3BOWB

Structure of m-calpain in complex with calpastatin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
174
structure length
174
Chain Sequence
SEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain-2 catalytic subunit
publication title Calcium-bound structure of calpain and its mechanism of inhibition by calpastatin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3bowB00
3DD4A 1RJVA 2KHNA 1CDLA 1YUTA 1CDNA 4AOMA 3OP0A 2HPSA 5TNCA 1FI6A 1K94A 2M29A 1JBAA 1KQMC 1L2OC 3KHEA 2KGBC 4AQIA 4E68A 5HKWA 3SIBA 1DMOA 3FWCA 3NSKA 1WRLA 2L5XB 2MHHA 3IQQA 1CMFA 2JTZA 3TUYC 2HF5A 1B1GA 1NCXA 2K8MB 4I5KA 3FWBA 2LUCA 3RM1A 2OS8C 1DF0B 2ZNDA 3VRQA 3EKHA 1S1EA 1J55A 3VRNA 3EVVA 2FCEA 5D7FA 1YR5A 1YX8A 1QLSA 1KFXS 1NPQA 1GGWA 1RROA 2LVJA 4GBAA 1CFDA 2KOTA 1EXRA 1HT9A 2F2PA 3JTDB 5PALA 2M1UA 1QV0A 3BUOB 1ALWA 4YGAA 4CFQA 2I18A 4PALA 4M2OA 1B7TZ 1PVAA 1FPWA 1K9PA 1CDMA 3RLZA 2KQYA 3PFVA 1RWYA 4JWQA 3DVKA 3WNXB 4MSPA 1BT6A 2RGIA 1OMDA 4MZJA 4PCWA 1S5GY 5DKQA 2LVIA 4GNKB 1S36A 1WY9A 1UHHA 3VGOA 1QTXA 2JT0A 1G4YR 1KK8C 3NSLA 2PALA 2BE4A 2KFFA 1XVJA 2BCBA 3HCMA 2CCMA 1A03A 1HQVA 2M1KB 1JF2A 1J1DA 1B8CA 1OSAA 3ZWHA 3I5GC 1GGZA 1QATA 1QIWA 2O5GA 2WCFA 3EK8A 1K93D 4I5LB 3WHTB 3O78A 1XO5A 1Q80A 1IQ3A 1DJWA 3SIAA 4AQJA 3SG2A 3CWGA 2SASA 1BR4B 1R2UA 3AAJA 2KBMA 1ODBA 3FS7A 1AVSA 1A4PA 1U5IA 2L98A 1J1EA 2MRDA 4NQGA 1LVCD 2OPOA 4FTGA 4CPVA 1DGVA 3E3RA 4ORAB 4MLWA 3KO0A 1QX7A 3PN7C 2FJUB 3OB1B 2A4JA 2EGDA 5K89A 4PHMA 2G9BA 1SYMA 1KFUL 2K2FA 1SL8A 1WDCB 1DJHA 1UHIA 4NDDA 1MXLC 2KAVA 3WXAA 1AK8A 3IF7A 1L7ZA 4DS7A 1CLLA 3I5FB 2M0RA 1WRZA 1KQVA 1EG3A 5I8NA 2WOSA 2LLTA 1Y1UA 2L4HA 1NWDA 1TCOB 3I5IB 1MQ1A 2NLNA 1IRJA 1IKUA 1LKJA 5FYXA 3A4UB 1UWOA 4ETOA 4OCIA 2KAXA 2AUCA 2JNXA 3GOFA 1CLMA 1YURA 1KSOA 2H61C 1QASA 1WLZA 2JT3A 3CGAA 1B9AA 1XFVO 4PE0A 2KFHA 3SJSA 2MAZA 5CSFA 1C07A 1IG5A 2H2KA 3AAKA 4PDZA 3O4YA 1OMVA 4OV2A 2E6WA 4HRHA 1JFJA 1IQ5A 1C7WA 2KAYA 1MR8A 3JTDC 3JVTB 4ORBB 5BPJA 2QPTA 1H4BA 4GPLB 2JQ6A 2JU0A 1RTP1 4MN0A 4N5XA 2LAPA 2I2RE 2BCXA 1ALVA 1PRWA 2M8UA 3LK0A 1DVIA 1UHNA 2AMIA 2F3ZA 3BXKA 2JXLA 3TS5B 2Y5IA 2JNFA 1SCVA 5G08A 1R6PA 1KSMA 2KI4B 1F71A 3BQ3A 1OMRA 4YGCB 2KI6D 2L51A 4F0ZB 2BE6A 1JSAA 4XYNA 1XFUO 3QRXA 5CSIA 3DVEA 2WORA 1CB1A 4ZCUA 2QACA 2WC8A 1V1FA 4D1EA 1KK7Y 1YTZC 1JC2A 1E8AA 2KNEA 3LK1A 1CFCA 1DJGA 2COLB 2K2AA 3BYAA 1IJ5A 4CLNA 4C0KA 4DIRA 1CTRA 1CDPA 1JWDA 1QXPA 2JOJA 1NCYA 1DGUA 4CFRA 3OX6A 4C0LA 5JOLA 2JRFA 2VRGA 4YGDB 2E30A 2TN4A 3M0WA 3TDZA 1CFPA 1TOPA 2L2EA 1KFXL 2BKHB 5J3XA 1MHOA 3OB2B 4NDBA 3CR2A 3TZ1A 4QJ3B 5F6TA 2HQ8A 3IQOA 1W7IB 3DF0B 2EC6B 4PE7A 2LMVA 1A75B 1S6CA 2ZN9A 5IBWA 1WDCC 1TNPA 5AFPA 2M49B 1QIVA 2JPTA 2M3WA 3EK7A 5HLVA 2BL0B 1S6JA 1LA0A 1SCMB 2I94A 3KPXA 3EKJA 3I5FC 3PALA 1OE9B 2PSRA 1V1GA 1MXEA 2KYFA 4XJKB 2GGMA 1NYAA 2G2BA 2LC5A 3I5IC 1FBVA 4ZCVA 1TTXA 1NSHA 5KSZA 4PE1A 1B8LA 1XFZO 1M45A 2B1UA 4M2QA 2KQ6A 2KSPA 4U8DA 4MRYA 2LCPA 5DKRA 1DTLA 1CNPA 1TNXA 5AXIA 1CLBA 4UPGA 1J7RA 4I5NB 3EVRA 2SCPA 4BY5A 4N1GA 1TRFA 5D69A 1BOCA 4A4BA 3PM8A 1OOJA 5CPVA 1S5GZ 2R2IA 2JXCA 1W7JB 3JVTC 3CLNA 2KI6C 2F2OA 4WQ2A 3D10A 4PHKA 2PASA 3TDUA 3TUYB 1CKKA 1TNWA 3I5HB 1AP4A 2D8NA 4BY4A 1OZOA 3HX4A 4MEWA 4YI9A 5AANA 1SR6B 3LCPC 3BOWA 2M9GA 3BUNB 3GK4X 3TS5C 1SL9A 1F8HA 2L4IA 1QJTA 2HQWA 3CR4X 3GK1A 3SG7A 2M97A 3CR5X 3WHUB 2ZFDA 5I2OA 3PATA 2LVKA 1LINA 2F8PA 4YI8A 2ZKMX 2WNDA 1KWOB 1SNLA 1OQPA 4QJ4B 2KYCA 2WCEA 4MZKA 5KU1A 4L9MA 2Y1NA 1JF0A 4P5OE 4NDCA 4JQ0D 4I5JA 5HYDA 2WCBA 5HKYA 5AEQA 1MF8B 1MUXA 1SW8A 1J7PA 2O60A 2PVBA 2CBLA 1KCYA 1CMGA 2F3YA 1SMGA 1DJZA 3GK2A 1SK6D 4MZLA 3ZNIA 1M31A 3SG6A 1QVIY 1DF0A 1NP8A 3KEVA 2EHBA 2H61A 1NCZA 3VROA 2LHLA 1A2XA 1EG4A 3F45A 4HREE 3NSOA 3BUMB 2BBNA 1LXFC 1EH2A 1NX0A 2V53A 2OTGB 4M2PA 5AERA 2NCPA 4QJ5B 3BUWB 2EC6C 1S26D 1U5IB 3K21A 2IS9A 1SY9A 2K0JA 1YX7A 3CZTX 2K61A 2BL0C 2BBMA 4JPZB 1SCMC 2JZIA 1DJYA 3OX5A 1BF5A 4ICBA 4N1FA 2LLUA 1YUUA 2JT8A 2GV5A 2K7DA 2KDHA 1SPYA 4Q04A 1SL7A 3VRRA 2DOQA 1M63B 3H4SE 4GGNA 1A29A 3CS1A 1G8IA 1PULA 3A8RA 3PLFB 3DVMA 1AJ5A 4XJKA 3O6BA 4GGFC 4GFTA 2LVVA 1BLQA 2ZRSA 4DCKA 1QV1A 3NXAA 1K2HA 5I2QA 2BECA 1TN4A 2LM5A 2K7BA 1K90D 1NUBA 4HRGA 1IJ6A 1YRTB 1G33A 1PK0D 3EK4A 1F55A 3CTNA 4GGFA 1RFJA 2PRUA 3MSEB 1NIWA 2MLEC 3AKBA 4HSZA 1B7TY 2LV7A 2JULA 1N65A 4OKHA 1N0YA 5DKNA 1F4OA 2FOTA 1H8BA 1JUOA 2Q4UA 1EJ3A 3I5HC 2NCOA 1UURA 2LP2A 1K95A 1BMOA 1DJIA 1J7QA 1XFYO 1SR6C 1KK7Z 2ZRTA 1S3PA 2NZ0A 1FF1A 2LNKA 2K7OA 3C1VA 1F54A 3D0YB 2GGZA 2HETA 2ISDA 1XFWO 1SBJA 5CSJA 3LL8B 2LANA 2ZNEA 2K7CA 1K96A 1CM4A 2KFGA 1CM1A 1OZSA 3SG3A 1S6IA 3TDIA 1KWOC 1XFXO 1XYDA 1BG1A 1Y0VH 5KTYA 1WRKA 1PALA 3LLEA 1VRKA 2CT9A 1YVLA 2MBXA 4IL1A 2MJWB 1K8UA 1MWNA 1YVHA 4DUQA 1AJ4A 4DRWA 1KQMB 1IWQA 1L2OB 1B8RA 1XK4C 3AKAA 5JJGA 1C7VA 5ER5A 4WRIA 4YGEB 1GJYA 1TCFA 3DVJA 4ORCB 2BKIB 1M46A 4OR9B 1IGVA 1QS7A 2OTGC 1WLMA 1UHKA 1XK4A 2OS8B 1QLKA 2L50A 1DT7B 1SRAA 2PMYA 1K9UA 5HLOA 2LP3A 1YRUB 2FCDA 1CFFA 3ICBA 2LHIA 2JWWA 1AHRA 4YGBB 1ZUZA 1AUIB 2KI4C 1PSRA 1Y1XA 4MVFA 4WQ3A 1D1OA 2Y4QA 3EVUA 4FQOA 1KFUS 4PE4A 1PVBA 4PHJA 1IH0A 5HKZA 3OHMB 1PSBA 1UUSA 1DJXA 1F70A 4CIDA 2Q91A 1Y6WA 1LA3A 2CXJA 4R1EA 3SG4A 2CTNA 1GQMA 1B4CA 4YRUA 4MBEA 1BJFA 4TNCA 2JTTA 4P2YB 2P6BB 3FIAA 2F33A 5GQQC 1BODA 1NX1A 4YBHB 5ER4X 1EL4A 1KK8B 1BU3A 1ZFSA 1BR1B 1YUSA 4MRXA 1M39A 4A4CA 5B8IB 2M7NA 2NXQA 1NX3A 1XA5A 2LLSA 1Y1AA 2ZN8A 2LE9B 4GUKA 3SG5A 3VRPA 2LMTA 1UHJA 1RECA 3I5GB 1F4QA 4USLA 1K9KA 2M7LA 5I2LA 1J7OA 4OVNF 2CNPA 4GAOA 4C0JA 2MA2A 1TIZA 1ZOTB 1ZACA 2KBIA 1JFKA 2BCAA 1N2DA 1UP5A 3KF9A 3O2PA 1NX2A 2KGRA 1FW4A 1RK9A 1X02A 3DF0A 2MLFC 3BUXB 1A75A 1QVIZ 2LUXA 3BOWB 3PSRA 3NSIA 1ZMZA 2AAOA 1SKTA 5CSNA 1B47A 1QX5B 2L0PA 1TNQA 2LMUA 1FI5A 3D0YA 3PN7B 2JC2A 2I7AA 4PHNA 1QX2A 2Y1MA
chains in the Genus database with same CATH superfamily
3DD4A 1RJVA 2KHNA 1CDLA 1YUTA 1CDNA 4AOMA 3L4AA 3OP0A 2HPSA 5TNCA 1FI6A 1K94A 2M29A 3BFBA 1JBAA 1KQMC 1L2OC 3KHEA 2KGBC 4AQIA 4E68A 2PYQA 5HKWA 3SIBA 1DMOA 3CDNA 3FWCA 3R1PA 2JPOA 3NSKA 3PJIA 1WRLA 2L5XB 2MHHA 3IQQA 1CMFA 2JTZA 3TUYC 2HF5A 1B1GA 2QEVA 1NCXA 2K8MB 4I5KA 3FWBA 2LUCA 3RM1A 2OS8C 1DF0B 2ZNDA 3VRQA 3EKHA 5FI6A 3L47A 1S1EA 1J55A 2QEHA 3VRNA 3EVVA 2FCEA 5D7FA 5DICA 1YR5A 1YX8A 1QLSA 1KFXS 1NPQA 1GGWA 1RROA 2LVJA 4GBAA 1CFDA 2KOTA 3O4XA 1EXRA 1HT9A 2F2PA 3JTDB 5PALA 2M1UA 1QV0A 3BUOB 1ALWA 4YGAA 4CFQA 2I18A 4PALA 4M2OA 1B7TZ 1PVAA 1FPWA 3SS3A 1K9PA 1W9ZA 1CDMA 3RLZA 2KQYA 2WCLA 3OBVA 3PFVA 1RWYA 4JWQA 3DVKA 3WNXB 3R1VA 4MSPA 1DQEA 3R1OA 1TWOA 1BT6A 2RGIA 1OMDA 4MZJA 4PCWA 1S5GY 5DKQA 2LVIA 4GNKB 2H8VA 1S36A 1WY9A 3BFHA 1UHHA 3VGOA 1QTXA 2JT0A 1G4YR 1KK8C 3NSLA 2PALA 2BE4A 2KFFA 1XVJA 2BCBA 3HCMA 1OOFA 2CCMA 1A03A 1HQVA 1TUZA 2M1KB 1JF2A 1J1DA 1B8CA 1OSAA 3ZWHA 3I5GC 1GGZA 1QATA 1QIWA 2O5GA 2WCFA 3EK8A 1K93D 4I5LB 1SSEB 3S0BA 3O78A 3WHTB 3QMEA 1XO5A 1Q80A 3D77A 3CABA 1IQ3A 1DJWA 3SIAA 4AQJA 3SG2A 3CWGA 2SASA 1BR4B 1R2UA 3AAJA 2KBMA 1ODBA 3FS7A 1AVSA 1A4PA 1U5IA 2L98A 5HL1A 1J1EA 2MRDA 4NQGA 1LVCD 2OPOA 4FTGA 4CPVA 3IVTA 2WCHA 3FE9A 1DGVA 3E3RA 4ORAB 4MLWA 3KO0A 1QX7A 3PN7C 2FJUB 3OB1B 2A4JA 2EGDA 5K89A 4PHMA 2G9BA 3RZSA 1SYMA 1KFUL 2K2FA 1SL8A 1WDCB 1DJHA 1UHIA 4NDDA 2QEOA 1MXLC 2KAVA 3WXAA 1AK8A 3IF7A 1L7ZA 4DS7A 1CLLA 3I5FB 2M0RA 1WRZA 1C3ZA 1EG3A 3B87A 5I8NA 1KQVA 3NHTA 2WOSA 2LLTA 1Y1UA 2L4HA 1NWDA 1TCOB 3I5IB 1MQ1A 5FI2A 2KPHA 2NLNA 1IRJA 3B88A 1IKUA 1LKJA 4INWA 5FYXA 3A4UB 1UWOA 4ETOA 4OCIA 2KAXA 2AUCA 2JNXA 3GOFA 3DZTA 1CLMA 1YURA 1KSOA 2H61C 3B6XA 1QASA 1WLZA 2JT3A 3CGAA 1B9AA 1XFVO 4PE0A 2KFHA 3SJSA 2MAZA 5CSFA 1C07A 1DEKA 1IG5A 2H2KA 3AAKA 4PDZA 3O4YA 1OMVA 4OV2A 3SS5A 2E6WA 4HRHA 1H4BA 4F7FA 1JFJA 1IQ5A 1C7WA 2KAYA 1MR8A 1P28A 2P71A 2PQLA 3JTDC 2QPTA 3JVTB 4ORBB 4GPLB 5BPJA 2JQ6A 2JU0A 1RTP1 3D73A 4MN0A 4N5XA 2LAPA 2I2RE 2BCXA 1ALVA 1PRWA 3D78A 2M8UA 3LK0A 1DVIA 1UHNA 2AMIA 2F3ZA 3BXKA 2JXLA 3TS5B 3D75A 2Y5IA 3OGNA 2JNFA 1DELA 1SCVA 5G08A 1R6PA 1KSMA 2KI4B 2WCJA 3BQ3A 1OMRA 4YGCB 1F71A 3S0FA 2KI6D 2L51A 4F0ZB 2BE6A 1JSAA 4XYNA 1XFUO 3QRXA 5CSIA 3DVEA 2WORA 3EG5B 1CB1A 2L2CA 3DYEA 2QACA 4ZCUA 3B7AA 2WC8A 1V1FA 2YGUA 4D1EA 1KK7Y 1LS8A 1YTZC 1JC2A 1E8AA 2KNEA 3LK1A 1CFCA 1DJGA 2COLB 2K2AA 3BYAA 1IJ5A 4CLNA 4C0KA 4DIRA 1CTRA 3L4LA 1CDPA 1JWDA 1QXPA 2JOJA 1NCYA 1DGUA 4CFRA 3OX6A 4C0LA 4OKHA 5JOLA 2JRFA 2VRGA 4YGDB 2E30A 2TN4A 3M0WA 3TDZA 1CFPA 1TOPA 2L2EA 1KFXL 2BKHB 2WC6A 5J3XA 1MHOA 3OB2B 4NDBA 3CR2A 1T14A 3TZ1A 4QJ3B 5F6TA 3S0AA 2HQ8A 3IQOA 1W7IB 3DF0B 2EC6B 2WC5A 4PE7A 2LMVA 1A75B 1S6CA 2ZN9A 5IBWA 1WDCC 1TNPA 5AFPA 2M49B 1QIVA 2JPTA 2M3WA 3EK7A 5HLVA 2BL0B 1S6JA 1LA0A 1SCMB 2I94A 3KPXA 3V2LA 3EKJA 3I5FC 3PALA 1OE9B 2PSRA 1V1GA 1MXEA 2KYFA 4XJKB 2GGMA 1NYAA 2G2BA 2LC5A 3I5IC 1FBVA 4ZCVA 1TTXA 1NSHA 2P70A 2GTEA 4PE1A 5KSZA 1B8LA 2K60A 1XFZO 1M45A 2B1UA 4M2QA 2KQ6A 2KSPA 3PM2A 4U8DA 4MRYA 2LCPA 5DKRA 1DTLA 1CNPA 1TNXA 5AXIA 1CLBA 4UPGA 1J7RA 4I5NB 3EVRA 2SCPA 2WCKA 4BY5A 3FE8A 4N1GA 2L5YA 1TRFA 5D69A 1BOCA 4A4BA 3PM8A 1OOJA 5CPVA 1S5GZ 2R2IA 2JXCA 1W7JB 3BJHA 3JVTC 3CLNA 2KI6C 2F2OA 4WQ2A 3D10A 4PHKA 2PASA 3TDUA 3TUYB 3D74A 1CKKA 1TNWA 3I5HB 1AP4A 2D8NA 4BY4A 1OZOA 3HX4A 4MEWA 4YI9A 5AANA 1SR6B 3LCPC 3BOWA 2M9GA 3BUNB 3GK4X 3TS5C 1SL9A 1F8HA 2L4IA 1QJTA 4JD9A 2HQWA 3CR4X 3GK1A 3SG7A 2M97A 3CR5X 3BFAA 3WHUB 2ZFDA 5I2OA 3PATA 2LVKA 3CZ0A 1LINA 2F8PA 4YI8A 2ZKMX 2WNDA 1KWOB 1SNLA 1OQPA 4QJ4B 2KYCA 2WCEA 4MZKA 5KU1A 4L9MA 2Y1NA 1JF0A 4KYNA 2BNXA 4P5OE 4NDCA 4JQ0D 4I5JA 5HYDA 2WCBA 5HKYA 5AEQA 1MF8B 1MUXA 1SW8A 1J7PA 2O60A 2PVBA 2CBLA 1KCYA 1CMGA 2F3YA 1SMGA 1DJZA 3GK2A 1SK6D 4MZLA 3ZNIA 1M31A 3S0EA 3SG6A 1QVIY 1DF0A 3B86A 1NP8A 3KEVA 2EHBA 2H61A 1NCZA 3VROA 2LHLA 1A2XA 1EG4A 3F45A 4HREE 3NSOA 3BUMB 2BBNA 1LXFC 1EH2A 1NX0A 2V53A 2OTGB 1DC1A 1IIOA 4M2PA 5AERA 2NCPA 4QJ5B 3BUWB 2EC6C 1S26D 1U5IB 3K21A 2IS9A 2WCMA 1SY9A 3CZ1A 3D76A 2K0JA 1YX7A 3CZTX 2K61A 2BL0C 2BBMA 4JPZB 1SCMC 2JZIA 1DJYA 3OX5A 1BF5A 4ICBA 4N1FA 3Q8IA 2LLUA 1YUUA 2JT8A 2GV5A 2K7DA 2KDHA 1SPYA 4Q04A 1SL7A 3VRRA 2DOQA 1M63B 3H4SE 4GGNA 1A29A 3CS1A 1G8IA 1PULA 3A8RA 3PLFB 3DVMA 1AJ5A 4XJKA 3O6BA 4GGFC 4GFTA 2LVVA 1BLQA 2ZRSA 4DCKA 1QV1A 3NXAA 1K2HA 3N7HA 5I2QA 2BECA 1TN4A 2LM5A 2K7BA 1K90D 1NUBA 4HRGA 1IJ6A 1YRTB 1G33A 1PK0D 3EK4A 1F55A 2KLEA 3CTNA 1RFJA 4GGFA 2PRUA 3MSEB 1NIWA 2MLEC 3AKBA 4HSZA 1B7TY 2LV7A 2JULA 1N65A 4JKTA 1N0YA 3DXLA 5DKNA 1F4OA 2FOTA 3VB1A 1JUOA 2Q4UA 1H8BA 1EJ3A 3I5HC 2NCOA 1UURA 2BAPA 2LP2A 1K95A 1BMOA 1DJIA 1J7QA 1XFYO 1SR6C 1QWVA 1KK7Z 2ZRTA 1S3PA 2NZ0A 1FF1A 3S0DA 3CZ2A 4IJ7A 2LNKA 2K7OA 3C1VA 1F54A 1TUJA 3D0YB 4PT1A 2GGZA 2HETA 2ISDA 1XFWO 1SBJA 3NGVA 5CSJA 3LL8B 2LANA 2ZNEA 3R72A 2K7CA 1OOIX 1K96A 1CM4A 2KFGA 1CM1A 2QEBA 1OZSA 3SG3A 1S6IA 3TDIA 1KWOC 1XFXO 1XYDA 1BG1A 1Y0VH 5KTYA 1WRKA 1PALA 3LLEA 1VRKA 2CT9A 1YVLA 3K1EA 2MBXA 4IL1A 2MJWB 1K8UA 1MWNA 1YVHA 2FJYA 2KLDA 3UNWA 4DUQA 1AJ4A 4DRWA 1KQMB 1IWQA 1L2OB 1B8RA 3NHIA 1XK4C 3AKAA 5JJGA 1C7VA 5ER5A 4WRIA 4YGEB 1GJYA 1TCFA 3DVJA 4ORCB 2BKIB 1M46A 4OR9B 1IGVA 3FE6A 1QS7A 2OTGC 1WLMA 1UHKA 1XK4A 2OS8B 1QLKA 2L50A 1DT7B 1SRAA 2PMYA 1K9UA 5HLOA 2LP3A 1YRUB 2FCDA 1CFFA 3ICBA 2LHIA 2JWWA 1AHRA 4YGBB 1ZUZA 1AUIB 2KI4C 1PSRA 1Y1XA 1OOGA 4MVFA 4WQ3A 1C3YA 1D1OA 4FQTA 2Y4QA 3EVUA 4FQOA 1KFUS 4PE4A 1PVBA 4PHJA 1IH0A 5I94A 5HKZA 1GM0A 3OHMB 1PSBA 1UUSA 1DJXA 1F70A 4CIDA 2Q91A 1Y6WA 1LA3A 1Z2CB 2CXJA 3CYZA 4R1EA 2CTNA 3SG4A 1GQMA 1B4CA 4YRUA 4MBEA 1BJFA 4TNCA 2JTTA 4P2YB 2P6BB 3FIAA 2F33A 5GQQC 2ERBA 1ORGA 3S0GA 1BODA 1XFRA 1NX1A 4YBHB 5ER4X 1EL4A 1KK8B 5EL2A 1BU3A 1ZFSA 1BR1B 1YUSA 4MRXA 1M39A 4A4CA 5B8IB 2M7NA 2NXQA 1NX3A 1XA5A 2LLSA 1Y1AA 2ZN8A 2LE9B 4GUKA 3SG5A 3VRPA 2LMTA 1UHJA 1RECA 3I5GB 1F4QA 4USLA 1K9KA 2M7LA 5I2LA 1J7OA 4OVNF 2CNPA 4GAOA 3UO9A 4C0JA 2MA2A 1TIZA 1ZOTB 1ZACA 2KBIA 1JFKA 2BCAA 1N2DA 1UP5A 4OZDA 3KF9A 3O2PA 1NX2A 2KGRA 2QDIA 1FW4A 1RK9A 5FI7A 1X02A 5D3OA 3DF0A 2MLFC 3BUXB 1A75A 1QVIZ 2LUXA 3BOWB 3PSRA 3NSIA 1ZMZA 2AAOA 1SKTA 5CSNA 1B47A 1QX5B 2L0PA 1TNQA 2LMUA 4INXA 1FI5A 1OW4A 3D0YA 3DY9A 1OOHA 1Z4HA 2JC2A 2I7AA 3PN7B 4PHNA 1QX2A 3SS4A 2Y1MA
chains in the Genus database with same CATH topology
3DD4A 1RJVA 2KHNA 1CDLA 1YUTA 1CDNA 4AOMA 3OP0A 2HPSA 5TNCA 1FI6A 1K94A 2M29A 1JBAA 1KQMC 1L2OC 3KHEA 2KGBC 4AQIA 4E68A 5HKWA 3SIBA 1DMOA 3FWCA 3NSKA 1WRLA 2L5XB 2MHHA 3IQQA 1CMFA 2JTZA 3TUYC 2HF5A 1B1GA 1NCXA 2K8MB 4I5KA 3FWBA 2LUCA 3RM1A 2OS8C 1DF0B 2ZNDA 3VRQA 3EKHA 1S1EA 1J55A 3VRNA 3EVVA 2FCEA 5D7FA 1YR5A 1YX8A 1QLSA 1KFXS 1NPQA 1GGWA 1RROA 2LVJA 4GBAA 1CFDA 2KOTA 1EXRA 1HT9A 2F2PA 3JTDB 5PALA 2M1UA 1QV0A 3BUOB 1ALWA 4YGAA 4CFQA 2I18A 4PALA 4M2OA 1B7TZ 1PVAA 1FPWA 1K9PA 1CDMA 3RLZA 2KQYA 3PFVA 1RWYA 4JWQA 3DVKA 3WNXB 4MSPA 1BT6A 2RGIA 1OMDA 4MZJA 4PCWA 1S5GY 5DKQA 2LVIA 4GNKB 1S36A 1WY9A 1UHHA 3VGOA 1QTXA 2JT0A 1G4YR 1KK8C 3NSLA 2PALA 2BE4A 2KFFA 1XVJA 2BCBA 3HCMA 2CCMA 1A03A 1HQVA 2M1KB 1JF2A 1J1DA 1B8CA 1OSAA 3ZWHA 3I5GC 1GGZA 1QATA 1QIWA 2O5GA 2WCFA 3EK8A 1K93D 4I5LB 3WHTB 3O78A 1XO5A 1Q80A 1IQ3A 1DJWA 3SIAA 4AQJA 3SG2A 3CWGA 2SASA 1BR4B 1R2UA 3AAJA 2KBMA 1ODBA 3FS7A 1AVSA 1A4PA 1U5IA 2L98A 1J1EA 2MRDA 4NQGA 1LVCD 2OPOA 4FTGA 4CPVA 1DGVA 3E3RA 4ORAB 4MLWA 3KO0A 1QX7A 3PN7C 2FJUB 3OB1B 2A4JA 2EGDA 5K89A 4PHMA 2G9BA 1SYMA 1KFUL 2K2FA 1SL8A 1WDCB 1DJHA 1UHIA 4NDDA 1MXLC 2KAVA 3WXAA 1AK8A 3IF7A 1L7ZA 4DS7A 1CLLA 3I5FB 2M0RA 1WRZA 1KQVA 1EG3A 5I8NA 2WOSA 2LLTA 1Y1UA 2L4HA 1NWDA 1TCOB 3I5IB 1MQ1A 2NLNA 1IRJA 1IKUA 1LKJA 5FYXA 3A4UB 1UWOA 4ETOA 4OCIA 2KAXA 2AUCA 2JNXA 3GOFA 1CLMA 1YURA 1KSOA 2H61C 1QASA 1WLZA 2JT3A 3CGAA 1B9AA 1XFVO 4PE0A 2KFHA 3SJSA 2MAZA 5CSFA 1C07A 1IG5A 2H2KA 3AAKA 4PDZA 3O4YA 1OMVA 4OV2A 2E6WA 4HRHA 1JFJA 1IQ5A 1C7WA 2KAYA 1MR8A 3JTDC 3JVTB 4ORBB 5BPJA 2QPTA 1H4BA 4GPLB 2JQ6A 2JU0A 1RTP1 4MN0A 4N5XA 2LAPA 2I2RE 2BCXA 1ALVA 1PRWA 2M8UA 3LK0A 1DVIA 1UHNA 2AMIA 2F3ZA 3BXKA 2JXLA 3TS5B 2Y5IA 2JNFA 1SCVA 5G08A 1R6PA 1KSMA 2KI4B 1F71A 3BQ3A 1OMRA 4YGCB 2KI6D 2L51A 4F0ZB 2BE6A 1JSAA 4XYNA 1XFUO 3QRXA 5CSIA 3DVEA 2WORA 1CB1A 4ZCUA 2QACA 2WC8A 1V1FA 4D1EA 1KK7Y 1YTZC 1JC2A 1E8AA 2KNEA 3LK1A 1CFCA 1DJGA 2COLB 2K2AA 3BYAA 1IJ5A 4CLNA 4C0KA 4DIRA 1CTRA 1CDPA 1JWDA 1QXPA 2JOJA 1NCYA 1DGUA 4CFRA 3OX6A 4C0LA 5JOLA 2JRFA 2VRGA 4YGDB 2E30A 2TN4A 3M0WA 3TDZA 1CFPA 1TOPA 2L2EA 1KFXL 2BKHB 5J3XA 1MHOA 3OB2B 4NDBA 3CR2A 3TZ1A 4QJ3B 5F6TA 2HQ8A 3IQOA 1W7IB 3DF0B 2EC6B 4PE7A 2LMVA 1A75B 1S6CA 2ZN9A 5IBWA 1WDCC 1TNPA 5AFPA 2M49B 1QIVA 2JPTA 2M3WA 3EK7A 5HLVA 2BL0B 1S6JA 1LA0A 1SCMB 2I94A 3KPXA 3EKJA 3I5FC 3PALA 1OE9B 2PSRA 1V1GA 1MXEA 2KYFA 4XJKB 2GGMA 1NYAA 2G2BA 2LC5A 3I5IC 1FBVA 4ZCVA 1TTXA 1NSHA 5KSZA 4PE1A 1B8LA 1XFZO 1M45A 2B1UA 4M2QA 2KQ6A 2KSPA 4U8DA 4MRYA 2LCPA 5DKRA 1DTLA 1CNPA 1TNXA 5AXIA 1CLBA 4UPGA 1J7RA 4I5NB 3EVRA 2SCPA 4BY5A 4N1GA 1TRFA 5D69A 1BOCA 4A4BA 3PM8A 1OOJA 5CPVA 1S5GZ 2R2IA 2JXCA 1W7JB 3JVTC 3CLNA 2KI6C 2F2OA 4WQ2A 3D10A 4PHKA 2PASA 3TDUA 3TUYB 1CKKA 1TNWA 3I5HB 1AP4A 2D8NA 4BY4A 1OZOA 3HX4A 4MEWA 4YI9A 5AANA 1SR6B 3LCPC 3BOWA 2M9GA 3BUNB 3GK4X 3TS5C 1SL9A 1F8HA 2L4IA 1QJTA 2HQWA 3CR4X 3GK1A 3SG7A 2M97A 3CR5X 3WHUB 2ZFDA 5I2OA 3PATA 2LVKA 1LINA 2F8PA 4YI8A 2ZKMX 2WNDA 1KWOB 1SNLA 1OQPA 4QJ4B 2KYCA 2WCEA 4MZKA 5KU1A 4L9MA 2Y1NA 1JF0A 4P5OE 4NDCA 4JQ0D 4I5JA 5HYDA 2WCBA 5HKYA 5AEQA 1MF8B 1MUXA 1SW8A 1J7PA 2O60A 2PVBA 2CBLA 1KCYA 1CMGA 2F3YA 1SMGA 1DJZA 3GK2A 1SK6D 4MZLA 3ZNIA 1M31A 3SG6A 1QVIY 1DF0A 1NP8A 3KEVA 2EHBA 2H61A 1NCZA 3VROA 2LHLA 1A2XA 1EG4A 3F45A 4HREE 3NSOA 3BUMB 2BBNA 1LXFC 1EH2A 1NX0A 2V53A 2OTGB 4M2PA 5AERA 2NCPA 4QJ5B 3BUWB 2EC6C 1S26D 1U5IB 3K21A 2IS9A 1SY9A 2K0JA 1YX7A 3CZTX 2K61A 2BL0C 2BBMA 4JPZB 1SCMC 2JZIA 1DJYA 3OX5A 1BF5A 4ICBA 4N1FA 2LLUA 1YUUA 2JT8A 2GV5A 2K7DA 2KDHA 1SPYA 4Q04A 1SL7A 3VRRA 2DOQA 1M63B 3H4SE 4GGNA 1A29A 3CS1A 1G8IA 1PULA 3A8RA 3PLFB 3DVMA 1AJ5A 4XJKA 3O6BA 4GGFC 4GFTA 2LVVA 1BLQA 2ZRSA 4DCKA 1QV1A 3NXAA 1K2HA 5I2QA 2BECA 1TN4A 2LM5A 2K7BA 1K90D 1NUBA 4HRGA 1IJ6A 1YRTB 1G33A 1PK0D 3EK4A 1F55A 3CTNA 4GGFA 1RFJA 2PRUA 3MSEB 1NIWA 2MLEC 3AKBA 4HSZA 1B7TY 2LV7A 2JULA 1N65A 4OKHA 1N0YA 5DKNA 1F4OA 2FOTA 1H8BA 1JUOA 2Q4UA 1EJ3A 3I5HC 2NCOA 1UURA 2LP2A 1K95A 1BMOA 1DJIA 1J7QA 1XFYO 1SR6C 1KK7Z 2ZRTA 1S3PA 2NZ0A 1FF1A 2LNKA 2K7OA 3C1VA 1F54A 3D0YB 2GGZA 2HETA 2ISDA 1XFWO 1SBJA 5CSJA 3LL8B 2LANA 2ZNEA 2K7CA 1K96A 1CM4A 2KFGA 1CM1A 1OZSA 3SG3A 1S6IA 3TDIA 1KWOC 1XFXO 1XYDA 1BG1A 1Y0VH 5KTYA 1WRKA 1PALA 3LLEA 1VRKA 2CT9A 1YVLA 2MBXA 4IL1A 2MJWB 1K8UA 1MWNA 1YVHA 4DUQA 1AJ4A 4DRWA 1KQMB 1IWQA 1L2OB 1B8RA 1XK4C 3AKAA 5JJGA 1C7VA 5ER5A 4WRIA 4YGEB 1GJYA 1TCFA 3DVJA 4ORCB 2BKIB 1M46A 4OR9B 1IGVA 1QS7A 2OTGC 1WLMA 1UHKA 1XK4A 2OS8B 1QLKA 2L50A 1DT7B 1SRAA 2PMYA 1K9UA 5HLOA 2LP3A 1YRUB 2FCDA 1CFFA 3ICBA 2LHIA 2JWWA 1AHRA 4YGBB 1ZUZA 1AUIB 2KI4C 1PSRA 1Y1XA 4MVFA 4WQ3A 1D1OA 2Y4QA 3EVUA 4FQOA 1KFUS 4PE4A 1PVBA 4PHJA 1IH0A 5HKZA 3OHMB 1PSBA 1UUSA 1DJXA 1F70A 4CIDA 2Q91A 1Y6WA 1LA3A 2CXJA 4R1EA 3SG4A 2CTNA 1GQMA 1B4CA 4YRUA 4MBEA 1BJFA 4TNCA 2JTTA 4P2YB 2P6BB 3FIAA 2F33A 5GQQC 1BODA 1NX1A 4YBHB 5ER4X 1EL4A 1KK8B 1BU3A 1ZFSA 1BR1B 1YUSA 4MRXA 1M39A 4A4CA 5B8IB 2M7NA 2NXQA 1NX3A 1XA5A 2LLSA 1Y1AA 2ZN8A 2LE9B 4GUKA 3SG5A 3VRPA 2LMTA 1UHJA 1RECA 3I5GB 1F4QA 4USLA 1K9KA 2M7LA 5I2LA 1J7OA 4OVNF 2CNPA 4GAOA 4C0JA 2MA2A 1TIZA 1ZOTB 1ZACA 2KBIA 1JFKA 2BCAA 1N2DA 1UP5A 3KF9A 3O2PA 1NX2A 2KGRA 1FW4A 1RK9A 1X02A 3DF0A 2MLFC 3BUXB 1A75A 1QVIZ 2LUXA 3BOWB 3PSRA 3NSIA 1ZMZA 2AAOA 1SKTA 5CSNA 1B47A 1QX5B 2L0PA 1TNQA 2LMUA 1FI5A 3D0YA 3PN7B 2JC2A 2I7AA 4PHNA 1QX2A 2Y1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD4 A;  1RJV A;  2KHN A;  1CDL A;  1YUT A;  1CDN A;  4AOM A;  3OP0 A;  2HPS A;  5TNC A;  1FI6 A;  1K94 A;  2M29 A;  1JBA A;  1KQM C;  1L2O C;  3KHE A;  2KGB C;  4AQI A;  4E68 A;  5HKW A;  3SIB A;  1DMO A;  3FWC A;  3NSK A;  1WRL A;  2L5X B;  2MHH A;  3IQQ A;  1CMF A;  2JTZ A;  3TUY C;  2HF5 A;  1B1G A;  1NCX A;  2K8M B;  4I5K A;  3FWB A;  2LUC A;  3RM1 A;  2OS8 C;  1DF0 B;  2ZND A;  3VRQ A;  3EKH A;  1S1E A;  1J55 A;  3VRN A;  3EVV A;  2FCE A;  5D7F A;  1YR5 A;  1YX8 A;  1QLS A;  1KFX S;  1NPQ A;  1GGW A;  1RRO A;  2LVJ A;  4GBA A;  1CFD A;  2KOT A;  1EXR A;  1HT9 A;  2F2P A;  3JTD B;  5PAL A;  2M1U A;  1QV0 A;  3BUO B;  1ALW A;  4YGA A;  4CFQ A;  2I18 A;  4PAL A;  4M2O A;  1B7T Z;  1PVA A;  1FPW A;  1K9P A;  1CDM A;  3RLZ A;  2KQY A;  3PFV A;  1RWY A;  4JWQ A;  3DVK A;  3WNX B;  4MSP A;  1BT6 A;  2RGI A;  1OMD A;  4MZJ A;  4PCW A;  1S5G Y;  5DKQ A;  2LVI A;  4GNK B;  1S36 A;  1WY9 A;  1UHH A;  3VGO A;  1QTX A;  2JT0 A;  1G4Y R;  1KK8 C;  3NSL A;  2PAL A;  2BE4 A;  2KFF A;  1XVJ A;  2BCB A;  3HCM A;  2CCM A;  1A03 A;  1HQV A;  2M1K B;  1JF2 A;  1J1D A;  1B8C A;  1OSA A;  3ZWH A;  3I5G C;  1GGZ A;  1QAT A;  1QIW A;  2O5G A;  2WCF A;  3EK8 A;  1K93 D;  4I5L B;  3WHT B;  3O78 A;  1XO5 A;  1Q80 A;  1IQ3 A;  1DJW A;  3SIA A;  4AQJ A;  3SG2 A;  3CWG A;  2SAS A;  1BR4 B;  1R2U A;  3AAJ A;  2KBM A;  1ODB A;  3FS7 A;  1AVS A;  1A4P A;  1U5I A;  2L98 A;  1J1E A;  2MRD A;  4NQG A;  1LVC D;  2OPO A;  4FTG A;  4CPV A;  1DGV A;  3E3R A;  4ORA B;  4MLW A;  3KO0 A;  1QX7 A;  3PN7 C;  2FJU B;  3OB1 B;  2A4J A;  2EGD A;  5K89 A;  4PHM A;  2G9B A;  1SYM A;  1KFU L;  2K2F A;  1SL8 A;  1WDC B;  1DJH A;  1UHI A;  4NDD A;  1MXL C;  2KAV A;  3WXA A;  1AK8 A;  3IF7 A;  1L7Z A;  4DS7 A;  1CLL A;  3I5F B;  2M0R A;  1WRZ A;  1KQV A;  1EG3 A;  5I8N A;  2WOS A;  2LLT A;  1Y1U A;  2L4H A;  1NWD A;  1TCO B;  3I5I B;  1MQ1 A;  2NLN A;  1IRJ A;  1IKU A;  1LKJ A;  5FYX A;  3A4U B;  1UWO A;  4ETO A;  4OCI A;  2KAX A;  2AUC A;  2JNX A;  3GOF A;  1CLM A;  1YUR A;  1KSO A;  2H61 C;  1QAS A;  1WLZ A;  2JT3 A;  3CGA A;  1B9A A;  1XFV O;  4PE0 A;  2KFH A;  3SJS A;  2MAZ A;  5CSF A;  1C07 A;  1IG5 A;  2H2K A;  3AAK A;  4PDZ A;  3O4Y A;  1OMV A;  4OV2 A;  2E6W A;  4HRH A;  1JFJ A;  1IQ5 A;  1C7W A;  2KAY A;  1MR8 A;  3JTD C;  3JVT B;  4ORB B;  5BPJ A;  2QPT A;  1H4B A;  4GPL B;  2JQ6 A;  2JU0 A;  1RTP 1;  4MN0 A;  4N5X A;  2LAP A;  2I2R E;  2BCX A;  1ALV A;  1PRW A;  2M8U A;  3LK0 A;  1DVI A;  1UHN A;  2AMI A;  2F3Z A;  3BXK A;  2JXL A;  3TS5 B;  2Y5I A;  2JNF A;  1SCV A;  5G08 A;  1R6P A;  1KSM A;  2KI4 B;  1F71 A;  3BQ3 A;  1OMR A;  4YGC B;  2KI6 D;  2L51 A;  4F0Z B;  2BE6 A;  1JSA A;  4XYN A;  1XFU O;  3QRX A;  5CSI A;  3DVE A;  2WOR A;  1CB1 A;  4ZCU A;  2QAC A;  2WC8 A;  1V1F A;  4D1E A;  1KK7 Y;  1YTZ C;  1JC2 A;  1E8A A;  2KNE A;  3LK1 A;  1CFC A;  1DJG A;  2COL B;  2K2A A;  3BYA A;  1IJ5 A;  4CLN A;  4C0K A;  4DIR A;  1CTR A;  1CDP A;  1JWD A;  1QXP A;  2JOJ A;  1NCY A;  1DGU A;  4CFR A;  3OX6 A;  4C0L A;  5JOL A;  2JRF A;  2VRG A;  4YGD B;  2E30 A;  2TN4 A;  3M0W A;  3TDZ A;  1CFP A;  1TOP A;  2L2E A;  1KFX L;  2BKH B;  5J3X A;  1MHO A;  3OB2 B;  4NDB A;  3CR2 A;  3TZ1 A;  4QJ3 B;  5F6T A;  2HQ8 A;  3IQO A;  1W7I B;  3DF0 B;  2EC6 B;  4PE7 A;  2LMV A;  1A75 B;  1S6C A;  2ZN9 A;  5IBW A;  1WDC C;  1TNP A;  5AFP A;  2M49 B;  1QIV A;  2JPT A;  2M3W A;  3EK7 A;  5HLV A;  2BL0 B;  1S6J A;  1LA0 A;  1SCM B;  2I94 A;  3KPX A;  3EKJ A;  3I5F C;  3PAL A;  1OE9 B;  2PSR A;  1V1G A;  1MXE A;  2KYF A;  4XJK B;  2GGM A;  1NYA A;  2G2B A;  2LC5 A;  3I5I C;  1FBV A;  4ZCV A;  1TTX A;  1NSH A;  5KSZ A;  4PE1 A;  1B8L A;  1XFZ O;  1M45 A;  2B1U A;  4M2Q A;  2KQ6 A;  2KSP A;  4U8D A;  4MRY A;  2LCP A;  5DKR A;  1DTL A;  1CNP A;  1TNX A;  5AXI A;  1CLB A;  4UPG A;  1J7R A;  4I5N B;  3EVR A;  2SCP A;  4BY5 A;  4N1G A;  1TRF A;  5D69 A;  1BOC A;  4A4B A;  3PM8 A;  1OOJ A;  5CPV A;  1S5G Z;  2R2I A;  2JXC A;  1W7J B;  3JVT C;  3CLN A;  2KI6 C;  2F2O A;  4WQ2 A;  3D10 A;  4PHK A;  2PAS A;  3TDU A;  3TUY B;  1CKK A;  1TNW A;  3I5H B;  1AP4 A;  2D8N A;  4BY4 A;  1OZO A;  3HX4 A;  4MEW A;  4YI9 A;  5AAN A;  1SR6 B;  3LCP C;  3BOW A;  2M9G A;  3BUN B;  3GK4 X;  3TS5 C;  1SL9 A;  1F8H A;  2L4I A;  1QJT A;  2HQW A;  3CR4 X;  3GK1 A;  3SG7 A;  2M97 A;  3CR5 X;  3WHU B;  2ZFD A;  5I2O A;  3PAT A;  2LVK A;  1LIN A;  2F8P A;  4YI8 A;  2ZKM X;  2WND A;  1KWO B;  1SNL A;  1OQP A;  4QJ4 B;  2KYC A;  2WCE A;  4MZK A;  5KU1 A;  4L9M A;  2Y1N A;  1JF0 A;  4P5O E;  4NDC A;  4JQ0 D;  4I5J A;  5HYD A;  2WCB A;  5HKY A;  5AEQ A;  1MF8 B;  1MUX A;  1SW8 A;  1J7P A;  2O60 A;  2PVB A;  2CBL A;  1KCY A;  1CMG A;  2F3Y A;  1SMG A;  1DJZ A;  3GK2 A;  1SK6 D;  4MZL A;  3ZNI A;  1M31 A;  3SG6 A;  1QVI Y;  1DF0 A;  1NP8 A;  3KEV A;  2EHB A;  2H61 A;  1NCZ A;  3VRO A;  2LHL A;  1A2X A;  1EG4 A;  3F45 A;  4HRE E;  3NSO A;  3BUM B;  2BBN A;  1LXF C;  1EH2 A;  1NX0 A;  2V53 A;  2OTG B;  4M2P A;  5AER A;  2NCP A;  4QJ5 B;  3BUW B;  2EC6 C;  1S26 D;  1U5I B;  3K21 A;  2IS9 A;  1SY9 A;  2K0J A;  1YX7 A;  3CZT X;  2K61 A;  2BL0 C;  2BBM A;  4JPZ B;  1SCM C;  2JZI A;  1DJY A;  3OX5 A;  1BF5 A;  4ICB A;  4N1F A;  2LLU A;  1YUU A;  2JT8 A;  2GV5 A;  2K7D A;  2KDH A;  1SPY A;  4Q04 A;  1SL7 A;  3VRR A;  2DOQ A;  1M63 B;  3H4S E;  4GGN A;  1A29 A;  3CS1 A;  1G8I A;  1PUL A;  3A8R A;  3PLF B;  3DVM A;  1AJ5 A;  4XJK A;  3O6B A;  4GGF C;  4GFT A;  2LVV A;  1BLQ A;  2ZRS A;  4DCK A;  1QV1 A;  3NXA A;  1K2H A;  5I2Q A;  2BEC A;  1TN4 A;  2LM5 A;  2K7B A;  1K90 D;  1NUB A;  4HRG A;  1IJ6 A;  1YRT B;  1G33 A;  1PK0 D;  3EK4 A;  1F55 A;  3CTN A;  4GGF A;  1RFJ A;  2PRU A;  3MSE B;  1NIW A;  2MLE C;  3AKB A;  4HSZ A;  1B7T Y;  2LV7 A;  2JUL A;  1N65 A;  4OKH A;  1N0Y A;  5DKN A;  1F4O A;  2FOT A;  1H8B A;  1JUO A;  2Q4U A;  1EJ3 A;  3I5H C;  2NCO A;  1UUR A;  2LP2 A;  1K95 A;  1BMO A;  1DJI A;  1J7Q A;  1XFY O;  1SR6 C;  1KK7 Z;  2ZRT A;  1S3P A;  2NZ0 A;  1FF1 A;  2LNK A;  2K7O A;  3C1V A;  1F54 A;  3D0Y B;  2GGZ A;  2HET A;  2ISD A;  1XFW O;  1SBJ A;  5CSJ A;  3LL8 B;  2LAN A;  2ZNE A;  2K7C A;  1K96 A;  1CM4 A;  2KFG A;  1CM1 A;  1OZS A;  3SG3 A;  1S6I A;  3TDI A;  1KWO C;  1XFX O;  1XYD A;  1BG1 A;  1Y0V H;  5KTY A;  1WRK A;  1PAL A;  3LLE A;  1VRK A;  2CT9 A;  1YVL A;  2MBX A;  4IL1 A;  2MJW B;  1K8U A;  1MWN A;  1YVH A;  4DUQ A;  1AJ4 A;  4DRW A;  1KQM B;  1IWQ A;  1L2O B;  1B8R A;  1XK4 C;  3AKA A;  5JJG A;  1C7V A;  5ER5 A;  4WRI A;  4YGE B;  1GJY A;  1TCF A;  3DVJ A;  4ORC B;  2BKI B;  1M46 A;  4OR9 B;  1IGV A;  1QS7 A;  2OTG C;  1WLM A;  1UHK A;  1XK4 A;  2OS8 B;  1QLK A;  2L50 A;  1DT7 B;  1SRA A;  2PMY A;  1K9U A;  5HLO A;  2LP3 A;  1YRU B;  2FCD A;  1CFF A;  3ICB A;  2LHI A;  2JWW A;  1AHR A;  4YGB B;  1ZUZ A;  1AUI B;  2KI4 C;  1PSR A;  1Y1X A;  4MVF A;  4WQ3 A;  1D1O A;  2Y4Q A;  3EVU A;  4FQO A;  1KFU S;  4PE4 A;  1PVB A;  4PHJ A;  1IH0 A;  5HKZ A;  3OHM B;  1PSB A;  1UUS A;  1DJX A;  1F70 A;  4CID A;  2Q91 A;  1Y6W A;  1LA3 A;  2CXJ A;  4R1E A;  3SG4 A;  2CTN A;  1GQM A;  1B4C A;  4YRU A;  4MBE A;  1BJF A;  4TNC A;  2JTT A;  4P2Y B;  2P6B B;  3FIA A;  2F33 A;  5GQQ C;  1BOD A;  1NX1 A;  4YBH B;  5ER4 X;  1EL4 A;  1KK8 B;  1BU3 A;  1ZFS A;  1BR1 B;  1YUS A;  4MRX A;  1M39 A;  4A4C A;  5B8I B;  2M7N A;  2NXQ A;  1NX3 A;  1XA5 A;  2LLS A;  1Y1A A;  2ZN8 A;  2LE9 B;  4GUK A;  3SG5 A;  3VRP A;  2LMT A;  1UHJ A;  1REC A;  3I5G B;  1F4Q A;  4USL A;  1K9K A;  2M7L A;  5I2L A;  1J7O A;  4OVN F;  2CNP A;  4GAO A;  4C0J A;  2MA2 A;  1TIZ A;  1ZOT B;  1ZAC A;  2KBI A;  1JFK A;  2BCA A;  1N2D A;  1UP5 A;  3KF9 A;  3O2P A;  1NX2 A;  2KGR A;  1FW4 A;  1RK9 A;  1X02 A;  3DF0 A;  2MLF C;  3BUX B;  1A75 A;  1QVI Z;  2LUX A;  3BOW B;  3PSR A;  3NSI A;  1ZMZ A;  2AAO A;  1SKT A;  5CSN A;  1B47 A;  1QX5 B;  2L0P A;  1TNQ A;  2LMU A;  1FI5 A;  3D0Y A;  3PN7 B;  2JC2 A;  2I7A A;  4PHN A;  1QX2 A;  2Y1M A; 
#chains in the Genus database with same CATH topology
 3DD4 A;  1RJV A;  2KHN A;  1CDL A;  1YUT A;  1CDN A;  4AOM A;  3L4A A;  3OP0 A;  2HPS A;  5TNC A;  1FI6 A;  1K94 A;  2M29 A;  3BFB A;  1JBA A;  1KQM C;  1L2O C;  3KHE A;  2KGB C;  4AQI A;  4E68 A;  2PYQ A;  5HKW A;  3SIB A;  1DMO A;  3CDN A;  3FWC A;  3R1P A;  2JPO A;  3NSK A;  3PJI A;  1WRL A;  2L5X B;  2MHH A;  3IQQ A;  1CMF A;  2JTZ A;  3TUY C;  2HF5 A;  1B1G A;  2QEV A;  1NCX A;  2K8M B;  4I5K A;  3FWB A;  2LUC A;  3RM1 A;  2OS8 C;  1DF0 B;  2ZND A;  3VRQ A;  3EKH A;  5FI6 A;  3L47 A;  1S1E A;  1J55 A;  2QEH A;  3VRN A;  3EVV A;  2FCE A;  5D7F A;  5DIC A;  1YR5 A;  1YX8 A;  1QLS A;  1KFX S;  1NPQ A;  1GGW A;  1RRO A;  2LVJ A;  4GBA A;  1CFD A;  2KOT A;  3O4X A;  1EXR A;  1HT9 A;  2F2P A;  3JTD B;  5PAL A;  2M1U A;  1QV0 A;  3BUO B;  1ALW A;  4YGA A;  4CFQ A;  2I18 A;  4PAL A;  4M2O A;  1B7T Z;  1PVA A;  1FPW A;  3SS3 A;  1K9P A;  1W9Z A;  1CDM A;  3RLZ A;  2KQY A;  2WCL A;  3OBV A;  3PFV A;  1RWY A;  4JWQ A;  3DVK A;  3WNX B;  3R1V A;  4MSP A;  1DQE A;  3R1O A;  1TWO A;  1BT6 A;  2RGI A;  1OMD A;  4MZJ A;  4PCW A;  1S5G Y;  5DKQ A;  2LVI A;  4GNK B;  2H8V A;  1S36 A;  1WY9 A;  3BFH A;  1UHH A;  3VGO A;  1QTX A;  2JT0 A;  1G4Y R;  1KK8 C;  3NSL A;  2PAL A;  2BE4 A;  2KFF A;  1XVJ A;  2BCB A;  3HCM A;  1OOF A;  2CCM A;  1A03 A;  1HQV A;  1TUZ A;  2M1K B;  1JF2 A;  1J1D A;  1B8C A;  1OSA A;  3ZWH A;  3I5G C;  1GGZ A;  1QAT A;  1QIW A;  2O5G A;  2WCF A;  3EK8 A;  1K93 D;  4I5L B;  1SSE B;  3S0B A;  3O78 A;  3WHT B;  3QME A;  1XO5 A;  1Q80 A;  3D77 A;  3CAB A;  1IQ3 A;  1DJW A;  3SIA A;  4AQJ A;  3SG2 A;  3CWG A;  2SAS A;  1BR4 B;  1R2U A;  3AAJ A;  2KBM A;  1ODB A;  3FS7 A;  1AVS A;  1A4P A;  1U5I A;  2L98 A;  5HL1 A;  1J1E A;  2MRD A;  4NQG A;  1LVC D;  2OPO A;  4FTG A;  4CPV A;  3IVT A;  2WCH A;  3FE9 A;  1DGV A;  3E3R A;  4ORA B;  4MLW A;  3KO0 A;  1QX7 A;  3PN7 C;  2FJU B;  3OB1 B;  2A4J A;  2EGD A;  5K89 A;  4PHM A;  2G9B A;  3RZS A;  1SYM A;  1KFU L;  2K2F A;  1SL8 A;  1WDC B;  1DJH A;  1UHI A;  4NDD A;  2QEO A;  1MXL C;  2KAV A;  3WXA A;  1AK8 A;  3IF7 A;  1L7Z A;  4DS7 A;  1CLL A;  3I5F B;  2M0R A;  1WRZ A;  1C3Z A;  1EG3 A;  3B87 A;  5I8N A;  1KQV A;  3NHT A;  2WOS A;  2LLT A;  1Y1U A;  2L4H A;  1NWD A;  1TCO B;  3I5I B;  1MQ1 A;  5FI2 A;  2KPH A;  2NLN A;  1IRJ A;  3B88 A;  1IKU A;  1LKJ A;  4INW A;  5FYX A;  3A4U B;  1UWO A;  4ETO A;  4OCI A;  2KAX A;  2AUC A;  2JNX A;  3GOF A;  3DZT A;  1CLM A;  1YUR A;  1KSO A;  2H61 C;  3B6X A;  1QAS A;  1WLZ A;  2JT3 A;  3CGA A;  1B9A A;  1XFV O;  4PE0 A;  2KFH A;  3SJS A;  2MAZ A;  5CSF A;  1C07 A;  1DEK A;  1IG5 A;  2H2K A;  3AAK A;  4PDZ A;  3O4Y A;  1OMV A;  4OV2 A;  3SS5 A;  2E6W A;  4HRH A;  1H4B A;  4F7F A;  1JFJ A;  1IQ5 A;  1C7W A;  2KAY A;  1MR8 A;  1P28 A;  2P71 A;  2PQL A;  3JTD C;  2QPT A;  3JVT B;  4ORB B;  4GPL B;  5BPJ A;  2JQ6 A;  2JU0 A;  1RTP 1;  3D73 A;  4MN0 A;  4N5X A;  2LAP A;  2I2R E;  2BCX A;  1ALV A;  1PRW A;  3D78 A;  2M8U A;  3LK0 A;  1DVI A;  1UHN A;  2AMI A;  2F3Z A;  3BXK A;  2JXL A;  3TS5 B;  3D75 A;  2Y5I A;  3OGN A;  2JNF A;  1DEL A;  1SCV A;  5G08 A;  1R6P A;  1KSM A;  2KI4 B;  2WCJ A;  3BQ3 A;  1OMR A;  4YGC B;  1F71 A;  3S0F A;  2KI6 D;  2L51 A;  4F0Z B;  2BE6 A;  1JSA A;  4XYN A;  1XFU O;  3QRX A;  5CSI A;  3DVE A;  2WOR A;  3EG5 B;  1CB1 A;  2L2C A;  3DYE A;  2QAC A;  4ZCU A;  3B7A A;  2WC8 A;  1V1F A;  2YGU A;  4D1E A;  1KK7 Y;  1LS8 A;  1YTZ C;  1JC2 A;  1E8A A;  2KNE A;  3LK1 A;  1CFC A;  1DJG A;  2COL B;  2K2A A;  3BYA A;  1IJ5 A;  4CLN A;  4C0K A;  4DIR A;  1CTR A;  3L4L A;  1CDP A;  1JWD A;  1QXP A;  2JOJ A;  1NCY A;  1DGU A;  4CFR A;  3OX6 A;  4C0L A;  4OKH A;  5JOL A;  2JRF A;  2VRG A;  4YGD B;  2E30 A;  2TN4 A;  3M0W A;  3TDZ A;  1CFP A;  1TOP A;  2L2E A;  1KFX L;  2BKH B;  2WC6 A;  5J3X A;  1MHO A;  3OB2 B;  4NDB A;  3CR2 A;  1T14 A;  3TZ1 A;  4QJ3 B;  5F6T A;  3S0A A;  2HQ8 A;  3IQO A;  1W7I B;  3DF0 B;  2EC6 B;  2WC5 A;  4PE7 A;  2LMV A;  1A75 B;  1S6C A;  2ZN9 A;  5IBW A;  1WDC C;  1TNP A;  5AFP A;  2M49 B;  1QIV A;  2JPT A;  2M3W A;  3EK7 A;  5HLV A;  2BL0 B;  1S6J A;  1LA0 A;  1SCM B;  2I94 A;  3KPX A;  3V2L A;  3EKJ A;  3I5F C;  3PAL A;  1OE9 B;  2PSR A;  1V1G A;  1MXE A;  2KYF A;  4XJK B;  2GGM A;  1NYA A;  2G2B A;  2LC5 A;  3I5I C;  1FBV A;  4ZCV A;  1TTX A;  1NSH A;  2P70 A;  2GTE A;  4PE1 A;  5KSZ A;  1B8L A;  2K60 A;  1XFZ O;  1M45 A;  2B1U A;  4M2Q A;  2KQ6 A;  2KSP A;  3PM2 A;  4U8D A;  4MRY A;  2LCP A;  5DKR A;  1DTL A;  1CNP A;  1TNX A;  5AXI A;  1CLB A;  4UPG A;  1J7R A;  4I5N B;  3EVR A;  2SCP A;  2WCK A;  4BY5 A;  3FE8 A;  4N1G A;  2L5Y A;  1TRF A;  5D69 A;  1BOC A;  4A4B A;  3PM8 A;  1OOJ A;  5CPV A;  1S5G Z;  2R2I A;  2JXC A;  1W7J B;  3BJH A;  3JVT C;  3CLN A;  2KI6 C;  2F2O A;  4WQ2 A;  3D10 A;  4PHK A;  2PAS A;  3TDU A;  3TUY B;  3D74 A;  1CKK A;  1TNW A;  3I5H B;  1AP4 A;  2D8N A;  4BY4 A;  1OZO A;  3HX4 A;  4MEW A;  4YI9 A;  5AAN A;  1SR6 B;  3LCP C;  3BOW A;  2M9G A;  3BUN B;  3GK4 X;  3TS5 C;  1SL9 A;  1F8H A;  2L4I A;  1QJT A;  4JD9 A;  2HQW A;  3CR4 X;  3GK1 A;  3SG7 A;  2M97 A;  3CR5 X;  3BFA A;  3WHU B;  2ZFD A;  5I2O A;  3PAT A;  2LVK A;  3CZ0 A;  1LIN A;  2F8P A;  4YI8 A;  2ZKM X;  2WND A;  1KWO B;  1SNL A;  1OQP A;  4QJ4 B;  2KYC A;  2WCE A;  4MZK A;  5KU1 A;  4L9M A;  2Y1N A;  1JF0 A;  4KYN A;  2BNX A;  4P5O E;  4NDC A;  4JQ0 D;  4I5J A;  5HYD A;  2WCB A;  5HKY A;  5AEQ A;  1MF8 B;  1MUX A;  1SW8 A;  1J7P A;  2O60 A;  2PVB A;  2CBL A;  1KCY A;  1CMG A;  2F3Y A;  1SMG A;  1DJZ A;  3GK2 A;  1SK6 D;  4MZL A;  3ZNI A;  1M31 A;  3S0E A;  3SG6 A;  1QVI Y;  1DF0 A;  3B86 A;  1NP8 A;  3KEV A;  2EHB A;  2H61 A;  1NCZ A;  3VRO A;  2LHL A;  1A2X A;  1EG4 A;  3F45 A;  4HRE E;  3NSO A;  3BUM B;  2BBN A;  1LXF C;  1EH2 A;  1NX0 A;  2V53 A;  2OTG B;  1DC1 A;  1IIO A;  4M2P A;  5AER A;  2NCP A;  4QJ5 B;  3BUW B;  2EC6 C;  1S26 D;  1U5I B;  3K21 A;  2IS9 A;  2WCM A;  1SY9 A;  3CZ1 A;  3D76 A;  2K0J A;  1YX7 A;  3CZT X;  2K61 A;  2BL0 C;  2BBM A;  4JPZ B;  1SCM C;  2JZI A;  1DJY A;  3OX5 A;  1BF5 A;  4ICB A;  4N1F A;  3Q8I A;  2LLU A;  1YUU A;  2JT8 A;  2GV5 A;  2K7D A;  2KDH A;  1SPY A;  4Q04 A;  1SL7 A;  3VRR A;  2DOQ A;  1M63 B;  3H4S E;  4GGN A;  1A29 A;  3CS1 A;  1G8I A;  1PUL A;  3A8R A;  3PLF B;  3DVM A;  1AJ5 A;  4XJK A;  3O6B A;  4GGF C;  4GFT A;  2LVV A;  1BLQ A;  2ZRS A;  4DCK A;  1QV1 A;  3NXA A;  1K2H A;  3N7H A;  5I2Q A;  2BEC A;  1TN4 A;  2LM5 A;  2K7B A;  1K90 D;  1NUB A;  4HRG A;  1IJ6 A;  1YRT B;  1G33 A;  1PK0 D;  3EK4 A;  1F55 A;  2KLE A;  3CTN A;  1RFJ A;  4GGF A;  2PRU A;  3MSE B;  1NIW A;  2MLE C;  3AKB A;  4HSZ A;  1B7T Y;  2LV7 A;  2JUL A;  1N65 A;  4JKT A;  1N0Y A;  3DXL A;  5DKN A;  1F4O A;  2FOT A;  3VB1 A;  1JUO A;  2Q4U A;  1H8B A;  1EJ3 A;  3I5H C;  2NCO A;  1UUR A;  2BAP A;  2LP2 A;  1K95 A;  1BMO A;  1DJI A;  1J7Q A;  1XFY O;  1SR6 C;  1QWV A;  1KK7 Z;  2ZRT A;  1S3P A;  2NZ0 A;  1FF1 A;  3S0D A;  3CZ2 A;  4IJ7 A;  2LNK A;  2K7O A;  3C1V A;  1F54 A;  1TUJ A;  3D0Y B;  4PT1 A;  2GGZ A;  2HET A;  2ISD A;  1XFW O;  1SBJ A;  3NGV A;  5CSJ A;  3LL8 B;  2LAN A;  2ZNE A;  3R72 A;  2K7C A;  1OOI X;  1K96 A;  1CM4 A;  2KFG A;  1CM1 A;  2QEB A;  1OZS A;  3SG3 A;  1S6I A;  3TDI A;  1KWO C;  1XFX O;  1XYD A;  1BG1 A;  1Y0V H;  5KTY A;  1WRK A;  1PAL A;  3LLE A;  1VRK A;  2CT9 A;  1YVL A;  3K1E A;  2MBX A;  4IL1 A;  2MJW B;  1K8U A;  1MWN A;  1YVH A;  2FJY A;  2KLD A;  3UNW A;  4DUQ A;  1AJ4 A;  4DRW A;  1KQM B;  1IWQ A;  1L2O B;  1B8R A;  3NHI A;  1XK4 C;  3AKA A;  5JJG A;  1C7V A;  5ER5 A;  4WRI A;  4YGE B;  1GJY A;  1TCF A;  3DVJ A;  4ORC B;  2BKI B;  1M46 A;  4OR9 B;  1IGV A;  3FE6 A;  1QS7 A;  2OTG C;  1WLM A;  1UHK A;  1XK4 A;  2OS8 B;  1QLK A;  2L50 A;  1DT7 B;  1SRA A;  2PMY A;  1K9U A;  5HLO A;  2LP3 A;  1YRU B;  2FCD A;  1CFF A;  3ICB A;  2LHI A;  2JWW A;  1AHR A;  4YGB B;  1ZUZ A;  1AUI B;  2KI4 C;  1PSR A;  1Y1X A;  1OOG A;  4MVF A;  4WQ3 A;  1C3Y A;  1D1O A;  4FQT A;  2Y4Q A;  3EVU A;  4FQO A;  1KFU S;  4PE4 A;  1PVB A;  4PHJ A;  1IH0 A;  5I94 A;  5HKZ A;  1GM0 A;  3OHM B;  1PSB A;  1UUS A;  1DJX A;  1F70 A;  4CID A;  2Q91 A;  1Y6W A;  1LA3 A;  1Z2C B;  2CXJ A;  3CYZ A;  4R1E A;  2CTN A;  3SG4 A;  1GQM A;  1B4C A;  4YRU A;  4MBE A;  1BJF A;  4TNC A;  2JTT A;  4P2Y B;  2P6B B;  3FIA A;  2F33 A;  5GQQ C;  2ERB A;  1ORG A;  3S0G A;  1BOD A;  1XFR A;  1NX1 A;  4YBH B;  5ER4 X;  1EL4 A;  1KK8 B;  5EL2 A;  1BU3 A;  1ZFS A;  1BR1 B;  1YUS A;  4MRX A;  1M39 A;  4A4C A;  5B8I B;  2M7N A;  2NXQ A;  1NX3 A;  1XA5 A;  2LLS A;  1Y1A A;  2ZN8 A;  2LE9 B;  4GUK A;  3SG5 A;  3VRP A;  2LMT A;  1UHJ A;  1REC A;  3I5G B;  1F4Q A;  4USL A;  1K9K A;  2M7L A;  5I2L A;  1J7O A;  4OVN F;  2CNP A;  4GAO A;  3UO9 A;  4C0J A;  2MA2 A;  1TIZ A;  1ZOT B;  1ZAC A;  2KBI A;  1JFK A;  2BCA A;  1N2D A;  1UP5 A;  4OZD A;  3KF9 A;  3O2P A;  1NX2 A;  2KGR A;  2QDI A;  1FW4 A;  1RK9 A;  5FI7 A;  1X02 A;  5D3O A;  3DF0 A;  2MLF C;  3BUX B;  1A75 A;  1QVI Z;  2LUX A;  3BOW B;  3PSR A;  3NSI A;  1ZMZ A;  2AAO A;  1SKT A;  5CSN A;  1B47 A;  1QX5 B;  2L0P A;  1TNQ A;  2LMU A;  4INX A;  1FI5 A;  1OW4 A;  3D0Y A;  3DY9 A;  1OOH A;  1Z4H A;  2JC2 A;  2I7A A;  3PN7 B;  4PHN A;  1QX2 A;  3SS4 A;  2Y1M A; 
#chains in the Genus database with same CATH homology
 3DD4 A;  1RJV A;  2KHN A;  1CDL A;  1YUT A;  1CDN A;  4AOM A;  3OP0 A;  2HPS A;  5TNC A;  1FI6 A;  1K94 A;  2M29 A;  1JBA A;  1KQM C;  1L2O C;  3KHE A;  2KGB C;  4AQI A;  4E68 A;  5HKW A;  3SIB A;  1DMO A;  3FWC A;  3NSK A;  1WRL A;  2L5X B;  2MHH A;  3IQQ A;  1CMF A;  2JTZ A;  3TUY C;  2HF5 A;  1B1G A;  1NCX A;  2K8M B;  4I5K A;  3FWB A;  2LUC A;  3RM1 A;  2OS8 C;  1DF0 B;  2ZND A;  3VRQ A;  3EKH A;  1S1E A;  1J55 A;  3VRN A;  3EVV A;  2FCE A;  5D7F A;  1YR5 A;  1YX8 A;  1QLS A;  1KFX S;  1NPQ A;  1GGW A;  1RRO A;  2LVJ A;  4GBA A;  1CFD A;  2KOT A;  1EXR A;  1HT9 A;  2F2P A;  3JTD B;  5PAL A;  2M1U A;  1QV0 A;  3BUO B;  1ALW A;  4YGA A;  4CFQ A;  2I18 A;  4PAL A;  4M2O A;  1B7T Z;  1PVA A;  1FPW A;  1K9P A;  1CDM A;  3RLZ A;  2KQY A;  3PFV A;  1RWY A;  4JWQ A;  3DVK A;  3WNX B;  4MSP A;  1BT6 A;  2RGI A;  1OMD A;  4MZJ A;  4PCW A;  1S5G Y;  5DKQ A;  2LVI A;  4GNK B;  1S36 A;  1WY9 A;  1UHH A;  3VGO A;  1QTX A;  2JT0 A;  1G4Y R;  1KK8 C;  3NSL A;  2PAL A;  2BE4 A;  2KFF A;  1XVJ A;  2BCB A;  3HCM A;  2CCM A;  1A03 A;  1HQV A;  2M1K B;  1JF2 A;  1J1D A;  1B8C A;  1OSA A;  3ZWH A;  3I5G C;  1GGZ A;  1QAT A;  1QIW A;  2O5G A;  2WCF A;  3EK8 A;  1K93 D;  4I5L B;  3WHT B;  3O78 A;  1XO5 A;  1Q80 A;  1IQ3 A;  1DJW A;  3SIA A;  4AQJ A;  3SG2 A;  3CWG A;  2SAS A;  1BR4 B;  1R2U A;  3AAJ A;  2KBM A;  1ODB A;  3FS7 A;  1AVS A;  1A4P A;  1U5I A;  2L98 A;  1J1E A;  2MRD A;  4NQG A;  1LVC D;  2OPO A;  4FTG A;  4CPV A;  1DGV A;  3E3R A;  4ORA B;  4MLW A;  3KO0 A;  1QX7 A;  3PN7 C;  2FJU B;  3OB1 B;  2A4J A;  2EGD A;  5K89 A;  4PHM A;  2G9B A;  1SYM A;  1KFU L;  2K2F A;  1SL8 A;  1WDC B;  1DJH A;  1UHI A;  4NDD A;  1MXL C;  2KAV A;  3WXA A;  1AK8 A;  3IF7 A;  1L7Z A;  4DS7 A;  1CLL A;  3I5F B;  2M0R A;  1WRZ A;  1KQV A;  1EG3 A;  5I8N A;  2WOS A;  2LLT A;  1Y1U A;  2L4H A;  1NWD A;  1TCO B;  3I5I B;  1MQ1 A;  2NLN A;  1IRJ A;  1IKU A;  1LKJ A;  5FYX A;  3A4U B;  1UWO A;  4ETO A;  4OCI A;  2KAX A;  2AUC A;  2JNX A;  3GOF A;  1CLM A;  1YUR A;  1KSO A;  2H61 C;  1QAS A;  1WLZ A;  2JT3 A;  3CGA A;  1B9A A;  1XFV O;  4PE0 A;  2KFH A;  3SJS A;  2MAZ A;  5CSF A;  1C07 A;  1IG5 A;  2H2K A;  3AAK A;  4PDZ A;  3O4Y A;  1OMV A;  4OV2 A;  2E6W A;  4HRH A;  1JFJ A;  1IQ5 A;  1C7W A;  2KAY A;  1MR8 A;  3JTD C;  3JVT B;  4ORB B;  5BPJ A;  2QPT A;  1H4B A;  4GPL B;  2JQ6 A;  2JU0 A;  1RTP 1;  4MN0 A;  4N5X A;  2LAP A;  2I2R E;  2BCX A;  1ALV A;  1PRW A;  2M8U A;  3LK0 A;  1DVI A;  1UHN A;  2AMI A;  2F3Z A;  3BXK A;  2JXL A;  3TS5 B;  2Y5I A;  2JNF A;  1SCV A;  5G08 A;  1R6P A;  1KSM A;  2KI4 B;  1F71 A;  3BQ3 A;  1OMR A;  4YGC B;  2KI6 D;  2L51 A;  4F0Z B;  2BE6 A;  1JSA A;  4XYN A;  1XFU O;  3QRX A;  5CSI A;  3DVE A;  2WOR A;  1CB1 A;  4ZCU A;  2QAC A;  2WC8 A;  1V1F A;  4D1E A;  1KK7 Y;  1YTZ C;  1JC2 A;  1E8A A;  2KNE A;  3LK1 A;  1CFC A;  1DJG A;  2COL B;  2K2A A;  3BYA A;  1IJ5 A;  4CLN A;  4C0K A;  4DIR A;  1CTR A;  1CDP A;  1JWD A;  1QXP A;  2JOJ A;  1NCY A;  1DGU A;  4CFR A;  3OX6 A;  4C0L A;  5JOL A;  2JRF A;  2VRG A;  4YGD B;  2E30 A;  2TN4 A;  3M0W A;  3TDZ A;  1CFP A;  1TOP A;  2L2E A;  1KFX L;  2BKH B;  5J3X A;  1MHO A;  3OB2 B;  4NDB A;  3CR2 A;  3TZ1 A;  4QJ3 B;  5F6T A;  2HQ8 A;  3IQO A;  1W7I B;  3DF0 B;  2EC6 B;  4PE7 A;  2LMV A;  1A75 B;  1S6C A;  2ZN9 A;  5IBW A;  1WDC C;  1TNP A;  5AFP A;  2M49 B;  1QIV A;  2JPT A;  2M3W A;  3EK7 A;  5HLV A;  2BL0 B;  1S6J A;  1LA0 A;  1SCM B;  2I94 A;  3KPX A;  3EKJ A;  3I5F C;  3PAL A;  1OE9 B;  2PSR A;  1V1G A;  1MXE A;  2KYF A;  4XJK B;  2GGM A;  1NYA A;  2G2B A;  2LC5 A;  3I5I C;  1FBV A;  4ZCV A;  1TTX A;  1NSH A;  5KSZ A;  4PE1 A;  1B8L A;  1XFZ O;  1M45 A;  2B1U A;  4M2Q A;  2KQ6 A;  2KSP A;  4U8D A;  4MRY A;  2LCP A;  5DKR A;  1DTL A;  1CNP A;  1TNX A;  5AXI A;  1CLB A;  4UPG A;  1J7R A;  4I5N B;  3EVR A;  2SCP A;  4BY5 A;  4N1G A;  1TRF A;  5D69 A;  1BOC A;  4A4B A;  3PM8 A;  1OOJ A;  5CPV A;  1S5G Z;  2R2I A;  2JXC A;  1W7J B;  3JVT C;  3CLN A;  2KI6 C;  2F2O A;  4WQ2 A;  3D10 A;  4PHK A;  2PAS A;  3TDU A;  3TUY B;  1CKK A;  1TNW A;  3I5H B;  1AP4 A;  2D8N A;  4BY4 A;  1OZO A;  3HX4 A;  4MEW A;  4YI9 A;  5AAN A;  1SR6 B;  3LCP C;  3BOW A;  2M9G A;  3BUN B;  3GK4 X;  3TS5 C;  1SL9 A;  1F8H A;  2L4I A;  1QJT A;  2HQW A;  3CR4 X;  3GK1 A;  3SG7 A;  2M97 A;  3CR5 X;  3WHU B;  2ZFD A;  5I2O A;  3PAT A;  2LVK A;  1LIN A;  2F8P A;  4YI8 A;  2ZKM X;  2WND A;  1KWO B;  1SNL A;  1OQP A;  4QJ4 B;  2KYC A;  2WCE A;  4MZK A;  5KU1 A;  4L9M A;  2Y1N A;  1JF0 A;  4P5O E;  4NDC A;  4JQ0 D;  4I5J A;  5HYD A;  2WCB A;  5HKY A;  5AEQ A;  1MF8 B;  1MUX A;  1SW8 A;  1J7P A;  2O60 A;  2PVB A;  2CBL A;  1KCY A;  1CMG A;  2F3Y A;  1SMG A;  1DJZ A;  3GK2 A;  1SK6 D;  4MZL A;  3ZNI A;  1M31 A;  3SG6 A;  1QVI Y;  1DF0 A;  1NP8 A;  3KEV A;  2EHB A;  2H61 A;  1NCZ A;  3VRO A;  2LHL A;  1A2X A;  1EG4 A;  3F45 A;  4HRE E;  3NSO A;  3BUM B;  2BBN A;  1LXF C;  1EH2 A;  1NX0 A;  2V53 A;  2OTG B;  4M2P A;  5AER A;  2NCP A;  4QJ5 B;  3BUW B;  2EC6 C;  1S26 D;  1U5I B;  3K21 A;  2IS9 A;  1SY9 A;  2K0J A;  1YX7 A;  3CZT X;  2K61 A;  2BL0 C;  2BBM A;  4JPZ B;  1SCM C;  2JZI A;  1DJY A;  3OX5 A;  1BF5 A;  4ICB A;  4N1F A;  2LLU A;  1YUU A;  2JT8 A;  2GV5 A;  2K7D A;  2KDH A;  1SPY A;  4Q04 A;  1SL7 A;  3VRR A;  2DOQ A;  1M63 B;  3H4S E;  4GGN A;  1A29 A;  3CS1 A;  1G8I A;  1PUL A;  3A8R A;  3PLF B;  3DVM A;  1AJ5 A;  4XJK A;  3O6B A;  4GGF C;  4GFT A;  2LVV A;  1BLQ A;  2ZRS A;  4DCK A;  1QV1 A;  3NXA A;  1K2H A;  5I2Q A;  2BEC A;  1TN4 A;  2LM5 A;  2K7B A;  1K90 D;  1NUB A;  4HRG A;  1IJ6 A;  1YRT B;  1G33 A;  1PK0 D;  3EK4 A;  1F55 A;  3CTN A;  4GGF A;  1RFJ A;  2PRU A;  3MSE B;  1NIW A;  2MLE C;  3AKB A;  4HSZ A;  1B7T Y;  2LV7 A;  2JUL A;  1N65 A;  4OKH A;  1N0Y A;  5DKN A;  1F4O A;  2FOT A;  1H8B A;  1JUO A;  2Q4U A;  1EJ3 A;  3I5H C;  2NCO A;  1UUR A;  2LP2 A;  1K95 A;  1BMO A;  1DJI A;  1J7Q A;  1XFY O;  1SR6 C;  1KK7 Z;  2ZRT A;  1S3P A;  2NZ0 A;  1FF1 A;  2LNK A;  2K7O A;  3C1V A;  1F54 A;  3D0Y B;  2GGZ A;  2HET A;  2ISD A;  1XFW O;  1SBJ A;  5CSJ A;  3LL8 B;  2LAN A;  2ZNE A;  2K7C A;  1K96 A;  1CM4 A;  2KFG A;  1CM1 A;  1OZS A;  3SG3 A;  1S6I A;  3TDI A;  1KWO C;  1XFX O;  1XYD A;  1BG1 A;  1Y0V H;  5KTY A;  1WRK A;  1PAL A;  3LLE A;  1VRK A;  2CT9 A;  1YVL A;  2MBX A;  4IL1 A;  2MJW B;  1K8U A;  1MWN A;  1YVH A;  4DUQ A;  1AJ4 A;  4DRW A;  1KQM B;  1IWQ A;  1L2O B;  1B8R A;  1XK4 C;  3AKA A;  5JJG A;  1C7V A;  5ER5 A;  4WRI A;  4YGE B;  1GJY A;  1TCF A;  3DVJ A;  4ORC B;  2BKI B;  1M46 A;  4OR9 B;  1IGV A;  1QS7 A;  2OTG C;  1WLM A;  1UHK A;  1XK4 A;  2OS8 B;  1QLK A;  2L50 A;  1DT7 B;  1SRA A;  2PMY A;  1K9U A;  5HLO A;  2LP3 A;  1YRU B;  2FCD A;  1CFF A;  3ICB A;  2LHI A;  2JWW A;  1AHR A;  4YGB B;  1ZUZ A;  1AUI B;  2KI4 C;  1PSR A;  1Y1X A;  4MVF A;  4WQ3 A;  1D1O A;  2Y4Q A;  3EVU A;  4FQO A;  1KFU S;  4PE4 A;  1PVB A;  4PHJ A;  1IH0 A;  5HKZ A;  3OHM B;  1PSB A;  1UUS A;  1DJX A;  1F70 A;  4CID A;  2Q91 A;  1Y6W A;  1LA3 A;  2CXJ A;  4R1E A;  3SG4 A;  2CTN A;  1GQM A;  1B4C A;  4YRU A;  4MBE A;  1BJF A;  4TNC A;  2JTT A;  4P2Y B;  2P6B B;  3FIA A;  2F33 A;  5GQQ C;  1BOD A;  1NX1 A;  4YBH B;  5ER4 X;  1EL4 A;  1KK8 B;  1BU3 A;  1ZFS A;  1BR1 B;  1YUS A;  4MRX A;  1M39 A;  4A4C A;  5B8I B;  2M7N A;  2NXQ A;  1NX3 A;  1XA5 A;  2LLS A;  1Y1A A;  2ZN8 A;  2LE9 B;  4GUK A;  3SG5 A;  3VRP A;  2LMT A;  1UHJ A;  1REC A;  3I5G B;  1F4Q A;  4USL A;  1K9K A;  2M7L A;  5I2L A;  1J7O A;  4OVN F;  2CNP A;  4GAO A;  4C0J A;  2MA2 A;  1TIZ A;  1ZOT B;  1ZAC A;  2KBI A;  1JFK A;  2BCA A;  1N2D A;  1UP5 A;  3KF9 A;  3O2P A;  1NX2 A;  2KGR A;  1FW4 A;  1RK9 A;  1X02 A;  3DF0 A;  2MLF C;  3BUX B;  1A75 A;  1QVI Z;  2LUX A;  3BOW B;  3PSR A;  3NSI A;  1ZMZ A;  2AAO A;  1SKT A;  5CSN A;  1B47 A;  1QX5 B;  2L0P A;  1TNQ A;  2LMU A;  1FI5 A;  3D0Y A;  3PN7 B;  2JC2 A;  2I7A A;  4PHN A;  1QX2 A;  2Y1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...