1BT6A

P11 (s100a10), ligand of annexin ii in complex with annexin ii n-terminus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A10
publication title The crystal structure of a complex of p11 with the annexin II N-terminal peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (ligand/annexin)
total genus 30
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1bt6A00
2K7BA 2JXLA 3GK4X 1UHKA 2WCEA 4E68A 1A29A 2JC2A 2WCBA 1TTXA 4HSZA 5HLOA 2B1UA 2L50A 3CWGA 1MXEA 2A4JA 1DMOA 1SL8A 2H61A 2LVVA 3SIAA 3LCPC 3NSIA 1CFPA 2Y5IA 3LK0A 1WDCB 3LL8B 4CIDA 4PHMA 1CDPA 1Y0VH 1PULA 5KTYA 1J7PA 1A2XA 1YVLA 1YRUB 1AVSA 2BKHB 1S5GY 1F4OA 2L98A 2D8NA 5FYXA 2BBMA 1CB1A 3PN7C 4GGNA 2F2OA 1AUIB 1WRKA 1WRLA 1B7TY 5I8NA 3HX4A 3D10A 1XK4A 2JU0A 2MHHA 4BY5A 1EXRA 3H4SE 1K93D 2LHIA 3SJSA 3NSLA 1TCFA 4DCKA 5DKQA 2EGDA 3VRPA 1DGUA 1GGZA 2KAYA 2L4IA 1CMGA 2E6WA 4YI8A 3I5IC 1L2OB 1F4QA 4GBAA 1S5GZ 3BUNB 2WC8A 2VRGA 2LP3A 4M2QA 1F70A 3I5GB 2HQWA 2BCXA 1NP8A 3ICBA 4MRYA 1B7TZ 2F8PA 1KQMC 1M45A 2LLSA 1DTLA 1N0YA 2LUXA 2K7CA 3TDUA 2RGIA 2M7NA 1K9UA 2L2EA 4CFQA 1YTZC 2OTGC 2Y1MA 2HF5A 1RJVA 2PASA 3O6BA 1WRZA 2CXJA 1N65A 1MWNA 3EKHA 2KYCA 3DF0B 2JTTA 4C0JA 2ISDA 1F55A 3CR5X 1UHHA 3E3RA 4QJ3B 3IQQA 4DIRA 1OE9B 4P5OE 5CPVA 1S6IA 1LXFC 5CSFA 3CTNA 3VRRA 1LVCD 3SG4A 1CDNA 5CSIA 2BE6A 1S1EA 2JNFA 3TS5B 2K7DA 4DS7A 4ICBA 2K7OA 2IS9A 1GGWA 3RM1A 4NDDA 1NWDA 3OP0A 1IG5A 1KK8B 4XJKA 1KFUS 1OMDA 2CNPA 2JXCA 2M8UA 3FWCA 2O60A 1K95A 1EJ3A 1UP5A 4YBHB 2EHBA 3NSKA 2LUCA 4MBEA 3DVKA 1A03A 1UURA 5CSJA 4NQGA 1B47A 4IL1A 3GK2A 1SK6D 4CFRA 3DD4A 1ZUZA 2EC6C 4PALA 1WLMA 1H8BA 1BLQA 2COLB 1CDMA 2M7LA 1SKTA 1NX2A 2CCMA 3PALA 2CBLA 1YVHA 4FTGA 1KFXL 1QX5B 1S36A 1K2HA 1YX8A 1K96A 2KAVA 4PHNA 2JWWA 1CMFA 1OQPA 2M0RA 2M1UA 4WQ2A 1PRWA 4DUQA 2R2IA 3I5HB 1WDCC 2M1KB 3I5FC 1KSOA 1J7QA 1Y1UA 1SR6C 2KI6C 4YGDB 2LCPA 4PE0A 5DKNA 5F6TA 3IF7A 1B1GA 1ZFSA 2NLNA 1WY9A 1M31A 1SMGA 1TNQA 3SG2A 4MLWA 2BL0C 1B8LA 2FCEA 1JUOA 1NPQA 1PVBA 4ZCUA 1XFZO 1FBVA 4ORCB 1EH2A 1N2DA 4R1EA 2M97A 2BECA 3LLEA 1EG4A 5HLVA 1VRKA 2L4HA 1IQ3A 5HYDA 2KFFA 3BQ3A 1S26D 3GOFA 1IJ5A 4MEWA 5AEQA 5PALA 3DF0A 1BG1A 1UHIA 1QVIY 3JVTC 2SASA 3EVRA 5JJGA 1OOJA 1J7RA 2LLUA 3RLZA 3ZNIA 1FI6A 1UHJA 2M29A 1AHRA 2I2RE 5KSZA 5CSNA 5D7FA 5AANA 1AJ4A 1NIWA 3BUXB 4N5XA 5J3XA 3WHTB 4C0KA 3OB1B 1UWOA 2NCPA 2OS8B 1BMOA 1ZOTB 1K8UA 4AQIA 4ORBB 5AXIA 1BODA 3DVJA 1D1OA 4Q04A 1B4CA 1DJWA 4PE7A 3BYAA 2BCAA 1FF1A 1YUUA 3VGOA 1F71A 2K61A 3BOWB 4ZCVA 3TS5C 4A4BA 1IRJA 2LANA 3F45A 1NSHA 1XYDA 4HRHA 3VROA 3KF9A 1TNPA 2H61C 1QLSA 3NSOA 2FCDA 2MAZA 1AP4A 2LV7A 1TRFA 2F2PA 1IQ5A 5GQQC 2MA2A 1M63B 2G2BA 2LMVA 1XFXO 2CT9A 1A75B 5I2LA 3MSEB 4GNKB 1S6JA 1BR4B 2MJWB 1V1FA 2WNDA 3IQOA 1IKUA 1S3PA 4YGCB 2KI6D 1XK4C 4USLA 4HREE 3JTDB 1F54A 2MRDA 2ZRTA 4MZJA 1SRAA 1RFJA 3EK4A 3NXAA 4HRGA 1JC2A 3CZTX 1C07A 1LA3A 1JFJA 1IGVA 1CLMA 5I2OA 3SG7A 5AFPA 3I5HC 3PM8A 1XFUO 1OMVA 1QS7A 3FWBA 1KWOC 1PALA 2JPTA 1OZSA 1C7VA 1SCVA 2BE4A 2LP2A 4GPLB 5IBWA 3AKAA 3VRNA 1DJIA 2K8MB 2PMYA 5KU1A 1DJYA 3SG5A 3TUYB 1V1GA 1YUSA 1HT9A 1QV0A 1JF0A 5ER5A 1UUSA 1DF0B 4GGFA 1CM4A 1RTP1 1K94A 1NCXA 1QX7A 2LMTA 2BKIB 2F3ZA 1BT6A 3TZ1A 4C0LA 3PSRA 4XYNA 1TNWA 1QXPA 1MHOA 4MZLA 1IWQA 1KQVA 1SL9A 3TDIA 4GGFC 4DRWA 4NDBA 1Y1XA 1UHNA 2Y4QA 2KI4C 2M9GA 1HQVA 2PVBA 1AK8A 1KFXS 1ODBA 3EK7A 3BOWA 1SL7A 5B8IB 1Q80A 2OS8C 4L9MA 3VRQA 1KFUL 1KCYA 1CKKA 4CLNA 2KFHA 4AQJA 1YUTA 4OR9B 1KSMA 2P6BB 1LINA 3I5IB 1DVIA 1A75A 5AERA 4I5LB 1M39A 5ER4X 3KO0A 2MLEC 1G33A 2KQ6A 4YRUA 1K90D 4MN0A 2Y1NA 3OHMB 3CR4X 1B8CA 1KQMB 1QIVA 3OX5A 2L51A 4FQOA 1OZOA 1U5IB 2QPTA 2DOQA 2FJUB 4YGAA 3WNXB 4U8DA 1OMRA 2KNEA 3A4UB 3PATA 4I5KA 1L2OC 4MVFA 2KGBC 4JQ0D 4OKHA 3OX6A 1E8AA 1XVJA 3I5GC 3JTDC 3PLFB 2LC5A 1SNLA 3KHEA 2LVJA 4PHJA 1YRTB 2MLFC 3AAJA 1YR5A 2QACA 2ZNDA 3OB2B 1JWDA 1PVAA 1RROA 2JT3A 1BJFA 1QTXA 1QASA 3TDZA 1TCOB 2KYFA 4PHKA 5TNCA 5HKZA 3A8RA 1DF0A 1EG3A 1DJHA 1QX2A 1XO5A 2K0JA 3WHUB 1YX7A 4MZKA 3O78A 1ZMZA 4OVNF 1PK0D 1SY9A 2K2FA 1IJ6A 4F0ZB 2KFGA 1CFCA 1QVIZ 1M46A 1QJTA 2ZN9A 2PSRA 1GJYA 2TN4A 5BPJA 1JFKA 1NX1A 2EC6B 2JRFA 2L0PA 2ZFDA 1CFDA 1KK8C 3KPXA 4GFTA 5DKRA 2SCPA 2HPSA 1ZACA 1B8RA 2L5XB 1MQ1A 1BR1B 1NYAA 2FOTA 2JNXA 4YGBB 1CTRA 4I5NB 2NZ0A 1XFYO 1C7WA 1ALWA 3I5FB 4BY4A 4ETOA 4D1EA 1H4BA 1SR6B 1MF8B 2LE9B 3SG3A 1KK7Y 1QATA 1MUXA 2I94A 1TIZA 2LMUA 1NX0A 2JT8A 3BUWB 1BU3A 2BL0B 3FS7A 4JPZB 1SW8A 3SG6A 3FIAA 1QLKA 2JZIA 3SIBA 3WXAA 5I2QA 3QRXA 1MR8A 1XFVO 2O5GA 4ORAB 1K9KA 4TNCA 1X02A 2K2AA 1A4PA 3GK1A 4N1GA 3D0YB 4PCWA 2Q4UA 2MBXA 1U5IA 2LVIA 3K21A 1NX3A 1SCMB 2ZNEA 1KK7Z 1WLZA 4MSPA 1DJZA 3PFVA 1Y6WA 4JWQA 3JVTB 4YI9A 3EVVA 1AJ5A 1DJXA 1MXLC 1SBJA 3CS1A 1NUBA 1DT7B 2PALA 2LAPA 1J55A 3O4YA 3LK1A 3CGAA 1RECA 1TOPA 2GGZA 4OCIA 2JQ6A 1ALVA 2M3WA 2F3YA 1PSBA 2OPOA 3HCMA 2BBNA 3DVEA 4YGEB 1XA5A 2JTZA 1JBAA 2KSPA 1TNXA 2I7AA 1G4YR 1J1EA 2LVKA 1J1DA 1Y1AA 1RK9A 3CR2A 1FI5A 3PN7B 2KQYA 2WCFA 3M0WA 2G9BA 2ZRSA 2KAXA 2NCOA 2ZN8A 1W7JB 1LA0A 1CDLA 1DGVA 2PRUA 3EKJA 2CTNA 2GV5A 1BOCA 1R2UA 2H2KA 2LHLA 1W7IB 3KEVA 1TN4A 1YURA 1QIWA 1BF5A 3BUOB 2LLTA 3EK8A 1J7OA 2I18A 3AKBA 4QJ4B 1CFFA 3BXKA 4OV2A 1SPYA 2KOTA 1F8HA 3DVMA 1B9AA 3O2PA 4GUKA 5HKYA 1OSAA 2OTGB 1S6CA 2AMIA 5HKWA 1RWYA 1JSAA 1EL4A 1FPWA 2JT0A 1K9PA 4CPVA 4QJ5B 4AOMA 5G08A 4WRIA 1KWOB 1CLLA 2HETA 2WORA 2WOSA 4PE1A 1R6PA 1CM1A 1CLBA 3C1VA 5K89A 2BCBA 2F33A 2NXQA 4PE4A 1IH0A 2HQ8A 3BUMB 2M49B 3D0YA 1CNPA 1GQMA 2KBIA 2ZKMX 4M2OA 2GGMA 2AAOA 3ZWHA 4N1FA 2AUCA 1PSRA 4A4CA 1SYMA 2Q91A 2KBMA 1QV1A 1G8IA 1XFWO 1DJGA 4UPGA 4P2YB 2JOJA 2LM5A 2KDHA 2V53A 4NDCA 4MRXA 4WQ3A 1JF2A 4PDZA 1NCYA 3AAKA 1NCZA 3EVUA 1L7ZA 2LNKA 1SCMC 2KHNA 2KGRA 5JOLA 2E30A 3TUYC 4I5JA 2JULA 4GAOA 4M2PA 1LKJA 4XJKB 2KI4B 5D69A 1FW4A 3CLNA
chains in the Genus database with same CATH superfamily
2K7BA 1IIOA 2JXLA 3GK4X 1SSEB 1UHKA 2WCEA 4E68A 1A29A 2JC2A 3RZSA 2WCBA 1TTXA 2PYQA 4HSZA 5HLOA 2B1UA 2L50A 3CWGA 1MXEA 1W9ZA 2A4JA 1DMOA 1SL8A 2H61A 2LVVA 3SIAA 3LCPC 3NSIA 1CFPA 2Y5IA 3LK0A 1WDCB 3LL8B 4CIDA 4PHMA 1CDPA 1Y0VH 1PULA 5KTYA 1J7PA 1A2XA 1YVLA 1YRUB 1AVSA 2BKHB 1S5GY 3BJHA 1F4OA 3DZTA 4FQTA 2L98A 2D8NA 5FYXA 2BBMA 1CB1A 3PN7C 3L4LA 4GGNA 2F2OA 1AUIB 1C3ZA 1WRLA 1WRKA 1B7TY 5I8NA 3HX4A 3D10A 1XK4A 2JU0A 2MHHA 4PT1A 4BY5A 1EXRA 3H4SE 1K93D 2LHIA 3SJSA 3NSLA 1TCFA 4DCKA 5DKQA 2EGDA 4F7FA 3VRPA 1DGUA 1GGZA 2KAYA 2L4IA 1CMGA 2E6WA 4YI8A 3I5IC 1L2OB 1F4QA 3CZ2A 4GBAA 1DEKA 1S5GZ 3BUNB 2WC8A 2VRGA 2LP3A 4M2QA 3S0DA 1F70A 3I5GB 2HQWA 2BCXA 3S0EA 1NP8A 3ICBA 4MRYA 1B7TZ 3K1EA 2F8PA 1KQMC 1M45A 2LLSA 1DTLA 1N0YA 2LUXA 2K7CA 2H8VA 3TDUA 2K60A 2RGIA 2M7NA 1K9UA 2L2EA 4CFQA 1YTZC 2OTGC 2Y1MA 2HF5A 1RJVA 2PASA 3O6BA 1WRZA 2CXJA 1N65A 1MWNA 3EKHA 2KYCA 3DF0B 2JTTA 4C0JA 3SS3A 3D76A 3UO9A 2ISDA 1F55A 3CR5X 1UHHA 3O4XA 3E3RA 4QJ3B 3OBVA 3IQQA 4DIRA 1OE9B 4P5OE 5CPVA 1S6IA 1LXFC 3D77A 3CDNA 5CSFA 3CTNA 3VRRA 1LVCD 3SG4A 1CDNA 5CSIA 2BE6A 1S1EA 2JNFA 3TS5B 2K7DA 4DS7A 4ICBA 2K7OA 2IS9A 1GGWA 3RM1A 4NDDA 3NHIA 1NWDA 3OP0A 1IG5A 1KK8B 4XJKA 1KFUS 1OMDA 2CNPA 2JXCA 2M8UA 2WCJA 2O60A 1K95A 3FWCA 1EJ3A 3V2LA 1UP5A 4YBHB 2EHBA 3NSKA 2LUCA 4MBEA 3DVKA 1A03A 1UURA 5CSJA 3IVTA 4NQGA 1B47A 4IL1A 3GK2A 1SK6D 4CFRA 3DD4A 1ZUZA 2EC6C 4PALA 1WLMA 1H8BA 1BLQA 2COLB 1CDMA 2M7LA 1SKTA 5I94A 1NX2A 2CCMA 3PALA 2CBLA 1YVHA 4FTGA 1KFXL 1QX5B 1S36A 1TUJA 1K2HA 1YX8A 1K96A 2KAVA 4PHNA 2JWWA 1CMFA 1OQPA 2M0RA 2M1UA 3DYEA 4WQ2A 1PRWA 4DUQA 2R2IA 3I5HB 1WDCC 2M1KB 2L2CA 3I5FC 1KSOA 1J7QA 1Y1UA 1SR6C 2KI6C 3PJIA 4YGDB 2LCPA 4PE0A 5DKNA 3B88A 5F6TA 3IF7A 1B1GA 1ZFSA 2NLNA 1WY9A 1M31A 1SMGA 1TNQA 3SG2A 4MLWA 2BL0C 1B8LA 2FCEA 1JUOA 2BNXA 1NPQA 1PVBA 5FI7A 4ZCUA 1XFZO 1FBVA 4ORCB 1EH2A 1N2DA 4R1EA 2M97A 1Z2CB 2BECA 3LLEA 1EG4A 5HLVA 1VRKA 2L4HA 1IQ3A 5HYDA 2KFFA 3BQ3A 1S26D 3GOFA 1IJ5A 4IJ7A 4MEWA 5AEQA 5PALA 3S0AA 3DF0A 1BG1A 1UHIA 1QVIY 3JVTC 3S0GA 2SASA 3EVRA 5JJGA 1OOJA 1J7RA 2LLUA 3RLZA 3ZNIA 1FI6A 1UHJA 2M29A 1AHRA 2I2RE 5KSZA 5CSNA 5D7FA 5AANA 1AJ4A 1NIWA 3BUXB 4N5XA 5J3XA 3WHTB 4C0KA 3OB1B 1UWOA 2NCPA 2BAPA 2OS8B 1BMOA 1ZOTB 1K8UA 4AQIA 4ORBB 5EL2A 5AXIA 3DVJA 1BODA 1D1OA 4Q04A 1B4CA 1DJWA 4PE7A 3BYAA 2BCAA 1FF1A 1YUUA 3VGOA 1F71A 1XFRA 2K61A 3BOWB 4ZCVA 3TS5C 4A4BA 1IRJA 2LANA 3F45A 1NSHA 1XYDA 4HRHA 3VROA 3CZ1A 3KF9A 1TNPA 2H61C 1QLSA 3NSOA 2FCDA 2MAZA 4JKTA 1AP4A 2LV7A 1TRFA 2WCHA 2F2PA 1IQ5A 5GQQC 2MA2A 1M63B 2G2BA 2LMVA 1XFXO 2CT9A 1A75B 5I2LA 3MSEB 4GNKB 1S6JA 1BR4B 2MJWB 1V1FA 1OW4A 2WNDA 3IQOA 1IKUA 1S3PA 4YGCB 2KI6D 1XK4C 2KLEA 4USLA 4HREE 3JTDB 1F54A 2MRDA 2ZRTA 3B87A 4MZJA 1SRAA 1OOGA 1RFJA 3EK4A 3NXAA 4HRGA 1JC2A 3CZTX 1C07A 1LA3A 1JFJA 1IGVA 1CLMA 5I2OA 3SG7A 4OZDA 1OOIX 5AFPA 3I5HC 3PM8A 1XFUO 1OMVA 1QS7A 3FWBA 1KWOC 1PALA 2JPTA 3FE8A 1OZSA 1C7VA 1SCVA 2BE4A 3L47A 2LP2A 4GPLB 5IBWA 3AKAA 3VRNA 1DJIA 1TWOA 2K8MB 2PMYA 1DJYA 5KU1A 3SG5A 3TUYB 3Q8IA 1V1GA 1YUSA 1HT9A 1QV0A 1JF0A 5ER5A 1UUSA 1DF0B 4GGFA 1CM4A 1RTP1 1K94A 1NCXA 1QX7A 5FI2A 2LMTA 2BKIB 2F3ZA 1BT6A 2QEBA 3TZ1A 1DQEA 4C0LA 3PSRA 4XYNA 1TNWA 1QXPA 1MHOA 4MZLA 1IWQA 2QEHA 1KQVA 1SL9A 3TDIA 4GGFC 4DRWA 1GM0A 4NDBA 1Y1XA 1UHNA 2WCKA 2Y4QA 2KI4C 2M9GA 3R72A 1HQVA 2PVBA 1AK8A 1KFXS 1ODBA 2GTEA 3EK7A 4INXA 2P71A 3BOWA 1SL7A 5B8IB 1Q80A 3BFAA 2KLDA 2OS8C 4L9MA 3DXLA 3VRQA 1KFUL 1KCYA 4JD9A 4CLNA 2KFHA 1CKKA 4AQJA 1YUTA 4OR9B 1KSMA 2P6BB 1LINA 3I5IB 1DVIA 1A75A 5AERA 4I5LB 1M39A 1OOFA 5ER4X 3KO0A 2MLEC 2ERBA 1G33A 2KQ6A 4YRUA 1K90D 4MN0A 2Y1NA 3OHMB 3OGNA 3CR4X 1B8CA 1KQMB 1OOHA 1QIVA 3OX5A 3S0FA 3B6XA 2L51A 4FQOA 1OZOA 1U5IB 2QPTA 5D3OA 2DOQA 2FJUB 4YGAA 3WNXB 4U8DA 1OMRA 2KNEA 3A4UB 3PATA 4I5KA 1L2OC 4MVFA 2KGBC 1Z4HA 3BFBA 3D73A 3OX6A 1E8AA 1XVJA 3I5GC 3JTDC 4JQ0D 4OKHA 3PLFB 2LC5A 1SNLA 3KHEA 2LVJA 1QWVA 1YRTB 2MLFC 2WC5A 3AAJA 1YR5A 2QACA 2ZNDA 3OB2B 4PHJA 1PVAA 1RROA 1JWDA 2JT3A 1BJFA 1QTXA 1QASA 3TDZA 1TCOB 2KYFA 4PHKA 5TNCA 5HKZA 3A8RA 1DF0A 1EG3A 1DJHA 1QX2A 1XO5A 2K0JA 3WHUB 1YX7A 3CABA 3O78A 4MZKA 1ZMZA 4OVNF 1PK0D 1SY9A 2K2FA 1IJ6A 4F0ZB 2KFGA 1CFCA 1QVIZ 1M46A 1QJTA 2ZN9A 2PSRA 1GJYA 2TN4A 5BPJA 1JFKA 1NX1A 2EC6B 2JRFA 3EG5B 2L0PA 2ZFDA 1CFDA 1KK8C 3KPXA 4GFTA 5DKRA 5HL1A 2SCPA 2HPSA 1ZACA 1B8RA 2L5XB 1MQ1A 1BR1B 1NYAA 2FOTA 2JNXA 4YGBB 1CTRA 4I5NB 2NZ0A 1XFYO 1C7WA 1ALWA 3I5FB 4BY4A 4ETOA 4D1EA 1H4BA 3NHTA 1DELA 1SR6B 1MF8B 2FJYA 2LE9B 3SG3A 3UNWA 3SS5A 1KK7Y 1QATA 1MUXA 2WCLA 2I94A 1TIZA 3D75A 2LMUA 1NX0A 2JT8A 3BUWB 1BU3A 3VB1A 2BL0B 3FS7A 4JPZB 1SW8A 3SG6A 3SS4A 3FIAA 1QLKA 2JZIA 4KYNA 1TUZA 2WC6A 3CYZA 3SIBA 3WXAA 5I2QA 3QMEA 3QRXA 2QEOA 1MR8A 1XFVO 2O5GA 4ORAB 1K9KA 4TNCA 1X02A 2K2AA 1A4PA 3GK1A 4N1GA 3D0YB 4PCWA 2Q4UA 2MBXA 1U5IA 2LVIA 3K21A 1NX3A 1SCMB 2ZNEA 1KK7Z 1WLZA 4MSPA 1DJZA 3PFVA 1Y6WA 4JWQA 3JVTB 4YI9A 3R1VA 3EVVA 1DC1A 1AJ5A 1DJXA 1MXLC 1SBJA 3CS1A 1NUBA 1DT7B 2PALA 2LAPA 1J55A 3O4YA 3R1OA 3LK1A 2QDIA 3CGAA 1RECA 1TOPA 2GGZA 3D78A 4OCIA 2JQ6A 1ALVA 2M3WA 2F3YA 1PSBA 2OPOA 3HCMA 2BBNA 3DVEA 4YGEB 1XA5A 2JTZA 1JBAA 2KSPA 1TNXA 2I7AA 1G4YR 1J1EA 4INWA 2LVKA 1J1DA 1Y1AA 1RK9A 3CR2A 1FI5A 2KPHA 2KQYA 3PN7B 2WCFA 3M0WA 2G9BA 2ZRSA 3S0BA 1P28A 2KAXA 2NCOA 2ZN8A 3DY9A 3FE9A 1W7JB 1LA0A 1CDLA 1DGVA 2PRUA 3EKJA 2CTNA 2GV5A 1BOCA 1R2UA 2H2KA 2LHLA 1W7IB 3KEVA 1TN4A 1YURA 1QIWA 1BF5A 1LS8A 2LLTA 3BUOB 3EK8A 1J7OA 1T14A 2I18A 3AKBA 4QJ4B 1CFFA 3BXKA 4OV2A 1SPYA 2KOTA 1F8HA 2JPOA 3DVMA 1B9AA 3O2PA 4GUKA 5HKYA 1OSAA 2OTGB 3L4AA 1S6CA 2AMIA 5HKWA 1RWYA 1JSAA 1EL4A 1FPWA 2JT0A 1K9PA 4CPVA 2P70A 4AOMA 4QJ5B 5G08A 4WRIA 1KWOB 1CLLA 2HETA 2WORA 2WOSA 4PE1A 1R6PA 1CM1A 3CZ0A 3C1VA 1CLBA 5K89A 2BCBA 3BFHA 2F33A 2NXQA 2QEVA 4PE4A 1C3YA 1IH0A 5DICA 2HQ8A 3BUMB 2M49B 3D0YA 1CNPA 1GQMA 2KBIA 2ZKMX 4M2OA 2GGMA 2AAOA 3ZWHA 3B86A 2AUCA 3D74A 1PSRA 4N1FA 3PM2A 4A4CA 1SYMA 2Q91A 2KBMA 1QV1A 1G8IA 1XFWO 1DJGA 2WCMA 4UPGA 4P2YB 2JOJA 2LM5A 2KDHA 2V53A 5FI6A 3R1PA 4NDCA 4MRXA 4WQ3A 1JF2A 4PDZA 1NCYA 3AAKA 1NCZA 2L5YA 2PQLA 1L7ZA 2LNKA 1SCMC 2KHNA 3EVUA 2YGUA 3FE6A 2KGRA 5JOLA 2E30A 3N7HA 3B7AA 3TUYC 4I5JA 2JULA 4GAOA 4M2PA 3NGVA 1LKJA 4XJKB 2KI4B 1ORGA 5D69A 1FW4A 3CLNA
chains in the Genus database with same CATH topology
2K7BA 2JXLA 3GK4X 1UHKA 2WCEA 4E68A 1A29A 2JC2A 2WCBA 1TTXA 4HSZA 5HLOA 2B1UA 2L50A 3CWGA 1MXEA 2A4JA 1DMOA 1SL8A 2H61A 2LVVA 3SIAA 3LCPC 3NSIA 1CFPA 2Y5IA 3LK0A 1WDCB 3LL8B 4CIDA 4PHMA 1CDPA 1Y0VH 1PULA 5KTYA 1J7PA 1A2XA 1YVLA 1YRUB 1AVSA 2BKHB 1S5GY 1F4OA 2L98A 2D8NA 5FYXA 2BBMA 1CB1A 3PN7C 4GGNA 2F2OA 1AUIB 1WRKA 1WRLA 1B7TY 5I8NA 3HX4A 3D10A 1XK4A 2JU0A 2MHHA 4BY5A 1EXRA 3H4SE 1K93D 2LHIA 3SJSA 3NSLA 1TCFA 4DCKA 5DKQA 2EGDA 3VRPA 1DGUA 1GGZA 2KAYA 2L4IA 1CMGA 2E6WA 4YI8A 3I5IC 1L2OB 1F4QA 4GBAA 1S5GZ 3BUNB 2WC8A 2VRGA 2LP3A 4M2QA 1F70A 3I5GB 2HQWA 2BCXA 1NP8A 3ICBA 4MRYA 1B7TZ 2F8PA 1KQMC 1M45A 2LLSA 1DTLA 1N0YA 2LUXA 2K7CA 3TDUA 2RGIA 2M7NA 1K9UA 2L2EA 4CFQA 1YTZC 2OTGC 2Y1MA 2HF5A 1RJVA 2PASA 3O6BA 1WRZA 2CXJA 1N65A 1MWNA 3EKHA 2KYCA 3DF0B 2JTTA 4C0JA 2ISDA 1F55A 3CR5X 1UHHA 3E3RA 4QJ3B 3IQQA 4DIRA 1OE9B 4P5OE 5CPVA 1S6IA 1LXFC 5CSFA 3CTNA 3VRRA 1LVCD 3SG4A 1CDNA 5CSIA 2BE6A 1S1EA 2JNFA 3TS5B 2K7DA 4DS7A 4ICBA 2K7OA 2IS9A 1GGWA 3RM1A 4NDDA 1NWDA 3OP0A 1IG5A 1KK8B 4XJKA 1KFUS 1OMDA 2CNPA 2JXCA 2M8UA 3FWCA 2O60A 1K95A 1EJ3A 1UP5A 4YBHB 2EHBA 3NSKA 2LUCA 4MBEA 3DVKA 1A03A 1UURA 5CSJA 4NQGA 1B47A 4IL1A 3GK2A 1SK6D 4CFRA 3DD4A 1ZUZA 2EC6C 4PALA 1WLMA 1H8BA 1BLQA 2COLB 1CDMA 2M7LA 1SKTA 1NX2A 2CCMA 3PALA 2CBLA 1YVHA 4FTGA 1KFXL 1QX5B 1S36A 1K2HA 1YX8A 1K96A 2KAVA 4PHNA 2JWWA 1CMFA 1OQPA 2M0RA 2M1UA 4WQ2A 1PRWA 4DUQA 2R2IA 3I5HB 1WDCC 2M1KB 3I5FC 1KSOA 1J7QA 1Y1UA 1SR6C 2KI6C 4YGDB 2LCPA 4PE0A 5DKNA 5F6TA 3IF7A 1B1GA 1ZFSA 2NLNA 1WY9A 1M31A 1SMGA 1TNQA 3SG2A 4MLWA 2BL0C 1B8LA 2FCEA 1JUOA 1NPQA 1PVBA 4ZCUA 1XFZO 1FBVA 4ORCB 1EH2A 1N2DA 4R1EA 2M97A 2BECA 3LLEA 1EG4A 5HLVA 1VRKA 2L4HA 1IQ3A 5HYDA 2KFFA 3BQ3A 1S26D 3GOFA 1IJ5A 4MEWA 5AEQA 5PALA 3DF0A 1BG1A 1UHIA 1QVIY 3JVTC 2SASA 3EVRA 5JJGA 1OOJA 1J7RA 2LLUA 3RLZA 3ZNIA 1FI6A 1UHJA 2M29A 1AHRA 2I2RE 5KSZA 5CSNA 5D7FA 5AANA 1AJ4A 1NIWA 3BUXB 4N5XA 5J3XA 3WHTB 4C0KA 3OB1B 1UWOA 2NCPA 2OS8B 1BMOA 1ZOTB 1K8UA 4AQIA 4ORBB 5AXIA 1BODA 3DVJA 1D1OA 4Q04A 1B4CA 1DJWA 4PE7A 3BYAA 2BCAA 1FF1A 1YUUA 3VGOA 1F71A 2K61A 3BOWB 4ZCVA 3TS5C 4A4BA 1IRJA 2LANA 3F45A 1NSHA 1XYDA 4HRHA 3VROA 3KF9A 1TNPA 2H61C 1QLSA 3NSOA 2FCDA 2MAZA 1AP4A 2LV7A 1TRFA 2F2PA 1IQ5A 5GQQC 2MA2A 1M63B 2G2BA 2LMVA 1XFXO 2CT9A 1A75B 5I2LA 3MSEB 4GNKB 1S6JA 1BR4B 2MJWB 1V1FA 2WNDA 3IQOA 1IKUA 1S3PA 4YGCB 2KI6D 1XK4C 4USLA 4HREE 3JTDB 1F54A 2MRDA 2ZRTA 4MZJA 1SRAA 1RFJA 3EK4A 3NXAA 4HRGA 1JC2A 3CZTX 1C07A 1LA3A 1JFJA 1IGVA 1CLMA 5I2OA 3SG7A 5AFPA 3I5HC 3PM8A 1XFUO 1OMVA 1QS7A 3FWBA 1KWOC 1PALA 2JPTA 1OZSA 1C7VA 1SCVA 2BE4A 2LP2A 4GPLB 5IBWA 3AKAA 3VRNA 1DJIA 2K8MB 2PMYA 5KU1A 1DJYA 3SG5A 3TUYB 1V1GA 1YUSA 1HT9A 1QV0A 1JF0A 5ER5A 1UUSA 1DF0B 4GGFA 1CM4A 1RTP1 1K94A 1NCXA 1QX7A 2LMTA 2BKIB 2F3ZA 1BT6A 3TZ1A 4C0LA 3PSRA 4XYNA 1TNWA 1QXPA 1MHOA 4MZLA 1IWQA 1KQVA 1SL9A 3TDIA 4GGFC 4DRWA 4NDBA 1Y1XA 1UHNA 2Y4QA 2KI4C 2M9GA 1HQVA 2PVBA 1AK8A 1KFXS 1ODBA 3EK7A 3BOWA 1SL7A 5B8IB 1Q80A 2OS8C 4L9MA 3VRQA 1KFUL 1KCYA 1CKKA 4CLNA 2KFHA 4AQJA 1YUTA 4OR9B 1KSMA 2P6BB 1LINA 3I5IB 1DVIA 1A75A 5AERA 4I5LB 1M39A 5ER4X 3KO0A 2MLEC 1G33A 2KQ6A 4YRUA 1K90D 4MN0A 2Y1NA 3OHMB 3CR4X 1B8CA 1KQMB 1QIVA 3OX5A 2L51A 4FQOA 1OZOA 1U5IB 2QPTA 2DOQA 2FJUB 4YGAA 3WNXB 4U8DA 1OMRA 2KNEA 3A4UB 3PATA 4I5KA 1L2OC 4MVFA 2KGBC 4JQ0D 4OKHA 3OX6A 1E8AA 1XVJA 3I5GC 3JTDC 3PLFB 2LC5A 1SNLA 3KHEA 2LVJA 4PHJA 1YRTB 2MLFC 3AAJA 1YR5A 2QACA 2ZNDA 3OB2B 1JWDA 1PVAA 1RROA 2JT3A 1BJFA 1QTXA 1QASA 3TDZA 1TCOB 2KYFA 4PHKA 5TNCA 5HKZA 3A8RA 1DF0A 1EG3A 1DJHA 1QX2A 1XO5A 2K0JA 3WHUB 1YX7A 4MZKA 3O78A 1ZMZA 4OVNF 1PK0D 1SY9A 2K2FA 1IJ6A 4F0ZB 2KFGA 1CFCA 1QVIZ 1M46A 1QJTA 2ZN9A 2PSRA 1GJYA 2TN4A 5BPJA 1JFKA 1NX1A 2EC6B 2JRFA 2L0PA 2ZFDA 1CFDA 1KK8C 3KPXA 4GFTA 5DKRA 2SCPA 2HPSA 1ZACA 1B8RA 2L5XB 1MQ1A 1BR1B 1NYAA 2FOTA 2JNXA 4YGBB 1CTRA 4I5NB 2NZ0A 1XFYO 1C7WA 1ALWA 3I5FB 4BY4A 4ETOA 4D1EA 1H4BA 1SR6B 1MF8B 2LE9B 3SG3A 1KK7Y 1QATA 1MUXA 2I94A 1TIZA 2LMUA 1NX0A 2JT8A 3BUWB 1BU3A 2BL0B 3FS7A 4JPZB 1SW8A 3SG6A 3FIAA 1QLKA 2JZIA 3SIBA 3WXAA 5I2QA 3QRXA 1MR8A 1XFVO 2O5GA 4ORAB 1K9KA 4TNCA 1X02A 2K2AA 1A4PA 3GK1A 4N1GA 3D0YB 4PCWA 2Q4UA 2MBXA 1U5IA 2LVIA 3K21A 1NX3A 1SCMB 2ZNEA 1KK7Z 1WLZA 4MSPA 1DJZA 3PFVA 1Y6WA 4JWQA 3JVTB 4YI9A 3EVVA 1AJ5A 1DJXA 1MXLC 1SBJA 3CS1A 1NUBA 1DT7B 2PALA 2LAPA 1J55A 3O4YA 3LK1A 3CGAA 1RECA 1TOPA 2GGZA 4OCIA 2JQ6A 1ALVA 2M3WA 2F3YA 1PSBA 2OPOA 3HCMA 2BBNA 3DVEA 4YGEB 1XA5A 2JTZA 1JBAA 2KSPA 1TNXA 2I7AA 1G4YR 1J1EA 2LVKA 1J1DA 1Y1AA 1RK9A 3CR2A 1FI5A 3PN7B 2KQYA 2WCFA 3M0WA 2G9BA 2ZRSA 2KAXA 2NCOA 2ZN8A 1W7JB 1LA0A 1CDLA 1DGVA 2PRUA 3EKJA 2CTNA 2GV5A 1BOCA 1R2UA 2H2KA 2LHLA 1W7IB 3KEVA 1TN4A 1YURA 1QIWA 1BF5A 3BUOB 2LLTA 3EK8A 1J7OA 2I18A 3AKBA 4QJ4B 1CFFA 3BXKA 4OV2A 1SPYA 2KOTA 1F8HA 3DVMA 1B9AA 3O2PA 4GUKA 5HKYA 1OSAA 2OTGB 1S6CA 2AMIA 5HKWA 1RWYA 1JSAA 1EL4A 1FPWA 2JT0A 1K9PA 4CPVA 4QJ5B 4AOMA 5G08A 4WRIA 1KWOB 1CLLA 2HETA 2WORA 2WOSA 4PE1A 1R6PA 1CM1A 1CLBA 3C1VA 5K89A 2BCBA 2F33A 2NXQA 4PE4A 1IH0A 2HQ8A 3BUMB 2M49B 3D0YA 1CNPA 1GQMA 2KBIA 2ZKMX 4M2OA 2GGMA 2AAOA 3ZWHA 4N1FA 2AUCA 1PSRA 4A4CA 1SYMA 2Q91A 2KBMA 1QV1A 1G8IA 1XFWO 1DJGA 4UPGA 4P2YB 2JOJA 2LM5A 2KDHA 2V53A 4NDCA 4MRXA 4WQ3A 1JF2A 4PDZA 1NCYA 3AAKA 1NCZA 3EVUA 1L7ZA 2LNKA 1SCMC 2KHNA 2KGRA 5JOLA 2E30A 3TUYC 4I5JA 2JULA 4GAOA 4M2PA 1LKJA 4XJKB 2KI4B 5D69A 1FW4A 3CLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7B A;  2JXL A;  3GK4 X;  1UHK A;  2WCE A;  4E68 A;  1A29 A;  2JC2 A;  2WCB A;  1TTX A;  4HSZ A;  5HLO A;  2B1U A;  2L50 A;  3CWG A;  1MXE A;  2A4J A;  1DMO A;  1SL8 A;  2H61 A;  2LVV A;  3SIA A;  3LCP C;  3NSI A;  1CFP A;  2Y5I A;  3LK0 A;  1WDC B;  3LL8 B;  4CID A;  4PHM A;  1CDP A;  1Y0V H;  1PUL A;  5KTY A;  1J7P A;  1A2X A;  1YVL A;  1YRU B;  1AVS A;  2BKH B;  1S5G Y;  1F4O A;  2L98 A;  2D8N A;  5FYX A;  2BBM A;  1CB1 A;  3PN7 C;  4GGN A;  2F2O A;  1AUI B;  1WRK A;  1WRL A;  1B7T Y;  5I8N A;  3HX4 A;  3D10 A;  1XK4 A;  2JU0 A;  2MHH A;  4BY5 A;  1EXR A;  3H4S E;  1K93 D;  2LHI A;  3SJS A;  3NSL A;  1TCF A;  4DCK A;  5DKQ A;  2EGD A;  3VRP A;  1DGU A;  1GGZ A;  2KAY A;  2L4I A;  1CMG A;  2E6W A;  4YI8 A;  3I5I C;  1L2O B;  1F4Q A;  4GBA A;  1S5G Z;  3BUN B;  2WC8 A;  2VRG A;  2LP3 A;  4M2Q A;  1F70 A;  3I5G B;  2HQW A;  2BCX A;  1NP8 A;  3ICB A;  4MRY A;  1B7T Z;  2F8P A;  1KQM C;  1M45 A;  2LLS A;  1DTL A;  1N0Y A;  2LUX A;  2K7C A;  3TDU A;  2RGI A;  2M7N A;  1K9U A;  2L2E A;  4CFQ A;  1YTZ C;  2OTG C;  2Y1M A;  2HF5 A;  1RJV A;  2PAS A;  3O6B A;  1WRZ A;  2CXJ A;  1N65 A;  1MWN A;  3EKH A;  2KYC A;  3DF0 B;  2JTT A;  4C0J A;  2ISD A;  1F55 A;  3CR5 X;  1UHH A;  3E3R A;  4QJ3 B;  3IQQ A;  4DIR A;  1OE9 B;  4P5O E;  5CPV A;  1S6I A;  1LXF C;  5CSF A;  3CTN A;  3VRR A;  1LVC D;  3SG4 A;  1CDN A;  5CSI A;  2BE6 A;  1S1E A;  2JNF A;  3TS5 B;  2K7D A;  4DS7 A;  4ICB A;  2K7O A;  2IS9 A;  1GGW A;  3RM1 A;  4NDD A;  1NWD A;  3OP0 A;  1IG5 A;  1KK8 B;  4XJK A;  1KFU S;  1OMD A;  2CNP A;  2JXC A;  2M8U A;  3FWC A;  2O60 A;  1K95 A;  1EJ3 A;  1UP5 A;  4YBH B;  2EHB A;  3NSK A;  2LUC A;  4MBE A;  3DVK A;  1A03 A;  1UUR A;  5CSJ A;  4NQG A;  1B47 A;  4IL1 A;  3GK2 A;  1SK6 D;  4CFR A;  3DD4 A;  1ZUZ A;  2EC6 C;  4PAL A;  1WLM A;  1H8B A;  1BLQ A;  2COL B;  1CDM A;  2M7L A;  1SKT A;  1NX2 A;  2CCM A;  3PAL A;  2CBL A;  1YVH A;  4FTG A;  1KFX L;  1QX5 B;  1S36 A;  1K2H A;  1YX8 A;  1K96 A;  2KAV A;  4PHN A;  2JWW A;  1CMF A;  1OQP A;  2M0R A;  2M1U A;  4WQ2 A;  1PRW A;  4DUQ A;  2R2I A;  3I5H B;  1WDC C;  2M1K B;  3I5F C;  1KSO A;  1J7Q A;  1Y1U A;  1SR6 C;  2KI6 C;  4YGD B;  2LCP A;  4PE0 A;  5DKN A;  5F6T A;  3IF7 A;  1B1G A;  1ZFS A;  2NLN A;  1WY9 A;  1M31 A;  1SMG A;  1TNQ A;  3SG2 A;  4MLW A;  2BL0 C;  1B8L A;  2FCE A;  1JUO A;  1NPQ A;  1PVB A;  4ZCU A;  1XFZ O;  1FBV A;  4ORC B;  1EH2 A;  1N2D A;  4R1E A;  2M97 A;  2BEC A;  3LLE A;  1EG4 A;  5HLV A;  1VRK A;  2L4H A;  1IQ3 A;  5HYD A;  2KFF A;  3BQ3 A;  1S26 D;  3GOF A;  1IJ5 A;  4MEW A;  5AEQ A;  5PAL A;  3DF0 A;  1BG1 A;  1UHI A;  1QVI Y;  3JVT C;  2SAS A;  3EVR A;  5JJG A;  1OOJ A;  1J7R A;  2LLU A;  3RLZ A;  3ZNI A;  1FI6 A;  1UHJ A;  2M29 A;  1AHR A;  2I2R E;  5KSZ A;  5CSN A;  5D7F A;  5AAN A;  1AJ4 A;  1NIW A;  3BUX B;  4N5X A;  5J3X A;  3WHT B;  4C0K A;  3OB1 B;  1UWO A;  2NCP A;  2OS8 B;  1BMO A;  1ZOT B;  1K8U A;  4AQI A;  4ORB B;  5AXI A;  1BOD A;  3DVJ A;  1D1O A;  4Q04 A;  1B4C A;  1DJW A;  4PE7 A;  3BYA A;  2BCA A;  1FF1 A;  1YUU A;  3VGO A;  1F71 A;  2K61 A;  3BOW B;  4ZCV A;  3TS5 C;  4A4B A;  1IRJ A;  2LAN A;  3F45 A;  1NSH A;  1XYD A;  4HRH A;  3VRO A;  3KF9 A;  1TNP A;  2H61 C;  1QLS A;  3NSO A;  2FCD A;  2MAZ A;  1AP4 A;  2LV7 A;  1TRF A;  2F2P A;  1IQ5 A;  5GQQ C;  2MA2 A;  1M63 B;  2G2B A;  2LMV A;  1XFX O;  2CT9 A;  1A75 B;  5I2L A;  3MSE B;  4GNK B;  1S6J A;  1BR4 B;  2MJW B;  1V1F A;  2WND A;  3IQO A;  1IKU A;  1S3P A;  4YGC B;  2KI6 D;  1XK4 C;  4USL A;  4HRE E;  3JTD B;  1F54 A;  2MRD A;  2ZRT A;  4MZJ A;  1SRA A;  1RFJ A;  3EK4 A;  3NXA A;  4HRG A;  1JC2 A;  3CZT X;  1C07 A;  1LA3 A;  1JFJ A;  1IGV A;  1CLM A;  5I2O A;  3SG7 A;  5AFP A;  3I5H C;  3PM8 A;  1XFU O;  1OMV A;  1QS7 A;  3FWB A;  1KWO C;  1PAL A;  2JPT A;  1OZS A;  1C7V A;  1SCV A;  2BE4 A;  2LP2 A;  4GPL B;  5IBW A;  3AKA A;  3VRN A;  1DJI A;  2K8M B;  2PMY A;  5KU1 A;  1DJY A;  3SG5 A;  3TUY B;  1V1G A;  1YUS A;  1HT9 A;  1QV0 A;  1JF0 A;  5ER5 A;  1UUS A;  1DF0 B;  4GGF A;  1CM4 A;  1RTP 1;  1K94 A;  1NCX A;  1QX7 A;  2LMT A;  2BKI B;  2F3Z A;  1BT6 A;  3TZ1 A;  4C0L A;  3PSR A;  4XYN A;  1TNW A;  1QXP A;  1MHO A;  4MZL A;  1IWQ A;  1KQV A;  1SL9 A;  3TDI A;  4GGF C;  4DRW A;  4NDB A;  1Y1X A;  1UHN A;  2Y4Q A;  2KI4 C;  2M9G A;  1HQV A;  2PVB A;  1AK8 A;  1KFX S;  1ODB A;  3EK7 A;  3BOW A;  1SL7 A;  5B8I B;  1Q80 A;  2OS8 C;  4L9M A;  3VRQ A;  1KFU L;  1KCY A;  1CKK A;  4CLN A;  2KFH A;  4AQJ A;  1YUT A;  4OR9 B;  1KSM A;  2P6B B;  1LIN A;  3I5I B;  1DVI A;  1A75 A;  5AER A;  4I5L B;  1M39 A;  5ER4 X;  3KO0 A;  2MLE C;  1G33 A;  2KQ6 A;  4YRU A;  1K90 D;  4MN0 A;  2Y1N A;  3OHM B;  3CR4 X;  1B8C A;  1KQM B;  1QIV A;  3OX5 A;  2L51 A;  4FQO A;  1OZO A;  1U5I B;  2QPT A;  2DOQ A;  2FJU B;  4YGA A;  3WNX B;  4U8D A;  1OMR A;  2KNE A;  3A4U B;  3PAT A;  4I5K A;  1L2O C;  4MVF A;  2KGB C;  4JQ0 D;  4OKH A;  3OX6 A;  1E8A A;  1XVJ A;  3I5G C;  3JTD C;  3PLF B;  2LC5 A;  1SNL A;  3KHE A;  2LVJ A;  4PHJ A;  1YRT B;  2MLF C;  3AAJ A;  1YR5 A;  2QAC A;  2ZND A;  3OB2 B;  1JWD A;  1PVA A;  1RRO A;  2JT3 A;  1BJF A;  1QTX A;  1QAS A;  3TDZ A;  1TCO B;  2KYF A;  4PHK A;  5TNC A;  5HKZ A;  3A8R A;  1DF0 A;  1EG3 A;  1DJH A;  1QX2 A;  1XO5 A;  2K0J A;  3WHU B;  1YX7 A;  4MZK A;  3O78 A;  1ZMZ A;  4OVN F;  1PK0 D;  1SY9 A;  2K2F A;  1IJ6 A;  4F0Z B;  2KFG A;  1CFC A;  1QVI Z;  1M46 A;  1QJT A;  2ZN9 A;  2PSR A;  1GJY A;  2TN4 A;  5BPJ A;  1JFK A;  1NX1 A;  2EC6 B;  2JRF A;  2L0P A;  2ZFD A;  1CFD A;  1KK8 C;  3KPX A;  4GFT A;  5DKR A;  2SCP A;  2HPS A;  1ZAC A;  1B8R A;  2L5X B;  1MQ1 A;  1BR1 B;  1NYA A;  2FOT A;  2JNX A;  4YGB B;  1CTR A;  4I5N B;  2NZ0 A;  1XFY O;  1C7W A;  1ALW A;  3I5F B;  4BY4 A;  4ETO A;  4D1E A;  1H4B A;  1SR6 B;  1MF8 B;  2LE9 B;  3SG3 A;  1KK7 Y;  1QAT A;  1MUX A;  2I94 A;  1TIZ A;  2LMU A;  1NX0 A;  2JT8 A;  3BUW B;  1BU3 A;  2BL0 B;  3FS7 A;  4JPZ B;  1SW8 A;  3SG6 A;  3FIA A;  1QLK A;  2JZI A;  3SIB A;  3WXA A;  5I2Q A;  3QRX A;  1MR8 A;  1XFV O;  2O5G A;  4ORA B;  1K9K A;  4TNC A;  1X02 A;  2K2A A;  1A4P A;  3GK1 A;  4N1G A;  3D0Y B;  4PCW A;  2Q4U A;  2MBX A;  1U5I A;  2LVI A;  3K21 A;  1NX3 A;  1SCM B;  2ZNE A;  1KK7 Z;  1WLZ A;  4MSP A;  1DJZ A;  3PFV A;  1Y6W A;  4JWQ A;  3JVT B;  4YI9 A;  3EVV A;  1AJ5 A;  1DJX A;  1MXL C;  1SBJ A;  3CS1 A;  1NUB A;  1DT7 B;  2PAL A;  2LAP A;  1J55 A;  3O4Y A;  3LK1 A;  3CGA A;  1REC A;  1TOP A;  2GGZ A;  4OCI A;  2JQ6 A;  1ALV A;  2M3W A;  2F3Y A;  1PSB A;  2OPO A;  3HCM A;  2BBN A;  3DVE A;  4YGE B;  1XA5 A;  2JTZ A;  1JBA A;  2KSP A;  1TNX A;  2I7A A;  1G4Y R;  1J1E A;  2LVK A;  1J1D A;  1Y1A A;  1RK9 A;  3CR2 A;  1FI5 A;  3PN7 B;  2KQY A;  2WCF A;  3M0W A;  2G9B A;  2ZRS A;  2KAX A;  2NCO A;  2ZN8 A;  1W7J B;  1LA0 A;  1CDL A;  1DGV A;  2PRU A;  3EKJ A;  2CTN A;  2GV5 A;  1BOC A;  1R2U A;  2H2K A;  2LHL A;  1W7I B;  3KEV A;  1TN4 A;  1YUR A;  1QIW A;  1BF5 A;  3BUO B;  2LLT A;  3EK8 A;  1J7O A;  2I18 A;  3AKB A;  4QJ4 B;  1CFF A;  3BXK A;  4OV2 A;  1SPY A;  2KOT A;  1F8H A;  3DVM A;  1B9A A;  3O2P A;  4GUK A;  5HKY A;  1OSA A;  2OTG B;  1S6C A;  2AMI A;  5HKW A;  1RWY A;  1JSA A;  1EL4 A;  1FPW A;  2JT0 A;  1K9P A;  4CPV A;  4QJ5 B;  4AOM A;  5G08 A;  4WRI A;  1KWO B;  1CLL A;  2HET A;  2WOR A;  2WOS A;  4PE1 A;  1R6P A;  1CM1 A;  1CLB A;  3C1V A;  5K89 A;  2BCB A;  2F33 A;  2NXQ A;  4PE4 A;  1IH0 A;  2HQ8 A;  3BUM B;  2M49 B;  3D0Y A;  1CNP A;  1GQM A;  2KBI A;  2ZKM X;  4M2O A;  2GGM A;  2AAO A;  3ZWH A;  4N1F A;  2AUC A;  1PSR A;  4A4C A;  1SYM A;  2Q91 A;  2KBM A;  1QV1 A;  1G8I A;  1XFW O;  1DJG A;  4UPG A;  4P2Y B;  2JOJ A;  2LM5 A;  2KDH A;  2V53 A;  4NDC A;  4MRX A;  4WQ3 A;  1JF2 A;  4PDZ A;  1NCY A;  3AAK A;  1NCZ A;  3EVU A;  1L7Z A;  2LNK A;  1SCM C;  2KHN A;  2KGR A;  5JOL A;  2E30 A;  3TUY C;  4I5J A;  2JUL A;  4GAO A;  4M2P A;  1LKJ A;  4XJK B;  2KI4 B;  5D69 A;  1FW4 A;  3CLN A; 
#chains in the Genus database with same CATH topology
 2K7B A;  1IIO A;  2JXL A;  3GK4 X;  1SSE B;  1UHK A;  2WCE A;  4E68 A;  1A29 A;  2JC2 A;  3RZS A;  2WCB A;  1TTX A;  2PYQ A;  4HSZ A;  5HLO A;  2B1U A;  2L50 A;  3CWG A;  1MXE A;  1W9Z A;  2A4J A;  1DMO A;  1SL8 A;  2H61 A;  2LVV A;  3SIA A;  3LCP C;  3NSI A;  1CFP A;  2Y5I A;  3LK0 A;  1WDC B;  3LL8 B;  4CID A;  4PHM A;  1CDP A;  1Y0V H;  1PUL A;  5KTY A;  1J7P A;  1A2X A;  1YVL A;  1YRU B;  1AVS A;  2BKH B;  1S5G Y;  3BJH A;  1F4O A;  3DZT A;  4FQT A;  2L98 A;  2D8N A;  5FYX A;  2BBM A;  1CB1 A;  3PN7 C;  3L4L A;  4GGN A;  2F2O A;  1AUI B;  1C3Z A;  1WRL A;  1WRK A;  1B7T Y;  5I8N A;  3HX4 A;  3D10 A;  1XK4 A;  2JU0 A;  2MHH A;  4PT1 A;  4BY5 A;  1EXR A;  3H4S E;  1K93 D;  2LHI A;  3SJS A;  3NSL A;  1TCF A;  4DCK A;  5DKQ A;  2EGD A;  4F7F A;  3VRP A;  1DGU A;  1GGZ A;  2KAY A;  2L4I A;  1CMG A;  2E6W A;  4YI8 A;  3I5I C;  1L2O B;  1F4Q A;  3CZ2 A;  4GBA A;  1DEK A;  1S5G Z;  3BUN B;  2WC8 A;  2VRG A;  2LP3 A;  4M2Q A;  3S0D A;  1F70 A;  3I5G B;  2HQW A;  2BCX A;  3S0E A;  1NP8 A;  3ICB A;  4MRY A;  1B7T Z;  3K1E A;  2F8P A;  1KQM C;  1M45 A;  2LLS A;  1DTL A;  1N0Y A;  2LUX A;  2K7C A;  2H8V A;  3TDU A;  2K60 A;  2RGI A;  2M7N A;  1K9U A;  2L2E A;  4CFQ A;  1YTZ C;  2OTG C;  2Y1M A;  2HF5 A;  1RJV A;  2PAS A;  3O6B A;  1WRZ A;  2CXJ A;  1N65 A;  1MWN A;  3EKH A;  2KYC A;  3DF0 B;  2JTT A;  4C0J A;  3SS3 A;  3D76 A;  3UO9 A;  2ISD A;  1F55 A;  3CR5 X;  1UHH A;  3O4X A;  3E3R A;  4QJ3 B;  3OBV A;  3IQQ A;  4DIR A;  1OE9 B;  4P5O E;  5CPV A;  1S6I A;  1LXF C;  3D77 A;  3CDN A;  5CSF A;  3CTN A;  3VRR A;  1LVC D;  3SG4 A;  1CDN A;  5CSI A;  2BE6 A;  1S1E A;  2JNF A;  3TS5 B;  2K7D A;  4DS7 A;  4ICB A;  2K7O A;  2IS9 A;  1GGW A;  3RM1 A;  4NDD A;  3NHI A;  1NWD A;  3OP0 A;  1IG5 A;  1KK8 B;  4XJK A;  1KFU S;  1OMD A;  2CNP A;  2JXC A;  2M8U A;  2WCJ A;  2O60 A;  1K95 A;  3FWC A;  1EJ3 A;  3V2L A;  1UP5 A;  4YBH B;  2EHB A;  3NSK A;  2LUC A;  4MBE A;  3DVK A;  1A03 A;  1UUR A;  5CSJ A;  3IVT A;  4NQG A;  1B47 A;  4IL1 A;  3GK2 A;  1SK6 D;  4CFR A;  3DD4 A;  1ZUZ A;  2EC6 C;  4PAL A;  1WLM A;  1H8B A;  1BLQ A;  2COL B;  1CDM A;  2M7L A;  1SKT A;  5I94 A;  1NX2 A;  2CCM A;  3PAL A;  2CBL A;  1YVH A;  4FTG A;  1KFX L;  1QX5 B;  1S36 A;  1TUJ A;  1K2H A;  1YX8 A;  1K96 A;  2KAV A;  4PHN A;  2JWW A;  1CMF A;  1OQP A;  2M0R A;  2M1U A;  3DYE A;  4WQ2 A;  1PRW A;  4DUQ A;  2R2I A;  3I5H B;  1WDC C;  2M1K B;  2L2C A;  3I5F C;  1KSO A;  1J7Q A;  1Y1U A;  1SR6 C;  2KI6 C;  3PJI A;  4YGD B;  2LCP A;  4PE0 A;  5DKN A;  3B88 A;  5F6T A;  3IF7 A;  1B1G A;  1ZFS A;  2NLN A;  1WY9 A;  1M31 A;  1SMG A;  1TNQ A;  3SG2 A;  4MLW A;  2BL0 C;  1B8L A;  2FCE A;  1JUO A;  2BNX A;  1NPQ A;  1PVB A;  5FI7 A;  4ZCU A;  1XFZ O;  1FBV A;  4ORC B;  1EH2 A;  1N2D A;  4R1E A;  2M97 A;  1Z2C B;  2BEC A;  3LLE A;  1EG4 A;  5HLV A;  1VRK A;  2L4H A;  1IQ3 A;  5HYD A;  2KFF A;  3BQ3 A;  1S26 D;  3GOF A;  1IJ5 A;  4IJ7 A;  4MEW A;  5AEQ A;  5PAL A;  3S0A A;  3DF0 A;  1BG1 A;  1UHI A;  1QVI Y;  3JVT C;  3S0G A;  2SAS A;  3EVR A;  5JJG A;  1OOJ A;  1J7R A;  2LLU A;  3RLZ A;  3ZNI A;  1FI6 A;  1UHJ A;  2M29 A;  1AHR A;  2I2R E;  5KSZ A;  5CSN A;  5D7F A;  5AAN A;  1AJ4 A;  1NIW A;  3BUX B;  4N5X A;  5J3X A;  3WHT B;  4C0K A;  3OB1 B;  1UWO A;  2NCP A;  2BAP A;  2OS8 B;  1BMO A;  1ZOT B;  1K8U A;  4AQI A;  4ORB B;  5EL2 A;  5AXI A;  3DVJ A;  1BOD A;  1D1O A;  4Q04 A;  1B4C A;  1DJW A;  4PE7 A;  3BYA A;  2BCA A;  1FF1 A;  1YUU A;  3VGO A;  1F71 A;  1XFR A;  2K61 A;  3BOW B;  4ZCV A;  3TS5 C;  4A4B A;  1IRJ A;  2LAN A;  3F45 A;  1NSH A;  1XYD A;  4HRH A;  3VRO A;  3CZ1 A;  3KF9 A;  1TNP A;  2H61 C;  1QLS A;  3NSO A;  2FCD A;  2MAZ A;  4JKT A;  1AP4 A;  2LV7 A;  1TRF A;  2WCH A;  2F2P A;  1IQ5 A;  5GQQ C;  2MA2 A;  1M63 B;  2G2B A;  2LMV A;  1XFX O;  2CT9 A;  1A75 B;  5I2L A;  3MSE B;  4GNK B;  1S6J A;  1BR4 B;  2MJW B;  1V1F A;  1OW4 A;  2WND A;  3IQO A;  1IKU A;  1S3P A;  4YGC B;  2KI6 D;  1XK4 C;  2KLE A;  4USL A;  4HRE E;  3JTD B;  1F54 A;  2MRD A;  2ZRT A;  3B87 A;  4MZJ A;  1SRA A;  1OOG A;  1RFJ A;  3EK4 A;  3NXA A;  4HRG A;  1JC2 A;  3CZT X;  1C07 A;  1LA3 A;  1JFJ A;  1IGV A;  1CLM A;  5I2O A;  3SG7 A;  4OZD A;  1OOI X;  5AFP A;  3I5H C;  3PM8 A;  1XFU O;  1OMV A;  1QS7 A;  3FWB A;  1KWO C;  1PAL A;  2JPT A;  3FE8 A;  1OZS A;  1C7V A;  1SCV A;  2BE4 A;  3L47 A;  2LP2 A;  4GPL B;  5IBW A;  3AKA A;  3VRN A;  1DJI A;  1TWO A;  2K8M B;  2PMY A;  1DJY A;  5KU1 A;  3SG5 A;  3TUY B;  3Q8I A;  1V1G A;  1YUS A;  1HT9 A;  1QV0 A;  1JF0 A;  5ER5 A;  1UUS A;  1DF0 B;  4GGF A;  1CM4 A;  1RTP 1;  1K94 A;  1NCX A;  1QX7 A;  5FI2 A;  2LMT A;  2BKI B;  2F3Z A;  1BT6 A;  2QEB A;  3TZ1 A;  1DQE A;  4C0L A;  3PSR A;  4XYN A;  1TNW A;  1QXP A;  1MHO A;  4MZL A;  1IWQ A;  2QEH A;  1KQV A;  1SL9 A;  3TDI A;  4GGF C;  4DRW A;  1GM0 A;  4NDB A;  1Y1X A;  1UHN A;  2WCK A;  2Y4Q A;  2KI4 C;  2M9G A;  3R72 A;  1HQV A;  2PVB A;  1AK8 A;  1KFX S;  1ODB A;  2GTE A;  3EK7 A;  4INX A;  2P71 A;  3BOW A;  1SL7 A;  5B8I B;  1Q80 A;  3BFA A;  2KLD A;  2OS8 C;  4L9M A;  3DXL A;  3VRQ A;  1KFU L;  1KCY A;  4JD9 A;  4CLN A;  2KFH A;  1CKK A;  4AQJ A;  1YUT A;  4OR9 B;  1KSM A;  2P6B B;  1LIN A;  3I5I B;  1DVI A;  1A75 A;  5AER A;  4I5L B;  1M39 A;  1OOF A;  5ER4 X;  3KO0 A;  2MLE C;  2ERB A;  1G33 A;  2KQ6 A;  4YRU A;  1K90 D;  4MN0 A;  2Y1N A;  3OHM B;  3OGN A;  3CR4 X;  1B8C A;  1KQM B;  1OOH A;  1QIV A;  3OX5 A;  3S0F A;  3B6X A;  2L51 A;  4FQO A;  1OZO A;  1U5I B;  2QPT A;  5D3O A;  2DOQ A;  2FJU B;  4YGA A;  3WNX B;  4U8D A;  1OMR A;  2KNE A;  3A4U B;  3PAT A;  4I5K A;  1L2O C;  4MVF A;  2KGB C;  1Z4H A;  3BFB A;  3D73 A;  3OX6 A;  1E8A A;  1XVJ A;  3I5G C;  3JTD C;  4JQ0 D;  4OKH A;  3PLF B;  2LC5 A;  1SNL A;  3KHE A;  2LVJ A;  1QWV A;  1YRT B;  2MLF C;  2WC5 A;  3AAJ A;  1YR5 A;  2QAC A;  2ZND A;  3OB2 B;  4PHJ A;  1PVA A;  1RRO A;  1JWD A;  2JT3 A;  1BJF A;  1QTX A;  1QAS A;  3TDZ A;  1TCO B;  2KYF A;  4PHK A;  5TNC A;  5HKZ A;  3A8R A;  1DF0 A;  1EG3 A;  1DJH A;  1QX2 A;  1XO5 A;  2K0J A;  3WHU B;  1YX7 A;  3CAB A;  3O78 A;  4MZK A;  1ZMZ A;  4OVN F;  1PK0 D;  1SY9 A;  2K2F A;  1IJ6 A;  4F0Z B;  2KFG A;  1CFC A;  1QVI Z;  1M46 A;  1QJT A;  2ZN9 A;  2PSR A;  1GJY A;  2TN4 A;  5BPJ A;  1JFK A;  1NX1 A;  2EC6 B;  2JRF A;  3EG5 B;  2L0P A;  2ZFD A;  1CFD A;  1KK8 C;  3KPX A;  4GFT A;  5DKR A;  5HL1 A;  2SCP A;  2HPS A;  1ZAC A;  1B8R A;  2L5X B;  1MQ1 A;  1BR1 B;  1NYA A;  2FOT A;  2JNX A;  4YGB B;  1CTR A;  4I5N B;  2NZ0 A;  1XFY O;  1C7W A;  1ALW A;  3I5F B;  4BY4 A;  4ETO A;  4D1E A;  1H4B A;  3NHT A;  1DEL A;  1SR6 B;  1MF8 B;  2FJY A;  2LE9 B;  3SG3 A;  3UNW A;  3SS5 A;  1KK7 Y;  1QAT A;  1MUX A;  2WCL A;  2I94 A;  1TIZ A;  3D75 A;  2LMU A;  1NX0 A;  2JT8 A;  3BUW B;  1BU3 A;  3VB1 A;  2BL0 B;  3FS7 A;  4JPZ B;  1SW8 A;  3SG6 A;  3SS4 A;  3FIA A;  1QLK A;  2JZI A;  4KYN A;  1TUZ A;  2WC6 A;  3CYZ A;  3SIB A;  3WXA A;  5I2Q A;  3QME A;  3QRX A;  2QEO A;  1MR8 A;  1XFV O;  2O5G A;  4ORA B;  1K9K A;  4TNC A;  1X02 A;  2K2A A;  1A4P A;  3GK1 A;  4N1G A;  3D0Y B;  4PCW A;  2Q4U A;  2MBX A;  1U5I A;  2LVI A;  3K21 A;  1NX3 A;  1SCM B;  2ZNE A;  1KK7 Z;  1WLZ A;  4MSP A;  1DJZ A;  3PFV A;  1Y6W A;  4JWQ A;  3JVT B;  4YI9 A;  3R1V A;  3EVV A;  1DC1 A;  1AJ5 A;  1DJX A;  1MXL C;  1SBJ A;  3CS1 A;  1NUB A;  1DT7 B;  2PAL A;  2LAP A;  1J55 A;  3O4Y A;  3R1O A;  3LK1 A;  2QDI A;  3CGA A;  1REC A;  1TOP A;  2GGZ A;  3D78 A;  4OCI A;  2JQ6 A;  1ALV A;  2M3W A;  2F3Y A;  1PSB A;  2OPO A;  3HCM A;  2BBN A;  3DVE A;  4YGE B;  1XA5 A;  2JTZ A;  1JBA A;  2KSP A;  1TNX A;  2I7A A;  1G4Y R;  1J1E A;  4INW A;  2LVK A;  1J1D A;  1Y1A A;  1RK9 A;  3CR2 A;  1FI5 A;  2KPH A;  2KQY A;  3PN7 B;  2WCF A;  3M0W A;  2G9B A;  2ZRS A;  3S0B A;  1P28 A;  2KAX A;  2NCO A;  2ZN8 A;  3DY9 A;  3FE9 A;  1W7J B;  1LA0 A;  1CDL A;  1DGV A;  2PRU A;  3EKJ A;  2CTN A;  2GV5 A;  1BOC A;  1R2U A;  2H2K A;  2LHL A;  1W7I B;  3KEV A;  1TN4 A;  1YUR A;  1QIW A;  1BF5 A;  1LS8 A;  2LLT A;  3BUO B;  3EK8 A;  1J7O A;  1T14 A;  2I18 A;  3AKB A;  4QJ4 B;  1CFF A;  3BXK A;  4OV2 A;  1SPY A;  2KOT A;  1F8H A;  2JPO A;  3DVM A;  1B9A A;  3O2P A;  4GUK A;  5HKY A;  1OSA A;  2OTG B;  3L4A A;  1S6C A;  2AMI A;  5HKW A;  1RWY A;  1JSA A;  1EL4 A;  1FPW A;  2JT0 A;  1K9P A;  4CPV A;  2P70 A;  4AOM A;  4QJ5 B;  5G08 A;  4WRI A;  1KWO B;  1CLL A;  2HET A;  2WOR A;  2WOS A;  4PE1 A;  1R6P A;  1CM1 A;  3CZ0 A;  3C1V A;  1CLB A;  5K89 A;  2BCB A;  3BFH A;  2F33 A;  2NXQ A;  2QEV A;  4PE4 A;  1C3Y A;  1IH0 A;  5DIC A;  2HQ8 A;  3BUM B;  2M49 B;  3D0Y A;  1CNP A;  1GQM A;  2KBI A;  2ZKM X;  4M2O A;  2GGM A;  2AAO A;  3ZWH A;  3B86 A;  2AUC A;  3D74 A;  1PSR A;  4N1F A;  3PM2 A;  4A4C A;  1SYM A;  2Q91 A;  2KBM A;  1QV1 A;  1G8I A;  1XFW O;  1DJG A;  2WCM A;  4UPG A;  4P2Y B;  2JOJ A;  2LM5 A;  2KDH A;  2V53 A;  5FI6 A;  3R1P A;  4NDC A;  4MRX A;  4WQ3 A;  1JF2 A;  4PDZ A;  1NCY A;  3AAK A;  1NCZ A;  2L5Y A;  2PQL A;  1L7Z A;  2LNK A;  1SCM C;  2KHN A;  3EVU A;  2YGU A;  3FE6 A;  2KGR A;  5JOL A;  2E30 A;  3N7H A;  3B7A A;  3TUY C;  4I5J A;  2JUL A;  4GAO A;  4M2P A;  3NGV A;  1LKJ A;  4XJK B;  2KI4 B;  1ORG A;  5D69 A;  1FW4 A;  3CLN A; 
#chains in the Genus database with same CATH homology
 2K7B A;  2JXL A;  3GK4 X;  1UHK A;  2WCE A;  4E68 A;  1A29 A;  2JC2 A;  2WCB A;  1TTX A;  4HSZ A;  5HLO A;  2B1U A;  2L50 A;  3CWG A;  1MXE A;  2A4J A;  1DMO A;  1SL8 A;  2H61 A;  2LVV A;  3SIA A;  3LCP C;  3NSI A;  1CFP A;  2Y5I A;  3LK0 A;  1WDC B;  3LL8 B;  4CID A;  4PHM A;  1CDP A;  1Y0V H;  1PUL A;  5KTY A;  1J7P A;  1A2X A;  1YVL A;  1YRU B;  1AVS A;  2BKH B;  1S5G Y;  1F4O A;  2L98 A;  2D8N A;  5FYX A;  2BBM A;  1CB1 A;  3PN7 C;  4GGN A;  2F2O A;  1AUI B;  1WRK A;  1WRL A;  1B7T Y;  5I8N A;  3HX4 A;  3D10 A;  1XK4 A;  2JU0 A;  2MHH A;  4BY5 A;  1EXR A;  3H4S E;  1K93 D;  2LHI A;  3SJS A;  3NSL A;  1TCF A;  4DCK A;  5DKQ A;  2EGD A;  3VRP A;  1DGU A;  1GGZ A;  2KAY A;  2L4I A;  1CMG A;  2E6W A;  4YI8 A;  3I5I C;  1L2O B;  1F4Q A;  4GBA A;  1S5G Z;  3BUN B;  2WC8 A;  2VRG A;  2LP3 A;  4M2Q A;  1F70 A;  3I5G B;  2HQW A;  2BCX A;  1NP8 A;  3ICB A;  4MRY A;  1B7T Z;  2F8P A;  1KQM C;  1M45 A;  2LLS A;  1DTL A;  1N0Y A;  2LUX A;  2K7C A;  3TDU A;  2RGI A;  2M7N A;  1K9U A;  2L2E A;  4CFQ A;  1YTZ C;  2OTG C;  2Y1M A;  2HF5 A;  1RJV A;  2PAS A;  3O6B A;  1WRZ A;  2CXJ A;  1N65 A;  1MWN A;  3EKH A;  2KYC A;  3DF0 B;  2JTT A;  4C0J A;  2ISD A;  1F55 A;  3CR5 X;  1UHH A;  3E3R A;  4QJ3 B;  3IQQ A;  4DIR A;  1OE9 B;  4P5O E;  5CPV A;  1S6I A;  1LXF C;  5CSF A;  3CTN A;  3VRR A;  1LVC D;  3SG4 A;  1CDN A;  5CSI A;  2BE6 A;  1S1E A;  2JNF A;  3TS5 B;  2K7D A;  4DS7 A;  4ICB A;  2K7O A;  2IS9 A;  1GGW A;  3RM1 A;  4NDD A;  1NWD A;  3OP0 A;  1IG5 A;  1KK8 B;  4XJK A;  1KFU S;  1OMD A;  2CNP A;  2JXC A;  2M8U A;  3FWC A;  2O60 A;  1K95 A;  1EJ3 A;  1UP5 A;  4YBH B;  2EHB A;  3NSK A;  2LUC A;  4MBE A;  3DVK A;  1A03 A;  1UUR A;  5CSJ A;  4NQG A;  1B47 A;  4IL1 A;  3GK2 A;  1SK6 D;  4CFR A;  3DD4 A;  1ZUZ A;  2EC6 C;  4PAL A;  1WLM A;  1H8B A;  1BLQ A;  2COL B;  1CDM A;  2M7L A;  1SKT A;  1NX2 A;  2CCM A;  3PAL A;  2CBL A;  1YVH A;  4FTG A;  1KFX L;  1QX5 B;  1S36 A;  1K2H A;  1YX8 A;  1K96 A;  2KAV A;  4PHN A;  2JWW A;  1CMF A;  1OQP A;  2M0R A;  2M1U A;  4WQ2 A;  1PRW A;  4DUQ A;  2R2I A;  3I5H B;  1WDC C;  2M1K B;  3I5F C;  1KSO A;  1J7Q A;  1Y1U A;  1SR6 C;  2KI6 C;  4YGD B;  2LCP A;  4PE0 A;  5DKN A;  5F6T A;  3IF7 A;  1B1G A;  1ZFS A;  2NLN A;  1WY9 A;  1M31 A;  1SMG A;  1TNQ A;  3SG2 A;  4MLW A;  2BL0 C;  1B8L A;  2FCE A;  1JUO A;  1NPQ A;  1PVB A;  4ZCU A;  1XFZ O;  1FBV A;  4ORC B;  1EH2 A;  1N2D A;  4R1E A;  2M97 A;  2BEC A;  3LLE A;  1EG4 A;  5HLV A;  1VRK A;  2L4H A;  1IQ3 A;  5HYD A;  2KFF A;  3BQ3 A;  1S26 D;  3GOF A;  1IJ5 A;  4MEW A;  5AEQ A;  5PAL A;  3DF0 A;  1BG1 A;  1UHI A;  1QVI Y;  3JVT C;  2SAS A;  3EVR A;  5JJG A;  1OOJ A;  1J7R A;  2LLU A;  3RLZ A;  3ZNI A;  1FI6 A;  1UHJ A;  2M29 A;  1AHR A;  2I2R E;  5KSZ A;  5CSN A;  5D7F A;  5AAN A;  1AJ4 A;  1NIW A;  3BUX B;  4N5X A;  5J3X A;  3WHT B;  4C0K A;  3OB1 B;  1UWO A;  2NCP A;  2OS8 B;  1BMO A;  1ZOT B;  1K8U A;  4AQI A;  4ORB B;  5AXI A;  1BOD A;  3DVJ A;  1D1O A;  4Q04 A;  1B4C A;  1DJW A;  4PE7 A;  3BYA A;  2BCA A;  1FF1 A;  1YUU A;  3VGO A;  1F71 A;  2K61 A;  3BOW B;  4ZCV A;  3TS5 C;  4A4B A;  1IRJ A;  2LAN A;  3F45 A;  1NSH A;  1XYD A;  4HRH A;  3VRO A;  3KF9 A;  1TNP A;  2H61 C;  1QLS A;  3NSO A;  2FCD A;  2MAZ A;  1AP4 A;  2LV7 A;  1TRF A;  2F2P A;  1IQ5 A;  5GQQ C;  2MA2 A;  1M63 B;  2G2B A;  2LMV A;  1XFX O;  2CT9 A;  1A75 B;  5I2L A;  3MSE B;  4GNK B;  1S6J A;  1BR4 B;  2MJW B;  1V1F A;  2WND A;  3IQO A;  1IKU A;  1S3P A;  4YGC B;  2KI6 D;  1XK4 C;  4USL A;  4HRE E;  3JTD B;  1F54 A;  2MRD A;  2ZRT A;  4MZJ A;  1SRA A;  1RFJ A;  3EK4 A;  3NXA A;  4HRG A;  1JC2 A;  3CZT X;  1C07 A;  1LA3 A;  1JFJ A;  1IGV A;  1CLM A;  5I2O A;  3SG7 A;  5AFP A;  3I5H C;  3PM8 A;  1XFU O;  1OMV A;  1QS7 A;  3FWB A;  1KWO C;  1PAL A;  2JPT A;  1OZS A;  1C7V A;  1SCV A;  2BE4 A;  2LP2 A;  4GPL B;  5IBW A;  3AKA A;  3VRN A;  1DJI A;  2K8M B;  2PMY A;  5KU1 A;  1DJY A;  3SG5 A;  3TUY B;  1V1G A;  1YUS A;  1HT9 A;  1QV0 A;  1JF0 A;  5ER5 A;  1UUS A;  1DF0 B;  4GGF A;  1CM4 A;  1RTP 1;  1K94 A;  1NCX A;  1QX7 A;  2LMT A;  2BKI B;  2F3Z A;  1BT6 A;  3TZ1 A;  4C0L A;  3PSR A;  4XYN A;  1TNW A;  1QXP A;  1MHO A;  4MZL A;  1IWQ A;  1KQV A;  1SL9 A;  3TDI A;  4GGF C;  4DRW A;  4NDB A;  1Y1X A;  1UHN A;  2Y4Q A;  2KI4 C;  2M9G A;  1HQV A;  2PVB A;  1AK8 A;  1KFX S;  1ODB A;  3EK7 A;  3BOW A;  1SL7 A;  5B8I B;  1Q80 A;  2OS8 C;  4L9M A;  3VRQ A;  1KFU L;  1KCY A;  1CKK A;  4CLN A;  2KFH A;  4AQJ A;  1YUT A;  4OR9 B;  1KSM A;  2P6B B;  1LIN A;  3I5I B;  1DVI A;  1A75 A;  5AER A;  4I5L B;  1M39 A;  5ER4 X;  3KO0 A;  2MLE C;  1G33 A;  2KQ6 A;  4YRU A;  1K90 D;  4MN0 A;  2Y1N A;  3OHM B;  3CR4 X;  1B8C A;  1KQM B;  1QIV A;  3OX5 A;  2L51 A;  4FQO A;  1OZO A;  1U5I B;  2QPT A;  2DOQ A;  2FJU B;  4YGA A;  3WNX B;  4U8D A;  1OMR A;  2KNE A;  3A4U B;  3PAT A;  4I5K A;  1L2O C;  4MVF A;  2KGB C;  4JQ0 D;  4OKH A;  3OX6 A;  1E8A A;  1XVJ A;  3I5G C;  3JTD C;  3PLF B;  2LC5 A;  1SNL A;  3KHE A;  2LVJ A;  4PHJ A;  1YRT B;  2MLF C;  3AAJ A;  1YR5 A;  2QAC A;  2ZND A;  3OB2 B;  1JWD A;  1PVA A;  1RRO A;  2JT3 A;  1BJF A;  1QTX A;  1QAS A;  3TDZ A;  1TCO B;  2KYF A;  4PHK A;  5TNC A;  5HKZ A;  3A8R A;  1DF0 A;  1EG3 A;  1DJH A;  1QX2 A;  1XO5 A;  2K0J A;  3WHU B;  1YX7 A;  4MZK A;  3O78 A;  1ZMZ A;  4OVN F;  1PK0 D;  1SY9 A;  2K2F A;  1IJ6 A;  4F0Z B;  2KFG A;  1CFC A;  1QVI Z;  1M46 A;  1QJT A;  2ZN9 A;  2PSR A;  1GJY A;  2TN4 A;  5BPJ A;  1JFK A;  1NX1 A;  2EC6 B;  2JRF A;  2L0P A;  2ZFD A;  1CFD A;  1KK8 C;  3KPX A;  4GFT A;  5DKR A;  2SCP A;  2HPS A;  1ZAC A;  1B8R A;  2L5X B;  1MQ1 A;  1BR1 B;  1NYA A;  2FOT A;  2JNX A;  4YGB B;  1CTR A;  4I5N B;  2NZ0 A;  1XFY O;  1C7W A;  1ALW A;  3I5F B;  4BY4 A;  4ETO A;  4D1E A;  1H4B A;  1SR6 B;  1MF8 B;  2LE9 B;  3SG3 A;  1KK7 Y;  1QAT A;  1MUX A;  2I94 A;  1TIZ A;  2LMU A;  1NX0 A;  2JT8 A;  3BUW B;  1BU3 A;  2BL0 B;  3FS7 A;  4JPZ B;  1SW8 A;  3SG6 A;  3FIA A;  1QLK A;  2JZI A;  3SIB A;  3WXA A;  5I2Q A;  3QRX A;  1MR8 A;  1XFV O;  2O5G A;  4ORA B;  1K9K A;  4TNC A;  1X02 A;  2K2A A;  1A4P A;  3GK1 A;  4N1G A;  3D0Y B;  4PCW A;  2Q4U A;  2MBX A;  1U5I A;  2LVI A;  3K21 A;  1NX3 A;  1SCM B;  2ZNE A;  1KK7 Z;  1WLZ A;  4MSP A;  1DJZ A;  3PFV A;  1Y6W A;  4JWQ A;  3JVT B;  4YI9 A;  3EVV A;  1AJ5 A;  1DJX A;  1MXL C;  1SBJ A;  3CS1 A;  1NUB A;  1DT7 B;  2PAL A;  2LAP A;  1J55 A;  3O4Y A;  3LK1 A;  3CGA A;  1REC A;  1TOP A;  2GGZ A;  4OCI A;  2JQ6 A;  1ALV A;  2M3W A;  2F3Y A;  1PSB A;  2OPO A;  3HCM A;  2BBN A;  3DVE A;  4YGE B;  1XA5 A;  2JTZ A;  1JBA A;  2KSP A;  1TNX A;  2I7A A;  1G4Y R;  1J1E A;  2LVK A;  1J1D A;  1Y1A A;  1RK9 A;  3CR2 A;  1FI5 A;  3PN7 B;  2KQY A;  2WCF A;  3M0W A;  2G9B A;  2ZRS A;  2KAX A;  2NCO A;  2ZN8 A;  1W7J B;  1LA0 A;  1CDL A;  1DGV A;  2PRU A;  3EKJ A;  2CTN A;  2GV5 A;  1BOC A;  1R2U A;  2H2K A;  2LHL A;  1W7I B;  3KEV A;  1TN4 A;  1YUR A;  1QIW A;  1BF5 A;  3BUO B;  2LLT A;  3EK8 A;  1J7O A;  2I18 A;  3AKB A;  4QJ4 B;  1CFF A;  3BXK A;  4OV2 A;  1SPY A;  2KOT A;  1F8H A;  3DVM A;  1B9A A;  3O2P A;  4GUK A;  5HKY A;  1OSA A;  2OTG B;  1S6C A;  2AMI A;  5HKW A;  1RWY A;  1JSA A;  1EL4 A;  1FPW A;  2JT0 A;  1K9P A;  4CPV A;  4QJ5 B;  4AOM A;  5G08 A;  4WRI A;  1KWO B;  1CLL A;  2HET A;  2WOR A;  2WOS A;  4PE1 A;  1R6P A;  1CM1 A;  1CLB A;  3C1V A;  5K89 A;  2BCB A;  2F33 A;  2NXQ A;  4PE4 A;  1IH0 A;  2HQ8 A;  3BUM B;  2M49 B;  3D0Y A;  1CNP A;  1GQM A;  2KBI A;  2ZKM X;  4M2O A;  2GGM A;  2AAO A;  3ZWH A;  4N1F A;  2AUC A;  1PSR A;  4A4C A;  1SYM A;  2Q91 A;  2KBM A;  1QV1 A;  1G8I A;  1XFW O;  1DJG A;  4UPG A;  4P2Y B;  2JOJ A;  2LM5 A;  2KDH A;  2V53 A;  4NDC A;  4MRX A;  4WQ3 A;  1JF2 A;  4PDZ A;  1NCY A;  3AAK A;  1NCZ A;  3EVU A;  1L7Z A;  2LNK A;  1SCM C;  2KHN A;  2KGR A;  5JOL A;  2E30 A;  3TUY C;  4I5J A;  2JUL A;  4GAO A;  4M2P A;  1LKJ A;  4XJK B;  2KI4 B;  5D69 A;  1FW4 A;  3CLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...