2KLDA

Solution structure of the calcium binding domain of the c-terminal cytosolic domain of polycystin-2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'DISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polycystin-2
publication title NMR-assignments of a cytosolic domain of the C-terminus of polycystin-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.170 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2kldA01
2KLDA 2KLEA
chains in the Genus database with same CATH superfamily
1QS7A 5HKWA 3WNXB 2PASA 2ZRTA 4CIDA 2ZFDA 1AHRA 1OMDA 2K8MB 1B7TY 1TUJA 2KQ6A 2BNXA 2H61C 1HQVA 2KPHA 5CSJA 1SYMA 1RFJA 3A8RA 3TS5B 1PVAA 1SY9A 1XVJA 2BKIB 1BJFA 2WCHA 3BYAA 3RLZA 2OTGC 5AXIA 3JTDC 4YGAA 3LK0A 1QXPA 2BAPA 4Q04A 4ZCVA 4A4BA 1DGUA 1DJWA 1A29A 2ZNEA 1XFWO 2BL0B 2I7AA 2BECA 4N5XA 2F33A 4OKHA 5HYDA 1PVBA 1JFKA 2HQ8A 2JT8A 2JU0A 1IG5A 3ZNIA 3SS4A 4DIRA 1RTP1 1KSOA 1F4QA 2NCOA 2LVIA 3R1OA 4I5KA 3DF0A 1H8BA 4YI8A 2CBLA 1N65A 4JQ0D 2HF5A 2QEBA 2L2CA 1KFUL 2KI4C 1UURA 3SIAA 1F71A 1YVHA 1SL8A 3SG3A 1YRTB 4MRYA 3PN7B 3NSLA 1XFVO 1TCOB 1CTRA 1J7RA 4M2OA 4YGEB 5HKZA 1KQVA 1Q80A 1K9UA 1Y6WA 1GQMA 2AMIA 4MZLA 1IRJA 1KQMC 1FI5A 1CDLA 3KO0A 2KLDA 3BUMB 4N1GA 4MLWA 2P70A 1MF8B 3EK8A 1RROA 5G08A 3EKJA 2L4IA 3TUYB 1F70A 1K90D 1S5GY 1SCMB 1TOPA 3S0BA 2WC5A 1GGZA 3L47A 5I8NA 4OR9B 2MA2A 5GQQC 4MRXA 1OMVA 1DT7B 1WRKA 1OE9B 5ER5A 1K96A 1G8IA 2KNEA 3D10A 1C07A 1TWOA 1YUSA 2GGZA 1LA3A 1ZOTB 3IQQA 2ERBA 2M97A 2F3YA 2K2FA 3OX5A 5CSFA 3PM8A 5JOLA 1DMOA 1H4BA 1JBAA 1OOFA 1T14A 3JVTC 3CZ0A 2WC6A 3V2LA 5IBWA 4L9MA 2NZ0A 2LP3A 4GPLB 1AJ5A 1D1OA 4CLNA 2F2OA 3SJSA 2BCXA 4ETOA 1Y0VH 2KHNA 4GNKB 2LVKA 2G2BA 1N2DA 3FE6A 1XK4C 5JJGA 3TDUA 1B4CA 3D0YA 1Z4HA 3BUOB 1IWQA 1UHJA 1TNPA 4ZCUA 1IQ5A 4MBEA 2BCAA 1CMFA 1LXFC 3GK1A 3NGVA 3KPXA 5AANA 2K60A 1LS8A 2M29A 2JRFA 3PALA 5DICA 1XFZO 1F55A 3IQOA 4HRGA 2LVVA 5DKRA 2IS9A 4DCKA 4XJKA 1TN4A 3ICBA 1BOCA 1SR6B 2H2KA 2KGBC 3DVEA 1G4YR 1UWOA 1A75A 2M49B 1YR5A 3CGAA 3VRQA 2JOJA 4JD9A 1FF1A 3I5IB 2EC6C 3B87A 4E68A 2MBXA 5J3XA 1M45A 1IQ3A 2KI6C 4C0LA 1NP8A 2H8VA 2LNKA 1WDCC 1QWVA 1CLLA 4AQJA 1DELA 4CFRA 2WORA 3EK4A 1ZUZA 1OW4A 1KK7Z 2I2RE 1YX7A 3AAJA 3LCPC 1F54A 1NWDA 1B7TZ 1M31A 1B8LA 2L2EA 1K93D 1DJYA 1IJ6A 2JZIA 3D0YB 3NSIA 4YGBB 5HLVA 1V1FA 1SRAA 1S3PA 1U5IB 2DOQA 1XO5A 2E30A 2NXQA 4INWA 2ZNDA 2F2PA 3I5HC 4M2PA 1OZOA 1S6CA 1BLQA 1GJYA 1ORGA 3I5FC 1W7JB 1WLZA 1QX7A 2K61A 1HT9A 1LA0A 2P6BB 1DJIA 3L4AA 1BODA 1NIWA 4XYNA 1CLBA 3VB1A 2PRUA 2LVJA 2G9BA 3PM2A 3SS3A 1KFUS 1BR1B 1JC2A 5PALA 4PE1A 2QEHA 4QJ5B 1C3YA 1B1GA 1Y1AA 2KSPA 3EKHA 1A75B 1ALVA 1KFXL 2LLUA 1Y1XA 3BJHA 3CR5X 1GGWA 1GM0A 3CTNA 5B8IB 2LHIA 1J7QA 1L2OC 2D8NA 2KAVA 1ZACA 5I2OA 2AAOA 2K7CA 2OPOA 3SG5A 3B6XA 2NCPA 1IGVA 1JUOA 3CABA 1JSAA 1PRWA 4GGFA 1LVCD 1Z2CB 1FI6A 3OB2B 1P28A 2M3WA 3AAKA 3LL8B 2ZKMX 1FPWA 1MR8A 2H61A 2NLNA 1BT6A 4QJ3B 1NX0A 2LLTA 1KWOB 4PHMA 5F6TA 1SPYA 3I5GB 2WCBA 2F3ZA 4DUQA 2JXCA 2KDHA 1DJGA 2LE9B 3IVTA 4ORBB 2JTTA 3S0EA 5KTYA 1QX2A 3AKAA 3SG2A 3Q8IA 1CFFA 1PSRA 1E8AA 3KEVA 1UHKA 3FWCA 3GK4X 1TUZA 4IL1A 4P2YB 5I2QA 1QASA 3OB1B 1TNXA 1KK8B 1QATA 2E6WA 1EG3A 1QTXA 2PALA 3BFAA 5DKQA 1DJZA 1RECA 4DRWA 1EG4A 4ICBA 4PHJA 3VGOA 2KFFA 1BMOA 2K7BA 1OMRA 1XFYO 1UHHA 3OP0A 3D74A 4N1FA 2WOSA 2R2IA 4PT1A 1MUXA 1DC1A 1OQPA 3EVVA 4PE7A 2OS8B 1W7IB 1ALWA 1XFRA 2BKHB 3HCMA 2LMUA 2BCBA 4GUKA 2PYQA 3BQ3A 4GBAA 3PFVA 4GGNA 1XA5A 4IJ7A 4KYNA 2MJWB 1MXEA 2Q4UA 1EH2A 1YX8A 1KSMA 2OTGB 3BFHA 1U5IA 1J55A 2CTNA 3JTDB 2WCMA 1TRFA 3EVRA 1SKTA 3CZ1A 2LAPA 2CT9A 1L7ZA 1LINA 1M63B 2LMVA 1EL4A 2ZN8A 3B88A 5D3OA 1CDNA 1CFCA 3BUWB 4USLA 3D76A 2LM5A 1QVIY 2L50A 4YBHB 1XFXO 2Q91A 2SASA 2CNPA 1YURA 4WRIA 1R2UA 1SK6D 2O60A 3RM1A 1SL7A 1M39A 4YGDB 2LC5A 2KI4B 2LCPA 3M0WA 3TS5C 3R1PA 2KOTA 2L0PA 1AK8A 2JC2A 2WCFA 1IIOA 5ER4X 2BE6A 1FW4A 1K8UA 4INXA 1PULA 1NX2A 3LLEA 3QRXA 2K2AA 3PSRA 4I5JA 2BL0C 2KYCA 1OOIX 2Y4QA 4R1EA 1KQMB 4PE4A 2M0RA 4MN0A 3D75A 1YUUA 2Y1MA 4NDBA 3DYEA 2Y5IA 1KFXS 1CDPA 1RJVA 1IJ5A 3NXAA 4YRUA 2JT3A 5CSIA 2HPSA 1DJHA 1ZFSA 3TDIA 1XFUO 4ORAB 1DVIA 4QJ4B 4OV2A 2K0JA 1DGVA 1QIVA 3MSEB 2COLB 1UHIA 2M7LA 1V1GA 2LV7A 5FI6A 2A4JA 3PN7C 5BPJA 2FCEA 2CXJA 1NCXA 3JVTB 4MSPA 4C0JA 1XYDA 1K95A 3S0DA 2FCDA 2JT0A 4P5OE 3VRRA 4MVFA 3BUXB 3DVJA 1TNWA 2MLEC 2K7OA 3L4LA 4WQ3A 1NX1A 4AQIA 1B8CA 4PCWA 1BR4B 3TUYC 1C7VA 2MAZA 3OHMB 1SCMC 2F8PA 4MZJA 1CDMA 3B7AA 3SS5A 2OS8C 1UUSA 2ISDA 5KSZA 3FIAA 3FE9A 3DVMA 4NDDA 4NQGA 3BOWB 4CPVA 2PQLA 1VRKA 3CZ2A 5EL2A 2LUXA 2FJUB 3CDNA 2BE4A 1EXRA 1JF2A 1OSAA 3D73A 1YTZC 1QJTA 3BXKA 3NHTA 3OGNA 2KGRA 3SG7A 4GGFC 3HX4A 2HQWA 3WHTB 2JPTA 2MRDA 3D78A 5FI2A 1SL9A 3SG4A 2P71A 1NPQA 2L5YA 2B1UA 1RK9A 1S5GZ 3TZ1A 2KBMA 3S0GA 3VROA 1QX5B 1CB1A 1J1EA 1S6IA 1K94A 2EC6B 1J1DA 4HSZA 1Y1UA 2V53A 3K1EA 3FWBA 4OZDA 2ZRSA 2ZN9A 1F4OA 2QDIA 1OZSA 1WDCB 3F45A 3FS7A 3WXAA 1CNPA 1DEKA 2PVBA 5D69A 3R72A 2FOTA 3H4SE 5FYXA 1K9PA 3UO9A 4PDZA 2JNFA 1DF0B 2LANA 4FQOA 3RZSA 3CLNA 2L51A 2KQYA 3D77A 1SR6C 4FTGA 3FE8A 1SNLA 1JF0A 2CCMA 2JXLA 3E3RA 3NHIA 2WC8A 4CFQA 1PSBA 3CZTX 3I5IC 3O2PA 2L5XB 3SIBA 1KCYA 1QLSA 2SCPA 3I5HB 2VRGA 1QIWA 1SW8A 2L98A 3I5FB 1OOJA 1BG1A 1WRLA 2QPTA 1WRZA 4OCIA 4DS7A 1J7OA 1CM1A 1X02A 1CFPA 1QV1A 5AEQA 4BY5A 1TNQA 3QMEA 1MHOA 2EGDA 4U8DA 3S0FA 2TN4A 3GOFA 2KBIA 4JWQA 3O4XA 1UHNA 4M2QA 1QVIZ 2JQ6A 2KFGA 2I94A 2M1KB 1CMGA 1B8RA 3AKBA 1C3ZA 2GTEA 3O4YA 1AP4A 3BFBA 3GK2A 4F0ZB 1AVSA 1DJXA 1L2OB 2M8UA 2KI6D 2RGIA 2WCKA 1DQEA 1R6PA 5CSNA 5HKYA 1B9AA 5K89A 3KF9A 3OBVA 1K9KA 3KHEA 3SG6A 3VRNA 3DY9A 1NX3A 3EG5B 3O78A 1IKUA 4FQTA 1SSEB 5TNCA 1AUIB 1NYAA 3ZWHA 1YVLA 5FI7A 1ODBA 2GGMA 4GFTA 2WCLA 2KYFA 2KAYA 1JWDA 1OOHA 2M1UA 2QEVA 5I2LA 5AERA 4I5NB 2M9GA 3CYZA 2O5GA 3DF0B 1XK4A 4BY4A 1N0YA 1K2HA 4YGCB 2QACA 1S26D 2JPOA 4JPZB 4AOMA 1S36A 1CLMA 1QLKA 4OVNF 4TNCA 1J7PA 1PK0D 3BOWA 1S1EA 2LLSA 3TDZA 1A4PA 2K7DA 2BBMA 3DD4A 5HL1A 3CS1A 2GV5A 1W9ZA 3OX6A 3A4UB 5AFPA 4ORCB 2EHBA 5D7FA 2MLFC 2KAXA 1RWYA 3VRPA 4UPGA 1ZMZA 2M7NA 3EVUA 4A4CA 1OOGA 1DTLA 1YUTA 1TTXA 1NCYA 4NDCA 3NSKA 2HETA 3PJIA 3S0AA 1PALA 5DKNA 1CM4A 1FBVA 4D1EA 1BF5A 3R1VA 5HLOA 1KWOC 1EJ3A 5I94A 2JTZA 2QEOA 2LUCA 2WCJA 4HRHA 2KLEA 1NUBA 3K21A 4PALA 4MZKA 4JKTA 3UNWA 1MWNA 1CFDA 3I5GC 1G33A 4F7FA 1B47A 3O6BA 1LKJA 5CPVA 1MQ1A 1C7WA 1TIZA 3BUNB 4PHNA 3WHUB 2PSRA 1UP5A 1TCFA 2BBNA 2FJYA 3DXLA 1S6JA 2JULA 3NSOA 1M46A 1IH0A 1QV0A 4C0KA 2MHHA 3CR2A 1WY9A 3CR4X 1DF0A 1AJ4A 3N7HA 2KFHA 4HREE 1BU3A 2JNXA 1KK8C 3PATA 3C1VA 1SMGA 2WNDA 2LMTA 2Y1NA 4WQ2A 3B86A 2AUCA 4PE0A 3EK7A 3PLFB 4I5LB 4GAOA 4YI9A 1NSHA 2YGUA 1F8HA 2PMYA 2L4HA 3CWGA 3DZTA 2LP2A 3DVKA 3IF7A 3LK1A 1A03A 2JWWA 1A2XA 1JFJA 1WLMA 1SCVA 1CKKA 4PHKA 1SBJA 1MXLC 2LHLA 1NCZA 4MEWA 5KU1A 2WCEA 2I18A 1YRUB 1KK7Y 4XJKB
chains in the Genus database with same CATH topology
1W9ZA 4I5JA 5FI2A 3PM2A 3SS3A 2K60A 2L5YA 1DELA 3OBVA 2BNXA 5D3OA 3EG5B 3SS5A 3IVTA 1DC1A 4I5LB 4GAOA 5FI7A 2BAPA 2YGUA 5I94A 4I5NB 1DEKA 2KLDA 2KLEA 3KEVA 4JKTA 3UNWA 4GBAA 3O4XA 5FI6A 3UO9A 1Z2CB 3SS4A 4IJ7A 4KYNA 1Z4HA 4MEWA 4I5KA 5HL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLD A;  2KLE A; 
#chains in the Genus database with same CATH topology
 1QS7 A;  5HKW A;  3WNX B;  2PAS A;  2ZRT A;  4CID A;  2ZFD A;  1AHR A;  1OMD A;  2K8M B;  1B7T Y;  1TUJ A;  2KQ6 A;  2BNX A;  2H61 C;  1HQV A;  2KPH A;  5CSJ A;  1SYM A;  1RFJ A;  3A8R A;  3TS5 B;  1PVA A;  1SY9 A;  1XVJ A;  2BKI B;  1BJF A;  2WCH A;  3BYA A;  3RLZ A;  2OTG C;  5AXI A;  3JTD C;  4YGA A;  3LK0 A;  1QXP A;  2BAP A;  4Q04 A;  4ZCV A;  4A4B A;  1DGU A;  1DJW A;  1A29 A;  2ZNE A;  1XFW O;  2BL0 B;  2I7A A;  2BEC A;  4N5X A;  2F33 A;  4OKH A;  5HYD A;  1PVB A;  1JFK A;  2HQ8 A;  2JT8 A;  2JU0 A;  1IG5 A;  3ZNI A;  3SS4 A;  4DIR A;  1RTP 1;  1KSO A;  1F4Q A;  2NCO A;  2LVI A;  3R1O A;  4I5K A;  3DF0 A;  1H8B A;  4YI8 A;  2CBL A;  1N65 A;  4JQ0 D;  2HF5 A;  2QEB A;  2L2C A;  1KFU L;  2KI4 C;  1UUR A;  3SIA A;  1F71 A;  1YVH A;  1SL8 A;  3SG3 A;  1YRT B;  4MRY A;  3PN7 B;  3NSL A;  1XFV O;  1TCO B;  1CTR A;  1J7R A;  4M2O A;  4YGE B;  5HKZ A;  1KQV A;  1Q80 A;  1K9U A;  1Y6W A;  1GQM A;  2AMI A;  4MZL A;  1IRJ A;  1KQM C;  1FI5 A;  1CDL A;  3KO0 A;  2KLD A;  3BUM B;  4N1G A;  4MLW A;  2P70 A;  1MF8 B;  3EK8 A;  1RRO A;  5G08 A;  3EKJ A;  2L4I A;  3TUY B;  1F70 A;  1K90 D;  1S5G Y;  1SCM B;  1TOP A;  3S0B A;  2WC5 A;  1GGZ A;  3L47 A;  5I8N A;  4OR9 B;  2MA2 A;  5GQQ C;  4MRX A;  1OMV A;  1DT7 B;  1WRK A;  1OE9 B;  5ER5 A;  1K96 A;  1G8I A;  2KNE A;  3D10 A;  1C07 A;  1TWO A;  1YUS A;  2GGZ A;  1LA3 A;  1ZOT B;  3IQQ A;  2ERB A;  2M97 A;  2F3Y A;  2K2F A;  3OX5 A;  5CSF A;  3PM8 A;  5JOL A;  1DMO A;  1H4B A;  1JBA A;  1OOF A;  1T14 A;  3JVT C;  3CZ0 A;  2WC6 A;  3V2L A;  5IBW A;  4L9M A;  2NZ0 A;  2LP3 A;  4GPL B;  1AJ5 A;  1D1O A;  4CLN A;  2F2O A;  3SJS A;  2BCX A;  4ETO A;  1Y0V H;  2KHN A;  4GNK B;  2LVK A;  2G2B A;  1N2D A;  3FE6 A;  1XK4 C;  5JJG A;  3TDU A;  1B4C A;  3D0Y A;  1Z4H A;  3BUO B;  1IWQ A;  1UHJ A;  1TNP A;  4ZCU A;  1IQ5 A;  4MBE A;  2BCA A;  1CMF A;  1LXF C;  3GK1 A;  3NGV A;  3KPX A;  5AAN A;  2K60 A;  1LS8 A;  2M29 A;  2JRF A;  3PAL A;  5DIC A;  1XFZ O;  1F55 A;  3IQO A;  4HRG A;  2LVV A;  5DKR A;  2IS9 A;  4DCK A;  4XJK A;  1TN4 A;  3ICB A;  1BOC A;  1SR6 B;  2H2K A;  2KGB C;  3DVE A;  1G4Y R;  1UWO A;  1A75 A;  2M49 B;  1YR5 A;  3CGA A;  3VRQ A;  2JOJ A;  4JD9 A;  1FF1 A;  3I5I B;  2EC6 C;  3B87 A;  4E68 A;  2MBX A;  5J3X A;  1M45 A;  1IQ3 A;  2KI6 C;  4C0L A;  1NP8 A;  2H8V A;  2LNK A;  1WDC C;  1QWV A;  1CLL A;  4AQJ A;  1DEL A;  4CFR A;  2WOR A;  3EK4 A;  1ZUZ A;  1OW4 A;  1KK7 Z;  2I2R E;  1YX7 A;  3AAJ A;  3LCP C;  1F54 A;  1NWD A;  1B7T Z;  1M31 A;  1B8L A;  2L2E A;  1K93 D;  1DJY A;  1IJ6 A;  2JZI A;  3D0Y B;  3NSI A;  4YGB B;  5HLV A;  1V1F A;  1SRA A;  1S3P A;  1U5I B;  2DOQ A;  1XO5 A;  2E30 A;  2NXQ A;  4INW A;  2ZND A;  2F2P A;  3I5H C;  4M2P A;  1OZO A;  1S6C A;  1BLQ A;  1GJY A;  1ORG A;  3I5F C;  1W7J B;  1WLZ A;  1QX7 A;  2K61 A;  1HT9 A;  1LA0 A;  2P6B B;  1DJI A;  3L4A A;  1BOD A;  1NIW A;  4XYN A;  1CLB A;  3VB1 A;  2PRU A;  2LVJ A;  2G9B A;  3PM2 A;  3SS3 A;  1KFU S;  1BR1 B;  1JC2 A;  5PAL A;  4PE1 A;  2QEH A;  4QJ5 B;  1C3Y A;  1B1G A;  1Y1A A;  2KSP A;  3EKH A;  1A75 B;  1ALV A;  1KFX L;  2LLU A;  1Y1X A;  3BJH A;  3CR5 X;  1GGW A;  1GM0 A;  3CTN A;  5B8I B;  2LHI A;  1J7Q A;  1L2O C;  2D8N A;  2KAV A;  1ZAC A;  5I2O A;  2AAO A;  2K7C A;  2OPO A;  3SG5 A;  3B6X A;  2NCP A;  1IGV A;  1JUO A;  3CAB A;  1JSA A;  1PRW A;  4GGF A;  1LVC D;  1Z2C B;  1FI6 A;  3OB2 B;  1P28 A;  2M3W A;  3AAK A;  3LL8 B;  2ZKM X;  1FPW A;  1MR8 A;  2H61 A;  2NLN A;  1BT6 A;  4QJ3 B;  1NX0 A;  2LLT A;  1KWO B;  4PHM A;  5F6T A;  1SPY A;  3I5G B;  2WCB A;  2F3Z A;  4DUQ A;  2JXC A;  2KDH A;  1DJG A;  2LE9 B;  3IVT A;  4ORB B;  2JTT A;  3S0E A;  5KTY A;  1QX2 A;  3AKA A;  3SG2 A;  3Q8I A;  1CFF A;  1PSR A;  1E8A A;  3KEV A;  1UHK A;  3FWC A;  3GK4 X;  1TUZ A;  4IL1 A;  4P2Y B;  5I2Q A;  1QAS A;  3OB1 B;  1TNX A;  1KK8 B;  1QAT A;  2E6W A;  1EG3 A;  1QTX A;  2PAL A;  3BFA A;  5DKQ A;  1DJZ A;  1REC A;  4DRW A;  1EG4 A;  4ICB A;  4PHJ A;  3VGO A;  2KFF A;  1BMO A;  2K7B A;  1OMR A;  1XFY O;  1UHH A;  3OP0 A;  3D74 A;  4N1F A;  2WOS A;  2R2I A;  4PT1 A;  1MUX A;  1DC1 A;  1OQP A;  3EVV A;  4PE7 A;  2OS8 B;  1W7I B;  1ALW A;  1XFR A;  2BKH B;  3HCM A;  2LMU A;  2BCB A;  4GUK A;  2PYQ A;  3BQ3 A;  4GBA A;  3PFV A;  4GGN A;  1XA5 A;  4IJ7 A;  4KYN A;  2MJW B;  1MXE A;  2Q4U A;  1EH2 A;  1YX8 A;  1KSM A;  2OTG B;  3BFH A;  1U5I A;  1J55 A;  2CTN A;  3JTD B;  2WCM A;  1TRF A;  3EVR A;  1SKT A;  3CZ1 A;  2LAP A;  2CT9 A;  1L7Z A;  1LIN A;  1M63 B;  2LMV A;  1EL4 A;  2ZN8 A;  3B88 A;  5D3O A;  1CDN A;  1CFC A;  3BUW B;  4USL A;  3D76 A;  2LM5 A;  1QVI Y;  2L50 A;  4YBH B;  1XFX O;  2Q91 A;  2SAS A;  2CNP A;  1YUR A;  4WRI A;  1R2U A;  1SK6 D;  2O60 A;  3RM1 A;  1SL7 A;  1M39 A;  4YGD B;  2LC5 A;  2KI4 B;  2LCP A;  3M0W A;  3TS5 C;  3R1P A;  2KOT A;  2L0P A;  1AK8 A;  2JC2 A;  2WCF A;  1IIO A;  5ER4 X;  2BE6 A;  1FW4 A;  1K8U A;  4INX A;  1PUL A;  1NX2 A;  3LLE A;  3QRX A;  2K2A A;  3PSR A;  4I5J A;  2BL0 C;  2KYC A;  1OOI X;  2Y4Q A;  4R1E A;  1KQM B;  4PE4 A;  2M0R A;  4MN0 A;  3D75 A;  1YUU A;  2Y1M A;  4NDB A;  3DYE A;  2Y5I A;  1KFX S;  1CDP A;  1RJV A;  1IJ5 A;  3NXA A;  4YRU A;  2JT3 A;  5CSI A;  2HPS A;  1DJH A;  1ZFS A;  3TDI A;  1XFU O;  4ORA B;  1DVI A;  4QJ4 B;  4OV2 A;  2K0J A;  1DGV A;  1QIV A;  3MSE B;  2COL B;  1UHI A;  2M7L A;  1V1G A;  2LV7 A;  5FI6 A;  2A4J A;  3PN7 C;  5BPJ A;  2FCE A;  2CXJ A;  1NCX A;  3JVT B;  4MSP A;  4C0J A;  1XYD A;  1K95 A;  3S0D A;  2FCD A;  2JT0 A;  4P5O E;  3VRR A;  4MVF A;  3BUX B;  3DVJ A;  1TNW A;  2MLE C;  2K7O A;  3L4L A;  4WQ3 A;  1NX1 A;  4AQI A;  1B8C A;  4PCW A;  1BR4 B;  3TUY C;  1C7V A;  2MAZ A;  3OHM B;  1SCM C;  2F8P A;  4MZJ A;  1CDM A;  3B7A A;  3SS5 A;  2OS8 C;  1UUS A;  2ISD A;  5KSZ A;  3FIA A;  3FE9 A;  3DVM A;  4NDD A;  4NQG A;  3BOW B;  4CPV A;  2PQL A;  1VRK A;  3CZ2 A;  5EL2 A;  2LUX A;  2FJU B;  3CDN A;  2BE4 A;  1EXR A;  1JF2 A;  1OSA A;  3D73 A;  1YTZ C;  1QJT A;  3BXK A;  3NHT A;  3OGN A;  2KGR A;  3SG7 A;  4GGF C;  3HX4 A;  2HQW A;  3WHT B;  2JPT A;  2MRD A;  3D78 A;  5FI2 A;  1SL9 A;  3SG4 A;  2P71 A;  1NPQ A;  2L5Y A;  2B1U A;  1RK9 A;  1S5G Z;  3TZ1 A;  2KBM A;  3S0G A;  3VRO A;  1QX5 B;  1CB1 A;  1J1E A;  1S6I A;  1K94 A;  2EC6 B;  1J1D A;  4HSZ A;  1Y1U A;  2V53 A;  3K1E A;  3FWB A;  4OZD A;  2ZRS A;  2ZN9 A;  1F4O A;  2QDI A;  1OZS A;  1WDC B;  3F45 A;  3FS7 A;  3WXA A;  1CNP A;  1DEK A;  2PVB A;  5D69 A;  3R72 A;  2FOT A;  3H4S E;  5FYX A;  1K9P A;  3UO9 A;  4PDZ A;  2JNF A;  1DF0 B;  2LAN A;  4FQO A;  3RZS A;  3CLN A;  2L51 A;  2KQY A;  3D77 A;  1SR6 C;  4FTG A;  3FE8 A;  1SNL A;  1JF0 A;  2CCM A;  2JXL A;  3E3R A;  3NHI A;  2WC8 A;  4CFQ A;  1PSB A;  3CZT X;  3I5I C;  3O2P A;  2L5X B;  3SIB A;  1KCY A;  1QLS A;  2SCP A;  3I5H B;  2VRG A;  1QIW A;  1SW8 A;  2L98 A;  3I5F B;  1OOJ A;  1BG1 A;  1WRL A;  2QPT A;  1WRZ A;  4OCI A;  4DS7 A;  1J7O A;  1CM1 A;  1X02 A;  1CFP A;  1QV1 A;  5AEQ A;  4BY5 A;  1TNQ A;  3QME A;  1MHO A;  2EGD A;  4U8D A;  3S0F A;  2TN4 A;  3GOF A;  2KBI A;  4JWQ A;  3O4X A;  1UHN A;  4M2Q A;  1QVI Z;  2JQ6 A;  2KFG A;  2I94 A;  2M1K B;  1CMG A;  1B8R A;  3AKB A;  1C3Z A;  2GTE A;  3O4Y A;  1AP4 A;  3BFB A;  3GK2 A;  4F0Z B;  1AVS A;  1DJX A;  1L2O B;  2M8U A;  2KI6 D;  2RGI A;  2WCK A;  1DQE A;  1R6P A;  5CSN A;  5HKY A;  1B9A A;  5K89 A;  3KF9 A;  3OBV A;  1K9K A;  3KHE A;  3SG6 A;  3VRN A;  3DY9 A;  1NX3 A;  3EG5 B;  3O78 A;  1IKU A;  4FQT A;  1SSE B;  5TNC A;  1AUI B;  1NYA A;  3ZWH A;  1YVL A;  5FI7 A;  1ODB A;  2GGM A;  4GFT A;  2WCL A;  2KYF A;  2KAY A;  1JWD A;  1OOH A;  2M1U A;  2QEV A;  5I2L A;  5AER A;  4I5N B;  2M9G A;  3CYZ A;  2O5G A;  3DF0 B;  1XK4 A;  4BY4 A;  1N0Y A;  1K2H A;  4YGC B;  2QAC A;  1S26 D;  2JPO A;  4JPZ B;  4AOM A;  1S36 A;  1CLM A;  1QLK A;  4OVN F;  4TNC A;  1J7P A;  1PK0 D;  3BOW A;  1S1E A;  2LLS A;  3TDZ A;  1A4P A;  2K7D A;  2BBM A;  3DD4 A;  5HL1 A;  3CS1 A;  2GV5 A;  1W9Z A;  3OX6 A;  3A4U B;  5AFP A;  4ORC B;  2EHB A;  5D7F A;  2MLF C;  2KAX A;  1RWY A;  3VRP A;  4UPG A;  1ZMZ A;  2M7N A;  3EVU A;  4A4C A;  1OOG A;  1DTL A;  1YUT A;  1TTX A;  1NCY A;  4NDC A;  3NSK A;  2HET A;  3PJI A;  3S0A A;  1PAL A;  5DKN A;  1CM4 A;  1FBV A;  4D1E A;  1BF5 A;  3R1V A;  5HLO A;  1KWO C;  1EJ3 A;  5I94 A;  2JTZ A;  2QEO A;  2LUC A;  2WCJ A;  4HRH A;  2KLE A;  1NUB A;  3K21 A;  4PAL A;  4MZK A;  4JKT A;  3UNW A;  1MWN A;  1CFD A;  3I5G C;  1G33 A;  4F7F A;  1B47 A;  3O6B A;  1LKJ A;  5CPV A;  1MQ1 A;  1C7W A;  1TIZ A;  3BUN B;  4PHN A;  3WHU B;  2PSR A;  1UP5 A;  1TCF A;  2BBN A;  2FJY A;  3DXL A;  1S6J A;  2JUL A;  3NSO A;  1M46 A;  1IH0 A;  1QV0 A;  4C0K A;  2MHH A;  3CR2 A;  1WY9 A;  3CR4 X;  1DF0 A;  1AJ4 A;  3N7H A;  2KFH A;  4HRE E;  1BU3 A;  2JNX A;  1KK8 C;  3PAT A;  3C1V A;  1SMG A;  2WND A;  2LMT A;  2Y1N A;  4WQ2 A;  3B86 A;  2AUC A;  4PE0 A;  3EK7 A;  3PLF B;  4I5L B;  4GAO A;  4YI9 A;  1NSH A;  2YGU A;  1F8H A;  2PMY A;  2L4H A;  3CWG A;  3DZT A;  2LP2 A;  3DVK A;  3IF7 A;  3LK1 A;  1A03 A;  2JWW A;  1A2X A;  1JFJ A;  1WLM A;  1SCV A;  1CKK A;  4PHK A;  1SBJ A;  1MXL C;  2LHL A;  1NCZ A;  4MEW A;  5KU1 A;  2WCE A;  2I18 A;  1YRU B;  1KK7 Y;  4XJK B; 
#chains in the Genus database with same CATH homology
 1W9Z A;  4I5J A;  5FI2 A;  3PM2 A;  3SS3 A;  2K60 A;  2L5Y A;  1DEL A;  3OBV A;  2BNX A;  5D3O A;  3EG5 B;  3SS5 A;  3IVT A;  1DC1 A;  4I5L B;  4GAO A;  5FI7 A;  2BAP A;  2YGU A;  5I94 A;  4I5N B;  1DEK A;  2KLD A;  2KLE A;  3KEV A;  4JKT A;  3UNW A;  4GBA A;  3O4X A;  5FI6 A;  3UO9 A;  1Z2C B;  3SS4 A;  4IJ7 A;  4KYN A;  1Z4H A;  4MEW A;  4I5K A;  5HL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...