2KLDA

Solution structure of the calcium binding domain of the c-terminal cytosolic domain of polycystin-2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
DISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polycystin-2
publication title NMR-assignments of a cytosolic domain of the C-terminus of polycystin-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.170 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2kldA01
2KLEA 2KLDA
chains in the Genus database with same CATH superfamily
2LE9B 2KHNA 1G4YR 3OHMB 2L51A 4P5OE 4IL1A 1CDLA 4CFRA 4PHNA 4MZKA 4MZLA 1L2OB 1SCMB 3DVMA 1NYAA 2WORA 1K96A 1LA3A 2GGMA 2K7BA 4ORBB 5GQQC 2MBXA 1SPYA 1CMFA 3AAKA 4GNKB 3TDUA 2L4HA 4QJ5B 1YR5A 3BUNB 2NCOA 1A29A 1DMOA 1B8RA 2ZKMX 1HT9A 1SNLA 2OTGC 1C7WA 1K9UA 1KCYA 2A4JA 3DVJA 1DTLA 5HLOA 1ZUZA 3H4SE 3JVTB 2JNFA 3NHIA 2JC2A 1UUSA 1C3ZA 3E3RA 1DQEA 4I5NB 4PDZA 3WNXB 1YRUB 2L4IA 4ETOA 1DGVA 2WCLA 3L4LA 4PE1A 2BNXA 4OVNF 5JJGA 1QJTA 1NPQA 1PVAA 5AXIA 1A75A 1CLBA 1SCVA 4XJKA 1CFDA 2FJUB 2M1KB 3MSEB 2QEVA 1EG4A 1U5IB 3EG5B 2WNDA 1XFVO 3I5FC 1KQMB 2FCEA 3BFHA 3KF9A 1QXPA 1CM4A 1KFXL 2JNXA 2K7DA 2NCPA 2Q91A 2TN4A 3Q8IA 3KO0A 4JWQA 1LS8A 4N1FA 5EL2A 2LLTA 5G08A 2KBMA 3O6BA 2KAVA 2B1UA 3NSOA 3S0GA 1KFXS 4A4CA 1SL8A 2JXLA 2ZN8A 2EGDA 1A4PA 4CLNA 1CFPA 2O5GA 2PASA 2GGZA 4PE4A 1K9PA 5I2LA 1LINA 1JFKA 1Z2CB 3EKJA 1OZSA 4ZCVA 1H4BA 2JXCA 4NDDA 1FPWA 4PCWA 3UO9A 1CNPA 3GOFA 3JTDB 3BUMB 2HETA 2LCPA 4DCKA 4Q04A 1BG1A 4FTGA 1CDNA 2BCBA 1YRTB 1G8IA 3SG2A 2ZRTA 2F3ZA 3OB2B 1ZOTB 1JBAA 1RTP1 2OPOA 3D0YA 2M29A 3IQQA 3IVTA 3PLFB 1FBVA 1MXEA 2K0JA 4FQTA 1JWDA 4MEWA 2K7CA 4BY5A 5I2QA 1J55A 3KEVA 2WCJA 2M3WA 1T14A 2I2RE 1FF1A 4C0KA 3B86A 3PFVA 2KI6D 2KNEA 1S6IA 2L98A 2M97A 2QPTA 3D78A 2F8PA 4OV2A 1AHRA 1NX2A 1UHJA 3A4UB 2K2AA 3LLEA 1PSRA 2LHIA 1OMVA 3CZTX 1SKTA 1NP8A 1TNXA 1OMRA 3O2PA 3WHUB 1E8AA 2BL0C 2KGRA 3DXLA 1XFZO 4GGNA 5AFPA 1GM0A 1S6JA 1NX0A 1NIWA 1V1GA 2LLSA 2LP3A 1DJGA 2ZN9A 3D10A 1QTXA 2LVKA 4YGEB 1YVLA 3EK4A 3KPXA 4P2YB 4M2PA 3CR4X 4WRIA 1S1EA 2BE4A 2FJYA 1OOHA 1B8LA 1QS7A 3QMEA 1QVIZ 4JKTA 5HYDA 3S0BA 2JRFA 2KLDA 1QLKA 3FS7A 3TS5B 2NZ0A 2WOSA 2WC8A 3VRRA 2KBIA 1PVBA 3PN7B 1J7RA 1RWYA 2PYQA 1DJWA 2OS8B 3O4YA 1D1OA 4QJ3B 2KDHA 2P70A 4N5XA 4PALA 1WRZA 2LHLA 1SRAA 4GBAA 5KU1A 2JZIA 3DD4A 4HRHA 4NDBA 1XFYO 4QJ4B 3AKBA 4YRUA 3RZSA 3VGOA 1U5IA 1CDMA 2LNKA 4I5JA 2JT3A 3CDNA 4MZJA 5F6TA 3L47A 3SIBA 4M2QA 3IF7A 1AK8A 2ERBA 1NWDA 3I5GB 1BR4B 3GK1A 1B9AA 1RFJA 5KTYA 2QEHA 5B8IB 2PMYA 2M0RA 1AUIB 1UHIA 1JSAA 2KI6C 1CKKA 3SG6A 2CXJA 2JTZA 2JWWA 2F2OA 1M45A 1DGUA 1OW4A 3TUYB 1CFCA 2M1UA 2K60A 1NCZA 4WQ3A 2FCDA 2Y4QA 4GPLB 1S36A 1BF5A 2GTEA 1MWNA 1Y1AA 4F7FA 4YI9A 4YGCB 1QVIY 5HKZA 3GK4X 4C0LA 2BBNA 1HQVA 1FW4A 1TWOA 1QX2A 2P71A 1AJ5A 1QIVA 2LMTA 4JPZB 3NSIA 2JTTA 1DJIA 3R1OA 3CWGA 5D69A 2MJWB 3AAJA 4IJ7A 4E68A 1QATA 1H8BA 2ZNEA 2LP2A 1L2OC 1SCMC 1NX3A 1M39A 1TNWA 4FQOA 3HX4A 5KSZA 1OOFA 2EC6C 1M46A 1AP4A 2BKHB 2Y5IA 4GAOA 1W9ZA 3S0FA 1FI5A 3EVUA 1OMDA 1B4CA 1EXRA 1WLMA 1XVJA 1XFUO 4CIDA 5CPVA 1QV1A 2EHBA 2LVVA 2L5XB 4I5KA 3OGNA 2MLFC 1YX8A 4XYNA 1SSEB 2QACA 2LANA 1WRKA 3RM1A 1LXFC 1GJYA 1Q80A 1K90D 1NX1A 2COLB 2MLEC 1KWOC 1XK4C 1TTXA 1WLZA 1YUUA 1SR6B 1DC1A 2M7NA 2LUXA 1ORGA 2KQYA 2SCPA 1BR1B 2AAOA 1PK0D 1SW8A 3I5HB 3S0EA 1S5GY 1Y1UA 2E30A 2I18A 3CYZA 4INWA 3L4AA 1AVSA 4NQGA 1Y1XA 1ODBA 1TN4A 1PALA 1CMGA 4YI8A 1LKJA 1X02A 3CTNA 1TCFA 1BT6A 1KK7Y 3B87A 3DF0B 3HCMA 2KGBC 1DVIA 1C3YA 5CSJA 1R2UA 2K61A 3FE9A 3D74A 4HREE 1KK8B 5I8NA 1QX5B 1IGVA 2NXQA 3D73A 2LC5A 1A03A 3R72A 1CM1A 1S6CA 3OB1B 5I94A 2KI4B 2HQWA 2I94A 2WCKA 1ZACA 1OOGA 3OP0A 4MLWA 2PSRA 4A4BA 1QWVA 4DIRA 2BE6A 2BKIB 3IQOA 2H61A 3JTDC 4MRXA 1DJYA 4PHJA 2GV5A 1RJVA 1ALWA 2KFFA 4HSZA 1OOIX 3FIAA 3OX6A 2DOQA 3TDIA 2WCHA 3K21A 3S0DA 1OE9B 2P6BB 5ER4X 1UHNA 3S0AA 1JC2A 3I5IB 1CLMA 1IJ5A 1IG5A 3SS4A 2PRUA 1KSOA 4MVFA 2AMIA 1SYMA 1IIOA 1EJ3A 1OOJA 1TUJA 1Y0VH 3NGVA 5AANA 2KAYA 1M63B 5FYXA 2LMVA 3CR5X 1EG3A 3SJSA 2HF5A 2KQ6A 1UP5A 2R2IA 4YGAA 2Y1MA 1MUXA 3EVVA 1F70A 2G9BA 4C0JA 1C7VA 3BJHA 1JUOA 3NSKA 1N65A 2LVJA 2LV7A 4R1EA 4UPGA 5CSIA 4GUKA 1XFRA 3DVEA 3PM8A 3PALA 4KYNA 3FE8A 3KHEA 4OKHA 1K2HA 2L5YA 2JPOA 5DKRA 2I7AA 3VRPA 5HKWA 5HKYA 2E6WA 3F45A 5FI7A 4NDCA 4YGDB 4AOMA 1OSAA 1JF0A 1IRJA 1AJ4A 1TNPA 1NSHA 3CZ0A 3CZ1A 5IBWA 4F0ZB 1B1GA 4CFQA 2O60A 1NCXA 1YTZC 2F33A 2PALA 4ORAB 3RLZA 4BY4A 3SIAA 1K8UA 1NCYA 1PULA 1TNQA 1ZMZA 3VROA 5BPJA 3TS5C 2SASA 2M7LA 1F71A 2F3YA 1VRKA 3NXAA 1LA0A 2IS9A 2OS8C 5DKNA 1GGWA 1DF0B 3V2LA 2BCAA 2F2PA 3BXKA 4U8DA 1K94A 1DJXA 1WDCB 1QIWA 1DJHA 3BUWB 3BOWB 2H61C 2BAPA 3PATA 3ICBA 1XA5A 3BUOB 4CPVA 1SL7A 3DF0A 1YX7A 1V1FA 1YUSA 3I5GC 5FI6A 3VRNA 1S5GZ 2LM5A 1MHOA 1TRFA 4DUQA 3LCPC 1RECA 1SMGA 1L7ZA 3SG7A 1IJ6A 2BCXA 3NSLA 1KK7Z 3TUYC 2MHHA 5D7FA 3SG5A 2PQLA 4AQJA 5HL1A 3BYAA 1NUBA 4DS7A 2L2CA 1DT7B 2OTGB 3WHTB 3OX5A 4MSPA 2M8UA 4ZCUA 1K93D 1KFUL 2K7OA 1LVCD 3WXAA 2VRGA 3VB1A 2KSPA 1QASA 2EC6B 3CLNA 1KFUS 3AKAA 4OCIA 3ZNIA 1TIZA 2KFHA 1SK6D 3B88A 1B7TY 3DVKA 2Q4UA 1UURA 2M49B 1RK9A 2FOTA 3JVTC 1J7OA 3LK1A 3SG3A 2JU0A 4YBHB 1A2XA 1IH0A 4MBEA 3PM2A 2H8VA 3I5FB 1BOCA 3TDZA 2LAPA 1IQ3A 2JT0A 2BBMA 1KWOB 2CT9A 3C1VA 3EVRA 3PJIA 4OR9B 1PSBA 3EK7A 2HPSA 2JULA 5DKQA 4HRGA 5D3OA 1KQMC 2K8MB 1EL4A 2D8NA 1F54A 3D76A 2H2KA 1SR6C 3B6XA 4PE7A 1IWQA 2JT8A 3I5HC 3BFAA 1TOPA 2MA2A 4GFTA 2KYCA 2RGIA 1FI6A 3R1PA 2ZRSA 1ALVA 4TNCA 2AUCA 2CTNA 4PHKA 5CSNA 3O4XA 1CB1A 1IKUA 1MQ1A 5J3XA 3FE6A 3CGAA 3PSRA 5AERA 2KPHA 1MF8B 1CLLA 2WCBA 5JOLA 1F4QA 4GGFA 1J7PA 1W7IB 2JPTA 4AQIA 1KK8C 1F55A 3BQ3A 2CNPA 1MR8A 2KAXA 4PE0A 1J1EA 1XO5A 1IQ5A 4WQ2A 4PHMA 1KSMA 2QEOA 2KI4C 1EH2A 1DF0A 1YVHA 2MRDA 1DEKA 4JQ0D 1CDPA 1JFJA 1UHKA 1K9KA 2NLNA 3DY9A 4MN0A 2MAZA 1XFXO 3OBVA 3BOWA 1Z4HA 2YGUA 2ZNDA 3DYEA 3O78A 1B47A 4ICBA 1OZOA 1SL9A 2KLEA 3CR2A 2L50A 1B8CA 1S3PA 2WCEA 1N0YA 1PRWA 1CTRA 2BL0B 2WCMA 3I5IC 1F4OA 1A75B 4D1EA 1DELA 1Y6WA 3SS5A 5K89A 2ZFDA 4INXA 3N7HA 4XJKB 1BU3A 1XFWO 3EKHA 2HQ8A 1CFFA 3GK2A 2WC6A 4USLA 1QX7A 3CZ2A 1QV0A 2KFGA 5DICA 1BODA 3BUXB 3A8RA 1J7QA 1BMOA 1TCOB 2CBLA 3B7AA 1W7JB 2BECA 3LK0A 4YGBB 1UHHA 1UWOA 3LL8B 2JOJA 2G2BA 1WRLA 2KOTA 2L2EA 3EK8A 1DJZA 2LLUA 3BFBA 1SBJA 3CS1A 4N1GA 5HLVA 4OZDA 1GQMA 1J1DA 1KQVA 1F8HA 3SG4A 4I5LB 1QLSA 1RROA 1GGZA 1OQPA 1WY9A 2QDIA 1ZFSA 3K1EA 3TZ1A 4ORCB 1M31A 3QRXA 3PN7C 4DRWA 1YUTA 2CCMA 1B7TZ 1SY9A 3CABA 3M0WA 2K2FA 1XK4A 2PVBA 4L9MA 2LMUA 3R1VA 5PALA 3UNWA 2KYFA 5I2OA 1S26D 2M9GA 4JD9A 2ISDA 1JF2A 5AEQA 5TNCA 3D77A 3D0YB 5ER5A 2LUCA 2Y1NA 4GGFC 1P28A 3SS3A 3ZWHA 1YURA 1R6PA 3FWBA 2QEBA 4PT1A 3NHTA 4MRYA 5CSFA 4M2OA 2JQ6A 1TUZA 1K95A 1N2DA 1MXLC 2WC5A 1C07A 1G33A 5FI2A 3D75A 3DZTA 1BJFA 2V53A 2WCFA 1XYDA 1WDCC 2L0PA 1BLQA 3FWCA 3VRQA 2LVIA
chains in the Genus database with same CATH topology
1DELA 3SS5A 4GAOA 1W9ZA 1Z2CB 2BNXA 5D3OA 4JKTA 3UO9A 2KLDA 3UNWA 2K60A 4I5KA 4KYNA 2BAPA 2L5YA 3SS4A 1DEKA 3SS3A 3EG5B 5FI6A 5FI7A 4GBAA 3OBVA 1Z4HA 2YGUA 5I94A 3IVTA 2KLEA 1DC1A 4I5JA 5FI2A 3O4XA 4MEWA 3PM2A 4IJ7A 3KEVA 4I5LB 4I5NB 5HL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLE A;  2KLD A; 
#chains in the Genus database with same CATH topology
 2LE9 B;  2KHN A;  1G4Y R;  3OHM B;  2L51 A;  4P5O E;  4IL1 A;  1CDL A;  4CFR A;  4PHN A;  4MZK A;  4MZL A;  1L2O B;  1SCM B;  3DVM A;  1NYA A;  2WOR A;  1K96 A;  1LA3 A;  2GGM A;  2K7B A;  4ORB B;  5GQQ C;  2MBX A;  1SPY A;  1CMF A;  3AAK A;  4GNK B;  3TDU A;  2L4H A;  4QJ5 B;  1YR5 A;  3BUN B;  2NCO A;  1A29 A;  1DMO A;  1B8R A;  2ZKM X;  1HT9 A;  1SNL A;  2OTG C;  1C7W A;  1K9U A;  1KCY A;  2A4J A;  3DVJ A;  1DTL A;  5HLO A;  1ZUZ A;  3H4S E;  3JVT B;  2JNF A;  3NHI A;  2JC2 A;  1UUS A;  1C3Z A;  3E3R A;  1DQE A;  4I5N B;  4PDZ A;  3WNX B;  1YRU B;  2L4I A;  4ETO A;  1DGV A;  2WCL A;  3L4L A;  4PE1 A;  2BNX A;  4OVN F;  5JJG A;  1QJT A;  1NPQ A;  1PVA A;  5AXI A;  1A75 A;  1CLB A;  1SCV A;  4XJK A;  1CFD A;  2FJU B;  2M1K B;  3MSE B;  2QEV A;  1EG4 A;  1U5I B;  3EG5 B;  2WND A;  1XFV O;  3I5F C;  1KQM B;  2FCE A;  3BFH A;  3KF9 A;  1QXP A;  1CM4 A;  1KFX L;  2JNX A;  2K7D A;  2NCP A;  2Q91 A;  2TN4 A;  3Q8I A;  3KO0 A;  4JWQ A;  1LS8 A;  4N1F A;  5EL2 A;  2LLT A;  5G08 A;  2KBM A;  3O6B A;  2KAV A;  2B1U A;  3NSO A;  3S0G A;  1KFX S;  4A4C A;  1SL8 A;  2JXL A;  2ZN8 A;  2EGD A;  1A4P A;  4CLN A;  1CFP A;  2O5G A;  2PAS A;  2GGZ A;  4PE4 A;  1K9P A;  5I2L A;  1LIN A;  1JFK A;  1Z2C B;  3EKJ A;  1OZS A;  4ZCV A;  1H4B A;  2JXC A;  4NDD A;  1FPW A;  4PCW A;  3UO9 A;  1CNP A;  3GOF A;  3JTD B;  3BUM B;  2HET A;  2LCP A;  4DCK A;  4Q04 A;  1BG1 A;  4FTG A;  1CDN A;  2BCB A;  1YRT B;  1G8I A;  3SG2 A;  2ZRT A;  2F3Z A;  3OB2 B;  1ZOT B;  1JBA A;  1RTP 1;  2OPO A;  3D0Y A;  2M29 A;  3IQQ A;  3IVT A;  3PLF B;  1FBV A;  1MXE A;  2K0J A;  4FQT A;  1JWD A;  4MEW A;  2K7C A;  4BY5 A;  5I2Q A;  1J55 A;  3KEV A;  2WCJ A;  2M3W A;  1T14 A;  2I2R E;  1FF1 A;  4C0K A;  3B86 A;  3PFV A;  2KI6 D;  2KNE A;  1S6I A;  2L98 A;  2M97 A;  2QPT A;  3D78 A;  2F8P A;  4OV2 A;  1AHR A;  1NX2 A;  1UHJ A;  3A4U B;  2K2A A;  3LLE A;  1PSR A;  2LHI A;  1OMV A;  3CZT X;  1SKT A;  1NP8 A;  1TNX A;  1OMR A;  3O2P A;  3WHU B;  1E8A A;  2BL0 C;  2KGR A;  3DXL A;  1XFZ O;  4GGN A;  5AFP A;  1GM0 A;  1S6J A;  1NX0 A;  1NIW A;  1V1G A;  2LLS A;  2LP3 A;  1DJG A;  2ZN9 A;  3D10 A;  1QTX A;  2LVK A;  4YGE B;  1YVL A;  3EK4 A;  3KPX A;  4P2Y B;  4M2P A;  3CR4 X;  4WRI A;  1S1E A;  2BE4 A;  2FJY A;  1OOH A;  1B8L A;  1QS7 A;  3QME A;  1QVI Z;  4JKT A;  5HYD A;  3S0B A;  2JRF A;  2KLD A;  1QLK A;  3FS7 A;  3TS5 B;  2NZ0 A;  2WOS A;  2WC8 A;  3VRR A;  2KBI A;  1PVB A;  3PN7 B;  1J7R A;  1RWY A;  2PYQ A;  1DJW A;  2OS8 B;  3O4Y A;  1D1O A;  4QJ3 B;  2KDH A;  2P70 A;  4N5X A;  4PAL A;  1WRZ A;  2LHL A;  1SRA A;  4GBA A;  5KU1 A;  2JZI A;  3DD4 A;  4HRH A;  4NDB A;  1XFY O;  4QJ4 B;  3AKB A;  4YRU A;  3RZS A;  3VGO A;  1U5I A;  1CDM A;  2LNK A;  4I5J A;  2JT3 A;  3CDN A;  4MZJ A;  5F6T A;  3L47 A;  3SIB A;  4M2Q A;  3IF7 A;  1AK8 A;  2ERB A;  1NWD A;  3I5G B;  1BR4 B;  3GK1 A;  1B9A A;  1RFJ A;  5KTY A;  2QEH A;  5B8I B;  2PMY A;  2M0R A;  1AUI B;  1UHI A;  1JSA A;  2KI6 C;  1CKK A;  3SG6 A;  2CXJ A;  2JTZ A;  2JWW A;  2F2O A;  1M45 A;  1DGU A;  1OW4 A;  3TUY B;  1CFC A;  2M1U A;  2K60 A;  1NCZ A;  4WQ3 A;  2FCD A;  2Y4Q A;  4GPL B;  1S36 A;  1BF5 A;  2GTE A;  1MWN A;  1Y1A A;  4F7F A;  4YI9 A;  4YGC B;  1QVI Y;  5HKZ A;  3GK4 X;  4C0L A;  2BBN A;  1HQV A;  1FW4 A;  1TWO A;  1QX2 A;  2P71 A;  1AJ5 A;  1QIV A;  2LMT A;  4JPZ B;  3NSI A;  2JTT A;  1DJI A;  3R1O A;  3CWG A;  5D69 A;  2MJW B;  3AAJ A;  4IJ7 A;  4E68 A;  1QAT A;  1H8B A;  2ZNE A;  2LP2 A;  1L2O C;  1SCM C;  1NX3 A;  1M39 A;  1TNW A;  4FQO A;  3HX4 A;  5KSZ A;  1OOF A;  2EC6 C;  1M46 A;  1AP4 A;  2BKH B;  2Y5I A;  4GAO A;  1W9Z A;  3S0F A;  1FI5 A;  3EVU A;  1OMD A;  1B4C A;  1EXR A;  1WLM A;  1XVJ A;  1XFU O;  4CID A;  5CPV A;  1QV1 A;  2EHB A;  2LVV A;  2L5X B;  4I5K A;  3OGN A;  2MLF C;  1YX8 A;  4XYN A;  1SSE B;  2QAC A;  2LAN A;  1WRK A;  3RM1 A;  1LXF C;  1GJY A;  1Q80 A;  1K90 D;  1NX1 A;  2COL B;  2MLE C;  1KWO C;  1XK4 C;  1TTX A;  1WLZ A;  1YUU A;  1SR6 B;  1DC1 A;  2M7N A;  2LUX A;  1ORG A;  2KQY A;  2SCP A;  1BR1 B;  2AAO A;  1PK0 D;  1SW8 A;  3I5H B;  3S0E A;  1S5G Y;  1Y1U A;  2E30 A;  2I18 A;  3CYZ A;  4INW A;  3L4A A;  1AVS A;  4NQG A;  1Y1X A;  1ODB A;  1TN4 A;  1PAL A;  1CMG A;  4YI8 A;  1LKJ A;  1X02 A;  3CTN A;  1TCF A;  1BT6 A;  1KK7 Y;  3B87 A;  3DF0 B;  3HCM A;  2KGB C;  1DVI A;  1C3Y A;  5CSJ A;  1R2U A;  2K61 A;  3FE9 A;  3D74 A;  4HRE E;  1KK8 B;  5I8N A;  1QX5 B;  1IGV A;  2NXQ A;  3D73 A;  2LC5 A;  1A03 A;  3R72 A;  1CM1 A;  1S6C A;  3OB1 B;  5I94 A;  2KI4 B;  2HQW A;  2I94 A;  2WCK A;  1ZAC A;  1OOG A;  3OP0 A;  4MLW A;  2PSR A;  4A4B A;  1QWV A;  4DIR A;  2BE6 A;  2BKI B;  3IQO A;  2H61 A;  3JTD C;  4MRX A;  1DJY A;  4PHJ A;  2GV5 A;  1RJV A;  1ALW A;  2KFF A;  4HSZ A;  1OOI X;  3FIA A;  3OX6 A;  2DOQ A;  3TDI A;  2WCH A;  3K21 A;  3S0D A;  1OE9 B;  2P6B B;  5ER4 X;  1UHN A;  3S0A A;  1JC2 A;  3I5I B;  1CLM A;  1IJ5 A;  1IG5 A;  3SS4 A;  2PRU A;  1KSO A;  4MVF A;  2AMI A;  1SYM A;  1IIO A;  1EJ3 A;  1OOJ A;  1TUJ A;  1Y0V H;  3NGV A;  5AAN A;  2KAY A;  1M63 B;  5FYX A;  2LMV A;  3CR5 X;  1EG3 A;  3SJS A;  2HF5 A;  2KQ6 A;  1UP5 A;  2R2I A;  4YGA A;  2Y1M A;  1MUX A;  3EVV A;  1F70 A;  2G9B A;  4C0J A;  1C7V A;  3BJH A;  1JUO A;  3NSK A;  1N65 A;  2LVJ A;  2LV7 A;  4R1E A;  4UPG A;  5CSI A;  4GUK A;  1XFR A;  3DVE A;  3PM8 A;  3PAL A;  4KYN A;  3FE8 A;  3KHE A;  4OKH A;  1K2H A;  2L5Y A;  2JPO A;  5DKR A;  2I7A A;  3VRP A;  5HKW A;  5HKY A;  2E6W A;  3F45 A;  5FI7 A;  4NDC A;  4YGD B;  4AOM A;  1OSA A;  1JF0 A;  1IRJ A;  1AJ4 A;  1TNP A;  1NSH A;  3CZ0 A;  3CZ1 A;  5IBW A;  4F0Z B;  1B1G A;  4CFQ A;  2O60 A;  1NCX A;  1YTZ C;  2F33 A;  2PAL A;  4ORA B;  3RLZ A;  4BY4 A;  3SIA A;  1K8U A;  1NCY A;  1PUL A;  1TNQ A;  1ZMZ A;  3VRO A;  5BPJ A;  3TS5 C;  2SAS A;  2M7L A;  1F71 A;  2F3Y A;  1VRK A;  3NXA A;  1LA0 A;  2IS9 A;  2OS8 C;  5DKN A;  1GGW A;  1DF0 B;  3V2L A;  2BCA A;  2F2P A;  3BXK A;  4U8D A;  1K94 A;  1DJX A;  1WDC B;  1QIW A;  1DJH A;  3BUW B;  3BOW B;  2H61 C;  2BAP A;  3PAT A;  3ICB A;  1XA5 A;  3BUO B;  4CPV A;  1SL7 A;  3DF0 A;  1YX7 A;  1V1F A;  1YUS A;  3I5G C;  5FI6 A;  3VRN A;  1S5G Z;  2LM5 A;  1MHO A;  1TRF A;  4DUQ A;  3LCP C;  1REC A;  1SMG A;  1L7Z A;  3SG7 A;  1IJ6 A;  2BCX A;  3NSL A;  1KK7 Z;  3TUY C;  2MHH A;  5D7F A;  3SG5 A;  2PQL A;  4AQJ A;  5HL1 A;  3BYA A;  1NUB A;  4DS7 A;  2L2C A;  1DT7 B;  2OTG B;  3WHT B;  3OX5 A;  4MSP A;  2M8U A;  4ZCU A;  1K93 D;  1KFU L;  2K7O A;  1LVC D;  3WXA A;  2VRG A;  3VB1 A;  2KSP A;  1QAS A;  2EC6 B;  3CLN A;  1KFU S;  3AKA A;  4OCI A;  3ZNI A;  1TIZ A;  2KFH A;  1SK6 D;  3B88 A;  1B7T Y;  3DVK A;  2Q4U A;  1UUR A;  2M49 B;  1RK9 A;  2FOT A;  3JVT C;  1J7O A;  3LK1 A;  3SG3 A;  2JU0 A;  4YBH B;  1A2X A;  1IH0 A;  4MBE A;  3PM2 A;  2H8V A;  3I5F B;  1BOC A;  3TDZ A;  2LAP A;  1IQ3 A;  2JT0 A;  2BBM A;  1KWO B;  2CT9 A;  3C1V A;  3EVR A;  3PJI A;  4OR9 B;  1PSB A;  3EK7 A;  2HPS A;  2JUL A;  5DKQ A;  4HRG A;  5D3O A;  1KQM C;  2K8M B;  1EL4 A;  2D8N A;  1F54 A;  3D76 A;  2H2K A;  1SR6 C;  3B6X A;  4PE7 A;  1IWQ A;  2JT8 A;  3I5H C;  3BFA A;  1TOP A;  2MA2 A;  4GFT A;  2KYC A;  2RGI A;  1FI6 A;  3R1P A;  2ZRS A;  1ALV A;  4TNC A;  2AUC A;  2CTN A;  4PHK A;  5CSN A;  3O4X A;  1CB1 A;  1IKU A;  1MQ1 A;  5J3X A;  3FE6 A;  3CGA A;  3PSR A;  5AER A;  2KPH A;  1MF8 B;  1CLL A;  2WCB A;  5JOL A;  1F4Q A;  4GGF A;  1J7P A;  1W7I B;  2JPT A;  4AQI A;  1KK8 C;  1F55 A;  3BQ3 A;  2CNP A;  1MR8 A;  2KAX A;  4PE0 A;  1J1E A;  1XO5 A;  1IQ5 A;  4WQ2 A;  4PHM A;  1KSM A;  2QEO A;  2KI4 C;  1EH2 A;  1DF0 A;  1YVH A;  2MRD A;  1DEK A;  4JQ0 D;  1CDP A;  1JFJ A;  1UHK A;  1K9K A;  2NLN A;  3DY9 A;  4MN0 A;  2MAZ A;  1XFX O;  3OBV A;  3BOW A;  1Z4H A;  2YGU A;  2ZND A;  3DYE A;  3O78 A;  1B47 A;  4ICB A;  1OZO A;  1SL9 A;  2KLE A;  3CR2 A;  2L50 A;  1B8C A;  1S3P A;  2WCE A;  1N0Y A;  1PRW A;  1CTR A;  2BL0 B;  2WCM A;  3I5I C;  1F4O A;  1A75 B;  4D1E A;  1DEL A;  1Y6W A;  3SS5 A;  5K89 A;  2ZFD A;  4INX A;  3N7H A;  4XJK B;  1BU3 A;  1XFW O;  3EKH A;  2HQ8 A;  1CFF A;  3GK2 A;  2WC6 A;  4USL A;  1QX7 A;  3CZ2 A;  1QV0 A;  2KFG A;  5DIC A;  1BOD A;  3BUX B;  3A8R A;  1J7Q A;  1BMO A;  1TCO B;  2CBL A;  3B7A A;  1W7J B;  2BEC A;  3LK0 A;  4YGB B;  1UHH A;  1UWO A;  3LL8 B;  2JOJ A;  2G2B A;  1WRL A;  2KOT A;  2L2E A;  3EK8 A;  1DJZ A;  2LLU A;  3BFB A;  1SBJ A;  3CS1 A;  4N1G A;  5HLV A;  4OZD A;  1GQM A;  1J1D A;  1KQV A;  1F8H A;  3SG4 A;  4I5L B;  1QLS A;  1RRO A;  1GGZ A;  1OQP A;  1WY9 A;  2QDI A;  1ZFS A;  3K1E A;  3TZ1 A;  4ORC B;  1M31 A;  3QRX A;  3PN7 C;  4DRW A;  1YUT A;  2CCM A;  1B7T Z;  1SY9 A;  3CAB A;  3M0W A;  2K2F A;  1XK4 A;  2PVB A;  4L9M A;  2LMU A;  3R1V A;  5PAL A;  3UNW A;  2KYF A;  5I2O A;  1S26 D;  2M9G A;  4JD9 A;  2ISD A;  1JF2 A;  5AEQ A;  5TNC A;  3D77 A;  3D0Y B;  5ER5 A;  2LUC A;  2Y1N A;  4GGF C;  1P28 A;  3SS3 A;  3ZWH A;  1YUR A;  1R6P A;  3FWB A;  2QEB A;  4PT1 A;  3NHT A;  4MRY A;  5CSF A;  4M2O A;  2JQ6 A;  1TUZ A;  1K95 A;  1N2D A;  1MXL C;  2WC5 A;  1C07 A;  1G33 A;  5FI2 A;  3D75 A;  3DZT A;  1BJF A;  2V53 A;  2WCF A;  1XYD A;  1WDC C;  2L0P A;  1BLQ A;  3FWC A;  3VRQ A;  2LVI A; 
#chains in the Genus database with same CATH homology
 1DEL A;  3SS5 A;  4GAO A;  1W9Z A;  1Z2C B;  2BNX A;  5D3O A;  4JKT A;  3UO9 A;  2KLD A;  3UNW A;  2K60 A;  4I5K A;  4KYN A;  2BAP A;  2L5Y A;  3SS4 A;  1DEK A;  3SS3 A;  3EG5 B;  5FI6 A;  5FI7 A;  4GBA A;  3OBV A;  1Z4H A;  2YGU A;  5I94 A;  3IVT A;  2KLE A;  1DC1 A;  4I5J A;  5FI2 A;  3O4X A;  4MEW A;  3PM2 A;  4IJ7 A;  3KEV A;  4I5L B;  4I5N B;  5HL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...