3IQQA

X-ray structure of bovine trtk12-ca(2+)-s100b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The Effects of CapZ Peptide (TRTK-12) Binding to S100B-Ca(2+) as Examined by NMR and X-ray Crystallography
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3iqqA00
4WQ3A 5CSJA 3JVTC 5CSNA 1J7RA 4ZCUA 3TUYC 5FYXA 1KQMB 1KFUS 1Y1XA 1DJZA 2BCBA 2GGMA 2LP2A 2KNEA 1ODBA 3SJSA 5ER5A 2BL0C 2V53A 5D69A 1CMGA 1XFUO 1V1FA 2F8PA 3K21A 1CLLA 2K7CA 2KYFA 1XA5A 2DOQA 2MLFC 3DVMA 1IJ6A 3H4SE 1A75B 4CIDA 1CFPA 2QPTA 1H8BA 1R6PA 2LLUA 4XJKA 1AVSA 2WC8A 1QTXA 1DMOA 1K9KA 3PFVA 2Y1NA 3PATA 1J55A 4GGNA 4PE7A 1IKUA 1BF5A 1CDLA 4MLWA 3IF7A 1NPQA 1RJVA 2JTTA 3O78A 4NDCA 4PHNA 4QJ5B 5AXIA 1NX1A 1OOJA 1C07A 5D7FA 1DJWA 4CPVA 1MHOA 1DJXA 1SK6D 2K0JA 2OS8C 3DVJA 4OVNF 3CR5X 1CKKA 2CBLA 2F2PA 2I7AA 1GGZA 2CTNA 2WORA 3OX5A 1J1DA 1F4QA 1PALA 2NCOA 1DF0B 1DT7B 4N5XA 2ZN9A 1DTLA 3LCPC 3VRPA 3JTDB 4MN0A 4YGBB 1CDNA 3F45A 2K61A 3E3RA 4GUKA 1EJ3A 3CZTX 1B9AA 1SY9A 1BJFA 1K2HA 1KFXS 2PMYA 1IQ5A 1DJHA 4HREE 1D1OA 1SW8A 4BY4A 2KDHA 2LP3A 1A75A 2JC2A 1QVIY 4CFRA 1Y6WA 1B7TY 1NWDA 1SCVA 3PN7C 1KK8B 2JNFA 2JT0A 3I5HB 1ALVA 2MBXA 2K7DA 3GOFA 4M2PA 4OCIA 2F3YA 1S5GY 2FOTA 2AAOA 1YVLA 3LLEA 4Q04A 1OMVA 3NSIA 1M31A 5BPJA 5KTYA 1SYMA 1SKTA 3I5IC 4GPLB 4QJ4B 3DVKA 2H61A 1N2DA 4DIRA 2D8NA 3ZWHA 2FCEA 2KFGA 1L7ZA 3TDIA 1SBJA 4NDBA 3OX6A 2JXLA 1R2UA 2IS9A 2HPSA 2JTZA 3GK2A 2L0PA 2OTGB 2KGRA 1DGUA 1IGVA 2SASA 1JUOA 1IG5A 4BY5A 2NLNA 2KI6C 4N1GA 1DF0A 1JC2A 4P2YB 2FCDA 1NCZA 1QV0A 2PSRA 3AKAA 4ORCB 5IBWA 2ZNEA 1SR6C 2I94A 3EK8A 2K7BA 3BUWB 2JULA 3I5FB 4ZCVA 2LMTA 4C0JA 3KEVA 2L51A 5CSFA 1TNXA 3VRQA 1S6JA 5DKQA 1MWNA 1TIZA 1FW4A 1QX2A 1RK9A 1UWOA 2LHLA 3BUNB 3NSKA 1EH2A 4I5JA 3TZ1A 1YX8A 2CT9A 2LVKA 1AHRA 1BR1B 1PSRA 1QIWA 2GV5A 1XYDA 1KSMA 1YURA 2LM5A 1PSBA 1MF8B 2LLSA 4USLA 2KYCA 1K9UA 1UHJA 4GAOA 4JWQA 1W7IB 5ER4X 2WCEA 1TRFA 1B8LA 1NX3A 1SL9A 2ZRSA 2I2RE 1BLQA 2K2AA 4PDZA 3TDUA 1CMFA 2LVVA 1WY9A 2L4IA 3EVVA 1RROA 1F70A 1QASA 2O5GA 3CS1A 4YGDB 4CFQA 5KU1A 1FPWA 1OZOA 3PSRA 3WHTB 3HX4A 1TN4A 3JVTB 3DVEA 3I5GB 3TUYB 2HQWA 4ORAB 4JPZB 3KO0A 2Y1MA 1IQ3A 2MRDA 4AQIA 1NX2A 1K9PA 2F2OA 4PHMA 4GGFC 1XK4A 1KWOB 4YI8A 1JFJA 2BBMA 1TNQA 3A4UB 1J7QA 1DJIA 5B8IB 2KBIA 4YI9A 1B7TZ 2Y5IA 4DS7A 2O60A 2LNKA 5J3XA 4YRUA 1F54A 1TNWA 3EK7A 1KCYA 1OQPA 1KQVA 1G8IA 1S5GZ 2L98A 2M7NA 1WLMA 3BUMB 1H4BA 3AAKA 3EVUA 1SCMB 2HF5A 1B8RA 3OHMB 4YGEB 3O2PA 1DGVA 2WNDA 2VRGA 3TS5B 1F4OA 3SG5A 1Y0VH 3D0YB 1BMOA 1YUUA 2KAYA 3TDZA 3AKBA 1CTRA 1L2OB 2JOJA 4R1EA 1CFFA 1S6CA 4WQ2A 4A4CA 1MXLC 2BECA 2M0RA 5I2OA 2F33A 1SL7A 2KQ6A 4PE0A 1M45A 1QX5B 2L50A 2KI6D 1CLMA 1A03A 2ZKMX 1NUBA 2M1KB 2LVJA 4I5LB 2PALA 4YGAA 3WXAA 2KBMA 2LC5A 2MA2A 1AK8A 4E68A 1XFXO 3JTDC 1B8CA 1YUSA 1MUXA 3RM1A 2LAPA 1M46A 2M8UA 2KAXA 1LA3A 3A8RA 3BOWA 2LMVA 5HYDA 1UP5A 1BR4B 1XFVO 2ZN8A 1PULA 2M97A 3DF0B 1LINA 2M7LA 3SG4A 1S36A 1NIWA 1M39A 3BYAA 4MRXA 5HKZA 1XO5A 3BQ3A 2WOSA 4QJ3B 1TCOB 2KOTA 4DUQA 4XYNA 1S1EA 2F3ZA 3ICBA 2KFHA 1KK8C 4C0LA 1IWQA 4GFTA 3I5HC 3BUOB 2KI4C 4MBEA 4F0ZB 1EL4A 3O4YA 4U8DA 3SG2A 3WHUB 3D0YA 1SRAA 2JNXA 5AERA 1NYAA 3GK1A 1OMDA 1UUSA 4OR9B 1WLZA 5CPVA 4C0KA 4A4BA 1NP8A 1QS7A 1CDMA 1RFJA 1WRLA 1DVIA 1MQ1A 3EVRA 4MZLA 4PHKA 1LXFC 1WRZA 1QXPA 2OTGC 1UHNA 1XFYO 1ZMZA 1G4YR 5KSZA 1EG3A 1PRWA 2HETA 3KHEA 4WRIA 2E6WA 1NCXA 4UPGA 1SR6B 4L9MA 1EG4A 2L2EA 2BKIB 2NCPA 1LKJA 1PVAA 3CWGA 4NQGA 2KHNA 3NXAA 1UHHA 3FWBA 2M9GA 4TNCA 1Y1UA 3I5FC 2NZ0A 2JPTA 2KAVA 1DJGA 2BBNA 3EKJA 1GJYA 2PRUA 3DF0A 4ETOA 1B47A 2K8MB 4MRYA 1B4CA 4HSZA 1FBVA 1PK0D 1WDCC 2OPOA 1RWYA 1ZUZA 1XFWO 4MVFA 2AUCA 5DKNA 1G33A 2MLEC 2Q91A 1N0YA 4JQ0D 2EC6C 2B1UA 1KSOA 4YBHB 5I8NA 1IRJA 1TOPA 1A2XA 3KPXA 1S3PA 2LUCA 3PM8A 1JSAA 3LL8B 1J1EA 1CLBA 4MZJA 1VRKA 1ALWA 3IQOA 1QJTA 1OE9B 2NXQA 1F55A 2JZIA 4PALA 4DCKA 5TNCA 1SL8A 2EHBA 3PLFB 5AFPA 1Y1AA 4AQJA 1IH0A 4GNKB 1SPYA 1KQMC 3LK1A 2JU0A 1BG1A 5HKYA 1K94A 3BOWB 1HQVA 2L5XB 4AOMA 2LE9B 2BL0B 1QVIZ 1CM4A 4M2OA 3FS7A 1WRKA 3I5GC 3CGAA 4MSPA 3M0WA 1JF0A 4NDDA 1KFUL 4PHJA 3VROA 3CR2A 3PALA 1C7VA 3WNXB 1KK7Y 1KWOC 3HCMA 1CDPA 1UHKA 2BKHB 2M29A 4DRWA 1AJ5A 1YUTA 3DD4A 5I2LA 2JWWA 3D10A 5DKRA 1HT9A 1JWDA 1NSHA 3QRXA 1XFZO 2BCXA 4OKHA 5I2QA 2RGIA 2MJWB 4CLNA 2TN4A 2WCBA 2JRFA 1RECA 2LCPA 1U5IB 1BT6A 1LVCD 1SCMC 2H61C 3EKHA 2OS8B 1K90D 1N65A 4M2QA 1J7PA 4MEWA 3TS5C 2AMIA 2CXJA 5AEQA 3SG7A 4PCWA 1K8UA 1ZFSA 1GQMA 1YTZC 1L2OC 1QLKA 1YX7A 4IL1A 1GGWA 2FJUB 3O6BA 1ZOTB 4ICBA 5HKWA 2WCFA 3LK0A 3SG6A 1YVHA 1SMGA 2KGBC 2M3WA 1LA0A 2KQYA 3CLNA 2PVBA 2K7OA 2LLTA 1BU3A 1S26D 2BE4A 1QATA 2ZNDA 5CSIA 1F71A 2E30A 1XVJA 1YR5A 4ORBB 2Q4UA 1A29A 1V1GA 3EK4A 1J7OA 4GGFA 2CNPA 1M63B 1JBAA 2LV7A 4I5NB 3PN7B 3MSEB 4HRGA 2M1UA 1F8HA 1FI5A 1KFXL 2H2KA 2R2IA 2EGDA 5F6TA 1IJ5A 1QIVA 3AAJA 3KF9A 1TTXA 4FTGA 2LVIA 4OV2A 4P5OE 2CCMA 2LHIA 2HQ8A 1QV1A 2LANA 3RLZA 5HLOA 1JFKA 4N1FA 3I5IB 1K93D 2SCPA 3FIAA 2GGZA 2KI4B 1FI6A 1U5IA 3CR4X 5HLVA 1OZSA 3BUXB 2I18A 2KFFA 3CTNA 1MXEA 4PE1A 3SIBA 3IQQA 3OB1B 2ZRTA 2QACA 1E8AA 2MHHA 5K89A 4GBAA 2JXCA 1TNPA 2BE6A 4YGCB 2ISDA 1XK4C 1YRUB 1C7WA 2G2BA 3GK4X 2MAZA 4FQOA 2A4JA 1K95A 5AANA 3VRNA 2COLB 4HRHA 3C1VA 1KK7Z 1NCYA 1UURA 1CFCA 1CNPA 1CFDA 1Q80A 2L4HA 2LUXA 5JJGA 1QLSA 1EXRA 1A4PA 1S6IA 2JT8A 4MZKA 3VGOA 1AJ4A 3VRRA 4XJKB 4D1EA 1ZACA 1W7JB 3NSLA 2P6BB 4I5KA 1X02A 3NSOA 1UHIA 1OMRA 2G9BA 3SIAA 1CM1A 3ZNIA 1YRTB 5PALA 1BOCA 1QX7A 1WDCB 3OB2B 3SG3A 3FWCA 2BCAA 4PE4A 1B1GA 1BODA 1SNLA 1PVBA 1CB1A 1MR8A 1FF1A 1TCFA 2KSPA 2M49B 1K96A 2JQ6A 2ZFDA 1AP4A 2EC6B 1NX0A 2LMUA 3OP0A 5G08A 3BXKA 5JOLA 2JT3A 5GQQC 1RTP1 1DJYA 1OSAA 2Y4QA 1AUIB 2PASA 1JF2A 2K2FA
chains in the Genus database with same CATH superfamily
3S0EA 3CYZA 4WQ3A 5CSJA 3JVTC 5CSNA 1ORGA 1J7RA 4ZCUA 3TUYC 5FYXA 1KQMB 1KFUS 1Y1XA 1DJZA 2BCBA 2GGMA 2LP2A 2H8VA 2KNEA 1ODBA 3SJSA 5ER5A 2BL0C 2V53A 5D69A 1CMGA 1XFUO 1V1FA 2F8PA 3K21A 1CLLA 2K7CA 2KYFA 1XA5A 2DOQA 2MLFC 3DVMA 1IJ6A 3H4SE 1A75B 4CIDA 1CFPA 2QPTA 1H8BA 1R6PA 2LLUA 4XJKA 1AVSA 2WC8A 1QTXA 1DMOA 1K9KA 3PFVA 2Y1NA 3PATA 1J55A 4GGNA 4PE7A 1IKUA 1BF5A 2WC6A 1CDLA 3D77A 3IF7A 4MLWA 1NPQA 2K60A 2PQLA 1RJVA 5EL2A 5FI7A 2JTTA 2WCLA 3O78A 4NDCA 4PHNA 2ERBA 4QJ5B 5AXIA 1NX1A 1OOJA 3SS4A 1C07A 5D7FA 1DJWA 4FQTA 3UNWA 4CPVA 1MHOA 1DJXA 1SK6D 2K0JA 2OS8C 3DVJA 1XFRA 4OVNF 3CR5X 1CKKA 2CBLA 2F2PA 2WCHA 2I7AA 1GGZA 2CTNA 2WORA 3OX5A 1J1DA 1F4QA 1PALA 2NCOA 1DF0B 1DT7B 4N5XA 2ZN9A 1DTLA 3LCPC 3VRPA 3JTDB 4MN0A 4YGBB 1CDNA 3F45A 2K61A 3PJIA 3E3RA 4GUKA 1EJ3A 3CZTX 1B9AA 2L2CA 1SY9A 1BJFA 1K2HA 1KFXS 2PMYA 1IQ5A 1DJHA 4HREE 5FI6A 1SW8A 1D1OA 4BY4A 3B87A 2KDHA 2LP3A 1A75A 2JC2A 1QVIY 4CFRA 1Y6WA 1B7TY 1NWDA 2KLDA 1SCVA 3PN7C 1KK8B 4F7FA 2JNFA 2JT0A 3I5HB 1ALVA 2MBXA 2K7DA 3GOFA 4M2PA 4OCIA 2F3YA 1S5GY 2FOTA 2AAOA 1YVLA 3LLEA 4Q04A 1OMVA 3NSIA 1M31A 3NGVA 5BPJA 5KTYA 1SYMA 1SKTA 3I5IC 4GPLB 4QJ4B 3DVKA 2H61A 1N2DA 4DIRA 2D8NA 3ZWHA 1TWOA 2FCEA 1L7ZA 2KFGA 3D78A 3NHIA 3TDIA 3D76A 1SBJA 4NDBA 3OX6A 2JXLA 1R2UA 2IS9A 2HPSA 2JTZA 3GK2A 3CZ2A 2L0PA 2OTGB 2KGRA 1DGUA 1IGVA 2SASA 1JUOA 1IG5A 4BY5A 2P71A 2NLNA 2KI6C 4N1GA 1DF0A 1JC2A 4P2YB 2FCDA 1NCZA 1QV0A 2QEHA 2PSRA 3AKAA 4ORCB 5IBWA 2ZNEA 1SR6C 2I94A 3EK8A 2K7BA 2BAPA 3BUWB 2JULA 3I5FB 4INXA 4ZCVA 2LMTA 2WCMA 4C0JA 3KEVA 2L51A 5CSFA 1TNXA 3VRQA 3FE6A 1S6JA 3R1OA 5FI2A 5DKQA 1MWNA 1TIZA 1FW4A 1QX2A 1RK9A 1UWOA 2LHLA 3BUNB 3NSKA 1EH2A 1T14A 4I5JA 3TZ1A 1YX8A 2CT9A 2LVKA 1AHRA 1BR1B 1PSRA 1QIWA 2GV5A 1XYDA 1KSMA 1YURA 2LM5A 1PSBA 1MF8B 2LLSA 4IJ7A 2KYCA 4USLA 1K9UA 3SS5A 1UHJA 3S0AA 3FE8A 4GAOA 4JWQA 1W7IB 5ER4X 2WCEA 1TRFA 1B8LA 1NX3A 1SL9A 3IVTA 2ZRSA 2I2RE 1OW4A 1CNPA 1BLQA 2K2AA 4PDZA 3TDUA 1CMFA 2LVVA 1WY9A 2L4IA 3EVVA 1RROA 3PM2A 1F70A 1QASA 2O5GA 3CS1A 4YGDB 4CFQA 5KU1A 1FPWA 1OZOA 3PSRA 3WHTB 3HX4A 1TN4A 3JVTB 3DVEA 3I5GB 3TUYB 2HQWA 4ORAB 4JPZB 3NHTA 3DXLA 3KO0A 2Y1MA 1IQ3A 2MRDA 3L4AA 4AQIA 1NX2A 1K9PA 2F2OA 3D74A 4GGFC 1XK4A 4PHMA 1KWOB 1OOIX 4YI8A 1JFJA 2BBMA 1TNQA 3A4UB 1J7QA 1DJIA 5B8IB 2KBIA 4YI9A 1B7TZ 2Y5IA 4DS7A 2O60A 1QWVA 2LNKA 2L5YA 5J3XA 4YRUA 1F54A 1TNWA 2KLEA 3EK7A 1KCYA 3SS3A 1OQPA 1KQVA 1G8IA 1S5GZ 2L98A 2M7NA 1WLMA 3BUMB 2QDIA 1H4BA 3AAKA 3EVUA 1SCMB 2HF5A 1B8RA 3OHMB 4YGEB 3O2PA 1DGVA 1TUZA 2WNDA 2VRGA 3TS5B 1F4OA 2FJYA 3SG5A 1Y0VH 3D0YB 1BMOA 1YUUA 2KAYA 3TDZA 3AKBA 1CTRA 1L2OB 2JOJA 4R1EA 1CFFA 1S6CA 4WQ2A 4A4CA 1MXLC 2BECA 2M0RA 5I2OA 2F33A 3S0FA 1SL7A 2KQ6A 4PE0A 1M45A 1QX5B 2L50A 2KI6D 1LS8A 1CLMA 1A03A 2ZKMX 1NUBA 3RZSA 2M1KB 2LVJA 4I5LB 2PALA 4YGAA 3S0DA 2KBMA 2LC5A 2MA2A 3WXAA 1AK8A 4E68A 1XFXO 3JTDC 1B8CA 1YUSA 1MUXA 3RM1A 2LAPA 1DC1A 1M46A 3FE9A 2M8UA 2KAXA 1LA3A 3A8RA 3BOWA 2LMVA 5HYDA 1UP5A 1BR4B 1XFVO 2ZN8A 5DICA 1PULA 2M97A 3DF0B 1LINA 2M7LA 3SG4A 1S36A 1NIWA 1M39A 3BYAA 4MRXA 5HKZA 1XO5A 3BQ3A 2WOSA 4QJ3B 3B6XA 1TCOB 2KOTA 4DUQA 4XYNA 3BJHA 1S1EA 2F3ZA 3ICBA 3B88A 2KFHA 5D3OA 3N7HA 1KK8C 4C0LA 1IWQA 4GFTA 3I5HC 3BUOB 2KI4C 4MBEA 4F0ZB 1EL4A 3O4YA 4U8DA 3SG2A 3WHUB 2YGUA 3D0YA 1SRAA 2JNXA 5AERA 1NYAA 3GK1A 1OMDA 1UUSA 4OR9B 1WLZA 5CPVA 2WC5A 4C0KA 4A4BA 1NP8A 1QS7A 1CDMA 1RFJA 1WRLA 1DVIA 1MQ1A 3EVRA 4MZLA 4PHKA 1LXFC 1WRZA 1QXPA 2OTGC 1UHNA 1DEKA 1XFYO 1ZMZA 1G4YR 3CZ0A 5KSZA 1EG3A 1PRWA 1TUJA 2HETA 3KHEA 4WRIA 2E6WA 1NCXA 4UPGA 1SR6B 4L9MA 1EG4A 2L2EA 2BKIB 2NCPA 1LKJA 1PVAA 3CWGA 2WCKA 4NQGA 2KHNA 3NXAA 1SSEB 1UHHA 3FWBA 2M9GA 4TNCA 1IIOA 1Y1UA 3I5FC 1DELA 2GTEA 2NZ0A 3O4XA 2JPTA 2KAVA 1DJGA 2BBNA 3EKJA 1GJYA 2PRUA 3DF0A 3L47A 4ETOA 1B47A 2K8MB 4MRYA 1B4CA 4HSZA 1FBVA 1PK0D 1WDCC 2OPOA 1RWYA 1ZUZA 1XFWO 4MVFA 2JPOA 2AUCA 5DKNA 1G33A 2MLEC 2Q91A 1N0YA 1C3YA 4JQ0D 3CDNA 2EC6C 2B1UA 1KSOA 4YBHB 5I8NA 1IRJA 1TOPA 1A2XA 3KPXA 1S3PA 2LUCA 3PM8A 1JSAA 3LL8B 1J1EA 1CLBA 4MZJA 1VRKA 1ALWA 3IQOA 1QJTA 1OE9B 2NXQA 4KYNA 1F55A 2JZIA 4PALA 4DCKA 5TNCA 1SL8A 2EHBA 3PLFB 5AFPA 1Y1AA 4AQJA 1IH0A 4GNKB 1SPYA 1KQMC 3LK1A 4INWA 2JU0A 1BG1A 5HKYA 1K94A 3BOWB 1OOHA 1HQVA 2L5XB 4AOMA 3OBVA 2LE9B 2BL0B 1QVIZ 1CM4A 4M2OA 3FS7A 1WRKA 3I5GC 3CGAA 4MSPA 3M0WA 1JF0A 4NDDA 1KFUL 4PHJA 3VB1A 3VROA 3CR2A 3PALA 3DZTA 1C7VA 2WCJA 3WNXB 1KK7Y 1KWOC 3HCMA 3S0BA 3CZ1A 1CDPA 1UHKA 2BKHB 2M29A 4DRWA 1AJ5A 1YUTA 3DD4A 3L4LA 5I2LA 2JWWA 3BFAA 3D10A 5DKRA 1HT9A 1JWDA 1NSHA 3QRXA 1XFZO 2BCXA 4OKHA 1P28A 5I2QA 2RGIA 2MJWB 4CLNA 2TN4A 2WCBA 2JRFA 1RECA 2KPHA 3CABA 2LCPA 1U5IB 1BT6A 1LVCD 1SCMC 2H61C 3EKHA 2OS8B 3OGNA 1K90D 1N65A 4M2QA 1J7PA 4MEWA 3TS5C 3B86A 2AMIA 1GM0A 2CXJA 5AEQA 3SG7A 4PCWA 1K8UA 1ZFSA 1GQMA 1YTZC 1L2OC 1QLKA 5I94A 1YX7A 4IL1A 1GGWA 2FJUB 1DQEA 3O6BA 1ZOTB 2P70A 4ICBA 5HKWA 2WCFA 3LK0A 3SG6A 1YVHA 1SMGA 2KGBC 1OOGA 2M3WA 1LA0A 2KQYA 3BFHA 2PVBA 3CLNA 2K7OA 2LLTA 1BU3A 1S26D 2BE4A 1QATA 2ZNDA 5CSIA 1F71A 2E30A 1XVJA 1YR5A 4OZDA 4ORBB 2Q4UA 1A29A 1V1GA 3EK4A 1J7OA 4GGFA 3QMEA 2CNPA 4JKTA 1M63B 1JBAA 1OOFA 2LV7A 4I5NB 3PN7B 3MSEB 4HRGA 2M1UA 3R72A 1F8HA 1FI5A 1KFXL 2H2KA 2R2IA 2EGDA 5F6TA 1IJ5A 1QIVA 3AAJA 3KF9A 1TTXA 4FTGA 2LVIA 4OV2A 1W9ZA 4P5OE 2CCMA 2LHIA 2HQ8A 1QV1A 2LANA 3RLZA 5HLOA 1JFKA 4N1FA 3I5IB 1K93D 2SCPA 3FIAA 3V2LA 2GGZA 2KI4B 1FI6A 1U5IA 3CR4X 5HLVA 1OZSA 2QEOA 3BUXB 5HL1A 2I18A 2KFFA 3CTNA 1MXEA 3DY9A 4PE1A 3IQQA 3SIBA 3OB1B 2ZRTA 2QACA 1E8AA 3S0GA 2MHHA 5K89A 4GBAA 2JXCA 1TNPA 2BE6A 3Q8IA 3R1VA 4YGCB 3UO9A 2ISDA 1XK4C 1YRUB 1C7WA 2G2BA 3GK4X 2MAZA 4FQOA 2A4JA 3EG5B 1K95A 5AANA 3VRNA 2COLB 4HRHA 3C1VA 1KK7Z 1NCYA 1UURA 2PYQA 1CFCA 1CFDA 4PT1A 1Q80A 2L4HA 2LUXA 5JJGA 1QLSA 1EXRA 3BFBA 1A4PA 1S6IA 2JT8A 4MZKA 3VGOA 1AJ4A 3B7AA 2QEBA 3VRRA 4XJKB 4D1EA 3DYEA 3D73A 3D75A 1ZACA 1W7JB 3NSLA 2P6BB 4I5KA 1X02A 3NSOA 4JD9A 1UHIA 1OMRA 2G9BA 3SIAA 3K1EA 1Z4HA 1CM1A 3ZNIA 2QEVA 1YRTB 5PALA 1BOCA 1QX7A 1WDCB 3OB2B 3R1PA 3FWCA 2BCAA 4PE4A 3SG3A 1B1GA 1SNLA 1BODA 1PVBA 1CB1A 1MR8A 1FF1A 2BNXA 1C3ZA 1TCFA 2KSPA 2M49B 1K96A 2JQ6A 2ZFDA 1AP4A 2EC6B 1NX0A 2LMUA 3OP0A 5G08A 3BXKA 1Z2CB 5JOLA 2JT3A 5GQQC 1RTP1 1DJYA 1OSAA 2Y4QA 1AUIB 2PASA 1JF2A 2K2FA
chains in the Genus database with same CATH topology
4WQ3A 5CSJA 3JVTC 5CSNA 1J7RA 4ZCUA 3TUYC 5FYXA 1KQMB 1KFUS 1Y1XA 1DJZA 2BCBA 2GGMA 2LP2A 2KNEA 1ODBA 3SJSA 5ER5A 2BL0C 2V53A 5D69A 1CMGA 1XFUO 1V1FA 2F8PA 3K21A 1CLLA 2K7CA 2KYFA 1XA5A 2DOQA 2MLFC 3DVMA 1IJ6A 3H4SE 1A75B 4CIDA 1CFPA 2QPTA 1H8BA 1R6PA 2LLUA 4XJKA 1AVSA 2WC8A 1QTXA 1DMOA 1K9KA 3PFVA 2Y1NA 3PATA 1J55A 4GGNA 4PE7A 1IKUA 1BF5A 1CDLA 4MLWA 3IF7A 1NPQA 1RJVA 2JTTA 3O78A 4NDCA 4PHNA 4QJ5B 5AXIA 1NX1A 1OOJA 1C07A 5D7FA 1DJWA 4CPVA 1MHOA 1DJXA 1SK6D 2K0JA 2OS8C 3DVJA 4OVNF 3CR5X 1CKKA 2CBLA 2F2PA 2I7AA 1GGZA 2CTNA 2WORA 3OX5A 1J1DA 1F4QA 1PALA 2NCOA 1DF0B 1DT7B 4N5XA 2ZN9A 1DTLA 3LCPC 3VRPA 3JTDB 4MN0A 4YGBB 1CDNA 3F45A 2K61A 3E3RA 4GUKA 1EJ3A 3CZTX 1B9AA 1SY9A 1BJFA 1K2HA 1KFXS 2PMYA 1IQ5A 1DJHA 4HREE 1D1OA 1SW8A 4BY4A 2KDHA 2LP3A 1A75A 2JC2A 1QVIY 4CFRA 1Y6WA 1B7TY 1NWDA 1SCVA 3PN7C 1KK8B 2JNFA 2JT0A 3I5HB 1ALVA 2MBXA 2K7DA 3GOFA 4M2PA 4OCIA 2F3YA 1S5GY 2FOTA 2AAOA 1YVLA 3LLEA 4Q04A 1OMVA 3NSIA 1M31A 5BPJA 5KTYA 1SYMA 1SKTA 3I5IC 4GPLB 4QJ4B 3DVKA 2H61A 1N2DA 4DIRA 2D8NA 3ZWHA 2FCEA 2KFGA 1L7ZA 3TDIA 1SBJA 4NDBA 3OX6A 2JXLA 1R2UA 2IS9A 2HPSA 2JTZA 3GK2A 2L0PA 2OTGB 2KGRA 1DGUA 1IGVA 2SASA 1JUOA 1IG5A 4BY5A 2NLNA 2KI6C 4N1GA 1DF0A 1JC2A 4P2YB 2FCDA 1NCZA 1QV0A 2PSRA 3AKAA 4ORCB 5IBWA 2ZNEA 1SR6C 2I94A 3EK8A 2K7BA 3BUWB 2JULA 3I5FB 4ZCVA 2LMTA 4C0JA 3KEVA 2L51A 5CSFA 1TNXA 3VRQA 1S6JA 5DKQA 1MWNA 1TIZA 1FW4A 1QX2A 1RK9A 1UWOA 2LHLA 3BUNB 3NSKA 1EH2A 4I5JA 3TZ1A 1YX8A 2CT9A 2LVKA 1AHRA 1BR1B 1PSRA 1QIWA 2GV5A 1XYDA 1KSMA 1YURA 2LM5A 1PSBA 1MF8B 2LLSA 4USLA 2KYCA 1K9UA 1UHJA 4GAOA 4JWQA 1W7IB 5ER4X 2WCEA 1TRFA 1B8LA 1NX3A 1SL9A 2ZRSA 2I2RE 1BLQA 2K2AA 4PDZA 3TDUA 1CMFA 2LVVA 1WY9A 2L4IA 3EVVA 1RROA 1F70A 1QASA 2O5GA 3CS1A 4YGDB 4CFQA 5KU1A 1FPWA 1OZOA 3PSRA 3WHTB 3HX4A 1TN4A 3JVTB 3DVEA 3I5GB 3TUYB 2HQWA 4ORAB 4JPZB 3KO0A 2Y1MA 1IQ3A 2MRDA 4AQIA 1NX2A 1K9PA 2F2OA 4PHMA 4GGFC 1XK4A 1KWOB 4YI8A 1JFJA 2BBMA 1TNQA 3A4UB 1J7QA 1DJIA 5B8IB 2KBIA 4YI9A 1B7TZ 2Y5IA 4DS7A 2O60A 2LNKA 5J3XA 4YRUA 1F54A 1TNWA 3EK7A 1KCYA 1OQPA 1KQVA 1G8IA 1S5GZ 2L98A 2M7NA 1WLMA 3BUMB 1H4BA 3AAKA 3EVUA 1SCMB 2HF5A 1B8RA 3OHMB 4YGEB 3O2PA 1DGVA 2WNDA 2VRGA 3TS5B 1F4OA 3SG5A 1Y0VH 3D0YB 1BMOA 1YUUA 2KAYA 3TDZA 3AKBA 1CTRA 1L2OB 2JOJA 4R1EA 1CFFA 1S6CA 4WQ2A 4A4CA 1MXLC 2BECA 2M0RA 5I2OA 2F33A 1SL7A 2KQ6A 4PE0A 1M45A 1QX5B 2L50A 2KI6D 1CLMA 1A03A 2ZKMX 1NUBA 2M1KB 2LVJA 4I5LB 2PALA 4YGAA 3WXAA 2KBMA 2LC5A 2MA2A 1AK8A 4E68A 1XFXO 3JTDC 1B8CA 1YUSA 1MUXA 3RM1A 2LAPA 1M46A 2M8UA 2KAXA 1LA3A 3A8RA 3BOWA 2LMVA 5HYDA 1UP5A 1BR4B 1XFVO 2ZN8A 1PULA 2M97A 3DF0B 1LINA 2M7LA 3SG4A 1S36A 1NIWA 1M39A 3BYAA 4MRXA 5HKZA 1XO5A 3BQ3A 2WOSA 4QJ3B 1TCOB 2KOTA 4DUQA 4XYNA 1S1EA 2F3ZA 3ICBA 2KFHA 1KK8C 4C0LA 1IWQA 4GFTA 3I5HC 3BUOB 2KI4C 4MBEA 4F0ZB 1EL4A 3O4YA 4U8DA 3SG2A 3WHUB 3D0YA 1SRAA 2JNXA 5AERA 1NYAA 3GK1A 1OMDA 1UUSA 4OR9B 1WLZA 5CPVA 4C0KA 4A4BA 1NP8A 1QS7A 1CDMA 1RFJA 1WRLA 1DVIA 1MQ1A 3EVRA 4MZLA 4PHKA 1LXFC 1WRZA 1QXPA 2OTGC 1UHNA 1XFYO 1ZMZA 1G4YR 5KSZA 1EG3A 1PRWA 2HETA 3KHEA 4WRIA 2E6WA 1NCXA 4UPGA 1SR6B 4L9MA 1EG4A 2L2EA 2BKIB 2NCPA 1LKJA 1PVAA 3CWGA 4NQGA 2KHNA 3NXAA 1UHHA 3FWBA 2M9GA 4TNCA 1Y1UA 3I5FC 2NZ0A 2JPTA 2KAVA 1DJGA 2BBNA 3EKJA 1GJYA 2PRUA 3DF0A 4ETOA 1B47A 2K8MB 4MRYA 1B4CA 4HSZA 1FBVA 1PK0D 1WDCC 2OPOA 1RWYA 1ZUZA 1XFWO 4MVFA 2AUCA 5DKNA 1G33A 2MLEC 2Q91A 1N0YA 4JQ0D 2EC6C 2B1UA 1KSOA 4YBHB 5I8NA 1IRJA 1TOPA 1A2XA 3KPXA 1S3PA 2LUCA 3PM8A 1JSAA 3LL8B 1J1EA 1CLBA 4MZJA 1VRKA 1ALWA 3IQOA 1QJTA 1OE9B 2NXQA 1F55A 2JZIA 4PALA 4DCKA 5TNCA 1SL8A 2EHBA 3PLFB 5AFPA 1Y1AA 4AQJA 1IH0A 4GNKB 1SPYA 1KQMC 3LK1A 2JU0A 1BG1A 5HKYA 1K94A 3BOWB 1HQVA 2L5XB 4AOMA 2LE9B 2BL0B 1QVIZ 1CM4A 4M2OA 3FS7A 1WRKA 3I5GC 3CGAA 4MSPA 3M0WA 1JF0A 4NDDA 1KFUL 4PHJA 3VROA 3CR2A 3PALA 1C7VA 3WNXB 1KK7Y 1KWOC 3HCMA 1CDPA 1UHKA 2BKHB 2M29A 4DRWA 1AJ5A 1YUTA 3DD4A 5I2LA 2JWWA 3D10A 5DKRA 1HT9A 1JWDA 1NSHA 3QRXA 1XFZO 2BCXA 4OKHA 5I2QA 2RGIA 2MJWB 4CLNA 2TN4A 2WCBA 2JRFA 1RECA 2LCPA 1U5IB 1BT6A 1LVCD 1SCMC 2H61C 3EKHA 2OS8B 1K90D 1N65A 4M2QA 1J7PA 4MEWA 3TS5C 2AMIA 2CXJA 5AEQA 3SG7A 4PCWA 1K8UA 1ZFSA 1GQMA 1YTZC 1L2OC 1QLKA 1YX7A 4IL1A 1GGWA 2FJUB 3O6BA 1ZOTB 4ICBA 5HKWA 2WCFA 3LK0A 3SG6A 1YVHA 1SMGA 2KGBC 2M3WA 1LA0A 2KQYA 3CLNA 2PVBA 2K7OA 2LLTA 1BU3A 1S26D 2BE4A 1QATA 2ZNDA 5CSIA 1F71A 2E30A 1XVJA 1YR5A 4ORBB 2Q4UA 1A29A 1V1GA 3EK4A 1J7OA 4GGFA 2CNPA 1M63B 1JBAA 2LV7A 4I5NB 3PN7B 3MSEB 4HRGA 2M1UA 1F8HA 1FI5A 1KFXL 2H2KA 2R2IA 2EGDA 5F6TA 1IJ5A 1QIVA 3AAJA 3KF9A 1TTXA 4FTGA 2LVIA 4OV2A 4P5OE 2CCMA 2LHIA 2HQ8A 1QV1A 2LANA 3RLZA 5HLOA 1JFKA 4N1FA 3I5IB 1K93D 2SCPA 3FIAA 2GGZA 2KI4B 1FI6A 1U5IA 3CR4X 5HLVA 1OZSA 3BUXB 2I18A 2KFFA 3CTNA 1MXEA 4PE1A 3SIBA 3IQQA 3OB1B 2ZRTA 2QACA 1E8AA 2MHHA 5K89A 4GBAA 2JXCA 1TNPA 2BE6A 4YGCB 2ISDA 1XK4C 1YRUB 1C7WA 2G2BA 3GK4X 2MAZA 4FQOA 2A4JA 1K95A 5AANA 3VRNA 2COLB 4HRHA 3C1VA 1KK7Z 1NCYA 1UURA 1CFCA 1CNPA 1CFDA 1Q80A 2L4HA 2LUXA 5JJGA 1QLSA 1EXRA 1A4PA 1S6IA 2JT8A 4MZKA 3VGOA 1AJ4A 3VRRA 4XJKB 4D1EA 1ZACA 1W7JB 3NSLA 2P6BB 4I5KA 1X02A 3NSOA 1UHIA 1OMRA 2G9BA 3SIAA 1CM1A 3ZNIA 1YRTB 5PALA 1BOCA 1QX7A 1WDCB 3OB2B 3SG3A 3FWCA 2BCAA 4PE4A 1B1GA 1BODA 1SNLA 1PVBA 1CB1A 1MR8A 1FF1A 1TCFA 2KSPA 2M49B 1K96A 2JQ6A 2ZFDA 1AP4A 2EC6B 1NX0A 2LMUA 3OP0A 5G08A 3BXKA 5JOLA 2JT3A 5GQQC 1RTP1 1DJYA 1OSAA 2Y4QA 1AUIB 2PASA 1JF2A 2K2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQ3 A;  5CSJ A;  3JVT C;  5CSN A;  1J7R A;  4ZCU A;  3TUY C;  5FYX A;  1KQM B;  1KFU S;  1Y1X A;  1DJZ A;  2BCB A;  2GGM A;  2LP2 A;  2KNE A;  1ODB A;  3SJS A;  5ER5 A;  2BL0 C;  2V53 A;  5D69 A;  1CMG A;  1XFU O;  1V1F A;  2F8P A;  3K21 A;  1CLL A;  2K7C A;  2KYF A;  1XA5 A;  2DOQ A;  2MLF C;  3DVM A;  1IJ6 A;  3H4S E;  1A75 B;  4CID A;  1CFP A;  2QPT A;  1H8B A;  1R6P A;  2LLU A;  4XJK A;  1AVS A;  2WC8 A;  1QTX A;  1DMO A;  1K9K A;  3PFV A;  2Y1N A;  3PAT A;  1J55 A;  4GGN A;  4PE7 A;  1IKU A;  1BF5 A;  1CDL A;  4MLW A;  3IF7 A;  1NPQ A;  1RJV A;  2JTT A;  3O78 A;  4NDC A;  4PHN A;  4QJ5 B;  5AXI A;  1NX1 A;  1OOJ A;  1C07 A;  5D7F A;  1DJW A;  4CPV A;  1MHO A;  1DJX A;  1SK6 D;  2K0J A;  2OS8 C;  3DVJ A;  4OVN F;  3CR5 X;  1CKK A;  2CBL A;  2F2P A;  2I7A A;  1GGZ A;  2CTN A;  2WOR A;  3OX5 A;  1J1D A;  1F4Q A;  1PAL A;  2NCO A;  1DF0 B;  1DT7 B;  4N5X A;  2ZN9 A;  1DTL A;  3LCP C;  3VRP A;  3JTD B;  4MN0 A;  4YGB B;  1CDN A;  3F45 A;  2K61 A;  3E3R A;  4GUK A;  1EJ3 A;  3CZT X;  1B9A A;  1SY9 A;  1BJF A;  1K2H A;  1KFX S;  2PMY A;  1IQ5 A;  1DJH A;  4HRE E;  1D1O A;  1SW8 A;  4BY4 A;  2KDH A;  2LP3 A;  1A75 A;  2JC2 A;  1QVI Y;  4CFR A;  1Y6W A;  1B7T Y;  1NWD A;  1SCV A;  3PN7 C;  1KK8 B;  2JNF A;  2JT0 A;  3I5H B;  1ALV A;  2MBX A;  2K7D A;  3GOF A;  4M2P A;  4OCI A;  2F3Y A;  1S5G Y;  2FOT A;  2AAO A;  1YVL A;  3LLE A;  4Q04 A;  1OMV A;  3NSI A;  1M31 A;  5BPJ A;  5KTY A;  1SYM A;  1SKT A;  3I5I C;  4GPL B;  4QJ4 B;  3DVK A;  2H61 A;  1N2D A;  4DIR A;  2D8N A;  3ZWH A;  2FCE A;  2KFG A;  1L7Z A;  3TDI A;  1SBJ A;  4NDB A;  3OX6 A;  2JXL A;  1R2U A;  2IS9 A;  2HPS A;  2JTZ A;  3GK2 A;  2L0P A;  2OTG B;  2KGR A;  1DGU A;  1IGV A;  2SAS A;  1JUO A;  1IG5 A;  4BY5 A;  2NLN A;  2KI6 C;  4N1G A;  1DF0 A;  1JC2 A;  4P2Y B;  2FCD A;  1NCZ A;  1QV0 A;  2PSR A;  3AKA A;  4ORC B;  5IBW A;  2ZNE A;  1SR6 C;  2I94 A;  3EK8 A;  2K7B A;  3BUW B;  2JUL A;  3I5F B;  4ZCV A;  2LMT A;  4C0J A;  3KEV A;  2L51 A;  5CSF A;  1TNX A;  3VRQ A;  1S6J A;  5DKQ A;  1MWN A;  1TIZ A;  1FW4 A;  1QX2 A;  1RK9 A;  1UWO A;  2LHL A;  3BUN B;  3NSK A;  1EH2 A;  4I5J A;  3TZ1 A;  1YX8 A;  2CT9 A;  2LVK A;  1AHR A;  1BR1 B;  1PSR A;  1QIW A;  2GV5 A;  1XYD A;  1KSM A;  1YUR A;  2LM5 A;  1PSB A;  1MF8 B;  2LLS A;  4USL A;  2KYC A;  1K9U A;  1UHJ A;  4GAO A;  4JWQ A;  1W7I B;  5ER4 X;  2WCE A;  1TRF A;  1B8L A;  1NX3 A;  1SL9 A;  2ZRS A;  2I2R E;  1BLQ A;  2K2A A;  4PDZ A;  3TDU A;  1CMF A;  2LVV A;  1WY9 A;  2L4I A;  3EVV A;  1RRO A;  1F70 A;  1QAS A;  2O5G A;  3CS1 A;  4YGD B;  4CFQ A;  5KU1 A;  1FPW A;  1OZO A;  3PSR A;  3WHT B;  3HX4 A;  1TN4 A;  3JVT B;  3DVE A;  3I5G B;  3TUY B;  2HQW A;  4ORA B;  4JPZ B;  3KO0 A;  2Y1M A;  1IQ3 A;  2MRD A;  4AQI A;  1NX2 A;  1K9P A;  2F2O A;  4PHM A;  4GGF C;  1XK4 A;  1KWO B;  4YI8 A;  1JFJ A;  2BBM A;  1TNQ A;  3A4U B;  1J7Q A;  1DJI A;  5B8I B;  2KBI A;  4YI9 A;  1B7T Z;  2Y5I A;  4DS7 A;  2O60 A;  2LNK A;  5J3X A;  4YRU A;  1F54 A;  1TNW A;  3EK7 A;  1KCY A;  1OQP A;  1KQV A;  1G8I A;  1S5G Z;  2L98 A;  2M7N A;  1WLM A;  3BUM B;  1H4B A;  3AAK A;  3EVU A;  1SCM B;  2HF5 A;  1B8R A;  3OHM B;  4YGE B;  3O2P A;  1DGV A;  2WND A;  2VRG A;  3TS5 B;  1F4O A;  3SG5 A;  1Y0V H;  3D0Y B;  1BMO A;  1YUU A;  2KAY A;  3TDZ A;  3AKB A;  1CTR A;  1L2O B;  2JOJ A;  4R1E A;  1CFF A;  1S6C A;  4WQ2 A;  4A4C A;  1MXL C;  2BEC A;  2M0R A;  5I2O A;  2F33 A;  1SL7 A;  2KQ6 A;  4PE0 A;  1M45 A;  1QX5 B;  2L50 A;  2KI6 D;  1CLM A;  1A03 A;  2ZKM X;  1NUB A;  2M1K B;  2LVJ A;  4I5L B;  2PAL A;  4YGA A;  3WXA A;  2KBM A;  2LC5 A;  2MA2 A;  1AK8 A;  4E68 A;  1XFX O;  3JTD C;  1B8C A;  1YUS A;  1MUX A;  3RM1 A;  2LAP A;  1M46 A;  2M8U A;  2KAX A;  1LA3 A;  3A8R A;  3BOW A;  2LMV A;  5HYD A;  1UP5 A;  1BR4 B;  1XFV O;  2ZN8 A;  1PUL A;  2M97 A;  3DF0 B;  1LIN A;  2M7L A;  3SG4 A;  1S36 A;  1NIW A;  1M39 A;  3BYA A;  4MRX A;  5HKZ A;  1XO5 A;  3BQ3 A;  2WOS A;  4QJ3 B;  1TCO B;  2KOT A;  4DUQ A;  4XYN A;  1S1E A;  2F3Z A;  3ICB A;  2KFH A;  1KK8 C;  4C0L A;  1IWQ A;  4GFT A;  3I5H C;  3BUO B;  2KI4 C;  4MBE A;  4F0Z B;  1EL4 A;  3O4Y A;  4U8D A;  3SG2 A;  3WHU B;  3D0Y A;  1SRA A;  2JNX A;  5AER A;  1NYA A;  3GK1 A;  1OMD A;  1UUS A;  4OR9 B;  1WLZ A;  5CPV A;  4C0K A;  4A4B A;  1NP8 A;  1QS7 A;  1CDM A;  1RFJ A;  1WRL A;  1DVI A;  1MQ1 A;  3EVR A;  4MZL A;  4PHK A;  1LXF C;  1WRZ A;  1QXP A;  2OTG C;  1UHN A;  1XFY O;  1ZMZ A;  1G4Y R;  5KSZ A;  1EG3 A;  1PRW A;  2HET A;  3KHE A;  4WRI A;  2E6W A;  1NCX A;  4UPG A;  1SR6 B;  4L9M A;  1EG4 A;  2L2E A;  2BKI B;  2NCP A;  1LKJ A;  1PVA A;  3CWG A;  4NQG A;  2KHN A;  3NXA A;  1UHH A;  3FWB A;  2M9G A;  4TNC A;  1Y1U A;  3I5F C;  2NZ0 A;  2JPT A;  2KAV A;  1DJG A;  2BBN A;  3EKJ A;  1GJY A;  2PRU A;  3DF0 A;  4ETO A;  1B47 A;  2K8M B;  4MRY A;  1B4C A;  4HSZ A;  1FBV A;  1PK0 D;  1WDC C;  2OPO A;  1RWY A;  1ZUZ A;  1XFW O;  4MVF A;  2AUC A;  5DKN A;  1G33 A;  2MLE C;  2Q91 A;  1N0Y A;  4JQ0 D;  2EC6 C;  2B1U A;  1KSO A;  4YBH B;  5I8N A;  1IRJ A;  1TOP A;  1A2X A;  3KPX A;  1S3P A;  2LUC A;  3PM8 A;  1JSA A;  3LL8 B;  1J1E A;  1CLB A;  4MZJ A;  1VRK A;  1ALW A;  3IQO A;  1QJT A;  1OE9 B;  2NXQ A;  1F55 A;  2JZI A;  4PAL A;  4DCK A;  5TNC A;  1SL8 A;  2EHB A;  3PLF B;  5AFP A;  1Y1A A;  4AQJ A;  1IH0 A;  4GNK B;  1SPY A;  1KQM C;  3LK1 A;  2JU0 A;  1BG1 A;  5HKY A;  1K94 A;  3BOW B;  1HQV A;  2L5X B;  4AOM A;  2LE9 B;  2BL0 B;  1QVI Z;  1CM4 A;  4M2O A;  3FS7 A;  1WRK A;  3I5G C;  3CGA A;  4MSP A;  3M0W A;  1JF0 A;  4NDD A;  1KFU L;  4PHJ A;  3VRO A;  3CR2 A;  3PAL A;  1C7V A;  3WNX B;  1KK7 Y;  1KWO C;  3HCM A;  1CDP A;  1UHK A;  2BKH B;  2M29 A;  4DRW A;  1AJ5 A;  1YUT A;  3DD4 A;  5I2L A;  2JWW A;  3D10 A;  5DKR A;  1HT9 A;  1JWD A;  1NSH A;  3QRX A;  1XFZ O;  2BCX A;  4OKH A;  5I2Q A;  2RGI A;  2MJW B;  4CLN A;  2TN4 A;  2WCB A;  2JRF A;  1REC A;  2LCP A;  1U5I B;  1BT6 A;  1LVC D;  1SCM C;  2H61 C;  3EKH A;  2OS8 B;  1K90 D;  1N65 A;  4M2Q A;  1J7P A;  4MEW A;  3TS5 C;  2AMI A;  2CXJ A;  5AEQ A;  3SG7 A;  4PCW A;  1K8U A;  1ZFS A;  1GQM A;  1YTZ C;  1L2O C;  1QLK A;  1YX7 A;  4IL1 A;  1GGW A;  2FJU B;  3O6B A;  1ZOT B;  4ICB A;  5HKW A;  2WCF A;  3LK0 A;  3SG6 A;  1YVH A;  1SMG A;  2KGB C;  2M3W A;  1LA0 A;  2KQY A;  3CLN A;  2PVB A;  2K7O A;  2LLT A;  1BU3 A;  1S26 D;  2BE4 A;  1QAT A;  2ZND A;  5CSI A;  1F71 A;  2E30 A;  1XVJ A;  1YR5 A;  4ORB B;  2Q4U A;  1A29 A;  1V1G A;  3EK4 A;  1J7O A;  4GGF A;  2CNP A;  1M63 B;  1JBA A;  2LV7 A;  4I5N B;  3PN7 B;  3MSE B;  4HRG A;  2M1U A;  1F8H A;  1FI5 A;  1KFX L;  2H2K A;  2R2I A;  2EGD A;  5F6T A;  1IJ5 A;  1QIV A;  3AAJ A;  3KF9 A;  1TTX A;  4FTG A;  2LVI A;  4OV2 A;  4P5O E;  2CCM A;  2LHI A;  2HQ8 A;  1QV1 A;  2LAN A;  3RLZ A;  5HLO A;  1JFK A;  4N1F A;  3I5I B;  1K93 D;  2SCP A;  3FIA A;  2GGZ A;  2KI4 B;  1FI6 A;  1U5I A;  3CR4 X;  5HLV A;  1OZS A;  3BUX B;  2I18 A;  2KFF A;  3CTN A;  1MXE A;  4PE1 A;  3SIB A;  3IQQ A;  3OB1 B;  2ZRT A;  2QAC A;  1E8A A;  2MHH A;  5K89 A;  4GBA A;  2JXC A;  1TNP A;  2BE6 A;  4YGC B;  2ISD A;  1XK4 C;  1YRU B;  1C7W A;  2G2B A;  3GK4 X;  2MAZ A;  4FQO A;  2A4J A;  1K95 A;  5AAN A;  3VRN A;  2COL B;  4HRH A;  3C1V A;  1KK7 Z;  1NCY A;  1UUR A;  1CFC A;  1CNP A;  1CFD A;  1Q80 A;  2L4H A;  2LUX A;  5JJG A;  1QLS A;  1EXR A;  1A4P A;  1S6I A;  2JT8 A;  4MZK A;  3VGO A;  1AJ4 A;  3VRR A;  4XJK B;  4D1E A;  1ZAC A;  1W7J B;  3NSL A;  2P6B B;  4I5K A;  1X02 A;  3NSO A;  1UHI A;  1OMR A;  2G9B A;  3SIA A;  1CM1 A;  3ZNI A;  1YRT B;  5PAL A;  1BOC A;  1QX7 A;  1WDC B;  3OB2 B;  3SG3 A;  3FWC A;  2BCA A;  4PE4 A;  1B1G A;  1BOD A;  1SNL A;  1PVB A;  1CB1 A;  1MR8 A;  1FF1 A;  1TCF A;  2KSP A;  2M49 B;  1K96 A;  2JQ6 A;  2ZFD A;  1AP4 A;  2EC6 B;  1NX0 A;  2LMU A;  3OP0 A;  5G08 A;  3BXK A;  5JOL A;  2JT3 A;  5GQQ C;  1RTP 1;  1DJY A;  1OSA A;  2Y4Q A;  1AUI B;  2PAS A;  1JF2 A;  2K2F A; 
#chains in the Genus database with same CATH topology
 3S0E A;  3CYZ A;  4WQ3 A;  5CSJ A;  3JVT C;  5CSN A;  1ORG A;  1J7R A;  4ZCU A;  3TUY C;  5FYX A;  1KQM B;  1KFU S;  1Y1X A;  1DJZ A;  2BCB A;  2GGM A;  2LP2 A;  2H8V A;  2KNE A;  1ODB A;  3SJS A;  5ER5 A;  2BL0 C;  2V53 A;  5D69 A;  1CMG A;  1XFU O;  1V1F A;  2F8P A;  3K21 A;  1CLL A;  2K7C A;  2KYF A;  1XA5 A;  2DOQ A;  2MLF C;  3DVM A;  1IJ6 A;  3H4S E;  1A75 B;  4CID A;  1CFP A;  2QPT A;  1H8B A;  1R6P A;  2LLU A;  4XJK A;  1AVS A;  2WC8 A;  1QTX A;  1DMO A;  1K9K A;  3PFV A;  2Y1N A;  3PAT A;  1J55 A;  4GGN A;  4PE7 A;  1IKU A;  1BF5 A;  2WC6 A;  1CDL A;  3D77 A;  3IF7 A;  4MLW A;  1NPQ A;  2K60 A;  2PQL A;  1RJV A;  5EL2 A;  5FI7 A;  2JTT A;  2WCL A;  3O78 A;  4NDC A;  4PHN A;  2ERB A;  4QJ5 B;  5AXI A;  1NX1 A;  1OOJ A;  3SS4 A;  1C07 A;  5D7F A;  1DJW A;  4FQT A;  3UNW A;  4CPV A;  1MHO A;  1DJX A;  1SK6 D;  2K0J A;  2OS8 C;  3DVJ A;  1XFR A;  4OVN F;  3CR5 X;  1CKK A;  2CBL A;  2F2P A;  2WCH A;  2I7A A;  1GGZ A;  2CTN A;  2WOR A;  3OX5 A;  1J1D A;  1F4Q A;  1PAL A;  2NCO A;  1DF0 B;  1DT7 B;  4N5X A;  2ZN9 A;  1DTL A;  3LCP C;  3VRP A;  3JTD B;  4MN0 A;  4YGB B;  1CDN A;  3F45 A;  2K61 A;  3PJI A;  3E3R A;  4GUK A;  1EJ3 A;  3CZT X;  1B9A A;  2L2C A;  1SY9 A;  1BJF A;  1K2H A;  1KFX S;  2PMY A;  1IQ5 A;  1DJH A;  4HRE E;  5FI6 A;  1SW8 A;  1D1O A;  4BY4 A;  3B87 A;  2KDH A;  2LP3 A;  1A75 A;  2JC2 A;  1QVI Y;  4CFR A;  1Y6W A;  1B7T Y;  1NWD A;  2KLD A;  1SCV A;  3PN7 C;  1KK8 B;  4F7F A;  2JNF A;  2JT0 A;  3I5H B;  1ALV A;  2MBX A;  2K7D A;  3GOF A;  4M2P A;  4OCI A;  2F3Y A;  1S5G Y;  2FOT A;  2AAO A;  1YVL A;  3LLE A;  4Q04 A;  1OMV A;  3NSI A;  1M31 A;  3NGV A;  5BPJ A;  5KTY A;  1SYM A;  1SKT A;  3I5I C;  4GPL B;  4QJ4 B;  3DVK A;  2H61 A;  1N2D A;  4DIR A;  2D8N A;  3ZWH A;  1TWO A;  2FCE A;  1L7Z A;  2KFG A;  3D78 A;  3NHI A;  3TDI A;  3D76 A;  1SBJ A;  4NDB A;  3OX6 A;  2JXL A;  1R2U A;  2IS9 A;  2HPS A;  2JTZ A;  3GK2 A;  3CZ2 A;  2L0P A;  2OTG B;  2KGR A;  1DGU A;  1IGV A;  2SAS A;  1JUO A;  1IG5 A;  4BY5 A;  2P71 A;  2NLN A;  2KI6 C;  4N1G A;  1DF0 A;  1JC2 A;  4P2Y B;  2FCD A;  1NCZ A;  1QV0 A;  2QEH A;  2PSR A;  3AKA A;  4ORC B;  5IBW A;  2ZNE A;  1SR6 C;  2I94 A;  3EK8 A;  2K7B A;  2BAP A;  3BUW B;  2JUL A;  3I5F B;  4INX A;  4ZCV A;  2LMT A;  2WCM A;  4C0J A;  3KEV A;  2L51 A;  5CSF A;  1TNX A;  3VRQ A;  3FE6 A;  1S6J A;  3R1O A;  5FI2 A;  5DKQ A;  1MWN A;  1TIZ A;  1FW4 A;  1QX2 A;  1RK9 A;  1UWO A;  2LHL A;  3BUN B;  3NSK A;  1EH2 A;  1T14 A;  4I5J A;  3TZ1 A;  1YX8 A;  2CT9 A;  2LVK A;  1AHR A;  1BR1 B;  1PSR A;  1QIW A;  2GV5 A;  1XYD A;  1KSM A;  1YUR A;  2LM5 A;  1PSB A;  1MF8 B;  2LLS A;  4IJ7 A;  2KYC A;  4USL A;  1K9U A;  3SS5 A;  1UHJ A;  3S0A A;  3FE8 A;  4GAO A;  4JWQ A;  1W7I B;  5ER4 X;  2WCE A;  1TRF A;  1B8L A;  1NX3 A;  1SL9 A;  3IVT A;  2ZRS A;  2I2R E;  1OW4 A;  1CNP A;  1BLQ A;  2K2A A;  4PDZ A;  3TDU A;  1CMF A;  2LVV A;  1WY9 A;  2L4I A;  3EVV A;  1RRO A;  3PM2 A;  1F70 A;  1QAS A;  2O5G A;  3CS1 A;  4YGD B;  4CFQ A;  5KU1 A;  1FPW A;  1OZO A;  3PSR A;  3WHT B;  3HX4 A;  1TN4 A;  3JVT B;  3DVE A;  3I5G B;  3TUY B;  2HQW A;  4ORA B;  4JPZ B;  3NHT A;  3DXL A;  3KO0 A;  2Y1M A;  1IQ3 A;  2MRD A;  3L4A A;  4AQI A;  1NX2 A;  1K9P A;  2F2O A;  3D74 A;  4GGF C;  1XK4 A;  4PHM A;  1KWO B;  1OOI X;  4YI8 A;  1JFJ A;  2BBM A;  1TNQ A;  3A4U B;  1J7Q A;  1DJI A;  5B8I B;  2KBI A;  4YI9 A;  1B7T Z;  2Y5I A;  4DS7 A;  2O60 A;  1QWV A;  2LNK A;  2L5Y A;  5J3X A;  4YRU A;  1F54 A;  1TNW A;  2KLE A;  3EK7 A;  1KCY A;  3SS3 A;  1OQP A;  1KQV A;  1G8I A;  1S5G Z;  2L98 A;  2M7N A;  1WLM A;  3BUM B;  2QDI A;  1H4B A;  3AAK A;  3EVU A;  1SCM B;  2HF5 A;  1B8R A;  3OHM B;  4YGE B;  3O2P A;  1DGV A;  1TUZ A;  2WND A;  2VRG A;  3TS5 B;  1F4O A;  2FJY A;  3SG5 A;  1Y0V H;  3D0Y B;  1BMO A;  1YUU A;  2KAY A;  3TDZ A;  3AKB A;  1CTR A;  1L2O B;  2JOJ A;  4R1E A;  1CFF A;  1S6C A;  4WQ2 A;  4A4C A;  1MXL C;  2BEC A;  2M0R A;  5I2O A;  2F33 A;  3S0F A;  1SL7 A;  2KQ6 A;  4PE0 A;  1M45 A;  1QX5 B;  2L50 A;  2KI6 D;  1LS8 A;  1CLM A;  1A03 A;  2ZKM X;  1NUB A;  3RZS A;  2M1K B;  2LVJ A;  4I5L B;  2PAL A;  4YGA A;  3S0D A;  2KBM A;  2LC5 A;  2MA2 A;  3WXA A;  1AK8 A;  4E68 A;  1XFX O;  3JTD C;  1B8C A;  1YUS A;  1MUX A;  3RM1 A;  2LAP A;  1DC1 A;  1M46 A;  3FE9 A;  2M8U A;  2KAX A;  1LA3 A;  3A8R A;  3BOW A;  2LMV A;  5HYD A;  1UP5 A;  1BR4 B;  1XFV O;  2ZN8 A;  5DIC A;  1PUL A;  2M97 A;  3DF0 B;  1LIN A;  2M7L A;  3SG4 A;  1S36 A;  1NIW A;  1M39 A;  3BYA A;  4MRX A;  5HKZ A;  1XO5 A;  3BQ3 A;  2WOS A;  4QJ3 B;  3B6X A;  1TCO B;  2KOT A;  4DUQ A;  4XYN A;  3BJH A;  1S1E A;  2F3Z A;  3ICB A;  3B88 A;  2KFH A;  5D3O A;  3N7H A;  1KK8 C;  4C0L A;  1IWQ A;  4GFT A;  3I5H C;  3BUO B;  2KI4 C;  4MBE A;  4F0Z B;  1EL4 A;  3O4Y A;  4U8D A;  3SG2 A;  3WHU B;  2YGU A;  3D0Y A;  1SRA A;  2JNX A;  5AER A;  1NYA A;  3GK1 A;  1OMD A;  1UUS A;  4OR9 B;  1WLZ A;  5CPV A;  2WC5 A;  4C0K A;  4A4B A;  1NP8 A;  1QS7 A;  1CDM A;  1RFJ A;  1WRL A;  1DVI A;  1MQ1 A;  3EVR A;  4MZL A;  4PHK A;  1LXF C;  1WRZ A;  1QXP A;  2OTG C;  1UHN A;  1DEK A;  1XFY O;  1ZMZ A;  1G4Y R;  3CZ0 A;  5KSZ A;  1EG3 A;  1PRW A;  1TUJ A;  2HET A;  3KHE A;  4WRI A;  2E6W A;  1NCX A;  4UPG A;  1SR6 B;  4L9M A;  1EG4 A;  2L2E A;  2BKI B;  2NCP A;  1LKJ A;  1PVA A;  3CWG A;  2WCK A;  4NQG A;  2KHN A;  3NXA A;  1SSE B;  1UHH A;  3FWB A;  2M9G A;  4TNC A;  1IIO A;  1Y1U A;  3I5F C;  1DEL A;  2GTE A;  2NZ0 A;  3O4X A;  2JPT A;  2KAV A;  1DJG A;  2BBN A;  3EKJ A;  1GJY A;  2PRU A;  3DF0 A;  3L47 A;  4ETO A;  1B47 A;  2K8M B;  4MRY A;  1B4C A;  4HSZ A;  1FBV A;  1PK0 D;  1WDC C;  2OPO A;  1RWY A;  1ZUZ A;  1XFW O;  4MVF A;  2JPO A;  2AUC A;  5DKN A;  1G33 A;  2MLE C;  2Q91 A;  1N0Y A;  1C3Y A;  4JQ0 D;  3CDN A;  2EC6 C;  2B1U A;  1KSO A;  4YBH B;  5I8N A;  1IRJ A;  1TOP A;  1A2X A;  3KPX A;  1S3P A;  2LUC A;  3PM8 A;  1JSA A;  3LL8 B;  1J1E A;  1CLB A;  4MZJ A;  1VRK A;  1ALW A;  3IQO A;  1QJT A;  1OE9 B;  2NXQ A;  4KYN A;  1F55 A;  2JZI A;  4PAL A;  4DCK A;  5TNC A;  1SL8 A;  2EHB A;  3PLF B;  5AFP A;  1Y1A A;  4AQJ A;  1IH0 A;  4GNK B;  1SPY A;  1KQM C;  3LK1 A;  4INW A;  2JU0 A;  1BG1 A;  5HKY A;  1K94 A;  3BOW B;  1OOH A;  1HQV A;  2L5X B;  4AOM A;  3OBV A;  2LE9 B;  2BL0 B;  1QVI Z;  1CM4 A;  4M2O A;  3FS7 A;  1WRK A;  3I5G C;  3CGA A;  4MSP A;  3M0W A;  1JF0 A;  4NDD A;  1KFU L;  4PHJ A;  3VB1 A;  3VRO A;  3CR2 A;  3PAL A;  3DZT A;  1C7V A;  2WCJ A;  3WNX B;  1KK7 Y;  1KWO C;  3HCM A;  3S0B A;  3CZ1 A;  1CDP A;  1UHK A;  2BKH B;  2M29 A;  4DRW A;  1AJ5 A;  1YUT A;  3DD4 A;  3L4L A;  5I2L A;  2JWW A;  3BFA A;  3D10 A;  5DKR A;  1HT9 A;  1JWD A;  1NSH A;  3QRX A;  1XFZ O;  2BCX A;  4OKH A;  1P28 A;  5I2Q A;  2RGI A;  2MJW B;  4CLN A;  2TN4 A;  2WCB A;  2JRF A;  1REC A;  2KPH A;  3CAB A;  2LCP A;  1U5I B;  1BT6 A;  1LVC D;  1SCM C;  2H61 C;  3EKH A;  2OS8 B;  3OGN A;  1K90 D;  1N65 A;  4M2Q A;  1J7P A;  4MEW A;  3TS5 C;  3B86 A;  2AMI A;  1GM0 A;  2CXJ A;  5AEQ A;  3SG7 A;  4PCW A;  1K8U A;  1ZFS A;  1GQM A;  1YTZ C;  1L2O C;  1QLK A;  5I94 A;  1YX7 A;  4IL1 A;  1GGW A;  2FJU B;  1DQE A;  3O6B A;  1ZOT B;  2P70 A;  4ICB A;  5HKW A;  2WCF A;  3LK0 A;  3SG6 A;  1YVH A;  1SMG A;  2KGB C;  1OOG A;  2M3W A;  1LA0 A;  2KQY A;  3BFH A;  2PVB A;  3CLN A;  2K7O A;  2LLT A;  1BU3 A;  1S26 D;  2BE4 A;  1QAT A;  2ZND A;  5CSI A;  1F71 A;  2E30 A;  1XVJ A;  1YR5 A;  4OZD A;  4ORB B;  2Q4U A;  1A29 A;  1V1G A;  3EK4 A;  1J7O A;  4GGF A;  3QME A;  2CNP A;  4JKT A;  1M63 B;  1JBA A;  1OOF A;  2LV7 A;  4I5N B;  3PN7 B;  3MSE B;  4HRG A;  2M1U A;  3R72 A;  1F8H A;  1FI5 A;  1KFX L;  2H2K A;  2R2I A;  2EGD A;  5F6T A;  1IJ5 A;  1QIV A;  3AAJ A;  3KF9 A;  1TTX A;  4FTG A;  2LVI A;  4OV2 A;  1W9Z A;  4P5O E;  2CCM A;  2LHI A;  2HQ8 A;  1QV1 A;  2LAN A;  3RLZ A;  5HLO A;  1JFK A;  4N1F A;  3I5I B;  1K93 D;  2SCP A;  3FIA A;  3V2L A;  2GGZ A;  2KI4 B;  1FI6 A;  1U5I A;  3CR4 X;  5HLV A;  1OZS A;  2QEO A;  3BUX B;  5HL1 A;  2I18 A;  2KFF A;  3CTN A;  1MXE A;  3DY9 A;  4PE1 A;  3IQQ A;  3SIB A;  3OB1 B;  2ZRT A;  2QAC A;  1E8A A;  3S0G A;  2MHH A;  5K89 A;  4GBA A;  2JXC A;  1TNP A;  2BE6 A;  3Q8I A;  3R1V A;  4YGC B;  3UO9 A;  2ISD A;  1XK4 C;  1YRU B;  1C7W A;  2G2B A;  3GK4 X;  2MAZ A;  4FQO A;  2A4J A;  3EG5 B;  1K95 A;  5AAN A;  3VRN A;  2COL B;  4HRH A;  3C1V A;  1KK7 Z;  1NCY A;  1UUR A;  2PYQ A;  1CFC A;  1CFD A;  4PT1 A;  1Q80 A;  2L4H A;  2LUX A;  5JJG A;  1QLS A;  1EXR A;  3BFB A;  1A4P A;  1S6I A;  2JT8 A;  4MZK A;  3VGO A;  1AJ4 A;  3B7A A;  2QEB A;  3VRR A;  4XJK B;  4D1E A;  3DYE A;  3D73 A;  3D75 A;  1ZAC A;  1W7J B;  3NSL A;  2P6B B;  4I5K A;  1X02 A;  3NSO A;  4JD9 A;  1UHI A;  1OMR A;  2G9B A;  3SIA A;  3K1E A;  1Z4H A;  1CM1 A;  3ZNI A;  2QEV A;  1YRT B;  5PAL A;  1BOC A;  1QX7 A;  1WDC B;  3OB2 B;  3R1P A;  3FWC A;  2BCA A;  4PE4 A;  3SG3 A;  1B1G A;  1SNL A;  1BOD A;  1PVB A;  1CB1 A;  1MR8 A;  1FF1 A;  2BNX A;  1C3Z A;  1TCF A;  2KSP A;  2M49 B;  1K96 A;  2JQ6 A;  2ZFD A;  1AP4 A;  2EC6 B;  1NX0 A;  2LMU A;  3OP0 A;  5G08 A;  3BXK A;  1Z2C B;  5JOL A;  2JT3 A;  5GQQ C;  1RTP 1;  1DJY A;  1OSA A;  2Y4Q A;  1AUI B;  2PAS A;  1JF2 A;  2K2F A; 
#chains in the Genus database with same CATH homology
 4WQ3 A;  5CSJ A;  3JVT C;  5CSN A;  1J7R A;  4ZCU A;  3TUY C;  5FYX A;  1KQM B;  1KFU S;  1Y1X A;  1DJZ A;  2BCB A;  2GGM A;  2LP2 A;  2KNE A;  1ODB A;  3SJS A;  5ER5 A;  2BL0 C;  2V53 A;  5D69 A;  1CMG A;  1XFU O;  1V1F A;  2F8P A;  3K21 A;  1CLL A;  2K7C A;  2KYF A;  1XA5 A;  2DOQ A;  2MLF C;  3DVM A;  1IJ6 A;  3H4S E;  1A75 B;  4CID A;  1CFP A;  2QPT A;  1H8B A;  1R6P A;  2LLU A;  4XJK A;  1AVS A;  2WC8 A;  1QTX A;  1DMO A;  1K9K A;  3PFV A;  2Y1N A;  3PAT A;  1J55 A;  4GGN A;  4PE7 A;  1IKU A;  1BF5 A;  1CDL A;  4MLW A;  3IF7 A;  1NPQ A;  1RJV A;  2JTT A;  3O78 A;  4NDC A;  4PHN A;  4QJ5 B;  5AXI A;  1NX1 A;  1OOJ A;  1C07 A;  5D7F A;  1DJW A;  4CPV A;  1MHO A;  1DJX A;  1SK6 D;  2K0J A;  2OS8 C;  3DVJ A;  4OVN F;  3CR5 X;  1CKK A;  2CBL A;  2F2P A;  2I7A A;  1GGZ A;  2CTN A;  2WOR A;  3OX5 A;  1J1D A;  1F4Q A;  1PAL A;  2NCO A;  1DF0 B;  1DT7 B;  4N5X A;  2ZN9 A;  1DTL A;  3LCP C;  3VRP A;  3JTD B;  4MN0 A;  4YGB B;  1CDN A;  3F45 A;  2K61 A;  3E3R A;  4GUK A;  1EJ3 A;  3CZT X;  1B9A A;  1SY9 A;  1BJF A;  1K2H A;  1KFX S;  2PMY A;  1IQ5 A;  1DJH A;  4HRE E;  1D1O A;  1SW8 A;  4BY4 A;  2KDH A;  2LP3 A;  1A75 A;  2JC2 A;  1QVI Y;  4CFR A;  1Y6W A;  1B7T Y;  1NWD A;  1SCV A;  3PN7 C;  1KK8 B;  2JNF A;  2JT0 A;  3I5H B;  1ALV A;  2MBX A;  2K7D A;  3GOF A;  4M2P A;  4OCI A;  2F3Y A;  1S5G Y;  2FOT A;  2AAO A;  1YVL A;  3LLE A;  4Q04 A;  1OMV A;  3NSI A;  1M31 A;  5BPJ A;  5KTY A;  1SYM A;  1SKT A;  3I5I C;  4GPL B;  4QJ4 B;  3DVK A;  2H61 A;  1N2D A;  4DIR A;  2D8N A;  3ZWH A;  2FCE A;  2KFG A;  1L7Z A;  3TDI A;  1SBJ A;  4NDB A;  3OX6 A;  2JXL A;  1R2U A;  2IS9 A;  2HPS A;  2JTZ A;  3GK2 A;  2L0P A;  2OTG B;  2KGR A;  1DGU A;  1IGV A;  2SAS A;  1JUO A;  1IG5 A;  4BY5 A;  2NLN A;  2KI6 C;  4N1G A;  1DF0 A;  1JC2 A;  4P2Y B;  2FCD A;  1NCZ A;  1QV0 A;  2PSR A;  3AKA A;  4ORC B;  5IBW A;  2ZNE A;  1SR6 C;  2I94 A;  3EK8 A;  2K7B A;  3BUW B;  2JUL A;  3I5F B;  4ZCV A;  2LMT A;  4C0J A;  3KEV A;  2L51 A;  5CSF A;  1TNX A;  3VRQ A;  1S6J A;  5DKQ A;  1MWN A;  1TIZ A;  1FW4 A;  1QX2 A;  1RK9 A;  1UWO A;  2LHL A;  3BUN B;  3NSK A;  1EH2 A;  4I5J A;  3TZ1 A;  1YX8 A;  2CT9 A;  2LVK A;  1AHR A;  1BR1 B;  1PSR A;  1QIW A;  2GV5 A;  1XYD A;  1KSM A;  1YUR A;  2LM5 A;  1PSB A;  1MF8 B;  2LLS A;  4USL A;  2KYC A;  1K9U A;  1UHJ A;  4GAO A;  4JWQ A;  1W7I B;  5ER4 X;  2WCE A;  1TRF A;  1B8L A;  1NX3 A;  1SL9 A;  2ZRS A;  2I2R E;  1BLQ A;  2K2A A;  4PDZ A;  3TDU A;  1CMF A;  2LVV A;  1WY9 A;  2L4I A;  3EVV A;  1RRO A;  1F70 A;  1QAS A;  2O5G A;  3CS1 A;  4YGD B;  4CFQ A;  5KU1 A;  1FPW A;  1OZO A;  3PSR A;  3WHT B;  3HX4 A;  1TN4 A;  3JVT B;  3DVE A;  3I5G B;  3TUY B;  2HQW A;  4ORA B;  4JPZ B;  3KO0 A;  2Y1M A;  1IQ3 A;  2MRD A;  4AQI A;  1NX2 A;  1K9P A;  2F2O A;  4PHM A;  4GGF C;  1XK4 A;  1KWO B;  4YI8 A;  1JFJ A;  2BBM A;  1TNQ A;  3A4U B;  1J7Q A;  1DJI A;  5B8I B;  2KBI A;  4YI9 A;  1B7T Z;  2Y5I A;  4DS7 A;  2O60 A;  2LNK A;  5J3X A;  4YRU A;  1F54 A;  1TNW A;  3EK7 A;  1KCY A;  1OQP A;  1KQV A;  1G8I A;  1S5G Z;  2L98 A;  2M7N A;  1WLM A;  3BUM B;  1H4B A;  3AAK A;  3EVU A;  1SCM B;  2HF5 A;  1B8R A;  3OHM B;  4YGE B;  3O2P A;  1DGV A;  2WND A;  2VRG A;  3TS5 B;  1F4O A;  3SG5 A;  1Y0V H;  3D0Y B;  1BMO A;  1YUU A;  2KAY A;  3TDZ A;  3AKB A;  1CTR A;  1L2O B;  2JOJ A;  4R1E A;  1CFF A;  1S6C A;  4WQ2 A;  4A4C A;  1MXL C;  2BEC A;  2M0R A;  5I2O A;  2F33 A;  1SL7 A;  2KQ6 A;  4PE0 A;  1M45 A;  1QX5 B;  2L50 A;  2KI6 D;  1CLM A;  1A03 A;  2ZKM X;  1NUB A;  2M1K B;  2LVJ A;  4I5L B;  2PAL A;  4YGA A;  3WXA A;  2KBM A;  2LC5 A;  2MA2 A;  1AK8 A;  4E68 A;  1XFX O;  3JTD C;  1B8C A;  1YUS A;  1MUX A;  3RM1 A;  2LAP A;  1M46 A;  2M8U A;  2KAX A;  1LA3 A;  3A8R A;  3BOW A;  2LMV A;  5HYD A;  1UP5 A;  1BR4 B;  1XFV O;  2ZN8 A;  1PUL A;  2M97 A;  3DF0 B;  1LIN A;  2M7L A;  3SG4 A;  1S36 A;  1NIW A;  1M39 A;  3BYA A;  4MRX A;  5HKZ A;  1XO5 A;  3BQ3 A;  2WOS A;  4QJ3 B;  1TCO B;  2KOT A;  4DUQ A;  4XYN A;  1S1E A;  2F3Z A;  3ICB A;  2KFH A;  1KK8 C;  4C0L A;  1IWQ A;  4GFT A;  3I5H C;  3BUO B;  2KI4 C;  4MBE A;  4F0Z B;  1EL4 A;  3O4Y A;  4U8D A;  3SG2 A;  3WHU B;  3D0Y A;  1SRA A;  2JNX A;  5AER A;  1NYA A;  3GK1 A;  1OMD A;  1UUS A;  4OR9 B;  1WLZ A;  5CPV A;  4C0K A;  4A4B A;  1NP8 A;  1QS7 A;  1CDM A;  1RFJ A;  1WRL A;  1DVI A;  1MQ1 A;  3EVR A;  4MZL A;  4PHK A;  1LXF C;  1WRZ A;  1QXP A;  2OTG C;  1UHN A;  1XFY O;  1ZMZ A;  1G4Y R;  5KSZ A;  1EG3 A;  1PRW A;  2HET A;  3KHE A;  4WRI A;  2E6W A;  1NCX A;  4UPG A;  1SR6 B;  4L9M A;  1EG4 A;  2L2E A;  2BKI B;  2NCP A;  1LKJ A;  1PVA A;  3CWG A;  4NQG A;  2KHN A;  3NXA A;  1UHH A;  3FWB A;  2M9G A;  4TNC A;  1Y1U A;  3I5F C;  2NZ0 A;  2JPT A;  2KAV A;  1DJG A;  2BBN A;  3EKJ A;  1GJY A;  2PRU A;  3DF0 A;  4ETO A;  1B47 A;  2K8M B;  4MRY A;  1B4C A;  4HSZ A;  1FBV A;  1PK0 D;  1WDC C;  2OPO A;  1RWY A;  1ZUZ A;  1XFW O;  4MVF A;  2AUC A;  5DKN A;  1G33 A;  2MLE C;  2Q91 A;  1N0Y A;  4JQ0 D;  2EC6 C;  2B1U A;  1KSO A;  4YBH B;  5I8N A;  1IRJ A;  1TOP A;  1A2X A;  3KPX A;  1S3P A;  2LUC A;  3PM8 A;  1JSA A;  3LL8 B;  1J1E A;  1CLB A;  4MZJ A;  1VRK A;  1ALW A;  3IQO A;  1QJT A;  1OE9 B;  2NXQ A;  1F55 A;  2JZI A;  4PAL A;  4DCK A;  5TNC A;  1SL8 A;  2EHB A;  3PLF B;  5AFP A;  1Y1A A;  4AQJ A;  1IH0 A;  4GNK B;  1SPY A;  1KQM C;  3LK1 A;  2JU0 A;  1BG1 A;  5HKY A;  1K94 A;  3BOW B;  1HQV A;  2L5X B;  4AOM A;  2LE9 B;  2BL0 B;  1QVI Z;  1CM4 A;  4M2O A;  3FS7 A;  1WRK A;  3I5G C;  3CGA A;  4MSP A;  3M0W A;  1JF0 A;  4NDD A;  1KFU L;  4PHJ A;  3VRO A;  3CR2 A;  3PAL A;  1C7V A;  3WNX B;  1KK7 Y;  1KWO C;  3HCM A;  1CDP A;  1UHK A;  2BKH B;  2M29 A;  4DRW A;  1AJ5 A;  1YUT A;  3DD4 A;  5I2L A;  2JWW A;  3D10 A;  5DKR A;  1HT9 A;  1JWD A;  1NSH A;  3QRX A;  1XFZ O;  2BCX A;  4OKH A;  5I2Q A;  2RGI A;  2MJW B;  4CLN A;  2TN4 A;  2WCB A;  2JRF A;  1REC A;  2LCP A;  1U5I B;  1BT6 A;  1LVC D;  1SCM C;  2H61 C;  3EKH A;  2OS8 B;  1K90 D;  1N65 A;  4M2Q A;  1J7P A;  4MEW A;  3TS5 C;  2AMI A;  2CXJ A;  5AEQ A;  3SG7 A;  4PCW A;  1K8U A;  1ZFS A;  1GQM A;  1YTZ C;  1L2O C;  1QLK A;  1YX7 A;  4IL1 A;  1GGW A;  2FJU B;  3O6B A;  1ZOT B;  4ICB A;  5HKW A;  2WCF A;  3LK0 A;  3SG6 A;  1YVH A;  1SMG A;  2KGB C;  2M3W A;  1LA0 A;  2KQY A;  3CLN A;  2PVB A;  2K7O A;  2LLT A;  1BU3 A;  1S26 D;  2BE4 A;  1QAT A;  2ZND A;  5CSI A;  1F71 A;  2E30 A;  1XVJ A;  1YR5 A;  4ORB B;  2Q4U A;  1A29 A;  1V1G A;  3EK4 A;  1J7O A;  4GGF A;  2CNP A;  1M63 B;  1JBA A;  2LV7 A;  4I5N B;  3PN7 B;  3MSE B;  4HRG A;  2M1U A;  1F8H A;  1FI5 A;  1KFX L;  2H2K A;  2R2I A;  2EGD A;  5F6T A;  1IJ5 A;  1QIV A;  3AAJ A;  3KF9 A;  1TTX A;  4FTG A;  2LVI A;  4OV2 A;  4P5O E;  2CCM A;  2LHI A;  2HQ8 A;  1QV1 A;  2LAN A;  3RLZ A;  5HLO A;  1JFK A;  4N1F A;  3I5I B;  1K93 D;  2SCP A;  3FIA A;  2GGZ A;  2KI4 B;  1FI6 A;  1U5I A;  3CR4 X;  5HLV A;  1OZS A;  3BUX B;  2I18 A;  2KFF A;  3CTN A;  1MXE A;  4PE1 A;  3SIB A;  3IQQ A;  3OB1 B;  2ZRT A;  2QAC A;  1E8A A;  2MHH A;  5K89 A;  4GBA A;  2JXC A;  1TNP A;  2BE6 A;  4YGC B;  2ISD A;  1XK4 C;  1YRU B;  1C7W A;  2G2B A;  3GK4 X;  2MAZ A;  4FQO A;  2A4J A;  1K95 A;  5AAN A;  3VRN A;  2COL B;  4HRH A;  3C1V A;  1KK7 Z;  1NCY A;  1UUR A;  1CFC A;  1CNP A;  1CFD A;  1Q80 A;  2L4H A;  2LUX A;  5JJG A;  1QLS A;  1EXR A;  1A4P A;  1S6I A;  2JT8 A;  4MZK A;  3VGO A;  1AJ4 A;  3VRR A;  4XJK B;  4D1E A;  1ZAC A;  1W7J B;  3NSL A;  2P6B B;  4I5K A;  1X02 A;  3NSO A;  1UHI A;  1OMR A;  2G9B A;  3SIA A;  1CM1 A;  3ZNI A;  1YRT B;  5PAL A;  1BOC A;  1QX7 A;  1WDC B;  3OB2 B;  3SG3 A;  3FWC A;  2BCA A;  4PE4 A;  1B1G A;  1BOD A;  1SNL A;  1PVB A;  1CB1 A;  1MR8 A;  1FF1 A;  1TCF A;  2KSP A;  2M49 B;  1K96 A;  2JQ6 A;  2ZFD A;  1AP4 A;  2EC6 B;  1NX0 A;  2LMU A;  3OP0 A;  5G08 A;  3BXK A;  5JOL A;  2JT3 A;  5GQQ C;  1RTP 1;  1DJY A;  1OSA A;  2Y4Q A;  1AUI B;  2PAS A;  1JF2 A;  2K2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...