2KLDA

Solution structure of the calcium binding domain of the c-terminal cytosolic domain of polycystin-2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
DISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Polycystin-2
publication title NMR-assignments of a cytosolic domain of the C-terminus of polycystin-2
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.170 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2kldA01
2KLEA 2KLDA
chains in the Genus database with same CATH superfamily
3GK1A 1F4OA 4C0JA 3WXAA 2KFGA 3AAJA 3KO0A 2GV5A 3E3RA 5D69A 2GGZA 1QX7A 5DKQA 1FBVA 3BOWB 1XFVO 4MLWA 3CR5X 1DEKA 1AHRA 3I5FB 2VRGA 1M46A 1OMRA 3FIAA 4PE4A 1J7QA 1EL4A 3KF9A 1G4YR 4NDCA 2KSPA 1QVIZ 1B7TY 1PSBA 4PCWA 3LL8B 1H4BA 5HKZA 2JT3A 1QWVA 3I5FC 3DVMA 4DUQA 1UHIA 1SCMC 1QIVA 4YGBB 2HF5A 1SL7A 1LA3A 1F55A 1KFUL 1PSRA 4FTGA 5TNCA 2LMUA 1V1FA 1Y1AA 2GTEA 3DXLA 1OOHA 2M8UA 2QEHA 3TUYB 1Y1XA 3CS1A 2PMYA 4MRXA 3D78A 4PE7A 3B6XA 3EK8A 2LLSA 4PHJA 4N1GA 2LCPA 4C0LA 1GGZA 2LNKA 3HCMA 1B47A 3S0GA 4QJ4B 1CFPA 1OSAA 1ORGA 1DJWA 1PRWA 1NCZA 1QX2A 2WCKA 3D74A 1CLBA 1ZACA 4HSZA 4UPGA 1KK7Z 3BJHA 1KWOB 2OPOA 2WC8A 5F6TA 4YGDB 3I5GC 4CLNA 1S6JA 4I5LB 3LK0A 1MXEA 1OOFA 1ZOTB 2JZIA 3PFVA 1IGVA 3UNWA 1BODA 3BQ3A 1F4QA 3I5IB 1UURA 1KWOC 1ALWA 2I18A 5FI2A 1DGVA 1M45A 3SG6A 4CIDA 1AVSA 1KFXS 2ERBA 3NSKA 3NSLA 3I5IC 2HQWA 5AERA 1J7PA 1DJXA 1QV1A 1K96A 3SIAA 1QLSA 1MR8A 4HREE 4OVNF 1XFYO 1DJZA 2WOSA 4ETOA 3PM2A 3VRPA 1HQVA 1SK6D 1QLKA 2LHLA 2JOJA 2PASA 2Q4UA 1QIWA 1XFWO 1QASA 2KAYA 1R2UA 2JC2A 4MEWA 3S0DA 4DRWA 2JWWA 2K2AA 2LVJA 2JQ6A 5FYXA 2JT8A 2JU0A 2MA2A 2QPTA 2K7BA 2R2IA 3SG5A 3S0BA 1D1OA 1DJYA 1WY9A 3FWCA 1L2OB 1OOJA 1QV0A 1A75B 1YRUB 2BE4A 2H61C 3AAKA 3D0YB 2WORA 4PE1A 1ZMZA 1U5IA 2WCEA 2L4IA 2QACA 5BPJA 3WNXB 1CM4A 3O4XA 2JXCA 1AUIB 2BCXA 3B86A 3EVVA 1MWNA 1MF8B 1CKKA 3K21A 5I2OA 1L2OC 1ZFSA 2LANA 3SG2A 1IH0A 2M7NA 2QDIA 1PK0D 3CWGA 4I5KA 1CLLA 3UO9A 3TS5C 4QJ5B 4I5JA 1JFJA 2LMVA 3EK7A 1TUZA 1NCXA 4NQGA 4CFQA 4DS7A 4CFRA 3DF0A 1FI5A 1GM0A 3PSRA 1M31A 3L4AA 1TUJA 4I5NB 3TDUA 1Y6WA 2WCMA 1S6IA 3SS4A 1A03A 1TCOB 2KQYA 1R6PA 5G08A 5HYDA 3EK4A 3FE9A 1OOGA 3BUMB 3MSEB 1KSMA 2NZ0A 1IKUA 2LE9B 3EVUA 2SCPA 4USLA 3CZ0A 5DKNA 3O4YA 1E8AA 1PULA 3IQQA 2JXLA 5HLVA 1F8HA 1BJFA 5EL2A 2HQ8A 2PYQA 3Q8IA 1YTZC 4XJKA 3S0AA 4FQOA 1B8RA 1K90D 3IVTA 1CDMA 1SYMA 1MQ1A 2YGUA 3CZ1A 2IS9A 1TWOA 2WC5A 1CMGA 3KPXA 3VB1A 2H8VA 2I7AA 1K8UA 1P28A 3K1EA 1WLZA 2Y1MA 4OKHA 1WRZA 3CGAA 2GGMA 1H8BA 2M29A 1RECA 5D7FA 2E6WA 1ODBA 1S36A 1DJHA 2LP3A 2M9GA 1GQMA 1T14A 1UWOA 1YVHA 4YGAA 2AUCA 5ER5A 4OR9B 1KK7Y 1JF2A 1SCMB 3LLEA 3OX5A 4C0KA 1K93D 2FJYA 2QEOA 3NSIA 1B4CA 1F70A 1IJ6A 3CDNA 1C7VA 3GK4X 1OZOA 1SL8A 1S3PA 1J7RA 2BE6A 4INWA 2PVBA 4PHKA 1B9AA 5CSNA 1Z2CB 2P70A 2JTTA 2KI6C 1LINA 3L47A 2G9BA 1IRJA 1DTLA 2KI6D 3DY9A 1N0YA 1XYDA 2BNXA 2NLNA 2M97A 4MN0A 4AOMA 1BLQA 1SY9A 1TNXA 2NCOA 1A2XA 1DQEA 3R1PA 4KYNA 3O6BA 5AEQA 4M2OA 1S26D 2OS8C 2CTNA 1S5GY 1SMGA 4P5OE 3TDZA 5AFPA 2WCHA 2NCPA 2V53A 1F54A 2KNEA 1UHNA 1AP4A 1QS7A 2KYFA 1WDCC 2CCMA 1G33A 3CABA 3I5GB 1YX7A 2PQLA 3KEVA 1LA0A 2WC6A 2PALA 2ZN8A 3BYAA 3LK1A 4AQIA 1TIZA 1DMOA 5CSJA 1DC1A 1CDNA 3N7HA 4M2QA 3RLZA 2L0PA 1K2HA 2LLUA 2F2OA 2KI4B 1OMVA 1QTXA 1X02A 4PHNA 3R1VA 1NX0A 1U5IB 5AXIA 3SJSA 1KFUS 1MXLC 1VRKA 2L2EA 3BXKA 2ZN9A 5CSFA 2A4JA 1QATA 4GBAA 1HT9A 5JJGA 2LLTA 1S1EA 5I2LA 2KI4C 1BR4B 2F2PA 1G8IA 3DVEA 2LVIA 3EKHA 2D8NA 4NDBA 1NWDA 3DF0B 1EG4A 3SG4A 3CLNA 1XA5A 2MAZA 1YX8A 3ZWHA 2MLEC 1A29A 1B7TZ 2MJWB 1XFZO 3EVRA 3WHUB 1QX5B 3L4LA 1PVBA 2JNFA 4HRHA 4YI9A 5I8NA 1BU3A 4AQJA 3VROA 1OW4A 2BKIB 2M1UA 1NUBA 1NX3A 4JKTA 3V2LA 4WRIA 1W9ZA 2KFHA 1XO5A 3GOFA 3TS5B 4GFTA 2LVKA 1FW4A 2M49B 2OTGB 3D10A 4A4CA 1BOCA 3SIBA 2KPHA 1LXFC 1CTRA 2O60A 1XVJA 1WRKA 2KAXA 1YRTB 2ZNEA 2RGIA 1AK8A 1CFFA 1FF1A 3DD4A 1NPQA 2I94A 3S0EA 1JSAA 1DVIA 2AAOA 2BKHB 1SRAA 2Y5IA 4JWQA 2OTGC 3GK2A 1CDPA 2M1KB 4GGFA 1KCYA 2K0JA 3OP0A 2WCJA 2BECA 1IWQA 3IQOA 2JTZA 3RZSA 1YR5A 3BUNB 3VGOA 1XFRA 1NSHA 2KOTA 3C1VA 2NXQA 1DT7B 1C3YA 1UHKA 3PN7B 2L4HA 2L98A 1XK4A 1Y1UA 3CTNA 5PALA 2KGBC 3PM8A 3QMEA 1V1GA 1SL9A 1IJ5A 1AJ5A 1RJVA 2KQ6A 3FE8A 2F3ZA 3BUOB 4YBHB 5FI7A 3AKBA 1QVIY 1OQPA 1SW8A 3PN7C 2BCAA 2K7OA 2ZRTA 2KLDA 4N5XA 2JT0A 3JTDB 4D1EA 1JC2A 3EKJA 1NP8A 1CFDA 2L2CA 3D75A 2JULA 3BFHA 3NHIA 5FI6A 1M39A 1K95A 1EJ3A 2MBXA 4IL1A 3QRXA 3D73A 1JFKA 3JTDC 3S0FA 3DVJA 4PDZA 1MUXA 1RFJA 1CM1A 1RROA 1RK9A 3FS7A 1TRFA 3M0WA 5GQQC 3OGNA 2BL0B 2F8PA 3JVTB 2WNDA 5CSIA 3B87A 2JRFA 2E30A 3DZTA 4YGEB 1UUSA 4MBEA 5CPVA 1IIOA 2K61A 4NDDA 4WQ3A 4OCIA 3B7AA 1JBAA 2TN4A 2QEVA 1DF0A 4ORBB 1C07A 2L5XB 2M7LA 1KQMC 2LM5A 4U8DA 2BL0C 3JVTC 4ZCVA 4ORCB 1DJGA 4PALA 2OS8B 4DIRA 1GGWA 2KHNA 2LC5A 3BFAA 1S6CA 2O5GA 1NYAA 3R1OA 2EGDA 2BBMA 2PSRA 3A8RA 5ER4X 4BY5A 1N2DA 1SNLA 2PRUA 2Y1NA 1WDCB 1BR1B 2DOQA 3A4UB 5HKYA 1JF0A 2M3WA 2Q91A 1SSEB 4MRYA 5JOLA 4P2YB 2P71A 1B8CA 1JUOA 1K9UA 3NHTA 2FCEA 3OB2B 4F0ZB 4GUKA 1EH2A 2BBNA 1CNPA 1OMDA 2WCBA 1J7OA 2JNXA 3OX6A 1TN4A 4CPVA 5KTYA 2HETA 1NX1A 1BT6A 1KK8B 1OZSA 1W7IB 2LAPA 4E68A 2KFFA 1EXRA 1CLMA 1KSOA 3HX4A 1NIWA 3NXAA 1UHJA 1RTP1 2KBMA 3TZ1A 3B88A 3VRRA 1YUSA 3CYZA 1C7WA 3AKAA 1TOPA 1WRLA 3DVKA 3NSOA 1KK8C 1UP5A 1TCFA 4OV2A 2EHBA 4M2PA 4MZJA 2SASA 4MZKA 3D76A 3DYEA 5HKWA 1OOIX 1MHOA 2WCFA 2KYCA 3RM1A 1K9KA 1KFXL 5J3XA 2JPTA 1XFUO 2CT9A 2K7CA 3TUYC 3BOWA 1TNPA 2LVVA 4JQ0D 4MZLA 2HPSA 1SKTA 3CZTX 1W7JB 1SPYA 1QJTA 2LV7A 1CMFA 3OBVA 1DJIA 2KAVA 1A4PA 1WLMA 3PATA 4GGFC 1C3ZA 5DKRA 1TTXA 2B1UA 4JPZB 3SG3A 1XFXO 3EG5B 1J1EA 4L9MA 1LVCD 2LUXA 2COLB 2BAPA 2L5YA 4A4BA 2K60A 1UHHA 1IQ5A 1CB1A 4F7FA 2FOTA 4GNKB 1XK4C 3I5HB 1S5GZ 3R72A 1CFCA 2CNPA 2AMIA 4XJKB 2F3YA 5I94A 3OHMB 2K7DA 4JD9A 2FCDA 1ALVA 3CZ2A 3WHTB 1DGUA 1QXPA 2M0RA 3CR4X 3FWBA 3I5HC 3OB1B 1TNQA 4FQTA 2ISDA 3CR2A 3KHEA 4IJ7A 4N1FA 1B8LA 1YVLA 1NX2A 3ZNIA 1F71A 1NCYA 4ICBA 4YGCB 2K2FA 2KDHA 4OZDA 1IQ3A 1L7ZA 3BUWB 1LS8A 2ZRSA 3ICBA 1J1DA 4MSPA 2LUCA 3O2PA 1K9PA 1RWYA 2Y4QA 1GJYA 1K94A 3BUXB 3LCPC 2ZNDA 2BCBA 1PALA 2L50A 1Q80A 1N65A 1DF0B 1YUUA 3PLFB 5HLOA 5IBWA 2F33A 1JWDA 4GPLB 3PALA 1SR6B 5KSZA 4MVFA 2K8MB 4PHMA 4ORAB 2L51A 1ZUZA 3BFBA 4Q04A 3SS3A 2ZFDA 1BG1A 2H2KA 2MLFC 1CDLA 3TDIA 3VRQA 2LHIA 2ZKMX 1Z4HA 2JPOA 2I2RE 3PJIA 1SR6C 2H61A 1B1GA 2LP2A 2KGRA 5HL1A 2G2BA 5KU1A 1J55A 1M63B 3FE6A 4HRGA 1AJ4A 3D77A 1EG3A 5B8IB 4WQ2A 2LMTA 1FI6A 1YUTA 4QJ3B 4YI8A 1IG5A 1OE9B 2EC6B 4PE0A 1YURA 1TNWA 1KQMB 4YRUA 3D0YA 3IF7A 3O78A 1A75A 4GAOA 4DCKA 1PVAA 4PT1A 5K89A 2MRDA 5I2QA 2KBIA 4R1EA 4BY4A 5DICA 1KQVA 1FPWA 2MHHA 3F45A 1BMOA 2EC6C 4INXA 5AANA 1DELA 2CXJA 4XYNA 5D3OA 3SS5A 2FJUB 3NGVA 1SBJA 1SCVA 1Y0VH 3SG7A 4ZCUA 2P6BB 4GGNA 2KLEA 4TNCA 3VRNA 2QEBA 2CBLA 2WCLA 3H4SE 1BF5A 1LKJA
chains in the Genus database with same CATH topology
3EG5B 4JKTA 4KYNA 2BAPA 2L5YA 1W9ZA 2K60A 4GBAA 5FI2A 4GAOA 3O4XA 1DEKA 5FI7A 2KLDA 5I94A 3KEVA 4I5KA 3UO9A 3SS3A 1DELA 4I5JA 5D3OA 3PM2A 3IVTA 3SS5A 1DC1A 5FI6A 2YGUA 4IJ7A 1Z2CB 4MEWA 1Z4HA 2KLEA 4I5LB 3OBVA 5HL1A 4I5NB 2BNXA 3UNWA 3SS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLE A;  2KLD A; 
#chains in the Genus database with same CATH topology
 3GK1 A;  1F4O A;  4C0J A;  3WXA A;  2KFG A;  3AAJ A;  3KO0 A;  2GV5 A;  3E3R A;  5D69 A;  2GGZ A;  1QX7 A;  5DKQ A;  1FBV A;  3BOW B;  1XFV O;  4MLW A;  3CR5 X;  1DEK A;  1AHR A;  3I5F B;  2VRG A;  1M46 A;  1OMR A;  3FIA A;  4PE4 A;  1J7Q A;  1EL4 A;  3KF9 A;  1G4Y R;  4NDC A;  2KSP A;  1QVI Z;  1B7T Y;  1PSB A;  4PCW A;  3LL8 B;  1H4B A;  5HKZ A;  2JT3 A;  1QWV A;  3I5F C;  3DVM A;  4DUQ A;  1UHI A;  1SCM C;  1QIV A;  4YGB B;  2HF5 A;  1SL7 A;  1LA3 A;  1F55 A;  1KFU L;  1PSR A;  4FTG A;  5TNC A;  2LMU A;  1V1F A;  1Y1A A;  2GTE A;  3DXL A;  1OOH A;  2M8U A;  2QEH A;  3TUY B;  1Y1X A;  3CS1 A;  2PMY A;  4MRX A;  3D78 A;  4PE7 A;  3B6X A;  3EK8 A;  2LLS A;  4PHJ A;  4N1G A;  2LCP A;  4C0L A;  1GGZ A;  2LNK A;  3HCM A;  1B47 A;  3S0G A;  4QJ4 B;  1CFP A;  1OSA A;  1ORG A;  1DJW A;  1PRW A;  1NCZ A;  1QX2 A;  2WCK A;  3D74 A;  1CLB A;  1ZAC A;  4HSZ A;  4UPG A;  1KK7 Z;  3BJH A;  1KWO B;  2OPO A;  2WC8 A;  5F6T A;  4YGD B;  3I5G C;  4CLN A;  1S6J A;  4I5L B;  3LK0 A;  1MXE A;  1OOF A;  1ZOT B;  2JZI A;  3PFV A;  1IGV A;  3UNW A;  1BOD A;  3BQ3 A;  1F4Q A;  3I5I B;  1UUR A;  1KWO C;  1ALW A;  2I18 A;  5FI2 A;  1DGV A;  1M45 A;  3SG6 A;  4CID A;  1AVS A;  1KFX S;  2ERB A;  3NSK A;  3NSL A;  3I5I C;  2HQW A;  5AER A;  1J7P A;  1DJX A;  1QV1 A;  1K96 A;  3SIA A;  1QLS A;  1MR8 A;  4HRE E;  4OVN F;  1XFY O;  1DJZ A;  2WOS A;  4ETO A;  3PM2 A;  3VRP A;  1HQV A;  1SK6 D;  1QLK A;  2LHL A;  2JOJ A;  2PAS A;  2Q4U A;  1QIW A;  1XFW O;  1QAS A;  2KAY A;  1R2U A;  2JC2 A;  4MEW A;  3S0D A;  4DRW A;  2JWW A;  2K2A A;  2LVJ A;  2JQ6 A;  5FYX A;  2JT8 A;  2JU0 A;  2MA2 A;  2QPT A;  2K7B A;  2R2I A;  3SG5 A;  3S0B A;  1D1O A;  1DJY A;  1WY9 A;  3FWC A;  1L2O B;  1OOJ A;  1QV0 A;  1A75 B;  1YRU B;  2BE4 A;  2H61 C;  3AAK A;  3D0Y B;  2WOR A;  4PE1 A;  1ZMZ A;  1U5I A;  2WCE A;  2L4I A;  2QAC A;  5BPJ A;  3WNX B;  1CM4 A;  3O4X A;  2JXC A;  1AUI B;  2BCX A;  3B86 A;  3EVV A;  1MWN A;  1MF8 B;  1CKK A;  3K21 A;  5I2O A;  1L2O C;  1ZFS A;  2LAN A;  3SG2 A;  1IH0 A;  2M7N A;  2QDI A;  1PK0 D;  3CWG A;  4I5K A;  1CLL A;  3UO9 A;  3TS5 C;  4QJ5 B;  4I5J A;  1JFJ A;  2LMV A;  3EK7 A;  1TUZ A;  1NCX A;  4NQG A;  4CFQ A;  4DS7 A;  4CFR A;  3DF0 A;  1FI5 A;  1GM0 A;  3PSR A;  1M31 A;  3L4A A;  1TUJ A;  4I5N B;  3TDU A;  1Y6W A;  2WCM A;  1S6I A;  3SS4 A;  1A03 A;  1TCO B;  2KQY A;  1R6P A;  5G08 A;  5HYD A;  3EK4 A;  3FE9 A;  1OOG A;  3BUM B;  3MSE B;  1KSM A;  2NZ0 A;  1IKU A;  2LE9 B;  3EVU A;  2SCP A;  4USL A;  3CZ0 A;  5DKN A;  3O4Y A;  1E8A A;  1PUL A;  3IQQ A;  2JXL A;  5HLV A;  1F8H A;  1BJF A;  5EL2 A;  2HQ8 A;  2PYQ A;  3Q8I A;  1YTZ C;  4XJK A;  3S0A A;  4FQO A;  1B8R A;  1K90 D;  3IVT A;  1CDM A;  1SYM A;  1MQ1 A;  2YGU A;  3CZ1 A;  2IS9 A;  1TWO A;  2WC5 A;  1CMG A;  3KPX A;  3VB1 A;  2H8V A;  2I7A A;  1K8U A;  1P28 A;  3K1E A;  1WLZ A;  2Y1M A;  4OKH A;  1WRZ A;  3CGA A;  2GGM A;  1H8B A;  2M29 A;  1REC A;  5D7F A;  2E6W A;  1ODB A;  1S36 A;  1DJH A;  2LP3 A;  2M9G A;  1GQM A;  1T14 A;  1UWO A;  1YVH A;  4YGA A;  2AUC A;  5ER5 A;  4OR9 B;  1KK7 Y;  1JF2 A;  1SCM B;  3LLE A;  3OX5 A;  4C0K A;  1K93 D;  2FJY A;  2QEO A;  3NSI A;  1B4C A;  1F70 A;  1IJ6 A;  3CDN A;  1C7V A;  3GK4 X;  1OZO A;  1SL8 A;  1S3P A;  1J7R A;  2BE6 A;  4INW A;  2PVB A;  4PHK A;  1B9A A;  5CSN A;  1Z2C B;  2P70 A;  2JTT A;  2KI6 C;  1LIN A;  3L47 A;  2G9B A;  1IRJ A;  1DTL A;  2KI6 D;  3DY9 A;  1N0Y A;  1XYD A;  2BNX A;  2NLN A;  2M97 A;  4MN0 A;  4AOM A;  1BLQ A;  1SY9 A;  1TNX A;  2NCO A;  1A2X A;  1DQE A;  3R1P A;  4KYN A;  3O6B A;  5AEQ A;  4M2O A;  1S26 D;  2OS8 C;  2CTN A;  1S5G Y;  1SMG A;  4P5O E;  3TDZ A;  5AFP A;  2WCH A;  2NCP A;  2V53 A;  1F54 A;  2KNE A;  1UHN A;  1AP4 A;  1QS7 A;  2KYF A;  1WDC C;  2CCM A;  1G33 A;  3CAB A;  3I5G B;  1YX7 A;  2PQL A;  3KEV A;  1LA0 A;  2WC6 A;  2PAL A;  2ZN8 A;  3BYA A;  3LK1 A;  4AQI A;  1TIZ A;  1DMO A;  5CSJ A;  1DC1 A;  1CDN A;  3N7H A;  4M2Q A;  3RLZ A;  2L0P A;  1K2H A;  2LLU A;  2F2O A;  2KI4 B;  1OMV A;  1QTX A;  1X02 A;  4PHN A;  3R1V A;  1NX0 A;  1U5I B;  5AXI A;  3SJS A;  1KFU S;  1MXL C;  1VRK A;  2L2E A;  3BXK A;  2ZN9 A;  5CSF A;  2A4J A;  1QAT A;  4GBA A;  1HT9 A;  5JJG A;  2LLT A;  1S1E A;  5I2L A;  2KI4 C;  1BR4 B;  2F2P A;  1G8I A;  3DVE A;  2LVI A;  3EKH A;  2D8N A;  4NDB A;  1NWD A;  3DF0 B;  1EG4 A;  3SG4 A;  3CLN A;  1XA5 A;  2MAZ A;  1YX8 A;  3ZWH A;  2MLE C;  1A29 A;  1B7T Z;  2MJW B;  1XFZ O;  3EVR A;  3WHU B;  1QX5 B;  3L4L A;  1PVB A;  2JNF A;  4HRH A;  4YI9 A;  5I8N A;  1BU3 A;  4AQJ A;  3VRO A;  1OW4 A;  2BKI B;  2M1U A;  1NUB A;  1NX3 A;  4JKT A;  3V2L A;  4WRI A;  1W9Z A;  2KFH A;  1XO5 A;  3GOF A;  3TS5 B;  4GFT A;  2LVK A;  1FW4 A;  2M49 B;  2OTG B;  3D10 A;  4A4C A;  1BOC A;  3SIB A;  2KPH A;  1LXF C;  1CTR A;  2O60 A;  1XVJ A;  1WRK A;  2KAX A;  1YRT B;  2ZNE A;  2RGI A;  1AK8 A;  1CFF A;  1FF1 A;  3DD4 A;  1NPQ A;  2I94 A;  3S0E A;  1JSA A;  1DVI A;  2AAO A;  2BKH B;  1SRA A;  2Y5I A;  4JWQ A;  2OTG C;  3GK2 A;  1CDP A;  2M1K B;  4GGF A;  1KCY A;  2K0J A;  3OP0 A;  2WCJ A;  2BEC A;  1IWQ A;  3IQO A;  2JTZ A;  3RZS A;  1YR5 A;  3BUN B;  3VGO A;  1XFR A;  1NSH A;  2KOT A;  3C1V A;  2NXQ A;  1DT7 B;  1C3Y A;  1UHK A;  3PN7 B;  2L4H A;  2L98 A;  1XK4 A;  1Y1U A;  3CTN A;  5PAL A;  2KGB C;  3PM8 A;  3QME A;  1V1G A;  1SL9 A;  1IJ5 A;  1AJ5 A;  1RJV A;  2KQ6 A;  3FE8 A;  2F3Z A;  3BUO B;  4YBH B;  5FI7 A;  3AKB A;  1QVI Y;  1OQP A;  1SW8 A;  3PN7 C;  2BCA A;  2K7O A;  2ZRT A;  2KLD A;  4N5X A;  2JT0 A;  3JTD B;  4D1E A;  1JC2 A;  3EKJ A;  1NP8 A;  1CFD A;  2L2C A;  3D75 A;  2JUL A;  3BFH A;  3NHI A;  5FI6 A;  1M39 A;  1K95 A;  1EJ3 A;  2MBX A;  4IL1 A;  3QRX A;  3D73 A;  1JFK A;  3JTD C;  3S0F A;  3DVJ A;  4PDZ A;  1MUX A;  1RFJ A;  1CM1 A;  1RRO A;  1RK9 A;  3FS7 A;  1TRF A;  3M0W A;  5GQQ C;  3OGN A;  2BL0 B;  2F8P A;  3JVT B;  2WND A;  5CSI A;  3B87 A;  2JRF A;  2E30 A;  3DZT A;  4YGE B;  1UUS A;  4MBE A;  5CPV A;  1IIO A;  2K61 A;  4NDD A;  4WQ3 A;  4OCI A;  3B7A A;  1JBA A;  2TN4 A;  2QEV A;  1DF0 A;  4ORB B;  1C07 A;  2L5X B;  2M7L A;  1KQM C;  2LM5 A;  4U8D A;  2BL0 C;  3JVT C;  4ZCV A;  4ORC B;  1DJG A;  4PAL A;  2OS8 B;  4DIR A;  1GGW A;  2KHN A;  2LC5 A;  3BFA A;  1S6C A;  2O5G A;  1NYA A;  3R1O A;  2EGD A;  2BBM A;  2PSR A;  3A8R A;  5ER4 X;  4BY5 A;  1N2D A;  1SNL A;  2PRU A;  2Y1N A;  1WDC B;  1BR1 B;  2DOQ A;  3A4U B;  5HKY A;  1JF0 A;  2M3W A;  2Q91 A;  1SSE B;  4MRY A;  5JOL A;  4P2Y B;  2P71 A;  1B8C A;  1JUO A;  1K9U A;  3NHT A;  2FCE A;  3OB2 B;  4F0Z B;  4GUK A;  1EH2 A;  2BBN A;  1CNP A;  1OMD A;  2WCB A;  1J7O A;  2JNX A;  3OX6 A;  1TN4 A;  4CPV A;  5KTY A;  2HET A;  1NX1 A;  1BT6 A;  1KK8 B;  1OZS A;  1W7I B;  2LAP A;  4E68 A;  2KFF A;  1EXR A;  1CLM A;  1KSO A;  3HX4 A;  1NIW A;  3NXA A;  1UHJ A;  1RTP 1;  2KBM A;  3TZ1 A;  3B88 A;  3VRR A;  1YUS A;  3CYZ A;  1C7W A;  3AKA A;  1TOP A;  1WRL A;  3DVK A;  3NSO A;  1KK8 C;  1UP5 A;  1TCF A;  4OV2 A;  2EHB A;  4M2P A;  4MZJ A;  2SAS A;  4MZK A;  3D76 A;  3DYE A;  5HKW A;  1OOI X;  1MHO A;  2WCF A;  2KYC A;  3RM1 A;  1K9K A;  1KFX L;  5J3X A;  2JPT A;  1XFU O;  2CT9 A;  2K7C A;  3TUY C;  3BOW A;  1TNP A;  2LVV A;  4JQ0 D;  4MZL A;  2HPS A;  1SKT A;  3CZT X;  1W7J B;  1SPY A;  1QJT A;  2LV7 A;  1CMF A;  3OBV A;  1DJI A;  2KAV A;  1A4P A;  1WLM A;  3PAT A;  4GGF C;  1C3Z A;  5DKR A;  1TTX A;  2B1U A;  4JPZ B;  3SG3 A;  1XFX O;  3EG5 B;  1J1E A;  4L9M A;  1LVC D;  2LUX A;  2COL B;  2BAP A;  2L5Y A;  4A4B A;  2K60 A;  1UHH A;  1IQ5 A;  1CB1 A;  4F7F A;  2FOT A;  4GNK B;  1XK4 C;  3I5H B;  1S5G Z;  3R72 A;  1CFC A;  2CNP A;  2AMI A;  4XJK B;  2F3Y A;  5I94 A;  3OHM B;  2K7D A;  4JD9 A;  2FCD A;  1ALV A;  3CZ2 A;  3WHT B;  1DGU A;  1QXP A;  2M0R A;  3CR4 X;  3FWB A;  3I5H C;  3OB1 B;  1TNQ A;  4FQT A;  2ISD A;  3CR2 A;  3KHE A;  4IJ7 A;  4N1F A;  1B8L A;  1YVL A;  1NX2 A;  3ZNI A;  1F71 A;  1NCY A;  4ICB A;  4YGC B;  2K2F A;  2KDH A;  4OZD A;  1IQ3 A;  1L7Z A;  3BUW B;  1LS8 A;  2ZRS A;  3ICB A;  1J1D A;  4MSP A;  2LUC A;  3O2P A;  1K9P A;  1RWY A;  2Y4Q A;  1GJY A;  1K94 A;  3BUX B;  3LCP C;  2ZND A;  2BCB A;  1PAL A;  2L50 A;  1Q80 A;  1N65 A;  1DF0 B;  1YUU A;  3PLF B;  5HLO A;  5IBW A;  2F33 A;  1JWD A;  4GPL B;  3PAL A;  1SR6 B;  5KSZ A;  4MVF A;  2K8M B;  4PHM A;  4ORA B;  2L51 A;  1ZUZ A;  3BFB A;  4Q04 A;  3SS3 A;  2ZFD A;  1BG1 A;  2H2K A;  2MLF C;  1CDL A;  3TDI A;  3VRQ A;  2LHI A;  2ZKM X;  1Z4H A;  2JPO A;  2I2R E;  3PJI A;  1SR6 C;  2H61 A;  1B1G A;  2LP2 A;  2KGR A;  5HL1 A;  2G2B A;  5KU1 A;  1J55 A;  1M63 B;  3FE6 A;  4HRG A;  1AJ4 A;  3D77 A;  1EG3 A;  5B8I B;  4WQ2 A;  2LMT A;  1FI6 A;  1YUT A;  4QJ3 B;  4YI8 A;  1IG5 A;  1OE9 B;  2EC6 B;  4PE0 A;  1YUR A;  1TNW A;  1KQM B;  4YRU A;  3D0Y A;  3IF7 A;  3O78 A;  1A75 A;  4GAO A;  4DCK A;  1PVA A;  4PT1 A;  5K89 A;  2MRD A;  5I2Q A;  2KBI A;  4R1E A;  4BY4 A;  5DIC A;  1KQV A;  1FPW A;  2MHH A;  3F45 A;  1BMO A;  2EC6 C;  4INX A;  5AAN A;  1DEL A;  2CXJ A;  4XYN A;  5D3O A;  3SS5 A;  2FJU B;  3NGV A;  1SBJ A;  1SCV A;  1Y0V H;  3SG7 A;  4ZCU A;  2P6B B;  4GGN A;  2KLE A;  4TNC A;  3VRN A;  2QEB A;  2CBL A;  2WCL A;  3H4S E;  1BF5 A;  1LKJ A; 
#chains in the Genus database with same CATH homology
 3EG5 B;  4JKT A;  4KYN A;  2BAP A;  2L5Y A;  1W9Z A;  2K60 A;  4GBA A;  5FI2 A;  4GAO A;  3O4X A;  1DEK A;  5FI7 A;  2KLD A;  5I94 A;  3KEV A;  4I5K A;  3UO9 A;  3SS3 A;  1DEL A;  4I5J A;  5D3O A;  3PM2 A;  3IVT A;  3SS5 A;  1DC1 A;  5FI6 A;  2YGU A;  4IJ7 A;  1Z2C B;  4MEW A;  1Z4H A;  2KLE A;  4I5L B;  3OBV A;  5HL1 A;  4I5N B;  2BNX A;  3UNW A;  3SS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...