3A 2K2AA 1K95A 3NXAA 2GV5A 1K9UA 1ALVA 4HSZA 1DJWA 1CFPA 3DVJA 1K9KA 1KK8C 1QX2A 1J7RA 1JC2A 1MUXA 1Y6WA 1YR5A 3PALA 3AAJA 5HLOA 2H61C 4PE0A 4OCIA 1UHIA 5ER5A 2MA2A 5AERA 2HETA 1XO5A 3PN7B 1K96A 1A2XA 4F0ZB 1WLZA 3CLNA 4PHMA 4PDZA 2BCAA 5CSFA 2JNFA 2M7LA 5JJGA 2L5XB 2LUXA 1TNQA 5ER4X 4NQGA 5IBWA 1K9PA 2KI6D 1B9AA 2H61A 1QLSA 2O60A 3VGOA 1K8UA 2AAOA 3SIAA 4MRXA 1AHRA 1KK8B 2EC6C 3BOWA 2ZN9A 3PM8A 3LK1A 2KGBC 5KU1A 1SCVA 1K2HA 2LLUA 2JNXA 1F8HA 1PVAA 1YUUA 4P5OE 2LE9B 2WCBA 1XFWO 3JVTC 1WY9A 1B8LA 3BYAA 4DRWA 1CM1A 1XA5A 2F2OA 1SCMB 1TOPA 4GBAA 1YX8A 2BECA 2KNEA 1S3PA 2JT8A 1AK8A 5G08A 3CWGA 3FWBA 2CXJA 2FCEA 2KOTA 4GAOA 1ALWA 1DVIA 1QASA 3E3RA 2F2PA 1Y1AA 1EG4A 1K94A 2FJUB 4GGFC 1RJVA 1KWOC 1PRWA 1TN4A 4Q04A 1J7OA 1ODBA 2K61A 1XFUO 2CNPA 2D8NA 4GFTA 5BPJA 1NUBA 3KO0A 4ORAB 3PLFB 2K8MB 4CFQA 5CSJA 1R2UA 3JVTB 1CDMA 4DIRA 4IL1A 5HLVA 1SNLA 1H4BA 2JXCA 2WCFA 3TDUA 2ISDA 1KK7Z 1QVIZ 2Y5IA 5D69A 5I2LA 1NPQA 2L51A 2M29A 4GNKB 1S6IA 4GGFA 2JTZA 1RECA 1D1OA 1OZOA 1TCFA 1WDCC 1CNPA 4BY4A 1BJFA 1IQ5A 1IGVA 4QJ5B 1NCYA 4XJKA 4C0JA 1CDNA 1SL8A 1UURA 1EG3A 2JC2A 4HREE 5AFPA 1YTZC 2Q91A 3WXAA 2L98A 2LMVA 3F45A 1VRKA 2ZNDA 1U5IA 1BU3A 1MR8A 3CR2A 1DJGA 1JF2A 2F3YA 1SL7A 4MVFA 1M31A 1SYMA 3OHMB 1PULA 1QJTA 2L2EA 1XVJA 4GGNA 2K2FA 1M39A 2Y1MA 3EVRA 1CMGA 1J55A 1WDCB 1SRAA 1EXRA 1QTXA 5J3XA 1RFJA 4AQJA 4NDDA 2QPTA 2WOSA 1S26D 4MBEA 2KGRA 1QIVA 1WLMA 2PSRA 2LANA 3PATA 5F6TA 3VROA 4L9MA 2KI6C 1XFVO 4I5NB 1OE9B 3CGAA 1ZOTB 3OB2B 4N5XA 1JFKA 3VRQA 5GQQC 3LL8B 1JUOA 1QXPA 1UHJA 4MSPA 2BBMA 2L4IA 1BR4B 2M1KB 2MRDA 1TIZA 2LAPA 3IQQA 2L0PA 4WQ3A 4OR9B 1FW4A 2G2BA 1KFUL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GGW A;  2KQ6 A;  1SPY A;  1A75 B;  2M0R A;  4I5J A;  4ORC B;  3EKJ A;  2AMI A;  2FOT A;  4QJ3 B;  5CSI A;  1NX2 A;  2LNK A;  3VRN A;  4FQO A;  2EGD A;  1UHH A;  2LUC A;  4PCW A;  1QV0 A;  1YUS A;  1SCM C;  4MZK A;  5HKW A;  3C1V A;  4YGB B;  3BUN B;  5DKN A;  2LLS A;  4AQI A;  1EL4 A;  1NYA A;  2L4H A;  1Q80 A;  2JT0 A;  2ZFD A;  2K7D A;  1DGU A;  3K21 A;  5DKR A;  5AAN A;  1PAL A;  2DOQ A;  1TNW A;  1KCY A;  4R1E A;  1GJY A;  1CLM A;  2EHB A;  2OS8 C;  1IKU A;  2I94 A;  3RLZ A;  2M97 A;  3CR5 X;  4MN0 A;  1AJ4 A;  1L7Z A;  1F70 A;  2JXL A;  3H4S E;  3I5G C;  1IH0 A;  4MZL A;  1CDL A;  1AJ5 A;  1QV1 A;  1TNP A;  4OV2 A;  3AAK A;  1EH2 A;  4N1G A;  3GOF A;  5AEQ A;  1FI5 A;  3D0Y B;  2F33 A;  2L50 A;  1MXE A;  3FWC A;  2K7B A;  1W7J B;  3TZ1 A;  1LIN A;  1NSH A;  1KFX L;  4GUK A;  1S5G Y;  4DCK A;  1IJ6 A;  1XYD A;  2B1U A;  2KFF A;  3AKB A;  2OS8 B;  3DVM A;  1PK0 D;  2JZI A;  4WRI A;  1SL9 A;  1N0Y A;  2MLE C;  4XYN A;  3O2P A;  1L2O C;  1SMG A;  1V1F A;  4TNC A;  3I5G B;  2LVK A;  2BCX A;  3PFV A;  1TCO B;  3CTN A;  3BXK A;  3MSE B;  2WCE A;  3TS5 B;  1S6C A;  1OMR A;  5PAL A;  1UUS A;  4WQ2 A;  2LVV A;  5KSZ A;  1KFU S;  4N1F A;  4CPV A;  1BMO A;  2BCB A;  1XK4 C;  1CFD A;  2KI4 B;  4YGA A;  1OOJ A;  2I2R E;  1NCZ A;  2WC8 A;  2M1U A;  3RM1 A;  2ZNE A;  1WRK A;  1YRT B;  4HRG A;  3BUW B;  1AP4 A;  1CLB A;  2GGZ A;  1F4Q A;  3A8R A;  1MXL C;  4ICB A;  3ZNI A;  4YI9 A;  1FF1 A;  2JQ6 A;  1L2O B;  2NXQ A;  5B8I B;  1QX7 A;  3SG4 A;  1RWY A;  1ZFS A;  2M8U A;  2V53 A;  1YVL A;  2OPO A;  1XK4 A;  3KPX A;  4CFR A;  1DJZ A;  3IQO A;  4YGD B;  4MRY A;  2LMU A;  4PHJ A;  1QS7 A;  1BG1 A;  1MF8 B;  2MJW B;  1J1D A;  1IRJ A;  1A4P A;  4GPL B;  4C0K A;  1OMD A;  1NX1 A;  1TTX A;  4ZCU A;  3VRR A;  2KSP A;  2NLN A;  1B7T Y;  3EVV A;  3HCM A;  2KDH A;  3M0W A;  5D7F A;  4USL A;  3DF0 B;  5DKQ A;  5KTY A;  1LA0 A;  1FI6 A;  1YVH A;  1CTR A;  2LVI A;  3SG3 A;  2CCM A;  1GQM A;  3JTD C;  2LCP A;  2RGI A;  1N65 A;  1Y0V H;  3I5H B;  1CFC A;  2ZN8 A;  4YGC B;  4QJ4 B;  2I7A A;  2PVB A;  1KFX S;  1J7Q A;  1CKK A;  3SG5 A;  2K0J A;  2LMT A;  1CMF A;  2JT3 A;  2KAV A;  1UWO A;  2KBI A;  1BR1 B;  2MHH A;  3SJS A;  3ZWH A;  2BKI B;  5JOL A;  4YI8 A;  1F54 A;  1OQP A;  3DVK A;  1A75 A;  1BF5 A;  1F4O A;  1NWD A;  2LHI A;  2BE6 A;  1W7I B;  2MBX A;  1C07 A;  2HPS A;  1CDP A;  1IWQ A;  2M9G A;  1IJ5 A;  1SR6 C;  1IQ3 A;  1KSO A;  3TDI A;  2P6B B;  5HKY A;  3JTD B;  2LV7 A;  2LP3 A;  1LKJ A;  1NIW A;  3BUM B;  1LXF C;  1LVC D;  4PE1 A;  2K7O A;  2KYF A;  1ZAC A;  3EK4 A;  3TDZ A;  2MLF C;  4PHK A;  3OX5 A;  4PHN A;  1PSB A;  1R6P A;  1ZMZ A;  1K93 D;  1S5G Z;  1RK9 A;  2ZKM X;  4JQ0 D;  2R2I A;  1SY9 A;  3I5F B;  2WOR A;  3SG6 A;  1A03 A;  2TN4 A;  1S1E A;  1M45 A;  4PAL A;  3GK2 A;  1B8R A;  3O78 A;  3KF9 A;  1TRF A;  2HQ8 A;  1BOC A;  4M2Q A;  2M49 B;  4M2P A;  1SKT A;  1SR6 B;  1UHN A;  1DGV A;  4DS7 A;  3OX6 A;  2BL0 B;  2A4J A;  1PVB A;  1F71 A;  4C0L A;  4CID A;  1TNX A;  3D0Y A;  4HRH A;  1OMV A;  2NCO A;  1JBA A;  1JSA A;  1Y1U A;  3LK0 A;  1LA3 A;  3SG7 A;  2H2K A;  1YUT A;  3NSI A;  3TS5 C;  2LM5 A;  3KHE A;  2OTG B;  4E68 A;  3ICB A;  4JWQ A;  1UP5 A;  2I18 A;  3I5I B;  3SG2 A;  4YGE B;  1F55 A;  2F8P A;  2KBM A;  2KI4 C;  1FBV A;  3VRP A;  1B47 A;  4BY5 A;  2BKH B;  3EVU A;  3PSR A;  5HKZ A;  1SK6 D;  1WRL A;  1QX5 B;  3NSO A;  4I5L B;  2CTN A;  5I2O A;  1JF0 A;  2KAY A;  1G8I A;  3QRX A;  4AOM A;  2JTT A;  1C7W A;  1DJX A;  1Y1X A;  2K7C A;  3HX4 A;  2BBN A;  1BT6 A;  1DJI A;  1MWN A;  4UPG A;  1H8B A;  1WRZ A;  1OZS A;  2E6W A;  3FS7 A;  3BOW B;  1CLL A;  3NSL A;  2PRU A;  3WNX B;  1M46 A;  1HQV A;  4NDC A;  2NZ0 A;  5I8N A;  3FIA A;  1S36 A;  4MEW A;  2SCP A;  5AXI A;  1YRU B;  1DJY A;  2KFG A;  1AVS A;  1DF0 A;  1K90 D;  2KAX A;  2ZRT A;  1B7T Z;  2LLT A;  3LCP C;  4ORB B;  1QLK A;  1ZUZ A;  1HT9 A;  1FPW A;  1GGZ A;  3SIB A;  2LHL A;  2G9B A;  4JPZ B;  3BQ3 A;  1BOD A;  1SBJ A;  2EC6 B;  1DF0 B;  2JPT A;  2Q4U A;  1XFX O;  1KQM C;  2O5G A;  1X02 A;  1DJH A;  4YBH B;  3O6B A;  1B8C A;  2JWW A;  2PAS A;  2IS9 A;  2COL B;  5CPV A;  3TUY C;  3I5H C;  3KEV A;  2AUC A;  4MLW A;  5TNC A;  1NCX A;  4CLN A;  1G33 A;  1UHK A;  3BUX B;  5HYD A;  5CSN A;  2HF5 A;  3WHT B;  1J7P A;  3GK1 A;  2FCD A;  1B4C A;  5FYX A;  2PAL A;  1QIW A;  1MHO A;  1XFZ O;  1KQV A;  1YUR A;  1DTL A;  2JU0 A;  3BUO B;  3CR4 X;  3AKA A;  3DF0 A;  1NX0 A;  3D10 A;  1DT7 B;  2CT9 A;  1QAT A;  3EK8 A;  1V1G A;  2PMY A;  1MQ1 A;  2QAC A;  1KWO B;  1NP8 A;  1M63 B;  5I2Q A;  1KQM B;  4M2O A;  1JFJ A;  2MAZ A;  1YX7 A;  1IG5 A;  1AUI B;  4OKH A;  2KYC A;  1S6J A;  2WND A;  1CM4 A;  2SAS A;  4NDB A;  4ZCV A;  4PE7 A;  2ZRS A;  2NCP A;  2HQW A;  2CBL A;  4XJK B;  1XFY O;  2JOJ A;  3TUY B;  4OVN F;  1G4Y R;  1SW8 A;  4U8D A;  2GGM A;  2Y1N A;  2E30 A;  1RTP 1;  3GK4 X;  3O4Y A;  4DUQ A;  1E8A A;  1BLQ A;  4MZJ A;  1N2D A;  1U5I B;  1J1E A;  1KSM A;  3CS1 A;  3DVE A;  3EKH A;  4A4C A;  3I5F C;  4A4B A;  1C7V A;  2KQY A;  1KK7 Y;  3DD4 A;  1QVI Y;  3EK7 A;  1B1G A;  1OSA A;  4FTG A;  2M3W A;  2LVJ A;  1EJ3 A;  1A29 A;  5K89 A;  4P2Y B;  3A4U B;  3PN7 C;  4I5K A;  1RRO A;  2BL0 C;  1DMO A;  2KHN A;  1JWD A;  3OB1 B;  3WHU B;  3CZT X;  3OP0 A;  4YRU A;  1CFF A;  2Y4Q A;  2BE4 A;  2JRF A;  2OTG C;  4PE4 A;  1PSR A;  3NSK A;  2M7N A;  4D1E A;  2KFH A;  2F3Z A;  2LP2 A;  4ETO A;  1CB1 A;  3I5I C;  2VRG A;  3LLE A;  2JUL A;  2LC5 A;  3IF7 A;  1NX3 A;  2K2A A;  1K95 A;  3NXA A;  2GV5 A;  1K9U A;  1ALV A;  4HSZ A;  1DJW A;  1CFP A;  3DVJ A;  1K9K A;  1KK8 C;  1QX2 A;  1J7R A;  1JC2 A;  1MUX A;  1Y6W A;  1YR5 A;  3PAL A;  3AAJ A;  5HLO A;  2H61 C;  4PE0 A;  4OCI A;  1UHI A;  5ER5 A;  2MA2 A;  5AER A;  2HET A;  1XO5 A;  3PN7 B;  1K96 A;  1A2X A;  4F0Z B;  1WLZ A;  3CLN A;  4PHM A;  4PDZ A;  2BCA A;  5CSF A;  2JNF A;  2M7L A;  5JJG A;  2L5X B;  2LUX A;  1TNQ A;  5ER4 X;  4NQG A;  5IBW A;  1K9P A;  2KI6 D;  1B9A A;  2H61 A;  1QLS A;  2O60 A;  3VGO A;  1K8U A;  2AAO A;  3SIA A;  4MRX A;  1AHR A;  1KK8 B;  2EC6 C;  3BOW A;  2ZN9 A;  3PM8 A;  3LK1 A;  2KGB C;  5KU1 A;  1SCV A;  1K2H A;  2LLU A;  2JNX A;  1F8H A;  1PVA A;  1YUU A;  4P5O E;  2LE9 B;  2WCB A;  1XFW O;  3JVT C;  1WY9 A;  1B8L A;  3BYA A;  4DRW A;  1CM1 A;  1XA5 A;  2F2O A;  1SCM B;  1TOP A;  4GBA A;  1YX8 A;  2BEC A;  2KNE A;  1S3P A;  2JT8 A;  1AK8 A;  5G08 A;  3CWG A;  3FWB A;  2CXJ A;  2FCE A;  2KOT A;  4GAO A;  1ALW A;  1DVI A;  1QAS A;  3E3R A;  2F2P A;  1Y1A A;  1EG4 A;  1K94 A;  2FJU B;  4GGF C;  1RJV A;  1KWO C;  1PRW A;  1TN4 A;  4Q04 A;  1J7O A;  1ODB A;  2K61 A;  1XFU O;  2CNP A;  2D8N A;  4GFT A;  5BPJ A;  1NUB A;  3KO0 A;  4ORA B;  3PLF B;  2K8M B;  4CFQ A;  5CSJ A;  1R2U A;  3JVT B;  1CDM A;  4DIR A;  4IL1 A;  5HLV A;  1SNL A;  1H4B A;  2JXC A;  2WCF A;  3TDU A;  2ISD A;  1KK7 Z;  1QVI Z;  2Y5I A;  5D69 A;  5I2L A;  1NPQ A;  2L51 A;  2M29 A;  4GNK B;  1S6I A;  4GGF A;  2JTZ A;  1REC A;  1D1O A;  1OZO A;  1TCF A;  1WDC C;  1CNP A;  4BY4 A;  1BJF A;  1IQ5 A;  1IGV A;  4QJ5 B;  1NCY A;  4XJK A;  4C0J A;  1CDN A;  1SL8 A;  1UUR A;  1EG3 A;  2JC2 A;  4HRE E;  5AFP A;  1YTZ C;  2Q91 A;  3WXA A;  2L98 A;  2LMV A;  3F45 A;  1VRK A;  2ZND A;  1U5I A;  1BU3 A;  1MR8 A;  3CR2 A;  1DJG A;  1JF2 A;  2F3Y A;  1SL7 A;  4MVF A;  1M31 A;  1SYM A;  3OHM B;  1PUL A;  1QJT A;  2L2E A;  1XVJ A;  4GGN A;  2K2F A;  1M39 A;  2Y1M A;  3EVR A;  1CMG A;  1J55 A;  1WDC B;  1SRA A;  1EXR A;  1QTX A;  5J3X A;  1RFJ A;  4AQJ A;  4NDD A;  2QPT A;  2WOS A;  1S26 D;  4MBE A;  2KGR A;  1QIV A;  1WLM A;  2PSR A;  2LAN A;  3PAT A;  5F6T A;  3VRO A;  4L9M A;  2KI6 C;  1XFV O;  4I5N B;  1OE9 B;  3CGA A;  1ZOT B;  3OB2 B;  4N5X A;  1JFK A;  3VRQ A;  5GQQ C;  3LL8 B;  1JUO A;  1QXP A;  1UHJ A;  4MSP A;  2BBM A;  2L4I A;  1BR4 B;  2M1K B;  2MRD A;  1TIZ A;  2LAP A;  3IQQ A;  2L0P A;  4WQ3 A;  4OR9 B;  1FW4 A;  2G2B A;  1KFU L; 
#chains in the Genus database with same CATH topology
 1GGW A;  2KQ6 A;  1SPY A;  1A75 B;  2M0R A;  4I5J A;  4ORC B;  3EKJ A;  5DIC A;  2AMI A;  2FOT A;  1OW4 A;  4QJ3 B;  5CSI A;  1NX2 A;  2LNK A;  3VRN A;  4FQO A;  2EGD A;  1UHH A;  2LUC A;  4PCW A;  1QV0 A;  1TUJ A;  1YUS A;  1SCM C;  4MZK A;  3D78 A;  5HKW A;  3C1V A;  1LS8 A;  4YGB B;  3BUN B;  5DKN A;  2LLS A;  4AQI A;  1EL4 A;  1NYA A;  2L4H A;  1Q80 A;  2JT0 A;  2ZFD A;  2K7D A;  1DGU A;  3K21 A;  3OBV A;  3RZS A;  5DKR A;  5AAN A;  1PAL A;  2DOQ A;  1TNW A;  1KCY A;  4R1E A;  1CLM A;  1GJY A;  2EHB A;  2OS8 C;  1IKU A;  3PJI A;  2I94 A;  3RLZ A;  2M97 A;  3CR5 X;  4MN0 A;  1AJ4 A;  3L47 A;  1L7Z A;  1F70 A;  2JXL A;  3H4S E;  3I5G C;  3D76 A;  2H8V A;  1IH0 A;  1DQE A;  4MZL A;  1CDL A;  1AJ5 A;  1QV1 A;  1TNP A;  4OV2 A;  3AAK A;  4PT1 A;  3R72 A;  4N1G A;  3GOF A;  1EH2 A;  5AEQ A;  1FI5 A;  3D0Y B;  3DY9 A;  2F33 A;  2L50 A;  1MXE A;  3FWC A;  2K7B A;  1W7J B;  3N7H A;  3TZ1 A;  1LIN A;  5FI7 A;  1NSH A;  1KFX L;  2GTE A;  4GUK A;  1S5G Y;  3B88 A;  4DCK A;  1IJ6 A;  1XYD A;  2B1U A;  2KFF A;  3AKB A;  2OS8 B;  5D3O A;  3DVM A;  1PK0 D;  2QEO A;  2JZI A;  4WRI A;  1SL9 A;  1N0Y A;  2MLE C;  4XYN A;  3O2P A;  1L2O C;  1SMG A;  1V1F A;  4TNC A;  3I5G B;  3O4X A;  2QEH A;  2LVK A;  2BCX A;  1XFR A;  3PFV A;  1TCO B;  3CTN A;  3BXK A;  3MSE B;  2WCE A;  3TS5 B;  1S6C A;  1OMR A;  5PAL A;  1UUS A;  4WQ2 A;  2LVV A;  5KSZ A;  1KFU S;  4N1F A;  4CPV A;  1BMO A;  2BCB A;  2QEB A;  1XK4 C;  1CFD A;  2KI4 B;  4YGA A;  1OOJ A;  2I2R E;  1NCZ A;  2WC8 A;  2M1U A;  3RM1 A;  2ZNE A;  1WRK A;  1YRT B;  4HRG A;  2WCH A;  2WCL A;  3BUW B;  1AP4 A;  1CLB A;  2GGZ A;  1F4Q A;  3A8R A;  1MXL C;  4ICB A;  3ZNI A;  4YI9 A;  1FF1 A;  2JQ6 A;  1L2O B;  2NXQ A;  5B8I B;  1QX7 A;  3SG4 A;  1RWY A;  1ZFS A;  2M8U A;  2V53 A;  1YVL A;  2WCM A;  2OPO A;  1XK4 A;  3KPX A;  4CFR A;  1DJZ A;  3IQO A;  4YGD B;  2L2C A;  3VB1 A;  4MRY A;  2LMU A;  4PHJ A;  1ORG A;  1QS7 A;  1DEL A;  1BG1 A;  1MF8 B;  2MJW B;  2PQL A;  1J1D A;  1IRJ A;  1A4P A;  4GPL B;  2WCK A;  4C0K A;  1OMD A;  1NX1 A;  1TTX A;  4ZCU A;  3VRR A;  2KSP A;  2NLN A;  1B7T Y;  3EVV A;  3HCM A;  2KDH A;  3M0W A;  5D7F A;  4USL A;  3DF0 B;  5DKQ A;  5KTY A;  3B87 A;  1LA0 A;  1FI6 A;  1YVH A;  1CTR A;  2LVI A;  3BFB A;  1C3Z A;  3SG3 A;  2CCM A;  1GQM A;  3JTD C;  2LCP A;  2RGI A;  1N65 A;  3S0D A;  1Y0V H;  3I5H B;  1CFC A;  2ZN8 A;  4YGC B;  4QJ4 B;  2I7A A;  2PVB A;  1KFX S;  5I94 A;  1J7Q A;  4JD9 A;  1CKK A;  4INW A;  3SG5 A;  2K0J A;  2LMT A;  1CMF A;  2JT3 A;  2KAV A;  1UWO A;  2KBI A;  2WC5 A;  1BR1 B;  2MHH A;  3SJS A;  3ZWH A;  1OOH A;  2BKI B;  5JOL A;  3NGV A;  4YI8 A;  1F54 A;  1OQP A;  3DVK A;  1A75 A;  1BF5 A;  1F4O A;  1NWD A;  3SS5 A;  2LHI A;  2BE6 A;  1W7I B;  2MBX A;  1C07 A;  2HPS A;  1CDP A;  1IWQ A;  2M9G A;  1IJ5 A;  1SR6 C;  1IQ3 A;  1T14 A;  1KSO A;  3TDI A;  2P6B B;  5HKY A;  3JTD B;  2LV7 A;  2LP3 A;  3D74 A;  1LKJ A;  1NIW A;  3BUM B;  2ERB A;  1LXF C;  1LVC D;  4PE1 A;  2K7O A;  2KYF A;  1ZAC A;  3EK4 A;  3TDZ A;  2MLF C;  4FQT A;  4PHK A;  3OX5 A;  4PHN A;  1PSB A;  1R6P A;  1ZMZ A;  1K93 D;  1S5G Z;  1RK9 A;  2ZKM X;  4JQ0 D;  2R2I A;  1SY9 A;  3I5F B;  2WOR A;  3SG6 A;  3S0G A;  1A03 A;  2BNX A;  2TN4 A;  3DXL A;  3UNW A;  1S1E A;  1M45 A;  1Z2C B;  4PAL A;  3GK2 A;  1B8R A;  3O78 A;  5FI2 A;  3KF9 A;  1TRF A;  2HQ8 A;  1BOC A;  4M2Q A;  2M49 B;  4M2P A;  1SKT A;  1SR6 B;  3QME A;  1UHN A;  3R1O A;  1DGV A;  4DS7 A;  3OX6 A;  2BL0 B;  2A4J A;  1PVB A;  1F71 A;  2QDI A;  4C0L A;  4CID A;  1TNX A;  3D0Y A;  4HRH A;  1OMV A;  2NCO A;  1JBA A;  1JSA A;  1Y1U A;  3LK0 A;  1LA3 A;  3SG7 A;  2H2K A;  1YUT A;  3NSI A;  3TS5 C;  2LM5 A;  2P71 A;  3KHE A;  2OTG B;  4E68 A;  3ICB A;  1DC1 A;  3S0E A;  4JWQ A;  1UP5 A;  2I18 A;  3I5I B;  3SG2 A;  4YGE B;  1F55 A;  3CDN A;  2F8P A;  2KBM A;  2FJY A;  1FBV A;  2KI4 C;  3VRP A;  1B47 A;  4BY5 A;  2BKH B;  3EVU A;  3PSR A;  5HKZ A;  1SK6 D;  1WRL A;  1QX5 B;  3NSO A;  4I5L B;  2CTN A;  5I2O A;  1JF0 A;  2KAY A;  1G8I A;  3QRX A;  4AOM A;  2JTT A;  1C7W A;  1DJX A;  1Y1X A;  2K7C A;  3HX4 A;  2BBN A;  1BT6 A;  1DJI A;  1MWN A;  4UPG A;  1H8B A;  1WRZ A;  1OZS A;  2E6W A;  1OOF A;  3FS7 A;  4KYN A;  3BOW B;  3V2L A;  1CLL A;  3NSL A;  2PRU A;  3WNX B;  1M46 A;  1HQV A;  4NDC A;  2NZ0 A;  5I8N A;  3FIA A;  1S36 A;  2K60 A;  2SCP A;  4MEW A;  5AXI A;  1YRU B;  1DJY A;  2KFG A;  1AVS A;  1DF0 A;  1K90 D;  2KAX A;  2ZRT A;  3Q8I A;  1B7T Z;  2LLT A;  3BJH A;  3LCP C;  4ORB B;  1QLK A;  1ZUZ A;  1HT9 A;  1FPW A;  1GGZ A;  3SIB A;  2LHL A;  2G9B A;  4JPZ B;  3BQ3 A;  1BOD A;  1SBJ A;  2EC6 B;  1DF0 B;  2JPT A;  2Q4U A;  1XFX O;  1KQM C;  2O5G A;  1X02 A;  1DJH A;  4YBH B;  3O6B A;  1B8C A;  2JWW A;  2PAS A;  2IS9 A;  2COL B;  5CPV A;  3TUY C;  3I5H C;  3KEV A;  2AUC A;  4MLW A;  1TUZ A;  1NCX A;  5TNC A;  4CLN A;  1G33 A;  1UHK A;  3BUX B;  3L4L A;  5HYD A;  5CSN A;  2HF5 A;  3WHT B;  1J7P A;  3GK1 A;  2FCD A;  1B4C A;  1IIO A;  5FYX A;  2PAL A;  1QIW A;  1MHO A;  1XFZ O;  2QEV A;  1KQV A;  1YUR A;  1DTL A;  2JU0 A;  3BUO B;  3CR4 X;  3AKA A;  3DF0 A;  1NX0 A;  3BFA A;  3D10 A;  1DT7 B;  2CT9 A;  1QAT A;  3EK8 A;  1V1G A;  2PMY A;  5EL2 A;  1MQ1 A;  2QAC A;  1KWO B;  1NP8 A;  1M63 B;  5I2Q A;  1KQM B;  4M2O A;  3CZ2 A;  2MAZ A;  1JFJ A;  1YX7 A;  1IG5 A;  3IVT A;  1AUI B;  3SS4 A;  4OKH A;  3L4A A;  2KYC A;  1S6J A;  2WND A;  1CM4 A;  2SAS A;  4NDB A;  4ZCV A;  4PE7 A;  2ZRS A;  2NCP A;  2HQW A;  2CBL A;  3B6X A;  4XJK B;  1XFY O;  2JOJ A;  2KPH A;  3TUY B;  4OVN F;  1G4Y R;  1SW8 A;  4U8D A;  2GGM A;  2Y1N A;  1OOI X;  2E30 A;  1RTP 1;  3GK4 X;  3O4Y A;  4DUQ A;  1SSE B;  1E8A A;  3SS3 A;  1BLQ A;  4MZJ A;  1N2D A;  1U5I B;  2KLD A;  1J1E A;  1KSM A;  3CS1 A;  3DVE A;  3EKH A;  4IJ7 A;  4A4C A;  3I5F C;  4A4B A;  1C7V A;  2KQY A;  5HL1 A;  1KK7 Y;  3DD4 A;  1QVI Y;  3EK7 A;  4OZD A;  1B1G A;  1OSA A;  4FTG A;  2M3W A;  2LVJ A;  3S0B A;  1EJ3 A;  1A29 A;  5K89 A;  4P2Y B;  3D77 A;  2WCJ A;  3A4U B;  3PN7 C;  4I5K A;  1RRO A;  2BL0 C;  1DMO A;  2KHN A;  2BAP A;  3OB1 B;  3WHU B;  1JWD A;  3CZT X;  3OP0 A;  4YRU A;  1CFF A;  2Y4Q A;  2BE4 A;  2JRF A;  2OTG C;  4PE4 A;  1PSR A;  3NSK A;  2M7N A;  4D1E A;  4F7F A;  2KFH A;  2F3Z A;  2LP2 A;  4ETO A;  4JKT A;  3I5I C;  1CB1 A;  2PYQ A;  2VRG A;  3LLE A;  3NHI A;  2JUL A;  2LC5 A;  1P28 A;  3IF7 A;  1NX3 A;  2K2A A;  1K95 A;  3NXA A;  2GV5 A;  1K9U A;  1ALV A;  3NHT A;  4HSZ A;  1DJW A;  1CFP A;  3DVJ A;  1K9K A;  1KK8 C;  1QX2 A;  1J7R A;  1JC2 A;  1MUX A;  3FE9 A;  1Y6W A;  1YR5 A;  3PAL A;  3AAJ A;  5HLO A;  2H61 C;  4PE0 A;  3CZ1 A;  4OCI A;  1UHI A;  5ER5 A;  2MA2 A;  5AER A;  2HET A;  1XO5 A;  3PN7 B;  1K96 A;  2WC6 A;  1A2X A;  4F0Z B;  1WLZ A;  3CLN A;  4PHM A;  4PDZ A;  2BCA A;  5CSF A;  3DYE A;  2JNF A;  2M7L A;  5JJG A;  3CAB A;  2L5X B;  2LUX A;  1TNQ A;  5ER4 X;  4NQG A;  5IBW A;  1K9P A;  1C3Y A;  2KI6 D;  1B9A A;  2H61 A;  1QLS A;  2O60 A;  3VGO A;  1K8U A;  2AAO A;  3SIA A;  4MRX A;  1AHR A;  1KK8 B;  2EC6 C;  2L5Y A;  3BOW A;  2ZN9 A;  3PM8 A;  3LK1 A;  2KGB C;  5KU1 A;  1SCV A;  1K2H A;  2LLU A;  2JNX A;  1F8H A;  1PVA A;  1YUU A;  4P5O E;  2LE9 B;  2WCB A;  1XFW O;  3JVT C;  1WY9 A;  3D73 A;  1B8L A;  3BYA A;  4DRW A;  1CM1 A;  1XA5 A;  2F2O A;  1SCM B;  1TOP A;  4GBA A;  1YX8 A;  2BEC A;  2KNE A;  1S3P A;  2JT8 A;  1AK8 A;  5G08 A;  3CWG A;  3FWB A;  2CXJ A;  2FCE A;  2KLE A;  2KOT A;  3DZT A;  4GAO A;  1ALW A;  3S0A A;  1DVI A;  1QAS A;  3FE6 A;  3E3R A;  2F2P A;  1Y1A A;  1EG4 A;  1K94 A;  2FJU B;  3B86 A;  4GGF C;  3UO9 A;  1RJV A;  3D75 A;  1KWO C;  1PRW A;  1TN4 A;  4INX A;  4Q04 A;  1J7O A;  2YGU A;  1ODB A;  1QWV A;  1XFU O;  2CNP A;  2D8N A;  2K61 A;  4GFT A;  1NUB A;  3KO0 A;  4ORA B;  5BPJ A;  3PLF B;  2K8M B;  4CFQ A;  5CSJ A;  1R2U A;  3JVT B;  1CDM A;  4DIR A;  4IL1 A;  5HLV A;  1SNL A;  1H4B A;  3K1E A;  2JXC A;  2WCF A;  3TDU A;  2ISD A;  1KK7 Z;  3CZ0 A;  1QVI Z;  2Y5I A;  5D69 A;  5I2L A;  1NPQ A;  2L51 A;  2M29 A;  4GNK B;  1S6I A;  4GGF A;  2JTZ A;  1REC A;  1D1O A;  1OZO A;  1TCF A;  1WDC C;  3OGN A;  1CNP A;  4BY4 A;  1BJF A;  1IQ5 A;  1IGV A;  4QJ5 B;  1NCY A;  4XJK A;  4C0J A;  1CDN A;  3S0F A;  1SL8 A;  1UUR A;  1EG3 A;  2JC2 A;  4HRE E;  5AFP A;  1YTZ C;  2Q91 A;  3WXA A;  2L98 A;  1TWO A;  2LMV A;  3PM2 A;  3F45 A;  1VRK A;  2ZND A;  1U5I A;  1BU3 A;  1MR8 A;  3CR2 A;  1DJG A;  1JF2 A;  2F3Y A;  1SL7 A;  3R1P A;  4MVF A;  1M31 A;  1SYM A;  3OHM B;  1PUL A;  1QJT A;  2L2E A;  1XVJ A;  4GGN A;  3R1V A;  1KFU L;  2K2F A;  1M39 A;  2Y1M A;  3EVR A;  1CMG A;  1J55 A;  1WDC B;  2JPO A;  1SRA A;  1EXR A;  1QTX A;  5J3X A;  1RFJ A;  4AQJ A;  4NDD A;  2QPT A;  2WOS A;  1S26 D;  1DEK A;  4MBE A;  3FE8 A;  2KGR A;  1QIV A;  3EG5 B;  1WLM A;  2PSR A;  2LAN A;  3PAT A;  5F6T A;  3VRO A;  4L9M A;  2KI6 C;  1XFV O;  4I5N B;  1OE9 B;  1GM0 A;  3CGA A;  1ZOT B;  3OB2 B;  4N5X A;  1JFK A;  5FI6 A;  3VRQ A;  5GQQ C;  3LL8 B;  1W9Z A;  3CYZ A;  1JUO A;  1QXP A;  1UHJ A;  3BFH A;  2BBM A;  2L4I A;  1BR4 B;  2M1K B;  2MRD A;  4MSP A;  1TIZ A;  2LAP A;  3IQQ A;  2L0P A;  1Z4H A;  4WQ3 A;  4OR9 B;  1FW4 A;  2G2B A;  2P70 A;  3B7A A;  1OOG A; 
#chains in the Genus database with same CATH homology
 1GGW A;  2KQ6 A;  1SPY A;  1A75 B;  2M0R A;  4I5J A;  4ORC B;  3EKJ A;  2AMI A;  2FOT A;  4QJ3 B;  5CSI A;  1NX2 A;  2LNK A;  3VRN A;  4FQO A;  2EGD A;  1UHH A;  2LUC A;  4PCW A;  1QV0 A;  1YUS A;  1SCM C;  4MZK A;  5HKW A;  3C1V A;  4YGB B;  3BUN B;  5DKN A;  2LLS A;  4AQI A;  1EL4 A;  1NYA A;  2L4H A;  1Q80 A;  2JT0 A;  2ZFD A;  2K7D A;  1DGU A;  3K21 A;  5DKR A;  5AAN A;  1PAL A;  2DOQ A;  1TNW A;  1KCY A;  4R1E A;  1GJY A;  1CLM A;  2EHB A;  2OS8 C;  1IKU A;  2I94 A;  3RLZ A;  2M97 A;  3CR5 X;  4MN0 A;  1AJ4 A;  1L7Z A;  1F70 A;  2JXL A;  3H4S E;  3I5G C;  1IH0 A;  4MZL A;  1CDL A;  1AJ5 A;  1QV1 A;  1TNP A;  4OV2 A;  3AAK A;  1EH2 A;  4N1G A;  3GOF A;  5AEQ A;  1FI5 A;  3D0Y B;  2F33 A;  2L50 A;  1MXE A;  3FWC A;  2K7B A;  1W7J B;  3TZ1 A;  1LIN A;  1NSH A;  1KFX L;  4GUK A;  1S5G Y;  4DCK A;  1IJ6 A;  1XYD A;  2B1U A;  2KFF A;  3AKB A;  2OS8 B;  3DVM A;  1PK0 D;  2JZI A;  4WRI A;  1SL9 A;  1N0Y A;  2MLE C;  4XYN A;  3O2P A;  1L2O C;  1SMG A;  1V1F A;  4TNC A;  3I5G B;  2LVK A;  2BCX A;  3PFV A;  1TCO B;  3CTN A;  3BXK A;  3MSE B;  2WCE A;  3TS5 B;  1S6C A;  1OMR A;  5PAL A;  1UUS A;  4WQ2 A;  2LVV A;  5KSZ A;  1KFU S;  4N1F A;  4CPV A;  1BMO A;  2BCB A;  1XK4 C;  1CFD A;  2KI4 B;  4YGA A;  1OOJ A;  2I2R E;  1NCZ A;  2WC8 A;  2M1U A;  3RM1 A;  2ZNE A;  1WRK A;  1YRT B;  4HRG A;  3BUW B;  1AP4 A;  1CLB A;  2GGZ A;  1F4Q A;  3A8R A;  1MXL C;  4ICB A;  3ZNI A;  4YI9 A;  1FF1 A;  2JQ6 A;  1L2O B;  2NXQ A;  5B8I B;  1QX7 A;  3SG4 A;  1RWY A;  1ZFS A;  2M8U A;  2V53 A;  1YVL A;  2OPO A;  1XK4 A;  3KPX A;  4CFR A;  1DJZ A;  3IQO A;  4YGD B;  4MRY A;  2LMU A;  4PHJ A;  1QS7 A;  1BG1 A;  1MF8 B;  2MJW B;  1J1D A;  1IRJ A;  1A4P A;  4GPL B;  4C0K A;  1OMD A;  1NX1 A;  1TTX A;  4ZCU A;  3VRR A;  2KSP A;  2NLN A;  1B7T Y;  3EVV A;  3HCM A;  2KDH A;  3M0W A;  5D7F A;  4USL A;  3DF0 B;  5DKQ A;  5KTY A;  1LA0 A;  1FI6 A;  1YVH A;  1CTR A;  2LVI A;  3SG3 A;  2CCM A;  1GQM A;  3JTD C;  2LCP A;  2RGI A;  1N65 A;  1Y0V H;  3I5H B;  1CFC A;  2ZN8 A;  4YGC B;  4QJ4 B;  2I7A A;  2PVB A;  1KFX S;  1J7Q A;  1CKK A;  3SG5 A;  2K0J A;  2LMT A;  1CMF A;  2JT3 A;  2KAV A;  1UWO A;  2KBI A;  1BR1 B;  2MHH A;  3SJS A;  3ZWH A;  2BKI B;  5JOL A;  4YI8 A;  1F54 A;  1OQP A;  3DVK A;  1A75 A;  1BF5 A;  1F4O A;  1NWD A;  2LHI A;  2BE6 A;  1W7I B;  2MBX A;  1C07 A;  2HPS A;  1CDP A;  1IWQ A;  2M9G A;  1IJ5 A;  1SR6 C;  1IQ3 A;  1KSO A;  3TDI A;  2P6B B;  5HKY A;  3JTD B;  2LV7 A;  2LP3 A;  1LKJ A;  1NIW A;  3BUM B;  1LXF C;  1LVC D;  4PE1 A;  2K7O A;  2KYF A;  1ZAC A;  3EK4 A;  3TDZ A;  2MLF C;  4PHK A;  3OX5 A;  4PHN A;  1PSB A;  1R6P A;  1ZMZ A;  1K93 D;  1S5G Z;  1RK9 A;  2ZKM X;  4JQ0 D;  2R2I A;  1SY9 A;  3I5F B;  2WOR A;  3SG6 A;  1A03 A;  2TN4 A;  1S1E A;  1M45 A;  4PAL A;  3GK2 A;  1B8R A;  3O78 A;  3KF9 A;  1TRF A;  2HQ8 A;  1BOC A;  4M2Q A;  2M49 B;  4M2P A;  1SKT A;  1SR6 B;  1UHN A;  1DGV A;  4DS7 A;  3OX6 A;  2BL0 B;  2A4J A;  1PVB A;  1F71 A;  4C0L A;  4CID A;  1TNX A;  3D0Y A;  4HRH A;  1OMV A;  2NCO A;  1JBA A;  1JSA A;  1Y1U A;  3LK0 A;  1LA3 A;  3SG7 A;  2H2K A;  1YUT A;  3NSI A;  3TS5 C;  2LM5 A;  3KHE A;  2OTG B;  4E68 A;  3ICB A;  4JWQ A;  1UP5 A;  2I18 A;  3I5I B;  3SG2 A;  4YGE B;  1F55 A;  2F8P A;  2KBM A;  2KI4 C;  1FBV A;  3VRP A;  1B47 A;  4BY5 A;  2BKH B;  3EVU A;  3PSR A;  5HKZ A;  1SK6 D;  1WRL A;  1QX5 B;  3NSO A;  4I5L B;  2CTN A;  5I2O A;  1JF0 A;  2KAY A;  1G8I A;  3QRX A;  4AOM A;  2JTT A;  1C7W A;  1DJX A;  1Y1X A;  2K7C A;  3HX4 A;  2BBN A;  1BT6 A;  1DJI A;  1MWN A;  4UPG A;  1H8B A;  1WRZ A;  1OZS A;  2E6W A;  3FS7 A;  3BOW B;  1CLL A;  3NSL A;  2PRU A;  3WNX B;  1M46 A;  1HQV A;  4NDC A;  2NZ0 A;  5I8N A;  3FIA A;  1S36 A;  4MEW A;  2SCP A;  5AXI A;  1YRU B;  1DJY A;  2KFG A;  1AVS A;  1DF0 A;  1K90 D;  2KAX A;  2ZRT A;  1B7T Z;  2LLT A;  3LCP C;  4ORB B;  1QLK A;  1ZUZ A;  1HT9 A;  1FPW A;  1GGZ A;  3SIB A;  2LHL A;  2G9B A;  4JPZ B;  3BQ3 A;  1BOD A;  1SBJ A;  2EC6 B;  1DF0 B;  2JPT A;  2Q4U A;  1XFX O;  1KQM C;  2O5G A;  1X02 A;  1DJH A;  4YBH B;  3O6B A;  1B8C A;  2JWW A;  2PAS A;  2IS9 A;  2COL B;  5CPV A;  3TUY C;  3I5H C;  3KEV A;  2AUC A;  4MLW A;  5TNC A;  1NCX A;  4CLN A;  1G33 A;  1UHK A;  3BUX B;  5HYD A;  5CSN A;  2HF5 A;  3WHT B;  1J7P A;  3GK1 A;  2FCD A;  1B4C A;  5FYX A;  2PAL A;  1QIW A;  1MHO A;  1XFZ O;  1KQV A;  1YUR A;  1DTL A;  2JU0 A;  3BUO B;  3CR4 X;  3AKA A;  3DF0 A;  1NX0 A;  3D10 A;  1DT7 B;  2CT9 A;  1QAT A;  3EK8 A;  1V1G A;  2PMY A;  1MQ1 A;  2QAC A;  1KWO B;  1NP8 A;  1M63 B;  5I2Q A;  1KQM B;  4M2O A;  1JFJ A;  2MAZ A;  1YX7 A;  1IG5 A;  1AUI B;  4OKH A;  2KYC A;  1S6J A;  2WND A;  1CM4 A;  2SAS A;  4NDB A;  4ZCV A;  4PE7 A;  2ZRS A;  2NCP A;  2HQW A;  2CBL A;  4XJK B;  1XFY O;  2JOJ A;  3TUY B;  4OVN F;  1G4Y R;  1SW8 A;  4U8D A;  2GGM A;  2Y1N A;  2E30 A;  1RTP 1;  3GK4 X;  3O4Y A;  4DUQ A;  1E8A A;  1BLQ A;  4MZJ A;  1N2D A;  1U5I B;  1J1E A;  1KSM A;  3CS1 A;  3DVE A;  3EKH A;  4A4C A;  3I5F C;  4A4B A;  1C7V A;  2KQY A;  1KK7 Y;  3DD4 A;  1QVI Y;  3EK7 A;  1B1G A;  1OSA A;  4FTG A;  2M3W A;  2LVJ A;  1EJ3 A;  1A29 A;  5K89 A;  4P2Y B;  3A4U B;  3PN7 C;  4I5K A;  1RRO A;  2BL0 C;  1DMO A;  2KHN A;  1JWD A;  3OB1 B;  3WHU B;  3CZT X;  3OP0 A;  4YRU A;  1CFF A;  2Y4Q A;  2BE4 A;  2JRF A;  2OTG C;  4PE4 A;  1PSR A;  3NSK A;  2M7N A;  4D1E A;  2KFH A;  2F3Z A;  2LP2 A;  4ETO A;  1CB1 A;  3I5I C;  2VRG A;  3LLE A;  2JUL A;  2LC5 A;  3IF7 A;  1NX3 A;  2K2A A;  1K95 A;  3NXA A;  2GV5 A;  1K9U A;  1ALV A;  4HSZ A;  1DJW A;  1CFP A;  3DVJ A;  1K9K A;  1KK8 C;  1QX2 A;  1J7R A;  1JC2 A;  1MUX A;  1Y6W A;  1YR5 A;  3PAL A;  3AAJ A;  5HLO A;  2H61 C;  4PE0 A;  4OCI A;  1UHI A;  5ER5 A;  2MA2 A;  5AER A;  2HET A;  1XO5 A;  3PN7 B;  1K96 A;  1A2X A;  4F0Z B;  1WLZ A;  3CLN A;  4PHM A;  4PDZ A;  2BCA A;  5CSF A;  2JNF A;  2M7L A;  5JJG A;  2L5X B;  2LUX A;  1TNQ A;  5ER4 X;  4NQG A;  5IBW A;  1K9P A;  2KI6 D;  1B9A A;  2H61 A;  1QLS A;  2O60 A;  3VGO A;  1K8U A;  2AAO A;  3SIA A;  4MRX A;  1AHR A;  1KK8 B;  2EC6 C;  3BOW A;  2ZN9 A;  3PM8 A;  3LK1 A;  2KGB C;  5KU1 A;  1SCV A;  1K2H A;  2LLU A;  2JNX A;  1F8H A;  1PVA A;  1YUU A;  4P5O E;  2LE9 B;  2WCB A;  1XFW O;  3JVT C;  1WY9 A;  1B8L A;  3BYA A;  4DRW A;  1CM1 A;  1XA5 A;  2F2O A;  1SCM B;  1TOP A;  4GBA A;  1YX8 A;  2BEC A;  2KNE A;  1S3P A;  2JT8 A;  1AK8 A;  5G08 A;  3CWG A;  3FWB A;  2CXJ A;  2FCE A;  2KOT A;  4GAO A;  1ALW A;  1DVI A;  1QAS A;  3E3R A;  2F2P A;  1Y1A A;  1EG4 A;  1K94 A;  2FJU B;  4GGF C;  1RJV A;  1KWO C;  1PRW A;  1TN4 A;  4Q04 A;  1J7O A;  1ODB A;  2K61 A;  1XFU O;  2CNP A;  2D8N A;  4GFT A;  5BPJ A;  1NUB A;  3KO0 A;  4ORA B;  3PLF B;  2K8M B;  4CFQ A;  5CSJ A;  1R2U A;  3JVT B;  1CDM A;  4DIR A;  4IL1 A;  5HLV A;  1SNL A;  1H4B A;  2JXC A;  2WCF A;  3TDU A;  2ISD A;  1KK7 Z;  1QVI Z;  2Y5I A;  5D69 A;  5I2L A;  1NPQ A;  2L51 A;  2M29 A;  4GNK B;  1S6I A;  4GGF A;  2JTZ A;  1REC A;  1D1O A;  1OZO A;  1TCF A;  1WDC C;  1CNP A;  4BY4 A;  1BJF A;  1IQ5 A;  1IGV A;  4QJ5 B;  1NCY A;  4XJK A;  4C0J A;  1CDN A;  1SL8 A;  1UUR A;  1EG3 A;  2JC2 A;  4HRE E;  5AFP A;  1YTZ C;  2Q91 A;  3WXA A;  2L98 A;  2LMV A;  3F45 A;  1VRK A;  2ZND A;  1U5I A;  1BU3 A;  1MR8 A;  3CR2 A;  1DJG A;  1JF2 A;  2F3Y A;  1SL7 A;  4MVF A;  1M31 A;  1SYM A;  3OHM B;  1PUL A;  1QJT A;  2L2E A;  1XVJ A;  4GGN A;  2K2F A;  1M39 A;  2Y1M A;  3EVR A;  1CMG A;  1J55 A;  1WDC B;  1SRA A;  1EXR A;  1QTX A;  5J3X A;  1RFJ A;  4AQJ A;  4NDD A;  2QPT A;  2WOS A;  1S26 D;  4MBE A;  2KGR A;  1QIV A;  1WLM A;  2PSR A;  2LAN A;  3PAT A;  5F6T A;  3VRO A;  4L9M A;  2KI6 C;  1XFV O;  4I5N B;  1OE9 B;  3CGA A;  1ZOT B;  3OB2 B;  4N5X A;  1JFK A;  3VRQ A;  5GQQ C;  3LL8 B;  1JUO A;  1QXP A;  1UHJ A;  4MSP A;  2BBM A;  2L4I A;  1BR4 B;  2M1K B;  2MRD A;  1TIZ A;  2LAP A;  3IQQ A;  2L0P A;  4WQ3 A;  4OR9 B;  1FW4 A;  2G2B A;  1KFU L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...