1TCFA

Crystal structure of calcium-saturated rabbit skeletal troponin c
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
156
structure length
156
Chain Sequence
DQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Conformational variation of calcium-bound troponin C.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Calcium-regulated muscle contraction
total genus 61
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tcfA00
2M7NA 4JQ0D 1QVIZ 2JPTA 2EHBA 3C1VA 3SG4A 1S5GY 1CLBA 1YVLA 3D0YA 3RLZA 3GK4X 2ZNDA 1D1OA 2ZN9A 3OB2B 3WXAA 1L2OC 1TN4A 1TNPA 2KBIA 3HX4A 4N1FA 4L9MA 1KFXS 4YGAA 1TCFA 1G8IA 2CTNA 1Q80A 3EVRA 1X02A 3FWCA 2KI6D 5D7FA 4PE4A 4YGCB 1QIWA 2WNDA 4DUQA 4R1EA 1CMFA 1K9PA 5BPJA 2WORA 4PHJA 5CPVA 2TN4A 1KSMA 3O78A 1M45A 3LCPC 4XJKB 3DVMA 1BR1B 3BUXB 3TUYB 1BLQA 1XFWO 1SR6C 1KK7Z 2BBNA 1WLZA 2WOSA 2F3ZA 4MRXA 3FS7A 3KPXA 5ER5A 3TZ1A 2L51A 4UPGA 1F55A 1MR8A 3I5IC 3LK1A 2M1UA 4D1EA 2JULA 1MF8B 3KHEA 2LP2A 3PSRA 1TNWA 1IG5A 1QS7A 1K94A 2M49B 2LHIA 1XK4C 1JFKA 1Y1XA 3OX5A 4JWQA 1B7TY 2OS8B 1C7VA 2KSPA 5HLOA 4A4BA 2JT3A 1CKKA 5HYDA 1MHOA 2BBMA 4Q04A 1KFUS 1QVIY 2EC6B 1YX7A 2LANA 3IQOA 2LVJA 2KGRA 3KEVA 5IBWA 2IS9A 4N1GA 1LVCD 2HF5A 1IJ6A 1QASA 1J7QA 1GGZA 1UUSA 1UWOA 1DJIA 1Y1UA 1EG3A 3PN7B 1LA3A 2KAYA 2FCEA 4YRUA 1AK8A 2PRUA 4GNKB 2JXLA 1YUUA 2MJWB 3TS5B 3NSKA 2Y1NA 1UHJA 1GQMA 1DJWA 1HQVA 2KFHA 3LL8B 4PDZA 2KI6C 1M63B 1S6CA 1XFUO 1CB1A 4F0ZB 1KK8C 1B8LA 3BQ3A 1JBAA 4NDBA 1YVHA 1KK7Y 2AMIA 2CCMA 2LMTA 3CR5X 3EKJA 3I5FC 1DMOA 3BUMB 3DVKA 1NX2A 2JT0A 2JOJA 3AAKA 3VRPA 3OX6A 3BUNB 1K96A 2R2IA 1FI6A 2FJUB 4PALA 1J55A 1WLMA 4OKHA 3NXAA 4C0JA 4PCWA 1JFJA 2M1KB 1QLSA 5J3XA 1ZOTB 2G9BA 4OCIA 1JSAA 2O5GA 1RK9A 1CLMA 1DJHA 1BF5A 3BUWB 2M0RA 1A2XA 4TNCA 2F8PA 2Y5IA 2K7OA 1M31A 2KFGA 1YUSA 1H4BA 2MAZA 5CSIA 2BECA 1A4PA 3WHUB 4XJKA 3AKBA 1DF0B 1GJYA 2LMVA 2NLNA 1J7PA 1F70A 4ZCVA 5AEQA 2JZIA 1YTZC 2L50A 1AVSA 1JF2A 1UHHA 1K2HA 3CR2A 3CS1A 4DCKA 3ZWHA 4QJ5B 1NCYA 2ZRTA 1SYMA 1LA0A 2ISDA 3PM8A 3A8RA 3I5HC 2KQYA 3PFVA 3QRXA 5CSFA 3SG3A 1EL4A 4I5JA 2GGZA 3JTDB 1J1DA 2OS8C 3EK7A 1PSRA 2NXQA 5I8NA 2MRDA 1ZMZA 1EH2A 1KFUL 4NDCA 4DIRA 2EC6C 2SASA 1XO5A 2CXJA 4CFRA 1BJFA 5KU1A 3AAJA 3DF0B 3NSLA 2JNFA 3BUOB 1XFYO 4AQJA 3CTNA 3OHMB 2LVIA 3SIAA 3VRQA 1WRKA 3VRRA 1GGWA 2ZKMX 1SCVA 2KHNA 3O2PA 4HRGA 3GK2A 4ORAB 4PE0A 2L98A 3PLFB 1EG4A 2BL0C 1WRZA 3PALA 3JVTB 2FOTA 1OMDA 1W7JB 1N2DA 1XFXO 2LLTA 2KOTA 1BODA 1TOPA 3I5GB 1KWOB 1QJTA 2KQ6A 4MZJA 1C07A 1CFFA 4I5NB 1SKTA 2SCPA 2KYCA 1NWDA 1B47A 2VRGA 1FF1A 1G4YR 2L4HA 4MVFA 1IQ5A 2NCOA 2LC5A 1TCOB 2KFFA 4MSPA 2JWWA 4XYNA 4MEWA 3FWBA 1VRKA 3KF9A 1A03A 1J7OA 4GUKA 1NPQA 1CM1A 2LUCA 3O4YA 1DT7B 1IGVA 4ORBB 1UURA 1F4OA 1XVJA 4QJ4B 1CDLA 2LVVA 1IQ3A 1CFPA 2H61A 2K2AA 4ORCB 4YI9A 2E30A 2JRFA 4GGFA 2AUCA 2WCBA 2MHHA 1S26D 5AFPA 1YR5A 2K7BA 2LP3A 3HCMA 4PE1A 2E6WA 2L2EA 5D69A 1KQVA 4GAOA 2BCBA 1TRFA 2MA2A 4HREE 2LLUA 1PSBA 2QPTA 3LLEA 1CDNA 4AOMA 1DF0A 1XFVO 1YRTB 1V1GA 1CNPA 1SPYA 1TIZA 5I2OA 3H4SE 1K9KA 1K93D 4CFQA 1CFDA 4CLNA 4MLWA 1ALWA 1Y6WA 1NX0A 1BOCA 1QIVA 1SCMC 2CNPA 2HQ8A 1IH0A 2BE4A 3AKAA 1OQPA 1PK0D 1R2UA 1S6JA 2MLEC 1QTXA 2O60A 2MBXA 1HT9A 2Y4QA 1J1EA 1S3PA 3JTDC 3IF7A 2M3WA 2I18A 4HSZA 5FYXA 4DS7A 4U8DA 2A4JA 1A29A 1NSHA 3SIBA 1KQMB 2GGMA 2M29A 1RWYA 5CSNA 4BY4A 1QLKA 1QATA 1AP4A 1S36A 1N65A 2KI4B 4MZLA 4DRWA 3DF0A 1N0YA 1QX7A 2JXCA 1L2OB 1OOJA 4P2YB 1WY9A 1WDCB 2LAPA 5DKRA 2L0PA 4YBHB 1W7IB 1Y1AA 2K61A 3WHTB 1F71A 4P5OE 1SBJA 1KFXL 3JVTC 4GBAA 4ZCUA 2MLFC 3CWGA 3I5GC 2WCFA 1KCYA 4FTGA 3WNXB 3M0WA 2M97A 5F6TA 1CM4A 4FQOA 1ZFSA 1SR6B 2PSRA 1K90D 1DVIA 3TUYC 2LUXA 1NX3A 3I5IB 4GPLB 2G2BA 2Q91A 1NP8A 1S5GZ 5KSZA 1MXEA 1CMGA 3E3RA 4C0LA 3DVJA 1B9AA 1SNLA 4GGNA 4NQGA 1B8RA 2LVKA 2K8MB 1K9UA 1OMRA 2EGDA 2KYFA 2I94A 4MBEA 1U5IA 3OB1B 1QX5B 1AJ5A 4NDDA 2HPSA 3GK1A 4GFTA 3ICBA 2HQWA 1SRAA 1RJVA 2K7DA 1AHRA 1UHKA 2KAXA 5I2LA 4E68A 4HRHA 1XA5A 1CDMA 2LCPA 2BCAA 1WRLA 1A75B 3BYAA 2F2PA 2L5XB 2JQ6A 1RTP1 1NX1A 1LKJA 1RFJA 2KNEA 1NIWA 2KBMA 2M7LA 3PN7C 4OR9B 4MRYA 4WQ3A 2JTTA 1TNXA 1MXLC 1UHNA 4I5KA 2FCDA 1ODBA 4YGBB 1S6IA 1IRJA 1PRWA 1F8HA 5HKWA 3FIAA 4QJ3B 3TS5C 1KK8B 1M46A 3MSEB 1B7TZ 2I2RE 1DJZA 1PVBA 5G08A 1B4CA 1J7RA 3I5FB 2GV5A 1DGUA 3CLNA 1KQMC 1PALA 3SG6A 1UP5A 3LK0A 1G33A 1RECA 2JC2A 2PVBA 1BT6A 2AAOA 1OE9B 1K8UA 4PE7A 3OP0A 5GQQC 2KI4C 2OTGB 2BKIB 3SG7A 4M2PA 2PMYA 5K89A 3K21A 1WDCC 1YURA 1UHIA 1C7WA 3RM1A 1MWNA 1FW4A 1ALVA 1U5IB 1MQ1A 4M2OA 4WRIA 3SG5A 1CTRA 2H61C 4GGFC 2L4IA 2JT8A 1EJ3A 5AXIA 2K0JA 2D8NA 4IL1A 3BOWB 1BG1A 1NYAA 2COLB 1NCZA 3CGAA 3CR4X 1PVAA 3D10A 1SL9A 1B1GA 1L7ZA 4M2QA 2BCXA 3EK4A 2LE9B 4PHNA 1CLLA 1Y0VH 1CDPA 2HETA 3TDIA 1QX2A 1XYDA 3I5HB 2F3YA 1DJGA 4USLA 2Y1MA 1XK4A 2NCPA 1IJ5A 1E8AA 2I7AA 3SJSA 2NZ0A 2OPOA 1F4QA 1JF0A 2H2KA 2JTZA 4CPVA 3VRNA 1PULA 1YX8A 1R6PA 2V53A 1MUXA 1QXPA 1M39A 1YRUB 3F45A 1BU3A 1LXFC 2F2OA 4OV2A 4C0KA 3D0YB 2K2FA 2ZRSA 4CIDA 3VGOA 1A75A 2LV7A 3NSIA 4AQIA 3A4UB 1IKUA 1AJ4A 2KAVA 1OSAA 1SL8A 2ZNEA 1H8BA 2BL0B 1DGVA 1OZOA 3GOFA 1SY9A 1JUOA 2K7CA 3BXKA 1FBVA 2LMUA 3SG2A 1S1EA 5JJGA 4MN0A 4I5LB 5I2QA 4YI8A 2WC8A 1KWOC 3DVEA 1FPWA 1EXRA 1V1FA 1ZACA 1K95A 1KSOA 1DTLA 3CZTX 1BMOA 5CSJA 1XFZO 2ZN8A 5HKYA 1TTXA 2QACA 3EVVA 2OTGC 2RGIA 3TDUA 1QV1A 1JC2A 1JWDA 2B1UA 3O6BA 1SW8A 2LM5A 4ICBA 2BE6A 4MZKA 1NUBA 2LHLA 2LNKA 2DOQA 5ER4X 2KDHA 3EVUA 4PHMA 1AUIB 1B8CA 3EKHA 3PATA 3VROA 1IWQA 1SMGA 3ZNIA 3EK8A 5TNCA 1YUTA 3IQQA 1QV0A 4BY5A 1TNQA 3BOWA 4JPZB 1OZSA 2JU0A 2CT9A 1FI5A 3KO0A 2P6BB 4WQ2A 2JNXA 2CBLA 2ZFDA 3TDZA 5JOLA 2Q4UA 5AERA 4A4CA 3NSOA 1SCMB 1OMVA 2KGBC 4YGDB 5AANA 2PASA 4YGEB 3DD4A 2F33A 1RROA 1SL7A 2M8UA 2WCEA 1BR4B 1LINA 5PALA 2LLSA 5KTYA 4PHKA 5DKQA 1SK6D 4N5XA 1DJXA 4OVNF 1ZUZA 1DJYA 2BKHB 5DKNA 4ETOA 1NCXA 5HLVA 2PALA 1F54A 5HKZA 2M9GA 5B8IB 1CFCA
chains in the Genus database with same CATH superfamily
2M7NA 4JQ0D 1QVIZ 2JPTA 2EHBA 3C1VA 3SG4A 1S5GY 1CLBA 4JKTA 1YVLA 3D0YA 3RLZA 3GK4X 2ZNDA 1D1OA 2ZN9A 3OB2B 3WXAA 1L2OC 1TN4A 1TNPA 2ERBA 2KBIA 3HX4A 4N1FA 4L9MA 1KFXS 4YGAA 1TCFA 1G8IA 2CTNA 1Q80A 3EVRA 3S0DA 1X02A 3FWCA 2KI6D 5D7FA 4PE4A 4YGCB 3FE8A 1QIWA 2WNDA 4DUQA 4R1EA 1CMFA 1K9PA 5BPJA 2WORA 4PHJA 5CPVA 2TN4A 1KSMA 3O78A 1M45A 3LCPC 4XJKB 3DVMA 3UO9A 1BR1B 3BUXB 1GM0A 2KPHA 3TUYB 5D3OA 1BLQA 1XFWO 1SR6C 1KK7Z 5I94A 2BBNA 1WLZA 2WOSA 2F3ZA 4MRXA 3FS7A 3KPXA 5ER5A 3TZ1A 2L51A 4UPGA 1F55A 1MR8A 3I5IC 3LK1A 2M1UA 4D1EA 2JULA 1MF8B 2QEHA 3KHEA 2FJYA 3S0BA 2LP2A 3PSRA 1TNWA 1IG5A 1QS7A 1K94A 2BNXA 2LHIA 2M49B 1XK4C 1JFKA 1Y1XA 3OX5A 4JWQA 1B7TY 2OS8B 1C7VA 2KSPA 3D78A 5HLOA 4A4BA 2JT3A 1CKKA 5HYDA 1MHOA 2BBMA 3EG5B 4Q04A 1KFUS 1QVIY 2EC6B 1YX7A 3D73A 2LANA 3IQOA 4FQTA 2LVJA 3S0GA 2KGRA 3KEVA 5IBWA 2IS9A 4N1GA 1LVCD 2HF5A 1IJ6A 1QASA 1J7QA 1GGZA 1UUSA 1UWOA 3D77A 1DJIA 3UNWA 3NGVA 1Y1UA 1EG3A 3DXLA 1TUJA 3PN7B 1LA3A 2KAYA 2FCEA 3NHIA 4YRUA 5FI2A 1AK8A 2PRUA 4GNKB 1Z2CB 2JXLA 1YUUA 2MJWB 3TS5B 2PYQA 2Y1NA 1UHJA 1DJWA 1GQMA 1HQVA 2KFHA 2P70A 3LL8B 2KI6C 3OBVA 4PDZA 1M63B 1S6CA 1XFUO 1CB1A 4F0ZB 1KK8C 1B8LA 3BQ3A 1JBAA 4NDBA 1YVHA 1KK7Y 2AMIA 2CCMA 2LMTA 3CR5X 3EKJA 3B7AA 3I5FC 1DMOA 3BUMB 3DVKA 1NX2A 2JT0A 2JOJA 3AAKA 3VRPA 5DICA 3OX6A 3BUNB 3L47A 1K96A 2R2IA 1FI6A 2FJUB 4PALA 1J55A 1WLMA 4OKHA 3NXAA 4C0JA 4PCWA 1JFJA 2M1KB 1QLSA 2QEOA 5J3XA 1ZOTB 5HL1A 2G9BA 4OCIA 1JSAA 2O5GA 1RK9A 1CLMA 1DJHA 1BF5A 1OW4A 3BUWB 2M0RA 1A2XA 4TNCA 2F8PA 2Y5IA 2K7OA 1M31A 2KFGA 1YUSA 1H4BA 2MAZA 5CSIA 1A4PA 2BECA 3WHUB 3S0EA 1TWOA 4XJKA 3AKBA 1DF0B 1GJYA 2LMVA 2NLNA 3BFAA 1J7PA 1F70A 4ZCVA 5AEQA 2JZIA 1C3ZA 1YTZC 2L50A 3PM2A 1AVSA 1JF2A 1UHHA 1K2HA 3CR2A 3CS1A 3V2LA 4DCKA 3ZWHA 4QJ5B 1NCYA 2ZRTA 1SYMA 1LA0A 2ISDA 2WC6A 3A8RA 3PM8A 3I5HC 2KQYA 3BFHA 3PFVA 3QRXA 5CSFA 1EL4A 4I5JA 3SS3A 3SG3A 2GGZA 3JTDB 1J1DA 2OS8C 3EK7A 3B87A 1PSRA 2NXQA 5I8NA 2MRDA 1ZMZA 1EH2A 1KFUL 4NDCA 4DIRA 2EC6C 2SASA 1TUZA 1XO5A 2CXJA 4CFRA 1BJFA 5KU1A 3AAJA 3D74A 3DF0B 3NSLA 2JNFA 3BUOB 1XFYO 4AQJA 3CTNA 3OHMB 2LVIA 3SIAA 3VRQA 1WRKA 3VRRA 1GGWA 2ZKMX 1SCVA 2KHNA 3O2PA 4HRGA 3GK2A 4ORAB 4PE0A 2L98A 3PLFB 3B86A 1EG4A 2BL0C 1WRZA 3PALA 3JVTB 2FOTA 1OMDA 1W7JB 1N2DA 1XFXO 2LLTA 2KOTA 3FE6A 1TOPA 3SS5A 3DZTA 3I5GB 1KWOB 1BODA 1QJTA 2KQ6A 4MZJA 5FI6A 1C07A 1CFFA 4I5NB 1SKTA 2SCPA 2KYCA 1NWDA 1B47A 2VRGA 3L4LA 1C3YA 5FI7A 1FF1A 3L4AA 1G4YR 2L4HA 4MVFA 1IQ5A 2NCOA 2LC5A 2H8VA 1TCOB 2KFFA 4MSPA 2JWWA 2WCMA 4MEWA 3FWBA 4XYNA 1VRKA 3KF9A 1A03A 1J7OA 4GUKA 1OOIX 1NPQA 1CM1A 2LUCA 3O4YA 1DT7B 1IGVA 4ORBB 1UURA 1F4OA 1XVJA 4QJ4B 1CDLA 2LVVA 1IQ3A 1CFPA 2H61A 2K2AA 4ORCB 4YI9A 2E30A 2JRFA 4GGFA 2AUCA 2WCBA 2MHHA 3B88A 1S26D 5AFPA 1YR5A 2K7BA 2LP3A 3HCMA 3B6XA 4PE1A 3QMEA 2E6WA 2L2EA 3PJIA 5D69A 1KQVA 4GAOA 2BCBA 4KYNA 1TRFA 2MA2A 4HREE 2LLUA 1PSBA 1OOFA 2QPTA 3LLEA 4AOMA 1CDNA 1DF0A 1XFVO 1YRTB 1V1GA 1CNPA 1SPYA 1TIZA 5I2OA 3CZ0A 3H4SE 2KLEA 1K9KA 1K93D 4CFQA 1CFDA 4CLNA 1QWVA 1ALWA 4MLWA 1Y6WA 1NX0A 1XFRA 3N7HA 1BOCA 1QIVA 1SCMC 2CNPA 2HQ8A 1IH0A 2BE4A 3AKAA 1OQPA 1PK0D 1R2UA 2GTEA 1S6JA 2MLEC 1QTXA 2O60A 2MBXA 1HT9A 2Y4QA 1J1EA 1S3PA 2P71A 3JTDC 3IF7A 4F7FA 2M3WA 2I18A 4HSZA 5FYXA 4DS7A 2WC5A 4U8DA 2A4JA 1A29A 1NSHA 3SIBA 1KQMB 2GGMA 2M29A 1RWYA 5CSNA 4BY4A 1QLKA 1QATA 1AP4A 1S36A 1N65A 2KI4B 4MZLA 4DRWA 3DF0A 1N0YA 1QX7A 2JXCA 1L2OB 1OOJA 4P2YB 1WY9A 3VB1A 1WDCB 2LAPA 5DKRA 2L0PA 2QDIA 4YBHB 1W7IB 1Y1AA 2K61A 3WHTB 1F71A 4P5OE 1SBJA 3S0AA 1KFXL 3DYEA 3JVTC 4GBAA 4ZCUA 2MLFC 3CWGA 3I5GC 2WCFA 4IJ7A 1KCYA 4FTGA 3WNXB 3M0WA 2M97A 5F6TA 1CM4A 4FQOA 1ZFSA 1SR6B 2PSRA 1K90D 1DVIA 3S0FA 3TUYC 1T14A 2LUXA 1NX3A 3I5IB 4GPLB 2G2BA 2Q91A 1NP8A 1S5GZ 3NSKA 1MXEA 5KSZA 1CMGA 3E3RA 4C0LA 3DVJA 3Q8IA 1B9AA 1SNLA 4GGNA 4NQGA 1B8RA 2LVKA 2K8MB 1K9UA 1OMRA 2EGDA 2KYFA 2I94A 3NHTA 4MBEA 1U5IA 3OB1B 3R1PA 1QX5B 1AJ5A 4NDDA 1W9ZA 2HPSA 3R72A 3GK1A 4GFTA 3ICBA 2HQWA 2WCLA 1SRAA 1ORGA 4OZDA 1RJVA 2K7DA 1AHRA 1DC1A 1UHKA 2KAXA 5I2LA 4E68A 4HRHA 1XA5A 1CDMA 2LCPA 2BCAA 3R1VA 1WRLA 3BJHA 1A75B 3BYAA 2F2PA 2L5XB 2JQ6A 3R1OA 1RTP1 1NX1A 1LKJA 1RFJA 2KNEA 1NIWA 2KBMA 2M7LA 3PN7C 4OR9B 4MRYA 4WQ3A 2JTTA 1TNXA 1MXLC 1UHNA 4I5KA 2FCDA 1ODBA 4YGBB 1S6IA 1IRJA 1PRWA 1F8HA 5HKWA 3CABA 3FIAA 4QJ3B 3TS5C 3IVTA 1KK8B 1M46A 3MSEB 1B7TZ 2I2RE 1DJZA 1PVBA 5G08A 1B4CA 1DELA 1J7RA 1DQEA 3I5FB 2GV5A 1DGUA 3CLNA 1KQMC 1PALA 3SG6A 1UP5A 3LK0A 1G33A 1RECA 2JC2A 2PVBA 1BT6A 2AAOA 1OE9B 1K8UA 4PE7A 3OP0A 5GQQC 2KI4C 1OOHA 2OTGB 2BKIB 3SG7A 4INWA 4M2PA 2PMYA 5K89A 3K21A 1WDCC 3CZ1A 1YURA 5EL2A 1UHIA 1C7WA 3RM1A 1MWNA 1FW4A 1ALVA 1U5IB 1MQ1A 2KLDA 4M2OA 4WRIA 3SG5A 1CTRA 2H61C 4GGFC 2L4IA 2JT8A 1EJ3A 1LS8A 3D75A 5AXIA 3CZ2A 2K0JA 2L2CA 2D8NA 4IL1A 2WCKA 3BOWB 1BG1A 1NYAA 2COLB 1NCZA 3CGAA 3CR4X 1PVAA 3D10A 1SL9A 1B1GA 1L7ZA 4M2QA 2BCXA 2BAPA 3EK4A 2LE9B 4PHNA 1CLLA 1Y0VH 1CDPA 2HETA 3TDIA 1QX2A 1XYDA 3I5HB 2F3YA 1DJGA 1OOGA 4USLA 2Y1MA 1XK4A 2NCPA 1IJ5A 1E8AA 2I7AA 3DY9A 2NZ0A 3SJSA 2OPOA 1F4QA 1JF0A 2H2KA 2JTZA 4CPVA 3FE9A 3VRNA 1PULA 1YX8A 1R6PA 2V53A 1MUXA 1QXPA 1M39A 1YRUB 2QEVA 1BU3A 1LXFC 2F2OA 3F45A 4OV2A 4C0KA 2JPOA 3D0YB 2K2FA 2ZRSA 2WCHA 4CIDA 2K60A 3VGOA 1A75A 1IIOA 2LV7A 3NSIA 4AQIA 3A4UB 1DEKA 1IKUA 1AJ4A 2KAVA 1OSAA 1SL8A 2ZNEA 3CYZA 3O4XA 1H8BA 2BL0B 1DGVA 1OZOA 2PQLA 1SY9A 1JUOA 3GOFA 2K7CA 2QEBA 3BXKA 1FBVA 2LMUA 3SG2A 3RZSA 1S1EA 5JJGA 4MN0A 4I5LB 5I2QA 4YI8A 2WC8A 1KWOC 3DVEA 1FPWA 1EXRA 1V1FA 1ZACA 1K95A 1KSOA 1DTLA 3CZTX 1BMOA 5CSJA 2WCJA 1XFZO 2ZN8A 4JD9A 5HKYA 1TTXA 2QACA 3EVVA 2OTGC 2RGIA 3TDUA 1QV1A 3CDNA 1JC2A 1P28A 1JWDA 2B1UA 3O6BA 3SS4A 1SW8A 2LM5A 3OGNA 4ICBA 2BE6A 4MZKA 1NUBA 2LHLA 2LNKA 2DOQA 5ER4X 1Z4HA 2KDHA 3EVUA 4PHMA 1AUIB 1B8CA 3EKHA 3PATA 3VROA 1IWQA 1SMGA 3ZNIA 1SSEB 3EK8A 5TNCA 1YUTA 3IQQA 1QV0A 4BY5A 4PT1A 1TNQA 2L5YA 3BOWA 4JPZB 1OZSA 2JU0A 2CT9A 3D76A 3KO0A 2P6BB 1FI5A 4WQ2A 2JNXA 2CBLA 2YGUA 2ZFDA 3TDZA 5JOLA 3K1EA 2Q4UA 5AERA 3BFBA 3NSOA 1SCMB 1OMVA 2KGBC 4YGDB 5AANA 2PASA 4A4CA 4YGEB 3DD4A 2F33A 1RROA 1SL7A 2M8UA 2WCEA 1BR4B 1LINA 5PALA 2LLSA 5KTYA 4PHKA 5DKQA 1SK6D 4N5XA 1DJXA 4OVNF 1ZUZA 1DJYA 2BKHB 4INXA 5DKNA 1NCXA 4ETOA 5HLVA 2PALA 1F54A 5HKZA 2M9GA 5B8IB 1CFCA
chains in the Genus database with same CATH topology
2M7NA 4JQ0D 1QVIZ 2JPTA 2EHBA 3C1VA 3SG4A 1S5GY 1CLBA 1YVLA 3D0YA 3RLZA 3GK4X 2ZNDA 1D1OA 2ZN9A 3OB2B 3WXAA 1L2OC 1TN4A 1TNPA 2KBIA 3HX4A 4N1FA 4L9MA 1KFXS 4YGAA 1TCFA 1G8IA 2CTNA 1Q80A 3EVRA 1X02A 3FWCA 2KI6D 5D7FA 4PE4A 4YGCB 1QIWA 2WNDA 4DUQA 4R1EA 1CMFA 1K9PA 5BPJA 2WORA 4PHJA 5CPVA 2TN4A 1KSMA 3O78A 1M45A 3LCPC 4XJKB 3DVMA 1BR1B 3BUXB 3TUYB 1BLQA 1XFWO 1SR6C 1KK7Z 2BBNA 1WLZA 2WOSA 2F3ZA 4MRXA 3FS7A 3KPXA 5ER5A 3TZ1A 2L51A 4UPGA 1F55A 1MR8A 3I5IC 3LK1A 2M1UA 4D1EA 2JULA 1MF8B 3KHEA 2LP2A 3PSRA 1TNWA 1IG5A 1QS7A 1K94A 2M49B 2LHIA 1XK4C 1JFKA 1Y1XA 3OX5A 4JWQA 1B7TY 2OS8B 1C7VA 2KSPA 5HLOA 4A4BA 2JT3A 1CKKA 5HYDA 1MHOA 2BBMA 4Q04A 1KFUS 1QVIY 2EC6B 1YX7A 2LANA 3IQOA 2LVJA 2KGRA 3KEVA 5IBWA 2IS9A 4N1GA 1LVCD 2HF5A 1IJ6A 1QASA 1J7QA 1GGZA 1UUSA 1UWOA 1DJIA 1Y1UA 1EG3A 3PN7B 1LA3A 2KAYA 2FCEA 4YRUA 1AK8A 2PRUA 4GNKB 2JXLA 1YUUA 2MJWB 3TS5B 3NSKA 2Y1NA 1UHJA 1GQMA 1DJWA 1HQVA 2KFHA 3LL8B 4PDZA 2KI6C 1M63B 1S6CA 1XFUO 1CB1A 4F0ZB 1KK8C 1B8LA 3BQ3A 1JBAA 4NDBA 1YVHA 1KK7Y 2AMIA 2CCMA 2LMTA 3CR5X 3EKJA 3I5FC 1DMOA 3BUMB 3DVKA 1NX2A 2JT0A 2JOJA 3AAKA 3VRPA 3OX6A 3BUNB 1K96A 2R2IA 1FI6A 2FJUB 4PALA 1J55A 1WLMA 4OKHA 3NXAA 4C0JA 4PCWA 1JFJA 2M1KB 1QLSA 5J3XA 1ZOTB 2G9BA 4OCIA 1JSAA 2O5GA 1RK9A 1CLMA 1DJHA 1BF5A 3BUWB 2M0RA 1A2XA 4TNCA 2F8PA 2Y5IA 2K7OA 1M31A 2KFGA 1YUSA 1H4BA 2MAZA 5CSIA 2BECA 1A4PA 3WHUB 4XJKA 3AKBA 1DF0B 1GJYA 2LMVA 2NLNA 1J7PA 1F70A 4ZCVA 5AEQA 2JZIA 1YTZC 2L50A 1AVSA 1JF2A 1UHHA 1K2HA 3CR2A 3CS1A 4DCKA 3ZWHA 4QJ5B 1NCYA 2ZRTA 1SYMA 1LA0A 2ISDA 3PM8A 3A8RA 3I5HC 2KQYA 3PFVA 3QRXA 5CSFA 3SG3A 1EL4A 4I5JA 2GGZA 3JTDB 1J1DA 2OS8C 3EK7A 1PSRA 2NXQA 5I8NA 2MRDA 1ZMZA 1EH2A 1KFUL 4NDCA 4DIRA 2EC6C 2SASA 1XO5A 2CXJA 4CFRA 1BJFA 5KU1A 3AAJA 3DF0B 3NSLA 2JNFA 3BUOB 1XFYO 4AQJA 3CTNA 3OHMB 2LVIA 3SIAA 3VRQA 1WRKA 3VRRA 1GGWA 2ZKMX 1SCVA 2KHNA 3O2PA 4HRGA 3GK2A 4ORAB 4PE0A 2L98A 3PLFB 1EG4A 2BL0C 1WRZA 3PALA 3JVTB 2FOTA 1OMDA 1W7JB 1N2DA 1XFXO 2LLTA 2KOTA 1BODA 1TOPA 3I5GB 1KWOB 1QJTA 2KQ6A 4MZJA 1C07A 1CFFA 4I5NB 1SKTA 2SCPA 2KYCA 1NWDA 1B47A 2VRGA 1FF1A 1G4YR 2L4HA 4MVFA 1IQ5A 2NCOA 2LC5A 1TCOB 2KFFA 4MSPA 2JWWA 4XYNA 4MEWA 3FWBA 1VRKA 3KF9A 1A03A 1J7OA 4GUKA 1NPQA 1CM1A 2LUCA 3O4YA 1DT7B 1IGVA 4ORBB 1UURA 1F4OA 1XVJA 4QJ4B 1CDLA 2LVVA 1IQ3A 1CFPA 2H61A 2K2AA 4ORCB 4YI9A 2E30A 2JRFA 4GGFA 2AUCA 2WCBA 2MHHA 1S26D 5AFPA 1YR5A 2K7BA 2LP3A 3HCMA 4PE1A 2E6WA 2L2EA 5D69A 1KQVA 4GAOA 2BCBA 1TRFA 2MA2A 4HREE 2LLUA 1PSBA 2QPTA 3LLEA 1CDNA 4AOMA 1DF0A 1XFVO 1YRTB 1V1GA 1CNPA 1SPYA 1TIZA 5I2OA 3H4SE 1K9KA 1K93D 4CFQA 1CFDA 4CLNA 4MLWA 1ALWA 1Y6WA 1NX0A 1BOCA 1QIVA 1SCMC 2CNPA 2HQ8A 1IH0A 2BE4A 3AKAA 1OQPA 1PK0D 1R2UA 1S6JA 2MLEC 1QTXA 2O60A 2MBXA 1HT9A 2Y4QA 1J1EA 1S3PA 3JTDC 3IF7A 2M3WA 2I18A 4HSZA 5FYXA 4DS7A 4U8DA 2A4JA 1A29A 1NSHA 3SIBA 1KQMB 2GGMA 2M29A 1RWYA 5CSNA 4BY4A 1QLKA 1QATA 1AP4A 1S36A 1N65A 2KI4B 4MZLA 4DRWA 3DF0A 1N0YA 1QX7A 2JXCA 1L2OB 1OOJA 4P2YB 1WY9A 1WDCB 2LAPA 5DKRA 2L0PA 4YBHB 1W7IB 1Y1AA 2K61A 3WHTB 1F71A 4P5OE 1SBJA 1KFXL 3JVTC 4GBAA 4ZCUA 2MLFC 3CWGA 3I5GC 2WCFA 1KCYA 4FTGA 3WNXB 3M0WA 2M97A 5F6TA 1CM4A 4FQOA 1ZFSA 1SR6B 2PSRA 1K90D 1DVIA 3TUYC 2LUXA 1NX3A 3I5IB 4GPLB 2G2BA 2Q91A 1NP8A 1S5GZ 5KSZA 1MXEA 1CMGA 3E3RA 4C0LA 3DVJA 1B9AA 1SNLA 4GGNA 4NQGA 1B8RA 2LVKA 2K8MB 1K9UA 1OMRA 2EGDA 2KYFA 2I94A 4MBEA 1U5IA 3OB1B 1QX5B 1AJ5A 4NDDA 2HPSA 3GK1A 4GFTA 3ICBA 2HQWA 1SRAA 1RJVA 2K7DA 1AHRA 1UHKA 2KAXA 5I2LA 4E68A 4HRHA 1XA5A 1CDMA 2LCPA 2BCAA 1WRLA 1A75B 3BYAA 2F2PA 2L5XB 2JQ6A 1RTP1 1NX1A 1LKJA 1RFJA 2KNEA 1NIWA 2KBMA 2M7LA 3PN7C 4OR9B 4MRYA 4WQ3A 2JTTA 1TNXA 1MXLC 1UHNA 4I5KA 2FCDA 1ODBA 4YGBB 1S6IA 1IRJA 1PRWA 1F8HA 5HKWA 3FIAA 4QJ3B 3TS5C 1KK8B 1M46A 3MSEB 1B7TZ 2I2RE 1DJZA 1PVBA 5G08A 1B4CA 1J7RA 3I5FB 2GV5A 1DGUA 3CLNA 1KQMC 1PALA 3SG6A 1UP5A 3LK0A 1G33A 1RECA 2JC2A 2PVBA 1BT6A 2AAOA 1OE9B 1K8UA 4PE7A 3OP0A 5GQQC 2KI4C 2OTGB 2BKIB 3SG7A 4M2PA 2PMYA 5K89A 3K21A 1WDCC 1YURA 1UHIA 1C7WA 3RM1A 1MWNA 1FW4A 1ALVA 1U5IB 1MQ1A 4M2OA 4WRIA 3SG5A 1CTRA 2H61C 4GGFC 2L4IA 2JT8A 1EJ3A 5AXIA 2K0JA 2D8NA 4IL1A 3BOWB 1BG1A 1NYAA 2COLB 1NCZA 3CGAA 3CR4X 1PVAA 3D10A 1SL9A 1B1GA 1L7ZA 4M2QA 2BCXA 3EK4A 2LE9B 4PHNA 1CLLA 1Y0VH 1CDPA 2HETA 3TDIA 1QX2A 1XYDA 3I5HB 2F3YA 1DJGA 4USLA 2Y1MA 1XK4A 2NCPA 1IJ5A 1E8AA 2I7AA 3SJSA 2NZ0A 2OPOA 1F4QA 1JF0A 2H2KA 2JTZA 4CPVA 3VRNA 1PULA 1YX8A 1R6PA 2V53A 1MUXA 1QXPA 1M39A 1YRUB 3F45A 1BU3A 1LXFC 2F2OA 4OV2A 4C0KA 3D0YB 2K2FA 2ZRSA 4CIDA 3VGOA 1A75A 2LV7A 3NSIA 4AQIA 3A4UB 1IKUA 1AJ4A 2KAVA 1OSAA 1SL8A 2ZNEA 1H8BA 2BL0B 1DGVA 1OZOA 3GOFA 1SY9A 1JUOA 2K7CA 3BXKA 1FBVA 2LMUA 3SG2A 1S1EA 5JJGA 4MN0A 4I5LB 5I2QA 4YI8A 2WC8A 1KWOC 3DVEA 1FPWA 1EXRA 1V1FA 1ZACA 1K95A 1KSOA 1DTLA 3CZTX 1BMOA 5CSJA 1XFZO 2ZN8A 5HKYA 1TTXA 2QACA 3EVVA 2OTGC 2RGIA 3TDUA 1QV1A 1JC2A 1JWDA 2B1UA 3O6BA 1SW8A 2LM5A 4ICBA 2BE6A 4MZKA 1NUBA 2LHLA 2LNKA 2DOQA 5ER4X 2KDHA 3EVUA 4PHMA 1AUIB 1B8CA 3EKHA 3PATA 3VROA 1IWQA 1SMGA 3ZNIA 3EK8A 5TNCA 1YUTA 3IQQA 1QV0A 4BY5A 1TNQA 3BOWA 4JPZB 1OZSA 2JU0A 2CT9A 1FI5A 3KO0A 2P6BB 4WQ2A 2JNXA 2CBLA 2ZFDA 3TDZA 5JOLA 2Q4UA 5AERA 4A4CA 3NSOA 1SCMB 1OMVA 2KGBC 4YGDB 5AANA 2PASA 4YGEB 3DD4A 2F33A 1RROA 1SL7A 2M8UA 2WCEA 1BR4B 1LINA 5PALA 2LLSA 5KTYA 4PHKA 5DKQA 1SK6D 4N5XA 1DJXA 4OVNF 1ZUZA 1DJYA 2BKHB 5DKNA 4ETOA 1NCXA 5HLVA 2PALA 1F54A 5HKZA 2M9GA 5B8IB 1CFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7N A;  4JQ0 D;  1QVI Z;  2JPT A;  2EHB A;  3C1V A;  3SG4 A;  1S5G Y;  1CLB A;  1YVL A;  3D0Y A;  3RLZ A;  3GK4 X;  2ZND A;  1D1O A;  2ZN9 A;  3OB2 B;  3WXA A;  1L2O C;  1TN4 A;  1TNP A;  2KBI A;  3HX4 A;  4N1F A;  4L9M A;  1KFX S;  4YGA A;  1TCF A;  1G8I A;  2CTN A;  1Q80 A;  3EVR A;  1X02 A;  3FWC A;  2KI6 D;  5D7F A;  4PE4 A;  4YGC B;  1QIW A;  2WND A;  4DUQ A;  4R1E A;  1CMF A;  1K9P A;  5BPJ A;  2WOR A;  4PHJ A;  5CPV A;  2TN4 A;  1KSM A;  3O78 A;  1M45 A;  3LCP C;  4XJK B;  3DVM A;  1BR1 B;  3BUX B;  3TUY B;  1BLQ A;  1XFW O;  1SR6 C;  1KK7 Z;  2BBN A;  1WLZ A;  2WOS A;  2F3Z A;  4MRX A;  3FS7 A;  3KPX A;  5ER5 A;  3TZ1 A;  2L51 A;  4UPG A;  1F55 A;  1MR8 A;  3I5I C;  3LK1 A;  2M1U A;  4D1E A;  2JUL A;  1MF8 B;  3KHE A;  2LP2 A;  3PSR A;  1TNW A;  1IG5 A;  1QS7 A;  1K94 A;  2M49 B;  2LHI A;  1XK4 C;  1JFK A;  1Y1X A;  3OX5 A;  4JWQ A;  1B7T Y;  2OS8 B;  1C7V A;  2KSP A;  5HLO A;  4A4B A;  2JT3 A;  1CKK A;  5HYD A;  1MHO A;  2BBM A;  4Q04 A;  1KFU S;  1QVI Y;  2EC6 B;  1YX7 A;  2LAN A;  3IQO A;  2LVJ A;  2KGR A;  3KEV A;  5IBW A;  2IS9 A;  4N1G A;  1LVC D;  2HF5 A;  1IJ6 A;  1QAS A;  1J7Q A;  1GGZ A;  1UUS A;  1UWO A;  1DJI A;  1Y1U A;  1EG3 A;  3PN7 B;  1LA3 A;  2KAY A;  2FCE A;  4YRU A;  1AK8 A;  2PRU A;  4GNK B;  2JXL A;  1YUU A;  2MJW B;  3TS5 B;  3NSK A;  2Y1N A;  1UHJ A;  1GQM A;  1DJW A;  1HQV A;  2KFH A;  3LL8 B;  4PDZ A;  2KI6 C;  1M63 B;  1S6C A;  1XFU O;  1CB1 A;  4F0Z B;  1KK8 C;  1B8L A;  3BQ3 A;  1JBA A;  4NDB A;  1YVH A;  1KK7 Y;  2AMI A;  2CCM A;  2LMT A;  3CR5 X;  3EKJ A;  3I5F C;  1DMO A;  3BUM B;  3DVK A;  1NX2 A;  2JT0 A;  2JOJ A;  3AAK A;  3VRP A;  3OX6 A;  3BUN B;  1K96 A;  2R2I A;  1FI6 A;  2FJU B;  4PAL A;  1J55 A;  1WLM A;  4OKH A;  3NXA A;  4C0J A;  4PCW A;  1JFJ A;  2M1K B;  1QLS A;  5J3X A;  1ZOT B;  2G9B A;  4OCI A;  1JSA A;  2O5G A;  1RK9 A;  1CLM A;  1DJH A;  1BF5 A;  3BUW B;  2M0R A;  1A2X A;  4TNC A;  2F8P A;  2Y5I A;  2K7O A;  1M31 A;  2KFG A;  1YUS A;  1H4B A;  2MAZ A;  5CSI A;  2BEC A;  1A4P A;  3WHU B;  4XJK A;  3AKB A;  1DF0 B;  1GJY A;  2LMV A;  2NLN A;  1J7P A;  1F70 A;  4ZCV A;  5AEQ A;  2JZI A;  1YTZ C;  2L50 A;  1AVS A;  1JF2 A;  1UHH A;  1K2H A;  3CR2 A;  3CS1 A;  4DCK A;  3ZWH A;  4QJ5 B;  1NCY A;  2ZRT A;  1SYM A;  1LA0 A;  2ISD A;  3PM8 A;  3A8R A;  3I5H C;  2KQY A;  3PFV A;  3QRX A;  5CSF A;  3SG3 A;  1EL4 A;  4I5J A;  2GGZ A;  3JTD B;  1J1D A;  2OS8 C;  3EK7 A;  1PSR A;  2NXQ A;  5I8N A;  2MRD A;  1ZMZ A;  1EH2 A;  1KFU L;  4NDC A;  4DIR A;  2EC6 C;  2SAS A;  1XO5 A;  2CXJ A;  4CFR A;  1BJF A;  5KU1 A;  3AAJ A;  3DF0 B;  3NSL A;  2JNF A;  3BUO B;  1XFY O;  4AQJ A;  3CTN A;  3OHM B;  2LVI A;  3SIA A;  3VRQ A;  1WRK A;  3VRR A;  1GGW A;  2ZKM X;  1SCV A;  2KHN A;  3O2P A;  4HRG A;  3GK2 A;  4ORA B;  4PE0 A;  2L98 A;  3PLF B;  1EG4 A;  2BL0 C;  1WRZ A;  3PAL A;  3JVT B;  2FOT A;  1OMD A;  1W7J B;  1N2D A;  1XFX O;  2LLT A;  2KOT A;  1BOD A;  1TOP A;  3I5G B;  1KWO B;  1QJT A;  2KQ6 A;  4MZJ A;  1C07 A;  1CFF A;  4I5N B;  1SKT A;  2SCP A;  2KYC A;  1NWD A;  1B47 A;  2VRG A;  1FF1 A;  1G4Y R;  2L4H A;  4MVF A;  1IQ5 A;  2NCO A;  2LC5 A;  1TCO B;  2KFF A;  4MSP A;  2JWW A;  4XYN A;  4MEW A;  3FWB A;  1VRK A;  3KF9 A;  1A03 A;  1J7O A;  4GUK A;  1NPQ A;  1CM1 A;  2LUC A;  3O4Y A;  1DT7 B;  1IGV A;  4ORB B;  1UUR A;  1F4O A;  1XVJ A;  4QJ4 B;  1CDL A;  2LVV A;  1IQ3 A;  1CFP A;  2H61 A;  2K2A A;  4ORC B;  4YI9 A;  2E30 A;  2JRF A;  4GGF A;  2AUC A;  2WCB A;  2MHH A;  1S26 D;  5AFP A;  1YR5 A;  2K7B A;  2LP3 A;  3HCM A;  4PE1 A;  2E6W A;  2L2E A;  5D69 A;  1KQV A;  4GAO A;  2BCB A;  1TRF A;  2MA2 A;  4HRE E;  2LLU A;  1PSB A;  2QPT A;  3LLE A;  1CDN A;  4AOM A;  1DF0 A;  1XFV O;  1YRT B;  1V1G A;  1CNP A;  1SPY A;  1TIZ A;  5I2O A;  3H4S E;  1K9K A;  1K93 D;  4CFQ A;  1CFD A;  4CLN A;  4MLW A;  1ALW A;  1Y6W A;  1NX0 A;  1BOC A;  1QIV A;  1SCM C;  2CNP A;  2HQ8 A;  1IH0 A;  2BE4 A;  3AKA A;  1OQP A;  1PK0 D;  1R2U A;  1S6J A;  2MLE C;  1QTX A;  2O60 A;  2MBX A;  1HT9 A;  2Y4Q A;  1J1E A;  1S3P A;  3JTD C;  3IF7 A;  2M3W A;  2I18 A;  4HSZ A;  5FYX A;  4DS7 A;  4U8D A;  2A4J A;  1A29 A;  1NSH A;  3SIB A;  1KQM B;  2GGM A;  2M29 A;  1RWY A;  5CSN A;  4BY4 A;  1QLK A;  1QAT A;  1AP4 A;  1S36 A;  1N65 A;  2KI4 B;  4MZL A;  4DRW A;  3DF0 A;  1N0Y A;  1QX7 A;  2JXC A;  1L2O B;  1OOJ A;  4P2Y B;  1WY9 A;  1WDC B;  2LAP A;  5DKR A;  2L0P A;  4YBH B;  1W7I B;  1Y1A A;  2K61 A;  3WHT B;  1F71 A;  4P5O E;  1SBJ A;  1KFX L;  3JVT C;  4GBA A;  4ZCU A;  2MLF C;  3CWG A;  3I5G C;  2WCF A;  1KCY A;  4FTG A;  3WNX B;  3M0W A;  2M97 A;  5F6T A;  1CM4 A;  4FQO A;  1ZFS A;  1SR6 B;  2PSR A;  1K90 D;  1DVI A;  3TUY C;  2LUX A;  1NX3 A;  3I5I B;  4GPL B;  2G2B A;  2Q91 A;  1NP8 A;  1S5G Z;  5KSZ A;  1MXE A;  1CMG A;  3E3R A;  4C0L A;  3DVJ A;  1B9A A;  1SNL A;  4GGN A;  4NQG A;  1B8R A;  2LVK A;  2K8M B;  1K9U A;  1OMR A;  2EGD A;  2KYF A;  2I94 A;  4MBE A;  1U5I A;  3OB1 B;  1QX5 B;  1AJ5 A;  4NDD A;  2HPS A;  3GK1 A;  4GFT A;  3ICB A;  2HQW A;  1SRA A;  1RJV A;  2K7D A;  1AHR A;  1UHK A;  2KAX A;  5I2L A;  4E68 A;  4HRH A;  1XA5 A;  1CDM A;  2LCP A;  2BCA A;  1WRL A;  1A75 B;  3BYA A;  2F2P A;  2L5X B;  2JQ6 A;  1RTP 1;  1NX1 A;  1LKJ A;  1RFJ A;  2KNE A;  1NIW A;  2KBM A;  2M7L A;  3PN7 C;  4OR9 B;  4MRY A;  4WQ3 A;  2JTT A;  1TNX A;  1MXL C;  1UHN A;  4I5K A;  2FCD A;  1ODB A;  4YGB B;  1S6I A;  1IRJ A;  1PRW A;  1F8H A;  5HKW A;  3FIA A;  4QJ3 B;  3TS5 C;  1KK8 B;  1M46 A;  3MSE B;  1B7T Z;  2I2R E;  1DJZ A;  1PVB A;  5G08 A;  1B4C A;  1J7R A;  3I5F B;  2GV5 A;  1DGU A;  3CLN A;  1KQM C;  1PAL A;  3SG6 A;  1UP5 A;  3LK0 A;  1G33 A;  1REC A;  2JC2 A;  2PVB A;  1BT6 A;  2AAO A;  1OE9 B;  1K8U A;  4PE7 A;  3OP0 A;  5GQQ C;  2KI4 C;  2OTG B;  2BKI B;  3SG7 A;  4M2P A;  2PMY A;  5K89 A;  3K21 A;  1WDC C;  1YUR A;  1UHI A;  1C7W A;  3RM1 A;  1MWN A;  1FW4 A;  1ALV A;  1U5I B;  1MQ1 A;  4M2O A;  4WRI A;  3SG5 A;  1CTR A;  2H61 C;  4GGF C;  2L4I A;  2JT8 A;  1EJ3 A;  5AXI A;  2K0J A;  2D8N A;  4IL1 A;  3BOW B;  1BG1 A;  1NYA A;  2COL B;  1NCZ A;  3CGA A;  3CR4 X;  1PVA A;  3D10 A;  1SL9 A;  1B1G A;  1L7Z A;  4M2Q A;  2BCX A;  3EK4 A;  2LE9 B;  4PHN A;  1CLL A;  1Y0V H;  1CDP A;  2HET A;  3TDI A;  1QX2 A;  1XYD A;  3I5H B;  2F3Y A;  1DJG A;  4USL A;  2Y1M A;  1XK4 A;  2NCP A;  1IJ5 A;  1E8A A;  2I7A A;  3SJS A;  2NZ0 A;  2OPO A;  1F4Q A;  1JF0 A;  2H2K A;  2JTZ A;  4CPV A;  3VRN A;  1PUL A;  1YX8 A;  1R6P A;  2V53 A;  1MUX A;  1QXP A;  1M39 A;  1YRU B;  3F45 A;  1BU3 A;  1LXF C;  2F2O A;  4OV2 A;  4C0K A;  3D0Y B;  2K2F A;  2ZRS A;  4CID A;  3VGO A;  1A75 A;  2LV7 A;  3NSI A;  4AQI A;  3A4U B;  1IKU A;  1AJ4 A;  2KAV A;  1OSA A;  1SL8 A;  2ZNE A;  1H8B A;  2BL0 B;  1DGV A;  1OZO A;  3GOF A;  1SY9 A;  1JUO A;  2K7C A;  3BXK A;  1FBV A;  2LMU A;  3SG2 A;  1S1E A;  5JJG A;  4MN0 A;  4I5L B;  5I2Q A;  4YI8 A;  2WC8 A;  1KWO C;  3DVE A;  1FPW A;  1EXR A;  1V1F A;  1ZAC A;  1K95 A;  1KSO A;  1DTL A;  3CZT X;  1BMO A;  5CSJ A;  1XFZ O;  2ZN8 A;  5HKY A;  1TTX A;  2QAC A;  3EVV A;  2OTG C;  2RGI A;  3TDU A;  1QV1 A;  1JC2 A;  1JWD A;  2B1U A;  3O6B A;  1SW8 A;  2LM5 A;  4ICB A;  2BE6 A;  4MZK A;  1NUB A;  2LHL A;  2LNK A;  2DOQ A;  5ER4 X;  2KDH A;  3EVU A;  4PHM A;  1AUI B;  1B8C A;  3EKH A;  3PAT A;  3VRO A;  1IWQ A;  1SMG A;  3ZNI A;  3EK8 A;  5TNC A;  1YUT A;  3IQQ A;  1QV0 A;  4BY5 A;  1TNQ A;  3BOW A;  4JPZ B;  1OZS A;  2JU0 A;  2CT9 A;  1FI5 A;  3KO0 A;  2P6B B;  4WQ2 A;  2JNX A;  2CBL A;  2ZFD A;  3TDZ A;  5JOL A;  2Q4U A;  5AER A;  4A4C A;  3NSO A;  1SCM B;  1OMV A;  2KGB C;  4YGD B;  5AAN A;  2PAS A;  4YGE B;  3DD4 A;  2F33 A;  1RRO A;  1SL7 A;  2M8U A;  2WCE A;  1BR4 B;  1LIN A;  5PAL A;  2LLS A;  5KTY A;  4PHK A;  5DKQ A;  1SK6 D;  4N5X A;  1DJX A;  4OVN F;  1ZUZ A;  1DJY A;  2BKH B;  5DKN A;  4ETO A;  1NCX A;  5HLV A;  2PAL A;  1F54 A;  5HKZ A;  2M9G A;  5B8I B;  1CFC A; 
#chains in the Genus database with same CATH topology
 2M7N A;  4JQ0 D;  1QVI Z;  2JPT A;  2EHB A;  3C1V A;  3SG4 A;  1S5G Y;  1CLB A;  4JKT A;  1YVL A;  3D0Y A;  3RLZ A;  3GK4 X;  2ZND A;  1D1O A;  2ZN9 A;  3OB2 B;  3WXA A;  1L2O C;  1TN4 A;  1TNP A;  2ERB A;  2KBI A;  3HX4 A;  4N1F A;  4L9M A;  1KFX S;  4YGA A;  1TCF A;  1G8I A;  2CTN A;  1Q80 A;  3EVR A;  3S0D A;  1X02 A;  3FWC A;  2KI6 D;  5D7F A;  4PE4 A;  4YGC B;  3FE8 A;  1QIW A;  2WND A;  4DUQ A;  4R1E A;  1CMF A;  1K9P A;  5BPJ A;  2WOR A;  4PHJ A;  5CPV A;  2TN4 A;  1KSM A;  3O78 A;  1M45 A;  3LCP C;  4XJK B;  3DVM A;  3UO9 A;  1BR1 B;  3BUX B;  1GM0 A;  2KPH A;  3TUY B;  5D3O A;  1BLQ A;  1XFW O;  1SR6 C;  1KK7 Z;  5I94 A;  2BBN A;  1WLZ A;  2WOS A;  2F3Z A;  4MRX A;  3FS7 A;  3KPX A;  5ER5 A;  3TZ1 A;  2L51 A;  4UPG A;  1F55 A;  1MR8 A;  3I5I C;  3LK1 A;  2M1U A;  4D1E A;  2JUL A;  1MF8 B;  2QEH A;  3KHE A;  2FJY A;  3S0B A;  2LP2 A;  3PSR A;  1TNW A;  1IG5 A;  1QS7 A;  1K94 A;  2BNX A;  2LHI A;  2M49 B;  1XK4 C;  1JFK A;  1Y1X A;  3OX5 A;  4JWQ A;  1B7T Y;  2OS8 B;  1C7V A;  2KSP A;  3D78 A;  5HLO A;  4A4B A;  2JT3 A;  1CKK A;  5HYD A;  1MHO A;  2BBM A;  3EG5 B;  4Q04 A;  1KFU S;  1QVI Y;  2EC6 B;  1YX7 A;  3D73 A;  2LAN A;  3IQO A;  4FQT A;  2LVJ A;  3S0G A;  2KGR A;  3KEV A;  5IBW A;  2IS9 A;  4N1G A;  1LVC D;  2HF5 A;  1IJ6 A;  1QAS A;  1J7Q A;  1GGZ A;  1UUS A;  1UWO A;  3D77 A;  1DJI A;  3UNW A;  3NGV A;  1Y1U A;  1EG3 A;  3DXL A;  1TUJ A;  3PN7 B;  1LA3 A;  2KAY A;  2FCE A;  3NHI A;  4YRU A;  5FI2 A;  1AK8 A;  2PRU A;  4GNK B;  1Z2C B;  2JXL A;  1YUU A;  2MJW B;  3TS5 B;  2PYQ A;  2Y1N A;  1UHJ A;  1DJW A;  1GQM A;  1HQV A;  2KFH A;  2P70 A;  3LL8 B;  2KI6 C;  3OBV A;  4PDZ A;  1M63 B;  1S6C A;  1XFU O;  1CB1 A;  4F0Z B;  1KK8 C;  1B8L A;  3BQ3 A;  1JBA A;  4NDB A;  1YVH A;  1KK7 Y;  2AMI A;  2CCM A;  2LMT A;  3CR5 X;  3EKJ A;  3B7A A;  3I5F C;  1DMO A;  3BUM B;  3DVK A;  1NX2 A;  2JT0 A;  2JOJ A;  3AAK A;  3VRP A;  5DIC A;  3OX6 A;  3BUN B;  3L47 A;  1K96 A;  2R2I A;  1FI6 A;  2FJU B;  4PAL A;  1J55 A;  1WLM A;  4OKH A;  3NXA A;  4C0J A;  4PCW A;  1JFJ A;  2M1K B;  1QLS A;  2QEO A;  5J3X A;  1ZOT B;  5HL1 A;  2G9B A;  4OCI A;  1JSA A;  2O5G A;  1RK9 A;  1CLM A;  1DJH A;  1BF5 A;  1OW4 A;  3BUW B;  2M0R A;  1A2X A;  4TNC A;  2F8P A;  2Y5I A;  2K7O A;  1M31 A;  2KFG A;  1YUS A;  1H4B A;  2MAZ A;  5CSI A;  1A4P A;  2BEC A;  3WHU B;  3S0E A;  1TWO A;  4XJK A;  3AKB A;  1DF0 B;  1GJY A;  2LMV A;  2NLN A;  3BFA A;  1J7P A;  1F70 A;  4ZCV A;  5AEQ A;  2JZI A;  1C3Z A;  1YTZ C;  2L50 A;  3PM2 A;  1AVS A;  1JF2 A;  1UHH A;  1K2H A;  3CR2 A;  3CS1 A;  3V2L A;  4DCK A;  3ZWH A;  4QJ5 B;  1NCY A;  2ZRT A;  1SYM A;  1LA0 A;  2ISD A;  2WC6 A;  3A8R A;  3PM8 A;  3I5H C;  2KQY A;  3BFH A;  3PFV A;  3QRX A;  5CSF A;  1EL4 A;  4I5J A;  3SS3 A;  3SG3 A;  2GGZ A;  3JTD B;  1J1D A;  2OS8 C;  3EK7 A;  3B87 A;  1PSR A;  2NXQ A;  5I8N A;  2MRD A;  1ZMZ A;  1EH2 A;  1KFU L;  4NDC A;  4DIR A;  2EC6 C;  2SAS A;  1TUZ A;  1XO5 A;  2CXJ A;  4CFR A;  1BJF A;  5KU1 A;  3AAJ A;  3D74 A;  3DF0 B;  3NSL A;  2JNF A;  3BUO B;  1XFY O;  4AQJ A;  3CTN A;  3OHM B;  2LVI A;  3SIA A;  3VRQ A;  1WRK A;  3VRR A;  1GGW A;  2ZKM X;  1SCV A;  2KHN A;  3O2P A;  4HRG A;  3GK2 A;  4ORA B;  4PE0 A;  2L98 A;  3PLF B;  3B86 A;  1EG4 A;  2BL0 C;  1WRZ A;  3PAL A;  3JVT B;  2FOT A;  1OMD A;  1W7J B;  1N2D A;  1XFX O;  2LLT A;  2KOT A;  3FE6 A;  1TOP A;  3SS5 A;  3DZT A;  3I5G B;  1KWO B;  1BOD A;  1QJT A;  2KQ6 A;  4MZJ A;  5FI6 A;  1C07 A;  1CFF A;  4I5N B;  1SKT A;  2SCP A;  2KYC A;  1NWD A;  1B47 A;  2VRG A;  3L4L A;  1C3Y A;  5FI7 A;  1FF1 A;  3L4A A;  1G4Y R;  2L4H A;  4MVF A;  1IQ5 A;  2NCO A;  2LC5 A;  2H8V A;  1TCO B;  2KFF A;  4MSP A;  2JWW A;  2WCM A;  4MEW A;  3FWB A;  4XYN A;  1VRK A;  3KF9 A;  1A03 A;  1J7O A;  4GUK A;  1OOI X;  1NPQ A;  1CM1 A;  2LUC A;  3O4Y A;  1DT7 B;  1IGV A;  4ORB B;  1UUR A;  1F4O A;  1XVJ A;  4QJ4 B;  1CDL A;  2LVV A;  1IQ3 A;  1CFP A;  2H61 A;  2K2A A;  4ORC B;  4YI9 A;  2E30 A;  2JRF A;  4GGF A;  2AUC A;  2WCB A;  2MHH A;  3B88 A;  1S26 D;  5AFP A;  1YR5 A;  2K7B A;  2LP3 A;  3HCM A;  3B6X A;  4PE1 A;  3QME A;  2E6W A;  2L2E A;  3PJI A;  5D69 A;  1KQV A;  4GAO A;  2BCB A;  4KYN A;  1TRF A;  2MA2 A;  4HRE E;  2LLU A;  1PSB A;  1OOF A;  2QPT A;  3LLE A;  4AOM A;  1CDN A;  1DF0 A;  1XFV O;  1YRT B;  1V1G A;  1CNP A;  1SPY A;  1TIZ A;  5I2O A;  3CZ0 A;  3H4S E;  2KLE A;  1K9K A;  1K93 D;  4CFQ A;  1CFD A;  4CLN A;  1QWV A;  1ALW A;  4MLW A;  1Y6W A;  1NX0 A;  1XFR A;  3N7H A;  1BOC A;  1QIV A;  1SCM C;  2CNP A;  2HQ8 A;  1IH0 A;  2BE4 A;  3AKA A;  1OQP A;  1PK0 D;  1R2U A;  2GTE A;  1S6J A;  2MLE C;  1QTX A;  2O60 A;  2MBX A;  1HT9 A;  2Y4Q A;  1J1E A;  1S3P A;  2P71 A;  3JTD C;  3IF7 A;  4F7F A;  2M3W A;  2I18 A;  4HSZ A;  5FYX A;  4DS7 A;  2WC5 A;  4U8D A;  2A4J A;  1A29 A;  1NSH A;  3SIB A;  1KQM B;  2GGM A;  2M29 A;  1RWY A;  5CSN A;  4BY4 A;  1QLK A;  1QAT A;  1AP4 A;  1S36 A;  1N65 A;  2KI4 B;  4MZL A;  4DRW A;  3DF0 A;  1N0Y A;  1QX7 A;  2JXC A;  1L2O B;  1OOJ A;  4P2Y B;  1WY9 A;  3VB1 A;  1WDC B;  2LAP A;  5DKR A;  2L0P A;  2QDI A;  4YBH B;  1W7I B;  1Y1A A;  2K61 A;  3WHT B;  1F71 A;  4P5O E;  1SBJ A;  3S0A A;  1KFX L;  3DYE A;  3JVT C;  4GBA A;  4ZCU A;  2MLF C;  3CWG A;  3I5G C;  2WCF A;  4IJ7 A;  1KCY A;  4FTG A;  3WNX B;  3M0W A;  2M97 A;  5F6T A;  1CM4 A;  4FQO A;  1ZFS A;  1SR6 B;  2PSR A;  1K90 D;  1DVI A;  3S0F A;  3TUY C;  1T14 A;  2LUX A;  1NX3 A;  3I5I B;  4GPL B;  2G2B A;  2Q91 A;  1NP8 A;  1S5G Z;  3NSK A;  1MXE A;  5KSZ A;  1CMG A;  3E3R A;  4C0L A;  3DVJ A;  3Q8I A;  1B9A A;  1SNL A;  4GGN A;  4NQG A;  1B8R A;  2LVK A;  2K8M B;  1K9U A;  1OMR A;  2EGD A;  2KYF A;  2I94 A;  3NHT A;  4MBE A;  1U5I A;  3OB1 B;  3R1P A;  1QX5 B;  1AJ5 A;  4NDD A;  1W9Z A;  2HPS A;  3R72 A;  3GK1 A;  4GFT A;  3ICB A;  2HQW A;  2WCL A;  1SRA A;  1ORG A;  4OZD A;  1RJV A;  2K7D A;  1AHR A;  1DC1 A;  1UHK A;  2KAX A;  5I2L A;  4E68 A;  4HRH A;  1XA5 A;  1CDM A;  2LCP A;  2BCA A;  3R1V A;  1WRL A;  3BJH A;  1A75 B;  3BYA A;  2F2P A;  2L5X B;  2JQ6 A;  3R1O A;  1RTP 1;  1NX1 A;  1LKJ A;  1RFJ A;  2KNE A;  1NIW A;  2KBM A;  2M7L A;  3PN7 C;  4OR9 B;  4MRY A;  4WQ3 A;  2JTT A;  1TNX A;  1MXL C;  1UHN A;  4I5K A;  2FCD A;  1ODB A;  4YGB B;  1S6I A;  1IRJ A;  1PRW A;  1F8H A;  5HKW A;  3CAB A;  3FIA A;  4QJ3 B;  3TS5 C;  3IVT A;  1KK8 B;  1M46 A;  3MSE B;  1B7T Z;  2I2R E;  1DJZ A;  1PVB A;  5G08 A;  1B4C A;  1DEL A;  1J7R A;  1DQE A;  3I5F B;  2GV5 A;  1DGU A;  3CLN A;  1KQM C;  1PAL A;  3SG6 A;  1UP5 A;  3LK0 A;  1G33 A;  1REC A;  2JC2 A;  2PVB A;  1BT6 A;  2AAO A;  1OE9 B;  1K8U A;  4PE7 A;  3OP0 A;  5GQQ C;  2KI4 C;  1OOH A;  2OTG B;  2BKI B;  3SG7 A;  4INW A;  4M2P A;  2PMY A;  5K89 A;  3K21 A;  1WDC C;  3CZ1 A;  1YUR A;  5EL2 A;  1UHI A;  1C7W A;  3RM1 A;  1MWN A;  1FW4 A;  1ALV A;  1U5I B;  1MQ1 A;  2KLD A;  4M2O A;  4WRI A;  3SG5 A;  1CTR A;  2H61 C;  4GGF C;  2L4I A;  2JT8 A;  1EJ3 A;  1LS8 A;  3D75 A;  5AXI A;  3CZ2 A;  2K0J A;  2L2C A;  2D8N A;  4IL1 A;  2WCK A;  3BOW B;  1BG1 A;  1NYA A;  2COL B;  1NCZ A;  3CGA A;  3CR4 X;  1PVA A;  3D10 A;  1SL9 A;  1B1G A;  1L7Z A;  4M2Q A;  2BCX A;  2BAP A;  3EK4 A;  2LE9 B;  4PHN A;  1CLL A;  1Y0V H;  1CDP A;  2HET A;  3TDI A;  1QX2 A;  1XYD A;  3I5H B;  2F3Y A;  1DJG A;  1OOG A;  4USL A;  2Y1M A;  1XK4 A;  2NCP A;  1IJ5 A;  1E8A A;  2I7A A;  3DY9 A;  2NZ0 A;  3SJS A;  2OPO A;  1F4Q A;  1JF0 A;  2H2K A;  2JTZ A;  4CPV A;  3FE9 A;  3VRN A;  1PUL A;  1YX8 A;  1R6P A;  2V53 A;  1MUX A;  1QXP A;  1M39 A;  1YRU B;  2QEV A;  1BU3 A;  1LXF C;  2F2O A;  3F45 A;  4OV2 A;  4C0K A;  2JPO A;  3D0Y B;  2K2F A;  2ZRS A;  2WCH A;  4CID A;  2K60 A;  3VGO A;  1A75 A;  1IIO A;  2LV7 A;  3NSI A;  4AQI A;  3A4U B;  1DEK A;  1IKU A;  1AJ4 A;  2KAV A;  1OSA A;  1SL8 A;  2ZNE A;  3CYZ A;  3O4X A;  1H8B A;  2BL0 B;  1DGV A;  1OZO A;  2PQL A;  1SY9 A;  1JUO A;  3GOF A;  2K7C A;  2QEB A;  3BXK A;  1FBV A;  2LMU A;  3SG2 A;  3RZS A;  1S1E A;  5JJG A;  4MN0 A;  4I5L B;  5I2Q A;  4YI8 A;  2WC8 A;  1KWO C;  3DVE A;  1FPW A;  1EXR A;  1V1F A;  1ZAC A;  1K95 A;  1KSO A;  1DTL A;  3CZT X;  1BMO A;  5CSJ A;  2WCJ A;  1XFZ O;  2ZN8 A;  4JD9 A;  5HKY A;  1TTX A;  2QAC A;  3EVV A;  2OTG C;  2RGI A;  3TDU A;  1QV1 A;  3CDN A;  1JC2 A;  1P28 A;  1JWD A;  2B1U A;  3O6B A;  3SS4 A;  1SW8 A;  2LM5 A;  3OGN A;  4ICB A;  2BE6 A;  4MZK A;  1NUB A;  2LHL A;  2LNK A;  2DOQ A;  5ER4 X;  1Z4H A;  2KDH A;  3EVU A;  4PHM A;  1AUI B;  1B8C A;  3EKH A;  3PAT A;  3VRO A;  1IWQ A;  1SMG A;  3ZNI A;  1SSE B;  3EK8 A;  5TNC A;  1YUT A;  3IQQ A;  1QV0 A;  4BY5 A;  4PT1 A;  1TNQ A;  2L5Y A;  3BOW A;  4JPZ B;  1OZS A;  2JU0 A;  2CT9 A;  3D76 A;  3KO0 A;  2P6B B;  1FI5 A;  4WQ2 A;  2JNX A;  2CBL A;  2YGU A;  2ZFD A;  3TDZ A;  5JOL A;  3K1E A;  2Q4U A;  5AER A;  3BFB A;  3NSO A;  1SCM B;  1OMV A;  2KGB C;  4YGD B;  5AAN A;  2PAS A;  4A4C A;  4YGE B;  3DD4 A;  2F33 A;  1RRO A;  1SL7 A;  2M8U A;  2WCE A;  1BR4 B;  1LIN A;  5PAL A;  2LLS A;  5KTY A;  4PHK A;  5DKQ A;  1SK6 D;  4N5X A;  1DJX A;  4OVN F;  1ZUZ A;  1DJY A;  2BKH B;  4INX A;  5DKN A;  1NCX A;  4ETO A;  5HLV A;  2PAL A;  1F54 A;  5HKZ A;  2M9G A;  5B8I B;  1CFC A; 
#chains in the Genus database with same CATH homology
 2M7N A;  4JQ0 D;  1QVI Z;  2JPT A;  2EHB A;  3C1V A;  3SG4 A;  1S5G Y;  1CLB A;  1YVL A;  3D0Y A;  3RLZ A;  3GK4 X;  2ZND A;  1D1O A;  2ZN9 A;  3OB2 B;  3WXA A;  1L2O C;  1TN4 A;  1TNP A;  2KBI A;  3HX4 A;  4N1F A;  4L9M A;  1KFX S;  4YGA A;  1TCF A;  1G8I A;  2CTN A;  1Q80 A;  3EVR A;  1X02 A;  3FWC A;  2KI6 D;  5D7F A;  4PE4 A;  4YGC B;  1QIW A;  2WND A;  4DUQ A;  4R1E A;  1CMF A;  1K9P A;  5BPJ A;  2WOR A;  4PHJ A;  5CPV A;  2TN4 A;  1KSM A;  3O78 A;  1M45 A;  3LCP C;  4XJK B;  3DVM A;  1BR1 B;  3BUX B;  3TUY B;  1BLQ A;  1XFW O;  1SR6 C;  1KK7 Z;  2BBN A;  1WLZ A;  2WOS A;  2F3Z A;  4MRX A;  3FS7 A;  3KPX A;  5ER5 A;  3TZ1 A;  2L51 A;  4UPG A;  1F55 A;  1MR8 A;  3I5I C;  3LK1 A;  2M1U A;  4D1E A;  2JUL A;  1MF8 B;  3KHE A;  2LP2 A;  3PSR A;  1TNW A;  1IG5 A;  1QS7 A;  1K94 A;  2M49 B;  2LHI A;  1XK4 C;  1JFK A;  1Y1X A;  3OX5 A;  4JWQ A;  1B7T Y;  2OS8 B;  1C7V A;  2KSP A;  5HLO A;  4A4B A;  2JT3 A;  1CKK A;  5HYD A;  1MHO A;  2BBM A;  4Q04 A;  1KFU S;  1QVI Y;  2EC6 B;  1YX7 A;  2LAN A;  3IQO A;  2LVJ A;  2KGR A;  3KEV A;  5IBW A;  2IS9 A;  4N1G A;  1LVC D;  2HF5 A;  1IJ6 A;  1QAS A;  1J7Q A;  1GGZ A;  1UUS A;  1UWO A;  1DJI A;  1Y1U A;  1EG3 A;  3PN7 B;  1LA3 A;  2KAY A;  2FCE A;  4YRU A;  1AK8 A;  2PRU A;  4GNK B;  2JXL A;  1YUU A;  2MJW B;  3TS5 B;  3NSK A;  2Y1N A;  1UHJ A;  1GQM A;  1DJW A;  1HQV A;  2KFH A;  3LL8 B;  4PDZ A;  2KI6 C;  1M63 B;  1S6C A;  1XFU O;  1CB1 A;  4F0Z B;  1KK8 C;  1B8L A;  3BQ3 A;  1JBA A;  4NDB A;  1YVH A;  1KK7 Y;  2AMI A;  2CCM A;  2LMT A;  3CR5 X;  3EKJ A;  3I5F C;  1DMO A;  3BUM B;  3DVK A;  1NX2 A;  2JT0 A;  2JOJ A;  3AAK A;  3VRP A;  3OX6 A;  3BUN B;  1K96 A;  2R2I A;  1FI6 A;  2FJU B;  4PAL A;  1J55 A;  1WLM A;  4OKH A;  3NXA A;  4C0J A;  4PCW A;  1JFJ A;  2M1K B;  1QLS A;  5J3X A;  1ZOT B;  2G9B A;  4OCI A;  1JSA A;  2O5G A;  1RK9 A;  1CLM A;  1DJH A;  1BF5 A;  3BUW B;  2M0R A;  1A2X A;  4TNC A;  2F8P A;  2Y5I A;  2K7O A;  1M31 A;  2KFG A;  1YUS A;  1H4B A;  2MAZ A;  5CSI A;  2BEC A;  1A4P A;  3WHU B;  4XJK A;  3AKB A;  1DF0 B;  1GJY A;  2LMV A;  2NLN A;  1J7P A;  1F70 A;  4ZCV A;  5AEQ A;  2JZI A;  1YTZ C;  2L50 A;  1AVS A;  1JF2 A;  1UHH A;  1K2H A;  3CR2 A;  3CS1 A;  4DCK A;  3ZWH A;  4QJ5 B;  1NCY A;  2ZRT A;  1SYM A;  1LA0 A;  2ISD A;  3PM8 A;  3A8R A;  3I5H C;  2KQY A;  3PFV A;  3QRX A;  5CSF A;  3SG3 A;  1EL4 A;  4I5J A;  2GGZ A;  3JTD B;  1J1D A;  2OS8 C;  3EK7 A;  1PSR A;  2NXQ A;  5I8N A;  2MRD A;  1ZMZ A;  1EH2 A;  1KFU L;  4NDC A;  4DIR A;  2EC6 C;  2SAS A;  1XO5 A;  2CXJ A;  4CFR A;  1BJF A;  5KU1 A;  3AAJ A;  3DF0 B;  3NSL A;  2JNF A;  3BUO B;  1XFY O;  4AQJ A;  3CTN A;  3OHM B;  2LVI A;  3SIA A;  3VRQ A;  1WRK A;  3VRR A;  1GGW A;  2ZKM X;  1SCV A;  2KHN A;  3O2P A;  4HRG A;  3GK2 A;  4ORA B;  4PE0 A;  2L98 A;  3PLF B;  1EG4 A;  2BL0 C;  1WRZ A;  3PAL A;  3JVT B;  2FOT A;  1OMD A;  1W7J B;  1N2D A;  1XFX O;  2LLT A;  2KOT A;  1BOD A;  1TOP A;  3I5G B;  1KWO B;  1QJT A;  2KQ6 A;  4MZJ A;  1C07 A;  1CFF A;  4I5N B;  1SKT A;  2SCP A;  2KYC A;  1NWD A;  1B47 A;  2VRG A;  1FF1 A;  1G4Y R;  2L4H A;  4MVF A;  1IQ5 A;  2NCO A;  2LC5 A;  1TCO B;  2KFF A;  4MSP A;  2JWW A;  4XYN A;  4MEW A;  3FWB A;  1VRK A;  3KF9 A;  1A03 A;  1J7O A;  4GUK A;  1NPQ A;  1CM1 A;  2LUC A;  3O4Y A;  1DT7 B;  1IGV A;  4ORB B;  1UUR A;  1F4O A;  1XVJ A;  4QJ4 B;  1CDL A;  2LVV A;  1IQ3 A;  1CFP A;  2H61 A;  2K2A A;  4ORC B;  4YI9 A;  2E30 A;  2JRF A;  4GGF A;  2AUC A;  2WCB A;  2MHH A;  1S26 D;  5AFP A;  1YR5 A;  2K7B A;  2LP3 A;  3HCM A;  4PE1 A;  2E6W A;  2L2E A;  5D69 A;  1KQV A;  4GAO A;  2BCB A;  1TRF A;  2MA2 A;  4HRE E;  2LLU A;  1PSB A;  2QPT A;  3LLE A;  1CDN A;  4AOM A;  1DF0 A;  1XFV O;  1YRT B;  1V1G A;  1CNP A;  1SPY A;  1TIZ A;  5I2O A;  3H4S E;  1K9K A;  1K93 D;  4CFQ A;  1CFD A;  4CLN A;  4MLW A;  1ALW A;  1Y6W A;  1NX0 A;  1BOC A;  1QIV A;  1SCM C;  2CNP A;  2HQ8 A;  1IH0 A;  2BE4 A;  3AKA A;  1OQP A;  1PK0 D;  1R2U A;  1S6J A;  2MLE C;  1QTX A;  2O60 A;  2MBX A;  1HT9 A;  2Y4Q A;  1J1E A;  1S3P A;  3JTD C;  3IF7 A;  2M3W A;  2I18 A;  4HSZ A;  5FYX A;  4DS7 A;  4U8D A;  2A4J A;  1A29 A;  1NSH A;  3SIB A;  1KQM B;  2GGM A;  2M29 A;  1RWY A;  5CSN A;  4BY4 A;  1QLK A;  1QAT A;  1AP4 A;  1S36 A;  1N65 A;  2KI4 B;  4MZL A;  4DRW A;  3DF0 A;  1N0Y A;  1QX7 A;  2JXC A;  1L2O B;  1OOJ A;  4P2Y B;  1WY9 A;  1WDC B;  2LAP A;  5DKR A;  2L0P A;  4YBH B;  1W7I B;  1Y1A A;  2K61 A;  3WHT B;  1F71 A;  4P5O E;  1SBJ A;  1KFX L;  3JVT C;  4GBA A;  4ZCU A;  2MLF C;  3CWG A;  3I5G C;  2WCF A;  1KCY A;  4FTG A;  3WNX B;  3M0W A;  2M97 A;  5F6T A;  1CM4 A;  4FQO A;  1ZFS A;  1SR6 B;  2PSR A;  1K90 D;  1DVI A;  3TUY C;  2LUX A;  1NX3 A;  3I5I B;  4GPL B;  2G2B A;  2Q91 A;  1NP8 A;  1S5G Z;  5KSZ A;  1MXE A;  1CMG A;  3E3R A;  4C0L A;  3DVJ A;  1B9A A;  1SNL A;  4GGN A;  4NQG A;  1B8R A;  2LVK A;  2K8M B;  1K9U A;  1OMR A;  2EGD A;  2KYF A;  2I94 A;  4MBE A;  1U5I A;  3OB1 B;  1QX5 B;  1AJ5 A;  4NDD A;  2HPS A;  3GK1 A;  4GFT A;  3ICB A;  2HQW A;  1SRA A;  1RJV A;  2K7D A;  1AHR A;  1UHK A;  2KAX A;  5I2L A;  4E68 A;  4HRH A;  1XA5 A;  1CDM A;  2LCP A;  2BCA A;  1WRL A;  1A75 B;  3BYA A;  2F2P A;  2L5X B;  2JQ6 A;  1RTP 1;  1NX1 A;  1LKJ A;  1RFJ A;  2KNE A;  1NIW A;  2KBM A;  2M7L A;  3PN7 C;  4OR9 B;  4MRY A;  4WQ3 A;  2JTT A;  1TNX A;  1MXL C;  1UHN A;  4I5K A;  2FCD A;  1ODB A;  4YGB B;  1S6I A;  1IRJ A;  1PRW A;  1F8H A;  5HKW A;  3FIA A;  4QJ3 B;  3TS5 C;  1KK8 B;  1M46 A;  3MSE B;  1B7T Z;  2I2R E;  1DJZ A;  1PVB A;  5G08 A;  1B4C A;  1J7R A;  3I5F B;  2GV5 A;  1DGU A;  3CLN A;  1KQM C;  1PAL A;  3SG6 A;  1UP5 A;  3LK0 A;  1G33 A;  1REC A;  2JC2 A;  2PVB A;  1BT6 A;  2AAO A;  1OE9 B;  1K8U A;  4PE7 A;  3OP0 A;  5GQQ C;  2KI4 C;  2OTG B;  2BKI B;  3SG7 A;  4M2P A;  2PMY A;  5K89 A;  3K21 A;  1WDC C;  1YUR A;  1UHI A;  1C7W A;  3RM1 A;  1MWN A;  1FW4 A;  1ALV A;  1U5I B;  1MQ1 A;  4M2O A;  4WRI A;  3SG5 A;  1CTR A;  2H61 C;  4GGF C;  2L4I A;  2JT8 A;  1EJ3 A;  5AXI A;  2K0J A;  2D8N A;  4IL1 A;  3BOW B;  1BG1 A;  1NYA A;  2COL B;  1NCZ A;  3CGA A;  3CR4 X;  1PVA A;  3D10 A;  1SL9 A;  1B1G A;  1L7Z A;  4M2Q A;  2BCX A;  3EK4 A;  2LE9 B;  4PHN A;  1CLL A;  1Y0V H;  1CDP A;  2HET A;  3TDI A;  1QX2 A;  1XYD A;  3I5H B;  2F3Y A;  1DJG A;  4USL A;  2Y1M A;  1XK4 A;  2NCP A;  1IJ5 A;  1E8A A;  2I7A A;  3SJS A;  2NZ0 A;  2OPO A;  1F4Q A;  1JF0 A;  2H2K A;  2JTZ A;  4CPV A;  3VRN A;  1PUL A;  1YX8 A;  1R6P A;  2V53 A;  1MUX A;  1QXP A;  1M39 A;  1YRU B;  3F45 A;  1BU3 A;  1LXF C;  2F2O A;  4OV2 A;  4C0K A;  3D0Y B;  2K2F A;  2ZRS A;  4CID A;  3VGO A;  1A75 A;  2LV7 A;  3NSI A;  4AQI A;  3A4U B;  1IKU A;  1AJ4 A;  2KAV A;  1OSA A;  1SL8 A;  2ZNE A;  1H8B A;  2BL0 B;  1DGV A;  1OZO A;  3GOF A;  1SY9 A;  1JUO A;  2K7C A;  3BXK A;  1FBV A;  2LMU A;  3SG2 A;  1S1E A;  5JJG A;  4MN0 A;  4I5L B;  5I2Q A;  4YI8 A;  2WC8 A;  1KWO C;  3DVE A;  1FPW A;  1EXR A;  1V1F A;  1ZAC A;  1K95 A;  1KSO A;  1DTL A;  3CZT X;  1BMO A;  5CSJ A;  1XFZ O;  2ZN8 A;  5HKY A;  1TTX A;  2QAC A;  3EVV A;  2OTG C;  2RGI A;  3TDU A;  1QV1 A;  1JC2 A;  1JWD A;  2B1U A;  3O6B A;  1SW8 A;  2LM5 A;  4ICB A;  2BE6 A;  4MZK A;  1NUB A;  2LHL A;  2LNK A;  2DOQ A;  5ER4 X;  2KDH A;  3EVU A;  4PHM A;  1AUI B;  1B8C A;  3EKH A;  3PAT A;  3VRO A;  1IWQ A;  1SMG A;  3ZNI A;  3EK8 A;  5TNC A;  1YUT A;  3IQQ A;  1QV0 A;  4BY5 A;  1TNQ A;  3BOW A;  4JPZ B;  1OZS A;  2JU0 A;  2CT9 A;  1FI5 A;  3KO0 A;  2P6B B;  4WQ2 A;  2JNX A;  2CBL A;  2ZFD A;  3TDZ A;  5JOL A;  2Q4U A;  5AER A;  4A4C A;  3NSO A;  1SCM B;  1OMV A;  2KGB C;  4YGD B;  5AAN A;  2PAS A;  4YGE B;  3DD4 A;  2F33 A;  1RRO A;  1SL7 A;  2M8U A;  2WCE A;  1BR4 B;  1LIN A;  5PAL A;  2LLS A;  5KTY A;  4PHK A;  5DKQ A;  1SK6 D;  4N5X A;  1DJX A;  4OVN F;  1ZUZ A;  1DJY A;  2BKH B;  5DKN A;  4ETO A;  1NCX A;  5HLV A;  2PAL A;  1F54 A;  5HKZ A;  2M9G A;  5B8I B;  1CFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...