2NCPA

Nmr solution structure for the c-terminal domain of tetrahymena tcb2 in the presence of calcium
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
SSKPKYNPEVEAKLDVARRLFKRYDKDGSGQLQDDEIAGLLKDTYAEMGMSNFTPTKEDVKIWLQMADTNSDGSVSLEEYEDLIIKSLQKAGIRVEKQSLVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords 25 kDa calcium-binding protein
publication title Solution NMR structures of the C-domain of Tetrahymena cytoskeletal protein Tcb2 reveal distinct calcium-induced structural rearrangements.
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ncpA00
1DTLA 1N65A 1LA0A 3CZTX 4DCKA 1BODA 1TNXA 4GFTA 1QVIY 1S6JA 3TDZA 1SNLA 1MHOA 5CSNA 5PALA 1DJZA 2AMIA 1WRLA 2KAVA 4ORAB 3TZ1A 1SL7A 4CPVA 1ODBA 1KWOC 5AANA 3IF7A 1KCYA 4WQ3A 1WDCB 2K7DA 3PATA 4YGCB 4ZCUA 1PVBA 2L51A 2WNDA 3CR5X 4GPLB 1TN4A 2WOSA 2CCMA 2JTTA 1XVJA 1CLMA 1LVCD 1QASA 1TCOB 3EKJA 2L2EA 2EC6B 1SPYA 2LP2A 5DKRA 1QLKA 4C0LA 4MRYA 1AJ5A 5G08A 1KK8B 1A2XA 2JRFA 2MJWB 3DF0A 4OR9B 1MR8A 2KNEA 2KI6C 3KHEA 1UP5A 1YURA 4ICBA 5HKZA 2GGMA 2OS8C 1KK7Z 1IQ5A 3I5FB 2JNXA 1KFXL 2CNPA 4HRHA 3KEVA 3BUMB 4CFRA 3IQQA 2I18A 2HQWA 2WCBA 1RJVA 2JTZA 1AP4A 2LVJA 1AJ4A 1MWNA 3D0YB 1KSOA 3NSKA 1EXRA 1MXEA 4YRUA 2IS9A 3BOWA 2PVBA 1NYAA 1FW4A 4MVFA 2LVVA 1M39A 4PE1A 3PSRA 2F3YA 1OMDA 1NX3A 2KYCA 2E30A 1Y6WA 2CT9A 5BPJA 1DF0A 1SY9A 2A4JA 1KQMC 3AKAA 1DJYA 2H2KA 2O60A 1EJ3A 1RK9A 2KFHA 2F2OA 5AEQA 4MZLA 3I5HC 3SJSA 4PDZA 1AUIB 1DJXA 1TTXA 3EVRA 4XJKA 4I5NB 1CDNA 5KTYA 3I5GC 1W7IB 2K0JA 1PK0D 1IQ3A 1OE9B 1OSAA 4PE7A 1G8IA 1YR5A 2SCPA 2CXJA 3BUOB 1M46A 1ZFSA 1TCFA 1B1GA 1FI5A 1UWOA 4TNCA 5ER4X 1TRFA 1BOCA 3PN7C 3DVEA 2JQ6A 1KSMA 2LLSA 1K93D 2LAPA 3SG3A 2LUXA 1LA3A 5IBWA 2WC8A 1DGUA 1MF8B 1WRKA 1ZOTB 1YVLA 4P2YB 5GQQC 3TDIA 1WDCC 2JPTA 1B7TZ 4GGFA 4GGFC 1JFJA 2JT8A 3VRRA 2LMTA 5DKQA 1QV0A 2FOTA 2M9GA 1WRZA 1WY9A 1PSBA 1QATA 1JF2A 1S3PA 1SRAA 1NCYA 5FYXA 1RROA 4WQ2A 4HRGA 2M0RA 4PE4A 2LLUA 3ICBA 2EC6C 2F8PA 3WNXB 1FBVA 2K2FA 1QIVA 1Y1UA 2JNFA 1BR4B 1NSHA 1KK8C 2Y1NA 1DF0B 4C0KA 2I94A 2PALA 4MBEA 1B9AA 1KQMB 2F33A 2KGBC 1EL4A 1CNPA 4I5JA 1U5IB 1GGWA 3I5FC 4XJKB 1IGVA 1K2HA 4A4CA 1R6PA 1S5GZ 4I5LB 4AQJA 2ZRSA 1BLQA 1RWYA 4OKHA 1CDLA 1KFXS 2KFGA 3AAJA 1BU3A 4M2OA 1IRJA 2JT0A 1UHJA 1QX7A 2I2RE 2M97A 4GUKA 1J7OA 3PN7B 4PE0A 3LLEA 4MN0A 1QXPA 3PLFB 1DJGA 1B47A 1L7ZA 2H61A 2H61C 1K9PA 1QTXA 1ZUZA 1C7WA 2JXCA 1TOPA 3SG7A 1NIWA 2G9BA 2K2AA 3TUYB 2LVIA 4MZKA 1CLLA 3CR4X 1DGVA 4ORCB 2ZRTA 4ZCVA 3M0WA 2AUCA 2Q4UA 4A4BA 2JC2A 1N2DA 1ZACA 2M7NA 1S26D 4N1FA 1NX2A 3O2PA 4AOMA 1CFPA 2LM5A 3EVVA 2KHNA 5J3XA 1Q80A 4QJ3B 1B4CA 1YX8A 4YI8A 1HT9A 1SR6B 3TS5B 2LLTA 3DVJA 2QPTA 1Y1AA 1CFFA 2F2PA 1IJ5A 1YX7A 2LMVA 4HSZA 3NSLA 2ISDA 3HCMA 2KBIA 2G2BA 1ALVA 1ZMZA 1Y0VH 2KBMA 3A4UB 2ZN8A 1OZSA 1CM1A 1XFVO 2OTGB 1A4PA 1DJWA 4BY5A 2K7CA 2PSRA 5K89A 1DVIA 3QRXA 3DVKA 1F4OA 2JZIA 3BUXB 1TNWA 3LCPC 5KU1A 2LHIA 5CSFA 1W7JB 2BE6A 1YRUB 3H4SE 4IL1A 5JJGA 3OB1B 5KSZA 1XFYO 4YGDB 3WHTB 4BY4A 3NSOA 3KF9A 3I5IB 1NPQA 1JWDA 1QLSA 1OOJA 1VRKA 4E68A 2GGZA 1TIZA 2KSPA 1ALWA 1KFUL 1K9UA 2LANA 4OCIA 3EK4A 5D69A 4JWQA 5I2QA 2D8NA 4DS7A 5I8NA 2DOQA 3O6BA 1QIWA 1B8RA 1CDPA 1JBAA 1CKKA 1SL9A 1U5IA 1NWDA 2KQ6A 1AVSA 4PHJA 1EG3A 4PHMA 2NCOA 1IG5A 4YGBB 4N5XA 1QVIZ 1S6IA 4NQGA 4YGEB 1KQVA 1OQPA 4MZJA 2MLEC 2M29A 5I2OA 3C1VA 5B8IB 1S6CA 1DJIA 3SG4A 1HQVA 1OMRA 2Q91A 1K94A 4PHNA 2L5XB 5CPVA 1XFXO 2JT3A 1DMOA 4XYNA 3BQ3A 3ZNIA 2I7AA 1A29A 1F71A 1J55A 1L2OB 3TUYC 2HETA 1CTRA 1JUOA 2BCXA 1NX1A 3CWGA 3EK7A 1XO5A 5AXIA 4FTGA 5ER5A 4AQIA 3SG2A 2JWWA 1YUUA 4CFQA 2F3ZA 1CFCA 1MXLC 2WCFA 3VRNA 1AK8A 4R1EA 3CS1A 3TDUA 2MHHA 4PALA 1RTP1 3SIAA 2BCAA 3O4YA 3FWBA 1PSRA 5I2LA 1CM4A 1DT7B 4PCWA 3FS7A 4D1EA 4YBHB 4YI9A 4JQ0D 1BJFA 2P6BB 2LC5A 1IWQA 1CLBA 3PFVA 1IKUA 1SR6C 3TS5C 1R2UA 2L0PA 1LXFC 1RECA 1SK6D 1Y1XA 4N1GA 2LCPA 2OTGC 1KK7Y 4HREE 3SG5A 3EVUA 3JTDB 2LV7A 3DD4A 1LKJA 1F4QA 1SCVA 2WORA 4DUQA 3VRPA 5HKYA 1H8BA 2BECA 3OX5A 4UPGA 1YUSA 2ZKMX 1YTZC 3WHUB 1M31A 3I5IC 2NLNA 4MLWA 1F8HA 2LHLA 2M3WA 5AFPA 3CLNA 2R2IA 1UHNA 2PMYA 1SW8A 4GAOA 3LL8B 1F55A 2KOTA 2B1UA 3OX6A 2L4HA 1M45A 2KQYA 1B8LA 2KDHA 5HKWA 4GBAA 1C7VA 2CTNA 2NXQA 1K90D 1NCZA 1K96A 3E3RA 2ZFDA 1D1OA 3OB2B 4NDBA 4P5OE 2QACA 1MUXA 4OV2A 2RGIA 1A75B 4Q04A 1SYMA 3MSEB 2ZNDA 4MRXA 1OZOA 2Y5IA 1UHKA 1PALA 3DVMA 3KO0A 4M2PA 3NSIA 3BXKA 4MEWA 1SCMC 3EK8A 1QS7A 1CMGA 1BR1B 5TNCA 2JU0A 1L2OC 1BG1A 1F70A 1AHRA 2Y4QA 2KI6D 3PM8A 3CGAA 1QX5B 5DKNA 1PULA 1J1EA 1M63B 2TN4A 2CBLA 4QJ5B 1B7TY 2MLFC 3GK1A 4M2QA 3FIAA 4F0ZB 2K7OA 3AAKA 1E8AA 2KGRA 3CR2A 4C0JA 1GJYA 1EG4A 2BKIB 1EH2A 3PALA 1LINA 3JVTB 4GGNA 4CLNA 3BUWB 1J7PA 2K7BA 1NCXA 2BL0B 1X02A 3BYAA 2HPSA 1JC2A 1G4YR 1PRWA 3SIBA 1OMVA 2LP3A 3LK0A 4MSPA 2V53A 1SL8A 1IH0A 5HYDA 5JOLA 4ETOA 1UHIA 1UUSA 3A8RA 1S36A 3F45A 2LVKA 3JTDC 1S5GY 4CIDA 2BCBA 1YRTB 2KI4C 1SBJA 2L98A 3OHMB 4OVNF 5HLVA 2MRDA 3D10A 1IJ6A 1UURA 1A03A 1YVHA 2JOJA 2LMUA 1C07A 1JSAA 2OPOA 1FI6A 2M7LA 1KWOB 4GNKB 1WLZA 4DRWA 1XA5A 1QJTA 2HF5A 2WCEA 1NUBA 2KAYA 1QX2A 1SCMB 3RM1A 1CB1A 1S1EA 5CSJA 3WXAA 2E6WA 3EKHA 1F54A 1V1GA 3RLZA 1CFDA 1BT6A 2M1UA 2O5GA 1J1DA 3O78A 1JFKA 2EGDA 4DIRA 1GQMA 1YUTA 2L4IA 4USLA 1B8CA 2GV5A 2ZN9A 1V1FA 1FPWA 1SKTA 3GK2A 2MA2A 2BE4A 1JF0A 3VGOA 1TNPA 1XFWO 2FJUB 4FQOA 5HLOA 4WRIA 2KFFA 4NDCA 1XFUO 2LNKA 2NZ0A 3KPXA 2HQ8A 1XFZO 3BUNB 1A75A 1PVAA 2FCEA 2K61A 2NCPA 3DF0B 1WLMA 3K21A 5CSIA 5AERA 2K8MB 2OS8B 3FWCA 1BF5A 1H4BA 1MQ1A 2BBMA 2AAOA 1DJHA 2EHBA 3OP0A 2Y1MA 3GK4X 1K9KA 1NP8A 1XYDA 1K8UA 2JULA 2BBNA 2FCDA 2KYFA 3VROA 2KAXA 3IQOA 3NXAA 4JPZB 2PRUA 2PASA 4ORBB 1RFJA 3AKBA 1QV1A 3VRQA 1GGZA 3HX4A 1G33A 4PHKA 3BOWB 4U8DA 4L9MA 2COLB 2KI4B 1XK4A 1XK4C 2MAZA 2SASA 3ZWHA 1K95A 3SG6A 1UHHA 3LK1A 1CDMA 1NX0A 2L50A 1J7RA 1SMGA 2ZNEA 4I5KA 4QJ4B 2LUCA 2M8UA 3I5HB 2LE9B 3JVTC 5F6TA 1N0YA 3CTNA 1CMFA 3I5GB 1FF1A 4NDDA 2VRGA 3GOFA 1KFUS 2BL0C 2MBXA 1J7QA 2M49B 2JXLA 2M1KB 1TNQA 2BKHB 1BMOA 4YGAA 5D7FA 3D0YA
chains in the Genus database with same CATH superfamily
1DTLA 1N65A 1LA0A 3CZTX 4DCKA 1BODA 1TNXA 4GFTA 1QVIY 1S6JA 2WCJA 3TDZA 1SNLA 1MHOA 5CSNA 5PALA 1DJZA 2AMIA 1WRLA 2KAVA 4ORAB 3TZ1A 1SL7A 4CPVA 1ODBA 1KWOC 5AANA 1OOFA 3IF7A 4WQ3A 1WDCB 2K7DA 4JKTA 1KCYA 3PATA 4YGCB 4ZCUA 1PVBA 2L51A 2L2CA 2WNDA 3CR5X 5HLVA 4GPLB 1TN4A 2WOSA 2CCMA 2JTTA 1DELA 1XVJA 1CLMA 1LVCD 1QASA 1TCOB 3R1VA 3B86A 3EKJA 2L2EA 2EC6B 1SPYA 2LP2A 5DKRA 1OW4A 1QLKA 3CDNA 4C0LA 2WCLA 4MRYA 1AJ5A 5G08A 1KK8B 1A2XA 2JRFA 2MJWB 3DF0A 4OR9B 1MR8A 2KNEA 2KI6C 3EG5B 3KHEA 1TUJA 1UP5A 1YURA 4ICBA 5HKZA 2GGMA 2OS8C 1KK7Z 1IQ5A 3I5FB 2JNXA 1KFXL 2CNPA 4HRHA 3KEVA 5HL1A 3BUMB 4CFRA 3IQQA 3BFHA 2I18A 5FI7A 4JD9A 2HQWA 2WCBA 3SS5A 1RJVA 2JTZA 1AP4A 2LVJA 1AJ4A 3S0BA 1MWNA 3D0YB 1KSOA 3NSKA 1EXRA 1MXEA 4YRUA 2IS9A 3BOWA 3B87A 2PVBA 1NYAA 1FW4A 4MVFA 2LVVA 1M39A 4PE1A 2KPHA 3PSRA 2F3YA 1OMDA 1NX3A 2KYCA 2E30A 3D78A 1Y6WA 2CT9A 5BPJA 1DF0A 1SY9A 2A4JA 1KQMC 3AKAA 1DJYA 2H2KA 2O60A 1EJ3A 3D77A 1RK9A 2KFHA 2F2OA 5AEQA 4MZLA 3I5HC 3SJSA 4PDZA 1AUIB 1DJXA 1TTXA 3EVRA 4XJKA 4I5NB 1CDNA 4OZDA 3I5GC 5KTYA 1QWVA 1W7IB 3K1EA 2K0JA 1PK0D 1IQ3A 3VB1A 1OE9B 1OSAA 4PE7A 1G8IA 1YR5A 2SCPA 2CXJA 3BUOB 1M46A 1ZFSA 5FI2A 1TCFA 1B1GA 1ORGA 3DZTA 1UWOA 2PQLA 4TNCA 1TRFA 5ER4X 1BOCA 3PN7C 1FI5A 1OOGA 3DVEA 2JQ6A 2JPOA 3O4XA 1KSMA 2LLSA 1K93D 2LAPA 3PM2A 2ERBA 3SG3A 2LUXA 1LA3A 5IBWA 2WC8A 1DGUA 1MF8B 1WRKA 1ZOTB 1YVLA 4P2YB 5GQQC 3TDIA 3NHTA 1WDCC 2JPTA 1B7TZ 4GGFA 4GGFC 1JFJA 2JT8A 3VRRA 2LMTA 3FE9A 5DKQA 3S0FA 2BNXA 3CZ1A 1QV0A 2FOTA 2M9GA 1WRZA 1WY9A 1PSBA 1QATA 1JF2A 1S3PA 1SRAA 1NCYA 5FYXA 1RROA 3B88A 4HRGA 2M0RA 4PE4A 4WQ2A 2LLUA 3ICBA 2EC6C 1GM0A 2F8PA 3WNXB 1FBVA 2K2FA 3L4LA 1QIVA 1Y1UA 2JNFA 1BR4B 2WCHA 1NSHA 1KK8C 2Y1NA 1DF0B 4C0KA 2I94A 2PALA 4MBEA 1B9AA 1KQMB 2F33A 2KGBC 1EL4A 1CNPA 3B7AA 4I5JA 1U5IB 1DEKA 1GGWA 3QMEA 3I5FC 4XJKB 1IGVA 3NGVA 1K2HA 4A4CA 1R6PA 1S5GZ 1TUZA 4I5LB 4AQJA 2ZRSA 1BLQA 1RWYA 4OKHA 1CDLA 1KFXS 2KFGA 3AAJA 1BU3A 4M2OA 1IRJA 2JT0A 1UHJA 1QX7A 2I2RE 2M97A 4GUKA 1J7OA 3PN7B 2KLDA 4PE0A 3LLEA 4MN0A 1QXPA 3PLFB 1DJGA 1B47A 1L7ZA 3R1PA 1DQEA 2H61A 2H61C 1K9PA 1QTXA 1ZUZA 1C7WA 2JXCA 1TOPA 3SG7A 1NIWA 2FJYA 2G9BA 2K2AA 3TUYB 2LVIA 4MZKA 1CLLA 3CR4X 1DGVA 3NHIA 3DXLA 4ORCB 2ZRTA 4ZCVA 3M0WA 3RZSA 2AUCA 2PYQA 1OOIX 2Q4UA 4A4BA 2JC2A 1N2DA 1ZACA 2M7NA 1S26D 4N1FA 1NX2A 3O2PA 3S0EA 4AOMA 1CFPA 2LM5A 3EVVA 2KHNA 5J3XA 1Q80A 4QJ3B 1B4CA 1YX8A 4YI8A 1HT9A 1SR6B 3TS5B 2LLTA 3DVJA 2QPTA 1Y1AA 1CFFA 2F2PA 1IJ5A 1YX7A 2LMVA 4HSZA 3NSLA 2ISDA 3HCMA 3B6XA 2KBIA 3S0AA 2G2BA 1ALVA 1ZMZA 1Y0VH 2KBMA 3A4UB 2ZN8A 1OZSA 1CM1A 1XFVO 2OTGB 1A4PA 1DJWA 4BY5A 2WCKA 2K7CA 2PSRA 5K89A 1DVIA 3QRXA 3DVKA 1F4OA 2JZIA 3BUXB 1TNWA 3LCPC 5KU1A 2LHIA 5EL2A 5CSFA 1W7JB 2BE6A 1YRUB 3H4SE 4IL1A 3OBVA 3OB1B 5JJGA 1XFYO 4YGDB 2QEHA 3WHTB 3NSOA 4BY4A 3KF9A 3I5IB 1NPQA 1JWDA 1QLSA 1OOJA 1VRKA 4E68A 4KYNA 2GGZA 1TIZA 2KSPA 1ALWA 1KFUL 1K9UA 2LANA 4OCIA 3EK4A 5D69A 4JWQA 5I2QA 2D8NA 4DS7A 5I8NA 2DOQA 1LS8A 3O6BA 1QIWA 1B8RA 4F7FA 1CDPA 1JBAA 1CKKA 1SL9A 1U5IA 1NWDA 2KQ6A 1AVSA 4PHJA 1EG3A 4PHMA 2NCOA 5DICA 1IG5A 4YGBB 2P70A 1QVIZ 1S6IA 4N5XA 4NQGA 4YGEB 1KQVA 3N7HA 1OQPA 4IJ7A 4MZJA 2MLEC 2M29A 4FQTA 1P28A 5I2OA 3C1VA 5B8IB 3CZ0A 1S6CA 4INXA 1DJIA 3SG4A 1HQVA 1OMRA 2Q91A 1K94A 2WC5A 4PHNA 2L5XB 5CPVA 1XFXO 2JT3A 1DMOA 4XYNA 3BQ3A 3ZNIA 2I7AA 1A29A 1F71A 1J55A 1L2OB 3BJHA 2HETA 1CTRA 1JUOA 2BCXA 1NX1A 3CWGA 3EK7A 1XO5A 5AXIA 4FTGA 5ER5A 4AQIA 3SG2A 2JWWA 1YUUA 4CFQA 2F3ZA 1CFCA 1MXLC 3S0DA 2WCFA 3VRNA 1AK8A 4R1EA 3CS1A 3TDUA 2MHHA 4PALA 1RTP1 3SIAA 3L4AA 2BCAA 3O4YA 3FWBA 1PSRA 5I2LA 1CM4A 1DT7B 4PCWA 3FS7A 4D1EA 4YBHB 4YI9A 4JQ0D 1BJFA 2P6BB 2LC5A 1IWQA 3D75A 1CLBA 3PFVA 1IKUA 1SR6C 3BFAA 3TS5C 1R2UA 2L0PA 3FE6A 1LXFC 1RECA 1SK6D 1Y1XA 4N1GA 3CABA 2LCPA 2OTGC 2YGUA 1KK7Y 3FE8A 4HREE 3SG5A 3EVUA 3JTDB 2LV7A 2QEVA 1LKJA 3DD4A 1F4QA 1SCVA 1SSEB 2WORA 4DUQA 3TUYC 3VRPA 5HKYA 1H8BA 2BECA 1IIOA 3OX5A 4UPGA 1YUSA 1Z4HA 1YTZC 1W9ZA 2ZKMX 3WHUB 1M31A 3CYZA 3I5IC 2NLNA 4MLWA 1F8HA 3L47A 2H8VA 2LHLA 2M3WA 5AFPA 3CLNA 2R2IA 1UHNA 2PMYA 1SW8A 4GAOA 3LL8B 1F55A 2KOTA 2B1UA 3OX6A 2L4HA 1M45A 2KQYA 1B8LA 3S0GA 2KDHA 5HKWA 4GBAA 1C7VA 2CTNA 2NXQA 1K90D 1NCZA 1K96A 3E3RA 2ZFDA 1DC1A 1D1OA 3OB2B 4NDBA 4P5OE 3R1OA 3R72A 2QACA 1MUXA 4OV2A 3CZ2A 2RGIA 1A75B 4Q04A 1SYMA 3MSEB 2ZNDA 4MRXA 3V2LA 1OZOA 2Y5IA 1UHKA 2GTEA 5KSZA 2L5YA 1PALA 3DVMA 3KO0A 4M2PA 3NSIA 3BXKA 4MEWA 1SCMC 3EK8A 1QS7A 1CMGA 1BR1B 5D3OA 5TNCA 2JU0A 1L2OC 2P71A 3BFBA 1AHRA 2Y4QA 1BG1A 1F70A 2KI6D 3PM8A 3CGAA 1QX5B 5DKNA 1PULA 1J1EA 4INWA 1M63B 2TN4A 2CBLA 4QJ5B 1B7TY 2MLFC 3GK1A 4M2QA 1C3ZA 3FIAA 4F0ZB 2K7OA 2KLEA 1E8AA 2KGRA 3AAKA 3CR2A 4C0JA 1OOHA 1GJYA 1EG4A 2BKIB 1EH2A 3PALA 1LINA 3JVTB 4GGNA 4CLNA 3BUWB 1J7PA 3DY9A 2K7BA 1NCXA 2BL0B 1X02A 3BYAA 3PJIA 2HPSA 1JC2A 1G4YR 1PRWA 3SIBA 1OMVA 2LP3A 2QDIA 3LK0A 2V53A 1SL8A 2K60A 4MSPA 5HYDA 1IH0A 5JOLA 4ETOA 1UHIA 1UUSA 3A8RA 1S36A 3F45A 2LVKA 3JTDC 1S5GY 4CIDA 2BCBA 1YRTB 2KI4C 1SBJA 2L98A 3OHMB 2QEOA 3DYEA 2MRDA 3D10A 4OVNF 1IJ6A 1UURA 3IVTA 1A03A 1YVHA 2JOJA 2LMUA 1C07A 1JSAA 2OPOA 1FI6A 2M7LA 1KWOB 4GNKB 1WLZA 4DRWA 1XA5A 1QJTA 2HF5A 2QEBA 2WCEA 1NUBA 2KAYA 1QX2A 1SCMB 3Q8IA 3RM1A 1CB1A 1S1EA 5CSJA 3WXAA 2E6WA 3EKHA 1F54A 1V1GA 3RLZA 1CFDA 1BT6A 2M1UA 2O5GA 1J1DA 3O78A 1JFKA 2EGDA 4DIRA 1GQMA 1YUTA 2L4IA 4USLA 1B8CA 2GV5A 2ZN9A 1V1FA 3SS3A 1FPWA 1SKTA 3GK2A 2MA2A 2BE4A 1JF0A 3VGOA 1TNPA 1XFWO 2FJUB 4FQOA 5HLOA 4WRIA 2KFFA 4NDCA 1XFUO 2LNKA 2NZ0A 3KPXA 2HQ8A 1XFZO 3D73A 3BUNB 1A75A 1PVAA 4PT1A 2FCEA 2K61A 2NCPA 3DF0B 1WLMA 5FI6A 3K21A 5CSIA 5AERA 2K8MB 2OS8B 3FWCA 3SS4A 1BF5A 1XFRA 1T14A 1H4BA 1MQ1A 2BBMA 2AAOA 1DJHA 2EHBA 3OGNA 3OP0A 2Y1MA 3GK4X 1K9KA 1NP8A 1XYDA 1K8UA 2JULA 2BBNA 2FCDA 2KYFA 3VROA 2KAXA 3IQOA 3NXAA 4JPZB 2PRUA 2PASA 4ORBB 1RFJA 3AKBA 3UNWA 1QV1A 3VRQA 1GGZA 3HX4A 1G33A 4PHKA 3BOWB 4U8DA 4L9MA 3UO9A 2COLB 2KI4B 5I94A 1XK4A 1XK4C 2MAZA 2SASA 3ZWHA 1K95A 3SG6A 2BAPA 1UHHA 3LK1A 1CDMA 1NX0A 2L50A 3D74A 1Z2CB 1J7RA 1SMGA 2ZNEA 4I5KA 2WC6A 4QJ4B 2LUCA 2M8UA 3I5HB 2LE9B 3JVTC 5F6TA 1N0YA 2WCMA 3CTNA 1CMFA 1TWOA 3I5GB 1FF1A 4NDDA 2VRGA 3GOFA 1KFUS 2BL0C 2MBXA 3D76A 1J7QA 2M49B 1C3YA 2JXLA 2M1KB 1TNQA 2BKHB 1BMOA 4YGAA 5D7FA 3D0YA
chains in the Genus database with same CATH topology
1DTLA 1N65A 1LA0A 3CZTX 4DCKA 1BODA 1TNXA 4GFTA 1QVIY 1S6JA 3TDZA 1SNLA 1MHOA 5CSNA 5PALA 1DJZA 2AMIA 1WRLA 2KAVA 4ORAB 3TZ1A 1SL7A 4CPVA 1ODBA 1KWOC 5AANA 3IF7A 1KCYA 4WQ3A 1WDCB 2K7DA 3PATA 4YGCB 4ZCUA 1PVBA 2L51A 2WNDA 3CR5X 4GPLB 1TN4A 2WOSA 2CCMA 2JTTA 1XVJA 1CLMA 1LVCD 1QASA 1TCOB 3EKJA 2L2EA 2EC6B 1SPYA 2LP2A 5DKRA 1QLKA 4C0LA 4MRYA 1AJ5A 5G08A 1KK8B 1A2XA 2JRFA 2MJWB 3DF0A 4OR9B 1MR8A 2KNEA 2KI6C 3KHEA 1UP5A 1YURA 4ICBA 5HKZA 2GGMA 2OS8C 1KK7Z 1IQ5A 3I5FB 2JNXA 1KFXL 2CNPA 4HRHA 3KEVA 3BUMB 4CFRA 3IQQA 2I18A 2HQWA 2WCBA 1RJVA 2JTZA 1AP4A 2LVJA 1AJ4A 1MWNA 3D0YB 1KSOA 3NSKA 1EXRA 1MXEA 4YRUA 2IS9A 3BOWA 2PVBA 1NYAA 1FW4A 4MVFA 2LVVA 1M39A 4PE1A 3PSRA 2F3YA 1OMDA 1NX3A 2KYCA 2E30A 1Y6WA 2CT9A 5BPJA 1DF0A 1SY9A 2A4JA 1KQMC 3AKAA 1DJYA 2H2KA 2O60A 1EJ3A 1RK9A 2KFHA 2F2OA 5AEQA 4MZLA 3I5HC 3SJSA 4PDZA 1AUIB 1DJXA 1TTXA 3EVRA 4XJKA 4I5NB 1CDNA 5KTYA 3I5GC 1W7IB 2K0JA 1PK0D 1IQ3A 1OE9B 1OSAA 4PE7A 1G8IA 1YR5A 2SCPA 2CXJA 3BUOB 1M46A 1ZFSA 1TCFA 1B1GA 1FI5A 1UWOA 4TNCA 5ER4X 1TRFA 1BOCA 3PN7C 3DVEA 2JQ6A 1KSMA 2LLSA 1K93D 2LAPA 3SG3A 2LUXA 1LA3A 5IBWA 2WC8A 1DGUA 1MF8B 1WRKA 1ZOTB 1YVLA 4P2YB 5GQQC 3TDIA 1WDCC 2JPTA 1B7TZ 4GGFA 4GGFC 1JFJA 2JT8A 3VRRA 2LMTA 5DKQA 1QV0A 2FOTA 2M9GA 1WRZA 1WY9A 1PSBA 1QATA 1JF2A 1S3PA 1SRAA 1NCYA 5FYXA 1RROA 4WQ2A 4HRGA 2M0RA 4PE4A 2LLUA 3ICBA 2EC6C 2F8PA 3WNXB 1FBVA 2K2FA 1QIVA 1Y1UA 2JNFA 1BR4B 1NSHA 1KK8C 2Y1NA 1DF0B 4C0KA 2I94A 2PALA 4MBEA 1B9AA 1KQMB 2F33A 2KGBC 1EL4A 1CNPA 4I5JA 1U5IB 1GGWA 3I5FC 4XJKB 1IGVA 1K2HA 4A4CA 1R6PA 1S5GZ 4I5LB 4AQJA 2ZRSA 1BLQA 1RWYA 4OKHA 1CDLA 1KFXS 2KFGA 3AAJA 1BU3A 4M2OA 1IRJA 2JT0A 1UHJA 1QX7A 2I2RE 2M97A 4GUKA 1J7OA 3PN7B 4PE0A 3LLEA 4MN0A 1QXPA 3PLFB 1DJGA 1B47A 1L7ZA 2H61A 2H61C 1K9PA 1QTXA 1ZUZA 1C7WA 2JXCA 1TOPA 3SG7A 1NIWA 2G9BA 2K2AA 3TUYB 2LVIA 4MZKA 1CLLA 3CR4X 1DGVA 4ORCB 2ZRTA 4ZCVA 3M0WA 2AUCA 2Q4UA 4A4BA 2JC2A 1N2DA 1ZACA 2M7NA 1S26D 4N1FA 1NX2A 3O2PA 4AOMA 1CFPA 2LM5A 3EVVA 2KHNA 5J3XA 1Q80A 4QJ3B 1B4CA 1YX8A 4YI8A 1HT9A 1SR6B 3TS5B 2LLTA 3DVJA 2QPTA 1Y1AA 1CFFA 2F2PA 1IJ5A 1YX7A 2LMVA 4HSZA 3NSLA 2ISDA 3HCMA 2KBIA 2G2BA 1ALVA 1ZMZA 1Y0VH 2KBMA 3A4UB 2ZN8A 1OZSA 1CM1A 1XFVO 2OTGB 1A4PA 1DJWA 4BY5A 2K7CA 2PSRA 5K89A 1DVIA 3QRXA 3DVKA 1F4OA 2JZIA 3BUXB 1TNWA 3LCPC 5KU1A 2LHIA 5CSFA 1W7JB 2BE6A 1YRUB 3H4SE 4IL1A 5JJGA 3OB1B 5KSZA 1XFYO 4YGDB 3WHTB 4BY4A 3NSOA 3KF9A 3I5IB 1NPQA 1JWDA 1QLSA 1OOJA 1VRKA 4E68A 2GGZA 1TIZA 2KSPA 1ALWA 1KFUL 1K9UA 2LANA 4OCIA 3EK4A 5D69A 4JWQA 5I2QA 2D8NA 4DS7A 5I8NA 2DOQA 3O6BA 1QIWA 1B8RA 1CDPA 1JBAA 1CKKA 1SL9A 1U5IA 1NWDA 2KQ6A 1AVSA 4PHJA 1EG3A 4PHMA 2NCOA 1IG5A 4YGBB 4N5XA 1QVIZ 1S6IA 4NQGA 4YGEB 1KQVA 1OQPA 4MZJA 2MLEC 2M29A 5I2OA 3C1VA 5B8IB 1S6CA 1DJIA 3SG4A 1HQVA 1OMRA 2Q91A 1K94A 4PHNA 2L5XB 5CPVA 1XFXO 2JT3A 1DMOA 4XYNA 3BQ3A 3ZNIA 2I7AA 1A29A 1F71A 1J55A 1L2OB 3TUYC 2HETA 1CTRA 1JUOA 2BCXA 1NX1A 3CWGA 3EK7A 1XO5A 5AXIA 4FTGA 5ER5A 4AQIA 3SG2A 2JWWA 1YUUA 4CFQA 2F3ZA 1CFCA 1MXLC 2WCFA 3VRNA 1AK8A 4R1EA 3CS1A 3TDUA 2MHHA 4PALA 1RTP1 3SIAA 2BCAA 3O4YA 3FWBA 1PSRA 5I2LA 1CM4A 1DT7B 4PCWA 3FS7A 4D1EA 4YBHB 4YI9A 4JQ0D 1BJFA 2P6BB 2LC5A 1IWQA 1CLBA 3PFVA 1IKUA 1SR6C 3TS5C 1R2UA 2L0PA 1LXFC 1RECA 1SK6D 1Y1XA 4N1GA 2LCPA 2OTGC 1KK7Y 4HREE 3SG5A 3EVUA 3JTDB 2LV7A 3DD4A 1LKJA 1F4QA 1SCVA 2WORA 4DUQA 3VRPA 5HKYA 1H8BA 2BECA 3OX5A 4UPGA 1YUSA 2ZKMX 1YTZC 3WHUB 1M31A 3I5IC 2NLNA 4MLWA 1F8HA 2LHLA 2M3WA 5AFPA 3CLNA 2R2IA 1UHNA 2PMYA 1SW8A 4GAOA 3LL8B 1F55A 2KOTA 2B1UA 3OX6A 2L4HA 1M45A 2KQYA 1B8LA 2KDHA 5HKWA 4GBAA 1C7VA 2CTNA 2NXQA 1K90D 1NCZA 1K96A 3E3RA 2ZFDA 1D1OA 3OB2B 4NDBA 4P5OE 2QACA 1MUXA 4OV2A 2RGIA 1A75B 4Q04A 1SYMA 3MSEB 2ZNDA 4MRXA 1OZOA 2Y5IA 1UHKA 1PALA 3DVMA 3KO0A 4M2PA 3NSIA 3BXKA 4MEWA 1SCMC 3EK8A 1QS7A 1CMGA 1BR1B 5TNCA 2JU0A 1L2OC 1BG1A 1F70A 1AHRA 2Y4QA 2KI6D 3PM8A 3CGAA 1QX5B 5DKNA 1PULA 1J1EA 1M63B 2TN4A 2CBLA 4QJ5B 1B7TY 2MLFC 3GK1A 4M2QA 3FIAA 4F0ZB 2K7OA 3AAKA 1E8AA 2KGRA 3CR2A 4C0JA 1GJYA 1EG4A 2BKIB 1EH2A 3PALA 1LINA 3JVTB 4GGNA 4CLNA 3BUWB 1J7PA 2K7BA 1NCXA 2BL0B 1X02A 3BYAA 2HPSA 1JC2A 1G4YR 1PRWA 3SIBA 1OMVA 2LP3A 3LK0A 4MSPA 2V53A 1SL8A 1IH0A 5HYDA 5JOLA 4ETOA 1UHIA 1UUSA 3A8RA 1S36A 3F45A 2LVKA 3JTDC 1S5GY 4CIDA 2BCBA 1YRTB 2KI4C 1SBJA 2L98A 3OHMB 4OVNF 5HLVA 2MRDA 3D10A 1IJ6A 1UURA 1A03A 1YVHA 2JOJA 2LMUA 1C07A 1JSAA 2OPOA 1FI6A 2M7LA 1KWOB 4GNKB 1WLZA 4DRWA 1XA5A 1QJTA 2HF5A 2WCEA 1NUBA 2KAYA 1QX2A 1SCMB 3RM1A 1CB1A 1S1EA 5CSJA 3WXAA 2E6WA 3EKHA 1F54A 1V1GA 3RLZA 1CFDA 1BT6A 2M1UA 2O5GA 1J1DA 3O78A 1JFKA 2EGDA 4DIRA 1GQMA 1YUTA 2L4IA 4USLA 1B8CA 2GV5A 2ZN9A 1V1FA 1FPWA 1SKTA 3GK2A 2MA2A 2BE4A 1JF0A 3VGOA 1TNPA 1XFWO 2FJUB 4FQOA 5HLOA 4WRIA 2KFFA 4NDCA 1XFUO 2LNKA 2NZ0A 3KPXA 2HQ8A 1XFZO 3BUNB 1A75A 1PVAA 2FCEA 2K61A 2NCPA 3DF0B 1WLMA 3K21A 5CSIA 5AERA 2K8MB 2OS8B 3FWCA 1BF5A 1H4BA 1MQ1A 2BBMA 2AAOA 1DJHA 2EHBA 3OP0A 2Y1MA 3GK4X 1K9KA 1NP8A 1XYDA 1K8UA 2JULA 2BBNA 2FCDA 2KYFA 3VROA 2KAXA 3IQOA 3NXAA 4JPZB 2PRUA 2PASA 4ORBB 1RFJA 3AKBA 1QV1A 3VRQA 1GGZA 3HX4A 1G33A 4PHKA 3BOWB 4U8DA 4L9MA 2COLB 2KI4B 1XK4A 1XK4C 2MAZA 2SASA 3ZWHA 1K95A 3SG6A 1UHHA 3LK1A 1CDMA 1NX0A 2L50A 1J7RA 1SMGA 2ZNEA 4I5KA 4QJ4B 2LUCA 2M8UA 3I5HB 2LE9B 3JVTC 5F6TA 1N0YA 3CTNA 1CMFA 3I5GB 1FF1A 4NDDA 2VRGA 3GOFA 1KFUS 2BL0C 2MBXA 1J7QA 2M49B 2JXLA 2M1KB 1TNQA 2BKHB 1BMOA 4YGAA 5D7FA 3D0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTL A;  1N65 A;  1LA0 A;  3CZT X;  4DCK A;  1BOD A;  1TNX A;  4GFT A;  1QVI Y;  1S6J A;  3TDZ A;  1SNL A;  1MHO A;  5CSN A;  5PAL A;  1DJZ A;  2AMI A;  1WRL A;  2KAV A;  4ORA B;  3TZ1 A;  1SL7 A;  4CPV A;  1ODB A;  1KWO C;  5AAN A;  3IF7 A;  1KCY A;  4WQ3 A;  1WDC B;  2K7D A;  3PAT A;  4YGC B;  4ZCU A;  1PVB A;  2L51 A;  2WND A;  3CR5 X;  4GPL B;  1TN4 A;  2WOS A;  2CCM A;  2JTT A;  1XVJ A;  1CLM A;  1LVC D;  1QAS A;  1TCO B;  3EKJ A;  2L2E A;  2EC6 B;  1SPY A;  2LP2 A;  5DKR A;  1QLK A;  4C0L A;  4MRY A;  1AJ5 A;  5G08 A;  1KK8 B;  1A2X A;  2JRF A;  2MJW B;  3DF0 A;  4OR9 B;  1MR8 A;  2KNE A;  2KI6 C;  3KHE A;  1UP5 A;  1YUR A;  4ICB A;  5HKZ A;  2GGM A;  2OS8 C;  1KK7 Z;  1IQ5 A;  3I5F B;  2JNX A;  1KFX L;  2CNP A;  4HRH A;  3KEV A;  3BUM B;  4CFR A;  3IQQ A;  2I18 A;  2HQW A;  2WCB A;  1RJV A;  2JTZ A;  1AP4 A;  2LVJ A;  1AJ4 A;  1MWN A;  3D0Y B;  1KSO A;  3NSK A;  1EXR A;  1MXE A;  4YRU A;  2IS9 A;  3BOW A;  2PVB A;  1NYA A;  1FW4 A;  4MVF A;  2LVV A;  1M39 A;  4PE1 A;  3PSR A;  2F3Y A;  1OMD A;  1NX3 A;  2KYC A;  2E30 A;  1Y6W A;  2CT9 A;  5BPJ A;  1DF0 A;  1SY9 A;  2A4J A;  1KQM C;  3AKA A;  1DJY A;  2H2K A;  2O60 A;  1EJ3 A;  1RK9 A;  2KFH A;  2F2O A;  5AEQ A;  4MZL A;  3I5H C;  3SJS A;  4PDZ A;  1AUI B;  1DJX A;  1TTX A;  3EVR A;  4XJK A;  4I5N B;  1CDN A;  5KTY A;  3I5G C;  1W7I B;  2K0J A;  1PK0 D;  1IQ3 A;  1OE9 B;  1OSA A;  4PE7 A;  1G8I A;  1YR5 A;  2SCP A;  2CXJ A;  3BUO B;  1M46 A;  1ZFS A;  1TCF A;  1B1G A;  1FI5 A;  1UWO A;  4TNC A;  5ER4 X;  1TRF A;  1BOC A;  3PN7 C;  3DVE A;  2JQ6 A;  1KSM A;  2LLS A;  1K93 D;  2LAP A;  3SG3 A;  2LUX A;  1LA3 A;  5IBW A;  2WC8 A;  1DGU A;  1MF8 B;  1WRK A;  1ZOT B;  1YVL A;  4P2Y B;  5GQQ C;  3TDI A;  1WDC C;  2JPT A;  1B7T Z;  4GGF A;  4GGF C;  1JFJ A;  2JT8 A;  3VRR A;  2LMT A;  5DKQ A;  1QV0 A;  2FOT A;  2M9G A;  1WRZ A;  1WY9 A;  1PSB A;  1QAT A;  1JF2 A;  1S3P A;  1SRA A;  1NCY A;  5FYX A;  1RRO A;  4WQ2 A;  4HRG A;  2M0R A;  4PE4 A;  2LLU A;  3ICB A;  2EC6 C;  2F8P A;  3WNX B;  1FBV A;  2K2F A;  1QIV A;  1Y1U A;  2JNF A;  1BR4 B;  1NSH A;  1KK8 C;  2Y1N A;  1DF0 B;  4C0K A;  2I94 A;  2PAL A;  4MBE A;  1B9A A;  1KQM B;  2F33 A;  2KGB C;  1EL4 A;  1CNP A;  4I5J A;  1U5I B;  1GGW A;  3I5F C;  4XJK B;  1IGV A;  1K2H A;  4A4C A;  1R6P A;  1S5G Z;  4I5L B;  4AQJ A;  2ZRS A;  1BLQ A;  1RWY A;  4OKH A;  1CDL A;  1KFX S;  2KFG A;  3AAJ A;  1BU3 A;  4M2O A;  1IRJ A;  2JT0 A;  1UHJ A;  1QX7 A;  2I2R E;  2M97 A;  4GUK A;  1J7O A;  3PN7 B;  4PE0 A;  3LLE A;  4MN0 A;  1QXP A;  3PLF B;  1DJG A;  1B47 A;  1L7Z A;  2H61 A;  2H61 C;  1K9P A;  1QTX A;  1ZUZ A;  1C7W A;  2JXC A;  1TOP A;  3SG7 A;  1NIW A;  2G9B A;  2K2A A;  3TUY B;  2LVI A;  4MZK A;  1CLL A;  3CR4 X;  1DGV A;  4ORC B;  2ZRT A;  4ZCV A;  3M0W A;  2AUC A;  2Q4U A;  4A4B A;  2JC2 A;  1N2D A;  1ZAC A;  2M7N A;  1S26 D;  4N1F A;  1NX2 A;  3O2P A;  4AOM A;  1CFP A;  2LM5 A;  3EVV A;  2KHN A;  5J3X A;  1Q80 A;  4QJ3 B;  1B4C A;  1YX8 A;  4YI8 A;  1HT9 A;  1SR6 B;  3TS5 B;  2LLT A;  3DVJ A;  2QPT A;  1Y1A A;  1CFF A;  2F2P A;  1IJ5 A;  1YX7 A;  2LMV A;  4HSZ A;  3NSL A;  2ISD A;  3HCM A;  2KBI A;  2G2B A;  1ALV A;  1ZMZ A;  1Y0V H;  2KBM A;  3A4U B;  2ZN8 A;  1OZS A;  1CM1 A;  1XFV O;  2OTG B;  1A4P A;  1DJW A;  4BY5 A;  2K7C A;  2PSR A;  5K89 A;  1DVI A;  3QRX A;  3DVK A;  1F4O A;  2JZI A;  3BUX B;  1TNW A;  3LCP C;  5KU1 A;  2LHI A;  5CSF A;  1W7J B;  2BE6 A;  1YRU B;  3H4S E;  4IL1 A;  5JJG A;  3OB1 B;  5KSZ A;  1XFY O;  4YGD B;  3WHT B;  4BY4 A;  3NSO A;  3KF9 A;  3I5I B;  1NPQ A;  1JWD A;  1QLS A;  1OOJ A;  1VRK A;  4E68 A;  2GGZ A;  1TIZ A;  2KSP A;  1ALW A;  1KFU L;  1K9U A;  2LAN A;  4OCI A;  3EK4 A;  5D69 A;  4JWQ A;  5I2Q A;  2D8N A;  4DS7 A;  5I8N A;  2DOQ A;  3O6B A;  1QIW A;  1B8R A;  1CDP A;  1JBA A;  1CKK A;  1SL9 A;  1U5I A;  1NWD A;  2KQ6 A;  1AVS A;  4PHJ A;  1EG3 A;  4PHM A;  2NCO A;  1IG5 A;  4YGB B;  4N5X A;  1QVI Z;  1S6I A;  4NQG A;  4YGE B;  1KQV A;  1OQP A;  4MZJ A;  2MLE C;  2M29 A;  5I2O A;  3C1V A;  5B8I B;  1S6C A;  1DJI A;  3SG4 A;  1HQV A;  1OMR A;  2Q91 A;  1K94 A;  4PHN A;  2L5X B;  5CPV A;  1XFX O;  2JT3 A;  1DMO A;  4XYN A;  3BQ3 A;  3ZNI A;  2I7A A;  1A29 A;  1F71 A;  1J55 A;  1L2O B;  3TUY C;  2HET A;  1CTR A;  1JUO A;  2BCX A;  1NX1 A;  3CWG A;  3EK7 A;  1XO5 A;  5AXI A;  4FTG A;  5ER5 A;  4AQI A;  3SG2 A;  2JWW A;  1YUU A;  4CFQ A;  2F3Z A;  1CFC A;  1MXL C;  2WCF A;  3VRN A;  1AK8 A;  4R1E A;  3CS1 A;  3TDU A;  2MHH A;  4PAL A;  1RTP 1;  3SIA A;  2BCA A;  3O4Y A;  3FWB A;  1PSR A;  5I2L A;  1CM4 A;  1DT7 B;  4PCW A;  3FS7 A;  4D1E A;  4YBH B;  4YI9 A;  4JQ0 D;  1BJF A;  2P6B B;  2LC5 A;  1IWQ A;  1CLB A;  3PFV A;  1IKU A;  1SR6 C;  3TS5 C;  1R2U A;  2L0P A;  1LXF C;  1REC A;  1SK6 D;  1Y1X A;  4N1G A;  2LCP A;  2OTG C;  1KK7 Y;  4HRE E;  3SG5 A;  3EVU A;  3JTD B;  2LV7 A;  3DD4 A;  1LKJ A;  1F4Q A;  1SCV A;  2WOR A;  4DUQ A;  3VRP A;  5HKY A;  1H8B A;  2BEC A;  3OX5 A;  4UPG A;  1YUS A;  2ZKM X;  1YTZ C;  3WHU B;  1M31 A;  3I5I C;  2NLN A;  4MLW A;  1F8H A;  2LHL A;  2M3W A;  5AFP A;  3CLN A;  2R2I A;  1UHN A;  2PMY A;  1SW8 A;  4GAO A;  3LL8 B;  1F55 A;  2KOT A;  2B1U A;  3OX6 A;  2L4H A;  1M45 A;  2KQY A;  1B8L A;  2KDH A;  5HKW A;  4GBA A;  1C7V A;  2CTN A;  2NXQ A;  1K90 D;  1NCZ A;  1K96 A;  3E3R A;  2ZFD A;  1D1O A;  3OB2 B;  4NDB A;  4P5O E;  2QAC A;  1MUX A;  4OV2 A;  2RGI A;  1A75 B;  4Q04 A;  1SYM A;  3MSE B;  2ZND A;  4MRX A;  1OZO A;  2Y5I A;  1UHK A;  1PAL A;  3DVM A;  3KO0 A;  4M2P A;  3NSI A;  3BXK A;  4MEW A;  1SCM C;  3EK8 A;  1QS7 A;  1CMG A;  1BR1 B;  5TNC A;  2JU0 A;  1L2O C;  1BG1 A;  1F70 A;  1AHR A;  2Y4Q A;  2KI6 D;  3PM8 A;  3CGA A;  1QX5 B;  5DKN A;  1PUL A;  1J1E A;  1M63 B;  2TN4 A;  2CBL A;  4QJ5 B;  1B7T Y;  2MLF C;  3GK1 A;  4M2Q A;  3FIA A;  4F0Z B;  2K7O A;  3AAK A;  1E8A A;  2KGR A;  3CR2 A;  4C0J A;  1GJY A;  1EG4 A;  2BKI B;  1EH2 A;  3PAL A;  1LIN A;  3JVT B;  4GGN A;  4CLN A;  3BUW B;  1J7P A;  2K7B A;  1NCX A;  2BL0 B;  1X02 A;  3BYA A;  2HPS A;  1JC2 A;  1G4Y R;  1PRW A;  3SIB A;  1OMV A;  2LP3 A;  3LK0 A;  4MSP A;  2V53 A;  1SL8 A;  1IH0 A;  5HYD A;  5JOL A;  4ETO A;  1UHI A;  1UUS A;  3A8R A;  1S36 A;  3F45 A;  2LVK A;  3JTD C;  1S5G Y;  4CID A;  2BCB A;  1YRT B;  2KI4 C;  1SBJ A;  2L98 A;  3OHM B;  4OVN F;  5HLV A;  2MRD A;  3D10 A;  1IJ6 A;  1UUR A;  1A03 A;  1YVH A;  2JOJ A;  2LMU A;  1C07 A;  1JSA A;  2OPO A;  1FI6 A;  2M7L A;  1KWO B;  4GNK B;  1WLZ A;  4DRW A;  1XA5 A;  1QJT A;  2HF5 A;  2WCE A;  1NUB A;  2KAY A;  1QX2 A;  1SCM B;  3RM1 A;  1CB1 A;  1S1E A;  5CSJ A;  3WXA A;  2E6W A;  3EKH A;  1F54 A;  1V1G A;  3RLZ A;  1CFD A;  1BT6 A;  2M1U A;  2O5G A;  1J1D A;  3O78 A;  1JFK A;  2EGD A;  4DIR A;  1GQM A;  1YUT A;  2L4I A;  4USL A;  1B8C A;  2GV5 A;  2ZN9 A;  1V1F A;  1FPW A;  1SKT A;  3GK2 A;  2MA2 A;  2BE4 A;  1JF0 A;  3VGO A;  1TNP A;  1XFW O;  2FJU B;  4FQO A;  5HLO A;  4WRI A;  2KFF A;  4NDC A;  1XFU O;  2LNK A;  2NZ0 A;  3KPX A;  2HQ8 A;  1XFZ O;  3BUN B;  1A75 A;  1PVA A;  2FCE A;  2K61 A;  2NCP A;  3DF0 B;  1WLM A;  3K21 A;  5CSI A;  5AER A;  2K8M B;  2OS8 B;  3FWC A;  1BF5 A;  1H4B A;  1MQ1 A;  2BBM A;  2AAO A;  1DJH A;  2EHB A;  3OP0 A;  2Y1M A;  3GK4 X;  1K9K A;  1NP8 A;  1XYD A;  1K8U A;  2JUL A;  2BBN A;  2FCD A;  2KYF A;  3VRO A;  2KAX A;  3IQO A;  3NXA A;  4JPZ B;  2PRU A;  2PAS A;  4ORB B;  1RFJ A;  3AKB A;  1QV1 A;  3VRQ A;  1GGZ A;  3HX4 A;  1G33 A;  4PHK A;  3BOW B;  4U8D A;  4L9M A;  2COL B;  2KI4 B;  1XK4 A;  1XK4 C;  2MAZ A;  2SAS A;  3ZWH A;  1K95 A;  3SG6 A;  1UHH A;  3LK1 A;  1CDM A;  1NX0 A;  2L50 A;  1J7R A;  1SMG A;  2ZNE A;  4I5K A;  4QJ4 B;  2LUC A;  2M8U A;  3I5H B;  2LE9 B;  3JVT C;  5F6T A;  1N0Y A;  3CTN A;  1CMF A;  3I5G B;  1FF1 A;  4NDD A;  2VRG A;  3GOF A;  1KFU S;  2BL0 C;  2MBX A;  1J7Q A;  2M49 B;  2JXL A;  2M1K B;  1TNQ A;  2BKH B;  1BMO A;  4YGA A;  5D7F A;  3D0Y A; 
#chains in the Genus database with same CATH topology
 1DTL A;  1N65 A;  1LA0 A;  3CZT X;  4DCK A;  1BOD A;  1TNX A;  4GFT A;  1QVI Y;  1S6J A;  2WCJ A;  3TDZ A;  1SNL A;  1MHO A;  5CSN A;  5PAL A;  1DJZ A;  2AMI A;  1WRL A;  2KAV A;  4ORA B;  3TZ1 A;  1SL7 A;  4CPV A;  1ODB A;  1KWO C;  5AAN A;  1OOF A;  3IF7 A;  4WQ3 A;  1WDC B;  2K7D A;  4JKT A;  1KCY A;  3PAT A;  4YGC B;  4ZCU A;  1PVB A;  2L51 A;  2L2C A;  2WND A;  3CR5 X;  5HLV A;  4GPL B;  1TN4 A;  2WOS A;  2CCM A;  2JTT A;  1DEL A;  1XVJ A;  1CLM A;  1LVC D;  1QAS A;  1TCO B;  3R1V A;  3B86 A;  3EKJ A;  2L2E A;  2EC6 B;  1SPY A;  2LP2 A;  5DKR A;  1OW4 A;  1QLK A;  3CDN A;  4C0L A;  2WCL A;  4MRY A;  1AJ5 A;  5G08 A;  1KK8 B;  1A2X A;  2JRF A;  2MJW B;  3DF0 A;  4OR9 B;  1MR8 A;  2KNE A;  2KI6 C;  3EG5 B;  3KHE A;  1TUJ A;  1UP5 A;  1YUR A;  4ICB A;  5HKZ A;  2GGM A;  2OS8 C;  1KK7 Z;  1IQ5 A;  3I5F B;  2JNX A;  1KFX L;  2CNP A;  4HRH A;  3KEV A;  5HL1 A;  3BUM B;  4CFR A;  3IQQ A;  3BFH A;  2I18 A;  5FI7 A;  4JD9 A;  2HQW A;  2WCB A;  3SS5 A;  1RJV A;  2JTZ A;  1AP4 A;  2LVJ A;  1AJ4 A;  3S0B A;  1MWN A;  3D0Y B;  1KSO A;  3NSK A;  1EXR A;  1MXE A;  4YRU A;  2IS9 A;  3BOW A;  3B87 A;  2PVB A;  1NYA A;  1FW4 A;  4MVF A;  2LVV A;  1M39 A;  4PE1 A;  2KPH A;  3PSR A;  2F3Y A;  1OMD A;  1NX3 A;  2KYC A;  2E30 A;  3D78 A;  1Y6W A;  2CT9 A;  5BPJ A;  1DF0 A;  1SY9 A;  2A4J A;  1KQM C;  3AKA A;  1DJY A;  2H2K A;  2O60 A;  1EJ3 A;  3D77 A;  1RK9 A;  2KFH A;  2F2O A;  5AEQ A;  4MZL A;  3I5H C;  3SJS A;  4PDZ A;  1AUI B;  1DJX A;  1TTX A;  3EVR A;  4XJK A;  4I5N B;  1CDN A;  4OZD A;  3I5G C;  5KTY A;  1QWV A;  1W7I B;  3K1E A;  2K0J A;  1PK0 D;  1IQ3 A;  3VB1 A;  1OE9 B;  1OSA A;  4PE7 A;  1G8I A;  1YR5 A;  2SCP A;  2CXJ A;  3BUO B;  1M46 A;  1ZFS A;  5FI2 A;  1TCF A;  1B1G A;  1ORG A;  3DZT A;  1UWO A;  2PQL A;  4TNC A;  1TRF A;  5ER4 X;  1BOC A;  3PN7 C;  1FI5 A;  1OOG A;  3DVE A;  2JQ6 A;  2JPO A;  3O4X A;  1KSM A;  2LLS A;  1K93 D;  2LAP A;  3PM2 A;  2ERB A;  3SG3 A;  2LUX A;  1LA3 A;  5IBW A;  2WC8 A;  1DGU A;  1MF8 B;  1WRK A;  1ZOT B;  1YVL A;  4P2Y B;  5GQQ C;  3TDI A;  3NHT A;  1WDC C;  2JPT A;  1B7T Z;  4GGF A;  4GGF C;  1JFJ A;  2JT8 A;  3VRR A;  2LMT A;  3FE9 A;  5DKQ A;  3S0F A;  2BNX A;  3CZ1 A;  1QV0 A;  2FOT A;  2M9G A;  1WRZ A;  1WY9 A;  1PSB A;  1QAT A;  1JF2 A;  1S3P A;  1SRA A;  1NCY A;  5FYX A;  1RRO A;  3B88 A;  4HRG A;  2M0R A;  4PE4 A;  4WQ2 A;  2LLU A;  3ICB A;  2EC6 C;  1GM0 A;  2F8P A;  3WNX B;  1FBV A;  2K2F A;  3L4L A;  1QIV A;  1Y1U A;  2JNF A;  1BR4 B;  2WCH A;  1NSH A;  1KK8 C;  2Y1N A;  1DF0 B;  4C0K A;  2I94 A;  2PAL A;  4MBE A;  1B9A A;  1KQM B;  2F33 A;  2KGB C;  1EL4 A;  1CNP A;  3B7A A;  4I5J A;  1U5I B;  1DEK A;  1GGW A;  3QME A;  3I5F C;  4XJK B;  1IGV A;  3NGV A;  1K2H A;  4A4C A;  1R6P A;  1S5G Z;  1TUZ A;  4I5L B;  4AQJ A;  2ZRS A;  1BLQ A;  1RWY A;  4OKH A;  1CDL A;  1KFX S;  2KFG A;  3AAJ A;  1BU3 A;  4M2O A;  1IRJ A;  2JT0 A;  1UHJ A;  1QX7 A;  2I2R E;  2M97 A;  4GUK A;  1J7O A;  3PN7 B;  2KLD A;  4PE0 A;  3LLE A;  4MN0 A;  1QXP A;  3PLF B;  1DJG A;  1B47 A;  1L7Z A;  3R1P A;  1DQE A;  2H61 A;  2H61 C;  1K9P A;  1QTX A;  1ZUZ A;  1C7W A;  2JXC A;  1TOP A;  3SG7 A;  1NIW A;  2FJY A;  2G9B A;  2K2A A;  3TUY B;  2LVI A;  4MZK A;  1CLL A;  3CR4 X;  1DGV A;  3NHI A;  3DXL A;  4ORC B;  2ZRT A;  4ZCV A;  3M0W A;  3RZS A;  2AUC A;  2PYQ A;  1OOI X;  2Q4U A;  4A4B A;  2JC2 A;  1N2D A;  1ZAC A;  2M7N A;  1S26 D;  4N1F A;  1NX2 A;  3O2P A;  3S0E A;  4AOM A;  1CFP A;  2LM5 A;  3EVV A;  2KHN A;  5J3X A;  1Q80 A;  4QJ3 B;  1B4C A;  1YX8 A;  4YI8 A;  1HT9 A;  1SR6 B;  3TS5 B;  2LLT A;  3DVJ A;  2QPT A;  1Y1A A;  1CFF A;  2F2P A;  1IJ5 A;  1YX7 A;  2LMV A;  4HSZ A;  3NSL A;  2ISD A;  3HCM A;  3B6X A;  2KBI A;  3S0A A;  2G2B A;  1ALV A;  1ZMZ A;  1Y0V H;  2KBM A;  3A4U B;  2ZN8 A;  1OZS A;  1CM1 A;  1XFV O;  2OTG B;  1A4P A;  1DJW A;  4BY5 A;  2WCK A;  2K7C A;  2PSR A;  5K89 A;  1DVI A;  3QRX A;  3DVK A;  1F4O A;  2JZI A;  3BUX B;  1TNW A;  3LCP C;  5KU1 A;  2LHI A;  5EL2 A;  5CSF A;  1W7J B;  2BE6 A;  1YRU B;  3H4S E;  4IL1 A;  3OBV A;  3OB1 B;  5JJG A;  1XFY O;  4YGD B;  2QEH A;  3WHT B;  3NSO A;  4BY4 A;  3KF9 A;  3I5I B;  1NPQ A;  1JWD A;  1QLS A;  1OOJ A;  1VRK A;  4E68 A;  4KYN A;  2GGZ A;  1TIZ A;  2KSP A;  1ALW A;  1KFU L;  1K9U A;  2LAN A;  4OCI A;  3EK4 A;  5D69 A;  4JWQ A;  5I2Q A;  2D8N A;  4DS7 A;  5I8N A;  2DOQ A;  1LS8 A;  3O6B A;  1QIW A;  1B8R A;  4F7F A;  1CDP A;  1JBA A;  1CKK A;  1SL9 A;  1U5I A;  1NWD A;  2KQ6 A;  1AVS A;  4PHJ A;  1EG3 A;  4PHM A;  2NCO A;  5DIC A;  1IG5 A;  4YGB B;  2P70 A;  1QVI Z;  1S6I A;  4N5X A;  4NQG A;  4YGE B;  1KQV A;  3N7H A;  1OQP A;  4IJ7 A;  4MZJ A;  2MLE C;  2M29 A;  4FQT A;  1P28 A;  5I2O A;  3C1V A;  5B8I B;  3CZ0 A;  1S6C A;  4INX A;  1DJI A;  3SG4 A;  1HQV A;  1OMR A;  2Q91 A;  1K94 A;  2WC5 A;  4PHN A;  2L5X B;  5CPV A;  1XFX O;  2JT3 A;  1DMO A;  4XYN A;  3BQ3 A;  3ZNI A;  2I7A A;  1A29 A;  1F71 A;  1J55 A;  1L2O B;  3BJH A;  2HET A;  1CTR A;  1JUO A;  2BCX A;  1NX1 A;  3CWG A;  3EK7 A;  1XO5 A;  5AXI A;  4FTG A;  5ER5 A;  4AQI A;  3SG2 A;  2JWW A;  1YUU A;  4CFQ A;  2F3Z A;  1CFC A;  1MXL C;  3S0D A;  2WCF A;  3VRN A;  1AK8 A;  4R1E A;  3CS1 A;  3TDU A;  2MHH A;  4PAL A;  1RTP 1;  3SIA A;  3L4A A;  2BCA A;  3O4Y A;  3FWB A;  1PSR A;  5I2L A;  1CM4 A;  1DT7 B;  4PCW A;  3FS7 A;  4D1E A;  4YBH B;  4YI9 A;  4JQ0 D;  1BJF A;  2P6B B;  2LC5 A;  1IWQ A;  3D75 A;  1CLB A;  3PFV A;  1IKU A;  1SR6 C;  3BFA A;  3TS5 C;  1R2U A;  2L0P A;  3FE6 A;  1LXF C;  1REC A;  1SK6 D;  1Y1X A;  4N1G A;  3CAB A;  2LCP A;  2OTG C;  2YGU A;  1KK7 Y;  3FE8 A;  4HRE E;  3SG5 A;  3EVU A;  3JTD B;  2LV7 A;  2QEV A;  1LKJ A;  3DD4 A;  1F4Q A;  1SCV A;  1SSE B;  2WOR A;  4DUQ A;  3TUY C;  3VRP A;  5HKY A;  1H8B A;  2BEC A;  1IIO A;  3OX5 A;  4UPG A;  1YUS A;  1Z4H A;  1YTZ C;  1W9Z A;  2ZKM X;  3WHU B;  1M31 A;  3CYZ A;  3I5I C;  2NLN A;  4MLW A;  1F8H A;  3L47 A;  2H8V A;  2LHL A;  2M3W A;  5AFP A;  3CLN A;  2R2I A;  1UHN A;  2PMY A;  1SW8 A;  4GAO A;  3LL8 B;  1F55 A;  2KOT A;  2B1U A;  3OX6 A;  2L4H A;  1M45 A;  2KQY A;  1B8L A;  3S0G A;  2KDH A;  5HKW A;  4GBA A;  1C7V A;  2CTN A;  2NXQ A;  1K90 D;  1NCZ A;  1K96 A;  3E3R A;  2ZFD A;  1DC1 A;  1D1O A;  3OB2 B;  4NDB A;  4P5O E;  3R1O A;  3R72 A;  2QAC A;  1MUX A;  4OV2 A;  3CZ2 A;  2RGI A;  1A75 B;  4Q04 A;  1SYM A;  3MSE B;  2ZND A;  4MRX A;  3V2L A;  1OZO A;  2Y5I A;  1UHK A;  2GTE A;  5KSZ A;  2L5Y A;  1PAL A;  3DVM A;  3KO0 A;  4M2P A;  3NSI A;  3BXK A;  4MEW A;  1SCM C;  3EK8 A;  1QS7 A;  1CMG A;  1BR1 B;  5D3O A;  5TNC A;  2JU0 A;  1L2O C;  2P71 A;  3BFB A;  1AHR A;  2Y4Q A;  1BG1 A;  1F70 A;  2KI6 D;  3PM8 A;  3CGA A;  1QX5 B;  5DKN A;  1PUL A;  1J1E A;  4INW A;  1M63 B;  2TN4 A;  2CBL A;  4QJ5 B;  1B7T Y;  2MLF C;  3GK1 A;  4M2Q A;  1C3Z A;  3FIA A;  4F0Z B;  2K7O A;  2KLE A;  1E8A A;  2KGR A;  3AAK A;  3CR2 A;  4C0J A;  1OOH A;  1GJY A;  1EG4 A;  2BKI B;  1EH2 A;  3PAL A;  1LIN A;  3JVT B;  4GGN A;  4CLN A;  3BUW B;  1J7P A;  3DY9 A;  2K7B A;  1NCX A;  2BL0 B;  1X02 A;  3BYA A;  3PJI A;  2HPS A;  1JC2 A;  1G4Y R;  1PRW A;  3SIB A;  1OMV A;  2LP3 A;  2QDI A;  3LK0 A;  2V53 A;  1SL8 A;  2K60 A;  4MSP A;  5HYD A;  1IH0 A;  5JOL A;  4ETO A;  1UHI A;  1UUS A;  3A8R A;  1S36 A;  3F45 A;  2LVK A;  3JTD C;  1S5G Y;  4CID A;  2BCB A;  1YRT B;  2KI4 C;  1SBJ A;  2L98 A;  3OHM B;  2QEO A;  3DYE A;  2MRD A;  3D10 A;  4OVN F;  1IJ6 A;  1UUR A;  3IVT A;  1A03 A;  1YVH A;  2JOJ A;  2LMU A;  1C07 A;  1JSA A;  2OPO A;  1FI6 A;  2M7L A;  1KWO B;  4GNK B;  1WLZ A;  4DRW A;  1XA5 A;  1QJT A;  2HF5 A;  2QEB A;  2WCE A;  1NUB A;  2KAY A;  1QX2 A;  1SCM B;  3Q8I A;  3RM1 A;  1CB1 A;  1S1E A;  5CSJ A;  3WXA A;  2E6W A;  3EKH A;  1F54 A;  1V1G A;  3RLZ A;  1CFD A;  1BT6 A;  2M1U A;  2O5G A;  1J1D A;  3O78 A;  1JFK A;  2EGD A;  4DIR A;  1GQM A;  1YUT A;  2L4I A;  4USL A;  1B8C A;  2GV5 A;  2ZN9 A;  1V1F A;  3SS3 A;  1FPW A;  1SKT A;  3GK2 A;  2MA2 A;  2BE4 A;  1JF0 A;  3VGO A;  1TNP A;  1XFW O;  2FJU B;  4FQO A;  5HLO A;  4WRI A;  2KFF A;  4NDC A;  1XFU O;  2LNK A;  2NZ0 A;  3KPX A;  2HQ8 A;  1XFZ O;  3D73 A;  3BUN B;  1A75 A;  1PVA A;  4PT1 A;  2FCE A;  2K61 A;  2NCP A;  3DF0 B;  1WLM A;  5FI6 A;  3K21 A;  5CSI A;  5AER A;  2K8M B;  2OS8 B;  3FWC A;  3SS4 A;  1BF5 A;  1XFR A;  1T14 A;  1H4B A;  1MQ1 A;  2BBM A;  2AAO A;  1DJH A;  2EHB A;  3OGN A;  3OP0 A;  2Y1M A;  3GK4 X;  1K9K A;  1NP8 A;  1XYD A;  1K8U A;  2JUL A;  2BBN A;  2FCD A;  2KYF A;  3VRO A;  2KAX A;  3IQO A;  3NXA A;  4JPZ B;  2PRU A;  2PAS A;  4ORB B;  1RFJ A;  3AKB A;  3UNW A;  1QV1 A;  3VRQ A;  1GGZ A;  3HX4 A;  1G33 A;  4PHK A;  3BOW B;  4U8D A;  4L9M A;  3UO9 A;  2COL B;  2KI4 B;  5I94 A;  1XK4 A;  1XK4 C;  2MAZ A;  2SAS A;  3ZWH A;  1K95 A;  3SG6 A;  2BAP A;  1UHH A;  3LK1 A;  1CDM A;  1NX0 A;  2L50 A;  3D74 A;  1Z2C B;  1J7R A;  1SMG A;  2ZNE A;  4I5K A;  2WC6 A;  4QJ4 B;  2LUC A;  2M8U A;  3I5H B;  2LE9 B;  3JVT C;  5F6T A;  1N0Y A;  2WCM A;  3CTN A;  1CMF A;  1TWO A;  3I5G B;  1FF1 A;  4NDD A;  2VRG A;  3GOF A;  1KFU S;  2BL0 C;  2MBX A;  3D76 A;  1J7Q A;  2M49 B;  1C3Y A;  2JXL A;  2M1K B;  1TNQ A;  2BKH B;  1BMO A;  4YGA A;  5D7F A;  3D0Y A; 
#chains in the Genus database with same CATH homology
 1DTL A;  1N65 A;  1LA0 A;  3CZT X;  4DCK A;  1BOD A;  1TNX A;  4GFT A;  1QVI Y;  1S6J A;  3TDZ A;  1SNL A;  1MHO A;  5CSN A;  5PAL A;  1DJZ A;  2AMI A;  1WRL A;  2KAV A;  4ORA B;  3TZ1 A;  1SL7 A;  4CPV A;  1ODB A;  1KWO C;  5AAN A;  3IF7 A;  1KCY A;  4WQ3 A;  1WDC B;  2K7D A;  3PAT A;  4YGC B;  4ZCU A;  1PVB A;  2L51 A;  2WND A;  3CR5 X;  4GPL B;  1TN4 A;  2WOS A;  2CCM A;  2JTT A;  1XVJ A;  1CLM A;  1LVC D;  1QAS A;  1TCO B;  3EKJ A;  2L2E A;  2EC6 B;  1SPY A;  2LP2 A;  5DKR A;  1QLK A;  4C0L A;  4MRY A;  1AJ5 A;  5G08 A;  1KK8 B;  1A2X A;  2JRF A;  2MJW B;  3DF0 A;  4OR9 B;  1MR8 A;  2KNE A;  2KI6 C;  3KHE A;  1UP5 A;  1YUR A;  4ICB A;  5HKZ A;  2GGM A;  2OS8 C;  1KK7 Z;  1IQ5 A;  3I5F B;  2JNX A;  1KFX L;  2CNP A;  4HRH A;  3KEV A;  3BUM B;  4CFR A;  3IQQ A;  2I18 A;  2HQW A;  2WCB A;  1RJV A;  2JTZ A;  1AP4 A;  2LVJ A;  1AJ4 A;  1MWN A;  3D0Y B;  1KSO A;  3NSK A;  1EXR A;  1MXE A;  4YRU A;  2IS9 A;  3BOW A;  2PVB A;  1NYA A;  1FW4 A;  4MVF A;  2LVV A;  1M39 A;  4PE1 A;  3PSR A;  2F3Y A;  1OMD A;  1NX3 A;  2KYC A;  2E30 A;  1Y6W A;  2CT9 A;  5BPJ A;  1DF0 A;  1SY9 A;  2A4J A;  1KQM C;  3AKA A;  1DJY A;  2H2K A;  2O60 A;  1EJ3 A;  1RK9 A;  2KFH A;  2F2O A;  5AEQ A;  4MZL A;  3I5H C;  3SJS A;  4PDZ A;  1AUI B;  1DJX A;  1TTX A;  3EVR A;  4XJK A;  4I5N B;  1CDN A;  5KTY A;  3I5G C;  1W7I B;  2K0J A;  1PK0 D;  1IQ3 A;  1OE9 B;  1OSA A;  4PE7 A;  1G8I A;  1YR5 A;  2SCP A;  2CXJ A;  3BUO B;  1M46 A;  1ZFS A;  1TCF A;  1B1G A;  1FI5 A;  1UWO A;  4TNC A;  5ER4 X;  1TRF A;  1BOC A;  3PN7 C;  3DVE A;  2JQ6 A;  1KSM A;  2LLS A;  1K93 D;  2LAP A;  3SG3 A;  2LUX A;  1LA3 A;  5IBW A;  2WC8 A;  1DGU A;  1MF8 B;  1WRK A;  1ZOT B;  1YVL A;  4P2Y B;  5GQQ C;  3TDI A;  1WDC C;  2JPT A;  1B7T Z;  4GGF A;  4GGF C;  1JFJ A;  2JT8 A;  3VRR A;  2LMT A;  5DKQ A;  1QV0 A;  2FOT A;  2M9G A;  1WRZ A;  1WY9 A;  1PSB A;  1QAT A;  1JF2 A;  1S3P A;  1SRA A;  1NCY A;  5FYX A;  1RRO A;  4WQ2 A;  4HRG A;  2M0R A;  4PE4 A;  2LLU A;  3ICB A;  2EC6 C;  2F8P A;  3WNX B;  1FBV A;  2K2F A;  1QIV A;  1Y1U A;  2JNF A;  1BR4 B;  1NSH A;  1KK8 C;  2Y1N A;  1DF0 B;  4C0K A;  2I94 A;  2PAL A;  4MBE A;  1B9A A;  1KQM B;  2F33 A;  2KGB C;  1EL4 A;  1CNP A;  4I5J A;  1U5I B;  1GGW A;  3I5F C;  4XJK B;  1IGV A;  1K2H A;  4A4C A;  1R6P A;  1S5G Z;  4I5L B;  4AQJ A;  2ZRS A;  1BLQ A;  1RWY A;  4OKH A;  1CDL A;  1KFX S;  2KFG A;  3AAJ A;  1BU3 A;  4M2O A;  1IRJ A;  2JT0 A;  1UHJ A;  1QX7 A;  2I2R E;  2M97 A;  4GUK A;  1J7O A;  3PN7 B;  4PE0 A;  3LLE A;  4MN0 A;  1QXP A;  3PLF B;  1DJG A;  1B47 A;  1L7Z A;  2H61 A;  2H61 C;  1K9P A;  1QTX A;  1ZUZ A;  1C7W A;  2JXC A;  1TOP A;  3SG7 A;  1NIW A;  2G9B A;  2K2A A;  3TUY B;  2LVI A;  4MZK A;  1CLL A;  3CR4 X;  1DGV A;  4ORC B;  2ZRT A;  4ZCV A;  3M0W A;  2AUC A;  2Q4U A;  4A4B A;  2JC2 A;  1N2D A;  1ZAC A;  2M7N A;  1S26 D;  4N1F A;  1NX2 A;  3O2P A;  4AOM A;  1CFP A;  2LM5 A;  3EVV A;  2KHN A;  5J3X A;  1Q80 A;  4QJ3 B;  1B4C A;  1YX8 A;  4YI8 A;  1HT9 A;  1SR6 B;  3TS5 B;  2LLT A;  3DVJ A;  2QPT A;  1Y1A A;  1CFF A;  2F2P A;  1IJ5 A;  1YX7 A;  2LMV A;  4HSZ A;  3NSL A;  2ISD A;  3HCM A;  2KBI A;  2G2B A;  1ALV A;  1ZMZ A;  1Y0V H;  2KBM A;  3A4U B;  2ZN8 A;  1OZS A;  1CM1 A;  1XFV O;  2OTG B;  1A4P A;  1DJW A;  4BY5 A;  2K7C A;  2PSR A;  5K89 A;  1DVI A;  3QRX A;  3DVK A;  1F4O A;  2JZI A;  3BUX B;  1TNW A;  3LCP C;  5KU1 A;  2LHI A;  5CSF A;  1W7J B;  2BE6 A;  1YRU B;  3H4S E;  4IL1 A;  5JJG A;  3OB1 B;  5KSZ A;  1XFY O;  4YGD B;  3WHT B;  4BY4 A;  3NSO A;  3KF9 A;  3I5I B;  1NPQ A;  1JWD A;  1QLS A;  1OOJ A;  1VRK A;  4E68 A;  2GGZ A;  1TIZ A;  2KSP A;  1ALW A;  1KFU L;  1K9U A;  2LAN A;  4OCI A;  3EK4 A;  5D69 A;  4JWQ A;  5I2Q A;  2D8N A;  4DS7 A;  5I8N A;  2DOQ A;  3O6B A;  1QIW A;  1B8R A;  1CDP A;  1JBA A;  1CKK A;  1SL9 A;  1U5I A;  1NWD A;  2KQ6 A;  1AVS A;  4PHJ A;  1EG3 A;  4PHM A;  2NCO A;  1IG5 A;  4YGB B;  4N5X A;  1QVI Z;  1S6I A;  4NQG A;  4YGE B;  1KQV A;  1OQP A;  4MZJ A;  2MLE C;  2M29 A;  5I2O A;  3C1V A;  5B8I B;  1S6C A;  1DJI A;  3SG4 A;  1HQV A;  1OMR A;  2Q91 A;  1K94 A;  4PHN A;  2L5X B;  5CPV A;  1XFX O;  2JT3 A;  1DMO A;  4XYN A;  3BQ3 A;  3ZNI A;  2I7A A;  1A29 A;  1F71 A;  1J55 A;  1L2O B;  3TUY C;  2HET A;  1CTR A;  1JUO A;  2BCX A;  1NX1 A;  3CWG A;  3EK7 A;  1XO5 A;  5AXI A;  4FTG A;  5ER5 A;  4AQI A;  3SG2 A;  2JWW A;  1YUU A;  4CFQ A;  2F3Z A;  1CFC A;  1MXL C;  2WCF A;  3VRN A;  1AK8 A;  4R1E A;  3CS1 A;  3TDU A;  2MHH A;  4PAL A;  1RTP 1;  3SIA A;  2BCA A;  3O4Y A;  3FWB A;  1PSR A;  5I2L A;  1CM4 A;  1DT7 B;  4PCW A;  3FS7 A;  4D1E A;  4YBH B;  4YI9 A;  4JQ0 D;  1BJF A;  2P6B B;  2LC5 A;  1IWQ A;  1CLB A;  3PFV A;  1IKU A;  1SR6 C;  3TS5 C;  1R2U A;  2L0P A;  1LXF C;  1REC A;  1SK6 D;  1Y1X A;  4N1G A;  2LCP A;  2OTG C;  1KK7 Y;  4HRE E;  3SG5 A;  3EVU A;  3JTD B;  2LV7 A;  3DD4 A;  1LKJ A;  1F4Q A;  1SCV A;  2WOR A;  4DUQ A;  3VRP A;  5HKY A;  1H8B A;  2BEC A;  3OX5 A;  4UPG A;  1YUS A;  2ZKM X;  1YTZ C;  3WHU B;  1M31 A;  3I5I C;  2NLN A;  4MLW A;  1F8H A;  2LHL A;  2M3W A;  5AFP A;  3CLN A;  2R2I A;  1UHN A;  2PMY A;  1SW8 A;  4GAO A;  3LL8 B;  1F55 A;  2KOT A;  2B1U A;  3OX6 A;  2L4H A;  1M45 A;  2KQY A;  1B8L A;  2KDH A;  5HKW A;  4GBA A;  1C7V A;  2CTN A;  2NXQ A;  1K90 D;  1NCZ A;  1K96 A;  3E3R A;  2ZFD A;  1D1O A;  3OB2 B;  4NDB A;  4P5O E;  2QAC A;  1MUX A;  4OV2 A;  2RGI A;  1A75 B;  4Q04 A;  1SYM A;  3MSE B;  2ZND A;  4MRX A;  1OZO A;  2Y5I A;  1UHK A;  1PAL A;  3DVM A;  3KO0 A;  4M2P A;  3NSI A;  3BXK A;  4MEW A;  1SCM C;  3EK8 A;  1QS7 A;  1CMG A;  1BR1 B;  5TNC A;  2JU0 A;  1L2O C;  1BG1 A;  1F70 A;  1AHR A;  2Y4Q A;  2KI6 D;  3PM8 A;  3CGA A;  1QX5 B;  5DKN A;  1PUL A;  1J1E A;  1M63 B;  2TN4 A;  2CBL A;  4QJ5 B;  1B7T Y;  2MLF C;  3GK1 A;  4M2Q A;  3FIA A;  4F0Z B;  2K7O A;  3AAK A;  1E8A A;  2KGR A;  3CR2 A;  4C0J A;  1GJY A;  1EG4 A;  2BKI B;  1EH2 A;  3PAL A;  1LIN A;  3JVT B;  4GGN A;  4CLN A;  3BUW B;  1J7P A;  2K7B A;  1NCX A;  2BL0 B;  1X02 A;  3BYA A;  2HPS A;  1JC2 A;  1G4Y R;  1PRW A;  3SIB A;  1OMV A;  2LP3 A;  3LK0 A;  4MSP A;  2V53 A;  1SL8 A;  1IH0 A;  5HYD A;  5JOL A;  4ETO A;  1UHI A;  1UUS A;  3A8R A;  1S36 A;  3F45 A;  2LVK A;  3JTD C;  1S5G Y;  4CID A;  2BCB A;  1YRT B;  2KI4 C;  1SBJ A;  2L98 A;  3OHM B;  4OVN F;  5HLV A;  2MRD A;  3D10 A;  1IJ6 A;  1UUR A;  1A03 A;  1YVH A;  2JOJ A;  2LMU A;  1C07 A;  1JSA A;  2OPO A;  1FI6 A;  2M7L A;  1KWO B;  4GNK B;  1WLZ A;  4DRW A;  1XA5 A;  1QJT A;  2HF5 A;  2WCE A;  1NUB A;  2KAY A;  1QX2 A;  1SCM B;  3RM1 A;  1CB1 A;  1S1E A;  5CSJ A;  3WXA A;  2E6W A;  3EKH A;  1F54 A;  1V1G A;  3RLZ A;  1CFD A;  1BT6 A;  2M1U A;  2O5G A;  1J1D A;  3O78 A;  1JFK A;  2EGD A;  4DIR A;  1GQM A;  1YUT A;  2L4I A;  4USL A;  1B8C A;  2GV5 A;  2ZN9 A;  1V1F A;  1FPW A;  1SKT A;  3GK2 A;  2MA2 A;  2BE4 A;  1JF0 A;  3VGO A;  1TNP A;  1XFW O;  2FJU B;  4FQO A;  5HLO A;  4WRI A;  2KFF A;  4NDC A;  1XFU O;  2LNK A;  2NZ0 A;  3KPX A;  2HQ8 A;  1XFZ O;  3BUN B;  1A75 A;  1PVA A;  2FCE A;  2K61 A;  2NCP A;  3DF0 B;  1WLM A;  3K21 A;  5CSI A;  5AER A;  2K8M B;  2OS8 B;  3FWC A;  1BF5 A;  1H4B A;  1MQ1 A;  2BBM A;  2AAO A;  1DJH A;  2EHB A;  3OP0 A;  2Y1M A;  3GK4 X;  1K9K A;  1NP8 A;  1XYD A;  1K8U A;  2JUL A;  2BBN A;  2FCD A;  2KYF A;  3VRO A;  2KAX A;  3IQO A;  3NXA A;  4JPZ B;  2PRU A;  2PAS A;  4ORB B;  1RFJ A;  3AKB A;  1QV1 A;  3VRQ A;  1GGZ A;  3HX4 A;  1G33 A;  4PHK A;  3BOW B;  4U8D A;  4L9M A;  2COL B;  2KI4 B;  1XK4 A;  1XK4 C;  2MAZ A;  2SAS A;  3ZWH A;  1K95 A;  3SG6 A;  1UHH A;  3LK1 A;  1CDM A;  1NX0 A;  2L50 A;  1J7R A;  1SMG A;  2ZNE A;  4I5K A;  4QJ4 B;  2LUC A;  2M8U A;  3I5H B;  2LE9 B;  3JVT C;  5F6T A;  1N0Y A;  3CTN A;  1CMF A;  3I5G B;  1FF1 A;  4NDD A;  2VRG A;  3GOF A;  1KFU S;  2BL0 C;  2MBX A;  1J7Q A;  2M49 B;  2JXL A;  2M1K B;  1TNQ A;  2BKH B;  1BMO A;  4YGA A;  5D7F A;  3D0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...