1BT6A

P11 (s100a10), ligand of annexin ii in complex with annexin ii n-terminus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (ligand/annexin)
molecule keywords S100A10
publication title The crystal structure of a complex of p11 with the annexin II N-terminal peptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bt6A00
3EVRA 1DTLA 4D1EA 3DF0B 2BECA 1XFVO 1N0YA 2LE9B 1XFYO 1J55A 2I2RE 2LUXA 1B8CA 1QJTA 2M1KB 1V1GA 3IF7A 2JT8A 1JSAA 1LKJA 5B8IB 1GGWA 1SL9A 3SIBA 1KWOB 2LC5A 2NCPA 2LVVA 1NPQA 3QRXA 4R1EA 5KTYA 1G8IA 4CFRA 3FIAA 3CTNA 2Y1NA 1CNPA 4GGFC 4MVFA 1B7TY 2KNEA 2LUCA 2PASA 2KI4C 4MZLA 1N65A 5JJGA 3DVMA 1JF2A 1HQVA 1VRKA 1CDMA 3I5FB 1M45A 4MLWA 2MRDA 5J3XA 1YR5A 4AOMA 4MN0A 3PN7B 2EC6C 5CSJA 3D10A 4AQJA 1CMFA 4HREE 2JXLA 1F54A 1UHNA 3BUWB 1OE9B 4MRXA 1S5GZ 1EL4A 1PVBA 2Y5IA 2KQ6A 1KQVA 2KFFA 3SG4A 1BT6A 2LLTA 1YX7A 2JXCA 2P6BB 3HCMA 1BG1A 4ZCUA 1F4QA 5ER5A 1KK8C 1IJ5A 1TNXA 1RTP1 3D0YA 5K89A 1J7PA 2K7DA 4L9MA 3LCPC 3EKJA 2WC8A 3SJSA 1PVAA 3BXKA 2JPTA 1SY9A 3EKHA 5DKNA 1JFKA 1S26D 4ICBA 4MZJA 3SG2A 1AUIB 1DJGA 2K2FA 1UUSA 1XA5A 5F6TA 1CMGA 3ZNIA 1NIWA 2NLNA 1PK0D 2KI6C 5HKWA 2F8PA 1Q80A 2AUCA 2WCEA 3GOFA 1CFDA 4PE7A 4ORBB 1NWDA 2M1UA 1AJ4A 1CLLA 1D1OA 1OZSA 3OX5A 1ZOTB 1L2OC 2A4JA 1BR1B 2WOSA 4MEWA 4Q04A 1PSBA 1LA0A 1SNLA 2MHHA 2BBNA 1M46A 1QTXA 5JOLA 1TIZA 2CT9A 2BKIB 4MBEA 1BLQA 4WQ3A 2RGIA 2GGMA 4YGCB 1CDNA 1KFXL 4I5LB 4OKHA 1RECA 1SCMC 2JNXA 2KYFA 2LMTA 1SK6D 3TS5B 5AANA 1SL7A 2LANA 3PM8A 3JTDC 4BY5A 4M2QA 5HLOA 3VROA 3I5HC 1N2DA 2M8UA 1QXPA 1A2XA 1ZUZA 4HSZA 2PSRA 1C7WA 3DVEA 1MXLC 4HRHA 1WY9A 3BQ3A 1K90D 3LL8B 3LK1A 1C7VA 1QVIZ 1TTXA 3TZ1A 1KSOA 4HRGA 1B9AA 4PHMA 1KFUL 1XK4C 4YGAA 2MBXA 3OHMB 4CIDA 2M9GA 2MJWB 2JWWA 2ISDA 3A4UB 1IKUA 1DMOA 2PALA 1CFPA 3KF9A 1IRJA 2FCDA 2JT0A 1A03A 4N5XA 3CR5X 2LMUA 1KQMB 1SBJA 2HQWA 4AQIA 1FI6A 1KK7Z 3OX6A 1RFJA 2K2AA 5HYDA 3ICBA 1IG5A 2L51A 2CCMA 3BUMB 5GQQC 3AAJA 1NYAA 2ZNEA 3C1VA 2LMVA 2FJUB 1A75B 1MWNA 2ZRTA 2ZRSA 1NX2A 3FS7A 2K8MB 1XVJA 2PMYA 1KWOC 2O5GA 3NSOA 1H8BA 3BUOB 1ZMZA 1U5IB 1S5GY 1B8LA 2WNDA 1G33A 5D7FA 2L5XB 4WRIA 2B1UA 2Q4UA 2ZFDA 1Y1AA 4A4CA 4NDBA 1KSMA 1OZOA 4FQOA 1X02A 2I18A 1QX2A 1F4OA 2GGZA 2KSPA 2ZN8A 2FOTA 1K96A 3WNXB 3TDUA 4PALA 1MR8A 2JNFA 2SASA 3VRQA 4NQGA 2TN4A 4QJ3B 2LLSA 2OS8B 1HT9A 2WCBA 4JQ0D 3VRNA 3EK7A 4BY4A 5AFPA 2BBMA 3O78A 1AVSA 2BE4A 2JULA 2MA2A 1C07A 4MSPA 3TDZA 1AHRA 1EXRA 4PHNA 1TOPA 1ZFSA 2I94A 1DJZA 2QPTA 1DJIA 3I5IB 3NSKA 3TUYB 1LINA 2R2IA 1M63B 3RLZA 1S36A 2M97A 4M2PA 1B1GA 3BUXB 2F3YA 4P5OE 3CWGA 1XFXO 5I2OA 2Y1MA 1CM4A 1IJ6A 4F0ZB 5TNCA 1SMGA 1ALWA 1PRWA 2L0PA 2KGBC 2KBMA 1NCYA 1NCZA 1QIVA 4PHJA 1JFJA 3VGOA 1CFCA 1CKKA 4XYNA 3A8RA 1PULA 3O2PA 1YX8A 3PSRA 3MSEB 1UHIA 3EVVA 2L4IA 4USLA 3WXAA 2CTNA 4GGFA 1PALA 1RK9A 2QACA 4JPZB 4ZCVA 2G2BA 1OMDA 4NDDA 3SG6A 1UWOA 2G9BA 1W7JB 3HX4A 2HQ8A 1QVIY 5KSZA 1YUUA 4C0KA 2PRUA 2KDHA 2BCAA 1J1DA 1Y6WA 2KAYA 2BE6A 4XJKA 2KAXA 1IWQA 2CNPA 2KI6D 5KU1A 1LVCD 3GK2A 3BUNB 3D0YB 1ODBA 1QATA 1J7QA 4OCIA 1NX1A 1KK7Y 4E68A 4GUKA 2JC2A 1QV1A 5I2LA 2MLEC 3WHUB 1DVIA 1K9PA 4YGDB 4DCKA 2JZIA 1TRFA 1F55A 1B47A 2EC6B 4QJ4B 3IQOA 1K8UA 1JWDA 4P2YB 2NZ0A 2E6WA 4DUQA 1KQMC 2NXQA 1ZACA 4UPGA 1OQPA 1MHOA 1S3PA 5CSNA 1R2UA 3CR4X 1NP8A 2ZNDA 2CXJA 2BCXA 1PSRA 3SG3A 2FCEA 2COLB 1KK8B 1Y1UA 1EG4A 3BOWA 4IL1A 1QX5B 4PCWA 2O60A 1DT7B 1BODA 3CGAA 5PALA 1MUXA 4GGNA 4YI8A 2M0RA 3CS1A 3H4SE 1RROA 2LCPA 2BKHB 4N1FA 1H4BA 2F2PA 3SG5A 1AJ5A 1Y0VH 2JRFA 2OPOA 1KCYA 1GQMA 2BL0B 2LM5A 4YGEB 1IQ5A 4OV2A 3TDIA 1L2OB 2NCOA 1XFWO 5HKYA 3WHTB 4C0LA 1UP5A 2LNKA 1BMOA 2V53A 4YRUA 1G4YR 2L4HA 2LVKA 3SIAA 4N1GA 2JQ6A 4DRWA 1A4PA 1SCMB 1S6JA 3OB2B 1CFFA 1QS7A 1XK4A 2D8NA 2KAVA 3GK1A 1SW8A 3AKAA 2KHNA 1KFXS 1JF0A 4DIRA 1W7IB 5ER4X 2H61C 4GNKB 3LK0A 1BOCA 3AAKA 1S6IA 3I5HB 3FWCA 3JVTB 1GJYA 1BJFA 1IH0A 2KYCA 3EVUA 1TN4A 1UHHA 1QLSA 1WRLA 2PVBA 2DOQA 4M2OA 4PE4A 1XO5A 3O4YA 3I5FC 1YUTA 1WLMA 1FI5A 1QX7A 1TNQA 2KQYA 3DF0A 4DS7A 1CB1A 1UURA 3CZTX 3PN7C 4PHKA 1F71A 2M7NA 3BYAA 1YVHA 3LLEA 1J7OA 1Y1XA 4CFQA 3NXAA 4GAOA 3KPXA 1WLZA 2M49B 3O6BA 4ETOA 3FWBA 1KFUS 2F2OA 2K7BA 1FW4A 1YRUB 1M39A 1FBVA 3DD4A 4I5NB 2M7LA 2L98A 2LVIA 1IGVA 1BR4B 2K7CA 5AEQA 1B4CA 1SPYA 1EH2A 3M0WA 4U8DA 4OVNF 3I5GB 1SYMA 5DKRA 1J1EA 1QV0A 2VRGA 1CDLA 4YBHB 4GFTA 1AK8A 1MF8B 3F45A 2M3WA 1FF1A 4QJ5B 1WDCB 2F3ZA 2OTGB 2JTZA 1DJYA 1JUOA 3OB1B 1QLKA 2K7OA 3EK4A 1YVLA 5AXIA 4I5JA 1S1EA 1S6CA 4NDCA 2JOJA 1WRKA 2LP2A 3E3RA 3AKBA 1MQ1A 1SR6B 5CSIA 1GGZA 1IQ3A 2E30A 5CSFA 1K9KA 2I7AA 4GPLB 1DF0A 3TS5C 3PLFB 1BU3A 1XYDA 1EJ3A 2F33A 1TCOB 1LXFC 5HKZA 1YRTB 2LV7A 3DVJA 3RM1A 1DJXA 3K21A 1YUSA 2H2KA 1DJHA 2LHLA 3VRRA 2HF5A 4FTGA 4GBAA 1F8HA 1E8AA 1R6PA 2KI4B 1B8RA 1K93D 1DF0B 2ZN9A 3SG7A 2JU0A 1JBAA 1TNWA 4XJKB 2BL0C 4I5KA 1OMVA 5AERA 1YURA 1B7TZ 4ORCB 1J7RA 2LVJA 3KO0A 3DVKA 4C0JA 3PALA 1K95A 2JTTA 4YI9A 1K94A 1OOJA 1WRZA 2EHBA 2KGRA 2ZKMX 5G08A 2HPSA 1AP4A 5DKQA 4ORAB 3NSLA 5IBWA 1DJWA 5HLVA 2AMIA 3KEVA 1CLBA 2M29A 3JVTC 4PDZA 1M31A 1RJVA 2SCPA 2Q91A 2KOTA 4MZKA 2KFHA 1CTRA 2LLUA 2WCFA 5CPVA 2EGDA 2LAPA 3BOWB 1XFUO 1OMRA 3VRPA 4YGBB 1SKTA 1RWYA 1CM1A 1FPWA 1NUBA 2LP3A 2Y4QA 2OS8C 2L50A 1A75A 2MLFC 4MRYA 1NSHA 2HETA 2MAZA 4A4BA 5BPJA 1DGVA 1CDPA 4PE1A 1YTZC 2KFGA 2WORA 3GK4X 3JTDB 2K0JA 1U5IA 3CLNA 1L7ZA 3PFVA 1TNPA 1NX3A 5D69A 4CPVA 3I5IC 4PE0A 4OR9B 3KHEA 1SL8A 3TUYC 3I5GC 1K9UA 2K61A 2BCBA 1V1FA 4CLNA 1NCXA 1A29A 2AAOA 2L2EA 3CR2A 1OSAA 1BF5A 4JWQA 1SRAA 1QIWA 5FYXA 5I2QA 1WDCC 1UHJA 1EG3A 2OTGC 3EK8A 1JC2A 4WQ2A 2CBLA 3OP0A 5I8NA 1F70A 2JT3A 2H61A 1ALVA 3NSIA 3PATA 1K2HA 2GV5A 3IQQA 3ZWHA 1MXEA 1LA3A 1TCFA 1DGUA 1QASA 2IS9A 1CLMA 1SR6C 2KBIA 1XFZO 2LHIA 4TNCA 1NX0A 1UHKA 1SCVA
chains in the Genus database with same CATH superfamily
3EVRA 3B87A 1DTLA 4D1EA 3DF0B 2BECA 1XFVO 1N0YA 2LE9B 1XFYO 1J55A 2P71A 2I2RE 2LUXA 1B8CA 1QJTA 2M1KB 1V1GA 3IF7A 2JT8A 1JSAA 1LKJA 5B8IB 1GGWA 1SL9A 3SIBA 1KWOB 2LC5A 2NCPA 2LVVA 1NPQA 3L4AA 3QRXA 4R1EA 5KTYA 1G8IA 5FI2A 4CFRA 3FIAA 3CTNA 2Y1NA 1CNPA 4GGFC 4MVFA 1B7TY 3UNWA 2KNEA 2LUCA 2PASA 2KI4C 4MZLA 3EG5B 1N65A 5JJGA 3DVMA 1JF2A 1HQVA 1VRKA 1CDMA 3I5FB 1M45A 4MLWA 2MRDA 5J3XA 1YR5A 4AOMA 4MN0A 1Z2CB 3PN7B 2EC6C 1DELA 5CSJA 3D10A 4AQJA 3NHIA 2QEOA 1CMFA 4HREE 2JXLA 1F54A 1UHNA 3BUWB 1OE9B 4MRXA 1S5GZ 1EL4A 1PVBA 2Y5IA 2KQ6A 3D73A 1KQVA 2KFFA 3SG4A 1BT6A 2LLTA 1YX7A 2JXCA 2P6BB 3HCMA 1BG1A 4ZCUA 5I94A 1F4QA 5ER5A 1KK8C 1IJ5A 1TNXA 1RTP1 3D0YA 1OOFA 5K89A 2K7DA 4L9MA 3LCPC 3EKJA 1J7PA 2WC8A 3SJSA 1PVAA 3BXKA 2JPTA 1SY9A 3EKHA 5DKNA 1JFKA 1S26D 4ICBA 4MZJA 3SG2A 3CDNA 1AUIB 1DJGA 2K2FA 1UUSA 1XA5A 3Q8IA 3L47A 5F6TA 1CMGA 3ZNIA 1NIWA 2NLNA 1PK0D 2KI6C 5HKWA 2F8PA 1Q80A 2AUCA 2WCEA 3GOFA 1CFDA 4PE7A 4ORBB 1NWDA 2M1UA 1AJ4A 1CLLA 5EL2A 1D1OA 1OZSA 3OX5A 1ZOTB 1L2OC 2A4JA 1BR1B 2WOSA 4MEWA 4Q04A 1PSBA 1LA0A 1SNLA 2MHHA 2BBNA 1M46A 1QTXA 5JOLA 1TIZA 2CT9A 2BKIB 4MBEA 1BLQA 4WQ3A 2RGIA 2KPHA 2GGMA 4YGCB 1CDNA 1KFXL 4I5LB 4OKHA 1RECA 1SCMC 2JNXA 2KYFA 2LMTA 1SK6D 3TS5B 3D78A 5AANA 1SL7A 2LANA 3PM8A 3JTDC 4BY5A 4M2QA 2K60A 5HLOA 3VROA 3I5HC 1N2DA 2M8UA 1QXPA 1A2XA 1ZUZA 4HSZA 2PSRA 1C7WA 3DVEA 1MXLC 4HRHA 1WY9A 3BQ3A 1K90D 3LL8B 3LK1A 3VB1A 1C7VA 1QVIZ 1TTXA 3TZ1A 1KSOA 4HRGA 1B9AA 4PHMA 1KFUL 1XK4C 4YGAA 2MBXA 3OHMB 4CIDA 2M9GA 2MJWB 2JWWA 2ISDA 2WCJA 3A4UB 1IKUA 1DMOA 2PALA 1CFPA 3KF9A 1IRJA 3S0EA 2FCDA 2JT0A 2QEBA 3UO9A 4N5XA 1A03A 3CR5X 2LMUA 4PT1A 1KQMB 1SBJA 2HQWA 4AQIA 1FI6A 1KK7Z 3O4XA 1RFJA 3OX6A 2K2AA 5HYDA 3ICBA 1IG5A 2L51A 2CCMA 3BUMB 5GQQC 3AAJA 1NYAA 3CZ0A 2ZNEA 2BNXA 3C1VA 2LMVA 2FJUB 2WC6A 3S0FA 1A75B 1MWNA 2ZRTA 2ZRSA 1NX2A 3FS7A 2K8MB 1XVJA 2PMYA 1KWOC 2O5GA 3R72A 3NSOA 1H8BA 3BUOB 1ZMZA 1U5IB 1S5GY 3B7AA 1B8LA 2WCLA 1G33A 2WNDA 5D7FA 2L5XB 4WRIA 2B1UA 3L4LA 5DICA 2Q4UA 2ZFDA 1Y1AA 3FE9A 2FJYA 4NDBA 4A4CA 1KSMA 1OZOA 4FQOA 5HL1A 1X02A 2I18A 1QX2A 1F4OA 2GGZA 2KSPA 2ZN8A 2FOTA 1K96A 3WNXB 3TDUA 4PALA 1MR8A 2JNFA 2SASA 3VRQA 4NQGA 1OOGA 3BJHA 4KYNA 2TN4A 4QJ3B 2LLSA 2OS8B 1HT9A 2WCBA 4JQ0D 3VRNA 3EK7A 4BY4A 3R1OA 5AFPA 2BBMA 3O78A 1AVSA 2BE4A 2JULA 2MA2A 1C07A 3B86A 4MSPA 3TDZA 1W9ZA 1AHRA 1EXRA 4PHNA 1TOPA 1ZFSA 2I94A 1DJZA 2JPOA 1DJIA 2QPTA 3I5IB 3OGNA 3NSKA 3TUYB 1LINA 2R2IA 1M63B 3RLZA 1S36A 2M97A 4M2PA 1GM0A 1B1GA 3BUXB 2F3YA 4P5OE 3CWGA 1XFXO 5I2OA 2Y1MA 1CM4A 1IJ6A 3SS5A 4F0ZB 5TNCA 1SMGA 1ALWA 1IIOA 1PRWA 2L0PA 2KGBC 2KBMA 1OOHA 3BFBA 1NCYA 1NCZA 1QIVA 3D74A 4PHJA 1JFJA 3VGOA 1CFCA 1CKKA 4XYNA 3A8RA 3CABA 1PULA 3O2PA 1Z4HA 1YX8A 3PSRA 3MSEB 1UHIA 3EVVA 2L4IA 4USLA 3WXAA 2CTNA 4GGFA 1PALA 1RK9A 2QACA 4JPZB 4ZCVA 2G2BA 1OMDA 4NDDA 3SG6A 1UWOA 2G9BA 1W7JB 3HX4A 2HQ8A 1QVIY 2L2CA 5KSZA 1YUUA 4C0KA 2PRUA 2KDHA 2BCAA 1J1DA 1Y6WA 2KAYA 2BE6A 4XJKA 2KAXA 1IWQA 2CNPA 2KI6D 5KU1A 1LVCD 2WCHA 3GK2A 3BUNB 3D0YB 1ODBA 1QATA 3DZTA 1J7QA 1SSEB 2BAPA 1NX1A 1KK7Y 3K1EA 4OCIA 4E68A 4GUKA 3RZSA 2JC2A 1QV1A 5I2LA 2MLEC 3WHUB 1DVIA 1K9PA 1OOIX 4YGDB 4DCKA 2JZIA 1TRFA 5FI6A 1F55A 1B47A 2EC6B 4QJ4B 3IQOA 3S0AA 1K8UA 1JWDA 4P2YB 2NZ0A 2E6WA 4DUQA 1KQMC 2NXQA 1ZACA 4UPGA 1OQPA 1MHOA 1S3PA 2QDIA 5CSNA 1R2UA 3FE6A 3CR4X 1NP8A 2ZNDA 2CXJA 2BCXA 1PSRA 3SG3A 2FCEA 2COLB 1KK8B 1Y1UA 1EG4A 3BOWA 4IL1A 1QWVA 1QX5B 4PCWA 2O60A 2KLDA 1DT7B 1BODA 3CGAA 5PALA 1MUXA 4GGNA 4YI8A 2M0RA 3OBVA 3CS1A 3H4SE 1RROA 2LCPA 2BKHB 4N1FA 1H4BA 2F2PA 3SG5A 1AJ5A 1Y0VH 2JRFA 2OPOA 1KCYA 1GQMA 2BL0B 2LM5A 4YGEB 3QMEA 1IQ5A 4OV2A 3TDIA 1L2OB 2NCOA 2GTEA 1XFWO 5HKYA 3WHTB 4C0LA 1UP5A 2LNKA 1BMOA 2V53A 4YRUA 1G4YR 2H8VA 2L4HA 2LVKA 3SIAA 4N1GA 2JQ6A 4DRWA 1A4PA 1SCMB 1S6JA 3DXLA 3OB2B 2PYQA 1CFFA 1QS7A 1XK4A 2D8NA 2KAVA 3GK1A 1SW8A 3AKAA 2KHNA 1KFXS 1JF0A 4DIRA 1W7IB 5ER4X 2H61C 4GNKB 3LK0A 1BOCA 3AAKA 1S6IA 3I5HB 3FWCA 3JVTB 2PQLA 1GJYA 1BJFA 1IH0A 2KYCA 3D77A 3EVUA 1TN4A 1UHHA 1QLSA 1WRLA 2PVBA 2DOQA 4M2OA 4PE4A 1XO5A 3O4YA 3I5FC 1YUTA 1WLMA 1FI5A 1QX7A 1TNQA 2KQYA 3DF0A 4DS7A 1CB1A 1UURA 3CZTX 3PN7C 4PHKA 1F71A 2WC5A 2M7NA 3BYAA 1YVHA 3LLEA 1J7OA 1Y1XA 4CFQA 1XFRA 3NXAA 4GAOA 3KPXA 1WLZA 2M49B 3O6BA 2QEVA 3FWBA 1KFUS 2F2OA 2K7BA 3S0DA 1FW4A 1YRUB 4ETOA 1M39A 1FBVA 3DD4A 4I5NB 2M7LA 2L98A 2LVIA 1IGVA 1BR4B 2K7CA 5AEQA 3N7HA 1B4CA 4FQTA 1SPYA 1EH2A 3M0WA 4U8DA 4OVNF 3I5GB 1SYMA 5DKRA 1J1EA 1QV0A 2VRGA 3B88A 1CDLA 4YBHB 4GFTA 4IJ7A 1AK8A 1MF8B 3F45A 2M3WA 1FF1A 4QJ5B 1WDCB 2F3ZA 2OTGB 2JTZA 3D76A 1DJYA 1JUOA 1OW4A 1QLKA 3OB1B 1P28A 2K7OA 3EK4A 1YVLA 5AXIA 4I5JA 1S1EA 1S6CA 1T14A 4NDCA 2JOJA 1WRKA 2LP2A 3E3RA 3AKBA 1MQ1A 1SR6B 5CSIA 1GGZA 4INXA 1IQ3A 2E30A 5CSFA 2YGUA 1K9KA 2I7AA 4GPLB 1DF0A 3TS5C 1TUJA 3PLFB 1BU3A 1XYDA 1DC1A 1EJ3A 3CZ1A 1ORGA 2L5YA 2F33A 1DEKA 1TCOB 3PM2A 1LXFC 5HKZA 1YRTB 2LV7A 3DYEA 3DVJA 3RM1A 1DJXA 3K21A 1YUSA 2H2KA 1DJHA 2LHLA 3VRRA 2HF5A 4FTGA 4JD9A 4GBAA 3SS4A 1F8HA 1E8AA 1R6PA 2KI4B 1B8RA 1K93D 1DF0B 2ZN9A 3SG7A 3DY9A 1LS8A 4OZDA 2WCMA 3B6XA 2JU0A 1JBAA 3D75A 1TNWA 4XJKB 2BL0C 4I5KA 1OMVA 3BFHA 5AERA 1YURA 1B7TZ 4ORCB 1J7RA 2LVJA 3KO0A 2WCKA 3DVKA 4C0JA 3PALA 1K95A 3SS3A 1C3YA 2JTTA 4YI9A 1K94A 1OOJA 1WRZA 2EHBA 2KGRA 2ZKMX 5G08A 2HPSA 1AP4A 5DKQA 4ORAB 3NSLA 5IBWA 1DJWA 5HLVA 2AMIA 3KEVA 1CLBA 2M29A 3JVTC 4PDZA 1M31A 1RJVA 3CZ2A 2SCPA 2Q91A 2KOTA 4MZKA 2KFHA 1CTRA 2LLUA 2WCFA 3R1PA 5CPVA 2EGDA 2LAPA 3BOWB 4F7FA 2KLEA 1TUZA 1TWOA 1XFUO 1OMRA 5D3OA 3VRPA 3V2LA 4YGBB 1SKTA 1RWYA 1CM1A 1FPWA 1NUBA 2LP3A 2Y4QA 2ERBA 2OS8C 2L50A 1A75A 2MLFC 4MRYA 1NSHA 2HETA 2MAZA 4A4BA 5BPJA 1DGVA 1CDPA 4INWA 4PE1A 1YTZC 2KFGA 2WORA 3GK4X 3JTDB 3S0GA 2K0JA 3PJIA 1U5IA 3CLNA 1L7ZA 3CYZA 3PFVA 1TNPA 1NX3A 5D69A 4CPVA 3I5IC 4PE0A 3NGVA 4OR9B 3KHEA 1SL8A 3TUYC 3I5GC 3IVTA 1K9UA 2K61A 2BCBA 1V1FA 1C3ZA 4CLNA 1NCXA 1A29A 2AAOA 4JKTA 2L2EA 3CR2A 1OSAA 1BF5A 3FE8A 4JWQA 1SRAA 1QIWA 5FYXA 3R1VA 1WDCC 1UHJA 5I2QA 1EG3A 2OTGC 3EK8A 1JC2A 4WQ2A 2CBLA 3OP0A 5I8NA 1F70A 3BFAA 2JT3A 2H61A 2QEHA 2P70A 3NHTA 3S0BA 1ALVA 3NSIA 3PATA 1K2HA 2GV5A 3IQQA 3ZWHA 1MXEA 1DQEA 1LA3A 1TCFA 1DGUA 1QASA 2IS9A 1CLMA 1SR6C 2KBIA 1XFZO 2LHIA 4TNCA 1NX0A 1UHKA 5FI7A 1SCVA
chains in the Genus database with same CATH topology
3EVRA 1DTLA 4D1EA 3DF0B 2BECA 1XFVO 1N0YA 2LE9B 1XFYO 1J55A 2I2RE 2LUXA 1B8CA 1QJTA 2M1KB 1V1GA 3IF7A 2JT8A 1JSAA 1LKJA 5B8IB 1GGWA 1SL9A 3SIBA 1KWOB 2LC5A 2NCPA 2LVVA 1NPQA 3QRXA 4R1EA 5KTYA 1G8IA 4CFRA 3FIAA 3CTNA 2Y1NA 1CNPA 4GGFC 4MVFA 1B7TY 2KNEA 2LUCA 2PASA 2KI4C 4MZLA 1N65A 5JJGA 3DVMA 1JF2A 1HQVA 1VRKA 1CDMA 3I5FB 1M45A 4MLWA 2MRDA 5J3XA 1YR5A 4AOMA 4MN0A 3PN7B 2EC6C 5CSJA 3D10A 4AQJA 1CMFA 4HREE 2JXLA 1F54A 1UHNA 3BUWB 1OE9B 4MRXA 1S5GZ 1EL4A 1PVBA 2Y5IA 2KQ6A 1KQVA 2KFFA 3SG4A 1BT6A 2LLTA 1YX7A 2JXCA 2P6BB 3HCMA 1BG1A 4ZCUA 1F4QA 5ER5A 1KK8C 1IJ5A 1TNXA 1RTP1 3D0YA 5K89A 1J7PA 2K7DA 4L9MA 3LCPC 3EKJA 2WC8A 3SJSA 1PVAA 3BXKA 2JPTA 1SY9A 3EKHA 5DKNA 1JFKA 1S26D 4ICBA 4MZJA 3SG2A 1AUIB 1DJGA 2K2FA 1UUSA 1XA5A 5F6TA 1CMGA 3ZNIA 1NIWA 2NLNA 1PK0D 2KI6C 5HKWA 2F8PA 1Q80A 2AUCA 2WCEA 3GOFA 1CFDA 4PE7A 4ORBB 1NWDA 2M1UA 1AJ4A 1CLLA 1D1OA 1OZSA 3OX5A 1ZOTB 1L2OC 2A4JA 1BR1B 2WOSA 4MEWA 4Q04A 1PSBA 1LA0A 1SNLA 2MHHA 2BBNA 1M46A 1QTXA 5JOLA 1TIZA 2CT9A 2BKIB 4MBEA 1BLQA 4WQ3A 2RGIA 2GGMA 4YGCB 1CDNA 1KFXL 4I5LB 4OKHA 1RECA 1SCMC 2JNXA 2KYFA 2LMTA 1SK6D 3TS5B 5AANA 1SL7A 2LANA 3PM8A 3JTDC 4BY5A 4M2QA 5HLOA 3VROA 3I5HC 1N2DA 2M8UA 1QXPA 1A2XA 1ZUZA 4HSZA 2PSRA 1C7WA 3DVEA 1MXLC 4HRHA 1WY9A 3BQ3A 1K90D 3LL8B 3LK1A 1C7VA 1QVIZ 1TTXA 3TZ1A 1KSOA 4HRGA 1B9AA 4PHMA 1KFUL 1XK4C 4YGAA 2MBXA 3OHMB 4CIDA 2M9GA 2MJWB 2JWWA 2ISDA 3A4UB 1IKUA 1DMOA 2PALA 1CFPA 3KF9A 1IRJA 2FCDA 2JT0A 1A03A 4N5XA 3CR5X 2LMUA 1KQMB 1SBJA 2HQWA 4AQIA 1FI6A 1KK7Z 3OX6A 1RFJA 2K2AA 5HYDA 3ICBA 1IG5A 2L51A 2CCMA 3BUMB 5GQQC 3AAJA 1NYAA 2ZNEA 3C1VA 2LMVA 2FJUB 1A75B 1MWNA 2ZRTA 2ZRSA 1NX2A 3FS7A 2K8MB 1XVJA 2PMYA 1KWOC 2O5GA 3NSOA 1H8BA 3BUOB 1ZMZA 1U5IB 1S5GY 1B8LA 2WNDA 1G33A 5D7FA 2L5XB 4WRIA 2B1UA 2Q4UA 2ZFDA 1Y1AA 4A4CA 4NDBA 1KSMA 1OZOA 4FQOA 1X02A 2I18A 1QX2A 1F4OA 2GGZA 2KSPA 2ZN8A 2FOTA 1K96A 3WNXB 3TDUA 4PALA 1MR8A 2JNFA 2SASA 3VRQA 4NQGA 2TN4A 4QJ3B 2LLSA 2OS8B 1HT9A 2WCBA 4JQ0D 3VRNA 3EK7A 4BY4A 5AFPA 2BBMA 3O78A 1AVSA 2BE4A 2JULA 2MA2A 1C07A 4MSPA 3TDZA 1AHRA 1EXRA 4PHNA 1TOPA 1ZFSA 2I94A 1DJZA 2QPTA 1DJIA 3I5IB 3NSKA 3TUYB 1LINA 2R2IA 1M63B 3RLZA 1S36A 2M97A 4M2PA 1B1GA 3BUXB 2F3YA 4P5OE 3CWGA 1XFXO 5I2OA 2Y1MA 1CM4A 1IJ6A 4F0ZB 5TNCA 1SMGA 1ALWA 1PRWA 2L0PA 2KGBC 2KBMA 1NCYA 1NCZA 1QIVA 4PHJA 1JFJA 3VGOA 1CFCA 1CKKA 4XYNA 3A8RA 1PULA 3O2PA 1YX8A 3PSRA 3MSEB 1UHIA 3EVVA 2L4IA 4USLA 3WXAA 2CTNA 4GGFA 1PALA 1RK9A 2QACA 4JPZB 4ZCVA 2G2BA 1OMDA 4NDDA 3SG6A 1UWOA 2G9BA 1W7JB 3HX4A 2HQ8A 1QVIY 5KSZA 1YUUA 4C0KA 2PRUA 2KDHA 2BCAA 1J1DA 1Y6WA 2KAYA 2BE6A 4XJKA 2KAXA 1IWQA 2CNPA 2KI6D 5KU1A 1LVCD 3GK2A 3BUNB 3D0YB 1ODBA 1QATA 1J7QA 4OCIA 1NX1A 1KK7Y 4E68A 4GUKA 2JC2A 1QV1A 5I2LA 2MLEC 3WHUB 1DVIA 1K9PA 4YGDB 4DCKA 2JZIA 1TRFA 1F55A 1B47A 2EC6B 4QJ4B 3IQOA 1K8UA 1JWDA 4P2YB 2NZ0A 2E6WA 4DUQA 1KQMC 2NXQA 1ZACA 4UPGA 1OQPA 1MHOA 1S3PA 5CSNA 1R2UA 3CR4X 1NP8A 2ZNDA 2CXJA 2BCXA 1PSRA 3SG3A 2FCEA 2COLB 1KK8B 1Y1UA 1EG4A 3BOWA 4IL1A 1QX5B 4PCWA 2O60A 1DT7B 1BODA 3CGAA 5PALA 1MUXA 4GGNA 4YI8A 2M0RA 3CS1A 3H4SE 1RROA 2LCPA 2BKHB 4N1FA 1H4BA 2F2PA 3SG5A 1AJ5A 1Y0VH 2JRFA 2OPOA 1KCYA 1GQMA 2BL0B 2LM5A 4YGEB 1IQ5A 4OV2A 3TDIA 1L2OB 2NCOA 1XFWO 5HKYA 3WHTB 4C0LA 1UP5A 2LNKA 1BMOA 2V53A 4YRUA 1G4YR 2L4HA 2LVKA 3SIAA 4N1GA 2JQ6A 4DRWA 1A4PA 1SCMB 1S6JA 3OB2B 1CFFA 1QS7A 1XK4A 2D8NA 2KAVA 3GK1A 1SW8A 3AKAA 2KHNA 1KFXS 1JF0A 4DIRA 1W7IB 5ER4X 2H61C 4GNKB 3LK0A 1BOCA 3AAKA 1S6IA 3I5HB 3FWCA 3JVTB 1GJYA 1BJFA 1IH0A 2KYCA 3EVUA 1TN4A 1UHHA 1QLSA 1WRLA 2PVBA 2DOQA 4M2OA 4PE4A 1XO5A 3O4YA 3I5FC 1YUTA 1WLMA 1FI5A 1QX7A 1TNQA 2KQYA 3DF0A 4DS7A 1CB1A 1UURA 3CZTX 3PN7C 4PHKA 1F71A 2M7NA 3BYAA 1YVHA 3LLEA 1J7OA 1Y1XA 4CFQA 3NXAA 4GAOA 3KPXA 1WLZA 2M49B 3O6BA 4ETOA 3FWBA 1KFUS 2F2OA 2K7BA 1FW4A 1YRUB 1M39A 1FBVA 3DD4A 4I5NB 2M7LA 2L98A 2LVIA 1IGVA 1BR4B 2K7CA 5AEQA 1B4CA 1SPYA 1EH2A 3M0WA 4U8DA 4OVNF 3I5GB 1SYMA 5DKRA 1J1EA 1QV0A 2VRGA 1CDLA 4YBHB 4GFTA 1AK8A 1MF8B 3F45A 2M3WA 1FF1A 4QJ5B 1WDCB 2F3ZA 2OTGB 2JTZA 1DJYA 1JUOA 3OB1B 1QLKA 2K7OA 3EK4A 1YVLA 5AXIA 4I5JA 1S1EA 1S6CA 4NDCA 2JOJA 1WRKA 2LP2A 3E3RA 3AKBA 1MQ1A 1SR6B 5CSIA 1GGZA 1IQ3A 2E30A 5CSFA 1K9KA 2I7AA 4GPLB 1DF0A 3TS5C 3PLFB 1BU3A 1XYDA 1EJ3A 2F33A 1TCOB 1LXFC 5HKZA 1YRTB 2LV7A 3DVJA 3RM1A 1DJXA 3K21A 1YUSA 2H2KA 1DJHA 2LHLA 3VRRA 2HF5A 4FTGA 4GBAA 1F8HA 1E8AA 1R6PA 2KI4B 1B8RA 1K93D 1DF0B 2ZN9A 3SG7A 2JU0A 1JBAA 1TNWA 4XJKB 2BL0C 4I5KA 1OMVA 5AERA 1YURA 1B7TZ 4ORCB 1J7RA 2LVJA 3KO0A 3DVKA 4C0JA 3PALA 1K95A 2JTTA 4YI9A 1K94A 1OOJA 1WRZA 2EHBA 2KGRA 2ZKMX 5G08A 2HPSA 1AP4A 5DKQA 4ORAB 3NSLA 5IBWA 1DJWA 5HLVA 2AMIA 3KEVA 1CLBA 2M29A 3JVTC 4PDZA 1M31A 1RJVA 2SCPA 2Q91A 2KOTA 4MZKA 2KFHA 1CTRA 2LLUA 2WCFA 5CPVA 2EGDA 2LAPA 3BOWB 1XFUO 1OMRA 3VRPA 4YGBB 1SKTA 1RWYA 1CM1A 1FPWA 1NUBA 2LP3A 2Y4QA 2OS8C 2L50A 1A75A 2MLFC 4MRYA 1NSHA 2HETA 2MAZA 4A4BA 5BPJA 1DGVA 1CDPA 4PE1A 1YTZC 2KFGA 2WORA 3GK4X 3JTDB 2K0JA 1U5IA 3CLNA 1L7ZA 3PFVA 1TNPA 1NX3A 5D69A 4CPVA 3I5IC 4PE0A 4OR9B 3KHEA 1SL8A 3TUYC 3I5GC 1K9UA 2K61A 2BCBA 1V1FA 4CLNA 1NCXA 1A29A 2AAOA 2L2EA 3CR2A 1OSAA 1BF5A 4JWQA 1SRAA 1QIWA 5FYXA 5I2QA 1WDCC 1UHJA 1EG3A 2OTGC 3EK8A 1JC2A 4WQ2A 2CBLA 3OP0A 5I8NA 1F70A 2JT3A 2H61A 1ALVA 3NSIA 3PATA 1K2HA 2GV5A 3IQQA 3ZWHA 1MXEA 1LA3A 1TCFA 1DGUA 1QASA 2IS9A 1CLMA 1SR6C 2KBIA 1XFZO 2LHIA 4TNCA 1NX0A 1UHKA 1SCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVR A;  1DTL A;  4D1E A;  3DF0 B;  2BEC A;  1XFV O;  1N0Y A;  2LE9 B;  1XFY O;  1J55 A;  2I2R E;  2LUX A;  1B8C A;  1QJT A;  2M1K B;  1V1G A;  3IF7 A;  2JT8 A;  1JSA A;  1LKJ A;  5B8I B;  1GGW A;  1SL9 A;  3SIB A;  1KWO B;  2LC5 A;  2NCP A;  2LVV A;  1NPQ A;  3QRX A;  4R1E A;  5KTY A;  1G8I A;  4CFR A;  3FIA A;  3CTN A;  2Y1N A;  1CNP A;  4GGF C;  4MVF A;  1B7T Y;  2KNE A;  2LUC A;  2PAS A;  2KI4 C;  4MZL A;  1N65 A;  5JJG A;  3DVM A;  1JF2 A;  1HQV A;  1VRK A;  1CDM A;  3I5F B;  1M45 A;  4MLW A;  2MRD A;  5J3X A;  1YR5 A;  4AOM A;  4MN0 A;  3PN7 B;  2EC6 C;  5CSJ A;  3D10 A;  4AQJ A;  1CMF A;  4HRE E;  2JXL A;  1F54 A;  1UHN A;  3BUW B;  1OE9 B;  4MRX A;  1S5G Z;  1EL4 A;  1PVB A;  2Y5I A;  2KQ6 A;  1KQV A;  2KFF A;  3SG4 A;  1BT6 A;  2LLT A;  1YX7 A;  2JXC A;  2P6B B;  3HCM A;  1BG1 A;  4ZCU A;  1F4Q A;  5ER5 A;  1KK8 C;  1IJ5 A;  1TNX A;  1RTP 1;  3D0Y A;  5K89 A;  1J7P A;  2K7D A;  4L9M A;  3LCP C;  3EKJ A;  2WC8 A;  3SJS A;  1PVA A;  3BXK A;  2JPT A;  1SY9 A;  3EKH A;  5DKN A;  1JFK A;  1S26 D;  4ICB A;  4MZJ A;  3SG2 A;  1AUI B;  1DJG A;  2K2F A;  1UUS A;  1XA5 A;  5F6T A;  1CMG A;  3ZNI A;  1NIW A;  2NLN A;  1PK0 D;  2KI6 C;  5HKW A;  2F8P A;  1Q80 A;  2AUC A;  2WCE A;  3GOF A;  1CFD A;  4PE7 A;  4ORB B;  1NWD A;  2M1U A;  1AJ4 A;  1CLL A;  1D1O A;  1OZS A;  3OX5 A;  1ZOT B;  1L2O C;  2A4J A;  1BR1 B;  2WOS A;  4MEW A;  4Q04 A;  1PSB A;  1LA0 A;  1SNL A;  2MHH A;  2BBN A;  1M46 A;  1QTX A;  5JOL A;  1TIZ A;  2CT9 A;  2BKI B;  4MBE A;  1BLQ A;  4WQ3 A;  2RGI A;  2GGM A;  4YGC B;  1CDN A;  1KFX L;  4I5L B;  4OKH A;  1REC A;  1SCM C;  2JNX A;  2KYF A;  2LMT A;  1SK6 D;  3TS5 B;  5AAN A;  1SL7 A;  2LAN A;  3PM8 A;  3JTD C;  4BY5 A;  4M2Q A;  5HLO A;  3VRO A;  3I5H C;  1N2D A;  2M8U A;  1QXP A;  1A2X A;  1ZUZ A;  4HSZ A;  2PSR A;  1C7W A;  3DVE A;  1MXL C;  4HRH A;  1WY9 A;  3BQ3 A;  1K90 D;  3LL8 B;  3LK1 A;  1C7V A;  1QVI Z;  1TTX A;  3TZ1 A;  1KSO A;  4HRG A;  1B9A A;  4PHM A;  1KFU L;  1XK4 C;  4YGA A;  2MBX A;  3OHM B;  4CID A;  2M9G A;  2MJW B;  2JWW A;  2ISD A;  3A4U B;  1IKU A;  1DMO A;  2PAL A;  1CFP A;  3KF9 A;  1IRJ A;  2FCD A;  2JT0 A;  1A03 A;  4N5X A;  3CR5 X;  2LMU A;  1KQM B;  1SBJ A;  2HQW A;  4AQI A;  1FI6 A;  1KK7 Z;  3OX6 A;  1RFJ A;  2K2A A;  5HYD A;  3ICB A;  1IG5 A;  2L51 A;  2CCM A;  3BUM B;  5GQQ C;  3AAJ A;  1NYA A;  2ZNE A;  3C1V A;  2LMV A;  2FJU B;  1A75 B;  1MWN A;  2ZRT A;  2ZRS A;  1NX2 A;  3FS7 A;  2K8M B;  1XVJ A;  2PMY A;  1KWO C;  2O5G A;  3NSO A;  1H8B A;  3BUO B;  1ZMZ A;  1U5I B;  1S5G Y;  1B8L A;  2WND A;  1G33 A;  5D7F A;  2L5X B;  4WRI A;  2B1U A;  2Q4U A;  2ZFD A;  1Y1A A;  4A4C A;  4NDB A;  1KSM A;  1OZO A;  4FQO A;  1X02 A;  2I18 A;  1QX2 A;  1F4O A;  2GGZ A;  2KSP A;  2ZN8 A;  2FOT A;  1K96 A;  3WNX B;  3TDU A;  4PAL A;  1MR8 A;  2JNF A;  2SAS A;  3VRQ A;  4NQG A;  2TN4 A;  4QJ3 B;  2LLS A;  2OS8 B;  1HT9 A;  2WCB A;  4JQ0 D;  3VRN A;  3EK7 A;  4BY4 A;  5AFP A;  2BBM A;  3O78 A;  1AVS A;  2BE4 A;  2JUL A;  2MA2 A;  1C07 A;  4MSP A;  3TDZ A;  1AHR A;  1EXR A;  4PHN A;  1TOP A;  1ZFS A;  2I94 A;  1DJZ A;  2QPT A;  1DJI A;  3I5I B;  3NSK A;  3TUY B;  1LIN A;  2R2I A;  1M63 B;  3RLZ A;  1S36 A;  2M97 A;  4M2P A;  1B1G A;  3BUX B;  2F3Y A;  4P5O E;  3CWG A;  1XFX O;  5I2O A;  2Y1M A;  1CM4 A;  1IJ6 A;  4F0Z B;  5TNC A;  1SMG A;  1ALW A;  1PRW A;  2L0P A;  2KGB C;  2KBM A;  1NCY A;  1NCZ A;  1QIV A;  4PHJ A;  1JFJ A;  3VGO A;  1CFC A;  1CKK A;  4XYN A;  3A8R A;  1PUL A;  3O2P A;  1YX8 A;  3PSR A;  3MSE B;  1UHI A;  3EVV A;  2L4I A;  4USL A;  3WXA A;  2CTN A;  4GGF A;  1PAL A;  1RK9 A;  2QAC A;  4JPZ B;  4ZCV A;  2G2B A;  1OMD A;  4NDD A;  3SG6 A;  1UWO A;  2G9B A;  1W7J B;  3HX4 A;  2HQ8 A;  1QVI Y;  5KSZ A;  1YUU A;  4C0K A;  2PRU A;  2KDH A;  2BCA A;  1J1D A;  1Y6W A;  2KAY A;  2BE6 A;  4XJK A;  2KAX A;  1IWQ A;  2CNP A;  2KI6 D;  5KU1 A;  1LVC D;  3GK2 A;  3BUN B;  3D0Y B;  1ODB A;  1QAT A;  1J7Q A;  4OCI A;  1NX1 A;  1KK7 Y;  4E68 A;  4GUK A;  2JC2 A;  1QV1 A;  5I2L A;  2MLE C;  3WHU B;  1DVI A;  1K9P A;  4YGD B;  4DCK A;  2JZI A;  1TRF A;  1F55 A;  1B47 A;  2EC6 B;  4QJ4 B;  3IQO A;  1K8U A;  1JWD A;  4P2Y B;  2NZ0 A;  2E6W A;  4DUQ A;  1KQM C;  2NXQ A;  1ZAC A;  4UPG A;  1OQP A;  1MHO A;  1S3P A;  5CSN A;  1R2U A;  3CR4 X;  1NP8 A;  2ZND A;  2CXJ A;  2BCX A;  1PSR A;  3SG3 A;  2FCE A;  2COL B;  1KK8 B;  1Y1U A;  1EG4 A;  3BOW A;  4IL1 A;  1QX5 B;  4PCW A;  2O60 A;  1DT7 B;  1BOD A;  3CGA A;  5PAL A;  1MUX A;  4GGN A;  4YI8 A;  2M0R A;  3CS1 A;  3H4S E;  1RRO A;  2LCP A;  2BKH B;  4N1F A;  1H4B A;  2F2P A;  3SG5 A;  1AJ5 A;  1Y0V H;  2JRF A;  2OPO A;  1KCY A;  1GQM A;  2BL0 B;  2LM5 A;  4YGE B;  1IQ5 A;  4OV2 A;  3TDI A;  1L2O B;  2NCO A;  1XFW O;  5HKY A;  3WHT B;  4C0L A;  1UP5 A;  2LNK A;  1BMO A;  2V53 A;  4YRU A;  1G4Y R;  2L4H A;  2LVK A;  3SIA A;  4N1G A;  2JQ6 A;  4DRW A;  1A4P A;  1SCM B;  1S6J A;  3OB2 B;  1CFF A;  1QS7 A;  1XK4 A;  2D8N A;  2KAV A;  3GK1 A;  1SW8 A;  3AKA A;  2KHN A;  1KFX S;  1JF0 A;  4DIR A;  1W7I B;  5ER4 X;  2H61 C;  4GNK B;  3LK0 A;  1BOC A;  3AAK A;  1S6I A;  3I5H B;  3FWC A;  3JVT B;  1GJY A;  1BJF A;  1IH0 A;  2KYC A;  3EVU A;  1TN4 A;  1UHH A;  1QLS A;  1WRL A;  2PVB A;  2DOQ A;  4M2O A;  4PE4 A;  1XO5 A;  3O4Y A;  3I5F C;  1YUT A;  1WLM A;  1FI5 A;  1QX7 A;  1TNQ A;  2KQY A;  3DF0 A;  4DS7 A;  1CB1 A;  1UUR A;  3CZT X;  3PN7 C;  4PHK A;  1F71 A;  2M7N A;  3BYA A;  1YVH A;  3LLE A;  1J7O A;  1Y1X A;  4CFQ A;  3NXA A;  4GAO A;  3KPX A;  1WLZ A;  2M49 B;  3O6B A;  4ETO A;  3FWB A;  1KFU S;  2F2O A;  2K7B A;  1FW4 A;  1YRU B;  1M39 A;  1FBV A;  3DD4 A;  4I5N B;  2M7L A;  2L98 A;  2LVI A;  1IGV A;  1BR4 B;  2K7C A;  5AEQ A;  1B4C A;  1SPY A;  1EH2 A;  3M0W A;  4U8D A;  4OVN F;  3I5G B;  1SYM A;  5DKR A;  1J1E A;  1QV0 A;  2VRG A;  1CDL A;  4YBH B;  4GFT A;  1AK8 A;  1MF8 B;  3F45 A;  2M3W A;  1FF1 A;  4QJ5 B;  1WDC B;  2F3Z A;  2OTG B;  2JTZ A;  1DJY A;  1JUO A;  3OB1 B;  1QLK A;  2K7O A;  3EK4 A;  1YVL A;  5AXI A;  4I5J A;  1S1E A;  1S6C A;  4NDC A;  2JOJ A;  1WRK A;  2LP2 A;  3E3R A;  3AKB A;  1MQ1 A;  1SR6 B;  5CSI A;  1GGZ A;  1IQ3 A;  2E30 A;  5CSF A;  1K9K A;  2I7A A;  4GPL B;  1DF0 A;  3TS5 C;  3PLF B;  1BU3 A;  1XYD A;  1EJ3 A;  2F33 A;  1TCO B;  1LXF C;  5HKZ A;  1YRT B;  2LV7 A;  3DVJ A;  3RM1 A;  1DJX A;  3K21 A;  1YUS A;  2H2K A;  1DJH A;  2LHL A;  3VRR A;  2HF5 A;  4FTG A;  4GBA A;  1F8H A;  1E8A A;  1R6P A;  2KI4 B;  1B8R A;  1K93 D;  1DF0 B;  2ZN9 A;  3SG7 A;  2JU0 A;  1JBA A;  1TNW A;  4XJK B;  2BL0 C;  4I5K A;  1OMV A;  5AER A;  1YUR A;  1B7T Z;  4ORC B;  1J7R A;  2LVJ A;  3KO0 A;  3DVK A;  4C0J A;  3PAL A;  1K95 A;  2JTT A;  4YI9 A;  1K94 A;  1OOJ A;  1WRZ A;  2EHB A;  2KGR A;  2ZKM X;  5G08 A;  2HPS A;  1AP4 A;  5DKQ A;  4ORA B;  3NSL A;  5IBW A;  1DJW A;  5HLV A;  2AMI A;  3KEV A;  1CLB A;  2M29 A;  3JVT C;  4PDZ A;  1M31 A;  1RJV A;  2SCP A;  2Q91 A;  2KOT A;  4MZK A;  2KFH A;  1CTR A;  2LLU A;  2WCF A;  5CPV A;  2EGD A;  2LAP A;  3BOW B;  1XFU O;  1OMR A;  3VRP A;  4YGB B;  1SKT A;  1RWY A;  1CM1 A;  1FPW A;  1NUB A;  2LP3 A;  2Y4Q A;  2OS8 C;  2L50 A;  1A75 A;  2MLF C;  4MRY A;  1NSH A;  2HET A;  2MAZ A;  4A4B A;  5BPJ A;  1DGV A;  1CDP A;  4PE1 A;  1YTZ C;  2KFG A;  2WOR A;  3GK4 X;  3JTD B;  2K0J A;  1U5I A;  3CLN A;  1L7Z A;  3PFV A;  1TNP A;  1NX3 A;  5D69 A;  4CPV A;  3I5I C;  4PE0 A;  4OR9 B;  3KHE A;  1SL8 A;  3TUY C;  3I5G C;  1K9U A;  2K61 A;  2BCB A;  1V1F A;  4CLN A;  1NCX A;  1A29 A;  2AAO A;  2L2E A;  3CR2 A;  1OSA A;  1BF5 A;  4JWQ A;  1SRA A;  1QIW A;  5FYX A;  5I2Q A;  1WDC C;  1UHJ A;  1EG3 A;  2OTG C;  3EK8 A;  1JC2 A;  4WQ2 A;  2CBL A;  3OP0 A;  5I8N A;  1F70 A;  2JT3 A;  2H61 A;  1ALV A;  3NSI A;  3PAT A;  1K2H A;  2GV5 A;  3IQQ A;  3ZWH A;  1MXE A;  1LA3 A;  1TCF A;  1DGU A;  1QAS A;  2IS9 A;  1CLM A;  1SR6 C;  2KBI A;  1XFZ O;  2LHI A;  4TNC A;  1NX0 A;  1UHK A;  1SCV A; 
#chains in the Genus database with same CATH topology
 3EVR A;  3B87 A;  1DTL A;  4D1E A;  3DF0 B;  2BEC A;  1XFV O;  1N0Y A;  2LE9 B;  1XFY O;  1J55 A;  2P71 A;  2I2R E;  2LUX A;  1B8C A;  1QJT A;  2M1K B;  1V1G A;  3IF7 A;  2JT8 A;  1JSA A;  1LKJ A;  5B8I B;  1GGW A;  1SL9 A;  3SIB A;  1KWO B;  2LC5 A;  2NCP A;  2LVV A;  1NPQ A;  3L4A A;  3QRX A;  4R1E A;  5KTY A;  1G8I A;  5FI2 A;  4CFR A;  3FIA A;  3CTN A;  2Y1N A;  1CNP A;  4GGF C;  4MVF A;  1B7T Y;  3UNW A;  2KNE A;  2LUC A;  2PAS A;  2KI4 C;  4MZL A;  3EG5 B;  1N65 A;  5JJG A;  3DVM A;  1JF2 A;  1HQV A;  1VRK A;  1CDM A;  3I5F B;  1M45 A;  4MLW A;  2MRD A;  5J3X A;  1YR5 A;  4AOM A;  4MN0 A;  1Z2C B;  3PN7 B;  2EC6 C;  1DEL A;  5CSJ A;  3D10 A;  4AQJ A;  3NHI A;  2QEO A;  1CMF A;  4HRE E;  2JXL A;  1F54 A;  1UHN A;  3BUW B;  1OE9 B;  4MRX A;  1S5G Z;  1EL4 A;  1PVB A;  2Y5I A;  2KQ6 A;  3D73 A;  1KQV A;  2KFF A;  3SG4 A;  1BT6 A;  2LLT A;  1YX7 A;  2JXC A;  2P6B B;  3HCM A;  1BG1 A;  4ZCU A;  5I94 A;  1F4Q A;  5ER5 A;  1KK8 C;  1IJ5 A;  1TNX A;  1RTP 1;  3D0Y A;  1OOF A;  5K89 A;  2K7D A;  4L9M A;  3LCP C;  3EKJ A;  1J7P A;  2WC8 A;  3SJS A;  1PVA A;  3BXK A;  2JPT A;  1SY9 A;  3EKH A;  5DKN A;  1JFK A;  1S26 D;  4ICB A;  4MZJ A;  3SG2 A;  3CDN A;  1AUI B;  1DJG A;  2K2F A;  1UUS A;  1XA5 A;  3Q8I A;  3L47 A;  5F6T A;  1CMG A;  3ZNI A;  1NIW A;  2NLN A;  1PK0 D;  2KI6 C;  5HKW A;  2F8P A;  1Q80 A;  2AUC A;  2WCE A;  3GOF A;  1CFD A;  4PE7 A;  4ORB B;  1NWD A;  2M1U A;  1AJ4 A;  1CLL A;  5EL2 A;  1D1O A;  1OZS A;  3OX5 A;  1ZOT B;  1L2O C;  2A4J A;  1BR1 B;  2WOS A;  4MEW A;  4Q04 A;  1PSB A;  1LA0 A;  1SNL A;  2MHH A;  2BBN A;  1M46 A;  1QTX A;  5JOL A;  1TIZ A;  2CT9 A;  2BKI B;  4MBE A;  1BLQ A;  4WQ3 A;  2RGI A;  2KPH A;  2GGM A;  4YGC B;  1CDN A;  1KFX L;  4I5L B;  4OKH A;  1REC A;  1SCM C;  2JNX A;  2KYF A;  2LMT A;  1SK6 D;  3TS5 B;  3D78 A;  5AAN A;  1SL7 A;  2LAN A;  3PM8 A;  3JTD C;  4BY5 A;  4M2Q A;  2K60 A;  5HLO A;  3VRO A;  3I5H C;  1N2D A;  2M8U A;  1QXP A;  1A2X A;  1ZUZ A;  4HSZ A;  2PSR A;  1C7W A;  3DVE A;  1MXL C;  4HRH A;  1WY9 A;  3BQ3 A;  1K90 D;  3LL8 B;  3LK1 A;  3VB1 A;  1C7V A;  1QVI Z;  1TTX A;  3TZ1 A;  1KSO A;  4HRG A;  1B9A A;  4PHM A;  1KFU L;  1XK4 C;  4YGA A;  2MBX A;  3OHM B;  4CID A;  2M9G A;  2MJW B;  2JWW A;  2ISD A;  2WCJ A;  3A4U B;  1IKU A;  1DMO A;  2PAL A;  1CFP A;  3KF9 A;  1IRJ A;  3S0E A;  2FCD A;  2JT0 A;  2QEB A;  3UO9 A;  4N5X A;  1A03 A;  3CR5 X;  2LMU A;  4PT1 A;  1KQM B;  1SBJ A;  2HQW A;  4AQI A;  1FI6 A;  1KK7 Z;  3O4X A;  1RFJ A;  3OX6 A;  2K2A A;  5HYD A;  3ICB A;  1IG5 A;  2L51 A;  2CCM A;  3BUM B;  5GQQ C;  3AAJ A;  1NYA A;  3CZ0 A;  2ZNE A;  2BNX A;  3C1V A;  2LMV A;  2FJU B;  2WC6 A;  3S0F A;  1A75 B;  1MWN A;  2ZRT A;  2ZRS A;  1NX2 A;  3FS7 A;  2K8M B;  1XVJ A;  2PMY A;  1KWO C;  2O5G A;  3R72 A;  3NSO A;  1H8B A;  3BUO B;  1ZMZ A;  1U5I B;  1S5G Y;  3B7A A;  1B8L A;  2WCL A;  1G33 A;  2WND A;  5D7F A;  2L5X B;  4WRI A;  2B1U A;  3L4L A;  5DIC A;  2Q4U A;  2ZFD A;  1Y1A A;  3FE9 A;  2FJY A;  4NDB A;  4A4C A;  1KSM A;  1OZO A;  4FQO A;  5HL1 A;  1X02 A;  2I18 A;  1QX2 A;  1F4O A;  2GGZ A;  2KSP A;  2ZN8 A;  2FOT A;  1K96 A;  3WNX B;  3TDU A;  4PAL A;  1MR8 A;  2JNF A;  2SAS A;  3VRQ A;  4NQG A;  1OOG A;  3BJH A;  4KYN A;  2TN4 A;  4QJ3 B;  2LLS A;  2OS8 B;  1HT9 A;  2WCB A;  4JQ0 D;  3VRN A;  3EK7 A;  4BY4 A;  3R1O A;  5AFP A;  2BBM A;  3O78 A;  1AVS A;  2BE4 A;  2JUL A;  2MA2 A;  1C07 A;  3B86 A;  4MSP A;  3TDZ A;  1W9Z A;  1AHR A;  1EXR A;  4PHN A;  1TOP A;  1ZFS A;  2I94 A;  1DJZ A;  2JPO A;  1DJI A;  2QPT A;  3I5I B;  3OGN A;  3NSK A;  3TUY B;  1LIN A;  2R2I A;  1M63 B;  3RLZ A;  1S36 A;  2M97 A;  4M2P A;  1GM0 A;  1B1G A;  3BUX B;  2F3Y A;  4P5O E;  3CWG A;  1XFX O;  5I2O A;  2Y1M A;  1CM4 A;  1IJ6 A;  3SS5 A;  4F0Z B;  5TNC A;  1SMG A;  1ALW A;  1IIO A;  1PRW A;  2L0P A;  2KGB C;  2KBM A;  1OOH A;  3BFB A;  1NCY A;  1NCZ A;  1QIV A;  3D74 A;  4PHJ A;  1JFJ A;  3VGO A;  1CFC A;  1CKK A;  4XYN A;  3A8R A;  3CAB A;  1PUL A;  3O2P A;  1Z4H A;  1YX8 A;  3PSR A;  3MSE B;  1UHI A;  3EVV A;  2L4I A;  4USL A;  3WXA A;  2CTN A;  4GGF A;  1PAL A;  1RK9 A;  2QAC A;  4JPZ B;  4ZCV A;  2G2B A;  1OMD A;  4NDD A;  3SG6 A;  1UWO A;  2G9B A;  1W7J B;  3HX4 A;  2HQ8 A;  1QVI Y;  2L2C A;  5KSZ A;  1YUU A;  4C0K A;  2PRU A;  2KDH A;  2BCA A;  1J1D A;  1Y6W A;  2KAY A;  2BE6 A;  4XJK A;  2KAX A;  1IWQ A;  2CNP A;  2KI6 D;  5KU1 A;  1LVC D;  2WCH A;  3GK2 A;  3BUN B;  3D0Y B;  1ODB A;  1QAT A;  3DZT A;  1J7Q A;  1SSE B;  2BAP A;  1NX1 A;  1KK7 Y;  3K1E A;  4OCI A;  4E68 A;  4GUK A;  3RZS A;  2JC2 A;  1QV1 A;  5I2L A;  2MLE C;  3WHU B;  1DVI A;  1K9P A;  1OOI X;  4YGD B;  4DCK A;  2JZI A;  1TRF A;  5FI6 A;  1F55 A;  1B47 A;  2EC6 B;  4QJ4 B;  3IQO A;  3S0A A;  1K8U A;  1JWD A;  4P2Y B;  2NZ0 A;  2E6W A;  4DUQ A;  1KQM C;  2NXQ A;  1ZAC A;  4UPG A;  1OQP A;  1MHO A;  1S3P A;  2QDI A;  5CSN A;  1R2U A;  3FE6 A;  3CR4 X;  1NP8 A;  2ZND A;  2CXJ A;  2BCX A;  1PSR A;  3SG3 A;  2FCE A;  2COL B;  1KK8 B;  1Y1U A;  1EG4 A;  3BOW A;  4IL1 A;  1QWV A;  1QX5 B;  4PCW A;  2O60 A;  2KLD A;  1DT7 B;  1BOD A;  3CGA A;  5PAL A;  1MUX A;  4GGN A;  4YI8 A;  2M0R A;  3OBV A;  3CS1 A;  3H4S E;  1RRO A;  2LCP A;  2BKH B;  4N1F A;  1H4B A;  2F2P A;  3SG5 A;  1AJ5 A;  1Y0V H;  2JRF A;  2OPO A;  1KCY A;  1GQM A;  2BL0 B;  2LM5 A;  4YGE B;  3QME A;  1IQ5 A;  4OV2 A;  3TDI A;  1L2O B;  2NCO A;  2GTE A;  1XFW O;  5HKY A;  3WHT B;  4C0L A;  1UP5 A;  2LNK A;  1BMO A;  2V53 A;  4YRU A;  1G4Y R;  2H8V A;  2L4H A;  2LVK A;  3SIA A;  4N1G A;  2JQ6 A;  4DRW A;  1A4P A;  1SCM B;  1S6J A;  3DXL A;  3OB2 B;  2PYQ A;  1CFF A;  1QS7 A;  1XK4 A;  2D8N A;  2KAV A;  3GK1 A;  1SW8 A;  3AKA A;  2KHN A;  1KFX S;  1JF0 A;  4DIR A;  1W7I B;  5ER4 X;  2H61 C;  4GNK B;  3LK0 A;  1BOC A;  3AAK A;  1S6I A;  3I5H B;  3FWC A;  3JVT B;  2PQL A;  1GJY A;  1BJF A;  1IH0 A;  2KYC A;  3D77 A;  3EVU A;  1TN4 A;  1UHH A;  1QLS A;  1WRL A;  2PVB A;  2DOQ A;  4M2O A;  4PE4 A;  1XO5 A;  3O4Y A;  3I5F C;  1YUT A;  1WLM A;  1FI5 A;  1QX7 A;  1TNQ A;  2KQY A;  3DF0 A;  4DS7 A;  1CB1 A;  1UUR A;  3CZT X;  3PN7 C;  4PHK A;  1F71 A;  2WC5 A;  2M7N A;  3BYA A;  1YVH A;  3LLE A;  1J7O A;  1Y1X A;  4CFQ A;  1XFR A;  3NXA A;  4GAO A;  3KPX A;  1WLZ A;  2M49 B;  3O6B A;  2QEV A;  3FWB A;  1KFU S;  2F2O A;  2K7B A;  3S0D A;  1FW4 A;  1YRU B;  4ETO A;  1M39 A;  1FBV A;  3DD4 A;  4I5N B;  2M7L A;  2L98 A;  2LVI A;  1IGV A;  1BR4 B;  2K7C A;  5AEQ A;  3N7H A;  1B4C A;  4FQT A;  1SPY A;  1EH2 A;  3M0W A;  4U8D A;  4OVN F;  3I5G B;  1SYM A;  5DKR A;  1J1E A;  1QV0 A;  2VRG A;  3B88 A;  1CDL A;  4YBH B;  4GFT A;  4IJ7 A;  1AK8 A;  1MF8 B;  3F45 A;  2M3W A;  1FF1 A;  4QJ5 B;  1WDC B;  2F3Z A;  2OTG B;  2JTZ A;  3D76 A;  1DJY A;  1JUO A;  1OW4 A;  1QLK A;  3OB1 B;  1P28 A;  2K7O A;  3EK4 A;  1YVL A;  5AXI A;  4I5J A;  1S1E A;  1S6C A;  1T14 A;  4NDC A;  2JOJ A;  1WRK A;  2LP2 A;  3E3R A;  3AKB A;  1MQ1 A;  1SR6 B;  5CSI A;  1GGZ A;  4INX A;  1IQ3 A;  2E30 A;  5CSF A;  2YGU A;  1K9K A;  2I7A A;  4GPL B;  1DF0 A;  3TS5 C;  1TUJ A;  3PLF B;  1BU3 A;  1XYD A;  1DC1 A;  1EJ3 A;  3CZ1 A;  1ORG A;  2L5Y A;  2F33 A;  1DEK A;  1TCO B;  3PM2 A;  1LXF C;  5HKZ A;  1YRT B;  2LV7 A;  3DYE A;  3DVJ A;  3RM1 A;  1DJX A;  3K21 A;  1YUS A;  2H2K A;  1DJH A;  2LHL A;  3VRR A;  2HF5 A;  4FTG A;  4JD9 A;  4GBA A;  3SS4 A;  1F8H A;  1E8A A;  1R6P A;  2KI4 B;  1B8R A;  1K93 D;  1DF0 B;  2ZN9 A;  3SG7 A;  3DY9 A;  1LS8 A;  4OZD A;  2WCM A;  3B6X A;  2JU0 A;  1JBA A;  3D75 A;  1TNW A;  4XJK B;  2BL0 C;  4I5K A;  1OMV A;  3BFH A;  5AER A;  1YUR A;  1B7T Z;  4ORC B;  1J7R A;  2LVJ A;  3KO0 A;  2WCK A;  3DVK A;  4C0J A;  3PAL A;  1K95 A;  3SS3 A;  1C3Y A;  2JTT A;  4YI9 A;  1K94 A;  1OOJ A;  1WRZ A;  2EHB A;  2KGR A;  2ZKM X;  5G08 A;  2HPS A;  1AP4 A;  5DKQ A;  4ORA B;  3NSL A;  5IBW A;  1DJW A;  5HLV A;  2AMI A;  3KEV A;  1CLB A;  2M29 A;  3JVT C;  4PDZ A;  1M31 A;  1RJV A;  3CZ2 A;  2SCP A;  2Q91 A;  2KOT A;  4MZK A;  2KFH A;  1CTR A;  2LLU A;  2WCF A;  3R1P A;  5CPV A;  2EGD A;  2LAP A;  3BOW B;  4F7F A;  2KLE A;  1TUZ A;  1TWO A;  1XFU O;  1OMR A;  5D3O A;  3VRP A;  3V2L A;  4YGB B;  1SKT A;  1RWY A;  1CM1 A;  1FPW A;  1NUB A;  2LP3 A;  2Y4Q A;  2ERB A;  2OS8 C;  2L50 A;  1A75 A;  2MLF C;  4MRY A;  1NSH A;  2HET A;  2MAZ A;  4A4B A;  5BPJ A;  1DGV A;  1CDP A;  4INW A;  4PE1 A;  1YTZ C;  2KFG A;  2WOR A;  3GK4 X;  3JTD B;  3S0G A;  2K0J A;  3PJI A;  1U5I A;  3CLN A;  1L7Z A;  3CYZ A;  3PFV A;  1TNP A;  1NX3 A;  5D69 A;  4CPV A;  3I5I C;  4PE0 A;  3NGV A;  4OR9 B;  3KHE A;  1SL8 A;  3TUY C;  3I5G C;  3IVT A;  1K9U A;  2K61 A;  2BCB A;  1V1F A;  1C3Z A;  4CLN A;  1NCX A;  1A29 A;  2AAO A;  4JKT A;  2L2E A;  3CR2 A;  1OSA A;  1BF5 A;  3FE8 A;  4JWQ A;  1SRA A;  1QIW A;  5FYX A;  3R1V A;  1WDC C;  1UHJ A;  5I2Q A;  1EG3 A;  2OTG C;  3EK8 A;  1JC2 A;  4WQ2 A;  2CBL A;  3OP0 A;  5I8N A;  1F70 A;  3BFA A;  2JT3 A;  2H61 A;  2QEH A;  2P70 A;  3NHT A;  3S0B A;  1ALV A;  3NSI A;  3PAT A;  1K2H A;  2GV5 A;  3IQQ A;  3ZWH A;  1MXE A;  1DQE A;  1LA3 A;  1TCF A;  1DGU A;  1QAS A;  2IS9 A;  1CLM A;  1SR6 C;  2KBI A;  1XFZ O;  2LHI A;  4TNC A;  1NX0 A;  1UHK A;  5FI7 A;  1SCV A; 
#chains in the Genus database with same CATH homology
 3EVR A;  1DTL A;  4D1E A;  3DF0 B;  2BEC A;  1XFV O;  1N0Y A;  2LE9 B;  1XFY O;  1J55 A;  2I2R E;  2LUX A;  1B8C A;  1QJT A;  2M1K B;  1V1G A;  3IF7 A;  2JT8 A;  1JSA A;  1LKJ A;  5B8I B;  1GGW A;  1SL9 A;  3SIB A;  1KWO B;  2LC5 A;  2NCP A;  2LVV A;  1NPQ A;  3QRX A;  4R1E A;  5KTY A;  1G8I A;  4CFR A;  3FIA A;  3CTN A;  2Y1N A;  1CNP A;  4GGF C;  4MVF A;  1B7T Y;  2KNE A;  2LUC A;  2PAS A;  2KI4 C;  4MZL A;  1N65 A;  5JJG A;  3DVM A;  1JF2 A;  1HQV A;  1VRK A;  1CDM A;  3I5F B;  1M45 A;  4MLW A;  2MRD A;  5J3X A;  1YR5 A;  4AOM A;  4MN0 A;  3PN7 B;  2EC6 C;  5CSJ A;  3D10 A;  4AQJ A;  1CMF A;  4HRE E;  2JXL A;  1F54 A;  1UHN A;  3BUW B;  1OE9 B;  4MRX A;  1S5G Z;  1EL4 A;  1PVB A;  2Y5I A;  2KQ6 A;  1KQV A;  2KFF A;  3SG4 A;  1BT6 A;  2LLT A;  1YX7 A;  2JXC A;  2P6B B;  3HCM A;  1BG1 A;  4ZCU A;  1F4Q A;  5ER5 A;  1KK8 C;  1IJ5 A;  1TNX A;  1RTP 1;  3D0Y A;  5K89 A;  1J7P A;  2K7D A;  4L9M A;  3LCP C;  3EKJ A;  2WC8 A;  3SJS A;  1PVA A;  3BXK A;  2JPT A;  1SY9 A;  3EKH A;  5DKN A;  1JFK A;  1S26 D;  4ICB A;  4MZJ A;  3SG2 A;  1AUI B;  1DJG A;  2K2F A;  1UUS A;  1XA5 A;  5F6T A;  1CMG A;  3ZNI A;  1NIW A;  2NLN A;  1PK0 D;  2KI6 C;  5HKW A;  2F8P A;  1Q80 A;  2AUC A;  2WCE A;  3GOF A;  1CFD A;  4PE7 A;  4ORB B;  1NWD A;  2M1U A;  1AJ4 A;  1CLL A;  1D1O A;  1OZS A;  3OX5 A;  1ZOT B;  1L2O C;  2A4J A;  1BR1 B;  2WOS A;  4MEW A;  4Q04 A;  1PSB A;  1LA0 A;  1SNL A;  2MHH A;  2BBN A;  1M46 A;  1QTX A;  5JOL A;  1TIZ A;  2CT9 A;  2BKI B;  4MBE A;  1BLQ A;  4WQ3 A;  2RGI A;  2GGM A;  4YGC B;  1CDN A;  1KFX L;  4I5L B;  4OKH A;  1REC A;  1SCM C;  2JNX A;  2KYF A;  2LMT A;  1SK6 D;  3TS5 B;  5AAN A;  1SL7 A;  2LAN A;  3PM8 A;  3JTD C;  4BY5 A;  4M2Q A;  5HLO A;  3VRO A;  3I5H C;  1N2D A;  2M8U A;  1QXP A;  1A2X A;  1ZUZ A;  4HSZ A;  2PSR A;  1C7W A;  3DVE A;  1MXL C;  4HRH A;  1WY9 A;  3BQ3 A;  1K90 D;  3LL8 B;  3LK1 A;  1C7V A;  1QVI Z;  1TTX A;  3TZ1 A;  1KSO A;  4HRG A;  1B9A A;  4PHM A;  1KFU L;  1XK4 C;  4YGA A;  2MBX A;  3OHM B;  4CID A;  2M9G A;  2MJW B;  2JWW A;  2ISD A;  3A4U B;  1IKU A;  1DMO A;  2PAL A;  1CFP A;  3KF9 A;  1IRJ A;  2FCD A;  2JT0 A;  1A03 A;  4N5X A;  3CR5 X;  2LMU A;  1KQM B;  1SBJ A;  2HQW A;  4AQI A;  1FI6 A;  1KK7 Z;  3OX6 A;  1RFJ A;  2K2A A;  5HYD A;  3ICB A;  1IG5 A;  2L51 A;  2CCM A;  3BUM B;  5GQQ C;  3AAJ A;  1NYA A;  2ZNE A;  3C1V A;  2LMV A;  2FJU B;  1A75 B;  1MWN A;  2ZRT A;  2ZRS A;  1NX2 A;  3FS7 A;  2K8M B;  1XVJ A;  2PMY A;  1KWO C;  2O5G A;  3NSO A;  1H8B A;  3BUO B;  1ZMZ A;  1U5I B;  1S5G Y;  1B8L A;  2WND A;  1G33 A;  5D7F A;  2L5X B;  4WRI A;  2B1U A;  2Q4U A;  2ZFD A;  1Y1A A;  4A4C A;  4NDB A;  1KSM A;  1OZO A;  4FQO A;  1X02 A;  2I18 A;  1QX2 A;  1F4O A;  2GGZ A;  2KSP A;  2ZN8 A;  2FOT A;  1K96 A;  3WNX B;  3TDU A;  4PAL A;  1MR8 A;  2JNF A;  2SAS A;  3VRQ A;  4NQG A;  2TN4 A;  4QJ3 B;  2LLS A;  2OS8 B;  1HT9 A;  2WCB A;  4JQ0 D;  3VRN A;  3EK7 A;  4BY4 A;  5AFP A;  2BBM A;  3O78 A;  1AVS A;  2BE4 A;  2JUL A;  2MA2 A;  1C07 A;  4MSP A;  3TDZ A;  1AHR A;  1EXR A;  4PHN A;  1TOP A;  1ZFS A;  2I94 A;  1DJZ A;  2QPT A;  1DJI A;  3I5I B;  3NSK A;  3TUY B;  1LIN A;  2R2I A;  1M63 B;  3RLZ A;  1S36 A;  2M97 A;  4M2P A;  1B1G A;  3BUX B;  2F3Y A;  4P5O E;  3CWG A;  1XFX O;  5I2O A;  2Y1M A;  1CM4 A;  1IJ6 A;  4F0Z B;  5TNC A;  1SMG A;  1ALW A;  1PRW A;  2L0P A;  2KGB C;  2KBM A;  1NCY A;  1NCZ A;  1QIV A;  4PHJ A;  1JFJ A;  3VGO A;  1CFC A;  1CKK A;  4XYN A;  3A8R A;  1PUL A;  3O2P A;  1YX8 A;  3PSR A;  3MSE B;  1UHI A;  3EVV A;  2L4I A;  4USL A;  3WXA A;  2CTN A;  4GGF A;  1PAL A;  1RK9 A;  2QAC A;  4JPZ B;  4ZCV A;  2G2B A;  1OMD A;  4NDD A;  3SG6 A;  1UWO A;  2G9B A;  1W7J B;  3HX4 A;  2HQ8 A;  1QVI Y;  5KSZ A;  1YUU A;  4C0K A;  2PRU A;  2KDH A;  2BCA A;  1J1D A;  1Y6W A;  2KAY A;  2BE6 A;  4XJK A;  2KAX A;  1IWQ A;  2CNP A;  2KI6 D;  5KU1 A;  1LVC D;  3GK2 A;  3BUN B;  3D0Y B;  1ODB A;  1QAT A;  1J7Q A;  4OCI A;  1NX1 A;  1KK7 Y;  4E68 A;  4GUK A;  2JC2 A;  1QV1 A;  5I2L A;  2MLE C;  3WHU B;  1DVI A;  1K9P A;  4YGD B;  4DCK A;  2JZI A;  1TRF A;  1F55 A;  1B47 A;  2EC6 B;  4QJ4 B;  3IQO A;  1K8U A;  1JWD A;  4P2Y B;  2NZ0 A;  2E6W A;  4DUQ A;  1KQM C;  2NXQ A;  1ZAC A;  4UPG A;  1OQP A;  1MHO A;  1S3P A;  5CSN A;  1R2U A;  3CR4 X;  1NP8 A;  2ZND A;  2CXJ A;  2BCX A;  1PSR A;  3SG3 A;  2FCE A;  2COL B;  1KK8 B;  1Y1U A;  1EG4 A;  3BOW A;  4IL1 A;  1QX5 B;  4PCW A;  2O60 A;  1DT7 B;  1BOD A;  3CGA A;  5PAL A;  1MUX A;  4GGN A;  4YI8 A;  2M0R A;  3CS1 A;  3H4S E;  1RRO A;  2LCP A;  2BKH B;  4N1F A;  1H4B A;  2F2P A;  3SG5 A;  1AJ5 A;  1Y0V H;  2JRF A;  2OPO A;  1KCY A;  1GQM A;  2BL0 B;  2LM5 A;  4YGE B;  1IQ5 A;  4OV2 A;  3TDI A;  1L2O B;  2NCO A;  1XFW O;  5HKY A;  3WHT B;  4C0L A;  1UP5 A;  2LNK A;  1BMO A;  2V53 A;  4YRU A;  1G4Y R;  2L4H A;  2LVK A;  3SIA A;  4N1G A;  2JQ6 A;  4DRW A;  1A4P A;  1SCM B;  1S6J A;  3OB2 B;  1CFF A;  1QS7 A;  1XK4 A;  2D8N A;  2KAV A;  3GK1 A;  1SW8 A;  3AKA A;  2KHN A;  1KFX S;  1JF0 A;  4DIR A;  1W7I B;  5ER4 X;  2H61 C;  4GNK B;  3LK0 A;  1BOC A;  3AAK A;  1S6I A;  3I5H B;  3FWC A;  3JVT B;  1GJY A;  1BJF A;  1IH0 A;  2KYC A;  3EVU A;  1TN4 A;  1UHH A;  1QLS A;  1WRL A;  2PVB A;  2DOQ A;  4M2O A;  4PE4 A;  1XO5 A;  3O4Y A;  3I5F C;  1YUT A;  1WLM A;  1FI5 A;  1QX7 A;  1TNQ A;  2KQY A;  3DF0 A;  4DS7 A;  1CB1 A;  1UUR A;  3CZT X;  3PN7 C;  4PHK A;  1F71 A;  2M7N A;  3BYA A;  1YVH A;  3LLE A;  1J7O A;  1Y1X A;  4CFQ A;  3NXA A;  4GAO A;  3KPX A;  1WLZ A;  2M49 B;  3O6B A;  4ETO A;  3FWB A;  1KFU S;  2F2O A;  2K7B A;  1FW4 A;  1YRU B;  1M39 A;  1FBV A;  3DD4 A;  4I5N B;  2M7L A;  2L98 A;  2LVI A;  1IGV A;  1BR4 B;  2K7C A;  5AEQ A;  1B4C A;  1SPY A;  1EH2 A;  3M0W A;  4U8D A;  4OVN F;  3I5G B;  1SYM A;  5DKR A;  1J1E A;  1QV0 A;  2VRG A;  1CDL A;  4YBH B;  4GFT A;  1AK8 A;  1MF8 B;  3F45 A;  2M3W A;  1FF1 A;  4QJ5 B;  1WDC B;  2F3Z A;  2OTG B;  2JTZ A;  1DJY A;  1JUO A;  3OB1 B;  1QLK A;  2K7O A;  3EK4 A;  1YVL A;  5AXI A;  4I5J A;  1S1E A;  1S6C A;  4NDC A;  2JOJ A;  1WRK A;  2LP2 A;  3E3R A;  3AKB A;  1MQ1 A;  1SR6 B;  5CSI A;  1GGZ A;  1IQ3 A;  2E30 A;  5CSF A;  1K9K A;  2I7A A;  4GPL B;  1DF0 A;  3TS5 C;  3PLF B;  1BU3 A;  1XYD A;  1EJ3 A;  2F33 A;  1TCO B;  1LXF C;  5HKZ A;  1YRT B;  2LV7 A;  3DVJ A;  3RM1 A;  1DJX A;  3K21 A;  1YUS A;  2H2K A;  1DJH A;  2LHL A;  3VRR A;  2HF5 A;  4FTG A;  4GBA A;  1F8H A;  1E8A A;  1R6P A;  2KI4 B;  1B8R A;  1K93 D;  1DF0 B;  2ZN9 A;  3SG7 A;  2JU0 A;  1JBA A;  1TNW A;  4XJK B;  2BL0 C;  4I5K A;  1OMV A;  5AER A;  1YUR A;  1B7T Z;  4ORC B;  1J7R A;  2LVJ A;  3KO0 A;  3DVK A;  4C0J A;  3PAL A;  1K95 A;  2JTT A;  4YI9 A;  1K94 A;  1OOJ A;  1WRZ A;  2EHB A;  2KGR A;  2ZKM X;  5G08 A;  2HPS A;  1AP4 A;  5DKQ A;  4ORA B;  3NSL A;  5IBW A;  1DJW A;  5HLV A;  2AMI A;  3KEV A;  1CLB A;  2M29 A;  3JVT C;  4PDZ A;  1M31 A;  1RJV A;  2SCP A;  2Q91 A;  2KOT A;  4MZK A;  2KFH A;  1CTR A;  2LLU A;  2WCF A;  5CPV A;  2EGD A;  2LAP A;  3BOW B;  1XFU O;  1OMR A;  3VRP A;  4YGB B;  1SKT A;  1RWY A;  1CM1 A;  1FPW A;  1NUB A;  2LP3 A;  2Y4Q A;  2OS8 C;  2L50 A;  1A75 A;  2MLF C;  4MRY A;  1NSH A;  2HET A;  2MAZ A;  4A4B A;  5BPJ A;  1DGV A;  1CDP A;  4PE1 A;  1YTZ C;  2KFG A;  2WOR A;  3GK4 X;  3JTD B;  2K0J A;  1U5I A;  3CLN A;  1L7Z A;  3PFV A;  1TNP A;  1NX3 A;  5D69 A;  4CPV A;  3I5I C;  4PE0 A;  4OR9 B;  3KHE A;  1SL8 A;  3TUY C;  3I5G C;  1K9U A;  2K61 A;  2BCB A;  1V1F A;  4CLN A;  1NCX A;  1A29 A;  2AAO A;  2L2E A;  3CR2 A;  1OSA A;  1BF5 A;  4JWQ A;  1SRA A;  1QIW A;  5FYX A;  5I2Q A;  1WDC C;  1UHJ A;  1EG3 A;  2OTG C;  3EK8 A;  1JC2 A;  4WQ2 A;  2CBL A;  3OP0 A;  5I8N A;  1F70 A;  2JT3 A;  2H61 A;  1ALV A;  3NSI A;  3PAT A;  1K2H A;  2GV5 A;  3IQQ A;  3ZWH A;  1MXE A;  1LA3 A;  1TCF A;  1DGU A;  1QAS A;  2IS9 A;  1CLM A;  1SR6 C;  2KBI A;  1XFZ O;  2LHI A;  4TNC A;  1NX0 A;  1UHK A;  1SCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...