1TCFA

Crystal structure of calcium-saturated rabbit skeletal troponin c
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
156
structure length
156
Chain Sequence
DQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-regulated muscle contraction
molecule keywords TROPONIN C
publication title Conformational variation of calcium-bound troponin C.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 61
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tcfA00
1WRLA 4JWQA 3K21A 1HT9A 3OX5A 2JOJA 1NCXA 2O5GA 4ZCUA 1CMFA 2JWWA 1AHRA 1BR1B 1W7JB 2KBIA 3DF0B 3KEVA 2I94A 1GGWA 1QS7A 1PSBA 1PRWA 1B1GA 3WXAA 1KWOB 1A03A 1CDNA 4HRGA 5I2OA 3DVKA 1UHJA 3PSRA 1TNPA 2WCBA 1S3PA 4L9MA 1E8AA 1IQ5A 2LMTA 4JQ0D 2HETA 3BQ3A 1CFPA 4MZJA 1NX1A 1SCVA 1DJYA 3JVTC 4FTGA 5HKZA 1KFUL 2KDHA 1KSMA 2QPTA 2KNEA 2E6WA 4NDBA 5CSIA 1JC2A 1TRFA 3WNXB 1K94A 1A2XA 1ZACA 2EC6B 3KHEA 1QX2A 5K89A 1SR6C 2K61A 2H61C 5TNCA 1TNQA 4OCIA 2F3YA 4DCKA 3GK2A 2MBXA 1U5IB 3GK1A 2LMVA 1KFXS 1H4BA 3JTDB 2LE9B 2KYCA 3VGOA 1IJ5A 1YURA 3BUNB 2KGBC 1JSAA 3LL8B 1M39A 3SG4A 4P5OE 1CMGA 4YGEB 1XFUO 2ZRSA 4I5JA 1K90D 1XFXO 1JBAA 1RJVA 1YVHA 1CFDA 2PRUA 1KSOA 1R2UA 2BKIB 1UHNA 1UURA 4MRYA 4ORCB 2WOSA 1D1OA 4ORAB 2LVJA 1S6JA 1EXRA 2LVIA 4YI8A 4YBHB 1B8RA 1A4PA 1NPQA 1QTXA 1IWQA 3FIAA 4N1GA 2MHHA 3DD4A 3GOFA 4PE0A 5IBWA 3I5GC 2KFFA 1J1EA 2WCEA 3IF7A 1NX0A 1DJIA 2Y1MA 4HSZA 1F55A 1QV1A 1H8BA 1EJ3A 2BCBA 1X02A 1WRZA 1CTRA 3CWGA 1FI6A 2KQ6A 2D8NA 3GK4X 5D7FA 5I8NA 1IRJA 1SMGA 2OS8C 2WNDA 4MVFA 3BYAA 4NQGA 1N0YA 1ZFSA 2SCPA 2VRGA 1S5GY 4JPZB 1XYDA 1PVBA 3DVMA 1WLZA 1YRTB 1ZUZA 4Q04A 2PALA 2Y1NA 4YRUA 1G4YR 2JC2A 4R1EA 2TN4A 3BOWA 3OP0A 1L7ZA 2HF5A 1DVIA 2Q91A 3PLFB 2EHBA 2GGZA 3CR5X 2COLB 2M49B 2K7CA 1SCMB 3PN7C 1BJFA 1DTLA 1S36A 3SG7A 3I5HC 5JOLA 1J1DA 1F4QA 1K9PA 5AFPA 2NCOA 4YGDB 2L98A 3BUWB 2PASA 5J3XA 1W7IB 2MRDA 4C0LA 1L2OC 1KK8B 4N1FA 2H2KA 1EG3A 4BY5A 1QXPA 3SIAA 1NCYA 3WHTB 5KU1A 2KI6D 3VRNA 2I2RE 1SK6D 2PSRA 1DT7B 1QV0A 4PCWA 1KFXL 2O60A 3IQQA 1TCOB 2G2BA 3EKHA 3FWBA 2NCPA 2PVBA 2LNKA 1B8LA 2ZKMX 1CB1A 4N5XA 1KCYA 1ALWA 1HQVA 1V1GA 2JXLA 1S6CA 3O2PA 3O4YA 1DF0A 2KQYA 4OV2A 2RGIA 4DUQA 2KBMA 2M97A 1K9UA 1UWOA 4NDDA 4C0JA 1CLMA 3PATA 1K2HA 5KTYA 2F8PA 3OB1B 1XFWO 3TS5B 2V53A 2BCAA 1NSHA 4ORBB 2M29A 1NCZA 1DGUA 4GBAA 1QJTA 2M7NA 3D0YB 3DVEA 1BR4B 1SKTA 1PK0D 2BBNA 1YR5A 1UP5A 3RLZA 4PHKA 2JU0A 5GQQC 1PULA 3QRXA 2KHNA 1F8HA 2OTGC 2CCMA 3LK1A 4PE7A 2BE4A 1QVIZ 1UHIA 1N65A 3EK4A 2JT3A 4D1EA 3EK8A 3HX4A 4CPVA 1SL7A 1WDCC 5D69A 2LLSA 2WC8A 3CTNA 4WQ3A 3I5IB 2K7DA 1QIWA 2M9GA 3TDZA 2HQWA 1CFFA 2EGDA 1ZMZA 1K93D 1MXLC 3CLNA 2LCPA 1OOJA 2QACA 3VRQA 1F71A 5CPVA 2ZNEA 4XJKA 2BL0C 3VROA 4YGBB 4DIRA 1XFVO 1YUSA 4ICBA 1A75A 4TNCA 2F2OA 2CXJA 5FYXA 1BU3A 2PMYA 2JULA 3CR4X 1XVJA 1FPWA 2LLTA 3ZWHA 4HREE 3EKJA 1S6IA 1AUIB 1F4OA 1K9KA 2MLFC 3M0WA 2LC5A 3AAJA 2JT0A 3IQOA 4YGAA 4UPGA 2HPSA 1SCMC 4PHMA 4U8DA 1WLMA 3AKAA 1A29A 2ZN8A 3SG2A 2CTNA 2WORA 1MHOA 4YI9A 4C0KA 1NX2A 2JT8A 4MSPA 2F3ZA 3DVJA 3RM1A 1M46A 1MF8B 4A4BA 1KQMB 1PALA 3I5FB 1OZOA 4HRHA 2KI4B 1RWYA 4MN0A 4QJ3B 3SG6A 2CBLA 4MZLA 2H61A 5ER5A 5BPJA 4E68A 1AP4A 4M2OA 1DJHA 1M45A 3O6BA 1J7RA 1YRUB 4BY4A 2JXCA 1LKJA 1DJGA 1TN4A 3BUMB 1CFCA 1AJ4A 1IH0A 3SJSA 2MJWB 2ZN9A 1Y1XA 1B7TZ 1XFYO 4GGFC 1TOPA 2JPTA 2LANA 4GUKA 2L4IA 3EVVA 3CGAA 3JVTB 1IGVA 1YVLA 1BG1A 3TUYC 1R6PA 3OX6A 1SBJA 2KFGA 5CSNA 1OQPA 1EG4A 2M0RA 2L2EA 1Q80A 5AERA 3KO0A 1KK7Z 2OPOA 1FW4A 1C07A 3KF9A 1QATA 3NSIA 1IQ3A 5HKWA 1KWOC 1TIZA 2L5XB 2KFHA 5AEQA 1UHKA 1OMRA 3F45A 4WRIA 1C7WA 1ALVA 1SL9A 4AQIA 1BF5A 1WY9A 3C1VA 4ZCVA 3MSEB 3VRPA 1PSRA 2I18A 1CDLA 1SPYA 1K96A 2WCFA 1CLLA 3E3RA 4GNKB 5KSZA 2AMIA 1B7TY 2KAXA 1AK8A 1JWDA 2GV5A 2I7AA 3BOWB 1OE9B 4GGFA 2EC6C 1FBVA 2LHLA 1CM1A 4DS7A 3ICBA 3OB2B 1K8UA 3SG5A 5DKNA 2ZNDA 2NXQA 1CLBA 2MLEC 1WRKA 1Y1UA 1Y6WA 3JTDC 1NUBA 1ZOTB 1SL8A 3SIBA 2Y4QA 2G9BA 3EVUA 1BT6A 2L4HA 1LXFC 3NXAA 1UHHA 3DF0A 2DOQA 1TCFA 4QJ5B 1QIVA 3BUOB 4CFQA 1CDMA 1TNWA 1G8IA 1S26D 4IL1A 3KPXA 1MR8A 2KSPA 1J7QA 5G08A 1BODA 2OS8B 1SW8A 1YTZC 4ETOA 1IG5A 3A8RA 2JNFA 1MXEA 1LA3A 3WHUB 1N2DA 5F6TA 1MQ1A 4FQOA 1C7VA 5AXIA 4CFRA 2AAOA 5DKRA 2JZIA 3I5FC 1F54A 5AANA 1GQMA 2JQ6A 2L51A 2F2PA 2K0JA 1OSAA 4PE1A 1FI5A 2LAPA 2Y5IA 3NSOA 1BMOA 1DJWA 1DF0B 1QX5B 1U5IA 1QASA 2LV7A 1M63B 3PN7B 1CNPA 3D10A 2JRFA 1XK4C 1XA5A 3I5HB 3NSLA 1SNLA 3TDIA 1OMDA 2KGRA 3H4SE 1TNXA 1L2OB 5HYDA 2L0PA 2LUXA 4OKHA 3OHMB 1CM4A 3LK0A 4A4CA 2JTTA 1YX8A 1EH2A 1RTP1 1QX7A 1AVSA 1Y0VH 4M2PA 4MBEA 1NYAA 1QLSA 3AKBA 1QVIY 5JJGA 1MUXA 1OZSA 3FS7A 1M31A 3O78A 2KAVA 4OVNF 1NP8A 1NIWA 1RFJA 1SYMA 3CZTX 2LVKA 2NLNA 3PFVA 4YGCB 5DKQA 2A4JA 3ZNIA 3CS1A 4MEWA 2LLUA 2LUCA 1YX7A 1KK8C 4USLA 1KQVA 4XJKB 2AUCA 2LP3A 4GGNA 1GGZA 1A75B 2SASA 4MRXA 4GPLB 5HLOA 4PDZA 1BOCA 1XK4A 5I2LA 1S5GZ 2FCEA 2CT9A 3HCMA 4P2YB 2JTZA 4NDCA 1UUSA 1CKKA 1IJ6A 5HLVA 2F33A 1B8CA 1B9AA 1RECA 2P6BB 1CDPA 2LHIA 5ER4X 1FF1A 2FJUB 2NZ0A 2K8MB 1K95A 2OTGB 2KI6C 1GJYA 1JFJA 4M2QA 4CIDA 1ODBA 1RROA 4MZKA 2E30A 1LINA 1G33A 2JNXA 1RK9A 1WDCB 1VRKA 4OR9B 1NX3A 5B8IB 2M1UA 1DMOA 1B4CA 1JFKA 1XFZO 3TS5C 1SRAA 1QLKA 1KFUS 4MLWA 3PALA 3CR2A 3SG3A 1SR6B 2LVVA 2M7LA 2BE6A 4I5NB 2KYFA 2BL0B 2HQ8A 3FWCA 1LVCD 3LLEA 4I5KA 1V1FA 2K7OA 2MAZA 2GGMA 2LMUA 4DRWA 5I2QA 2B1UA 3BUXB 3AAKA 4GAOA 2K2AA 2L50A 4GFTA 4XYNA 2K2FA 3I5IC 4WQ2A 1AJ5A 1IKUA 1J7PA 3TZ1A 1DGVA 2M1KB 2ISDA 1SY9A 4I5LB 3TDUA 2K7BA 2IS9A 1XO5A 2KAYA 4AOMA 3EVRA 2ZFDA 3I5GB 2BECA 5PALA 1KK7Y 3NSKA 1Y1AA 1NWDA 1LA0A 1B47A 1PVAA 2BCXA 1TTXA 2M8UA 2KOTA 1YUTA 4F0ZB 2LM5A 1DJZA 1JF0A 1JF2A 2FCDA 3D0YA 1J55A 4PALA 1JUOA 2R2IA 5CSJA 5CSFA 1YUUA 2LP2A 3EK7A 3BXKA 2Q4UA 2BBMA 1F70A 4QJ4B 3PM8A 1EL4A 3LCPC 1DJXA 2M3WA 2BKHB 1J7OA 1MWNA 4PHNA 4CLNA 1BLQA 2CNPA 3VRRA 1KQMC 2ZRTA 4PE4A 2MA2A 5HKYA 3TUYB 1S1EA 2KI4C 3A4UB 1OMVA 2FOTA 4PHJA 4AQJA
chains in the Genus database with same CATH superfamily
1WRLA 4JWQA 3K21A 1HT9A 3OX5A 2JOJA 1NCXA 2O5GA 4ZCUA 1CMFA 2JWWA 1AHRA 1BR1B 1W7JB 2KBIA 3DF0B 3KEVA 2I94A 2QEVA 1GGWA 1QS7A 1PSBA 1PRWA 1B1GA 3WXAA 1KWOB 3N7HA 1A03A 4HRGA 5I2OA 1CDNA 3DVKA 1UHJA 3PSRA 1TNPA 2WCBA 1S3PA 4L9MA 1E8AA 1IQ5A 2LMTA 4JQ0D 2HETA 3BQ3A 1CFPA 4MZJA 1NX1A 5DICA 1SCVA 2L2CA 1DJYA 1TWOA 3JVTC 4FTGA 5HKZA 3S0AA 1KFUL 2KDHA 1KSMA 2QPTA 2KNEA 2E6WA 4NDBA 5CSIA 1Z2CB 1TRFA 1JC2A 4N1GA 3WNXB 1K94A 1A2XA 1ZACA 2EC6B 3KHEA 1QX2A 5K89A 1SR6C 2K61A 2H61C 3R72A 5TNCA 3EG5B 1TNQA 4OCIA 2F3YA 4DCKA 3GK2A 2MBXA 1U5IB 3GK1A 2LMVA 1KFXS 1H4BA 3JTDB 2LE9B 2KYCA 3VGOA 1IJ5A 1YURA 3BUNB 2KGBC 3Q8IA 1JSAA 3LL8B 1M39A 4KYNA 3V2LA 3SG4A 3QMEA 4P5OE 4YGEB 1XFUO 1CMGA 2ZRSA 4I5JA 1K90D 1XFXO 3BFBA 1JBAA 1RJVA 1YVHA 1CFDA 2PRUA 1TUZA 1KSOA 1R2UA 2BKIB 1UHNA 1UURA 4MRYA 4ORCB 2WOSA 1D1OA 1W9ZA 4ORAB 3S0FA 1XFRA 2LVJA 1S6JA 1EXRA 2LVIA 4YI8A 3L4AA 4YBHB 4OZDA 1B8RA 1A4PA 1NPQA 1QTXA 1IWQA 3D77A 3FIAA 1SSEB 2MHHA 3DD4A 3GOFA 4PE0A 5IBWA 3I5GC 2KFFA 1J1EA 2WCEA 3IF7A 3CZ2A 1NX0A 1DJIA 2Y1MA 4HSZA 2KLDA 1F55A 1QV1A 1H8BA 1EJ3A 2BCBA 1X02A 1WRZA 3B87A 1CTRA 3CWGA 1FI6A 2KQ6A 2KPHA 2D8NA 3GK4X 5D7FA 5I8NA 1IRJA 1SMGA 5D3OA 3NHTA 1P28A 2OS8C 2WNDA 4MVFA 3BYAA 4NQGA 1N0YA 1ZFSA 2SCPA 2VRGA 1S5GY 4JPZB 1XYDA 1PVBA 3DVMA 2L5YA 1WLZA 1YRTB 1ZUZA 4Q04A 2PALA 2Y1NA 4YRUA 1G4YR 2JC2A 4R1EA 2TN4A 3S0BA 3BOWA 3S0GA 3OP0A 1L7ZA 2HF5A 1DVIA 2Q91A 3PLFB 2EHBA 2GGZA 2WCJA 2COLB 3CR5X 2M49B 2K7CA 1SCMB 3PN7C 1BJFA 1DTLA 1S36A 3SG7A 3I5HC 5JOLA 1J1DA 1F4QA 1K9PA 5AFPA 2NCOA 4YGDB 2L98A 3BUWB 2PASA 5J3XA 2PYQA 1W7IB 2MRDA 4C0LA 1L2OC 1KK8B 2QEHA 4N1FA 1DELA 3L47A 2H2KA 1EG3A 4BY5A 1QXPA 3SIAA 1NCYA 3WHTB 5KU1A 2KI6D 3VRNA 2I2RE 1SK6D 2PSRA 3CDNA 1DT7B 1QV0A 4PCWA 1KFXL 2O60A 3IQQA 1TCOB 2G2BA 3EKHA 3FWBA 2NCPA 2PVBA 2LNKA 1B8LA 2ZKMX 1CB1A 4N5XA 1KCYA 1ALWA 1HQVA 1V1GA 3DY9A 2JXLA 1S6CA 1OOIX 3O2PA 3O4YA 3BFHA 1DF0A 2KQYA 4OV2A 2RGIA 4DUQA 2KBMA 2M97A 1K9UA 1UWOA 3CZ0A 4NDDA 4C0JA 1CLMA 3PATA 1K2HA 3D73A 2F8PA 3OB1B 4F7FA 5KTYA 1XFWO 3TS5B 1DEKA 2QEOA 2V53A 2BCAA 1NSHA 3FE8A 4ORBB 2M29A 1NCZA 1DGUA 4GBAA 1QJTA 2WCLA 3PM2A 2M7NA 3D0YB 3DVEA 1BR4B 1SKTA 1PK0D 2BBNA 1YR5A 1UP5A 3RLZA 4PHKA 2JU0A 5GQQC 1PULA 3QRXA 2KHNA 1OOGA 3R1PA 2OTGC 1F8HA 2CCMA 3LK1A 4PE7A 2BE4A 1QVIZ 1UHIA 1N65A 1TUJA 3EK4A 3VB1A 2JT3A 4D1EA 2GTEA 3EK8A 3HX4A 4CPVA 1SL7A 1WDCC 5D69A 2LLSA 2WC8A 3CTNA 3NGVA 4WQ3A 3I5IB 2K7DA 1OOHA 1QIWA 2M9GA 3TDZA 2HQWA 1CFFA 2EGDA 1ZMZA 1K93D 1MXLC 3CLNA 1IIOA 2LCPA 1OOJA 2QACA 3DXLA 3VRQA 1F71A 5CPVA 2ZNEA 3S0DA 4XJKA 2BL0C 3VROA 4YGBB 4DIRA 1XFVO 1YUSA 4ICBA 1A75A 4TNCA 2F2OA 2CXJA 5FYXA 4FQTA 1BU3A 2PMYA 2JULA 3CR4X 1XVJA 4INXA 3RZSA 1FPWA 2LLTA 3ZWHA 4HREE 3EKJA 1S6IA 1AUIB 3SS5A 1F4OA 1K9KA 2MLFC 3M0WA 2LC5A 3AAJA 2JT0A 3IQOA 4YGAA 4UPGA 2HPSA 1SCMC 4PHMA 4U8DA 1WLMA 3AKAA 1A29A 2ZN8A 1LS8A 2CTNA 3SG2A 2WORA 3FE6A 1MHOA 4YI9A 4C0KA 1NX2A 2JT8A 4MSPA 2F3ZA 2YGUA 3DVJA 3RM1A 1M46A 1MF8B 3S0EA 4A4BA 1KQMB 1PALA 3I5FB 1OZOA 4HRHA 2KI4B 1RWYA 4MN0A 4QJ3B 3SG6A 2CBLA 4MZLA 2H61A 5ER5A 5BPJA 4E68A 1AP4A 4M2OA 3R1VA 1DJHA 1M45A 3D75A 3O6BA 1J7RA 1YRUB 4BY4A 2JXCA 1LKJA 1DJGA 1TN4A 3BUMB 1OOFA 1AJ4A 1CFCA 1IH0A 3SJSA 2MJWB 2ZN9A 1Y1XA 1B7TZ 1XFYO 3R1OA 4GGFC 1QWVA 1TOPA 2JPTA 2LANA 4GUKA 2L4IA 3EVVA 3CGAA 1T14A 3JVTB 1IGVA 1YVLA 1BG1A 3TUYC 1R6PA 3OX6A 1SBJA 2KFGA 5CSNA 1OQPA 1EG4A 2M0RA 2L2EA 3BFAA 1Q80A 5AERA 3KO0A 1KK7Z 2OPOA 1FW4A 1C07A 3KF9A 1QATA 3NSIA 1IQ3A 5HKWA 3CABA 1KWOC 1TIZA 2L5XB 2KFHA 5AEQA 3B7AA 1UHKA 1OMRA 3F45A 4WRIA 1C7WA 1ALVA 5EL2A 1SL9A 4AQIA 1BF5A 3D74A 3L4LA 1WY9A 3C1VA 4ZCVA 3MSEB 3VRPA 1PSRA 2I18A 1CDLA 1SPYA 1K96A 2WCFA 1CLLA 3E3RA 4GNKB 2QDIA 5KSZA 2AMIA 1B7TY 3SS4A 2KAXA 1AK8A 1JWDA 2GV5A 2I7AA 3BOWB 1OE9B 3DZTA 2EC6C 1FBVA 2LHLA 1CM1A 4GGFA 4DS7A 3ICBA 3OB2B 1K8UA 3O4XA 3SG5A 5DKNA 2ZNDA 3FE9A 2NXQA 1CLBA 2MLEC 1WRKA 1Y1UA 1Y6WA 3JTDC 1NUBA 1ZOTB 1SL8A 3SIBA 3NHIA 1GM0A 2PQLA 2G9BA 2Y4QA 3EVUA 1BT6A 2L4HA 1LXFC 3NXAA 1UHHA 3DF0A 2KLEA 2DOQA 1ORGA 1TCFA 4QJ5B 1QIVA 3BUOB 3PJIA 4CFQA 1CDMA 1TNWA 1G8IA 1S26D 4IL1A 3KPXA 1MR8A 2KSPA 2BNXA 4PT1A 1J7QA 5G08A 1BODA 2OS8B 1SW8A 1YTZC 4ETOA 1IG5A 1OW4A 2JNFA 3A8RA 1MXEA 2FJYA 1LA3A 3WHUB 1N2DA 5F6TA 1MQ1A 2ERBA 4FQOA 1C7VA 4IJ7A 5AXIA 4CFRA 2AAOA 5DKRA 2JZIA 3I5FC 1F54A 5AANA 1GQMA 2JQ6A 2L51A 3D76A 2F2PA 2K0JA 1OSAA 4PE1A 1FI5A 2LAPA 2Y5IA 3NSOA 2WCKA 1BMOA 1DJWA 1DF0B 1QX5B 1U5IA 1QASA 2LV7A 1M63B 3PN7B 1CNPA 3D10A 2JRFA 1XK4C 1XA5A 3I5HB 3NSLA 1SNLA 4JD9A 2JPOA 3TDIA 1OMDA 2KGRA 3H4SE 1TNXA 1L2OB 5HYDA 2L0PA 1DC1A 2LUXA 4OKHA 3OHMB 1CM4A 3LK0A 4A4CA 2JTTA 1YX8A 1EH2A 2QEBA 1RTP1 1QX7A 1AVSA 1Y0VH 4M2PA 1C3ZA 4MBEA 1NYAA 2K60A 3CZ1A 1QLSA 3AKBA 1QVIY 5JJGA 3BJHA 1MUXA 3B86A 1OZSA 3FS7A 1M31A 3O78A 2KAVA 4OVNF 1NP8A 1NIWA 1RFJA 1SYMA 2BAPA 3CZTX 2LVKA 2NLNA 3PFVA 4YGCB 5DKQA 3OGNA 2A4JA 3ZNIA 3CS1A 4MEWA 2LLUA 2LUCA 1YX7A 1KK8C 4USLA 1KQVA 4XJKB 2AUCA 2LP3A 4GGNA 1GGZA 1A75B 2SASA 4MRXA 4GPLB 5HLOA 4PDZA 1BOCA 1XK4A 2WCHA 1S5GZ 5I2LA 2FCEA 5HL1A 2WCMA 2CT9A 3HCMA 4P2YB 2JTZA 4NDCA 1UUSA 1CKKA 1IJ6A 5HLVA 2F33A 1B8CA 1B9AA 1RECA 2P6BB 1CDPA 2LHIA 5ER4X 1FF1A 3K1EA 2FJUB 2NZ0A 5I94A 2K8MB 1K95A 2OTGB 2KI6C 1GJYA 1JFJA 4M2QA 3UNWA 4CIDA 1ODBA 1RROA 4MZKA 2E30A 1LINA 1G33A 2JNXA 1RK9A 1WDCB 1VRKA 4OR9B 1NX3A 5B8IB 1Z4HA 2M1UA 1DMOA 1B4CA 1JFKA 1XFZO 3TS5C 1SRAA 1QLKA 3B6XA 1KFUS 4MLWA 3PALA 3CR2A 3D78A 3SG3A 1SR6B 2LVVA 2WC5A 2M7LA 2BE6A 4I5NB 2KYFA 2BL0B 2HQ8A 3FWCA 1LVCD 3LLEA 4I5KA 1V1FA 5FI6A 2K7OA 2MAZA 2GGMA 2LMUA 4DRWA 5I2QA 2B1UA 3BUXB 4INWA 3AAKA 4GAOA 2K2AA 2L50A 4GFTA 4XYNA 3UO9A 5FI7A 2K2FA 3I5IC 4WQ2A 1AJ5A 2WC6A 1IKUA 1C3YA 3DYEA 1J7PA 3TZ1A 1DGVA 2M1KB 2P71A 1SY9A 4I5LB 2ISDA 3TDUA 2K7BA 2IS9A 1XO5A 2KAYA 4AOMA 3EVRA 2ZFDA 3I5GB 2BECA 5PALA 1KK7Y 3NSKA 1Y1AA 1NWDA 5FI2A 1LA0A 1B47A 1PVAA 2BCXA 1TTXA 3IVTA 2M8UA 2KOTA 1YUTA 4F0ZB 3SS3A 2LM5A 1DJZA 1JF0A 1JF2A 2FCDA 1DQEA 3D0YA 1J55A 4PALA 1JUOA 2H8VA 2R2IA 5CSJA 5CSFA 1YUUA 2LP2A 2P70A 3B88A 3EK7A 3BXKA 2Q4UA 2BBMA 1F70A 4QJ4B 3PM8A 1EL4A 3LCPC 1DJXA 2M3WA 3CYZA 2BKHB 1J7OA 1MWNA 4PHNA 4CLNA 1BLQA 2CNPA 3VRRA 1KQMC 2ZRTA 4PE4A 2MA2A 4JKTA 5HKYA 3TUYB 1S1EA 2KI4C 3OBVA 3A4UB 1OMVA 2FOTA 4PHJA 4AQJA
chains in the Genus database with same CATH topology
1WRLA 4JWQA 3K21A 1HT9A 3OX5A 2JOJA 1NCXA 2O5GA 4ZCUA 1CMFA 2JWWA 1AHRA 1BR1B 1W7JB 2KBIA 3DF0B 3KEVA 2I94A 1GGWA 1QS7A 1PSBA 1PRWA 1B1GA 3WXAA 1KWOB 1A03A 1CDNA 4HRGA 5I2OA 3DVKA 1UHJA 3PSRA 1TNPA 2WCBA 1S3PA 4L9MA 1E8AA 1IQ5A 2LMTA 4JQ0D 2HETA 3BQ3A 1CFPA 4MZJA 1NX1A 1SCVA 1DJYA 3JVTC 4FTGA 5HKZA 1KFUL 2KDHA 1KSMA 2QPTA 2KNEA 2E6WA 4NDBA 5CSIA 1JC2A 1TRFA 3WNXB 1K94A 1A2XA 1ZACA 2EC6B 3KHEA 1QX2A 5K89A 1SR6C 2K61A 2H61C 5TNCA 1TNQA 4OCIA 2F3YA 4DCKA 3GK2A 2MBXA 1U5IB 3GK1A 2LMVA 1KFXS 1H4BA 3JTDB 2LE9B 2KYCA 3VGOA 1IJ5A 1YURA 3BUNB 2KGBC 1JSAA 3LL8B 1M39A 3SG4A 4P5OE 1CMGA 4YGEB 1XFUO 2ZRSA 4I5JA 1K90D 1XFXO 1JBAA 1RJVA 1YVHA 1CFDA 2PRUA 1KSOA 1R2UA 2BKIB 1UHNA 1UURA 4MRYA 4ORCB 2WOSA 1D1OA 4ORAB 2LVJA 1S6JA 1EXRA 2LVIA 4YI8A 4YBHB 1B8RA 1A4PA 1NPQA 1QTXA 1IWQA 3FIAA 4N1GA 2MHHA 3DD4A 3GOFA 4PE0A 5IBWA 3I5GC 2KFFA 1J1EA 2WCEA 3IF7A 1NX0A 1DJIA 2Y1MA 4HSZA 1F55A 1QV1A 1H8BA 1EJ3A 2BCBA 1X02A 1WRZA 1CTRA 3CWGA 1FI6A 2KQ6A 2D8NA 3GK4X 5D7FA 5I8NA 1IRJA 1SMGA 2OS8C 2WNDA 4MVFA 3BYAA 4NQGA 1N0YA 1ZFSA 2SCPA 2VRGA 1S5GY 4JPZB 1XYDA 1PVBA 3DVMA 1WLZA 1YRTB 1ZUZA 4Q04A 2PALA 2Y1NA 4YRUA 1G4YR 2JC2A 4R1EA 2TN4A 3BOWA 3OP0A 1L7ZA 2HF5A 1DVIA 2Q91A 3PLFB 2EHBA 2GGZA 3CR5X 2COLB 2M49B 2K7CA 1SCMB 3PN7C 1BJFA 1DTLA 1S36A 3SG7A 3I5HC 5JOLA 1J1DA 1F4QA 1K9PA 5AFPA 2NCOA 4YGDB 2L98A 3BUWB 2PASA 5J3XA 1W7IB 2MRDA 4C0LA 1L2OC 1KK8B 4N1FA 2H2KA 1EG3A 4BY5A 1QXPA 3SIAA 1NCYA 3WHTB 5KU1A 2KI6D 3VRNA 2I2RE 1SK6D 2PSRA 1DT7B 1QV0A 4PCWA 1KFXL 2O60A 3IQQA 1TCOB 2G2BA 3EKHA 3FWBA 2NCPA 2PVBA 2LNKA 1B8LA 2ZKMX 1CB1A 4N5XA 1KCYA 1ALWA 1HQVA 1V1GA 2JXLA 1S6CA 3O2PA 3O4YA 1DF0A 2KQYA 4OV2A 2RGIA 4DUQA 2KBMA 2M97A 1K9UA 1UWOA 4NDDA 4C0JA 1CLMA 3PATA 1K2HA 5KTYA 2F8PA 3OB1B 1XFWO 3TS5B 2V53A 2BCAA 1NSHA 4ORBB 2M29A 1NCZA 1DGUA 4GBAA 1QJTA 2M7NA 3D0YB 3DVEA 1BR4B 1SKTA 1PK0D 2BBNA 1YR5A 1UP5A 3RLZA 4PHKA 2JU0A 5GQQC 1PULA 3QRXA 2KHNA 1F8HA 2OTGC 2CCMA 3LK1A 4PE7A 2BE4A 1QVIZ 1UHIA 1N65A 3EK4A 2JT3A 4D1EA 3EK8A 3HX4A 4CPVA 1SL7A 1WDCC 5D69A 2LLSA 2WC8A 3CTNA 4WQ3A 3I5IB 2K7DA 1QIWA 2M9GA 3TDZA 2HQWA 1CFFA 2EGDA 1ZMZA 1K93D 1MXLC 3CLNA 2LCPA 1OOJA 2QACA 3VRQA 1F71A 5CPVA 2ZNEA 4XJKA 2BL0C 3VROA 4YGBB 4DIRA 1XFVO 1YUSA 4ICBA 1A75A 4TNCA 2F2OA 2CXJA 5FYXA 1BU3A 2PMYA 2JULA 3CR4X 1XVJA 1FPWA 2LLTA 3ZWHA 4HREE 3EKJA 1S6IA 1AUIB 1F4OA 1K9KA 2MLFC 3M0WA 2LC5A 3AAJA 2JT0A 3IQOA 4YGAA 4UPGA 2HPSA 1SCMC 4PHMA 4U8DA 1WLMA 3AKAA 1A29A 2ZN8A 3SG2A 2CTNA 2WORA 1MHOA 4YI9A 4C0KA 1NX2A 2JT8A 4MSPA 2F3ZA 3DVJA 3RM1A 1M46A 1MF8B 4A4BA 1KQMB 1PALA 3I5FB 1OZOA 4HRHA 2KI4B 1RWYA 4MN0A 4QJ3B 3SG6A 2CBLA 4MZLA 2H61A 5ER5A 5BPJA 4E68A 1AP4A 4M2OA 1DJHA 1M45A 3O6BA 1J7RA 1YRUB 4BY4A 2JXCA 1LKJA 1DJGA 1TN4A 3BUMB 1CFCA 1AJ4A 1IH0A 3SJSA 2MJWB 2ZN9A 1Y1XA 1B7TZ 1XFYO 4GGFC 1TOPA 2JPTA 2LANA 4GUKA 2L4IA 3EVVA 3CGAA 3JVTB 1IGVA 1YVLA 1BG1A 3TUYC 1R6PA 3OX6A 1SBJA 2KFGA 5CSNA 1OQPA 1EG4A 2M0RA 2L2EA 1Q80A 5AERA 3KO0A 1KK7Z 2OPOA 1FW4A 1C07A 3KF9A 1QATA 3NSIA 1IQ3A 5HKWA 1KWOC 1TIZA 2L5XB 2KFHA 5AEQA 1UHKA 1OMRA 3F45A 4WRIA 1C7WA 1ALVA 1SL9A 4AQIA 1BF5A 1WY9A 3C1VA 4ZCVA 3MSEB 3VRPA 1PSRA 2I18A 1CDLA 1SPYA 1K96A 2WCFA 1CLLA 3E3RA 4GNKB 5KSZA 2AMIA 1B7TY 2KAXA 1AK8A 1JWDA 2GV5A 2I7AA 3BOWB 1OE9B 4GGFA 2EC6C 1FBVA 2LHLA 1CM1A 4DS7A 3ICBA 3OB2B 1K8UA 3SG5A 5DKNA 2ZNDA 2NXQA 1CLBA 2MLEC 1WRKA 1Y1UA 1Y6WA 3JTDC 1NUBA 1ZOTB 1SL8A 3SIBA 2Y4QA 2G9BA 3EVUA 1BT6A 2L4HA 1LXFC 3NXAA 1UHHA 3DF0A 2DOQA 1TCFA 4QJ5B 1QIVA 3BUOB 4CFQA 1CDMA 1TNWA 1G8IA 1S26D 4IL1A 3KPXA 1MR8A 2KSPA 1J7QA 5G08A 1BODA 2OS8B 1SW8A 1YTZC 4ETOA 1IG5A 3A8RA 2JNFA 1MXEA 1LA3A 3WHUB 1N2DA 5F6TA 1MQ1A 4FQOA 1C7VA 5AXIA 4CFRA 2AAOA 5DKRA 2JZIA 3I5FC 1F54A 5AANA 1GQMA 2JQ6A 2L51A 2F2PA 2K0JA 1OSAA 4PE1A 1FI5A 2LAPA 2Y5IA 3NSOA 1BMOA 1DJWA 1DF0B 1QX5B 1U5IA 1QASA 2LV7A 1M63B 3PN7B 1CNPA 3D10A 2JRFA 1XK4C 1XA5A 3I5HB 3NSLA 1SNLA 3TDIA 1OMDA 2KGRA 3H4SE 1TNXA 1L2OB 5HYDA 2L0PA 2LUXA 4OKHA 3OHMB 1CM4A 3LK0A 4A4CA 2JTTA 1YX8A 1EH2A 1RTP1 1QX7A 1AVSA 1Y0VH 4M2PA 4MBEA 1NYAA 1QLSA 3AKBA 1QVIY 5JJGA 1MUXA 1OZSA 3FS7A 1M31A 3O78A 2KAVA 4OVNF 1NP8A 1NIWA 1RFJA 1SYMA 3CZTX 2LVKA 2NLNA 3PFVA 4YGCB 5DKQA 2A4JA 3ZNIA 3CS1A 4MEWA 2LLUA 2LUCA 1YX7A 1KK8C 4USLA 1KQVA 4XJKB 2AUCA 2LP3A 4GGNA 1GGZA 1A75B 2SASA 4MRXA 4GPLB 5HLOA 4PDZA 1BOCA 1XK4A 5I2LA 1S5GZ 2FCEA 2CT9A 3HCMA 4P2YB 2JTZA 4NDCA 1UUSA 1CKKA 1IJ6A 5HLVA 2F33A 1B8CA 1B9AA 1RECA 2P6BB 1CDPA 2LHIA 5ER4X 1FF1A 2FJUB 2NZ0A 2K8MB 1K95A 2OTGB 2KI6C 1GJYA 1JFJA 4M2QA 4CIDA 1ODBA 1RROA 4MZKA 2E30A 1LINA 1G33A 2JNXA 1RK9A 1WDCB 1VRKA 4OR9B 1NX3A 5B8IB 2M1UA 1DMOA 1B4CA 1JFKA 1XFZO 3TS5C 1SRAA 1QLKA 1KFUS 4MLWA 3PALA 3CR2A 3SG3A 1SR6B 2LVVA 2M7LA 2BE6A 4I5NB 2KYFA 2BL0B 2HQ8A 3FWCA 1LVCD 3LLEA 4I5KA 1V1FA 2K7OA 2MAZA 2GGMA 2LMUA 4DRWA 5I2QA 2B1UA 3BUXB 3AAKA 4GAOA 2K2AA 2L50A 4GFTA 4XYNA 2K2FA 3I5IC 4WQ2A 1AJ5A 1IKUA 1J7PA 3TZ1A 1DGVA 2M1KB 2ISDA 1SY9A 4I5LB 3TDUA 2K7BA 2IS9A 1XO5A 2KAYA 4AOMA 3EVRA 2ZFDA 3I5GB 2BECA 5PALA 1KK7Y 3NSKA 1Y1AA 1NWDA 1LA0A 1B47A 1PVAA 2BCXA 1TTXA 2M8UA 2KOTA 1YUTA 4F0ZB 2LM5A 1DJZA 1JF0A 1JF2A 2FCDA 3D0YA 1J55A 4PALA 1JUOA 2R2IA 5CSJA 5CSFA 1YUUA 2LP2A 3EK7A 3BXKA 2Q4UA 2BBMA 1F70A 4QJ4B 3PM8A 1EL4A 3LCPC 1DJXA 2M3WA 2BKHB 1J7OA 1MWNA 4PHNA 4CLNA 1BLQA 2CNPA 3VRRA 1KQMC 2ZRTA 4PE4A 2MA2A 5HKYA 3TUYB 1S1EA 2KI4C 3A4UB 1OMVA 2FOTA 4PHJA 4AQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRL A;  4JWQ A;  3K21 A;  1HT9 A;  3OX5 A;  2JOJ A;  1NCX A;  2O5G A;  4ZCU A;  1CMF A;  2JWW A;  1AHR A;  1BR1 B;  1W7J B;  2KBI A;  3DF0 B;  3KEV A;  2I94 A;  1GGW A;  1QS7 A;  1PSB A;  1PRW A;  1B1G A;  3WXA A;  1KWO B;  1A03 A;  1CDN A;  4HRG A;  5I2O A;  3DVK A;  1UHJ A;  3PSR A;  1TNP A;  2WCB A;  1S3P A;  4L9M A;  1E8A A;  1IQ5 A;  2LMT A;  4JQ0 D;  2HET A;  3BQ3 A;  1CFP A;  4MZJ A;  1NX1 A;  1SCV A;  1DJY A;  3JVT C;  4FTG A;  5HKZ A;  1KFU L;  2KDH A;  1KSM A;  2QPT A;  2KNE A;  2E6W A;  4NDB A;  5CSI A;  1JC2 A;  1TRF A;  3WNX B;  1K94 A;  1A2X A;  1ZAC A;  2EC6 B;  3KHE A;  1QX2 A;  5K89 A;  1SR6 C;  2K61 A;  2H61 C;  5TNC A;  1TNQ A;  4OCI A;  2F3Y A;  4DCK A;  3GK2 A;  2MBX A;  1U5I B;  3GK1 A;  2LMV A;  1KFX S;  1H4B A;  3JTD B;  2LE9 B;  2KYC A;  3VGO A;  1IJ5 A;  1YUR A;  3BUN B;  2KGB C;  1JSA A;  3LL8 B;  1M39 A;  3SG4 A;  4P5O E;  1CMG A;  4YGE B;  1XFU O;  2ZRS A;  4I5J A;  1K90 D;  1XFX O;  1JBA A;  1RJV A;  1YVH A;  1CFD A;  2PRU A;  1KSO A;  1R2U A;  2BKI B;  1UHN A;  1UUR A;  4MRY A;  4ORC B;  2WOS A;  1D1O A;  4ORA B;  2LVJ A;  1S6J A;  1EXR A;  2LVI A;  4YI8 A;  4YBH B;  1B8R A;  1A4P A;  1NPQ A;  1QTX A;  1IWQ A;  3FIA A;  4N1G A;  2MHH A;  3DD4 A;  3GOF A;  4PE0 A;  5IBW A;  3I5G C;  2KFF A;  1J1E A;  2WCE A;  3IF7 A;  1NX0 A;  1DJI A;  2Y1M A;  4HSZ A;  1F55 A;  1QV1 A;  1H8B A;  1EJ3 A;  2BCB A;  1X02 A;  1WRZ A;  1CTR A;  3CWG A;  1FI6 A;  2KQ6 A;  2D8N A;  3GK4 X;  5D7F A;  5I8N A;  1IRJ A;  1SMG A;  2OS8 C;  2WND A;  4MVF A;  3BYA A;  4NQG A;  1N0Y A;  1ZFS A;  2SCP A;  2VRG A;  1S5G Y;  4JPZ B;  1XYD A;  1PVB A;  3DVM A;  1WLZ A;  1YRT B;  1ZUZ A;  4Q04 A;  2PAL A;  2Y1N A;  4YRU A;  1G4Y R;  2JC2 A;  4R1E A;  2TN4 A;  3BOW A;  3OP0 A;  1L7Z A;  2HF5 A;  1DVI A;  2Q91 A;  3PLF B;  2EHB A;  2GGZ A;  3CR5 X;  2COL B;  2M49 B;  2K7C A;  1SCM B;  3PN7 C;  1BJF A;  1DTL A;  1S36 A;  3SG7 A;  3I5H C;  5JOL A;  1J1D A;  1F4Q A;  1K9P A;  5AFP A;  2NCO A;  4YGD B;  2L98 A;  3BUW B;  2PAS A;  5J3X A;  1W7I B;  2MRD A;  4C0L A;  1L2O C;  1KK8 B;  4N1F A;  2H2K A;  1EG3 A;  4BY5 A;  1QXP A;  3SIA A;  1NCY A;  3WHT B;  5KU1 A;  2KI6 D;  3VRN A;  2I2R E;  1SK6 D;  2PSR A;  1DT7 B;  1QV0 A;  4PCW A;  1KFX L;  2O60 A;  3IQQ A;  1TCO B;  2G2B A;  3EKH A;  3FWB A;  2NCP A;  2PVB A;  2LNK A;  1B8L A;  2ZKM X;  1CB1 A;  4N5X A;  1KCY A;  1ALW A;  1HQV A;  1V1G A;  2JXL A;  1S6C A;  3O2P A;  3O4Y A;  1DF0 A;  2KQY A;  4OV2 A;  2RGI A;  4DUQ A;  2KBM A;  2M97 A;  1K9U A;  1UWO A;  4NDD A;  4C0J A;  1CLM A;  3PAT A;  1K2H A;  5KTY A;  2F8P A;  3OB1 B;  1XFW O;  3TS5 B;  2V53 A;  2BCA A;  1NSH A;  4ORB B;  2M29 A;  1NCZ A;  1DGU A;  4GBA A;  1QJT A;  2M7N A;  3D0Y B;  3DVE A;  1BR4 B;  1SKT A;  1PK0 D;  2BBN A;  1YR5 A;  1UP5 A;  3RLZ A;  4PHK A;  2JU0 A;  5GQQ C;  1PUL A;  3QRX A;  2KHN A;  1F8H A;  2OTG C;  2CCM A;  3LK1 A;  4PE7 A;  2BE4 A;  1QVI Z;  1UHI A;  1N65 A;  3EK4 A;  2JT3 A;  4D1E A;  3EK8 A;  3HX4 A;  4CPV A;  1SL7 A;  1WDC C;  5D69 A;  2LLS A;  2WC8 A;  3CTN A;  4WQ3 A;  3I5I B;  2K7D A;  1QIW A;  2M9G A;  3TDZ A;  2HQW A;  1CFF A;  2EGD A;  1ZMZ A;  1K93 D;  1MXL C;  3CLN A;  2LCP A;  1OOJ A;  2QAC A;  3VRQ A;  1F71 A;  5CPV A;  2ZNE A;  4XJK A;  2BL0 C;  3VRO A;  4YGB B;  4DIR A;  1XFV O;  1YUS A;  4ICB A;  1A75 A;  4TNC A;  2F2O A;  2CXJ A;  5FYX A;  1BU3 A;  2PMY A;  2JUL A;  3CR4 X;  1XVJ A;  1FPW A;  2LLT A;  3ZWH A;  4HRE E;  3EKJ A;  1S6I A;  1AUI B;  1F4O A;  1K9K A;  2MLF C;  3M0W A;  2LC5 A;  3AAJ A;  2JT0 A;  3IQO A;  4YGA A;  4UPG A;  2HPS A;  1SCM C;  4PHM A;  4U8D A;  1WLM A;  3AKA A;  1A29 A;  2ZN8 A;  3SG2 A;  2CTN A;  2WOR A;  1MHO A;  4YI9 A;  4C0K A;  1NX2 A;  2JT8 A;  4MSP A;  2F3Z A;  3DVJ A;  3RM1 A;  1M46 A;  1MF8 B;  4A4B A;  1KQM B;  1PAL A;  3I5F B;  1OZO A;  4HRH A;  2KI4 B;  1RWY A;  4MN0 A;  4QJ3 B;  3SG6 A;  2CBL A;  4MZL A;  2H61 A;  5ER5 A;  5BPJ A;  4E68 A;  1AP4 A;  4M2O A;  1DJH A;  1M45 A;  3O6B A;  1J7R A;  1YRU B;  4BY4 A;  2JXC A;  1LKJ A;  1DJG A;  1TN4 A;  3BUM B;  1CFC A;  1AJ4 A;  1IH0 A;  3SJS A;  2MJW B;  2ZN9 A;  1Y1X A;  1B7T Z;  1XFY O;  4GGF C;  1TOP A;  2JPT A;  2LAN A;  4GUK A;  2L4I A;  3EVV A;  3CGA A;  3JVT B;  1IGV A;  1YVL A;  1BG1 A;  3TUY C;  1R6P A;  3OX6 A;  1SBJ A;  2KFG A;  5CSN A;  1OQP A;  1EG4 A;  2M0R A;  2L2E A;  1Q80 A;  5AER A;  3KO0 A;  1KK7 Z;  2OPO A;  1FW4 A;  1C07 A;  3KF9 A;  1QAT A;  3NSI A;  1IQ3 A;  5HKW A;  1KWO C;  1TIZ A;  2L5X B;  2KFH A;  5AEQ A;  1UHK A;  1OMR A;  3F45 A;  4WRI A;  1C7W A;  1ALV A;  1SL9 A;  4AQI A;  1BF5 A;  1WY9 A;  3C1V A;  4ZCV A;  3MSE B;  3VRP A;  1PSR A;  2I18 A;  1CDL A;  1SPY A;  1K96 A;  2WCF A;  1CLL A;  3E3R A;  4GNK B;  5KSZ A;  2AMI A;  1B7T Y;  2KAX A;  1AK8 A;  1JWD A;  2GV5 A;  2I7A A;  3BOW B;  1OE9 B;  4GGF A;  2EC6 C;  1FBV A;  2LHL A;  1CM1 A;  4DS7 A;  3ICB A;  3OB2 B;  1K8U A;  3SG5 A;  5DKN A;  2ZND A;  2NXQ A;  1CLB A;  2MLE C;  1WRK A;  1Y1U A;  1Y6W A;  3JTD C;  1NUB A;  1ZOT B;  1SL8 A;  3SIB A;  2Y4Q A;  2G9B A;  3EVU A;  1BT6 A;  2L4H A;  1LXF C;  3NXA A;  1UHH A;  3DF0 A;  2DOQ A;  1TCF A;  4QJ5 B;  1QIV A;  3BUO B;  4CFQ A;  1CDM A;  1TNW A;  1G8I A;  1S26 D;  4IL1 A;  3KPX A;  1MR8 A;  2KSP A;  1J7Q A;  5G08 A;  1BOD A;  2OS8 B;  1SW8 A;  1YTZ C;  4ETO A;  1IG5 A;  3A8R A;  2JNF A;  1MXE A;  1LA3 A;  3WHU B;  1N2D A;  5F6T A;  1MQ1 A;  4FQO A;  1C7V A;  5AXI A;  4CFR A;  2AAO A;  5DKR A;  2JZI A;  3I5F C;  1F54 A;  5AAN A;  1GQM A;  2JQ6 A;  2L51 A;  2F2P A;  2K0J A;  1OSA A;  4PE1 A;  1FI5 A;  2LAP A;  2Y5I A;  3NSO A;  1BMO A;  1DJW A;  1DF0 B;  1QX5 B;  1U5I A;  1QAS A;  2LV7 A;  1M63 B;  3PN7 B;  1CNP A;  3D10 A;  2JRF A;  1XK4 C;  1XA5 A;  3I5H B;  3NSL A;  1SNL A;  3TDI A;  1OMD A;  2KGR A;  3H4S E;  1TNX A;  1L2O B;  5HYD A;  2L0P A;  2LUX A;  4OKH A;  3OHM B;  1CM4 A;  3LK0 A;  4A4C A;  2JTT A;  1YX8 A;  1EH2 A;  1RTP 1;  1QX7 A;  1AVS A;  1Y0V H;  4M2P A;  4MBE A;  1NYA A;  1QLS A;  3AKB A;  1QVI Y;  5JJG A;  1MUX A;  1OZS A;  3FS7 A;  1M31 A;  3O78 A;  2KAV A;  4OVN F;  1NP8 A;  1NIW A;  1RFJ A;  1SYM A;  3CZT X;  2LVK A;  2NLN A;  3PFV A;  4YGC B;  5DKQ A;  2A4J A;  3ZNI A;  3CS1 A;  4MEW A;  2LLU A;  2LUC A;  1YX7 A;  1KK8 C;  4USL A;  1KQV A;  4XJK B;  2AUC A;  2LP3 A;  4GGN A;  1GGZ A;  1A75 B;  2SAS A;  4MRX A;  4GPL B;  5HLO A;  4PDZ A;  1BOC A;  1XK4 A;  5I2L A;  1S5G Z;  2FCE A;  2CT9 A;  3HCM A;  4P2Y B;  2JTZ A;  4NDC A;  1UUS A;  1CKK A;  1IJ6 A;  5HLV A;  2F33 A;  1B8C A;  1B9A A;  1REC A;  2P6B B;  1CDP A;  2LHI A;  5ER4 X;  1FF1 A;  2FJU B;  2NZ0 A;  2K8M B;  1K95 A;  2OTG B;  2KI6 C;  1GJY A;  1JFJ A;  4M2Q A;  4CID A;  1ODB A;  1RRO A;  4MZK A;  2E30 A;  1LIN A;  1G33 A;  2JNX A;  1RK9 A;  1WDC B;  1VRK A;  4OR9 B;  1NX3 A;  5B8I B;  2M1U A;  1DMO A;  1B4C A;  1JFK A;  1XFZ O;  3TS5 C;  1SRA A;  1QLK A;  1KFU S;  4MLW A;  3PAL A;  3CR2 A;  3SG3 A;  1SR6 B;  2LVV A;  2M7L A;  2BE6 A;  4I5N B;  2KYF A;  2BL0 B;  2HQ8 A;  3FWC A;  1LVC D;  3LLE A;  4I5K A;  1V1F A;  2K7O A;  2MAZ A;  2GGM A;  2LMU A;  4DRW A;  5I2Q A;  2B1U A;  3BUX B;  3AAK A;  4GAO A;  2K2A A;  2L50 A;  4GFT A;  4XYN A;  2K2F A;  3I5I C;  4WQ2 A;  1AJ5 A;  1IKU A;  1J7P A;  3TZ1 A;  1DGV A;  2M1K B;  2ISD A;  1SY9 A;  4I5L B;  3TDU A;  2K7B A;  2IS9 A;  1XO5 A;  2KAY A;  4AOM A;  3EVR A;  2ZFD A;  3I5G B;  2BEC A;  5PAL A;  1KK7 Y;  3NSK A;  1Y1A A;  1NWD A;  1LA0 A;  1B47 A;  1PVA A;  2BCX A;  1TTX A;  2M8U A;  2KOT A;  1YUT A;  4F0Z B;  2LM5 A;  1DJZ A;  1JF0 A;  1JF2 A;  2FCD A;  3D0Y A;  1J55 A;  4PAL A;  1JUO A;  2R2I A;  5CSJ A;  5CSF A;  1YUU A;  2LP2 A;  3EK7 A;  3BXK A;  2Q4U A;  2BBM A;  1F70 A;  4QJ4 B;  3PM8 A;  1EL4 A;  3LCP C;  1DJX A;  2M3W A;  2BKH B;  1J7O A;  1MWN A;  4PHN A;  4CLN A;  1BLQ A;  2CNP A;  3VRR A;  1KQM C;  2ZRT A;  4PE4 A;  2MA2 A;  5HKY A;  3TUY B;  1S1E A;  2KI4 C;  3A4U B;  1OMV A;  2FOT A;  4PHJ A;  4AQJ A; 
#chains in the Genus database with same CATH topology
 1WRL A;  4JWQ A;  3K21 A;  1HT9 A;  3OX5 A;  2JOJ A;  1NCX A;  2O5G A;  4ZCU A;  1CMF A;  2JWW A;  1AHR A;  1BR1 B;  1W7J B;  2KBI A;  3DF0 B;  3KEV A;  2I94 A;  2QEV A;  1GGW A;  1QS7 A;  1PSB A;  1PRW A;  1B1G A;  3WXA A;  1KWO B;  3N7H A;  1A03 A;  4HRG A;  5I2O A;  1CDN A;  3DVK A;  1UHJ A;  3PSR A;  1TNP A;  2WCB A;  1S3P A;  4L9M A;  1E8A A;  1IQ5 A;  2LMT A;  4JQ0 D;  2HET A;  3BQ3 A;  1CFP A;  4MZJ A;  1NX1 A;  5DIC A;  1SCV A;  2L2C A;  1DJY A;  1TWO A;  3JVT C;  4FTG A;  5HKZ A;  3S0A A;  1KFU L;  2KDH A;  1KSM A;  2QPT A;  2KNE A;  2E6W A;  4NDB A;  5CSI A;  1Z2C B;  1TRF A;  1JC2 A;  4N1G A;  3WNX B;  1K94 A;  1A2X A;  1ZAC A;  2EC6 B;  3KHE A;  1QX2 A;  5K89 A;  1SR6 C;  2K61 A;  2H61 C;  3R72 A;  5TNC A;  3EG5 B;  1TNQ A;  4OCI A;  2F3Y A;  4DCK A;  3GK2 A;  2MBX A;  1U5I B;  3GK1 A;  2LMV A;  1KFX S;  1H4B A;  3JTD B;  2LE9 B;  2KYC A;  3VGO A;  1IJ5 A;  1YUR A;  3BUN B;  2KGB C;  3Q8I A;  1JSA A;  3LL8 B;  1M39 A;  4KYN A;  3V2L A;  3SG4 A;  3QME A;  4P5O E;  4YGE B;  1XFU O;  1CMG A;  2ZRS A;  4I5J A;  1K90 D;  1XFX O;  3BFB A;  1JBA A;  1RJV A;  1YVH A;  1CFD A;  2PRU A;  1TUZ A;  1KSO A;  1R2U A;  2BKI B;  1UHN A;  1UUR A;  4MRY A;  4ORC B;  2WOS A;  1D1O A;  1W9Z A;  4ORA B;  3S0F A;  1XFR A;  2LVJ A;  1S6J A;  1EXR A;  2LVI A;  4YI8 A;  3L4A A;  4YBH B;  4OZD A;  1B8R A;  1A4P A;  1NPQ A;  1QTX A;  1IWQ A;  3D77 A;  3FIA A;  1SSE B;  2MHH A;  3DD4 A;  3GOF A;  4PE0 A;  5IBW A;  3I5G C;  2KFF A;  1J1E A;  2WCE A;  3IF7 A;  3CZ2 A;  1NX0 A;  1DJI A;  2Y1M A;  4HSZ A;  2KLD A;  1F55 A;  1QV1 A;  1H8B A;  1EJ3 A;  2BCB A;  1X02 A;  1WRZ A;  3B87 A;  1CTR A;  3CWG A;  1FI6 A;  2KQ6 A;  2KPH A;  2D8N A;  3GK4 X;  5D7F A;  5I8N A;  1IRJ A;  1SMG A;  5D3O A;  3NHT A;  1P28 A;  2OS8 C;  2WND A;  4MVF A;  3BYA A;  4NQG A;  1N0Y A;  1ZFS A;  2SCP A;  2VRG A;  1S5G Y;  4JPZ B;  1XYD A;  1PVB A;  3DVM A;  2L5Y A;  1WLZ A;  1YRT B;  1ZUZ A;  4Q04 A;  2PAL A;  2Y1N A;  4YRU A;  1G4Y R;  2JC2 A;  4R1E A;  2TN4 A;  3S0B A;  3BOW A;  3S0G A;  3OP0 A;  1L7Z A;  2HF5 A;  1DVI A;  2Q91 A;  3PLF B;  2EHB A;  2GGZ A;  2WCJ A;  2COL B;  3CR5 X;  2M49 B;  2K7C A;  1SCM B;  3PN7 C;  1BJF A;  1DTL A;  1S36 A;  3SG7 A;  3I5H C;  5JOL A;  1J1D A;  1F4Q A;  1K9P A;  5AFP A;  2NCO A;  4YGD B;  2L98 A;  3BUW B;  2PAS A;  5J3X A;  2PYQ A;  1W7I B;  2MRD A;  4C0L A;  1L2O C;  1KK8 B;  2QEH A;  4N1F A;  1DEL A;  3L47 A;  2H2K A;  1EG3 A;  4BY5 A;  1QXP A;  3SIA A;  1NCY A;  3WHT B;  5KU1 A;  2KI6 D;  3VRN A;  2I2R E;  1SK6 D;  2PSR A;  3CDN A;  1DT7 B;  1QV0 A;  4PCW A;  1KFX L;  2O60 A;  3IQQ A;  1TCO B;  2G2B A;  3EKH A;  3FWB A;  2NCP A;  2PVB A;  2LNK A;  1B8L A;  2ZKM X;  1CB1 A;  4N5X A;  1KCY A;  1ALW A;  1HQV A;  1V1G A;  3DY9 A;  2JXL A;  1S6C A;  1OOI X;  3O2P A;  3O4Y A;  3BFH A;  1DF0 A;  2KQY A;  4OV2 A;  2RGI A;  4DUQ A;  2KBM A;  2M97 A;  1K9U A;  1UWO A;  3CZ0 A;  4NDD A;  4C0J A;  1CLM A;  3PAT A;  1K2H A;  3D73 A;  2F8P A;  3OB1 B;  4F7F A;  5KTY A;  1XFW O;  3TS5 B;  1DEK A;  2QEO A;  2V53 A;  2BCA A;  1NSH A;  3FE8 A;  4ORB B;  2M29 A;  1NCZ A;  1DGU A;  4GBA A;  1QJT A;  2WCL A;  3PM2 A;  2M7N A;  3D0Y B;  3DVE A;  1BR4 B;  1SKT A;  1PK0 D;  2BBN A;  1YR5 A;  1UP5 A;  3RLZ A;  4PHK A;  2JU0 A;  5GQQ C;  1PUL A;  3QRX A;  2KHN A;  1OOG A;  3R1P A;  2OTG C;  1F8H A;  2CCM A;  3LK1 A;  4PE7 A;  2BE4 A;  1QVI Z;  1UHI A;  1N65 A;  1TUJ A;  3EK4 A;  3VB1 A;  2JT3 A;  4D1E A;  2GTE A;  3EK8 A;  3HX4 A;  4CPV A;  1SL7 A;  1WDC C;  5D69 A;  2LLS A;  2WC8 A;  3CTN A;  3NGV A;  4WQ3 A;  3I5I B;  2K7D A;  1OOH A;  1QIW A;  2M9G A;  3TDZ A;  2HQW A;  1CFF A;  2EGD A;  1ZMZ A;  1K93 D;  1MXL C;  3CLN A;  1IIO A;  2LCP A;  1OOJ A;  2QAC A;  3DXL A;  3VRQ A;  1F71 A;  5CPV A;  2ZNE A;  3S0D A;  4XJK A;  2BL0 C;  3VRO A;  4YGB B;  4DIR A;  1XFV O;  1YUS A;  4ICB A;  1A75 A;  4TNC A;  2F2O A;  2CXJ A;  5FYX A;  4FQT A;  1BU3 A;  2PMY A;  2JUL A;  3CR4 X;  1XVJ A;  4INX A;  3RZS A;  1FPW A;  2LLT A;  3ZWH A;  4HRE E;  3EKJ A;  1S6I A;  1AUI B;  3SS5 A;  1F4O A;  1K9K A;  2MLF C;  3M0W A;  2LC5 A;  3AAJ A;  2JT0 A;  3IQO A;  4YGA A;  4UPG A;  2HPS A;  1SCM C;  4PHM A;  4U8D A;  1WLM A;  3AKA A;  1A29 A;  2ZN8 A;  1LS8 A;  2CTN A;  3SG2 A;  2WOR A;  3FE6 A;  1MHO A;  4YI9 A;  4C0K A;  1NX2 A;  2JT8 A;  4MSP A;  2F3Z A;  2YGU A;  3DVJ A;  3RM1 A;  1M46 A;  1MF8 B;  3S0E A;  4A4B A;  1KQM B;  1PAL A;  3I5F B;  1OZO A;  4HRH A;  2KI4 B;  1RWY A;  4MN0 A;  4QJ3 B;  3SG6 A;  2CBL A;  4MZL A;  2H61 A;  5ER5 A;  5BPJ A;  4E68 A;  1AP4 A;  4M2O A;  3R1V A;  1DJH A;  1M45 A;  3D75 A;  3O6B A;  1J7R A;  1YRU B;  4BY4 A;  2JXC A;  1LKJ A;  1DJG A;  1TN4 A;  3BUM B;  1OOF A;  1AJ4 A;  1CFC A;  1IH0 A;  3SJS A;  2MJW B;  2ZN9 A;  1Y1X A;  1B7T Z;  1XFY O;  3R1O A;  4GGF C;  1QWV A;  1TOP A;  2JPT A;  2LAN A;  4GUK A;  2L4I A;  3EVV A;  3CGA A;  1T14 A;  3JVT B;  1IGV A;  1YVL A;  1BG1 A;  3TUY C;  1R6P A;  3OX6 A;  1SBJ A;  2KFG A;  5CSN A;  1OQP A;  1EG4 A;  2M0R A;  2L2E A;  3BFA A;  1Q80 A;  5AER A;  3KO0 A;  1KK7 Z;  2OPO A;  1FW4 A;  1C07 A;  3KF9 A;  1QAT A;  3NSI A;  1IQ3 A;  5HKW A;  3CAB A;  1KWO C;  1TIZ A;  2L5X B;  2KFH A;  5AEQ A;  3B7A A;  1UHK A;  1OMR A;  3F45 A;  4WRI A;  1C7W A;  1ALV A;  5EL2 A;  1SL9 A;  4AQI A;  1BF5 A;  3D74 A;  3L4L A;  1WY9 A;  3C1V A;  4ZCV A;  3MSE B;  3VRP A;  1PSR A;  2I18 A;  1CDL A;  1SPY A;  1K96 A;  2WCF A;  1CLL A;  3E3R A;  4GNK B;  2QDI A;  5KSZ A;  2AMI A;  1B7T Y;  3SS4 A;  2KAX A;  1AK8 A;  1JWD A;  2GV5 A;  2I7A A;  3BOW B;  1OE9 B;  3DZT A;  2EC6 C;  1FBV A;  2LHL A;  1CM1 A;  4GGF A;  4DS7 A;  3ICB A;  3OB2 B;  1K8U A;  3O4X A;  3SG5 A;  5DKN A;  2ZND A;  3FE9 A;  2NXQ A;  1CLB A;  2MLE C;  1WRK A;  1Y1U A;  1Y6W A;  3JTD C;  1NUB A;  1ZOT B;  1SL8 A;  3SIB A;  3NHI A;  1GM0 A;  2PQL A;  2G9B A;  2Y4Q A;  3EVU A;  1BT6 A;  2L4H A;  1LXF C;  3NXA A;  1UHH A;  3DF0 A;  2KLE A;  2DOQ A;  1ORG A;  1TCF A;  4QJ5 B;  1QIV A;  3BUO B;  3PJI A;  4CFQ A;  1CDM A;  1TNW A;  1G8I A;  1S26 D;  4IL1 A;  3KPX A;  1MR8 A;  2KSP A;  2BNX A;  4PT1 A;  1J7Q A;  5G08 A;  1BOD A;  2OS8 B;  1SW8 A;  1YTZ C;  4ETO A;  1IG5 A;  1OW4 A;  2JNF A;  3A8R A;  1MXE A;  2FJY A;  1LA3 A;  3WHU B;  1N2D A;  5F6T A;  1MQ1 A;  2ERB A;  4FQO A;  1C7V A;  4IJ7 A;  5AXI A;  4CFR A;  2AAO A;  5DKR A;  2JZI A;  3I5F C;  1F54 A;  5AAN A;  1GQM A;  2JQ6 A;  2L51 A;  3D76 A;  2F2P A;  2K0J A;  1OSA A;  4PE1 A;  1FI5 A;  2LAP A;  2Y5I A;  3NSO A;  2WCK A;  1BMO A;  1DJW A;  1DF0 B;  1QX5 B;  1U5I A;  1QAS A;  2LV7 A;  1M63 B;  3PN7 B;  1CNP A;  3D10 A;  2JRF A;  1XK4 C;  1XA5 A;  3I5H B;  3NSL A;  1SNL A;  4JD9 A;  2JPO A;  3TDI A;  1OMD A;  2KGR A;  3H4S E;  1TNX A;  1L2O B;  5HYD A;  2L0P A;  1DC1 A;  2LUX A;  4OKH A;  3OHM B;  1CM4 A;  3LK0 A;  4A4C A;  2JTT A;  1YX8 A;  1EH2 A;  2QEB A;  1RTP 1;  1QX7 A;  1AVS A;  1Y0V H;  4M2P A;  1C3Z A;  4MBE A;  1NYA A;  2K60 A;  3CZ1 A;  1QLS A;  3AKB A;  1QVI Y;  5JJG A;  3BJH A;  1MUX A;  3B86 A;  1OZS A;  3FS7 A;  1M31 A;  3O78 A;  2KAV A;  4OVN F;  1NP8 A;  1NIW A;  1RFJ A;  1SYM A;  2BAP A;  3CZT X;  2LVK A;  2NLN A;  3PFV A;  4YGC B;  5DKQ A;  3OGN A;  2A4J A;  3ZNI A;  3CS1 A;  4MEW A;  2LLU A;  2LUC A;  1YX7 A;  1KK8 C;  4USL A;  1KQV A;  4XJK B;  2AUC A;  2LP3 A;  4GGN A;  1GGZ A;  1A75 B;  2SAS A;  4MRX A;  4GPL B;  5HLO A;  4PDZ A;  1BOC A;  1XK4 A;  2WCH A;  1S5G Z;  5I2L A;  2FCE A;  5HL1 A;  2WCM A;  2CT9 A;  3HCM A;  4P2Y B;  2JTZ A;  4NDC A;  1UUS A;  1CKK A;  1IJ6 A;  5HLV A;  2F33 A;  1B8C A;  1B9A A;  1REC A;  2P6B B;  1CDP A;  2LHI A;  5ER4 X;  1FF1 A;  3K1E A;  2FJU B;  2NZ0 A;  5I94 A;  2K8M B;  1K95 A;  2OTG B;  2KI6 C;  1GJY A;  1JFJ A;  4M2Q A;  3UNW A;  4CID A;  1ODB A;  1RRO A;  4MZK A;  2E30 A;  1LIN A;  1G33 A;  2JNX A;  1RK9 A;  1WDC B;  1VRK A;  4OR9 B;  1NX3 A;  5B8I B;  1Z4H A;  2M1U A;  1DMO A;  1B4C A;  1JFK A;  1XFZ O;  3TS5 C;  1SRA A;  1QLK A;  3B6X A;  1KFU S;  4MLW A;  3PAL A;  3CR2 A;  3D78 A;  3SG3 A;  1SR6 B;  2LVV A;  2WC5 A;  2M7L A;  2BE6 A;  4I5N B;  2KYF A;  2BL0 B;  2HQ8 A;  3FWC A;  1LVC D;  3LLE A;  4I5K A;  1V1F A;  5FI6 A;  2K7O A;  2MAZ A;  2GGM A;  2LMU A;  4DRW A;  5I2Q A;  2B1U A;  3BUX B;  4INW A;  3AAK A;  4GAO A;  2K2A A;  2L50 A;  4GFT A;  4XYN A;  3UO9 A;  5FI7 A;  2K2F A;  3I5I C;  4WQ2 A;  1AJ5 A;  2WC6 A;  1IKU A;  1C3Y A;  3DYE A;  1J7P A;  3TZ1 A;  1DGV A;  2M1K B;  2P71 A;  1SY9 A;  4I5L B;  2ISD A;  3TDU A;  2K7B A;  2IS9 A;  1XO5 A;  2KAY A;  4AOM A;  3EVR A;  2ZFD A;  3I5G B;  2BEC A;  5PAL A;  1KK7 Y;  3NSK A;  1Y1A A;  1NWD A;  5FI2 A;  1LA0 A;  1B47 A;  1PVA A;  2BCX A;  1TTX A;  3IVT A;  2M8U A;  2KOT A;  1YUT A;  4F0Z B;  3SS3 A;  2LM5 A;  1DJZ A;  1JF0 A;  1JF2 A;  2FCD A;  1DQE A;  3D0Y A;  1J55 A;  4PAL A;  1JUO A;  2H8V A;  2R2I A;  5CSJ A;  5CSF A;  1YUU A;  2LP2 A;  2P70 A;  3B88 A;  3EK7 A;  3BXK A;  2Q4U A;  2BBM A;  1F70 A;  4QJ4 B;  3PM8 A;  1EL4 A;  3LCP C;  1DJX A;  2M3W A;  3CYZ A;  2BKH B;  1J7O A;  1MWN A;  4PHN A;  4CLN A;  1BLQ A;  2CNP A;  3VRR A;  1KQM C;  2ZRT A;  4PE4 A;  2MA2 A;  4JKT A;  5HKY A;  3TUY B;  1S1E A;  2KI4 C;  3OBV A;  3A4U B;  1OMV A;  2FOT A;  4PHJ A;  4AQJ A; 
#chains in the Genus database with same CATH homology
 1WRL A;  4JWQ A;  3K21 A;  1HT9 A;  3OX5 A;  2JOJ A;  1NCX A;  2O5G A;  4ZCU A;  1CMF A;  2JWW A;  1AHR A;  1BR1 B;  1W7J B;  2KBI A;  3DF0 B;  3KEV A;  2I94 A;  1GGW A;  1QS7 A;  1PSB A;  1PRW A;  1B1G A;  3WXA A;  1KWO B;  1A03 A;  1CDN A;  4HRG A;  5I2O A;  3DVK A;  1UHJ A;  3PSR A;  1TNP A;  2WCB A;  1S3P A;  4L9M A;  1E8A A;  1IQ5 A;  2LMT A;  4JQ0 D;  2HET A;  3BQ3 A;  1CFP A;  4MZJ A;  1NX1 A;  1SCV A;  1DJY A;  3JVT C;  4FTG A;  5HKZ A;  1KFU L;  2KDH A;  1KSM A;  2QPT A;  2KNE A;  2E6W A;  4NDB A;  5CSI A;  1JC2 A;  1TRF A;  3WNX B;  1K94 A;  1A2X A;  1ZAC A;  2EC6 B;  3KHE A;  1QX2 A;  5K89 A;  1SR6 C;  2K61 A;  2H61 C;  5TNC A;  1TNQ A;  4OCI A;  2F3Y A;  4DCK A;  3GK2 A;  2MBX A;  1U5I B;  3GK1 A;  2LMV A;  1KFX S;  1H4B A;  3JTD B;  2LE9 B;  2KYC A;  3VGO A;  1IJ5 A;  1YUR A;  3BUN B;  2KGB C;  1JSA A;  3LL8 B;  1M39 A;  3SG4 A;  4P5O E;  1CMG A;  4YGE B;  1XFU O;  2ZRS A;  4I5J A;  1K90 D;  1XFX O;  1JBA A;  1RJV A;  1YVH A;  1CFD A;  2PRU A;  1KSO A;  1R2U A;  2BKI B;  1UHN A;  1UUR A;  4MRY A;  4ORC B;  2WOS A;  1D1O A;  4ORA B;  2LVJ A;  1S6J A;  1EXR A;  2LVI A;  4YI8 A;  4YBH B;  1B8R A;  1A4P A;  1NPQ A;  1QTX A;  1IWQ A;  3FIA A;  4N1G A;  2MHH A;  3DD4 A;  3GOF A;  4PE0 A;  5IBW A;  3I5G C;  2KFF A;  1J1E A;  2WCE A;  3IF7 A;  1NX0 A;  1DJI A;  2Y1M A;  4HSZ A;  1F55 A;  1QV1 A;  1H8B A;  1EJ3 A;  2BCB A;  1X02 A;  1WRZ A;  1CTR A;  3CWG A;  1FI6 A;  2KQ6 A;  2D8N A;  3GK4 X;  5D7F A;  5I8N A;  1IRJ A;  1SMG A;  2OS8 C;  2WND A;  4MVF A;  3BYA A;  4NQG A;  1N0Y A;  1ZFS A;  2SCP A;  2VRG A;  1S5G Y;  4JPZ B;  1XYD A;  1PVB A;  3DVM A;  1WLZ A;  1YRT B;  1ZUZ A;  4Q04 A;  2PAL A;  2Y1N A;  4YRU A;  1G4Y R;  2JC2 A;  4R1E A;  2TN4 A;  3BOW A;  3OP0 A;  1L7Z A;  2HF5 A;  1DVI A;  2Q91 A;  3PLF B;  2EHB A;  2GGZ A;  3CR5 X;  2COL B;  2M49 B;  2K7C A;  1SCM B;  3PN7 C;  1BJF A;  1DTL A;  1S36 A;  3SG7 A;  3I5H C;  5JOL A;  1J1D A;  1F4Q A;  1K9P A;  5AFP A;  2NCO A;  4YGD B;  2L98 A;  3BUW B;  2PAS A;  5J3X A;  1W7I B;  2MRD A;  4C0L A;  1L2O C;  1KK8 B;  4N1F A;  2H2K A;  1EG3 A;  4BY5 A;  1QXP A;  3SIA A;  1NCY A;  3WHT B;  5KU1 A;  2KI6 D;  3VRN A;  2I2R E;  1SK6 D;  2PSR A;  1DT7 B;  1QV0 A;  4PCW A;  1KFX L;  2O60 A;  3IQQ A;  1TCO B;  2G2B A;  3EKH A;  3FWB A;  2NCP A;  2PVB A;  2LNK A;  1B8L A;  2ZKM X;  1CB1 A;  4N5X A;  1KCY A;  1ALW A;  1HQV A;  1V1G A;  2JXL A;  1S6C A;  3O2P A;  3O4Y A;  1DF0 A;  2KQY A;  4OV2 A;  2RGI A;  4DUQ A;  2KBM A;  2M97 A;  1K9U A;  1UWO A;  4NDD A;  4C0J A;  1CLM A;  3PAT A;  1K2H A;  5KTY A;  2F8P A;  3OB1 B;  1XFW O;  3TS5 B;  2V53 A;  2BCA A;  1NSH A;  4ORB B;  2M29 A;  1NCZ A;  1DGU A;  4GBA A;  1QJT A;  2M7N A;  3D0Y B;  3DVE A;  1BR4 B;  1SKT A;  1PK0 D;  2BBN A;  1YR5 A;  1UP5 A;  3RLZ A;  4PHK A;  2JU0 A;  5GQQ C;  1PUL A;  3QRX A;  2KHN A;  1F8H A;  2OTG C;  2CCM A;  3LK1 A;  4PE7 A;  2BE4 A;  1QVI Z;  1UHI A;  1N65 A;  3EK4 A;  2JT3 A;  4D1E A;  3EK8 A;  3HX4 A;  4CPV A;  1SL7 A;  1WDC C;  5D69 A;  2LLS A;  2WC8 A;  3CTN A;  4WQ3 A;  3I5I B;  2K7D A;  1QIW A;  2M9G A;  3TDZ A;  2HQW A;  1CFF A;  2EGD A;  1ZMZ A;  1K93 D;  1MXL C;  3CLN A;  2LCP A;  1OOJ A;  2QAC A;  3VRQ A;  1F71 A;  5CPV A;  2ZNE A;  4XJK A;  2BL0 C;  3VRO A;  4YGB B;  4DIR A;  1XFV O;  1YUS A;  4ICB A;  1A75 A;  4TNC A;  2F2O A;  2CXJ A;  5FYX A;  1BU3 A;  2PMY A;  2JUL A;  3CR4 X;  1XVJ A;  1FPW A;  2LLT A;  3ZWH A;  4HRE E;  3EKJ A;  1S6I A;  1AUI B;  1F4O A;  1K9K A;  2MLF C;  3M0W A;  2LC5 A;  3AAJ A;  2JT0 A;  3IQO A;  4YGA A;  4UPG A;  2HPS A;  1SCM C;  4PHM A;  4U8D A;  1WLM A;  3AKA A;  1A29 A;  2ZN8 A;  3SG2 A;  2CTN A;  2WOR A;  1MHO A;  4YI9 A;  4C0K A;  1NX2 A;  2JT8 A;  4MSP A;  2F3Z A;  3DVJ A;  3RM1 A;  1M46 A;  1MF8 B;  4A4B A;  1KQM B;  1PAL A;  3I5F B;  1OZO A;  4HRH A;  2KI4 B;  1RWY A;  4MN0 A;  4QJ3 B;  3SG6 A;  2CBL A;  4MZL A;  2H61 A;  5ER5 A;  5BPJ A;  4E68 A;  1AP4 A;  4M2O A;  1DJH A;  1M45 A;  3O6B A;  1J7R A;  1YRU B;  4BY4 A;  2JXC A;  1LKJ A;  1DJG A;  1TN4 A;  3BUM B;  1CFC A;  1AJ4 A;  1IH0 A;  3SJS A;  2MJW B;  2ZN9 A;  1Y1X A;  1B7T Z;  1XFY O;  4GGF C;  1TOP A;  2JPT A;  2LAN A;  4GUK A;  2L4I A;  3EVV A;  3CGA A;  3JVT B;  1IGV A;  1YVL A;  1BG1 A;  3TUY C;  1R6P A;  3OX6 A;  1SBJ A;  2KFG A;  5CSN A;  1OQP A;  1EG4 A;  2M0R A;  2L2E A;  1Q80 A;  5AER A;  3KO0 A;  1KK7 Z;  2OPO A;  1FW4 A;  1C07 A;  3KF9 A;  1QAT A;  3NSI A;  1IQ3 A;  5HKW A;  1KWO C;  1TIZ A;  2L5X B;  2KFH A;  5AEQ A;  1UHK A;  1OMR A;  3F45 A;  4WRI A;  1C7W A;  1ALV A;  1SL9 A;  4AQI A;  1BF5 A;  1WY9 A;  3C1V A;  4ZCV A;  3MSE B;  3VRP A;  1PSR A;  2I18 A;  1CDL A;  1SPY A;  1K96 A;  2WCF A;  1CLL A;  3E3R A;  4GNK B;  5KSZ A;  2AMI A;  1B7T Y;  2KAX A;  1AK8 A;  1JWD A;  2GV5 A;  2I7A A;  3BOW B;  1OE9 B;  4GGF A;  2EC6 C;  1FBV A;  2LHL A;  1CM1 A;  4DS7 A;  3ICB A;  3OB2 B;  1K8U A;  3SG5 A;  5DKN A;  2ZND A;  2NXQ A;  1CLB A;  2MLE C;  1WRK A;  1Y1U A;  1Y6W A;  3JTD C;  1NUB A;  1ZOT B;  1SL8 A;  3SIB A;  2Y4Q A;  2G9B A;  3EVU A;  1BT6 A;  2L4H A;  1LXF C;  3NXA A;  1UHH A;  3DF0 A;  2DOQ A;  1TCF A;  4QJ5 B;  1QIV A;  3BUO B;  4CFQ A;  1CDM A;  1TNW A;  1G8I A;  1S26 D;  4IL1 A;  3KPX A;  1MR8 A;  2KSP A;  1J7Q A;  5G08 A;  1BOD A;  2OS8 B;  1SW8 A;  1YTZ C;  4ETO A;  1IG5 A;  3A8R A;  2JNF A;  1MXE A;  1LA3 A;  3WHU B;  1N2D A;  5F6T A;  1MQ1 A;  4FQO A;  1C7V A;  5AXI A;  4CFR A;  2AAO A;  5DKR A;  2JZI A;  3I5F C;  1F54 A;  5AAN A;  1GQM A;  2JQ6 A;  2L51 A;  2F2P A;  2K0J A;  1OSA A;  4PE1 A;  1FI5 A;  2LAP A;  2Y5I A;  3NSO A;  1BMO A;  1DJW A;  1DF0 B;  1QX5 B;  1U5I A;  1QAS A;  2LV7 A;  1M63 B;  3PN7 B;  1CNP A;  3D10 A;  2JRF A;  1XK4 C;  1XA5 A;  3I5H B;  3NSL A;  1SNL A;  3TDI A;  1OMD A;  2KGR A;  3H4S E;  1TNX A;  1L2O B;  5HYD A;  2L0P A;  2LUX A;  4OKH A;  3OHM B;  1CM4 A;  3LK0 A;  4A4C A;  2JTT A;  1YX8 A;  1EH2 A;  1RTP 1;  1QX7 A;  1AVS A;  1Y0V H;  4M2P A;  4MBE A;  1NYA A;  1QLS A;  3AKB A;  1QVI Y;  5JJG A;  1MUX A;  1OZS A;  3FS7 A;  1M31 A;  3O78 A;  2KAV A;  4OVN F;  1NP8 A;  1NIW A;  1RFJ A;  1SYM A;  3CZT X;  2LVK A;  2NLN A;  3PFV A;  4YGC B;  5DKQ A;  2A4J A;  3ZNI A;  3CS1 A;  4MEW A;  2LLU A;  2LUC A;  1YX7 A;  1KK8 C;  4USL A;  1KQV A;  4XJK B;  2AUC A;  2LP3 A;  4GGN A;  1GGZ A;  1A75 B;  2SAS A;  4MRX A;  4GPL B;  5HLO A;  4PDZ A;  1BOC A;  1XK4 A;  5I2L A;  1S5G Z;  2FCE A;  2CT9 A;  3HCM A;  4P2Y B;  2JTZ A;  4NDC A;  1UUS A;  1CKK A;  1IJ6 A;  5HLV A;  2F33 A;  1B8C A;  1B9A A;  1REC A;  2P6B B;  1CDP A;  2LHI A;  5ER4 X;  1FF1 A;  2FJU B;  2NZ0 A;  2K8M B;  1K95 A;  2OTG B;  2KI6 C;  1GJY A;  1JFJ A;  4M2Q A;  4CID A;  1ODB A;  1RRO A;  4MZK A;  2E30 A;  1LIN A;  1G33 A;  2JNX A;  1RK9 A;  1WDC B;  1VRK A;  4OR9 B;  1NX3 A;  5B8I B;  2M1U A;  1DMO A;  1B4C A;  1JFK A;  1XFZ O;  3TS5 C;  1SRA A;  1QLK A;  1KFU S;  4MLW A;  3PAL A;  3CR2 A;  3SG3 A;  1SR6 B;  2LVV A;  2M7L A;  2BE6 A;  4I5N B;  2KYF A;  2BL0 B;  2HQ8 A;  3FWC A;  1LVC D;  3LLE A;  4I5K A;  1V1F A;  2K7O A;  2MAZ A;  2GGM A;  2LMU A;  4DRW A;  5I2Q A;  2B1U A;  3BUX B;  3AAK A;  4GAO A;  2K2A A;  2L50 A;  4GFT A;  4XYN A;  2K2F A;  3I5I C;  4WQ2 A;  1AJ5 A;  1IKU A;  1J7P A;  3TZ1 A;  1DGV A;  2M1K B;  2ISD A;  1SY9 A;  4I5L B;  3TDU A;  2K7B A;  2IS9 A;  1XO5 A;  2KAY A;  4AOM A;  3EVR A;  2ZFD A;  3I5G B;  2BEC A;  5PAL A;  1KK7 Y;  3NSK A;  1Y1A A;  1NWD A;  1LA0 A;  1B47 A;  1PVA A;  2BCX A;  1TTX A;  2M8U A;  2KOT A;  1YUT A;  4F0Z B;  2LM5 A;  1DJZ A;  1JF0 A;  1JF2 A;  2FCD A;  3D0Y A;  1J55 A;  4PAL A;  1JUO A;  2R2I A;  5CSJ A;  5CSF A;  1YUU A;  2LP2 A;  3EK7 A;  3BXK A;  2Q4U A;  2BBM A;  1F70 A;  4QJ4 B;  3PM8 A;  1EL4 A;  3LCP C;  1DJX A;  2M3W A;  2BKH B;  1J7O A;  1MWN A;  4PHN A;  4CLN A;  1BLQ A;  2CNP A;  3VRR A;  1KQM C;  2ZRT A;  4PE4 A;  2MA2 A;  5HKY A;  3TUY B;  1S1E A;  2KI4 C;  3A4U B;  1OMV A;  2FOT A;  4PHJ A;  4AQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...