2NCPA

Nmr solution structure for the c-terminal domain of tetrahymena tcb2 in the presence of calcium
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
SSKPKYNPEVEAKLDVARRLFKRYDKDGSGQLQDDEIAGLLKDTYAEMGMSNFTPTKEDVKIWLQMADTNSDGSVSLEEYEDLIIKSLQKAGIRVEKQSLVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 25 kDa calcium-binding protein
publication title Solution NMR structures of the C-domain of Tetrahymena cytoskeletal protein Tcb2 reveal distinct calcium-induced structural rearrangements.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Metal binding protein
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ncpA00
1A75B 2KGBC 2NZ0A 4DUQA 1NPQA 1QV1A 1K2HA 4PHNA 5DKQA 5I8NA 1CNPA 1ZMZA 2LLTA 2ZN9A 1CFCA 1S36A 1YTZC 1DVIA 2ZN8A 1B1GA 2M29A 1K95A 3D0YA 2AUCA 1OE9B 2KQ6A 1PK0D 2JWWA 3OB2B 4USLA 4P5OE 1TRFA 1KQVA 1EJ3A 1UHIA 3LK0A 1D1OA 1DJIA 1MQ1A 2GV5A 1J55A 1ZACA 2WCFA 3I5IB 1DGVA 2BCBA 3O78A 1EL4A 4NDBA 1PALA 2BKIB 2L98A 2M9GA 5DKRA 2I18A 3VRNA 2I2RE 1K8UA 1RECA 3WHUB 1H8BA 1UHNA 2BBMA 1UHJA 3VRPA 3PM8A 1WDCC 1DJZA 3PALA 5I2LA 1G4YR 5HYDA 1S5GZ 1KK7Z 1XK4C 1CM4A 1KWOB 2LANA 1YR5A 2MJWB 2IS9A 3RLZA 1JFKA 2LCPA 4CLNA 1GGZA 2OS8B 1TNQA 3EK7A 3IQQA 3I5HC 2M1KB 3CR4X 5CSNA 4CFRA 2KAVA 1F54A 1U5IA 3E3RA 5G08A 2M8UA 1NCZA 1K94A 1G33A 5JJGA 1HQVA 1RJVA 1TNPA 1IQ5A 1TOPA 4WRIA 2CBLA 3DVJA 1DMOA 1BR4B 3OX5A 2LUCA 1WLZA 3BOWA 1W7IB 3D10A 1SL8A 1ALWA 1A2XA 3C1VA 3CZTX 2WORA 3OB1B 1IH0A 1SCMC 5ER4X 3SG6A 3WXAA 3PN7B 2CNPA 2KI4B 2PSRA 1PRWA 1DGUA 2L50A 2MAZA 1JF0A 2MLFC 2L5XB 1IRJA 4GNKB 2LM5A 3TS5C 2F33A 2ZKMX 3FWCA 1YVLA 1F8HA 5CPVA 1KFXL 2K7CA 1NP8A 1SL9A 1XA5A 5FYXA 1Y1XA 1MR8A 2KNEA 1WRZA 1M31A 1J1DA 2K2AA 3K21A 3PLFB 3DD4A 1XFWO 1YX7A 2CXJA 3PATA 2FOTA 4I5KA 4OCIA 1F55A 1MXEA 1JFJA 2BL0C 1C7WA 1TCOB 2KQYA 4JPZB 1QVIY 1XFYO 1K9PA 1BT6A 1C07A 4YGBB 4YGEB 1CDLA 1UURA 2CT9A 5J3XA 4DRWA 3CWGA 4GFTA 1JSAA 3BQ3A 5B8IB 2I94A 4NDDA 1LA0A 1SKTA 3BYAA 2V53A 1AHRA 1QLKA 3ICBA 2LVKA 4MZJA 1K90D 4M2QA 1IWQA 3KF9A 2K8MB 4PCWA 2JNXA 4PDZA 3SIBA 4NQGA 2K2FA 1EXRA 3VRQA 4BY5A 2PASA 3SJSA 4BY4A 2PMYA 2ZNDA 1IGVA 2O60A 3VROA 1RROA 1Y1UA 1KFXS 2KYCA 4MSPA 5AERA 5BPJA 1BLQA 3H4SE 3SG3A 4WQ2A 2F2PA 1QXPA 2ZNEA 2KYFA 3ZNIA 1DF0B 4R1EA 3DVMA 1X02A 4A4CA 4CIDA 2GGMA 3LCPC 1TNWA 3PSRA 1FPWA 2QPTA 1WDCB 4ICBA 3VRRA 4CFQA 2FCDA 1WRKA 2LP2A 3SIAA 1A29A 1JBAA 4TNCA 2O5GA 1CLBA 4QJ5B 1XFVO 2TN4A 1XFXO 2LUXA 3QRXA 4P2YB 2LVVA 4YI9A 2BE6A 2EGDA 2F3ZA 3I5HB 1DJXA 1S6IA 1Y6WA 4PALA 4MLWA 1CLMA 1L2OC 2WCBA 1EH2A 3O6BA 1K9UA 1JUOA 1RFJA 3EKJA 1OQPA 2BCAA 3KPXA 3D0YB 1CFDA 2KHNA 2FCEA 4N1FA 4YBHB 1BU3A 2RGIA 3A8RA 3FWBA 1QX2A 2JNFA 4MN0A 1SCMB 5HLOA 4XJKA 2FJUB 1YX8A 2M7NA 1QV0A 1QIWA 1IJ5A 1NX0A 2E6WA 2Y1NA 1XYDA 1ZOTB 2LP3A 3FS7A 3TS5B 3WHTB 1CTRA 2VRGA 2F8PA 1S3PA 2HQ8A 1MWNA 2L2EA 1TIZA 1Y0VH 3O2PA 2KBIA 4C0KA 3AAKA 1J7QA 4FQOA 3OP0A 2Y5IA 5IBWA 2AMIA 3SG5A 4C0LA 3EK8A 4L9MA 5CSIA 2L0PA 4GBAA 3AKBA 1TTXA 2MHHA 1ODBA 2BL0B 1OMRA 1OMVA 1SK6D 2JOJA 2LNKA 1JWDA 1M46A 2K7OA 4DS7A 2HETA 2L51A 2D8NA 1M45A 3GK2A 1U5IB 1KSMA 2BE4A 2JZIA 2WCEA 1CKKA 4F0ZB 1IG5A 1SY9A 2HF5A 4I5JA 1SMGA 1NUBA 2JULA 4I5NB 3TUYC 3BXKA 4MEWA 1EG4A 4PHJA 1ZUZA 1N0YA 1UHKA 1CMFA 1KK8C 4MVFA 3BOWB 2JC2A 3KEVA 1NX3A 3SG4A 1N2DA 1OZSA 3SG7A 2JXLA 1CDMA 2OTGC 2NCPA 2LV7A 1GGWA 1LKJA 1R6PA 4YGAA 1MUXA 1YUUA 2K61A 5CSFA 1F71A 4AOMA 2HPSA 1FBVA 1KQMC 4YRUA 1QASA 1DT7B 3VGOA 3BUWB 3EVUA 5I2OA 1AP4A 4JWQA 1S1EA 1XFZO 2E30A 1C7VA 2R2IA 3OHMB 1M39A 5HKWA 1HT9A 3EVVA 3F45A 1G8IA 1B7TZ 2EC6C 3CTNA 1SPYA 2BCXA 2L4HA 2M0RA 2SCPA 2QACA 1AJ5A 1FI5A 1B8CA 1BODA 1J7PA 1R2UA 2JT8A 2AAOA 1L2OB 2OPOA 4GGNA 1S6JA 4YGCB 1Q80A 1A03A 4ORAB 4U8DA 3CR5X 2KAXA 4HRGA 1YRUB 1DJGA 3SG2A 3EK4A 1LINA 4HREE 2NXQA 3GK1A 1JC2A 1YUTA 2JRFA 2JT3A 1OSAA 1PSBA 3HX4A 4FTGA 1KFUS 3GOFA 4GAOA 1DJWA 3HCMA 2KI6C 3LL8B 1CDNA 2CCMA 1CLLA 4GUKA 2LMTA 4AQJA 1CDPA 2M97A 3M0WA 1TNXA 4GGFA 3NSKA 2B1UA 3KO0A 4MBEA 4N5XA 1OOJA 4HSZA 4DCKA 1YVHA 4N1GA 1TN4A 3NSIA 4XYNA 2Q91A 3I5FB 2MBXA 2PVBA 2I7AA 3CGAA 2ISDA 1BF5A 1PSRA 1GQMA 4OKHA 1CB1A 1K93D 3DF0A 4OR9B 3DVKA 1LXFC 1L7ZA 3MSEB 4Q04A 2LVIA 2P6BB 4CPVA 1S6CA 2KOTA 4YI8A 1SYMA 2M3WA 1A75A 1Y1AA 2KAYA 3NSLA 5D7FA 4QJ4B 3A4UB 1AK8A 1H4BA 4M2OA 2M7LA 2JXCA 1FW4A 5K89A 1B8RA 5AANA 1KK8B 4WQ3A 1UUSA 2KDHA 1K9KA 2KSPA 2Q4UA 1SR6C 3AKAA 2L4IA 5PALA 4XJKB 4OVNF 1N65A 4PE0A 2KBMA 5AEQA 4GGFC 1S5GY 1KK7Y 2OTGB 1QS7A 4GPLB 1GJYA 1W7JB 1ZFSA 1QX5B 2LC5A 1NX1A 2JT0A 2LVJA 1OZOA 1KQMB 1YUSA 1BMOA 2CTNA 2KFFA 1OMDA 1PULA 2MLEC 3I5GC 4PHKA 1SL7A 1SW8A 1NYAA 3JTDC 5F6TA 1UP5A 5ER5A 2WC8A 2ZRTA 1QX7A 2F2OA 3CLNA 2EC6B 2LHIA 2KI6D 3CS1A 1J7OA 2MRDA 1NCYA 2BKHB 2LLUA 2H61A 3TDUA 1LA3A 1TCFA 1CMGA 3JVTC 1XVJA 1PVAA 3BUNB 3ZWHA 1NWDA 4ZCVA 3BUOB 1AVSA 1J1EA 4D1EA 2ZRSA 1UWOA 1RTP1 2JQ6A 3TDIA 5DKNA 2DOQA 3IQOA 4HRHA 2F3YA 1WLMA 2GGZA 2PALA 1NX2A 2KGRA 4PE1A 1M63B 5JOLA 1E8AA 4DIRA 1SNLA 3WNXB 2NLNA 3O4YA 1KFUL 4MRXA 1UHHA 4MRYA 2G9BA 2ZFDA 1B47A 3AAJA 1RK9A 5TNCA 1WRLA 1IJ6A 3OX6A 3I5IC 4JQ0D 1NIWA 5HKZA 2WOSA 4OV2A 1F4QA 1QATA 4AQIA 1YRTB 1CFPA 5HKYA 2SASA 1B7TY 2LE9B 3KHEA 4I5LB 5D69A 1NSHA 2LMUA 1BJFA 5KTYA 1K96A 1MF8B 1FF1A 1F70A 1KWOC 1QLSA 4M2PA 4ZCUA 2H61C 1AJ4A 2NCOA 3NXAA 1YURA 2EHBA 2OS8C 1MHOA 1A4PA 2HQWA 1SCVA 2KFHA 2WNDA 3BUMB 4UPGA 5I2QA 1BR1B 1QJTA 2LLSA 4MZLA 4MZKA 1QIVA 1QVIZ 3IF7A 5AXIA 1SRAA 2BBNA 2JTZA 3CR2A 2JPTA 5AFPA 1IQ3A 1J7RA 1S26D 4NDCA 3TDZA 1BOCA 1RWYA 2G2BA 1IKUA 5GQQC 4ORCB 1F4OA 2KFGA 2COLB 1B4CA 4A4BA 2LMVA 3LLEA 2MA2A 2PRUA 3I5FC 1SR6B 1QTXA 1JF2A 2K7BA 5KU1A 4IL1A 1DTLA 3BUXB 3PN7C 1CFFA 2KI4C 1KCYA 1VRKA 3FIAA 2Y1MA 5HLVA 2K7DA 3RM1A 3NSOA 1FI6A 2Y4QA 1DF0A 1EG3A 4PHMA 1WY9A 3EVRA 2BECA 2H2KA 1B9AA 1PVBA 1MXLC 1LVCD 2JU0A 3I5GB 1BG1A 1V1GA 3JTDB 1V1FA 3LK1A 1XFUO 2A4JA 2JTTA 5KSZA 1DJYA 1DJHA 2K0JA 2M1UA 5CSJA 1ALVA 1XK4A 4PE7A 4C0JA 3TZ1A 3EKHA 1KSOA 1SBJA 3DF0B 4ORBB 4E68A 4YGDB 2LHLA 3PFVA 2M49B 3JVTB 1AUIB 2LAPA 1NCXA 1CM1A 3GK4X 1XO5A 4PE4A 3TUYB 3DVEA 4QJ3B 1B8LA 4ETOA
chains in the Genus database with same CATH superfamily
1A75B 2KGBC 2NZ0A 4DUQA 1NPQA 1QV1A 3PM2A 1K2HA 4PHNA 5DKQA 5I8NA 1CNPA 1OOFA 1ZMZA 2LLTA 2ZN9A 1CFCA 1S36A 1YTZC 1DVIA 2GTEA 2ZN8A 1B1GA 2M29A 1K95A 3D0YA 2AUCA 1OE9B 2KQ6A 1PK0D 2JWWA 3OB2B 1TWOA 4USLA 4P5OE 1TRFA 1KQVA 1EJ3A 1UHIA 3BFHA 3LK0A 1D1OA 1DJIA 1MQ1A 2GV5A 1J55A 1ZACA 2WCFA 3I5IB 1DGVA 2BCBA 3O78A 1EL4A 4NDBA 1PALA 2BKIB 2L98A 2M9GA 3FE8A 2I18A 5DKRA 2I2RE 3VRNA 1K8UA 1RECA 3WHUB 1H8BA 1UHNA 2BBMA 1UHJA 3VRPA 3PM8A 1T14A 1WDCC 1DJZA 3PALA 5I2LA 1G4YR 1IIOA 5HYDA 1S5GZ 1KK7Z 1XK4C 3UO9A 1CM4A 2K60A 1KWOB 2LANA 1YR5A 2MJWB 2IS9A 5D3OA 3RLZA 1JFKA 2LCPA 4CLNA 1GGZA 2OS8B 1TNQA 3EK7A 3IQQA 3I5HC 2M1KB 3CR4X 5CSNA 4CFRA 2KAVA 1F54A 3R1PA 1U5IA 3E3RA 5G08A 2M8UA 1NCZA 1K94A 1G33A 5JJGA 1HQVA 1RJVA 1TNPA 1IQ5A 1TOPA 1TUJA 5EL2A 4WRIA 2CBLA 3DVJA 4JKTA 1BR4B 3OX5A 1DMOA 2LUCA 1WLZA 3BOWA 1W7IB 3D10A 1SL8A 1ALWA 1A2XA 3C1VA 3CZTX 2WORA 3CDNA 3OB1B 1IH0A 1SCMC 5ER4X 3SG6A 3WXAA 3PN7B 2CNPA 2KI4B 2PSRA 1PRWA 1DGUA 2L50A 2MAZA 1JF0A 2MLFC 2L5XB 1IRJA 4GNKB 2LM5A 3TS5C 2F33A 2ZKMX 3FWCA 1YVLA 1F8HA 5CPVA 4JD9A 1KFXL 2K7CA 1NP8A 1SL9A 1XA5A 5FYXA 1Y1XA 1MR8A 2KNEA 1WRZA 3D73A 1M31A 1J1DA 2K2AA 1TUZA 3K21A 3PLFB 3DD4A 1XFWO 1YX7A 2CXJA 3PATA 2FOTA 4I5KA 4OCIA 1F55A 2KPHA 1MXEA 1JFJA 2BL0C 1C7WA 3D76A 1TCOB 2KQYA 4JPZB 1QVIY 1XFYO 1K9PA 1BT6A 1C07A 4YGBB 4YGEB 5FI6A 3NHIA 1CDLA 1UURA 2CT9A 3B7AA 5J3XA 2WCLA 4DRWA 3CWGA 4GFTA 1JSAA 3BQ3A 5B8IB 2I94A 4NDDA 1LA0A 1SKTA 2WCMA 2V53A 1AHRA 1QLKA 3BYAA 2LVKA 3ICBA 1DEKA 4MZJA 1K90D 4M2QA 3L47A 1IWQA 3KF9A 2K8MB 4PCWA 2JNXA 4PDZA 3SIBA 4NQGA 2K2FA 1EXRA 3VRQA 4BY5A 2PASA 3SJSA 4BY4A 2PMYA 2ZNDA 1IGVA 2O60A 3VROA 1RROA 1Y1UA 1KFXS 2KYCA 4MSPA 5AERA 5BPJA 1BLQA 3H4SE 3SG3A 4WQ2A 3VB1A 2F2PA 1QXPA 1W9ZA 2ZNEA 2KYFA 3ZNIA 1DF0B 1F71A 2ERBA 4R1EA 3DVMA 1X02A 4A4CA 2JPOA 4CIDA 2GGMA 3LCPC 1TNWA 3PSRA 1FPWA 3FE9A 2QPTA 1WDCB 4ICBA 3VRRA 4CFQA 2FCDA 1WRKA 2LP2A 1QWVA 1A29A 3SIAA 1JBAA 4TNCA 2O5GA 1CLBA 4QJ5B 1XFVO 2TN4A 3SS5A 1XFXO 2LUXA 3L4AA 1ORGA 3QRXA 4P2YB 2LVVA 3CYZA 4YI9A 2BE6A 2EGDA 2KLDA 3V2LA 3B87A 2F3ZA 3I5HB 1DJXA 1S6IA 1Y6WA 4PALA 4MLWA 1CLMA 1L2OC 2WCBA 1J7OA 1EH2A 3O6BA 3R1OA 1K9UA 1JUOA 4INXA 1RFJA 3EKJA 2L5YA 4OZDA 2PYQA 3D77A 1OQPA 2BCAA 3KPXA 3D0YB 1CFDA 2KHNA 2FCEA 4N1FA 4YBHB 1BU3A 2RGIA 3A8RA 3FWBA 1QX2A 2JNFA 4MN0A 1SCMB 5HLOA 4XJKA 2FJUB 1C3ZA 1YX8A 2M7NA 1QV0A 1QIWA 1IJ5A 1NX0A 2E6WA 2Y1NA 1XYDA 1ZOTB 2LP3A 3FS7A 3TS5B 3WHTB 1CTRA 2VRGA 2F8PA 1S3PA 2HQ8A 1MWNA 1GM0A 1OOHA 1TIZA 2L2EA 1Y0VH 3O2PA 2KBIA 3K1EA 4C0KA 3AAKA 1SSEB 1J7QA 4FQOA 3OP0A 2Y5IA 5IBWA 4PT1A 2AMIA 3SG5A 4C0LA 3EK8A 4L9MA 5CSIA 2L0PA 4GBAA 3AKBA 1TTXA 2MHHA 3BJHA 1ODBA 2BL0B 1OMRA 1OMVA 1SK6D 2JOJA 2LNKA 3D74A 1M46A 1JWDA 2K7OA 4DS7A 2HETA 2L51A 2D8NA 1M45A 3GK2A 3NHTA 1U5IB 1KSMA 2BE4A 2JZIA 2WCEA 1CKKA 3S0AA 4F0ZB 3OGNA 1IG5A 1SY9A 2HF5A 4I5JA 1SMGA 1NUBA 2JULA 4I5NB 5I94A 3TUYC 3BXKA 4MEWA 1EG4A 4PHJA 1ZUZA 1N0YA 1UHKA 1CMFA 1KK8C 2QDIA 4MVFA 3BOWB 2JC2A 3KEVA 1DC1A 1NX3A 4KYNA 1N2DA 3SG4A 1OZSA 3SG7A 2JXLA 1CDMA 2OTGC 2QEHA 3CZ1A 2NCPA 2LV7A 1GGWA 1LKJA 1R6PA 4YGAA 1MUXA 1YUUA 2K61A 5CSFA 3S0DA 4AOMA 2HPSA 1FBVA 1KQMC 2WCJA 4YRUA 1QASA 1DT7B 2YGUA 3VGOA 3BUWB 3EVUA 5I2OA 1AP4A 2BAPA 4JWQA 1S1EA 1XFZO 2E30A 1C7VA 2R2IA 3OHMB 1M39A 5HKWA 1HT9A 3R1VA 3EVVA 3F45A 1G8IA 1B7TZ 3FE6A 2EC6C 3CTNA 1SPYA 2BCXA 2L4HA 2M0RA 2SCPA 2QACA 1AJ5A 1FI5A 1B8CA 1BODA 3B6XA 1J7PA 1R2UA 2JT8A 2AAOA 1L2OB 2OPOA 4GGNA 1S6JA 4YGCB 1Q80A 1Z4HA 1A03A 4ORAB 4U8DA 3CR5X 2KAXA 4HRGA 1YRUB 1XFRA 1DJGA 3SG2A 4F7FA 3EK4A 1LINA 4HREE 2NXQA 3GK1A 1JC2A 1YUTA 2JRFA 2JT3A 1OSAA 1PSBA 3HX4A 4FTGA 1KFUS 3GOFA 4GAOA 1DJWA 3HCMA 2KI6C 3LL8B 1CDNA 2CCMA 1CLLA 4GUKA 2LMTA 4AQJA 1CDPA 2M97A 3M0WA 1TNXA 4GGFA 2P70A 3NSKA 3PJIA 3R72A 3UNWA 2B1UA 3KO0A 4MBEA 4N5XA 1OOJA 4HSZA 4DCKA 1YVHA 3CZ2A 4N1GA 1TN4A 3NSIA 3SS4A 4XYNA 1P28A 2Q91A 3I5FB 2MBXA 2PVBA 3CZ0A 2I7AA 1OOIX 3CGAA 2ISDA 1BF5A 1PSRA 1GQMA 3L4LA 3S0FA 1DQEA 3QMEA 4OKHA 1CB1A 1K93D 3DF0A 3DY9A 4INWA 4OR9B 3DVKA 1LXFC 1L7ZA 2QEBA 3MSEB 4Q04A 2LVIA 2P6BB 2BNXA 2QEVA 4CPVA 1S6CA 2KOTA 4YI8A 3DXLA 1SYMA 2M3WA 1A75A 1Y1AA 2KAYA 3NSLA 3B88A 5D7FA 4QJ4B 3A4UB 1AK8A 1H4BA 4M2OA 2M7LA 2JXCA 1FW4A 5K89A 1B8RA 5AANA 1KK8B 4WQ3A 1UUSA 2KDHA 3DYEA 1K9KA 1LS8A 2KSPA 2Q4UA 1SR6C 3AKAA 2L4IA 5PALA 3O4XA 4XJKB 4OVNF 1N65A 4PE0A 2KBMA 5AEQA 4GGFC 1S5GY 1KK7Y 2OTGB 1QS7A 4GPLB 1GJYA 1W7JB 1ZFSA 1QX5B 2LC5A 5FI2A 1NX1A 2JT0A 2LVJA 1OZOA 2PQLA 1KQMB 1YUSA 3D75A 1BMOA 2CTNA 2KFFA 2H8VA 2WC6A 1OMDA 1PULA 2MLEC 3I5GC 4PHKA 1SL7A 1SW8A 2KLEA 1NYAA 3JTDC 5F6TA 1UP5A 3NGVA 5ER5A 2WC8A 2ZRTA 1QX7A 2F2OA 3CLNA 2EC6B 2LHIA 2KI6D 3CABA 3CS1A 2MRDA 1NCYA 2BKHB 5HL1A 2LLUA 2H61A 3TDUA 1LA3A 1TCFA 1CMGA 3JVTC 1XVJA 1PVAA 3BUNB 3ZWHA 1NWDA 4ZCVA 3BUOB 1AVSA 1J1EA 4D1EA 2ZRSA 3DZTA 1UWOA 1RTP1 2JQ6A 3TDIA 5DKNA 2DOQA 3IQOA 4HRHA 2F3YA 1WLMA 2GGZA 2PALA 1NX2A 3D78A 2KGRA 4PE1A 1M63B 5JOLA 1E8AA 4DIRA 1SNLA 3WNXB 2NLNA 3O4YA 1KFUL 4MRXA 1UHHA 4MRYA 2QEOA 2G9BA 2ZFDA 3BFAA 1B47A 3AAJA 1C3YA 1RK9A 5TNCA 1WRLA 1IJ6A 3OX6A 3RZSA 3I5IC 4JQ0D 1NIWA 5HKZA 1DELA 2WOSA 2FJYA 4OV2A 1F4QA 1QATA 3BFBA 4AQIA 1YRTB 1CFPA 5HKYA 2SASA 1B7TY 2LE9B 3KHEA 4I5LB 5D69A 2WCHA 1NSHA 2LMUA 3SS3A 1BJFA 4FQTA 3OBVA 5KTYA 1K96A 1MF8B 2WC5A 1FF1A 1F70A 1KWOC 1QLSA 4M2PA 4ZCUA 2H61C 1AJ4A 2NCOA 3N7HA 3NXAA 1YURA 2EHBA 2OS8C 1MHOA 1A4PA 2HQWA 1SCVA 2KFHA 2WNDA 3BUMB 4UPGA 5I2QA 1BR1B 1QJTA 2LLSA 4MZLA 4MZKA 1QIVA 1QVIZ 3IF7A 5AXIA 1SRAA 2BBNA 2JTZA 3CR2A 2JPTA 5AFPA 1IQ3A 1J7RA 1S26D 4NDCA 3TDZA 1BOCA 2WCKA 1RWYA 2G2BA 1IKUA 5FI7A 4ORCB 1F4OA 2KFGA 3IVTA 2COLB 5GQQC 4A4BA 2LMVA 3LLEA 1B4CA 2MA2A 2PRUA 3EG5B 1SR6B 3I5FC 1QTXA 1JF2A 2K7BA 5KU1A 4IL1A 1DTLA 3S0BA 3BUXB 3PN7C 1CFFA 2KI4C 1KCYA 2L2CA 1VRKA 3FIAA 2Y1MA 3B86A 5HLVA 2K7DA 3RM1A 3NSOA 1FI6A 2Y4QA 1DF0A 1EG3A 4PHMA 1WY9A 3EVRA 2BECA 2H2KA 1B9AA 1PVBA 1MXLC 1LVCD 2JU0A 3I5GB 1BG1A 4IJ7A 1V1GA 3JTDB 1V1FA 3LK1A 1XFUO 2A4JA 2JTTA 5KSZA 1DJYA 3S0GA 1DJHA 3S0EA 2K0JA 2M1UA 5CSJA 1ALVA 1XK4A 4PE7A 1Z2CB 3TZ1A 4C0JA 3EKHA 1KSOA 1SBJA 3DF0B 4ORBB 5DICA 4E68A 4YGDB 2LHLA 3PFVA 2M49B 3JVTB 1AUIB 2LAPA 1NCXA 1CM1A 3GK4X 1XO5A 4PE4A 1OW4A 3DVEA 4QJ3B 3TUYB 3Q8IA 1B8LA 4ETOA 2P71A 1OOGA
chains in the Genus database with same CATH topology
1A75B 2KGBC 2NZ0A 4DUQA 1NPQA 1QV1A 1K2HA 4PHNA 5DKQA 5I8NA 1CNPA 1ZMZA 2LLTA 2ZN9A 1CFCA 1S36A 1YTZC 1DVIA 2ZN8A 1B1GA 2M29A 1K95A 3D0YA 2AUCA 1OE9B 2KQ6A 1PK0D 2JWWA 3OB2B 4USLA 4P5OE 1TRFA 1KQVA 1EJ3A 1UHIA 3LK0A 1D1OA 1DJIA 1MQ1A 2GV5A 1J55A 1ZACA 2WCFA 3I5IB 1DGVA 2BCBA 3O78A 1EL4A 4NDBA 1PALA 2BKIB 2L98A 2M9GA 5DKRA 2I18A 3VRNA 2I2RE 1K8UA 1RECA 3WHUB 1H8BA 1UHNA 2BBMA 1UHJA 3VRPA 3PM8A 1WDCC 1DJZA 3PALA 5I2LA 1G4YR 5HYDA 1S5GZ 1KK7Z 1XK4C 1CM4A 1KWOB 2LANA 1YR5A 2MJWB 2IS9A 3RLZA 1JFKA 2LCPA 4CLNA 1GGZA 2OS8B 1TNQA 3EK7A 3IQQA 3I5HC 2M1KB 3CR4X 5CSNA 4CFRA 2KAVA 1F54A 1U5IA 3E3RA 5G08A 2M8UA 1NCZA 1K94A 1G33A 5JJGA 1HQVA 1RJVA 1TNPA 1IQ5A 1TOPA 4WRIA 2CBLA 3DVJA 1DMOA 1BR4B 3OX5A 2LUCA 1WLZA 3BOWA 1W7IB 3D10A 1SL8A 1ALWA 1A2XA 3C1VA 3CZTX 2WORA 3OB1B 1IH0A 1SCMC 5ER4X 3SG6A 3WXAA 3PN7B 2CNPA 2KI4B 2PSRA 1PRWA 1DGUA 2L50A 2MAZA 1JF0A 2MLFC 2L5XB 1IRJA 4GNKB 2LM5A 3TS5C 2F33A 2ZKMX 3FWCA 1YVLA 1F8HA 5CPVA 1KFXL 2K7CA 1NP8A 1SL9A 1XA5A 5FYXA 1Y1XA 1MR8A 2KNEA 1WRZA 1M31A 1J1DA 2K2AA 3K21A 3PLFB 3DD4A 1XFWO 1YX7A 2CXJA 3PATA 2FOTA 4I5KA 4OCIA 1F55A 1MXEA 1JFJA 2BL0C 1C7WA 1TCOB 2KQYA 4JPZB 1QVIY 1XFYO 1K9PA 1BT6A 1C07A 4YGBB 4YGEB 1CDLA 1UURA 2CT9A 5J3XA 4DRWA 3CWGA 4GFTA 1JSAA 3BQ3A 5B8IB 2I94A 4NDDA 1LA0A 1SKTA 3BYAA 2V53A 1AHRA 1QLKA 3ICBA 2LVKA 4MZJA 1K90D 4M2QA 1IWQA 3KF9A 2K8MB 4PCWA 2JNXA 4PDZA 3SIBA 4NQGA 2K2FA 1EXRA 3VRQA 4BY5A 2PASA 3SJSA 4BY4A 2PMYA 2ZNDA 1IGVA 2O60A 3VROA 1RROA 1Y1UA 1KFXS 2KYCA 4MSPA 5AERA 5BPJA 1BLQA 3H4SE 3SG3A 4WQ2A 2F2PA 1QXPA 2ZNEA 2KYFA 3ZNIA 1DF0B 4R1EA 3DVMA 1X02A 4A4CA 4CIDA 2GGMA 3LCPC 1TNWA 3PSRA 1FPWA 2QPTA 1WDCB 4ICBA 3VRRA 4CFQA 2FCDA 1WRKA 2LP2A 3SIAA 1A29A 1JBAA 4TNCA 2O5GA 1CLBA 4QJ5B 1XFVO 2TN4A 1XFXO 2LUXA 3QRXA 4P2YB 2LVVA 4YI9A 2BE6A 2EGDA 2F3ZA 3I5HB 1DJXA 1S6IA 1Y6WA 4PALA 4MLWA 1CLMA 1L2OC 2WCBA 1EH2A 3O6BA 1K9UA 1JUOA 1RFJA 3EKJA 1OQPA 2BCAA 3KPXA 3D0YB 1CFDA 2KHNA 2FCEA 4N1FA 4YBHB 1BU3A 2RGIA 3A8RA 3FWBA 1QX2A 2JNFA 4MN0A 1SCMB 5HLOA 4XJKA 2FJUB 1YX8A 2M7NA 1QV0A 1QIWA 1IJ5A 1NX0A 2E6WA 2Y1NA 1XYDA 1ZOTB 2LP3A 3FS7A 3TS5B 3WHTB 1CTRA 2VRGA 2F8PA 1S3PA 2HQ8A 1MWNA 2L2EA 1TIZA 1Y0VH 3O2PA 2KBIA 4C0KA 3AAKA 1J7QA 4FQOA 3OP0A 2Y5IA 5IBWA 2AMIA 3SG5A 4C0LA 3EK8A 4L9MA 5CSIA 2L0PA 4GBAA 3AKBA 1TTXA 2MHHA 1ODBA 2BL0B 1OMRA 1OMVA 1SK6D 2JOJA 2LNKA 1JWDA 1M46A 2K7OA 4DS7A 2HETA 2L51A 2D8NA 1M45A 3GK2A 1U5IB 1KSMA 2BE4A 2JZIA 2WCEA 1CKKA 4F0ZB 1IG5A 1SY9A 2HF5A 4I5JA 1SMGA 1NUBA 2JULA 4I5NB 3TUYC 3BXKA 4MEWA 1EG4A 4PHJA 1ZUZA 1N0YA 1UHKA 1CMFA 1KK8C 4MVFA 3BOWB 2JC2A 3KEVA 1NX3A 3SG4A 1N2DA 1OZSA 3SG7A 2JXLA 1CDMA 2OTGC 2NCPA 2LV7A 1GGWA 1LKJA 1R6PA 4YGAA 1MUXA 1YUUA 2K61A 5CSFA 1F71A 4AOMA 2HPSA 1FBVA 1KQMC 4YRUA 1QASA 1DT7B 3VGOA 3BUWB 3EVUA 5I2OA 1AP4A 4JWQA 1S1EA 1XFZO 2E30A 1C7VA 2R2IA 3OHMB 1M39A 5HKWA 1HT9A 3EVVA 3F45A 1G8IA 1B7TZ 2EC6C 3CTNA 1SPYA 2BCXA 2L4HA 2M0RA 2SCPA 2QACA 1AJ5A 1FI5A 1B8CA 1BODA 1J7PA 1R2UA 2JT8A 2AAOA 1L2OB 2OPOA 4GGNA 1S6JA 4YGCB 1Q80A 1A03A 4ORAB 4U8DA 3CR5X 2KAXA 4HRGA 1YRUB 1DJGA 3SG2A 3EK4A 1LINA 4HREE 2NXQA 3GK1A 1JC2A 1YUTA 2JRFA 2JT3A 1OSAA 1PSBA 3HX4A 4FTGA 1KFUS 3GOFA 4GAOA 1DJWA 3HCMA 2KI6C 3LL8B 1CDNA 2CCMA 1CLLA 4GUKA 2LMTA 4AQJA 1CDPA 2M97A 3M0WA 1TNXA 4GGFA 3NSKA 2B1UA 3KO0A 4MBEA 4N5XA 1OOJA 4HSZA 4DCKA 1YVHA 4N1GA 1TN4A 3NSIA 4XYNA 2Q91A 3I5FB 2MBXA 2PVBA 2I7AA 3CGAA 2ISDA 1BF5A 1PSRA 1GQMA 4OKHA 1CB1A 1K93D 3DF0A 4OR9B 3DVKA 1LXFC 1L7ZA 3MSEB 4Q04A 2LVIA 2P6BB 4CPVA 1S6CA 2KOTA 4YI8A 1SYMA 2M3WA 1A75A 1Y1AA 2KAYA 3NSLA 5D7FA 4QJ4B 3A4UB 1AK8A 1H4BA 4M2OA 2M7LA 2JXCA 1FW4A 5K89A 1B8RA 5AANA 1KK8B 4WQ3A 1UUSA 2KDHA 1K9KA 2KSPA 2Q4UA 1SR6C 3AKAA 2L4IA 5PALA 4XJKB 4OVNF 1N65A 4PE0A 2KBMA 5AEQA 4GGFC 1S5GY 1KK7Y 2OTGB 1QS7A 4GPLB 1GJYA 1W7JB 1ZFSA 1QX5B 2LC5A 1NX1A 2JT0A 2LVJA 1OZOA 1KQMB 1YUSA 1BMOA 2CTNA 2KFFA 1OMDA 1PULA 2MLEC 3I5GC 4PHKA 1SL7A 1SW8A 1NYAA 3JTDC 5F6TA 1UP5A 5ER5A 2WC8A 2ZRTA 1QX7A 2F2OA 3CLNA 2EC6B 2LHIA 2KI6D 3CS1A 1J7OA 2MRDA 1NCYA 2BKHB 2LLUA 2H61A 3TDUA 1LA3A 1TCFA 1CMGA 3JVTC 1XVJA 1PVAA 3BUNB 3ZWHA 1NWDA 4ZCVA 3BUOB 1AVSA 1J1EA 4D1EA 2ZRSA 1UWOA 1RTP1 2JQ6A 3TDIA 5DKNA 2DOQA 3IQOA 4HRHA 2F3YA 1WLMA 2GGZA 2PALA 1NX2A 2KGRA 4PE1A 1M63B 5JOLA 1E8AA 4DIRA 1SNLA 3WNXB 2NLNA 3O4YA 1KFUL 4MRXA 1UHHA 4MRYA 2G9BA 2ZFDA 1B47A 3AAJA 1RK9A 5TNCA 1WRLA 1IJ6A 3OX6A 3I5IC 4JQ0D 1NIWA 5HKZA 2WOSA 4OV2A 1F4QA 1QATA 4AQIA 1YRTB 1CFPA 5HKYA 2SASA 1B7TY 2LE9B 3KHEA 4I5LB 5D69A 1NSHA 2LMUA 1BJFA 5KTYA 1K96A 1MF8B 1FF1A 1F70A 1KWOC 1QLSA 4M2PA 4ZCUA 2H61C 1AJ4A 2NCOA 3NXAA 1YURA 2EHBA 2OS8C 1MHOA 1A4PA 2HQWA 1SCVA 2KFHA 2WNDA 3BUMB 4UPGA 5I2QA 1BR1B 1QJTA 2LLSA 4MZLA 4MZKA 1QIVA 1QVIZ 3IF7A 5AXIA 1SRAA 2BBNA 2JTZA 3CR2A 2JPTA 5AFPA 1IQ3A 1J7RA 1S26D 4NDCA 3TDZA 1BOCA 1RWYA 2G2BA 1IKUA 5GQQC 4ORCB 1F4OA 2KFGA 2COLB 1B4CA 4A4BA 2LMVA 3LLEA 2MA2A 2PRUA 3I5FC 1SR6B 1QTXA 1JF2A 2K7BA 5KU1A 4IL1A 1DTLA 3BUXB 3PN7C 1CFFA 2KI4C 1KCYA 1VRKA 3FIAA 2Y1MA 5HLVA 2K7DA 3RM1A 3NSOA 1FI6A 2Y4QA 1DF0A 1EG3A 4PHMA 1WY9A 3EVRA 2BECA 2H2KA 1B9AA 1PVBA 1MXLC 1LVCD 2JU0A 3I5GB 1BG1A 1V1GA 3JTDB 1V1FA 3LK1A 1XFUO 2A4JA 2JTTA 5KSZA 1DJYA 1DJHA 2K0JA 2M1UA 5CSJA 1ALVA 1XK4A 4PE7A 4C0JA 3TZ1A 3EKHA 1KSOA 1SBJA 3DF0B 4ORBB 4E68A 4YGDB 2LHLA 3PFVA 2M49B 3JVTB 1AUIB 2LAPA 1NCXA 1CM1A 3GK4X 1XO5A 4PE4A 3TUYB 3DVEA 4QJ3B 1B8LA 4ETOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A75 B;  2KGB C;  2NZ0 A;  4DUQ A;  1NPQ A;  1QV1 A;  1K2H A;  4PHN A;  5DKQ A;  5I8N A;  1CNP A;  1ZMZ A;  2LLT A;  2ZN9 A;  1CFC A;  1S36 A;  1YTZ C;  1DVI A;  2ZN8 A;  1B1G A;  2M29 A;  1K95 A;  3D0Y A;  2AUC A;  1OE9 B;  2KQ6 A;  1PK0 D;  2JWW A;  3OB2 B;  4USL A;  4P5O E;  1TRF A;  1KQV A;  1EJ3 A;  1UHI A;  3LK0 A;  1D1O A;  1DJI A;  1MQ1 A;  2GV5 A;  1J55 A;  1ZAC A;  2WCF A;  3I5I B;  1DGV A;  2BCB A;  3O78 A;  1EL4 A;  4NDB A;  1PAL A;  2BKI B;  2L98 A;  2M9G A;  5DKR A;  2I18 A;  3VRN A;  2I2R E;  1K8U A;  1REC A;  3WHU B;  1H8B A;  1UHN A;  2BBM A;  1UHJ A;  3VRP A;  3PM8 A;  1WDC C;  1DJZ A;  3PAL A;  5I2L A;  1G4Y R;  5HYD A;  1S5G Z;  1KK7 Z;  1XK4 C;  1CM4 A;  1KWO B;  2LAN A;  1YR5 A;  2MJW B;  2IS9 A;  3RLZ A;  1JFK A;  2LCP A;  4CLN A;  1GGZ A;  2OS8 B;  1TNQ A;  3EK7 A;  3IQQ A;  3I5H C;  2M1K B;  3CR4 X;  5CSN A;  4CFR A;  2KAV A;  1F54 A;  1U5I A;  3E3R A;  5G08 A;  2M8U A;  1NCZ A;  1K94 A;  1G33 A;  5JJG A;  1HQV A;  1RJV A;  1TNP A;  1IQ5 A;  1TOP A;  4WRI A;  2CBL A;  3DVJ A;  1DMO A;  1BR4 B;  3OX5 A;  2LUC A;  1WLZ A;  3BOW A;  1W7I B;  3D10 A;  1SL8 A;  1ALW A;  1A2X A;  3C1V A;  3CZT X;  2WOR A;  3OB1 B;  1IH0 A;  1SCM C;  5ER4 X;  3SG6 A;  3WXA A;  3PN7 B;  2CNP A;  2KI4 B;  2PSR A;  1PRW A;  1DGU A;  2L50 A;  2MAZ A;  1JF0 A;  2MLF C;  2L5X B;  1IRJ A;  4GNK B;  2LM5 A;  3TS5 C;  2F33 A;  2ZKM X;  3FWC A;  1YVL A;  1F8H A;  5CPV A;  1KFX L;  2K7C A;  1NP8 A;  1SL9 A;  1XA5 A;  5FYX A;  1Y1X A;  1MR8 A;  2KNE A;  1WRZ A;  1M31 A;  1J1D A;  2K2A A;  3K21 A;  3PLF B;  3DD4 A;  1XFW O;  1YX7 A;  2CXJ A;  3PAT A;  2FOT A;  4I5K A;  4OCI A;  1F55 A;  1MXE A;  1JFJ A;  2BL0 C;  1C7W A;  1TCO B;  2KQY A;  4JPZ B;  1QVI Y;  1XFY O;  1K9P A;  1BT6 A;  1C07 A;  4YGB B;  4YGE B;  1CDL A;  1UUR A;  2CT9 A;  5J3X A;  4DRW A;  3CWG A;  4GFT A;  1JSA A;  3BQ3 A;  5B8I B;  2I94 A;  4NDD A;  1LA0 A;  1SKT A;  3BYA A;  2V53 A;  1AHR A;  1QLK A;  3ICB A;  2LVK A;  4MZJ A;  1K90 D;  4M2Q A;  1IWQ A;  3KF9 A;  2K8M B;  4PCW A;  2JNX A;  4PDZ A;  3SIB A;  4NQG A;  2K2F A;  1EXR A;  3VRQ A;  4BY5 A;  2PAS A;  3SJS A;  4BY4 A;  2PMY A;  2ZND A;  1IGV A;  2O60 A;  3VRO A;  1RRO A;  1Y1U A;  1KFX S;  2KYC A;  4MSP A;  5AER A;  5BPJ A;  1BLQ A;  3H4S E;  3SG3 A;  4WQ2 A;  2F2P A;  1QXP A;  2ZNE A;  2KYF A;  3ZNI A;  1DF0 B;  4R1E A;  3DVM A;  1X02 A;  4A4C A;  4CID A;  2GGM A;  3LCP C;  1TNW A;  3PSR A;  1FPW A;  2QPT A;  1WDC B;  4ICB A;  3VRR A;  4CFQ A;  2FCD A;  1WRK A;  2LP2 A;  3SIA A;  1A29 A;  1JBA A;  4TNC A;  2O5G A;  1CLB A;  4QJ5 B;  1XFV O;  2TN4 A;  1XFX O;  2LUX A;  3QRX A;  4P2Y B;  2LVV A;  4YI9 A;  2BE6 A;  2EGD A;  2F3Z A;  3I5H B;  1DJX A;  1S6I A;  1Y6W A;  4PAL A;  4MLW A;  1CLM A;  1L2O C;  2WCB A;  1EH2 A;  3O6B A;  1K9U A;  1JUO A;  1RFJ A;  3EKJ A;  1OQP A;  2BCA A;  3KPX A;  3D0Y B;  1CFD A;  2KHN A;  2FCE A;  4N1F A;  4YBH B;  1BU3 A;  2RGI A;  3A8R A;  3FWB A;  1QX2 A;  2JNF A;  4MN0 A;  1SCM B;  5HLO A;  4XJK A;  2FJU B;  1YX8 A;  2M7N A;  1QV0 A;  1QIW A;  1IJ5 A;  1NX0 A;  2E6W A;  2Y1N A;  1XYD A;  1ZOT B;  2LP3 A;  3FS7 A;  3TS5 B;  3WHT B;  1CTR A;  2VRG A;  2F8P A;  1S3P A;  2HQ8 A;  1MWN A;  2L2E A;  1TIZ A;  1Y0V H;  3O2P A;  2KBI A;  4C0K A;  3AAK A;  1J7Q A;  4FQO A;  3OP0 A;  2Y5I A;  5IBW A;  2AMI A;  3SG5 A;  4C0L A;  3EK8 A;  4L9M A;  5CSI A;  2L0P A;  4GBA A;  3AKB A;  1TTX A;  2MHH A;  1ODB A;  2BL0 B;  1OMR A;  1OMV A;  1SK6 D;  2JOJ A;  2LNK A;  1JWD A;  1M46 A;  2K7O A;  4DS7 A;  2HET A;  2L51 A;  2D8N A;  1M45 A;  3GK2 A;  1U5I B;  1KSM A;  2BE4 A;  2JZI A;  2WCE A;  1CKK A;  4F0Z B;  1IG5 A;  1SY9 A;  2HF5 A;  4I5J A;  1SMG A;  1NUB A;  2JUL A;  4I5N B;  3TUY C;  3BXK A;  4MEW A;  1EG4 A;  4PHJ A;  1ZUZ A;  1N0Y A;  1UHK A;  1CMF A;  1KK8 C;  4MVF A;  3BOW B;  2JC2 A;  3KEV A;  1NX3 A;  3SG4 A;  1N2D A;  1OZS A;  3SG7 A;  2JXL A;  1CDM A;  2OTG C;  2NCP A;  2LV7 A;  1GGW A;  1LKJ A;  1R6P A;  4YGA A;  1MUX A;  1YUU A;  2K61 A;  5CSF A;  1F71 A;  4AOM A;  2HPS A;  1FBV A;  1KQM C;  4YRU A;  1QAS A;  1DT7 B;  3VGO A;  3BUW B;  3EVU A;  5I2O A;  1AP4 A;  4JWQ A;  1S1E A;  1XFZ O;  2E30 A;  1C7V A;  2R2I A;  3OHM B;  1M39 A;  5HKW A;  1HT9 A;  3EVV A;  3F45 A;  1G8I A;  1B7T Z;  2EC6 C;  3CTN A;  1SPY A;  2BCX A;  2L4H A;  2M0R A;  2SCP A;  2QAC A;  1AJ5 A;  1FI5 A;  1B8C A;  1BOD A;  1J7P A;  1R2U A;  2JT8 A;  2AAO A;  1L2O B;  2OPO A;  4GGN A;  1S6J A;  4YGC B;  1Q80 A;  1A03 A;  4ORA B;  4U8D A;  3CR5 X;  2KAX A;  4HRG A;  1YRU B;  1DJG A;  3SG2 A;  3EK4 A;  1LIN A;  4HRE E;  2NXQ A;  3GK1 A;  1JC2 A;  1YUT A;  2JRF A;  2JT3 A;  1OSA A;  1PSB A;  3HX4 A;  4FTG A;  1KFU S;  3GOF A;  4GAO A;  1DJW A;  3HCM A;  2KI6 C;  3LL8 B;  1CDN A;  2CCM A;  1CLL A;  4GUK A;  2LMT A;  4AQJ A;  1CDP A;  2M97 A;  3M0W A;  1TNX A;  4GGF A;  3NSK A;  2B1U A;  3KO0 A;  4MBE A;  4N5X A;  1OOJ A;  4HSZ A;  4DCK A;  1YVH A;  4N1G A;  1TN4 A;  3NSI A;  4XYN A;  2Q91 A;  3I5F B;  2MBX A;  2PVB A;  2I7A A;  3CGA A;  2ISD A;  1BF5 A;  1PSR A;  1GQM A;  4OKH A;  1CB1 A;  1K93 D;  3DF0 A;  4OR9 B;  3DVK A;  1LXF C;  1L7Z A;  3MSE B;  4Q04 A;  2LVI A;  2P6B B;  4CPV A;  1S6C A;  2KOT A;  4YI8 A;  1SYM A;  2M3W A;  1A75 A;  1Y1A A;  2KAY A;  3NSL A;  5D7F A;  4QJ4 B;  3A4U B;  1AK8 A;  1H4B A;  4M2O A;  2M7L A;  2JXC A;  1FW4 A;  5K89 A;  1B8R A;  5AAN A;  1KK8 B;  4WQ3 A;  1UUS A;  2KDH A;  1K9K A;  2KSP A;  2Q4U A;  1SR6 C;  3AKA A;  2L4I A;  5PAL A;  4XJK B;  4OVN F;  1N65 A;  4PE0 A;  2KBM A;  5AEQ A;  4GGF C;  1S5G Y;  1KK7 Y;  2OTG B;  1QS7 A;  4GPL B;  1GJY A;  1W7J B;  1ZFS A;  1QX5 B;  2LC5 A;  1NX1 A;  2JT0 A;  2LVJ A;  1OZO A;  1KQM B;  1YUS A;  1BMO A;  2CTN A;  2KFF A;  1OMD A;  1PUL A;  2MLE C;  3I5G C;  4PHK A;  1SL7 A;  1SW8 A;  1NYA A;  3JTD C;  5F6T A;  1UP5 A;  5ER5 A;  2WC8 A;  2ZRT A;  1QX7 A;  2F2O A;  3CLN A;  2EC6 B;  2LHI A;  2KI6 D;  3CS1 A;  1J7O A;  2MRD A;  1NCY A;  2BKH B;  2LLU A;  2H61 A;  3TDU A;  1LA3 A;  1TCF A;  1CMG A;  3JVT C;  1XVJ A;  1PVA A;  3BUN B;  3ZWH A;  1NWD A;  4ZCV A;  3BUO B;  1AVS A;  1J1E A;  4D1E A;  2ZRS A;  1UWO A;  1RTP 1;  2JQ6 A;  3TDI A;  5DKN A;  2DOQ A;  3IQO A;  4HRH A;  2F3Y A;  1WLM A;  2GGZ A;  2PAL A;  1NX2 A;  2KGR A;  4PE1 A;  1M63 B;  5JOL A;  1E8A A;  4DIR A;  1SNL A;  3WNX B;  2NLN A;  3O4Y A;  1KFU L;  4MRX A;  1UHH A;  4MRY A;  2G9B A;  2ZFD A;  1B47 A;  3AAJ A;  1RK9 A;  5TNC A;  1WRL A;  1IJ6 A;  3OX6 A;  3I5I C;  4JQ0 D;  1NIW A;  5HKZ A;  2WOS A;  4OV2 A;  1F4Q A;  1QAT A;  4AQI A;  1YRT B;  1CFP A;  5HKY A;  2SAS A;  1B7T Y;  2LE9 B;  3KHE A;  4I5L B;  5D69 A;  1NSH A;  2LMU A;  1BJF A;  5KTY A;  1K96 A;  1MF8 B;  1FF1 A;  1F70 A;  1KWO C;  1QLS A;  4M2P A;  4ZCU A;  2H61 C;  1AJ4 A;  2NCO A;  3NXA A;  1YUR A;  2EHB A;  2OS8 C;  1MHO A;  1A4P A;  2HQW A;  1SCV A;  2KFH A;  2WND A;  3BUM B;  4UPG A;  5I2Q A;  1BR1 B;  1QJT A;  2LLS A;  4MZL A;  4MZK A;  1QIV A;  1QVI Z;  3IF7 A;  5AXI A;  1SRA A;  2BBN A;  2JTZ A;  3CR2 A;  2JPT A;  5AFP A;  1IQ3 A;  1J7R A;  1S26 D;  4NDC A;  3TDZ A;  1BOC A;  1RWY A;  2G2B A;  1IKU A;  5GQQ C;  4ORC B;  1F4O A;  2KFG A;  2COL B;  1B4C A;  4A4B A;  2LMV A;  3LLE A;  2MA2 A;  2PRU A;  3I5F C;  1SR6 B;  1QTX A;  1JF2 A;  2K7B A;  5KU1 A;  4IL1 A;  1DTL A;  3BUX B;  3PN7 C;  1CFF A;  2KI4 C;  1KCY A;  1VRK A;  3FIA A;  2Y1M A;  5HLV A;  2K7D A;  3RM1 A;  3NSO A;  1FI6 A;  2Y4Q A;  1DF0 A;  1EG3 A;  4PHM A;  1WY9 A;  3EVR A;  2BEC A;  2H2K A;  1B9A A;  1PVB A;  1MXL C;  1LVC D;  2JU0 A;  3I5G B;  1BG1 A;  1V1G A;  3JTD B;  1V1F A;  3LK1 A;  1XFU O;  2A4J A;  2JTT A;  5KSZ A;  1DJY A;  1DJH A;  2K0J A;  2M1U A;  5CSJ A;  1ALV A;  1XK4 A;  4PE7 A;  4C0J A;  3TZ1 A;  3EKH A;  1KSO A;  1SBJ A;  3DF0 B;  4ORB B;  4E68 A;  4YGD B;  2LHL A;  3PFV A;  2M49 B;  3JVT B;  1AUI B;  2LAP A;  1NCX A;  1CM1 A;  3GK4 X;  1XO5 A;  4PE4 A;  3TUY B;  3DVE A;  4QJ3 B;  1B8L A;  4ETO A; 
#chains in the Genus database with same CATH topology
 1A75 B;  2KGB C;  2NZ0 A;  4DUQ A;  1NPQ A;  1QV1 A;  3PM2 A;  1K2H A;  4PHN A;  5DKQ A;  5I8N A;  1CNP A;  1OOF A;  1ZMZ A;  2LLT A;  2ZN9 A;  1CFC A;  1S36 A;  1YTZ C;  1DVI A;  2GTE A;  2ZN8 A;  1B1G A;  2M29 A;  1K95 A;  3D0Y A;  2AUC A;  1OE9 B;  2KQ6 A;  1PK0 D;  2JWW A;  3OB2 B;  1TWO A;  4USL A;  4P5O E;  1TRF A;  1KQV A;  1EJ3 A;  1UHI A;  3BFH A;  3LK0 A;  1D1O A;  1DJI A;  1MQ1 A;  2GV5 A;  1J55 A;  1ZAC A;  2WCF A;  3I5I B;  1DGV A;  2BCB A;  3O78 A;  1EL4 A;  4NDB A;  1PAL A;  2BKI B;  2L98 A;  2M9G A;  3FE8 A;  2I18 A;  5DKR A;  2I2R E;  3VRN A;  1K8U A;  1REC A;  3WHU B;  1H8B A;  1UHN A;  2BBM A;  1UHJ A;  3VRP A;  3PM8 A;  1T14 A;  1WDC C;  1DJZ A;  3PAL A;  5I2L A;  1G4Y R;  1IIO A;  5HYD A;  1S5G Z;  1KK7 Z;  1XK4 C;  3UO9 A;  1CM4 A;  2K60 A;  1KWO B;  2LAN A;  1YR5 A;  2MJW B;  2IS9 A;  5D3O A;  3RLZ A;  1JFK A;  2LCP A;  4CLN A;  1GGZ A;  2OS8 B;  1TNQ A;  3EK7 A;  3IQQ A;  3I5H C;  2M1K B;  3CR4 X;  5CSN A;  4CFR A;  2KAV A;  1F54 A;  3R1P A;  1U5I A;  3E3R A;  5G08 A;  2M8U A;  1NCZ A;  1K94 A;  1G33 A;  5JJG A;  1HQV A;  1RJV A;  1TNP A;  1IQ5 A;  1TOP A;  1TUJ A;  5EL2 A;  4WRI A;  2CBL A;  3DVJ A;  4JKT A;  1BR4 B;  3OX5 A;  1DMO A;  2LUC A;  1WLZ A;  3BOW A;  1W7I B;  3D10 A;  1SL8 A;  1ALW A;  1A2X A;  3C1V A;  3CZT X;  2WOR A;  3CDN A;  3OB1 B;  1IH0 A;  1SCM C;  5ER4 X;  3SG6 A;  3WXA A;  3PN7 B;  2CNP A;  2KI4 B;  2PSR A;  1PRW A;  1DGU A;  2L50 A;  2MAZ A;  1JF0 A;  2MLF C;  2L5X B;  1IRJ A;  4GNK B;  2LM5 A;  3TS5 C;  2F33 A;  2ZKM X;  3FWC A;  1YVL A;  1F8H A;  5CPV A;  4JD9 A;  1KFX L;  2K7C A;  1NP8 A;  1SL9 A;  1XA5 A;  5FYX A;  1Y1X A;  1MR8 A;  2KNE A;  1WRZ A;  3D73 A;  1M31 A;  1J1D A;  2K2A A;  1TUZ A;  3K21 A;  3PLF B;  3DD4 A;  1XFW O;  1YX7 A;  2CXJ A;  3PAT A;  2FOT A;  4I5K A;  4OCI A;  1F55 A;  2KPH A;  1MXE A;  1JFJ A;  2BL0 C;  1C7W A;  3D76 A;  1TCO B;  2KQY A;  4JPZ B;  1QVI Y;  1XFY O;  1K9P A;  1BT6 A;  1C07 A;  4YGB B;  4YGE B;  5FI6 A;  3NHI A;  1CDL A;  1UUR A;  2CT9 A;  3B7A A;  5J3X A;  2WCL A;  4DRW A;  3CWG A;  4GFT A;  1JSA A;  3BQ3 A;  5B8I B;  2I94 A;  4NDD A;  1LA0 A;  1SKT A;  2WCM A;  2V53 A;  1AHR A;  1QLK A;  3BYA A;  2LVK A;  3ICB A;  1DEK A;  4MZJ A;  1K90 D;  4M2Q A;  3L47 A;  1IWQ A;  3KF9 A;  2K8M B;  4PCW A;  2JNX A;  4PDZ A;  3SIB A;  4NQG A;  2K2F A;  1EXR A;  3VRQ A;  4BY5 A;  2PAS A;  3SJS A;  4BY4 A;  2PMY A;  2ZND A;  1IGV A;  2O60 A;  3VRO A;  1RRO A;  1Y1U A;  1KFX S;  2KYC A;  4MSP A;  5AER A;  5BPJ A;  1BLQ A;  3H4S E;  3SG3 A;  4WQ2 A;  3VB1 A;  2F2P A;  1QXP A;  1W9Z A;  2ZNE A;  2KYF A;  3ZNI A;  1DF0 B;  1F71 A;  2ERB A;  4R1E A;  3DVM A;  1X02 A;  4A4C A;  2JPO A;  4CID A;  2GGM A;  3LCP C;  1TNW A;  3PSR A;  1FPW A;  3FE9 A;  2QPT A;  1WDC B;  4ICB A;  3VRR A;  4CFQ A;  2FCD A;  1WRK A;  2LP2 A;  1QWV A;  1A29 A;  3SIA A;  1JBA A;  4TNC A;  2O5G A;  1CLB A;  4QJ5 B;  1XFV O;  2TN4 A;  3SS5 A;  1XFX O;  2LUX A;  3L4A A;  1ORG A;  3QRX A;  4P2Y B;  2LVV A;  3CYZ A;  4YI9 A;  2BE6 A;  2EGD A;  2KLD A;  3V2L A;  3B87 A;  2F3Z A;  3I5H B;  1DJX A;  1S6I A;  1Y6W A;  4PAL A;  4MLW A;  1CLM A;  1L2O C;  2WCB A;  1J7O A;  1EH2 A;  3O6B A;  3R1O A;  1K9U A;  1JUO A;  4INX A;  1RFJ A;  3EKJ A;  2L5Y A;  4OZD A;  2PYQ A;  3D77 A;  1OQP A;  2BCA A;  3KPX A;  3D0Y B;  1CFD A;  2KHN A;  2FCE A;  4N1F A;  4YBH B;  1BU3 A;  2RGI A;  3A8R A;  3FWB A;  1QX2 A;  2JNF A;  4MN0 A;  1SCM B;  5HLO A;  4XJK A;  2FJU B;  1C3Z A;  1YX8 A;  2M7N A;  1QV0 A;  1QIW A;  1IJ5 A;  1NX0 A;  2E6W A;  2Y1N A;  1XYD A;  1ZOT B;  2LP3 A;  3FS7 A;  3TS5 B;  3WHT B;  1CTR A;  2VRG A;  2F8P A;  1S3P A;  2HQ8 A;  1MWN A;  1GM0 A;  1OOH A;  1TIZ A;  2L2E A;  1Y0V H;  3O2P A;  2KBI A;  3K1E A;  4C0K A;  3AAK A;  1SSE B;  1J7Q A;  4FQO A;  3OP0 A;  2Y5I A;  5IBW A;  4PT1 A;  2AMI A;  3SG5 A;  4C0L A;  3EK8 A;  4L9M A;  5CSI A;  2L0P A;  4GBA A;  3AKB A;  1TTX A;  2MHH A;  3BJH A;  1ODB A;  2BL0 B;  1OMR A;  1OMV A;  1SK6 D;  2JOJ A;  2LNK A;  3D74 A;  1M46 A;  1JWD A;  2K7O A;  4DS7 A;  2HET A;  2L51 A;  2D8N A;  1M45 A;  3GK2 A;  3NHT A;  1U5I B;  1KSM A;  2BE4 A;  2JZI A;  2WCE A;  1CKK A;  3S0A A;  4F0Z B;  3OGN A;  1IG5 A;  1SY9 A;  2HF5 A;  4I5J A;  1SMG A;  1NUB A;  2JUL A;  4I5N B;  5I94 A;  3TUY C;  3BXK A;  4MEW A;  1EG4 A;  4PHJ A;  1ZUZ A;  1N0Y A;  1UHK A;  1CMF A;  1KK8 C;  2QDI A;  4MVF A;  3BOW B;  2JC2 A;  3KEV A;  1DC1 A;  1NX3 A;  4KYN A;  1N2D A;  3SG4 A;  1OZS A;  3SG7 A;  2JXL A;  1CDM A;  2OTG C;  2QEH A;  3CZ1 A;  2NCP A;  2LV7 A;  1GGW A;  1LKJ A;  1R6P A;  4YGA A;  1MUX A;  1YUU A;  2K61 A;  5CSF A;  3S0D A;  4AOM A;  2HPS A;  1FBV A;  1KQM C;  2WCJ A;  4YRU A;  1QAS A;  1DT7 B;  2YGU A;  3VGO A;  3BUW B;  3EVU A;  5I2O A;  1AP4 A;  2BAP A;  4JWQ A;  1S1E A;  1XFZ O;  2E30 A;  1C7V A;  2R2I A;  3OHM B;  1M39 A;  5HKW A;  1HT9 A;  3R1V A;  3EVV A;  3F45 A;  1G8I A;  1B7T Z;  3FE6 A;  2EC6 C;  3CTN A;  1SPY A;  2BCX A;  2L4H A;  2M0R A;  2SCP A;  2QAC A;  1AJ5 A;  1FI5 A;  1B8C A;  1BOD A;  3B6X A;  1J7P A;  1R2U A;  2JT8 A;  2AAO A;  1L2O B;  2OPO A;  4GGN A;  1S6J A;  4YGC B;  1Q80 A;  1Z4H A;  1A03 A;  4ORA B;  4U8D A;  3CR5 X;  2KAX A;  4HRG A;  1YRU B;  1XFR A;  1DJG A;  3SG2 A;  4F7F A;  3EK4 A;  1LIN A;  4HRE E;  2NXQ A;  3GK1 A;  1JC2 A;  1YUT A;  2JRF A;  2JT3 A;  1OSA A;  1PSB A;  3HX4 A;  4FTG A;  1KFU S;  3GOF A;  4GAO A;  1DJW A;  3HCM A;  2KI6 C;  3LL8 B;  1CDN A;  2CCM A;  1CLL A;  4GUK A;  2LMT A;  4AQJ A;  1CDP A;  2M97 A;  3M0W A;  1TNX A;  4GGF A;  2P70 A;  3NSK A;  3PJI A;  3R72 A;  3UNW A;  2B1U A;  3KO0 A;  4MBE A;  4N5X A;  1OOJ A;  4HSZ A;  4DCK A;  1YVH A;  3CZ2 A;  4N1G A;  1TN4 A;  3NSI A;  3SS4 A;  4XYN A;  1P28 A;  2Q91 A;  3I5F B;  2MBX A;  2PVB A;  3CZ0 A;  2I7A A;  1OOI X;  3CGA A;  2ISD A;  1BF5 A;  1PSR A;  1GQM A;  3L4L A;  3S0F A;  1DQE A;  3QME A;  4OKH A;  1CB1 A;  1K93 D;  3DF0 A;  3DY9 A;  4INW A;  4OR9 B;  3DVK A;  1LXF C;  1L7Z A;  2QEB A;  3MSE B;  4Q04 A;  2LVI A;  2P6B B;  2BNX A;  2QEV A;  4CPV A;  1S6C A;  2KOT A;  4YI8 A;  3DXL A;  1SYM A;  2M3W A;  1A75 A;  1Y1A A;  2KAY A;  3NSL A;  3B88 A;  5D7F A;  4QJ4 B;  3A4U B;  1AK8 A;  1H4B A;  4M2O A;  2M7L A;  2JXC A;  1FW4 A;  5K89 A;  1B8R A;  5AAN A;  1KK8 B;  4WQ3 A;  1UUS A;  2KDH A;  3DYE A;  1K9K A;  1LS8 A;  2KSP A;  2Q4U A;  1SR6 C;  3AKA A;  2L4I A;  5PAL A;  3O4X A;  4XJK B;  4OVN F;  1N65 A;  4PE0 A;  2KBM A;  5AEQ A;  4GGF C;  1S5G Y;  1KK7 Y;  2OTG B;  1QS7 A;  4GPL B;  1GJY A;  1W7J B;  1ZFS A;  1QX5 B;  2LC5 A;  5FI2 A;  1NX1 A;  2JT0 A;  2LVJ A;  1OZO A;  2PQL A;  1KQM B;  1YUS A;  3D75 A;  1BMO A;  2CTN A;  2KFF A;  2H8V A;  2WC6 A;  1OMD A;  1PUL A;  2MLE C;  3I5G C;  4PHK A;  1SL7 A;  1SW8 A;  2KLE A;  1NYA A;  3JTD C;  5F6T A;  1UP5 A;  3NGV A;  5ER5 A;  2WC8 A;  2ZRT A;  1QX7 A;  2F2O A;  3CLN A;  2EC6 B;  2LHI A;  2KI6 D;  3CAB A;  3CS1 A;  2MRD A;  1NCY A;  2BKH B;  5HL1 A;  2LLU A;  2H61 A;  3TDU A;  1LA3 A;  1TCF A;  1CMG A;  3JVT C;  1XVJ A;  1PVA A;  3BUN B;  3ZWH A;  1NWD A;  4ZCV A;  3BUO B;  1AVS A;  1J1E A;  4D1E A;  2ZRS A;  3DZT A;  1UWO A;  1RTP 1;  2JQ6 A;  3TDI A;  5DKN A;  2DOQ A;  3IQO A;  4HRH A;  2F3Y A;  1WLM A;  2GGZ A;  2PAL A;  1NX2 A;  3D78 A;  2KGR A;  4PE1 A;  1M63 B;  5JOL A;  1E8A A;  4DIR A;  1SNL A;  3WNX B;  2NLN A;  3O4Y A;  1KFU L;  4MRX A;  1UHH A;  4MRY A;  2QEO A;  2G9B A;  2ZFD A;  3BFA A;  1B47 A;  3AAJ A;  1C3Y A;  1RK9 A;  5TNC A;  1WRL A;  1IJ6 A;  3OX6 A;  3RZS A;  3I5I C;  4JQ0 D;  1NIW A;  5HKZ A;  1DEL A;  2WOS A;  2FJY A;  4OV2 A;  1F4Q A;  1QAT A;  3BFB A;  4AQI A;  1YRT B;  1CFP A;  5HKY A;  2SAS A;  1B7T Y;  2LE9 B;  3KHE A;  4I5L B;  5D69 A;  2WCH A;  1NSH A;  2LMU A;  3SS3 A;  1BJF A;  4FQT A;  3OBV A;  5KTY A;  1K96 A;  1MF8 B;  2WC5 A;  1FF1 A;  1F70 A;  1KWO C;  1QLS A;  4M2P A;  4ZCU A;  2H61 C;  1AJ4 A;  2NCO A;  3N7H A;  3NXA A;  1YUR A;  2EHB A;  2OS8 C;  1MHO A;  1A4P A;  2HQW A;  1SCV A;  2KFH A;  2WND A;  3BUM B;  4UPG A;  5I2Q A;  1BR1 B;  1QJT A;  2LLS A;  4MZL A;  4MZK A;  1QIV A;  1QVI Z;  3IF7 A;  5AXI A;  1SRA A;  2BBN A;  2JTZ A;  3CR2 A;  2JPT A;  5AFP A;  1IQ3 A;  1J7R A;  1S26 D;  4NDC A;  3TDZ A;  1BOC A;  2WCK A;  1RWY A;  2G2B A;  1IKU A;  5FI7 A;  4ORC B;  1F4O A;  2KFG A;  3IVT A;  2COL B;  5GQQ C;  4A4B A;  2LMV A;  3LLE A;  1B4C A;  2MA2 A;  2PRU A;  3EG5 B;  1SR6 B;  3I5F C;  1QTX A;  1JF2 A;  2K7B A;  5KU1 A;  4IL1 A;  1DTL A;  3S0B A;  3BUX B;  3PN7 C;  1CFF A;  2KI4 C;  1KCY A;  2L2C A;  1VRK A;  3FIA A;  2Y1M A;  3B86 A;  5HLV A;  2K7D A;  3RM1 A;  3NSO A;  1FI6 A;  2Y4Q A;  1DF0 A;  1EG3 A;  4PHM A;  1WY9 A;  3EVR A;  2BEC A;  2H2K A;  1B9A A;  1PVB A;  1MXL C;  1LVC D;  2JU0 A;  3I5G B;  1BG1 A;  4IJ7 A;  1V1G A;  3JTD B;  1V1F A;  3LK1 A;  1XFU O;  2A4J A;  2JTT A;  5KSZ A;  1DJY A;  3S0G A;  1DJH A;  3S0E A;  2K0J A;  2M1U A;  5CSJ A;  1ALV A;  1XK4 A;  4PE7 A;  1Z2C B;  3TZ1 A;  4C0J A;  3EKH A;  1KSO A;  1SBJ A;  3DF0 B;  4ORB B;  5DIC A;  4E68 A;  4YGD B;  2LHL A;  3PFV A;  2M49 B;  3JVT B;  1AUI B;  2LAP A;  1NCX A;  1CM1 A;  3GK4 X;  1XO5 A;  4PE4 A;  1OW4 A;  3DVE A;  4QJ3 B;  3TUY B;  3Q8I A;  1B8L A;  4ETO A;  2P71 A;  1OOG A; 
#chains in the Genus database with same CATH homology
 1A75 B;  2KGB C;  2NZ0 A;  4DUQ A;  1NPQ A;  1QV1 A;  1K2H A;  4PHN A;  5DKQ A;  5I8N A;  1CNP A;  1ZMZ A;  2LLT A;  2ZN9 A;  1CFC A;  1S36 A;  1YTZ C;  1DVI A;  2ZN8 A;  1B1G A;  2M29 A;  1K95 A;  3D0Y A;  2AUC A;  1OE9 B;  2KQ6 A;  1PK0 D;  2JWW A;  3OB2 B;  4USL A;  4P5O E;  1TRF A;  1KQV A;  1EJ3 A;  1UHI A;  3LK0 A;  1D1O A;  1DJI A;  1MQ1 A;  2GV5 A;  1J55 A;  1ZAC A;  2WCF A;  3I5I B;  1DGV A;  2BCB A;  3O78 A;  1EL4 A;  4NDB A;  1PAL A;  2BKI B;  2L98 A;  2M9G A;  5DKR A;  2I18 A;  3VRN A;  2I2R E;  1K8U A;  1REC A;  3WHU B;  1H8B A;  1UHN A;  2BBM A;  1UHJ A;  3VRP A;  3PM8 A;  1WDC C;  1DJZ A;  3PAL A;  5I2L A;  1G4Y R;  5HYD A;  1S5G Z;  1KK7 Z;  1XK4 C;  1CM4 A;  1KWO B;  2LAN A;  1YR5 A;  2MJW B;  2IS9 A;  3RLZ A;  1JFK A;  2LCP A;  4CLN A;  1GGZ A;  2OS8 B;  1TNQ A;  3EK7 A;  3IQQ A;  3I5H C;  2M1K B;  3CR4 X;  5CSN A;  4CFR A;  2KAV A;  1F54 A;  1U5I A;  3E3R A;  5G08 A;  2M8U A;  1NCZ A;  1K94 A;  1G33 A;  5JJG A;  1HQV A;  1RJV A;  1TNP A;  1IQ5 A;  1TOP A;  4WRI A;  2CBL A;  3DVJ A;  1DMO A;  1BR4 B;  3OX5 A;  2LUC A;  1WLZ A;  3BOW A;  1W7I B;  3D10 A;  1SL8 A;  1ALW A;  1A2X A;  3C1V A;  3CZT X;  2WOR A;  3OB1 B;  1IH0 A;  1SCM C;  5ER4 X;  3SG6 A;  3WXA A;  3PN7 B;  2CNP A;  2KI4 B;  2PSR A;  1PRW A;  1DGU A;  2L50 A;  2MAZ A;  1JF0 A;  2MLF C;  2L5X B;  1IRJ A;  4GNK B;  2LM5 A;  3TS5 C;  2F33 A;  2ZKM X;  3FWC A;  1YVL A;  1F8H A;  5CPV A;  1KFX L;  2K7C A;  1NP8 A;  1SL9 A;  1XA5 A;  5FYX A;  1Y1X A;  1MR8 A;  2KNE A;  1WRZ A;  1M31 A;  1J1D A;  2K2A A;  3K21 A;  3PLF B;  3DD4 A;  1XFW O;  1YX7 A;  2CXJ A;  3PAT A;  2FOT A;  4I5K A;  4OCI A;  1F55 A;  1MXE A;  1JFJ A;  2BL0 C;  1C7W A;  1TCO B;  2KQY A;  4JPZ B;  1QVI Y;  1XFY O;  1K9P A;  1BT6 A;  1C07 A;  4YGB B;  4YGE B;  1CDL A;  1UUR A;  2CT9 A;  5J3X A;  4DRW A;  3CWG A;  4GFT A;  1JSA A;  3BQ3 A;  5B8I B;  2I94 A;  4NDD A;  1LA0 A;  1SKT A;  3BYA A;  2V53 A;  1AHR A;  1QLK A;  3ICB A;  2LVK A;  4MZJ A;  1K90 D;  4M2Q A;  1IWQ A;  3KF9 A;  2K8M B;  4PCW A;  2JNX A;  4PDZ A;  3SIB A;  4NQG A;  2K2F A;  1EXR A;  3VRQ A;  4BY5 A;  2PAS A;  3SJS A;  4BY4 A;  2PMY A;  2ZND A;  1IGV A;  2O60 A;  3VRO A;  1RRO A;  1Y1U A;  1KFX S;  2KYC A;  4MSP A;  5AER A;  5BPJ A;  1BLQ A;  3H4S E;  3SG3 A;  4WQ2 A;  2F2P A;  1QXP A;  2ZNE A;  2KYF A;  3ZNI A;  1DF0 B;  4R1E A;  3DVM A;  1X02 A;  4A4C A;  4CID A;  2GGM A;  3LCP C;  1TNW A;  3PSR A;  1FPW A;  2QPT A;  1WDC B;  4ICB A;  3VRR A;  4CFQ A;  2FCD A;  1WRK A;  2LP2 A;  3SIA A;  1A29 A;  1JBA A;  4TNC A;  2O5G A;  1CLB A;  4QJ5 B;  1XFV O;  2TN4 A;  1XFX O;  2LUX A;  3QRX A;  4P2Y B;  2LVV A;  4YI9 A;  2BE6 A;  2EGD A;  2F3Z A;  3I5H B;  1DJX A;  1S6I A;  1Y6W A;  4PAL A;  4MLW A;  1CLM A;  1L2O C;  2WCB A;  1EH2 A;  3O6B A;  1K9U A;  1JUO A;  1RFJ A;  3EKJ A;  1OQP A;  2BCA A;  3KPX A;  3D0Y B;  1CFD A;  2KHN A;  2FCE A;  4N1F A;  4YBH B;  1BU3 A;  2RGI A;  3A8R A;  3FWB A;  1QX2 A;  2JNF A;  4MN0 A;  1SCM B;  5HLO A;  4XJK A;  2FJU B;  1YX8 A;  2M7N A;  1QV0 A;  1QIW A;  1IJ5 A;  1NX0 A;  2E6W A;  2Y1N A;  1XYD A;  1ZOT B;  2LP3 A;  3FS7 A;  3TS5 B;  3WHT B;  1CTR A;  2VRG A;  2F8P A;  1S3P A;  2HQ8 A;  1MWN A;  2L2E A;  1TIZ A;  1Y0V H;  3O2P A;  2KBI A;  4C0K A;  3AAK A;  1J7Q A;  4FQO A;  3OP0 A;  2Y5I A;  5IBW A;  2AMI A;  3SG5 A;  4C0L A;  3EK8 A;  4L9M A;  5CSI A;  2L0P A;  4GBA A;  3AKB A;  1TTX A;  2MHH A;  1ODB A;  2BL0 B;  1OMR A;  1OMV A;  1SK6 D;  2JOJ A;  2LNK A;  1JWD A;  1M46 A;  2K7O A;  4DS7 A;  2HET A;  2L51 A;  2D8N A;  1M45 A;  3GK2 A;  1U5I B;  1KSM A;  2BE4 A;  2JZI A;  2WCE A;  1CKK A;  4F0Z B;  1IG5 A;  1SY9 A;  2HF5 A;  4I5J A;  1SMG A;  1NUB A;  2JUL A;  4I5N B;  3TUY C;  3BXK A;  4MEW A;  1EG4 A;  4PHJ A;  1ZUZ A;  1N0Y A;  1UHK A;  1CMF A;  1KK8 C;  4MVF A;  3BOW B;  2JC2 A;  3KEV A;  1NX3 A;  3SG4 A;  1N2D A;  1OZS A;  3SG7 A;  2JXL A;  1CDM A;  2OTG C;  2NCP A;  2LV7 A;  1GGW A;  1LKJ A;  1R6P A;  4YGA A;  1MUX A;  1YUU A;  2K61 A;  5CSF A;  1F71 A;  4AOM A;  2HPS A;  1FBV A;  1KQM C;  4YRU A;  1QAS A;  1DT7 B;  3VGO A;  3BUW B;  3EVU A;  5I2O A;  1AP4 A;  4JWQ A;  1S1E A;  1XFZ O;  2E30 A;  1C7V A;  2R2I A;  3OHM B;  1M39 A;  5HKW A;  1HT9 A;  3EVV A;  3F45 A;  1G8I A;  1B7T Z;  2EC6 C;  3CTN A;  1SPY A;  2BCX A;  2L4H A;  2M0R A;  2SCP A;  2QAC A;  1AJ5 A;  1FI5 A;  1B8C A;  1BOD A;  1J7P A;  1R2U A;  2JT8 A;  2AAO A;  1L2O B;  2OPO A;  4GGN A;  1S6J A;  4YGC B;  1Q80 A;  1A03 A;  4ORA B;  4U8D A;  3CR5 X;  2KAX A;  4HRG A;  1YRU B;  1DJG A;  3SG2 A;  3EK4 A;  1LIN A;  4HRE E;  2NXQ A;  3GK1 A;  1JC2 A;  1YUT A;  2JRF A;  2JT3 A;  1OSA A;  1PSB A;  3HX4 A;  4FTG A;  1KFU S;  3GOF A;  4GAO A;  1DJW A;  3HCM A;  2KI6 C;  3LL8 B;  1CDN A;  2CCM A;  1CLL A;  4GUK A;  2LMT A;  4AQJ A;  1CDP A;  2M97 A;  3M0W A;  1TNX A;  4GGF A;  3NSK A;  2B1U A;  3KO0 A;  4MBE A;  4N5X A;  1OOJ A;  4HSZ A;  4DCK A;  1YVH A;  4N1G A;  1TN4 A;  3NSI A;  4XYN A;  2Q91 A;  3I5F B;  2MBX A;  2PVB A;  2I7A A;  3CGA A;  2ISD A;  1BF5 A;  1PSR A;  1GQM A;  4OKH A;  1CB1 A;  1K93 D;  3DF0 A;  4OR9 B;  3DVK A;  1LXF C;  1L7Z A;  3MSE B;  4Q04 A;  2LVI A;  2P6B B;  4CPV A;  1S6C A;  2KOT A;  4YI8 A;  1SYM A;  2M3W A;  1A75 A;  1Y1A A;  2KAY A;  3NSL A;  5D7F A;  4QJ4 B;  3A4U B;  1AK8 A;  1H4B A;  4M2O A;  2M7L A;  2JXC A;  1FW4 A;  5K89 A;  1B8R A;  5AAN A;  1KK8 B;  4WQ3 A;  1UUS A;  2KDH A;  1K9K A;  2KSP A;  2Q4U A;  1SR6 C;  3AKA A;  2L4I A;  5PAL A;  4XJK B;  4OVN F;  1N65 A;  4PE0 A;  2KBM A;  5AEQ A;  4GGF C;  1S5G Y;  1KK7 Y;  2OTG B;  1QS7 A;  4GPL B;  1GJY A;  1W7J B;  1ZFS A;  1QX5 B;  2LC5 A;  1NX1 A;  2JT0 A;  2LVJ A;  1OZO A;  1KQM B;  1YUS A;  1BMO A;  2CTN A;  2KFF A;  1OMD A;  1PUL A;  2MLE C;  3I5G C;  4PHK A;  1SL7 A;  1SW8 A;  1NYA A;  3JTD C;  5F6T A;  1UP5 A;  5ER5 A;  2WC8 A;  2ZRT A;  1QX7 A;  2F2O A;  3CLN A;  2EC6 B;  2LHI A;  2KI6 D;  3CS1 A;  1J7O A;  2MRD A;  1NCY A;  2BKH B;  2LLU A;  2H61 A;  3TDU A;  1LA3 A;  1TCF A;  1CMG A;  3JVT C;  1XVJ A;  1PVA A;  3BUN B;  3ZWH A;  1NWD A;  4ZCV A;  3BUO B;  1AVS A;  1J1E A;  4D1E A;  2ZRS A;  1UWO A;  1RTP 1;  2JQ6 A;  3TDI A;  5DKN A;  2DOQ A;  3IQO A;  4HRH A;  2F3Y A;  1WLM A;  2GGZ A;  2PAL A;  1NX2 A;  2KGR A;  4PE1 A;  1M63 B;  5JOL A;  1E8A A;  4DIR A;  1SNL A;  3WNX B;  2NLN A;  3O4Y A;  1KFU L;  4MRX A;  1UHH A;  4MRY A;  2G9B A;  2ZFD A;  1B47 A;  3AAJ A;  1RK9 A;  5TNC A;  1WRL A;  1IJ6 A;  3OX6 A;  3I5I C;  4JQ0 D;  1NIW A;  5HKZ A;  2WOS A;  4OV2 A;  1F4Q A;  1QAT A;  4AQI A;  1YRT B;  1CFP A;  5HKY A;  2SAS A;  1B7T Y;  2LE9 B;  3KHE A;  4I5L B;  5D69 A;  1NSH A;  2LMU A;  1BJF A;  5KTY A;  1K96 A;  1MF8 B;  1FF1 A;  1F70 A;  1KWO C;  1QLS A;  4M2P A;  4ZCU A;  2H61 C;  1AJ4 A;  2NCO A;  3NXA A;  1YUR A;  2EHB A;  2OS8 C;  1MHO A;  1A4P A;  2HQW A;  1SCV A;  2KFH A;  2WND A;  3BUM B;  4UPG A;  5I2Q A;  1BR1 B;  1QJT A;  2LLS A;  4MZL A;  4MZK A;  1QIV A;  1QVI Z;  3IF7 A;  5AXI A;  1SRA A;  2BBN A;  2JTZ A;  3CR2 A;  2JPT A;  5AFP A;  1IQ3 A;  1J7R A;  1S26 D;  4NDC A;  3TDZ A;  1BOC A;  1RWY A;  2G2B A;  1IKU A;  5GQQ C;  4ORC B;  1F4O A;  2KFG A;  2COL B;  1B4C A;  4A4B A;  2LMV A;  3LLE A;  2MA2 A;  2PRU A;  3I5F C;  1SR6 B;  1QTX A;  1JF2 A;  2K7B A;  5KU1 A;  4IL1 A;  1DTL A;  3BUX B;  3PN7 C;  1CFF A;  2KI4 C;  1KCY A;  1VRK A;  3FIA A;  2Y1M A;  5HLV A;  2K7D A;  3RM1 A;  3NSO A;  1FI6 A;  2Y4Q A;  1DF0 A;  1EG3 A;  4PHM A;  1WY9 A;  3EVR A;  2BEC A;  2H2K A;  1B9A A;  1PVB A;  1MXL C;  1LVC D;  2JU0 A;  3I5G B;  1BG1 A;  1V1G A;  3JTD B;  1V1F A;  3LK1 A;  1XFU O;  2A4J A;  2JTT A;  5KSZ A;  1DJY A;  1DJH A;  2K0J A;  2M1U A;  5CSJ A;  1ALV A;  1XK4 A;  4PE7 A;  4C0J A;  3TZ1 A;  3EKH A;  1KSO A;  1SBJ A;  3DF0 B;  4ORB B;  4E68 A;  4YGD B;  2LHL A;  3PFV A;  2M49 B;  3JVT B;  1AUI B;  2LAP A;  1NCX A;  1CM1 A;  3GK4 X;  1XO5 A;  4PE4 A;  3TUY B;  3DVE A;  4QJ3 B;  1B8L A;  4ETO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...