2NCPA

Nmr solution structure for the c-terminal domain of tetrahymena tcb2 in the presence of calcium
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
SSKPKYNPEVEAKLDVARRLFKRYDKDGSGQLQDDEIAGLLKDTYAEMGMSNFTPTKEDVKIWLQMADTNSDGSVSLEEYEDLIIKSLQKAGIRVEKQSLVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 25 kDa calcium-binding protein
publication title Solution NMR structures of the C-domain of Tetrahymena cytoskeletal protein Tcb2 reveal distinct calcium-induced structural rearrangements.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Metal binding protein
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ncpA00
1PVBA 2L4IA 1XA5A 2WOSA 1G8IA 2LHIA 3AAJA 4CLNA 1AHRA 3PN7B 2M1UA 2TN4A 1WDCB 2JT8A 3CTNA 1NCXA 1OZSA 1QV0A 4OR9B 5JOLA 4DCKA 1TOPA 4XYNA 1TNXA 1EG3A 4NDCA 1J7PA 3C1VA 3PLFB 1BF5A 2PMYA 1J7RA 1AVSA 1Y1XA 2EC6C 4Q04A 5KTYA 3SG3A 4ORAB 1LA3A 1KWOC 2V53A 4OV2A 1QASA 1YUUA 2LCPA 3I5GC 3GK1A 1B7TZ 1KK7Y 2E30A 4BY5A 1UHNA 1BLQA 1SY9A 5FYXA 1LA0A 1C7VA 1Q80A 2LV7A 1TIZA 4N5XA 1YVHA 2D8NA 1E8AA 4GBAA 5AFPA 5B8IB 3EK8A 1QVIY 1YX7A 2O60A 2GGZA 2JTZA 2M3WA 1KQMC 2Y4QA 1BMOA 1SCMC 2PSRA 3SG7A 1MUXA 1OZOA 1UP5A 1A29A 2F2PA 5ER4X 1J55A 3A4UB 3O2PA 3FS7A 1NUBA 1SK6D 3HCMA 3O4YA 4NQGA 1PRWA 1IG5A 1GGZA 1V1GA 1V1FA 2WCEA 2I94A 3DF0B 1B47A 3EVUA 2G9BA 2MLFC 1B4CA 4DUQA 2LVIA 3HX4A 4WRIA 2FCDA 1QX2A 1BODA 1N65A 1YURA 2KQYA 1UHKA 1CM1A 1K96A 2M29A 1CB1A 1WRKA 4C0JA 2JC2A 1KK8C 2BCBA 2JTTA 3TS5C 2EGDA 2L5XB 5CSNA 3WHTB 3GOFA 3I5IB 1FI5A 1A2XA 2HQ8A 2NLNA 2KAVA 1UURA 2Q4UA 4PE1A 2KGBC 2JWWA 1MR8A 3VRQA 1KQVA 1K90D 4PDZA 2MJWB 4YBHB 2L51A 4GAOA 2M1KB 4I5LB 4HREE 4GUKA 3LLEA 1M39A 2AMIA 2H61A 1DGVA 1SW8A 3EVVA 1KFXL 4YI8A 2K7DA 4DS7A 1IJ6A 2M8UA 3CR4X 2L2EA 4ORCB 5DKNA 3NSKA 2PALA 2BL0C 3RM1A 3WNXB 2KI6D 2MBXA 1K93D 1CTRA 3EK7A 3LCPC 2F3ZA 1RWYA 1F70A 5HKZA 1L7ZA 4QJ3B 3VROA 1M31A 1GJYA 1RTP1 4I5NB 1XK4C 1FF1A 2RGIA 3LL8B 3EVRA 4GPLB 3JVTB 4A4CA 5D69A 3KPXA 1NPQA 4YGEB 2JNXA 2JOJA 3VRRA 1RECA 2KBIA 1UUSA 1B8LA 1MXEA 2JZIA 2ZN8A 1IH0A 1BU3A 2OTGC 1LINA 2K7BA 4ORBB 1K2HA 2LVVA 1NX0A 3FIAA 1RJVA 4JWQA 1EG4A 4CPVA 5HKYA 1DJXA 2LUCA 1IKUA 1UHJA 3DVKA 4NDDA 2LLTA 2I18A 1HT9A 2SASA 1YR5A 1B9AA 2JNFA 2LUXA 3VGOA 2EHBA 1KFXS 1WLMA 3TZ1A 2CCMA 2AUCA 2HETA 3DD4A 3ZNIA 1BG1A 4M2QA 5D7FA 1TCOB 3TUYB 4MBEA 4YGBB 5PALA 2BKIB 3OB1B 3KF9A 1DGUA 2G2BA 1YUSA 1EH2A 1KWOB 2WNDA 2FOTA 4OVNF 1SR6C 3I5GB 4PHMA 3BOWA 1KFUS 5AEQA 1MWNA 1DF0B 3O78A 1R6PA 1VRKA 1MF8B 2IS9A 2BBMA 3I5HB 3IQQA 3I5FC 2M9GA 1QIVA 1BR1B 1XFYO 2I2RE 1CFPA 2F3YA 5HLOA 4PALA 2KGRA 1MXLC 3H4SE 1XFXO 2F2OA 2KFGA 2LMTA 4GGFC 2K7CA 1K8UA 3SG5A 1S6CA 5CSFA 1NX1A 1QX7A 1NCYA 2Y1MA 2OS8C 1KK7Z 4MZJA 1XVJA 3SJSA 1A03A 1ZFSA 3CS1A 1B8CA 3JTDB 4MZLA 1QLKA 1B7TY 2KNEA 3OB2B 3O6BA 4GFTA 2LNKA 3ICBA 5AANA 2PVBA 2ZFDA 3JTDC 2Y5IA 1BJFA 1R2UA 1JSAA 1C7WA 2LE9B 1QTXA 1SL7A 3PN7C 1JFJA 1XYDA 5CPVA 4C0KA 1OMDA 1F55A 1Y1AA 5F6TA 1FW4A 1NSHA 2NXQA 1Y1UA 5JJGA 1CKKA 1CFDA 3OX5A 3DVEA 1SKTA 3GK4X 1F71A 1ZACA 1NWDA 2LC5A 1DF0A 2BCXA 3CR5X 2KI4B 2NCPA 2JU0A 2L98A 1CDNA 3D10A 4E68A 1AUIB 5I2LA 1XO5A 1YRTB 1SMGA 1AP4A 2BECA 2K8MB 1DJYA 2VRGA 4YI9A 3WHUB 4MLWA 4P2YB 1PALA 5J3XA 2H61C 1DTLA 2COLB 2LAPA 3NSLA 5TNCA 3D0YB 4MEWA 1XFUO 3CWGA 5KU1A 2E6WA 2LLUA 2A4JA 2GGMA 3SG2A 3TDUA 2KI6C 2MHHA 1CDLA 1FI6A 2H2KA 2SCPA 1XFWO 1UWOA 2WORA 4IL1A 2JQ6A 4HSZA 4UPGA 1W7IB 1QS7A 3BYAA 3BUNB 2M7LA 2QPTA 1LVCD 3LK0A 1TN4A 2KBMA 1CLBA 2M7NA 1JC2A 1DJZA 2ZRTA 4N1GA 3BOWB 1DMOA 1J7QA 3DVJA 3CGAA 3PSRA 4PE0A 1F54A 1KFUL 1PSBA 4PHNA 1HQVA 1YRUB 1CDPA 2JT0A 4TNCA 1L2OB 4L9MA 1SL9A 3GK2A 2NZ0A 4YGDB 2ZNEA 1F4OA 1QIWA 2LHLA 1MHOA 4CIDA 3I5IC 3PATA 1D1OA 1EXRA 1CMGA 2M49B 1GQMA 4USLA 1IRJA 1A75B 2KOTA 4YGAA 1DT7B 2KQ6A 5K89A 2QACA 1CM4A 1PVAA 5IBWA 3TDIA 4MZKA 2ZKMX 1A4PA 4BY4A 1BT6A 2PRUA 2Q91A 2M0RA 4HRGA 5DKRA 4I5KA 3OHMB 5HLVA 4A4BA 4QJ5B 3BUMB 3D0YA 3PALA 2ISDA 1X02A 2CTNA 1SL8A 2BCAA 4PE7A 4ZCVA 2LMVA 1CLMA 1IJ5A 2KFFA 4YGCB 1BOCA 1QLSA 1YX8A 1XK4A 4DRWA 2CXJA 4ETOA 2EC6B 4F0ZB 1M63B 4CFQA 1NCZA 1CDMA 1TRFA 2M97A 3VRNA 3EKHA 1JF2A 1M45A 1DVIA 1SNLA 3MSEB 4MSPA 1YTZC 2MAZA 3SG4A 3KEVA 3JVTC 1CNPA 1NX2A 1OSAA 2CT9A 4FTGA 1IQ3A 1Y0VH 1AK8A 3LK1A 3AAKA 2HQWA 4GNKB 5I8NA 2LP3A 1K9UA 3AKBA 1S3PA 3DVMA 5I2OA 1S5GY 1SRAA 3IF7A 1KQMB 1S1EA 1DJHA 1TNWA 1B1GA 1WRLA 1SCMB 3NSOA 1JWDA 1DJGA 1SPYA 1A75A 1IWQA 4MRXA 1JBAA 3FWBA 5I2QA 1J1DA 1CFCA 3CR2A 1SYMA 4FQOA 1XFVO 2ZN9A 1OQPA 1QXPA 2BBNA 3BUOB 1F8HA 3BQ3A 4AOMA 1OMVA 2F33A 3SG6A 3TUYC 2K7OA 1K9PA 3E3RA 1N0YA 3IQOA 4XJKB 2MLEC 4PE4A 1J7OA 2KAYA 2L50A 1WLZA 3OP0A 1QVIZ 4PHKA 4U8DA 2FCEA 2JXCA 5KSZA 3SIBA 1ODBA 1RROA 1W7JB 1WDCC 2BE6A 1AJ4A 3RLZA 1KK8B 2F8PA 3TS5B 1YVLA 2KHNA 2MA2A 4MRYA 3I5HC 1N2DA 1UHHA 1EJ3A 4GGFA 1ALVA 4MVFA 2JRFA 2LP2A 1NP8A 4C0LA 3A8RA 2K2FA 1EL4A 2DOQA 4HRHA 5BPJA 1NX3A 1YUTA 3NXAA 3PM8A 1K94A 1QATA 1ZMZA 1M46A 1IQ5A 2FJUB 1S6JA 4AQIA 1TNPA 1OOJA 1XFZO 1NIWA 2BL0B 2LVKA 1IGVA 2HPSA 2B1UA 4NDBA 2P6BB 1CLLA 5AXIA 2ZRSA 1MQ1A 1LXFC 1JFKA 1DJWA 1Y6WA 3BUXB 3WXAA 2WCBA 4JQ0D 2R2IA 1H8BA 3F45A 2I7AA 2JT3A 1ZOTB 3EKJA 4DIRA 4XJKA 1S26D 1RK9A 2LM5A 2PASA 2WC8A 3BXKA 3OX6A 1S6IA 1DJIA 1JUOA 1UHIA 2KAXA 2OTGB 2CNPA 1RFJA 1KCYA 4GGNA 2KI4C 4MN0A 4CFRA 1QV1A 1S36A 3KHEA 1U5IB 2KYCA 4JPZB 2KYFA 1OE9B 2OPOA 1H4BA 5GQQC 1K9KA 4WQ2A 1TNQA 3EK4A 2GV5A 2JULA 2LVJA 2O5GA 3FWCA 4QJ4B 4ICBA 1KSOA 2MRDA 5ER5A 2LMUA 2JPTA 1PULA 1CMFA 1C07A 2KFHA 5CSIA 1F4QA 2LLSA 1TTXA 3PFVA 4YRUA 1JF0A 1CFFA 1KSMA 4N1FA 1B8RA 3CZTX 2CBLA 3NSIA 5HKWA 2WCFA 5HYDA 4M2OA 1SR6B 4R1EA 1SBJA 2L4HA 3DF0A 1GGWA 2LANA 3KO0A 4PCWA 4OKHA 4D1EA 4ZCUA 3I5FB 2JXLA 4M2PA 3CLNA 5AERA 2K0JA 1PSRA 1G4YR 1J1EA 3ZWHA 1ALWA 4P5OE 1WRZA 2NCOA 4I5JA 1FPWA 3QRXA 5G08A 1L2OC 2BE4A 2K2AA 1LKJA 1TCFA 1K95A 4OCIA 2ZNDA 1QJTA 3BUWB 2K61A 3K21A 3M0WA 1FBVA 1AJ5A 2OS8B 4PHJA 3TDZA 3VRPA 1WY9A 3AKAA 1U5IA 2BKHB 1NYAA 5DKQA 1OMRA 1G33A 1SCVA 1ZUZA 2KDHA 2KSPA 1PK0D 2Y1NA 4WQ3A 5CSJA 1QX5B 2L0PA 1BR4B 2HF5A 2AAOA 3SIAA 1S5GZ 4AQJA
chains in the Genus database with same CATH superfamily
1PVBA 2L4IA 1XA5A 2WOSA 1G8IA 2LHIA 3AAJA 2WCKA 3O4XA 1AHRA 4CLNA 3PN7B 2M1UA 2TN4A 1WDCB 2JT8A 3CTNA 1NCXA 1OZSA 1QV0A 3QMEA 4OR9B 5JOLA 4DCKA 1TOPA 4XYNA 1TNXA 1EG3A 4NDCA 1J7PA 3C1VA 2PYQA 3PLFB 1BF5A 2PMYA 2H8VA 1J7RA 1AVSA 1Y1XA 2EC6C 4Q04A 5KTYA 3SG3A 4ORAB 1LA3A 1KWOC 2V53A 3D74A 4OV2A 1QASA 1YUUA 2LCPA 3I5GC 4OZDA 3GK1A 1B7TZ 1KK7Y 2E30A 4BY5A 1UHNA 1BLQA 1SY9A 5FYXA 1LA0A 1C7VA 1Q80A 2LV7A 1TIZA 4N5XA 1YVHA 2D8NA 1E8AA 4GBAA 5AFPA 5B8IB 3EK8A 1QVIY 1YX7A 2O60A 2GGZA 2JTZA 2M3WA 1KQMC 2Y4QA 1BMOA 1SCMC 2PSRA 3SG7A 1MUXA 1OZOA 1UP5A 1A29A 2F2PA 5ER4X 1J55A 3L47A 3A4UB 3O2PA 3FS7A 1NUBA 1SK6D 3HCMA 3O4YA 2WC5A 4NQGA 3S0EA 1PRWA 1IG5A 1GGZA 1V1GA 1V1FA 2WCEA 3D75A 2I94A 3DF0B 1B47A 3EVUA 2G9BA 2MLFC 1B4CA 4DUQA 2LVIA 3HX4A 3RZSA 4WRIA 2FCDA 2WCJA 1QX2A 1BODA 1N65A 1YURA 2KQYA 1UHKA 1CM1A 1K96A 2M29A 1CB1A 1WRKA 4C0JA 2JC2A 1KK8C 2BCBA 2JTTA 3TS5C 2EGDA 2L5XB 5CSNA 3WHTB 3GOFA 3I5IB 1FI5A 1A2XA 2HQ8A 2NLNA 2KAVA 3B7AA 1UURA 2Q4UA 3CABA 4INWA 4PE1A 1LS8A 2JWWA 2KGBC 4F7FA 1MR8A 3VRQA 1KQVA 1K90D 4PDZA 2MJWB 4YBHB 2L51A 4GAOA 2M1KB 4I5LB 3CZ2A 2YGUA 4HREE 4GUKA 3LLEA 1M39A 2AMIA 2H61A 1DGVA 1SW8A 2BAPA 2QDIA 3EVVA 5HL1A 1KFXL 4YI8A 1IIOA 2K7DA 4DS7A 1IJ6A 2M8UA 3CR4X 2L2EA 4ORCB 5DKNA 3DYEA 3NSKA 2PALA 2BL0C 3RM1A 3WNXB 2KI6D 2MBXA 1K93D 1CTRA 5FI2A 3EK7A 3UO9A 3LCPC 2F3ZA 1RWYA 1F70A 5HKZA 1L7ZA 4QJ3B 3VROA 1M31A 3NHIA 1GJYA 1RTP1 4I5NB 1XK4C 1FF1A 3PJIA 2RGIA 3LL8B 3EVRA 4GPLB 3JVTB 4A4CA 5D69A 1GM0A 3KPXA 1NPQA 4YGEB 2JNXA 2JOJA 3VRRA 3N7HA 1RECA 2KBIA 1UUSA 1B8LA 1MXEA 2JZIA 2ZN8A 1IH0A 1BU3A 1TUJA 2OTGC 3B6XA 1LINA 3NHTA 3S0AA 1SSEB 2K7BA 4ORBB 1K2HA 2LVVA 1NX0A 3FIAA 1RJVA 4JWQA 1EG4A 3BJHA 3L4LA 4CPVA 1XFRA 5HKYA 1DJXA 2LUCA 3BFAA 4PT1A 1UHJA 3DVKA 4NDDA 1IKUA 2LLTA 2I18A 3SS3A 1HT9A 2SASA 1YR5A 1B9AA 2JNFA 2LUXA 3VGOA 2EHBA 2WC6A 3CZ0A 1KFXS 3VB1A 1WLMA 3TZ1A 1C3YA 2CCMA 2AUCA 2HETA 3DD4A 3ZNIA 1BG1A 4M2QA 5D7FA 1TCOB 3TUYB 4MBEA 4YGBB 5PALA 2BKIB 3OB1B 3KF9A 1DEKA 1DGUA 1YUSA 2G2BA 1EH2A 5FI6A 1KWOB 2WNDA 2FOTA 4OVNF 1SR6C 3I5GB 4PHMA 4JD9A 3BOWA 1KFUS 3B86A 1MWNA 1DF0B 3R1OA 3O78A 5AEQA 1R6PA 1VRKA 1MF8B 2IS9A 2BBMA 3I5HB 3IQQA 3I5FC 1OOGA 2M9GA 1QIVA 1BR1B 1XFYO 2I2RE 3D77A 1CFPA 2F3YA 5HLOA 4PALA 2KGRA 1MXLC 3H4SE 1XFXO 2F2OA 2KFGA 1TWOA 2LMTA 5D3OA 4GGFC 2K7CA 1K8UA 3L4AA 3SG5A 1S6CA 5CSFA 1NX1A 1QX7A 1NCYA 2Y1MA 2OS8C 1KK7Z 4MZJA 1XVJA 4IJ7A 3SJSA 1A03A 1ZFSA 3CS1A 1B8CA 3JTDB 3OGNA 4MZLA 4FQTA 1QLKA 1B7TY 2GTEA 2KNEA 3O6BA 3OB2B 2LNKA 4GFTA 3ICBA 5AANA 2PVBA 2ZFDA 3JTDC 2Y5IA 3FE6A 1BJFA 1R2UA 1JSAA 1C7WA 2LE9B 1QTXA 1SL7A 2P70A 3D76A 1XYDA 3PN7C 5CPVA 4C0KA 1JFJA 1OMDA 1F55A 1Y1AA 5F6TA 2KLDA 1FW4A 1OOIX 1NSHA 1DQEA 1Y1UA 2NXQA 5JJGA 1CKKA 3K1EA 1CFDA 3OX5A 3DVEA 1SKTA 3GK4X 1F71A 1ZACA 1NWDA 2LC5A 1DF0A 2BCXA 3CR5X 2KI4B 2NCPA 2JU0A 2L98A 1CDNA 3D10A 4E68A 1AUIB 5I2LA 1XO5A 1YRTB 1SMGA 1AP4A 2BECA 3Q8IA 2K8MB 1DJYA 2VRGA 4YI9A 3WHUB 4MLWA 4P2YB 1PALA 1Z2CB 5J3XA 2H61C 1DTLA 2COLB 2LAPA 3NSLA 5TNCA 3D0YB 4MEWA 1XFUO 3CWGA 5KU1A 2E6WA 2KPHA 2LLUA 2A4JA 2GGMA 3SG2A 3TDUA 2KI6C 1P28A 2MHHA 1CDLA 1FI6A 1Z4HA 2H2KA 2SCPA 1C3ZA 3D73A 1XFWO 1UWOA 2WCHA 2WORA 4IL1A 2JQ6A 4HSZA 4UPGA 1W7IB 1QS7A 3BYAA 3BUNB 2M7LA 2QPTA 1LVCD 3LK0A 1TN4A 2KBMA 1CLBA 2FJYA 2M7NA 1JC2A 1DJZA 2ZRTA 3DZTA 3R1PA 4N1GA 3BOWB 1DMOA 2K60A 1J7QA 3DVJA 3CGAA 3PSRA 4PE0A 1F54A 1KFUL 4INXA 1DELA 1PSBA 4PHNA 1HQVA 1YRUB 1CDPA 2JT0A 4TNCA 1TUZA 1L2OB 4L9MA 1SL9A 3GK2A 2NZ0A 4YGDB 3V2LA 2ZNEA 1F4OA 1QIWA 2LHLA 1MHOA 3CDNA 4CIDA 3NGVA 3I5IC 3PATA 1D1OA 1EXRA 1CMGA 2M49B 1GQMA 4USLA 1IRJA 1A75B 2KOTA 3IVTA 4YGAA 1DT7B 2KQ6A 3UNWA 5K89A 2QACA 1CM4A 1PVAA 5IBWA 3TDIA 4MZKA 2ZKMX 1A4PA 4BY4A 1BT6A 2PRUA 2Q91A 2M0RA 4HRGA 1OOFA 5DKRA 4I5KA 3OHMB 5HLVA 4A4BA 4QJ5B 3BUMB 3D0YA 3PALA 2ISDA 3FE8A 1X02A 2CTNA 1SL8A 2BCAA 4PE7A 2L5YA 4ZCVA 2LMVA 1CLMA 1ORGA 1IJ5A 2KFFA 4YGCB 1BOCA 1QLSA 1YX8A 1XK4A 4DRWA 2ERBA 2CXJA 1W9ZA 4ETOA 2EC6B 4F0ZB 1M63B 4CFQA 1NCZA 1CDMA 1TRFA 2M97A 3VRNA 3CZ1A 3EKHA 1JF2A 1M45A 1DVIA 1SNLA 3MSEB 4MSPA 1YTZC 2MAZA 3SG4A 3KEVA 3JVTC 1CNPA 1NX2A 1OSAA 2CT9A 4FTGA 1IQ3A 1Y0VH 1AK8A 3LK1A 1OW4A 3AAKA 2HQWA 4GNKB 5I8NA 2LP3A 1K9UA 3AKBA 1S3PA 3DVMA 5I2OA 1S5GY 1SRAA 3PM2A 3IF7A 1KQMB 1S1EA 3S0BA 1DJHA 1TNWA 2L2CA 1WRLA 1B1GA 1SCMB 3NSOA 5DICA 3FE9A 1JWDA 1DJGA 1SPYA 1A75A 1IWQA 4MRXA 1JBAA 2KLEA 3FWBA 5I2QA 1J1DA 1CFCA 3CR2A 1SYMA 4FQOA 1XFVO 2ZN9A 1OQPA 1QXPA 2BBNA 3BUOB 1F8HA 3BQ3A 4AOMA 1OMVA 1QWVA 2F33A 2JPOA 3SG6A 3TUYC 2K7OA 1K9PA 3E3RA 1N0YA 3IQOA 4XJKB 2MLEC 4PE4A 1J7OA 2KAYA 2L50A 1WLZA 3OP0A 1QVIZ 4PHKA 4U8DA 2FCEA 2JXCA 5KSZA 3SIBA 1ODBA 1RROA 2P71A 1W7JB 1WDCC 2QEVA 2BE6A 1AJ4A 3RLZA 1KK8B 2F8PA 3TS5B 1YVLA 2KHNA 2MA2A 4MRYA 3I5HC 1N2DA 1UHHA 1EJ3A 4GGFA 1ALVA 4MVFA 3BFBA 1DC1A 2JRFA 2LP2A 1NP8A 4C0LA 3A8RA 2K2FA 1EL4A 2DOQA 4HRHA 5BPJA 1NX3A 5I94A 1YUTA 3NXAA 1T14A 3PM8A 3S0DA 1K94A 1QATA 1ZMZA 1M46A 1IQ5A 3D78A 2FJUB 1S6JA 4AQIA 2WCLA 1TNPA 1OOJA 1XFZO 1NIWA 2BL0B 3DXLA 4KYNA 2LVKA 1IGVA 2HPSA 2B1UA 4NDBA 2P6BB 3EG5B 3B87A 1CLLA 5AXIA 2ZRSA 1MQ1A 3DY9A 1LXFC 3CYZA 1JFKA 1DJWA 1Y6WA 3BUXB 3WXAA 2WCBA 4JQ0D 2R2IA 1H8BA 3F45A 2I7AA 2QEBA 2JT3A 1ZOTB 3EKJA 4DIRA 4XJKA 1S26D 1RK9A 2LM5A 2PASA 2WC8A 3BXKA 3OX6A 1S6IA 3SS5A 1DJIA 1JUOA 1UHIA 2KAXA 2OTGB 2CNPA 1RFJA 1KCYA 4GGNA 2KI4C 4MN0A 4CFRA 1QV1A 1S36A 3KHEA 1U5IB 2KYCA 4JPZB 2KYFA 5EL2A 1OE9B 2OPOA 4JKTA 2QEOA 1H4BA 5GQQC 3BFHA 1K9KA 4WQ2A 2BNXA 1TNQA 3EK4A 2GV5A 2JULA 2LVJA 2O5GA 3FWCA 4QJ4B 4ICBA 1KSOA 2MRDA 2PQLA 2LMUA 2QEHA 5ER5A 2JPTA 1PULA 1CMFA 1C07A 2KFHA 3SS4A 5CSIA 1F4QA 2LLSA 1TTXA 3PFVA 4YRUA 1JF0A 1CFFA 1KSMA 4N1FA 1B8RA 3CZTX 2CBLA 3NSIA 5HKWA 2WCFA 5HYDA 4M2OA 1SR6B 3R1VA 4R1EA 1SBJA 2L4HA 3DF0A 1GGWA 2LANA 3S0FA 3KO0A 4PCWA 4OKHA 4D1EA 4ZCUA 3I5FB 2JXLA 4M2PA 3CLNA 5AERA 2K0JA 1PSRA 1G4YR 1J1EA 3ZWHA 3S0GA 1ALWA 4P5OE 1WRZA 2NCOA 4I5JA 1FPWA 1OOHA 3QRXA 5G08A 1L2OC 3B88A 2BE4A 2K2AA 1LKJA 1TCFA 3OBVA 1K95A 4OCIA 2ZNDA 1QJTA 3BUWB 2K61A 3K21A 3M0WA 1FBVA 1AJ5A 2OS8B 4PHJA 3TDZA 3VRPA 3R72A 1WY9A 3AKAA 1U5IA 2BKHB 2WCMA 1NYAA 5DKQA 1OMRA 1G33A 1SCVA 1ZUZA 2KDHA 2KSPA 1PK0D 2Y1NA 4WQ3A 5CSJA 1QX5B 2L0PA 1BR4B 2HF5A 5FI7A 2AAOA 3SIAA 1S5GZ 4AQJA
chains in the Genus database with same CATH topology
1PVBA 2L4IA 1XA5A 2WOSA 1G8IA 2LHIA 3AAJA 4CLNA 1AHRA 3PN7B 2M1UA 2TN4A 1WDCB 2JT8A 3CTNA 1NCXA 1OZSA 1QV0A 4OR9B 5JOLA 4DCKA 1TOPA 4XYNA 1TNXA 1EG3A 4NDCA 1J7PA 3C1VA 3PLFB 1BF5A 2PMYA 1J7RA 1AVSA 1Y1XA 2EC6C 4Q04A 5KTYA 3SG3A 4ORAB 1LA3A 1KWOC 2V53A 4OV2A 1QASA 1YUUA 2LCPA 3I5GC 3GK1A 1B7TZ 1KK7Y 2E30A 4BY5A 1UHNA 1BLQA 1SY9A 5FYXA 1LA0A 1C7VA 1Q80A 2LV7A 1TIZA 4N5XA 1YVHA 2D8NA 1E8AA 4GBAA 5AFPA 5B8IB 3EK8A 1QVIY 1YX7A 2O60A 2GGZA 2JTZA 2M3WA 1KQMC 2Y4QA 1BMOA 1SCMC 2PSRA 3SG7A 1MUXA 1OZOA 1UP5A 1A29A 2F2PA 5ER4X 1J55A 3A4UB 3O2PA 3FS7A 1NUBA 1SK6D 3HCMA 3O4YA 4NQGA 1PRWA 1IG5A 1GGZA 1V1GA 1V1FA 2WCEA 2I94A 3DF0B 1B47A 3EVUA 2G9BA 2MLFC 1B4CA 4DUQA 2LVIA 3HX4A 4WRIA 2FCDA 1QX2A 1BODA 1N65A 1YURA 2KQYA 1UHKA 1CM1A 1K96A 2M29A 1CB1A 1WRKA 4C0JA 2JC2A 1KK8C 2BCBA 2JTTA 3TS5C 2EGDA 2L5XB 5CSNA 3WHTB 3GOFA 3I5IB 1FI5A 1A2XA 2HQ8A 2NLNA 2KAVA 1UURA 2Q4UA 4PE1A 2KGBC 2JWWA 1MR8A 3VRQA 1KQVA 1K90D 4PDZA 2MJWB 4YBHB 2L51A 4GAOA 2M1KB 4I5LB 4HREE 4GUKA 3LLEA 1M39A 2AMIA 2H61A 1DGVA 1SW8A 3EVVA 1KFXL 4YI8A 2K7DA 4DS7A 1IJ6A 2M8UA 3CR4X 2L2EA 4ORCB 5DKNA 3NSKA 2PALA 2BL0C 3RM1A 3WNXB 2KI6D 2MBXA 1K93D 1CTRA 3EK7A 3LCPC 2F3ZA 1RWYA 1F70A 5HKZA 1L7ZA 4QJ3B 3VROA 1M31A 1GJYA 1RTP1 4I5NB 1XK4C 1FF1A 2RGIA 3LL8B 3EVRA 4GPLB 3JVTB 4A4CA 5D69A 3KPXA 1NPQA 4YGEB 2JNXA 2JOJA 3VRRA 1RECA 2KBIA 1UUSA 1B8LA 1MXEA 2JZIA 2ZN8A 1IH0A 1BU3A 2OTGC 1LINA 2K7BA 4ORBB 1K2HA 2LVVA 1NX0A 3FIAA 1RJVA 4JWQA 1EG4A 4CPVA 5HKYA 1DJXA 2LUCA 1IKUA 1UHJA 3DVKA 4NDDA 2LLTA 2I18A 1HT9A 2SASA 1YR5A 1B9AA 2JNFA 2LUXA 3VGOA 2EHBA 1KFXS 1WLMA 3TZ1A 2CCMA 2AUCA 2HETA 3DD4A 3ZNIA 1BG1A 4M2QA 5D7FA 1TCOB 3TUYB 4MBEA 4YGBB 5PALA 2BKIB 3OB1B 3KF9A 1DGUA 2G2BA 1YUSA 1EH2A 1KWOB 2WNDA 2FOTA 4OVNF 1SR6C 3I5GB 4PHMA 3BOWA 1KFUS 5AEQA 1MWNA 1DF0B 3O78A 1R6PA 1VRKA 1MF8B 2IS9A 2BBMA 3I5HB 3IQQA 3I5FC 2M9GA 1QIVA 1BR1B 1XFYO 2I2RE 1CFPA 2F3YA 5HLOA 4PALA 2KGRA 1MXLC 3H4SE 1XFXO 2F2OA 2KFGA 2LMTA 4GGFC 2K7CA 1K8UA 3SG5A 1S6CA 5CSFA 1NX1A 1QX7A 1NCYA 2Y1MA 2OS8C 1KK7Z 4MZJA 1XVJA 3SJSA 1A03A 1ZFSA 3CS1A 1B8CA 3JTDB 4MZLA 1QLKA 1B7TY 2KNEA 3OB2B 3O6BA 4GFTA 2LNKA 3ICBA 5AANA 2PVBA 2ZFDA 3JTDC 2Y5IA 1BJFA 1R2UA 1JSAA 1C7WA 2LE9B 1QTXA 1SL7A 3PN7C 1JFJA 1XYDA 5CPVA 4C0KA 1OMDA 1F55A 1Y1AA 5F6TA 1FW4A 1NSHA 2NXQA 1Y1UA 5JJGA 1CKKA 1CFDA 3OX5A 3DVEA 1SKTA 3GK4X 1F71A 1ZACA 1NWDA 2LC5A 1DF0A 2BCXA 3CR5X 2KI4B 2NCPA 2JU0A 2L98A 1CDNA 3D10A 4E68A 1AUIB 5I2LA 1XO5A 1YRTB 1SMGA 1AP4A 2BECA 2K8MB 1DJYA 2VRGA 4YI9A 3WHUB 4MLWA 4P2YB 1PALA 5J3XA 2H61C 1DTLA 2COLB 2LAPA 3NSLA 5TNCA 3D0YB 4MEWA 1XFUO 3CWGA 5KU1A 2E6WA 2LLUA 2A4JA 2GGMA 3SG2A 3TDUA 2KI6C 2MHHA 1CDLA 1FI6A 2H2KA 2SCPA 1XFWO 1UWOA 2WORA 4IL1A 2JQ6A 4HSZA 4UPGA 1W7IB 1QS7A 3BYAA 3BUNB 2M7LA 2QPTA 1LVCD 3LK0A 1TN4A 2KBMA 1CLBA 2M7NA 1JC2A 1DJZA 2ZRTA 4N1GA 3BOWB 1DMOA 1J7QA 3DVJA 3CGAA 3PSRA 4PE0A 1F54A 1KFUL 1PSBA 4PHNA 1HQVA 1YRUB 1CDPA 2JT0A 4TNCA 1L2OB 4L9MA 1SL9A 3GK2A 2NZ0A 4YGDB 2ZNEA 1F4OA 1QIWA 2LHLA 1MHOA 4CIDA 3I5IC 3PATA 1D1OA 1EXRA 1CMGA 2M49B 1GQMA 4USLA 1IRJA 1A75B 2KOTA 4YGAA 1DT7B 2KQ6A 5K89A 2QACA 1CM4A 1PVAA 5IBWA 3TDIA 4MZKA 2ZKMX 1A4PA 4BY4A 1BT6A 2PRUA 2Q91A 2M0RA 4HRGA 5DKRA 4I5KA 3OHMB 5HLVA 4A4BA 4QJ5B 3BUMB 3D0YA 3PALA 2ISDA 1X02A 2CTNA 1SL8A 2BCAA 4PE7A 4ZCVA 2LMVA 1CLMA 1IJ5A 2KFFA 4YGCB 1BOCA 1QLSA 1YX8A 1XK4A 4DRWA 2CXJA 4ETOA 2EC6B 4F0ZB 1M63B 4CFQA 1NCZA 1CDMA 1TRFA 2M97A 3VRNA 3EKHA 1JF2A 1M45A 1DVIA 1SNLA 3MSEB 4MSPA 1YTZC 2MAZA 3SG4A 3KEVA 3JVTC 1CNPA 1NX2A 1OSAA 2CT9A 4FTGA 1IQ3A 1Y0VH 1AK8A 3LK1A 3AAKA 2HQWA 4GNKB 5I8NA 2LP3A 1K9UA 3AKBA 1S3PA 3DVMA 5I2OA 1S5GY 1SRAA 3IF7A 1KQMB 1S1EA 1DJHA 1TNWA 1B1GA 1WRLA 1SCMB 3NSOA 1JWDA 1DJGA 1SPYA 1A75A 1IWQA 4MRXA 1JBAA 3FWBA 5I2QA 1J1DA 1CFCA 3CR2A 1SYMA 4FQOA 1XFVO 2ZN9A 1OQPA 1QXPA 2BBNA 3BUOB 1F8HA 3BQ3A 4AOMA 1OMVA 2F33A 3SG6A 3TUYC 2K7OA 1K9PA 3E3RA 1N0YA 3IQOA 4XJKB 2MLEC 4PE4A 1J7OA 2KAYA 2L50A 1WLZA 3OP0A 1QVIZ 4PHKA 4U8DA 2FCEA 2JXCA 5KSZA 3SIBA 1ODBA 1RROA 1W7JB 1WDCC 2BE6A 1AJ4A 3RLZA 1KK8B 2F8PA 3TS5B 1YVLA 2KHNA 2MA2A 4MRYA 3I5HC 1N2DA 1UHHA 1EJ3A 4GGFA 1ALVA 4MVFA 2JRFA 2LP2A 1NP8A 4C0LA 3A8RA 2K2FA 1EL4A 2DOQA 4HRHA 5BPJA 1NX3A 1YUTA 3NXAA 3PM8A 1K94A 1QATA 1ZMZA 1M46A 1IQ5A 2FJUB 1S6JA 4AQIA 1TNPA 1OOJA 1XFZO 1NIWA 2BL0B 2LVKA 1IGVA 2HPSA 2B1UA 4NDBA 2P6BB 1CLLA 5AXIA 2ZRSA 1MQ1A 1LXFC 1JFKA 1DJWA 1Y6WA 3BUXB 3WXAA 2WCBA 4JQ0D 2R2IA 1H8BA 3F45A 2I7AA 2JT3A 1ZOTB 3EKJA 4DIRA 4XJKA 1S26D 1RK9A 2LM5A 2PASA 2WC8A 3BXKA 3OX6A 1S6IA 1DJIA 1JUOA 1UHIA 2KAXA 2OTGB 2CNPA 1RFJA 1KCYA 4GGNA 2KI4C 4MN0A 4CFRA 1QV1A 1S36A 3KHEA 1U5IB 2KYCA 4JPZB 2KYFA 1OE9B 2OPOA 1H4BA 5GQQC 1K9KA 4WQ2A 1TNQA 3EK4A 2GV5A 2JULA 2LVJA 2O5GA 3FWCA 4QJ4B 4ICBA 1KSOA 2MRDA 5ER5A 2LMUA 2JPTA 1PULA 1CMFA 1C07A 2KFHA 5CSIA 1F4QA 2LLSA 1TTXA 3PFVA 4YRUA 1JF0A 1CFFA 1KSMA 4N1FA 1B8RA 3CZTX 2CBLA 3NSIA 5HKWA 2WCFA 5HYDA 4M2OA 1SR6B 4R1EA 1SBJA 2L4HA 3DF0A 1GGWA 2LANA 3KO0A 4PCWA 4OKHA 4D1EA 4ZCUA 3I5FB 2JXLA 4M2PA 3CLNA 5AERA 2K0JA 1PSRA 1G4YR 1J1EA 3ZWHA 1ALWA 4P5OE 1WRZA 2NCOA 4I5JA 1FPWA 3QRXA 5G08A 1L2OC 2BE4A 2K2AA 1LKJA 1TCFA 1K95A 4OCIA 2ZNDA 1QJTA 3BUWB 2K61A 3K21A 3M0WA 1FBVA 1AJ5A 2OS8B 4PHJA 3TDZA 3VRPA 1WY9A 3AKAA 1U5IA 2BKHB 1NYAA 5DKQA 1OMRA 1G33A 1SCVA 1ZUZA 2KDHA 2KSPA 1PK0D 2Y1NA 4WQ3A 5CSJA 1QX5B 2L0PA 1BR4B 2HF5A 2AAOA 3SIAA 1S5GZ 4AQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVB A;  2L4I A;  1XA5 A;  2WOS A;  1G8I A;  2LHI A;  3AAJ A;  4CLN A;  1AHR A;  3PN7 B;  2M1U A;  2TN4 A;  1WDC B;  2JT8 A;  3CTN A;  1NCX A;  1OZS A;  1QV0 A;  4OR9 B;  5JOL A;  4DCK A;  1TOP A;  4XYN A;  1TNX A;  1EG3 A;  4NDC A;  1J7P A;  3C1V A;  3PLF B;  1BF5 A;  2PMY A;  1J7R A;  1AVS A;  1Y1X A;  2EC6 C;  4Q04 A;  5KTY A;  3SG3 A;  4ORA B;  1LA3 A;  1KWO C;  2V53 A;  4OV2 A;  1QAS A;  1YUU A;  2LCP A;  3I5G C;  3GK1 A;  1B7T Z;  1KK7 Y;  2E30 A;  4BY5 A;  1UHN A;  1BLQ A;  1SY9 A;  5FYX A;  1LA0 A;  1C7V A;  1Q80 A;  2LV7 A;  1TIZ A;  4N5X A;  1YVH A;  2D8N A;  1E8A A;  4GBA A;  5AFP A;  5B8I B;  3EK8 A;  1QVI Y;  1YX7 A;  2O60 A;  2GGZ A;  2JTZ A;  2M3W A;  1KQM C;  2Y4Q A;  1BMO A;  1SCM C;  2PSR A;  3SG7 A;  1MUX A;  1OZO A;  1UP5 A;  1A29 A;  2F2P A;  5ER4 X;  1J55 A;  3A4U B;  3O2P A;  3FS7 A;  1NUB A;  1SK6 D;  3HCM A;  3O4Y A;  4NQG A;  1PRW A;  1IG5 A;  1GGZ A;  1V1G A;  1V1F A;  2WCE A;  2I94 A;  3DF0 B;  1B47 A;  3EVU A;  2G9B A;  2MLF C;  1B4C A;  4DUQ A;  2LVI A;  3HX4 A;  4WRI A;  2FCD A;  1QX2 A;  1BOD A;  1N65 A;  1YUR A;  2KQY A;  1UHK A;  1CM1 A;  1K96 A;  2M29 A;  1CB1 A;  1WRK A;  4C0J A;  2JC2 A;  1KK8 C;  2BCB A;  2JTT A;  3TS5 C;  2EGD A;  2L5X B;  5CSN A;  3WHT B;  3GOF A;  3I5I B;  1FI5 A;  1A2X A;  2HQ8 A;  2NLN A;  2KAV A;  1UUR A;  2Q4U A;  4PE1 A;  2KGB C;  2JWW A;  1MR8 A;  3VRQ A;  1KQV A;  1K90 D;  4PDZ A;  2MJW B;  4YBH B;  2L51 A;  4GAO A;  2M1K B;  4I5L B;  4HRE E;  4GUK A;  3LLE A;  1M39 A;  2AMI A;  2H61 A;  1DGV A;  1SW8 A;  3EVV A;  1KFX L;  4YI8 A;  2K7D A;  4DS7 A;  1IJ6 A;  2M8U A;  3CR4 X;  2L2E A;  4ORC B;  5DKN A;  3NSK A;  2PAL A;  2BL0 C;  3RM1 A;  3WNX B;  2KI6 D;  2MBX A;  1K93 D;  1CTR A;  3EK7 A;  3LCP C;  2F3Z A;  1RWY A;  1F70 A;  5HKZ A;  1L7Z A;  4QJ3 B;  3VRO A;  1M31 A;  1GJY A;  1RTP 1;  4I5N B;  1XK4 C;  1FF1 A;  2RGI A;  3LL8 B;  3EVR A;  4GPL B;  3JVT B;  4A4C A;  5D69 A;  3KPX A;  1NPQ A;  4YGE B;  2JNX A;  2JOJ A;  3VRR A;  1REC A;  2KBI A;  1UUS A;  1B8L A;  1MXE A;  2JZI A;  2ZN8 A;  1IH0 A;  1BU3 A;  2OTG C;  1LIN A;  2K7B A;  4ORB B;  1K2H A;  2LVV A;  1NX0 A;  3FIA A;  1RJV A;  4JWQ A;  1EG4 A;  4CPV A;  5HKY A;  1DJX A;  2LUC A;  1IKU A;  1UHJ A;  3DVK A;  4NDD A;  2LLT A;  2I18 A;  1HT9 A;  2SAS A;  1YR5 A;  1B9A A;  2JNF A;  2LUX A;  3VGO A;  2EHB A;  1KFX S;  1WLM A;  3TZ1 A;  2CCM A;  2AUC A;  2HET A;  3DD4 A;  3ZNI A;  1BG1 A;  4M2Q A;  5D7F A;  1TCO B;  3TUY B;  4MBE A;  4YGB B;  5PAL A;  2BKI B;  3OB1 B;  3KF9 A;  1DGU A;  2G2B A;  1YUS A;  1EH2 A;  1KWO B;  2WND A;  2FOT A;  4OVN F;  1SR6 C;  3I5G B;  4PHM A;  3BOW A;  1KFU S;  5AEQ A;  1MWN A;  1DF0 B;  3O78 A;  1R6P A;  1VRK A;  1MF8 B;  2IS9 A;  2BBM A;  3I5H B;  3IQQ A;  3I5F C;  2M9G A;  1QIV A;  1BR1 B;  1XFY O;  2I2R E;  1CFP A;  2F3Y A;  5HLO A;  4PAL A;  2KGR A;  1MXL C;  3H4S E;  1XFX O;  2F2O A;  2KFG A;  2LMT A;  4GGF C;  2K7C A;  1K8U A;  3SG5 A;  1S6C A;  5CSF A;  1NX1 A;  1QX7 A;  1NCY A;  2Y1M A;  2OS8 C;  1KK7 Z;  4MZJ A;  1XVJ A;  3SJS A;  1A03 A;  1ZFS A;  3CS1 A;  1B8C A;  3JTD B;  4MZL A;  1QLK A;  1B7T Y;  2KNE A;  3OB2 B;  3O6B A;  4GFT A;  2LNK A;  3ICB A;  5AAN A;  2PVB A;  2ZFD A;  3JTD C;  2Y5I A;  1BJF A;  1R2U A;  1JSA A;  1C7W A;  2LE9 B;  1QTX A;  1SL7 A;  3PN7 C;  1JFJ A;  1XYD A;  5CPV A;  4C0K A;  1OMD A;  1F55 A;  1Y1A A;  5F6T A;  1FW4 A;  1NSH A;  2NXQ A;  1Y1U A;  5JJG A;  1CKK A;  1CFD A;  3OX5 A;  3DVE A;  1SKT A;  3GK4 X;  1F71 A;  1ZAC A;  1NWD A;  2LC5 A;  1DF0 A;  2BCX A;  3CR5 X;  2KI4 B;  2NCP A;  2JU0 A;  2L98 A;  1CDN A;  3D10 A;  4E68 A;  1AUI B;  5I2L A;  1XO5 A;  1YRT B;  1SMG A;  1AP4 A;  2BEC A;  2K8M B;  1DJY A;  2VRG A;  4YI9 A;  3WHU B;  4MLW A;  4P2Y B;  1PAL A;  5J3X A;  2H61 C;  1DTL A;  2COL B;  2LAP A;  3NSL A;  5TNC A;  3D0Y B;  4MEW A;  1XFU O;  3CWG A;  5KU1 A;  2E6W A;  2LLU A;  2A4J A;  2GGM A;  3SG2 A;  3TDU A;  2KI6 C;  2MHH A;  1CDL A;  1FI6 A;  2H2K A;  2SCP A;  1XFW O;  1UWO A;  2WOR A;  4IL1 A;  2JQ6 A;  4HSZ A;  4UPG A;  1W7I B;  1QS7 A;  3BYA A;  3BUN B;  2M7L A;  2QPT A;  1LVC D;  3LK0 A;  1TN4 A;  2KBM A;  1CLB A;  2M7N A;  1JC2 A;  1DJZ A;  2ZRT A;  4N1G A;  3BOW B;  1DMO A;  1J7Q A;  3DVJ A;  3CGA A;  3PSR A;  4PE0 A;  1F54 A;  1KFU L;  1PSB A;  4PHN A;  1HQV A;  1YRU B;  1CDP A;  2JT0 A;  4TNC A;  1L2O B;  4L9M A;  1SL9 A;  3GK2 A;  2NZ0 A;  4YGD B;  2ZNE A;  1F4O A;  1QIW A;  2LHL A;  1MHO A;  4CID A;  3I5I C;  3PAT A;  1D1O A;  1EXR A;  1CMG A;  2M49 B;  1GQM A;  4USL A;  1IRJ A;  1A75 B;  2KOT A;  4YGA A;  1DT7 B;  2KQ6 A;  5K89 A;  2QAC A;  1CM4 A;  1PVA A;  5IBW A;  3TDI A;  4MZK A;  2ZKM X;  1A4P A;  4BY4 A;  1BT6 A;  2PRU A;  2Q91 A;  2M0R A;  4HRG A;  5DKR A;  4I5K A;  3OHM B;  5HLV A;  4A4B A;  4QJ5 B;  3BUM B;  3D0Y A;  3PAL A;  2ISD A;  1X02 A;  2CTN A;  1SL8 A;  2BCA A;  4PE7 A;  4ZCV A;  2LMV A;  1CLM A;  1IJ5 A;  2KFF A;  4YGC B;  1BOC A;  1QLS A;  1YX8 A;  1XK4 A;  4DRW A;  2CXJ A;  4ETO A;  2EC6 B;  4F0Z B;  1M63 B;  4CFQ A;  1NCZ A;  1CDM A;  1TRF A;  2M97 A;  3VRN A;  3EKH A;  1JF2 A;  1M45 A;  1DVI A;  1SNL A;  3MSE B;  4MSP A;  1YTZ C;  2MAZ A;  3SG4 A;  3KEV A;  3JVT C;  1CNP A;  1NX2 A;  1OSA A;  2CT9 A;  4FTG A;  1IQ3 A;  1Y0V H;  1AK8 A;  3LK1 A;  3AAK A;  2HQW A;  4GNK B;  5I8N A;  2LP3 A;  1K9U A;  3AKB A;  1S3P A;  3DVM A;  5I2O A;  1S5G Y;  1SRA A;  3IF7 A;  1KQM B;  1S1E A;  1DJH A;  1TNW A;  1B1G A;  1WRL A;  1SCM B;  3NSO A;  1JWD A;  1DJG A;  1SPY A;  1A75 A;  1IWQ A;  4MRX A;  1JBA A;  3FWB A;  5I2Q A;  1J1D A;  1CFC A;  3CR2 A;  1SYM A;  4FQO A;  1XFV O;  2ZN9 A;  1OQP A;  1QXP A;  2BBN A;  3BUO B;  1F8H A;  3BQ3 A;  4AOM A;  1OMV A;  2F33 A;  3SG6 A;  3TUY C;  2K7O A;  1K9P A;  3E3R A;  1N0Y A;  3IQO A;  4XJK B;  2MLE C;  4PE4 A;  1J7O A;  2KAY A;  2L50 A;  1WLZ A;  3OP0 A;  1QVI Z;  4PHK A;  4U8D A;  2FCE A;  2JXC A;  5KSZ A;  3SIB A;  1ODB A;  1RRO A;  1W7J B;  1WDC C;  2BE6 A;  1AJ4 A;  3RLZ A;  1KK8 B;  2F8P A;  3TS5 B;  1YVL A;  2KHN A;  2MA2 A;  4MRY A;  3I5H C;  1N2D A;  1UHH A;  1EJ3 A;  4GGF A;  1ALV A;  4MVF A;  2JRF A;  2LP2 A;  1NP8 A;  4C0L A;  3A8R A;  2K2F A;  1EL4 A;  2DOQ A;  4HRH A;  5BPJ A;  1NX3 A;  1YUT A;  3NXA A;  3PM8 A;  1K94 A;  1QAT A;  1ZMZ A;  1M46 A;  1IQ5 A;  2FJU B;  1S6J A;  4AQI A;  1TNP A;  1OOJ A;  1XFZ O;  1NIW A;  2BL0 B;  2LVK A;  1IGV A;  2HPS A;  2B1U A;  4NDB A;  2P6B B;  1CLL A;  5AXI A;  2ZRS A;  1MQ1 A;  1LXF C;  1JFK A;  1DJW A;  1Y6W A;  3BUX B;  3WXA A;  2WCB A;  4JQ0 D;  2R2I A;  1H8B A;  3F45 A;  2I7A A;  2JT3 A;  1ZOT B;  3EKJ A;  4DIR A;  4XJK A;  1S26 D;  1RK9 A;  2LM5 A;  2PAS A;  2WC8 A;  3BXK A;  3OX6 A;  1S6I A;  1DJI A;  1JUO A;  1UHI A;  2KAX A;  2OTG B;  2CNP A;  1RFJ A;  1KCY A;  4GGN A;  2KI4 C;  4MN0 A;  4CFR A;  1QV1 A;  1S36 A;  3KHE A;  1U5I B;  2KYC A;  4JPZ B;  2KYF A;  1OE9 B;  2OPO A;  1H4B A;  5GQQ C;  1K9K A;  4WQ2 A;  1TNQ A;  3EK4 A;  2GV5 A;  2JUL A;  2LVJ A;  2O5G A;  3FWC A;  4QJ4 B;  4ICB A;  1KSO A;  2MRD A;  5ER5 A;  2LMU A;  2JPT A;  1PUL A;  1CMF A;  1C07 A;  2KFH A;  5CSI A;  1F4Q A;  2LLS A;  1TTX A;  3PFV A;  4YRU A;  1JF0 A;  1CFF A;  1KSM A;  4N1F A;  1B8R A;  3CZT X;  2CBL A;  3NSI A;  5HKW A;  2WCF A;  5HYD A;  4M2O A;  1SR6 B;  4R1E A;  1SBJ A;  2L4H A;  3DF0 A;  1GGW A;  2LAN A;  3KO0 A;  4PCW A;  4OKH A;  4D1E A;  4ZCU A;  3I5F B;  2JXL A;  4M2P A;  3CLN A;  5AER A;  2K0J A;  1PSR A;  1G4Y R;  1J1E A;  3ZWH A;  1ALW A;  4P5O E;  1WRZ A;  2NCO A;  4I5J A;  1FPW A;  3QRX A;  5G08 A;  1L2O C;  2BE4 A;  2K2A A;  1LKJ A;  1TCF A;  1K95 A;  4OCI A;  2ZND A;  1QJT A;  3BUW B;  2K61 A;  3K21 A;  3M0W A;  1FBV A;  1AJ5 A;  2OS8 B;  4PHJ A;  3TDZ A;  3VRP A;  1WY9 A;  3AKA A;  1U5I A;  2BKH B;  1NYA A;  5DKQ A;  1OMR A;  1G33 A;  1SCV A;  1ZUZ A;  2KDH A;  2KSP A;  1PK0 D;  2Y1N A;  4WQ3 A;  5CSJ A;  1QX5 B;  2L0P A;  1BR4 B;  2HF5 A;  2AAO A;  3SIA A;  1S5G Z;  4AQJ A; 
#chains in the Genus database with same CATH topology
 1PVB A;  2L4I A;  1XA5 A;  2WOS A;  1G8I A;  2LHI A;  3AAJ A;  2WCK A;  3O4X A;  1AHR A;  4CLN A;  3PN7 B;  2M1U A;  2TN4 A;  1WDC B;  2JT8 A;  3CTN A;  1NCX A;  1OZS A;  1QV0 A;  3QME A;  4OR9 B;  5JOL A;  4DCK A;  1TOP A;  4XYN A;  1TNX A;  1EG3 A;  4NDC A;  1J7P A;  3C1V A;  2PYQ A;  3PLF B;  1BF5 A;  2PMY A;  2H8V A;  1J7R A;  1AVS A;  1Y1X A;  2EC6 C;  4Q04 A;  5KTY A;  3SG3 A;  4ORA B;  1LA3 A;  1KWO C;  2V53 A;  3D74 A;  4OV2 A;  1QAS A;  1YUU A;  2LCP A;  3I5G C;  4OZD A;  3GK1 A;  1B7T Z;  1KK7 Y;  2E30 A;  4BY5 A;  1UHN A;  1BLQ A;  1SY9 A;  5FYX A;  1LA0 A;  1C7V A;  1Q80 A;  2LV7 A;  1TIZ A;  4N5X A;  1YVH A;  2D8N A;  1E8A A;  4GBA A;  5AFP A;  5B8I B;  3EK8 A;  1QVI Y;  1YX7 A;  2O60 A;  2GGZ A;  2JTZ A;  2M3W A;  1KQM C;  2Y4Q A;  1BMO A;  1SCM C;  2PSR A;  3SG7 A;  1MUX A;  1OZO A;  1UP5 A;  1A29 A;  2F2P A;  5ER4 X;  1J55 A;  3L47 A;  3A4U B;  3O2P A;  3FS7 A;  1NUB A;  1SK6 D;  3HCM A;  3O4Y A;  2WC5 A;  4NQG A;  3S0E A;  1PRW A;  1IG5 A;  1GGZ A;  1V1G A;  1V1F A;  2WCE A;  3D75 A;  2I94 A;  3DF0 B;  1B47 A;  3EVU A;  2G9B A;  2MLF C;  1B4C A;  4DUQ A;  2LVI A;  3HX4 A;  3RZS A;  4WRI A;  2FCD A;  2WCJ A;  1QX2 A;  1BOD A;  1N65 A;  1YUR A;  2KQY A;  1UHK A;  1CM1 A;  1K96 A;  2M29 A;  1CB1 A;  1WRK A;  4C0J A;  2JC2 A;  1KK8 C;  2BCB A;  2JTT A;  3TS5 C;  2EGD A;  2L5X B;  5CSN A;  3WHT B;  3GOF A;  3I5I B;  1FI5 A;  1A2X A;  2HQ8 A;  2NLN A;  2KAV A;  3B7A A;  1UUR A;  2Q4U A;  3CAB A;  4INW A;  4PE1 A;  1LS8 A;  2JWW A;  2KGB C;  4F7F A;  1MR8 A;  3VRQ A;  1KQV A;  1K90 D;  4PDZ A;  2MJW B;  4YBH B;  2L51 A;  4GAO A;  2M1K B;  4I5L B;  3CZ2 A;  2YGU A;  4HRE E;  4GUK A;  3LLE A;  1M39 A;  2AMI A;  2H61 A;  1DGV A;  1SW8 A;  2BAP A;  2QDI A;  3EVV A;  5HL1 A;  1KFX L;  4YI8 A;  1IIO A;  2K7D A;  4DS7 A;  1IJ6 A;  2M8U A;  3CR4 X;  2L2E A;  4ORC B;  5DKN A;  3DYE A;  3NSK A;  2PAL A;  2BL0 C;  3RM1 A;  3WNX B;  2KI6 D;  2MBX A;  1K93 D;  1CTR A;  5FI2 A;  3EK7 A;  3UO9 A;  3LCP C;  2F3Z A;  1RWY A;  1F70 A;  5HKZ A;  1L7Z A;  4QJ3 B;  3VRO A;  1M31 A;  3NHI A;  1GJY A;  1RTP 1;  4I5N B;  1XK4 C;  1FF1 A;  3PJI A;  2RGI A;  3LL8 B;  3EVR A;  4GPL B;  3JVT B;  4A4C A;  5D69 A;  1GM0 A;  3KPX A;  1NPQ A;  4YGE B;  2JNX A;  2JOJ A;  3VRR A;  3N7H A;  1REC A;  2KBI A;  1UUS A;  1B8L A;  1MXE A;  2JZI A;  2ZN8 A;  1IH0 A;  1BU3 A;  1TUJ A;  2OTG C;  3B6X A;  1LIN A;  3NHT A;  3S0A A;  1SSE B;  2K7B A;  4ORB B;  1K2H A;  2LVV A;  1NX0 A;  3FIA A;  1RJV A;  4JWQ A;  1EG4 A;  3BJH A;  3L4L A;  4CPV A;  1XFR A;  5HKY A;  1DJX A;  2LUC A;  3BFA A;  4PT1 A;  1UHJ A;  3DVK A;  4NDD A;  1IKU A;  2LLT A;  2I18 A;  3SS3 A;  1HT9 A;  2SAS A;  1YR5 A;  1B9A A;  2JNF A;  2LUX A;  3VGO A;  2EHB A;  2WC6 A;  3CZ0 A;  1KFX S;  3VB1 A;  1WLM A;  3TZ1 A;  1C3Y A;  2CCM A;  2AUC A;  2HET A;  3DD4 A;  3ZNI A;  1BG1 A;  4M2Q A;  5D7F A;  1TCO B;  3TUY B;  4MBE A;  4YGB B;  5PAL A;  2BKI B;  3OB1 B;  3KF9 A;  1DEK A;  1DGU A;  1YUS A;  2G2B A;  1EH2 A;  5FI6 A;  1KWO B;  2WND A;  2FOT A;  4OVN F;  1SR6 C;  3I5G B;  4PHM A;  4JD9 A;  3BOW A;  1KFU S;  3B86 A;  1MWN A;  1DF0 B;  3R1O A;  3O78 A;  5AEQ A;  1R6P A;  1VRK A;  1MF8 B;  2IS9 A;  2BBM A;  3I5H B;  3IQQ A;  3I5F C;  1OOG A;  2M9G A;  1QIV A;  1BR1 B;  1XFY O;  2I2R E;  3D77 A;  1CFP A;  2F3Y A;  5HLO A;  4PAL A;  2KGR A;  1MXL C;  3H4S E;  1XFX O;  2F2O A;  2KFG A;  1TWO A;  2LMT A;  5D3O A;  4GGF C;  2K7C A;  1K8U A;  3L4A A;  3SG5 A;  1S6C A;  5CSF A;  1NX1 A;  1QX7 A;  1NCY A;  2Y1M A;  2OS8 C;  1KK7 Z;  4MZJ A;  1XVJ A;  4IJ7 A;  3SJS A;  1A03 A;  1ZFS A;  3CS1 A;  1B8C A;  3JTD B;  3OGN A;  4MZL A;  4FQT A;  1QLK A;  1B7T Y;  2GTE A;  2KNE A;  3O6B A;  3OB2 B;  2LNK A;  4GFT A;  3ICB A;  5AAN A;  2PVB A;  2ZFD A;  3JTD C;  2Y5I A;  3FE6 A;  1BJF A;  1R2U A;  1JSA A;  1C7W A;  2LE9 B;  1QTX A;  1SL7 A;  2P70 A;  3D76 A;  1XYD A;  3PN7 C;  5CPV A;  4C0K A;  1JFJ A;  1OMD A;  1F55 A;  1Y1A A;  5F6T A;  2KLD A;  1FW4 A;  1OOI X;  1NSH A;  1DQE A;  1Y1U A;  2NXQ A;  5JJG A;  1CKK A;  3K1E A;  1CFD A;  3OX5 A;  3DVE A;  1SKT A;  3GK4 X;  1F71 A;  1ZAC A;  1NWD A;  2LC5 A;  1DF0 A;  2BCX A;  3CR5 X;  2KI4 B;  2NCP A;  2JU0 A;  2L98 A;  1CDN A;  3D10 A;  4E68 A;  1AUI B;  5I2L A;  1XO5 A;  1YRT B;  1SMG A;  1AP4 A;  2BEC A;  3Q8I A;  2K8M B;  1DJY A;  2VRG A;  4YI9 A;  3WHU B;  4MLW A;  4P2Y B;  1PAL A;  1Z2C B;  5J3X A;  2H61 C;  1DTL A;  2COL B;  2LAP A;  3NSL A;  5TNC A;  3D0Y B;  4MEW A;  1XFU O;  3CWG A;  5KU1 A;  2E6W A;  2KPH A;  2LLU A;  2A4J A;  2GGM A;  3SG2 A;  3TDU A;  2KI6 C;  1P28 A;  2MHH A;  1CDL A;  1FI6 A;  1Z4H A;  2H2K A;  2SCP A;  1C3Z A;  3D73 A;  1XFW O;  1UWO A;  2WCH A;  2WOR A;  4IL1 A;  2JQ6 A;  4HSZ A;  4UPG A;  1W7I B;  1QS7 A;  3BYA A;  3BUN B;  2M7L A;  2QPT A;  1LVC D;  3LK0 A;  1TN4 A;  2KBM A;  1CLB A;  2FJY A;  2M7N A;  1JC2 A;  1DJZ A;  2ZRT A;  3DZT A;  3R1P A;  4N1G A;  3BOW B;  1DMO A;  2K60 A;  1J7Q A;  3DVJ A;  3CGA A;  3PSR A;  4PE0 A;  1F54 A;  1KFU L;  4INX A;  1DEL A;  1PSB A;  4PHN A;  1HQV A;  1YRU B;  1CDP A;  2JT0 A;  4TNC A;  1TUZ A;  1L2O B;  4L9M A;  1SL9 A;  3GK2 A;  2NZ0 A;  4YGD B;  3V2L A;  2ZNE A;  1F4O A;  1QIW A;  2LHL A;  1MHO A;  3CDN A;  4CID A;  3NGV A;  3I5I C;  3PAT A;  1D1O A;  1EXR A;  1CMG A;  2M49 B;  1GQM A;  4USL A;  1IRJ A;  1A75 B;  2KOT A;  3IVT A;  4YGA A;  1DT7 B;  2KQ6 A;  3UNW A;  5K89 A;  2QAC A;  1CM4 A;  1PVA A;  5IBW A;  3TDI A;  4MZK A;  2ZKM X;  1A4P A;  4BY4 A;  1BT6 A;  2PRU A;  2Q91 A;  2M0R A;  4HRG A;  1OOF A;  5DKR A;  4I5K A;  3OHM B;  5HLV A;  4A4B A;  4QJ5 B;  3BUM B;  3D0Y A;  3PAL A;  2ISD A;  3FE8 A;  1X02 A;  2CTN A;  1SL8 A;  2BCA A;  4PE7 A;  2L5Y A;  4ZCV A;  2LMV A;  1CLM A;  1ORG A;  1IJ5 A;  2KFF A;  4YGC B;  1BOC A;  1QLS A;  1YX8 A;  1XK4 A;  4DRW A;  2ERB A;  2CXJ A;  1W9Z A;  4ETO A;  2EC6 B;  4F0Z B;  1M63 B;  4CFQ A;  1NCZ A;  1CDM A;  1TRF A;  2M97 A;  3VRN A;  3CZ1 A;  3EKH A;  1JF2 A;  1M45 A;  1DVI A;  1SNL A;  3MSE B;  4MSP A;  1YTZ C;  2MAZ A;  3SG4 A;  3KEV A;  3JVT C;  1CNP A;  1NX2 A;  1OSA A;  2CT9 A;  4FTG A;  1IQ3 A;  1Y0V H;  1AK8 A;  3LK1 A;  1OW4 A;  3AAK A;  2HQW A;  4GNK B;  5I8N A;  2LP3 A;  1K9U A;  3AKB A;  1S3P A;  3DVM A;  5I2O A;  1S5G Y;  1SRA A;  3PM2 A;  3IF7 A;  1KQM B;  1S1E A;  3S0B A;  1DJH A;  1TNW A;  2L2C A;  1WRL A;  1B1G A;  1SCM B;  3NSO A;  5DIC A;  3FE9 A;  1JWD A;  1DJG A;  1SPY A;  1A75 A;  1IWQ A;  4MRX A;  1JBA A;  2KLE A;  3FWB A;  5I2Q A;  1J1D A;  1CFC A;  3CR2 A;  1SYM A;  4FQO A;  1XFV O;  2ZN9 A;  1OQP A;  1QXP A;  2BBN A;  3BUO B;  1F8H A;  3BQ3 A;  4AOM A;  1OMV A;  1QWV A;  2F33 A;  2JPO A;  3SG6 A;  3TUY C;  2K7O A;  1K9P A;  3E3R A;  1N0Y A;  3IQO A;  4XJK B;  2MLE C;  4PE4 A;  1J7O A;  2KAY A;  2L50 A;  1WLZ A;  3OP0 A;  1QVI Z;  4PHK A;  4U8D A;  2FCE A;  2JXC A;  5KSZ A;  3SIB A;  1ODB A;  1RRO A;  2P71 A;  1W7J B;  1WDC C;  2QEV A;  2BE6 A;  1AJ4 A;  3RLZ A;  1KK8 B;  2F8P A;  3TS5 B;  1YVL A;  2KHN A;  2MA2 A;  4MRY A;  3I5H C;  1N2D A;  1UHH A;  1EJ3 A;  4GGF A;  1ALV A;  4MVF A;  3BFB A;  1DC1 A;  2JRF A;  2LP2 A;  1NP8 A;  4C0L A;  3A8R A;  2K2F A;  1EL4 A;  2DOQ A;  4HRH A;  5BPJ A;  1NX3 A;  5I94 A;  1YUT A;  3NXA A;  1T14 A;  3PM8 A;  3S0D A;  1K94 A;  1QAT A;  1ZMZ A;  1M46 A;  1IQ5 A;  3D78 A;  2FJU B;  1S6J A;  4AQI A;  2WCL A;  1TNP A;  1OOJ A;  1XFZ O;  1NIW A;  2BL0 B;  3DXL A;  4KYN A;  2LVK A;  1IGV A;  2HPS A;  2B1U A;  4NDB A;  2P6B B;  3EG5 B;  3B87 A;  1CLL A;  5AXI A;  2ZRS A;  1MQ1 A;  3DY9 A;  1LXF C;  3CYZ A;  1JFK A;  1DJW A;  1Y6W A;  3BUX B;  3WXA A;  2WCB A;  4JQ0 D;  2R2I A;  1H8B A;  3F45 A;  2I7A A;  2QEB A;  2JT3 A;  1ZOT B;  3EKJ A;  4DIR A;  4XJK A;  1S26 D;  1RK9 A;  2LM5 A;  2PAS A;  2WC8 A;  3BXK A;  3OX6 A;  1S6I A;  3SS5 A;  1DJI A;  1JUO A;  1UHI A;  2KAX A;  2OTG B;  2CNP A;  1RFJ A;  1KCY A;  4GGN A;  2KI4 C;  4MN0 A;  4CFR A;  1QV1 A;  1S36 A;  3KHE A;  1U5I B;  2KYC A;  4JPZ B;  2KYF A;  5EL2 A;  1OE9 B;  2OPO A;  4JKT A;  2QEO A;  1H4B A;  5GQQ C;  3BFH A;  1K9K A;  4WQ2 A;  2BNX A;  1TNQ A;  3EK4 A;  2GV5 A;  2JUL A;  2LVJ A;  2O5G A;  3FWC A;  4QJ4 B;  4ICB A;  1KSO A;  2MRD A;  2PQL A;  2LMU A;  2QEH A;  5ER5 A;  2JPT A;  1PUL A;  1CMF A;  1C07 A;  2KFH A;  3SS4 A;  5CSI A;  1F4Q A;  2LLS A;  1TTX A;  3PFV A;  4YRU A;  1JF0 A;  1CFF A;  1KSM A;  4N1F A;  1B8R A;  3CZT X;  2CBL A;  3NSI A;  5HKW A;  2WCF A;  5HYD A;  4M2O A;  1SR6 B;  3R1V A;  4R1E A;  1SBJ A;  2L4H A;  3DF0 A;  1GGW A;  2LAN A;  3S0F A;  3KO0 A;  4PCW A;  4OKH A;  4D1E A;  4ZCU A;  3I5F B;  2JXL A;  4M2P A;  3CLN A;  5AER A;  2K0J A;  1PSR A;  1G4Y R;  1J1E A;  3ZWH A;  3S0G A;  1ALW A;  4P5O E;  1WRZ A;  2NCO A;  4I5J A;  1FPW A;  1OOH A;  3QRX A;  5G08 A;  1L2O C;  3B88 A;  2BE4 A;  2K2A A;  1LKJ A;  1TCF A;  3OBV A;  1K95 A;  4OCI A;  2ZND A;  1QJT A;  3BUW B;  2K61 A;  3K21 A;  3M0W A;  1FBV A;  1AJ5 A;  2OS8 B;  4PHJ A;  3TDZ A;  3VRP A;  3R72 A;  1WY9 A;  3AKA A;  1U5I A;  2BKH B;  2WCM A;  1NYA A;  5DKQ A;  1OMR A;  1G33 A;  1SCV A;  1ZUZ A;  2KDH A;  2KSP A;  1PK0 D;  2Y1N A;  4WQ3 A;  5CSJ A;  1QX5 B;  2L0P A;  1BR4 B;  2HF5 A;  5FI7 A;  2AAO A;  3SIA A;  1S5G Z;  4AQJ A; 
#chains in the Genus database with same CATH homology
 1PVB A;  2L4I A;  1XA5 A;  2WOS A;  1G8I A;  2LHI A;  3AAJ A;  4CLN A;  1AHR A;  3PN7 B;  2M1U A;  2TN4 A;  1WDC B;  2JT8 A;  3CTN A;  1NCX A;  1OZS A;  1QV0 A;  4OR9 B;  5JOL A;  4DCK A;  1TOP A;  4XYN A;  1TNX A;  1EG3 A;  4NDC A;  1J7P A;  3C1V A;  3PLF B;  1BF5 A;  2PMY A;  1J7R A;  1AVS A;  1Y1X A;  2EC6 C;  4Q04 A;  5KTY A;  3SG3 A;  4ORA B;  1LA3 A;  1KWO C;  2V53 A;  4OV2 A;  1QAS A;  1YUU A;  2LCP A;  3I5G C;  3GK1 A;  1B7T Z;  1KK7 Y;  2E30 A;  4BY5 A;  1UHN A;  1BLQ A;  1SY9 A;  5FYX A;  1LA0 A;  1C7V A;  1Q80 A;  2LV7 A;  1TIZ A;  4N5X A;  1YVH A;  2D8N A;  1E8A A;  4GBA A;  5AFP A;  5B8I B;  3EK8 A;  1QVI Y;  1YX7 A;  2O60 A;  2GGZ A;  2JTZ A;  2M3W A;  1KQM C;  2Y4Q A;  1BMO A;  1SCM C;  2PSR A;  3SG7 A;  1MUX A;  1OZO A;  1UP5 A;  1A29 A;  2F2P A;  5ER4 X;  1J55 A;  3A4U B;  3O2P A;  3FS7 A;  1NUB A;  1SK6 D;  3HCM A;  3O4Y A;  4NQG A;  1PRW A;  1IG5 A;  1GGZ A;  1V1G A;  1V1F A;  2WCE A;  2I94 A;  3DF0 B;  1B47 A;  3EVU A;  2G9B A;  2MLF C;  1B4C A;  4DUQ A;  2LVI A;  3HX4 A;  4WRI A;  2FCD A;  1QX2 A;  1BOD A;  1N65 A;  1YUR A;  2KQY A;  1UHK A;  1CM1 A;  1K96 A;  2M29 A;  1CB1 A;  1WRK A;  4C0J A;  2JC2 A;  1KK8 C;  2BCB A;  2JTT A;  3TS5 C;  2EGD A;  2L5X B;  5CSN A;  3WHT B;  3GOF A;  3I5I B;  1FI5 A;  1A2X A;  2HQ8 A;  2NLN A;  2KAV A;  1UUR A;  2Q4U A;  4PE1 A;  2KGB C;  2JWW A;  1MR8 A;  3VRQ A;  1KQV A;  1K90 D;  4PDZ A;  2MJW B;  4YBH B;  2L51 A;  4GAO A;  2M1K B;  4I5L B;  4HRE E;  4GUK A;  3LLE A;  1M39 A;  2AMI A;  2H61 A;  1DGV A;  1SW8 A;  3EVV A;  1KFX L;  4YI8 A;  2K7D A;  4DS7 A;  1IJ6 A;  2M8U A;  3CR4 X;  2L2E A;  4ORC B;  5DKN A;  3NSK A;  2PAL A;  2BL0 C;  3RM1 A;  3WNX B;  2KI6 D;  2MBX A;  1K93 D;  1CTR A;  3EK7 A;  3LCP C;  2F3Z A;  1RWY A;  1F70 A;  5HKZ A;  1L7Z A;  4QJ3 B;  3VRO A;  1M31 A;  1GJY A;  1RTP 1;  4I5N B;  1XK4 C;  1FF1 A;  2RGI A;  3LL8 B;  3EVR A;  4GPL B;  3JVT B;  4A4C A;  5D69 A;  3KPX A;  1NPQ A;  4YGE B;  2JNX A;  2JOJ A;  3VRR A;  1REC A;  2KBI A;  1UUS A;  1B8L A;  1MXE A;  2JZI A;  2ZN8 A;  1IH0 A;  1BU3 A;  2OTG C;  1LIN A;  2K7B A;  4ORB B;  1K2H A;  2LVV A;  1NX0 A;  3FIA A;  1RJV A;  4JWQ A;  1EG4 A;  4CPV A;  5HKY A;  1DJX A;  2LUC A;  1IKU A;  1UHJ A;  3DVK A;  4NDD A;  2LLT A;  2I18 A;  1HT9 A;  2SAS A;  1YR5 A;  1B9A A;  2JNF A;  2LUX A;  3VGO A;  2EHB A;  1KFX S;  1WLM A;  3TZ1 A;  2CCM A;  2AUC A;  2HET A;  3DD4 A;  3ZNI A;  1BG1 A;  4M2Q A;  5D7F A;  1TCO B;  3TUY B;  4MBE A;  4YGB B;  5PAL A;  2BKI B;  3OB1 B;  3KF9 A;  1DGU A;  2G2B A;  1YUS A;  1EH2 A;  1KWO B;  2WND A;  2FOT A;  4OVN F;  1SR6 C;  3I5G B;  4PHM A;  3BOW A;  1KFU S;  5AEQ A;  1MWN A;  1DF0 B;  3O78 A;  1R6P A;  1VRK A;  1MF8 B;  2IS9 A;  2BBM A;  3I5H B;  3IQQ A;  3I5F C;  2M9G A;  1QIV A;  1BR1 B;  1XFY O;  2I2R E;  1CFP A;  2F3Y A;  5HLO A;  4PAL A;  2KGR A;  1MXL C;  3H4S E;  1XFX O;  2F2O A;  2KFG A;  2LMT A;  4GGF C;  2K7C A;  1K8U A;  3SG5 A;  1S6C A;  5CSF A;  1NX1 A;  1QX7 A;  1NCY A;  2Y1M A;  2OS8 C;  1KK7 Z;  4MZJ A;  1XVJ A;  3SJS A;  1A03 A;  1ZFS A;  3CS1 A;  1B8C A;  3JTD B;  4MZL A;  1QLK A;  1B7T Y;  2KNE A;  3OB2 B;  3O6B A;  4GFT A;  2LNK A;  3ICB A;  5AAN A;  2PVB A;  2ZFD A;  3JTD C;  2Y5I A;  1BJF A;  1R2U A;  1JSA A;  1C7W A;  2LE9 B;  1QTX A;  1SL7 A;  3PN7 C;  1JFJ A;  1XYD A;  5CPV A;  4C0K A;  1OMD A;  1F55 A;  1Y1A A;  5F6T A;  1FW4 A;  1NSH A;  2NXQ A;  1Y1U A;  5JJG A;  1CKK A;  1CFD A;  3OX5 A;  3DVE A;  1SKT A;  3GK4 X;  1F71 A;  1ZAC A;  1NWD A;  2LC5 A;  1DF0 A;  2BCX A;  3CR5 X;  2KI4 B;  2NCP A;  2JU0 A;  2L98 A;  1CDN A;  3D10 A;  4E68 A;  1AUI B;  5I2L A;  1XO5 A;  1YRT B;  1SMG A;  1AP4 A;  2BEC A;  2K8M B;  1DJY A;  2VRG A;  4YI9 A;  3WHU B;  4MLW A;  4P2Y B;  1PAL A;  5J3X A;  2H61 C;  1DTL A;  2COL B;  2LAP A;  3NSL A;  5TNC A;  3D0Y B;  4MEW A;  1XFU O;  3CWG A;  5KU1 A;  2E6W A;  2LLU A;  2A4J A;  2GGM A;  3SG2 A;  3TDU A;  2KI6 C;  2MHH A;  1CDL A;  1FI6 A;  2H2K A;  2SCP A;  1XFW O;  1UWO A;  2WOR A;  4IL1 A;  2JQ6 A;  4HSZ A;  4UPG A;  1W7I B;  1QS7 A;  3BYA A;  3BUN B;  2M7L A;  2QPT A;  1LVC D;  3LK0 A;  1TN4 A;  2KBM A;  1CLB A;  2M7N A;  1JC2 A;  1DJZ A;  2ZRT A;  4N1G A;  3BOW B;  1DMO A;  1J7Q A;  3DVJ A;  3CGA A;  3PSR A;  4PE0 A;  1F54 A;  1KFU L;  1PSB A;  4PHN A;  1HQV A;  1YRU B;  1CDP A;  2JT0 A;  4TNC A;  1L2O B;  4L9M A;  1SL9 A;  3GK2 A;  2NZ0 A;  4YGD B;  2ZNE A;  1F4O A;  1QIW A;  2LHL A;  1MHO A;  4CID A;  3I5I C;  3PAT A;  1D1O A;  1EXR A;  1CMG A;  2M49 B;  1GQM A;  4USL A;  1IRJ A;  1A75 B;  2KOT A;  4YGA A;  1DT7 B;  2KQ6 A;  5K89 A;  2QAC A;  1CM4 A;  1PVA A;  5IBW A;  3TDI A;  4MZK A;  2ZKM X;  1A4P A;  4BY4 A;  1BT6 A;  2PRU A;  2Q91 A;  2M0R A;  4HRG A;  5DKR A;  4I5K A;  3OHM B;  5HLV A;  4A4B A;  4QJ5 B;  3BUM B;  3D0Y A;  3PAL A;  2ISD A;  1X02 A;  2CTN A;  1SL8 A;  2BCA A;  4PE7 A;  4ZCV A;  2LMV A;  1CLM A;  1IJ5 A;  2KFF A;  4YGC B;  1BOC A;  1QLS A;  1YX8 A;  1XK4 A;  4DRW A;  2CXJ A;  4ETO A;  2EC6 B;  4F0Z B;  1M63 B;  4CFQ A;  1NCZ A;  1CDM A;  1TRF A;  2M97 A;  3VRN A;  3EKH A;  1JF2 A;  1M45 A;  1DVI A;  1SNL A;  3MSE B;  4MSP A;  1YTZ C;  2MAZ A;  3SG4 A;  3KEV A;  3JVT C;  1CNP A;  1NX2 A;  1OSA A;  2CT9 A;  4FTG A;  1IQ3 A;  1Y0V H;  1AK8 A;  3LK1 A;  3AAK A;  2HQW A;  4GNK B;  5I8N A;  2LP3 A;  1K9U A;  3AKB A;  1S3P A;  3DVM A;  5I2O A;  1S5G Y;  1SRA A;  3IF7 A;  1KQM B;  1S1E A;  1DJH A;  1TNW A;  1B1G A;  1WRL A;  1SCM B;  3NSO A;  1JWD A;  1DJG A;  1SPY A;  1A75 A;  1IWQ A;  4MRX A;  1JBA A;  3FWB A;  5I2Q A;  1J1D A;  1CFC A;  3CR2 A;  1SYM A;  4FQO A;  1XFV O;  2ZN9 A;  1OQP A;  1QXP A;  2BBN A;  3BUO B;  1F8H A;  3BQ3 A;  4AOM A;  1OMV A;  2F33 A;  3SG6 A;  3TUY C;  2K7O A;  1K9P A;  3E3R A;  1N0Y A;  3IQO A;  4XJK B;  2MLE C;  4PE4 A;  1J7O A;  2KAY A;  2L50 A;  1WLZ A;  3OP0 A;  1QVI Z;  4PHK A;  4U8D A;  2FCE A;  2JXC A;  5KSZ A;  3SIB A;  1ODB A;  1RRO A;  1W7J B;  1WDC C;  2BE6 A;  1AJ4 A;  3RLZ A;  1KK8 B;  2F8P A;  3TS5 B;  1YVL A;  2KHN A;  2MA2 A;  4MRY A;  3I5H C;  1N2D A;  1UHH A;  1EJ3 A;  4GGF A;  1ALV A;  4MVF A;  2JRF A;  2LP2 A;  1NP8 A;  4C0L A;  3A8R A;  2K2F A;  1EL4 A;  2DOQ A;  4HRH A;  5BPJ A;  1NX3 A;  1YUT A;  3NXA A;  3PM8 A;  1K94 A;  1QAT A;  1ZMZ A;  1M46 A;  1IQ5 A;  2FJU B;  1S6J A;  4AQI A;  1TNP A;  1OOJ A;  1XFZ O;  1NIW A;  2BL0 B;  2LVK A;  1IGV A;  2HPS A;  2B1U A;  4NDB A;  2P6B B;  1CLL A;  5AXI A;  2ZRS A;  1MQ1 A;  1LXF C;  1JFK A;  1DJW A;  1Y6W A;  3BUX B;  3WXA A;  2WCB A;  4JQ0 D;  2R2I A;  1H8B A;  3F45 A;  2I7A A;  2JT3 A;  1ZOT B;  3EKJ A;  4DIR A;  4XJK A;  1S26 D;  1RK9 A;  2LM5 A;  2PAS A;  2WC8 A;  3BXK A;  3OX6 A;  1S6I A;  1DJI A;  1JUO A;  1UHI A;  2KAX A;  2OTG B;  2CNP A;  1RFJ A;  1KCY A;  4GGN A;  2KI4 C;  4MN0 A;  4CFR A;  1QV1 A;  1S36 A;  3KHE A;  1U5I B;  2KYC A;  4JPZ B;  2KYF A;  1OE9 B;  2OPO A;  1H4B A;  5GQQ C;  1K9K A;  4WQ2 A;  1TNQ A;  3EK4 A;  2GV5 A;  2JUL A;  2LVJ A;  2O5G A;  3FWC A;  4QJ4 B;  4ICB A;  1KSO A;  2MRD A;  5ER5 A;  2LMU A;  2JPT A;  1PUL A;  1CMF A;  1C07 A;  2KFH A;  5CSI A;  1F4Q A;  2LLS A;  1TTX A;  3PFV A;  4YRU A;  1JF0 A;  1CFF A;  1KSM A;  4N1F A;  1B8R A;  3CZT X;  2CBL A;  3NSI A;  5HKW A;  2WCF A;  5HYD A;  4M2O A;  1SR6 B;  4R1E A;  1SBJ A;  2L4H A;  3DF0 A;  1GGW A;  2LAN A;  3KO0 A;  4PCW A;  4OKH A;  4D1E A;  4ZCU A;  3I5F B;  2JXL A;  4M2P A;  3CLN A;  5AER A;  2K0J A;  1PSR A;  1G4Y R;  1J1E A;  3ZWH A;  1ALW A;  4P5O E;  1WRZ A;  2NCO A;  4I5J A;  1FPW A;  3QRX A;  5G08 A;  1L2O C;  2BE4 A;  2K2A A;  1LKJ A;  1TCF A;  1K95 A;  4OCI A;  2ZND A;  1QJT A;  3BUW B;  2K61 A;  3K21 A;  3M0W A;  1FBV A;  1AJ5 A;  2OS8 B;  4PHJ A;  3TDZ A;  3VRP A;  1WY9 A;  3AKA A;  1U5I A;  2BKH B;  1NYA A;  5DKQ A;  1OMR A;  1G33 A;  1SCV A;  1ZUZ A;  2KDH A;  2KSP A;  1PK0 D;  2Y1N A;  4WQ3 A;  5CSJ A;  1QX5 B;  2L0P A;  1BR4 B;  2HF5 A;  2AAO A;  3SIA A;  1S5G Z;  4AQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...