3IQQA

X-ray structure of bovine trtk12-ca(2+)-s100b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-B
publication title The Effects of CapZ Peptide (TRTK-12) Binding to S100B-Ca(2+) as Examined by NMR and X-ray Crystallography
pubmed doi rcsb
source organism Bos taurus
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3iqqA00
3NSKA 1QV1A 2F8PA 5AANA 1F4OA 2KAVA 1SCMC 2NCPA 4JWQA 3SG3A 2JXCA 2Y1MA 3DVKA 3VRQA 2IS9A 2WNDA 2GGZA 4HREE 2AMIA 1NCYA 2CBLA 1RJVA 2NCOA 2JTZA 1AP4A 4MBEA 1XK4A 2KI4B 2JU0A 4C0JA 1XK4C 1MXEA 1K8UA 1YURA 2MLEC 2MLFC 3CLNA 4YRUA 4AQJA 2JPTA 1GGZA 1QVIY 1QLKA 2AUCA 1KCYA 4YBHB 2LP2A 4PE4A 3EKJA 3OX5A 4PE0A 1DJYA 3KEVA 3NXAA 4PE7A 1UHKA 1C7WA 5F6TA 5TNCA 3HX4A 3WHTB 3OB2B 3CR5X 1WDCC 3NSOA 2LVVA 2BECA 4MSPA 2ZFDA 1NUBA 1SY9A 1J7QA 2Y4QA 1CLMA 1Y1UA 1QATA 1UURA 4A4BA 4DIRA 2TN4A 2BCBA 1QXPA 3D0YB 2KI6C 1AJ5A 2D8NA 4GGFA 4OR9B 4GGFC 1SKTA 1TCOB 2FOTA 1KSMA 4JPZB 1XA5A 2LVKA 2KI4C 2M3WA 2K61A 2RGIA 1QX2A 1M46A 1UP5A 2AAOA 2LMVA 3ZWHA 4HRHA 2LAPA 3FS7A 1CKKA 3IQQA 1ZUZA 2O60A 1VRKA 3SJSA 4MRXA 5DKNA 1EL4A 1TNPA 1SR6B 3BXKA 1NSHA 2I2RE 3BQ3A 3DVJA 4MVFA 1B7TZ 3SG7A 1CB1A 1B8RA 1CFDA 2KSPA 1ZACA 1DJZA 1QJTA 2GGMA 5I2QA 1F54A 2LANA 1SPYA 5PALA 2OTGB 2CNPA 3M0WA 4OV2A 3O78A 1S3PA 2KAXA 1TNXA 3EK7A 1PVAA 1B8CA 1KK7Z 2BE6A 2F2OA 3CTNA 1A03A 1MR8A 1KFUL 3EK4A 5HKWA 2MBXA 2ZN8A 3ZNIA 3VGOA 3PSRA 3HCMA 2LUXA 3SIBA 3D0YA 4DCKA 1N2DA 5AFPA 2LVIA 2CXJA 1SYMA 1L2OB 2VRGA 1LA0A 1YX7A 4PHNA 4N1FA 3SG4A 2K8MB 1WLMA 3BOWA 1M63B 3TDUA 5K89A 1FBVA 1J7PA 1JFJA 2K7CA 1K9UA 3DF0B 1EG3A 1RFJA 2LE9B 1ZMZA 1B4CA 1K95A 1G8IA 4ZCUA 1JF2A 3EK8A 1CFCA 3TDIA 1DVIA 1NIWA 5D7FA 1U5IB 1UUSA 3OX6A 4NDCA 1ALWA 4AQIA 1C7VA 1SR6C 1GGWA 3CWGA 4YGEB 1CFPA 1EJ3A 4JQ0D 3BUOB 1DJXA 2Y1NA 2MJWB 3ICBA 4DRWA 2M0RA 4N5XA 2JNXA 2M1KB 2OTGC 2SASA 2KYFA 4GBAA 2Y5IA 1S36A 5B8IB 2PRUA 1S1EA 2ZRTA 1S5GZ 2R2IA 1XFYO 3KO0A 1NWDA 2I18A 1UHJA 1NX2A 1Y1AA 1TN4A 3BUMB 1FPWA 4ETOA 3VRPA 1NCZA 1L2OC 3JVTB 1F71A 2NXQA 3PLFB 1BG1A 1CNPA 5BPJA 2JT0A 1PULA 2EHBA 5J3XA 2KFHA 4XJKB 2LVJA 1BLQA 2CCMA 1YVHA 4GFTA 1U5IA 2GV5A 3PM8A 3VRRA 1ZOTB 2BBNA 2G9BA 2QPTA 1BT6A 2LC5A 3I5FB 3CS1A 1XFVO 4UPGA 2FCDA 3AKBA 3TUYB 1JUOA 1M45A 1NX3A 1KQMB 1IJ6A 2MA2A 1YUUA 1EG4A 1BODA 5AEQA 1KWOB 2OS8B 1XO5A 2PASA 4GUKA 3AAKA 1BF5A 4YGAA 3GK4X 1SW8A 3DD4A 1JSAA 1OQPA 4MZKA 1KQVA 2KI6D 1TNWA 2LNKA 2F3YA 4BY4A 1B7TY 1L7ZA 2BE4A 3JVTC 1MQ1A 2JZIA 3GK1A 1X02A 4DS7A 1LXFC 1DJHA 1OE9B 1AVSA 2LHIA 2V53A 2BCXA 4XJKA 4NDDA 1QIWA 4ORAB 1HQVA 1J1EA 1JFKA 1V1GA 1BMOA 2F2PA 2WCEA 3FWCA 1A29A 1KK7Y 1G33A 5HLOA 1OMVA 1ALVA 3SIAA 1YR5A 3QRXA 1JWDA 2CT9A 2KHNA 3I5FC 4YI9A 3I5GB 3FIAA 1QASA 4AOMA 1QTXA 4ORCB 1PALA 3TUYC 1MWNA 2M1UA 1KQMC 3BUXB 3IF7A 1CDNA 1DMOA 2JC2A 1SCVA 2M49B 1KWOC 5JOLA 1UHHA 2OS8C 2WC8A 1B47A 2WOSA 3BOWB 4I5KA 5JJGA 2NLNA 2L51A 3A4UB 1TIZA 3A8RA 2F3ZA 1B8LA 1IGVA 3WNXB 1AUIB 1D1OA 2M8UA 1NP8A 1MF8B 1XFUO 1XYDA 3PATA 4MEWA 5I2LA 3TZ1A 1E8AA 2BBMA 2LLTA 2PSRA 2K7OA 3NSLA 2I94A 1ZFSA 4PCWA 1V1FA 1DF0B 2L2EA 1KFXL 4PHKA 1K94A 1F70A 3CZTX 1C07A 1WRKA 1NX1A 4CLNA 2H61A 2JQ6A 3EKHA 1LKJA 2E6WA 3I5IB 1S5GY 3I5HB 4PHJA 2ZKMX 3RM1A 5I2OA 4CFQA 1BJFA 2Q4UA 1SK6D 4P2YB 1F55A 2ZN9A 2K2AA 3I5GC 1PSBA 2KGRA 2M29A 2WORA 3E3RA 3BUWB 1CM4A 1SBJA 2EC6B 3WHUB 3VRNA 2B1UA 2ZRSA 3NSIA 1CTRA 1K93D 1R6PA 1KK8B 2A4JA 4HSZA 1RROA 4I5JA 4M2OA 5ER4X 1WRLA 1RECA 1XVJA 2KFGA 4I5NB 4WQ3A 1S6IA 5DKRA 1DJIA 4NDBA 1DF0A 3GOFA 2MHHA 4GPLB 1CM1A 2KBIA 2BL0B 4GGNA 2KAYA 1B1GA 1HT9A 1Q80A 3DVMA 3FWBA 3I5IC 1KSOA 1CFFA 1K2HA 1XFZO 3I5HC 5DKQA 1LA3A 2F33A 4C0KA 1FW4A 4C0LA 3CR4X 4U8DA 1BR4B 1OMRA 4L9MA 3LK1A 2L4HA 2LUCA 4FTGA 1TTXA 4IL1A 1PSRA 1OZOA 1QS7A 2FJUB 4OCIA 5KSZA 2LV7A 2MRDA 2KDHA 2EC6C 1SL8A 1CDLA 1JF0A 2KGBC 1WRZA 2JWWA 1AJ4A 5KU1A 1Y6WA 1KK8C 3KPXA 1AK8A 1IRJA 1RTP1 2KQ6A 2NZ0A 2KBMA 1N0YA 2I7AA 2LMTA 1YTZC 1CDMA 5IBWA 4F0ZB 2COLB 4WRIA 1G4YR 4HRGA 2KNEA 4CFRA 2BL0C 1UHIA 3LCPC 4ZCVA 1EXRA 1A2XA 4P5OE 1K9KA 2PALA 1QV0A 2LHLA 3AKAA 2KOTA 2ZNDA 3EVUA 4GNKB 1IH0A 4BY5A 2LM5A 3D10A 4TNCA 4XYNA 1YX8A 1DTLA 2M9GA 1RK9A 1Y0VH 2LLSA 4YGCB 2LLUA 1A75B 3BUNB 1KFXS 1YRTB 2KQYA 1SL7A 3DVEA 1DGVA 1J1DA 3VROA 1SRAA 2BKIB 3SG5A 3PN7B 4FQOA 1LVCD 2M97A 5CSFA 2SCPA 3LLEA 1YRUB 2HPSA 2LCPA 4CPVA 1MUXA 3CGAA 2PMYA 5HLVA 2LP3A 5AXIA 1KFUS 4ICBA 2ISDA 3O6BA 1XFXO 2G2BA 5GQQC 4WQ2A 1XFWO 1YVLA 2WCBA 3OHMB 3KHEA 1GQMA 1TNQA 1SNLA 1NCXA 1MHOA 1GJYA 4PDZA 1BOCA 1W7JB 4E68A 1OOJA 1QIVA 2MAZA 1TCFA 2JRFA 1ODBA 1FI6A 1NX0A 4A4CA 4ORBB 5CPVA 2Q91A 1R2UA 1A75A 3K21A 1LINA 1YUTA 1EH2A 2HF5A 1YUSA 1DJGA 2JT3A 3SG2A 1PK0D 2CTNA 3LL8B 1BR1B 2FCEA 1CMGA 1S26D 3O4YA 3PN7C 1IKUA 2H61C 1S6JA 2WCFA 1J7RA 2O5GA 3O2PA 3TDZA 1DT7B 3IQOA 4YI8A 5CSIA 1B9AA 4I5LB 4R1EA 2HQWA 3LK0A 4QJ3B 1UWOA 4M2QA 5G08A 1IJ5A 1W7IB 1MXLC 1QVIZ 2KFFA 1AHRA 1S6CA 3KF9A 2L4IA 1WY9A 1FI5A 1BU3A 1OMDA 3CR2A 3TS5B 5HKZA 2M7NA 3PALA 1TRFA 4PHMA 1M39A 1QX5B 4NQGA 1A4PA 3JTDB 2K7BA 2L98A 4MRYA 4PE1A 2JOJA 5HKYA 4GAOA 4QJ5B 1F4QA 3RLZA 2L50A 1H8BA 4USLA 1N65A 1JBAA 2LMUA 2L5XB 1K96A 3MSEB 4DUQA 3PFVA 4D1EA 1NPQA 2BCAA 1IWQA 1TOPA 1H4BA 2OPOA 2K0JA 2H2KA 1CDPA 2QACA 2HETA 5D69A 1F8HA 1WLZA 4OVNF 1RWYA 2L0PA 1CMFA 1PRWA 3OP0A 1JC2A 3EVVA 2JXLA 2K7DA 3BYAA 2JT8A 2JULA 3C1VA 5HYDA 4QJ4B 1IQ5A 1OSAA 4YGBB 2E30A 2EGDA 2PVBA 2M7LA 4OKHA 3EVRA 2K2FA 1SCMB 1OZSA 2HQ8A 3GK2A 1DGUA 2JNFA 2ZNEA 3TS5C 4PALA 5I8NA 5ER5A 4MZJA 1SL9A 4M2PA 1M31A 2P6BB 5FYXA 1IQ3A 4Q04A 1K9PA 3JTDC 2JTTA 1CLBA 1PVBA 1IG5A 3H4SE 4MN0A 1DJWA 3WXAA 5CSNA 4MLWA 4MZLA 2BKHB 1CLLA 1QX7A 1Y1XA 3AAJA 3SG6A 1J7OA 3F45A 2KYCA 5AERA 4CIDA 1QLSA 4N1GA 5CSJA 4YGDB 3DF0A 1FF1A 3OB1B 1K90D 1SMGA 5KTYA 1NYAA 1J55A 1WDCB 1UHNA 2DOQA
chains in the Genus database with same CATH superfamily
3NSKA 3EG5B 1QV1A 2F8PA 5AANA 1F4OA 2KAVA 1SCMC 2NCPA 4JWQA 3SG3A 2JXCA 2Y1MA 3DVKA 3VRQA 2IS9A 2QEVA 2ERBA 1C3ZA 2WNDA 2GGZA 4HREE 2AMIA 1NCYA 1T14A 2CBLA 1RJVA 2NCOA 2JTZA 1AP4A 3PM2A 4MBEA 1XK4A 2KI4B 2JU0A 4C0JA 1XK4C 1MXEA 1K8UA 1YURA 2MLEC 2MLFC 3CLNA 4YRUA 4AQJA 2JPTA 1GGZA 1QVIY 1QLKA 2AUCA 1KCYA 4YBHB 2LP2A 4PE4A 3EKJA 3OX5A 4PE0A 1DJYA 3KEVA 3NXAA 4PE7A 1UHKA 3PJIA 1C7WA 5F6TA 5TNCA 3HX4A 1GM0A 3WHTB 3OB2B 3CR5X 1WDCC 3NSOA 2LVVA 2BECA 4MSPA 2ZFDA 1NUBA 1SY9A 5FI7A 1J7QA 2Y4QA 1CLMA 1OW4A 1Y1UA 1QATA 1UURA 4A4BA 4DIRA 2TN4A 2BCBA 1QXPA 3CZ2A 2KI6C 1AJ5A 2D8NA 3D0YB 3D78A 4GGFA 4GGFC 1SKTA 1TCOB 2FOTA 3BFAA 2PYQA 4OR9B 1KSMA 4JPZB 1XA5A 4IJ7A 2LVKA 2KI4C 2M3WA 2K61A 2RGIA 1QX2A 1M46A 3NHTA 3CZ1A 1UP5A 2AAOA 2GTEA 2LMVA 5FI6A 3ZWHA 4HRHA 2LAPA 3FS7A 3R1VA 1CKKA 3S0DA 3IQQA 1ZUZA 2O60A 1VRKA 3SJSA 4MRXA 5DKNA 1EL4A 1TNPA 1SR6B 3BXKA 1NSHA 2I2RE 2QDIA 3BQ3A 3DVJA 4MVFA 1B7TZ 3SG7A 1CB1A 1B8RA 1CFDA 2KSPA 1ZACA 1DJZA 1QJTA 2GGMA 5I2QA 1F54A 2LANA 1SPYA 5PALA 2OTGB 2CNPA 3M0WA 4OV2A 3O78A 3QMEA 1S3PA 2KAXA 3B7AA 3N7HA 1TNXA 1DC1A 3EK7A 1PVAA 1B8CA 1KK7Z 2BE6A 2F2OA 3CTNA 1A03A 1MR8A 1KFUL 3EK4A 5HKWA 2MBXA 2ZN8A 3ZNIA 3VGOA 3PSRA 3HCMA 2LUXA 3SIBA 3D0YA 4DCKA 1N2DA 5AFPA 2LVIA 3B86A 2CXJA 3CZ0A 1SYMA 1L2OB 2VRGA 1YX7A 1LA0A 4PHNA 4N1FA 3SG4A 2K8MB 1WLMA 3BOWA 1M63B 3TDUA 5K89A 1FBVA 1J7PA 1JFJA 2K7CA 1K9UA 1Z4HA 1EG3A 3DF0B 1RFJA 2LE9B 1ZMZA 1B4CA 1K95A 1G8IA 4ZCUA 1JF2A 3EK8A 1W9ZA 3TDIA 1DVIA 1CFCA 1NIWA 3BJHA 1U5IB 5D7FA 3B87A 1UUSA 3OX6A 4NDCA 1ALWA 4AQIA 5EL2A 1C7VA 1SR6C 1GGWA 1OOHA 3CWGA 4YGEB 1CFPA 1EJ3A 4JQ0D 3BUOB 5DICA 1DJXA 2Y1NA 2MJWB 3ICBA 4DRWA 2M0RA 4N5XA 3SS3A 2JNXA 3K1EA 2M1KB 2OTGC 2SASA 2KYFA 4GBAA 2Y5IA 1S36A 5B8IB 2PRUA 1S1EA 2ZRTA 1S5GZ 2R2IA 1XFYO 3NHIA 2QEHA 3KO0A 1NWDA 2I18A 1UHJA 1NX2A 1Y1AA 1TN4A 3BUMB 3SS4A 2PQLA 1FPWA 4ETOA 3S0AA 3VRPA 1NCZA 1L2OC 3JVTB 1F71A 2NXQA 3PLFB 1BG1A 1CNPA 5BPJA 2JT0A 1PULA 2EHBA 5J3XA 2KFHA 4XJKB 2LVJA 5HL1A 1BLQA 2CCMA 4F7FA 1YVHA 4GFTA 1U5IA 2GV5A 3PM8A 3VRRA 1ZOTB 2BBNA 2G9BA 2QPTA 1BT6A 2LC5A 3I5FB 3V2LA 3CS1A 1XFVO 4UPGA 2FCDA 3AKBA 3TUYB 1JUOA 1M45A 2WC6A 1NX3A 1KQMB 1IJ6A 2MA2A 3DY9A 1YUUA 1EG4A 1BODA 4KYNA 5AEQA 1KWOB 2OS8B 1XO5A 2PASA 4GUKA 3S0GA 3AAKA 1BF5A 4YGAA 3GK4X 1SW8A 3DD4A 1JSAA 2YGUA 1OQPA 4MZKA 1KQVA 2KI6D 1TNWA 2LNKA 2F3YA 2QEOA 4BY4A 1B7TY 1L7ZA 3S0BA 2BE4A 3JVTC 1MQ1A 2JZIA 3GK1A 1X02A 3DYEA 4DS7A 1LXFC 1DJHA 1OE9B 1AVSA 2LHIA 2V53A 2BCXA 4XJKA 4NDDA 1QIWA 4ORAB 4JKTA 1HQVA 1J1EA 1JFKA 1V1GA 1BMOA 2F2PA 3OBVA 2WCEA 3FWCA 1A29A 3D76A 1KK7Y 2FJYA 1G33A 5HLOA 1OMVA 1ALVA 3SIAA 1YR5A 3QRXA 1JWDA 2CT9A 2KHNA 3I5FC 4YI9A 3I5GB 1TWOA 3FIAA 1QASA 4AOMA 1QTXA 4ORCB 1PALA 3TUYC 1MWNA 2M1UA 1KQMC 3BUXB 3IF7A 1CDNA 1DMOA 2JC2A 3RZSA 1SCVA 2M49B 1KWOC 5JOLA 1UHHA 4OZDA 2OS8C 2WC8A 1B47A 2WOSA 3BOWB 4I5KA 5JJGA 2KPHA 1TUZA 2NLNA 2L51A 3A4UB 1TIZA 3A8RA 2F3ZA 1B8LA 1IGVA 3WNXB 1AUIB 1D1OA 2M8UA 1NP8A 1MF8B 1XFUO 1XYDA 3PATA 4MEWA 5I2LA 3TZ1A 1E8AA 2BBMA 2LLTA 3IVTA 2PSRA 2L5YA 2K7OA 3NSLA 2I94A 1ZFSA 4PCWA 1V1FA 1DF0B 2L2EA 1KFXL 4PHKA 1K94A 1F70A 3CZTX 1C07A 1WRKA 1NX1A 2WCJA 4CLNA 2WCMA 2H61A 2JQ6A 2BNXA 2WCKA 1LKJA 2E6WA 3EKHA 3I5IB 1S5GY 3I5HB 4PHJA 2ZKMX 3RM1A 5I2OA 4CFQA 1BJFA 2Q4UA 1SK6D 4P2YB 1F55A 2ZN9A 2K2AA 3I5GC 3O4XA 4INWA 1P28A 1PSBA 2KGRA 2M29A 2WORA 3D75A 3E3RA 3BUWB 3FE6A 1CM4A 1SBJA 2EC6B 3WHUB 3VRNA 2B1UA 2ZRSA 3NSIA 1CTRA 2P70A 1K93D 1R6PA 1KK8B 2A4JA 4HSZA 1RROA 4I5JA 4M2OA 5ER4X 2BAPA 1WRLA 1RECA 3S0EA 1XVJA 2KFGA 4I5NB 4WQ3A 1S6IA 5DKRA 1DJIA 3R1OA 4NDBA 1DF0A 3GOFA 3L4LA 2MHHA 4GPLB 1CM1A 2KBIA 2BL0B 3B6XA 4GGNA 2KAYA 1B1GA 1HT9A 1Q80A 3DVMA 3FWBA 3I5IC 1KSOA 1CFFA 1K2HA 1XFZO 3I5HC 5DKQA 1LA3A 2F33A 3BFBA 3SS5A 1DQEA 4C0KA 1FW4A 4C0LA 3CR4X 4U8DA 3R1PA 1BR4B 1OMRA 4L9MA 1Z2CB 3LK1A 3B88A 2L4HA 2LUCA 4FTGA 1TTXA 4IL1A 1PSRA 1OZOA 1QS7A 2FJUB 4OCIA 5KSZA 2LV7A 2MRDA 2KDHA 3Q8IA 2EC6C 1OOFA 1TUJA 1SL8A 1CDLA 1JF0A 2KGBC 3DXLA 1WRZA 2JWWA 1AJ4A 3FE9A 5KU1A 1Y6WA 1KK8C 3KPXA 1AK8A 2H8VA 1IRJA 1RTP1 2KQ6A 2NZ0A 2KBMA 1N0YA 2I7AA 2LMTA 1YTZC 1CDMA 5IBWA 2WCHA 4F0ZB 2COLB 4WRIA 1G4YR 4HRGA 2KNEA 4INXA 4CFRA 2BL0C 1UHIA 2K60A 3NGVA 3LCPC 4ZCVA 1EXRA 1A2XA 4P5OE 1K9KA 2PALA 1QV0A 2LHLA 3AKAA 2KOTA 2ZNDA 3EVUA 4GNKB 1IH0A 4BY5A 2LM5A 3D10A 4TNCA 4XYNA 1YX8A 1DTLA 2M9GA 1RK9A 1Y0VH 4JD9A 2LLSA 2JPOA 3UO9A 4YGCB 2LLUA 1A75B 3BUNB 1KFXS 3D74A 1YRTB 2KQYA 1SL7A 3DVEA 1DGVA 1OOIX 1J1DA 3R72A 3VROA 1SRAA 2BKIB 3SG5A 3PN7B 4FQOA 1LVCD 2M97A 5CSFA 2SCPA 3LLEA 1YRUB 3CABA 2HPSA 2LCPA 4CPVA 1MUXA 3CGAA 2PMYA 5HLVA 2LP3A 5AXIA 1OOGA 1KFUS 2WC5A 4ICBA 2ISDA 1DELA 3O6BA 1XFXO 2G2BA 5GQQC 4WQ2A 3CDNA 1XFWO 1YVLA 2WCBA 3OHMB 3KHEA 1GQMA 1TNQA 3BFHA 1SNLA 1NCXA 1MHOA 3L4AA 1GJYA 4PDZA 1BOCA 1W7JB 2KLEA 4E68A 4PT1A 1OOJA 1DEKA 1QIVA 2MAZA 1TCFA 2JRFA 1ODBA 1FI6A 1NX0A 3FE8A 4A4CA 4ORBB 3S0FA 5CPVA 2Q91A 2QEBA 1R2UA 5FI2A 1A75A 3K21A 1LINA 1YUTA 1EH2A 2HF5A 1YUSA 1DJGA 2JT3A 3SG2A 1PK0D 2CTNA 3LL8B 1BR1B 2FCEA 1CMGA 3UNWA 1S26D 3O4YA 3PN7C 1IKUA 2H61C 1QWVA 1S6JA 2WCFA 1J7RA 2O5GA 3O2PA 3TDZA 1DT7B 3IQOA 4YI8A 1XFRA 5CSIA 1B9AA 3L47A 1SSEB 4I5LB 4R1EA 2HQWA 3LK0A 4QJ3B 1UWOA 4M2QA 5G08A 1IJ5A 1W7IB 1MXLC 1QVIZ 2KFFA 2P71A 1C3YA 1AHRA 1S6CA 3KF9A 2L4IA 1WY9A 3VB1A 1BU3A 1OMDA 3CR2A 3TS5B 1FI5A 5HKZA 2M7NA 2L2CA 3PALA 1TRFA 4PHMA 1M39A 1QX5B 3CYZA 4NQGA 1A4PA 3JTDB 2K7BA 2L98A 3D77A 4MRYA 2JOJA 4PE1A 5HKYA 4GAOA 4QJ5B 1F4QA 3RLZA 2L50A 1H8BA 4USLA 1ORGA 1N65A 1JBAA 2LMUA 2L5XB 1K96A 3MSEB 4DUQA 3PFVA 4D1EA 1NPQA 2BCAA 4FQTA 1IWQA 1TOPA 1H4BA 2OPOA 2K0JA 2H2KA 1CDPA 2QACA 2HETA 5D69A 1F8HA 1WLZA 4OVNF 1RWYA 2L0PA 1CMFA 1PRWA 3OP0A 1JC2A 3EVVA 2JXLA 2K7DA 3BYAA 2JT8A 2JULA 3C1VA 5HYDA 4QJ4B 1IQ5A 1OSAA 2WCLA 4YGBB 2E30A 2EGDA 2PVBA 2M7LA 5I94A 4OKHA 3EVRA 5D3OA 2K2FA 1SCMB 1OZSA 2HQ8A 3GK2A 1DGUA 2JNFA 2ZNEA 3DZTA 3TS5C 4PALA 5I8NA 5ER5A 4MZJA 1SL9A 3OGNA 4M2PA 1M31A 2P6BB 5FYXA 1IQ3A 2KLDA 4Q04A 1K9PA 3JTDC 2JTTA 1CLBA 1PVBA 1IG5A 1LS8A 3H4SE 4MN0A 1DJWA 3WXAA 1IIOA 5CSNA 4MLWA 4MZLA 2BKHB 1CLLA 1Y1XA 1QX7A 3AAJA 3SG6A 1J7OA 3F45A 2KYCA 5AERA 4CIDA 1QLSA 4N1GA 5CSJA 4YGDB 3DF0A 1FF1A 3OB1B 1K90D 1SMGA 5KTYA 1NYAA 1J55A 1WDCB 3D73A 1UHNA 2DOQA
chains in the Genus database with same CATH topology
3NSKA 1QV1A 2F8PA 5AANA 1F4OA 2KAVA 1SCMC 2NCPA 4JWQA 3SG3A 2JXCA 2Y1MA 3DVKA 3VRQA 2IS9A 2WNDA 2GGZA 4HREE 2AMIA 1NCYA 2CBLA 1RJVA 2NCOA 2JTZA 1AP4A 4MBEA 1XK4A 2KI4B 2JU0A 4C0JA 1XK4C 1MXEA 1K8UA 1YURA 2MLEC 2MLFC 3CLNA 4YRUA 4AQJA 2JPTA 1GGZA 1QVIY 1QLKA 2AUCA 1KCYA 4YBHB 2LP2A 4PE4A 3EKJA 3OX5A 4PE0A 1DJYA 3KEVA 3NXAA 4PE7A 1UHKA 1C7WA 5F6TA 5TNCA 3HX4A 3WHTB 3OB2B 3CR5X 1WDCC 3NSOA 2LVVA 2BECA 4MSPA 2ZFDA 1NUBA 1SY9A 1J7QA 2Y4QA 1CLMA 1Y1UA 1QATA 1UURA 4A4BA 4DIRA 2TN4A 2BCBA 1QXPA 3D0YB 2KI6C 1AJ5A 2D8NA 4GGFA 4OR9B 4GGFC 1SKTA 1TCOB 2FOTA 1KSMA 4JPZB 1XA5A 2LVKA 2KI4C 2M3WA 2K61A 2RGIA 1QX2A 1M46A 1UP5A 2AAOA 2LMVA 3ZWHA 4HRHA 2LAPA 3FS7A 1CKKA 3IQQA 1ZUZA 2O60A 1VRKA 3SJSA 4MRXA 5DKNA 1EL4A 1TNPA 1SR6B 3BXKA 1NSHA 2I2RE 3BQ3A 3DVJA 4MVFA 1B7TZ 3SG7A 1CB1A 1B8RA 1CFDA 2KSPA 1ZACA 1DJZA 1QJTA 2GGMA 5I2QA 1F54A 2LANA 1SPYA 5PALA 2OTGB 2CNPA 3M0WA 4OV2A 3O78A 1S3PA 2KAXA 1TNXA 3EK7A 1PVAA 1B8CA 1KK7Z 2BE6A 2F2OA 3CTNA 1A03A 1MR8A 1KFUL 3EK4A 5HKWA 2MBXA 2ZN8A 3ZNIA 3VGOA 3PSRA 3HCMA 2LUXA 3SIBA 3D0YA 4DCKA 1N2DA 5AFPA 2LVIA 2CXJA 1SYMA 1L2OB 2VRGA 1LA0A 1YX7A 4PHNA 4N1FA 3SG4A 2K8MB 1WLMA 3BOWA 1M63B 3TDUA 5K89A 1FBVA 1J7PA 1JFJA 2K7CA 1K9UA 3DF0B 1EG3A 1RFJA 2LE9B 1ZMZA 1B4CA 1K95A 1G8IA 4ZCUA 1JF2A 3EK8A 1CFCA 3TDIA 1DVIA 1NIWA 5D7FA 1U5IB 1UUSA 3OX6A 4NDCA 1ALWA 4AQIA 1C7VA 1SR6C 1GGWA 3CWGA 4YGEB 1CFPA 1EJ3A 4JQ0D 3BUOB 1DJXA 2Y1NA 2MJWB 3ICBA 4DRWA 2M0RA 4N5XA 2JNXA 2M1KB 2OTGC 2SASA 2KYFA 4GBAA 2Y5IA 1S36A 5B8IB 2PRUA 1S1EA 2ZRTA 1S5GZ 2R2IA 1XFYO 3KO0A 1NWDA 2I18A 1UHJA 1NX2A 1Y1AA 1TN4A 3BUMB 1FPWA 4ETOA 3VRPA 1NCZA 1L2OC 3JVTB 1F71A 2NXQA 3PLFB 1BG1A 1CNPA 5BPJA 2JT0A 1PULA 2EHBA 5J3XA 2KFHA 4XJKB 2LVJA 1BLQA 2CCMA 1YVHA 4GFTA 1U5IA 2GV5A 3PM8A 3VRRA 1ZOTB 2BBNA 2G9BA 2QPTA 1BT6A 2LC5A 3I5FB 3CS1A 1XFVO 4UPGA 2FCDA 3AKBA 3TUYB 1JUOA 1M45A 1NX3A 1KQMB 1IJ6A 2MA2A 1YUUA 1EG4A 1BODA 5AEQA 1KWOB 2OS8B 1XO5A 2PASA 4GUKA 3AAKA 1BF5A 4YGAA 3GK4X 1SW8A 3DD4A 1JSAA 1OQPA 4MZKA 1KQVA 2KI6D 1TNWA 2LNKA 2F3YA 4BY4A 1B7TY 1L7ZA 2BE4A 3JVTC 1MQ1A 2JZIA 3GK1A 1X02A 4DS7A 1LXFC 1DJHA 1OE9B 1AVSA 2LHIA 2V53A 2BCXA 4XJKA 4NDDA 1QIWA 4ORAB 1HQVA 1J1EA 1JFKA 1V1GA 1BMOA 2F2PA 2WCEA 3FWCA 1A29A 1KK7Y 1G33A 5HLOA 1OMVA 1ALVA 3SIAA 1YR5A 3QRXA 1JWDA 2CT9A 2KHNA 3I5FC 4YI9A 3I5GB 3FIAA 1QASA 4AOMA 1QTXA 4ORCB 1PALA 3TUYC 1MWNA 2M1UA 1KQMC 3BUXB 3IF7A 1CDNA 1DMOA 2JC2A 1SCVA 2M49B 1KWOC 5JOLA 1UHHA 2OS8C 2WC8A 1B47A 2WOSA 3BOWB 4I5KA 5JJGA 2NLNA 2L51A 3A4UB 1TIZA 3A8RA 2F3ZA 1B8LA 1IGVA 3WNXB 1AUIB 1D1OA 2M8UA 1NP8A 1MF8B 1XFUO 1XYDA 3PATA 4MEWA 5I2LA 3TZ1A 1E8AA 2BBMA 2LLTA 2PSRA 2K7OA 3NSLA 2I94A 1ZFSA 4PCWA 1V1FA 1DF0B 2L2EA 1KFXL 4PHKA 1K94A 1F70A 3CZTX 1C07A 1WRKA 1NX1A 4CLNA 2H61A 2JQ6A 3EKHA 1LKJA 2E6WA 3I5IB 1S5GY 3I5HB 4PHJA 2ZKMX 3RM1A 5I2OA 4CFQA 1BJFA 2Q4UA 1SK6D 4P2YB 1F55A 2ZN9A 2K2AA 3I5GC 1PSBA 2KGRA 2M29A 2WORA 3E3RA 3BUWB 1CM4A 1SBJA 2EC6B 3WHUB 3VRNA 2B1UA 2ZRSA 3NSIA 1CTRA 1K93D 1R6PA 1KK8B 2A4JA 4HSZA 1RROA 4I5JA 4M2OA 5ER4X 1WRLA 1RECA 1XVJA 2KFGA 4I5NB 4WQ3A 1S6IA 5DKRA 1DJIA 4NDBA 1DF0A 3GOFA 2MHHA 4GPLB 1CM1A 2KBIA 2BL0B 4GGNA 2KAYA 1B1GA 1HT9A 1Q80A 3DVMA 3FWBA 3I5IC 1KSOA 1CFFA 1K2HA 1XFZO 3I5HC 5DKQA 1LA3A 2F33A 4C0KA 1FW4A 4C0LA 3CR4X 4U8DA 1BR4B 1OMRA 4L9MA 3LK1A 2L4HA 2LUCA 4FTGA 1TTXA 4IL1A 1PSRA 1OZOA 1QS7A 2FJUB 4OCIA 5KSZA 2LV7A 2MRDA 2KDHA 2EC6C 1SL8A 1CDLA 1JF0A 2KGBC 1WRZA 2JWWA 1AJ4A 5KU1A 1Y6WA 1KK8C 3KPXA 1AK8A 1IRJA 1RTP1 2KQ6A 2NZ0A 2KBMA 1N0YA 2I7AA 2LMTA 1YTZC 1CDMA 5IBWA 4F0ZB 2COLB 4WRIA 1G4YR 4HRGA 2KNEA 4CFRA 2BL0C 1UHIA 3LCPC 4ZCVA 1EXRA 1A2XA 4P5OE 1K9KA 2PALA 1QV0A 2LHLA 3AKAA 2KOTA 2ZNDA 3EVUA 4GNKB 1IH0A 4BY5A 2LM5A 3D10A 4TNCA 4XYNA 1YX8A 1DTLA 2M9GA 1RK9A 1Y0VH 2LLSA 4YGCB 2LLUA 1A75B 3BUNB 1KFXS 1YRTB 2KQYA 1SL7A 3DVEA 1DGVA 1J1DA 3VROA 1SRAA 2BKIB 3SG5A 3PN7B 4FQOA 1LVCD 2M97A 5CSFA 2SCPA 3LLEA 1YRUB 2HPSA 2LCPA 4CPVA 1MUXA 3CGAA 2PMYA 5HLVA 2LP3A 5AXIA 1KFUS 4ICBA 2ISDA 3O6BA 1XFXO 2G2BA 5GQQC 4WQ2A 1XFWO 1YVLA 2WCBA 3OHMB 3KHEA 1GQMA 1TNQA 1SNLA 1NCXA 1MHOA 1GJYA 4PDZA 1BOCA 1W7JB 4E68A 1OOJA 1QIVA 2MAZA 1TCFA 2JRFA 1ODBA 1FI6A 1NX0A 4A4CA 4ORBB 5CPVA 2Q91A 1R2UA 1A75A 3K21A 1LINA 1YUTA 1EH2A 2HF5A 1YUSA 1DJGA 2JT3A 3SG2A 1PK0D 2CTNA 3LL8B 1BR1B 2FCEA 1CMGA 1S26D 3O4YA 3PN7C 1IKUA 2H61C 1S6JA 2WCFA 1J7RA 2O5GA 3O2PA 3TDZA 1DT7B 3IQOA 4YI8A 5CSIA 1B9AA 4I5LB 4R1EA 2HQWA 3LK0A 4QJ3B 1UWOA 4M2QA 5G08A 1IJ5A 1W7IB 1MXLC 1QVIZ 2KFFA 1AHRA 1S6CA 3KF9A 2L4IA 1WY9A 1FI5A 1BU3A 1OMDA 3CR2A 3TS5B 5HKZA 2M7NA 3PALA 1TRFA 4PHMA 1M39A 1QX5B 4NQGA 1A4PA 3JTDB 2K7BA 2L98A 4MRYA 4PE1A 2JOJA 5HKYA 4GAOA 4QJ5B 1F4QA 3RLZA 2L50A 1H8BA 4USLA 1N65A 1JBAA 2LMUA 2L5XB 1K96A 3MSEB 4DUQA 3PFVA 4D1EA 1NPQA 2BCAA 1IWQA 1TOPA 1H4BA 2OPOA 2K0JA 2H2KA 1CDPA 2QACA 2HETA 5D69A 1F8HA 1WLZA 4OVNF 1RWYA 2L0PA 1CMFA 1PRWA 3OP0A 1JC2A 3EVVA 2JXLA 2K7DA 3BYAA 2JT8A 2JULA 3C1VA 5HYDA 4QJ4B 1IQ5A 1OSAA 4YGBB 2E30A 2EGDA 2PVBA 2M7LA 4OKHA 3EVRA 2K2FA 1SCMB 1OZSA 2HQ8A 3GK2A 1DGUA 2JNFA 2ZNEA 3TS5C 4PALA 5I8NA 5ER5A 4MZJA 1SL9A 4M2PA 1M31A 2P6BB 5FYXA 1IQ3A 4Q04A 1K9PA 3JTDC 2JTTA 1CLBA 1PVBA 1IG5A 3H4SE 4MN0A 1DJWA 3WXAA 5CSNA 4MLWA 4MZLA 2BKHB 1CLLA 1QX7A 1Y1XA 3AAJA 3SG6A 1J7OA 3F45A 2KYCA 5AERA 4CIDA 1QLSA 4N1GA 5CSJA 4YGDB 3DF0A 1FF1A 3OB1B 1K90D 1SMGA 5KTYA 1NYAA 1J55A 1WDCB 1UHNA 2DOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSK A;  1QV1 A;  2F8P A;  5AAN A;  1F4O A;  2KAV A;  1SCM C;  2NCP A;  4JWQ A;  3SG3 A;  2JXC A;  2Y1M A;  3DVK A;  3VRQ A;  2IS9 A;  2WND A;  2GGZ A;  4HRE E;  2AMI A;  1NCY A;  2CBL A;  1RJV A;  2NCO A;  2JTZ A;  1AP4 A;  4MBE A;  1XK4 A;  2KI4 B;  2JU0 A;  4C0J A;  1XK4 C;  1MXE A;  1K8U A;  1YUR A;  2MLE C;  2MLF C;  3CLN A;  4YRU A;  4AQJ A;  2JPT A;  1GGZ A;  1QVI Y;  1QLK A;  2AUC A;  1KCY A;  4YBH B;  2LP2 A;  4PE4 A;  3EKJ A;  3OX5 A;  4PE0 A;  1DJY A;  3KEV A;  3NXA A;  4PE7 A;  1UHK A;  1C7W A;  5F6T A;  5TNC A;  3HX4 A;  3WHT B;  3OB2 B;  3CR5 X;  1WDC C;  3NSO A;  2LVV A;  2BEC A;  4MSP A;  2ZFD A;  1NUB A;  1SY9 A;  1J7Q A;  2Y4Q A;  1CLM A;  1Y1U A;  1QAT A;  1UUR A;  4A4B A;  4DIR A;  2TN4 A;  2BCB A;  1QXP A;  3D0Y B;  2KI6 C;  1AJ5 A;  2D8N A;  4GGF A;  4OR9 B;  4GGF C;  1SKT A;  1TCO B;  2FOT A;  1KSM A;  4JPZ B;  1XA5 A;  2LVK A;  2KI4 C;  2M3W A;  2K61 A;  2RGI A;  1QX2 A;  1M46 A;  1UP5 A;  2AAO A;  2LMV A;  3ZWH A;  4HRH A;  2LAP A;  3FS7 A;  1CKK A;  3IQQ A;  1ZUZ A;  2O60 A;  1VRK A;  3SJS A;  4MRX A;  5DKN A;  1EL4 A;  1TNP A;  1SR6 B;  3BXK A;  1NSH A;  2I2R E;  3BQ3 A;  3DVJ A;  4MVF A;  1B7T Z;  3SG7 A;  1CB1 A;  1B8R A;  1CFD A;  2KSP A;  1ZAC A;  1DJZ A;  1QJT A;  2GGM A;  5I2Q A;  1F54 A;  2LAN A;  1SPY A;  5PAL A;  2OTG B;  2CNP A;  3M0W A;  4OV2 A;  3O78 A;  1S3P A;  2KAX A;  1TNX A;  3EK7 A;  1PVA A;  1B8C A;  1KK7 Z;  2BE6 A;  2F2O A;  3CTN A;  1A03 A;  1MR8 A;  1KFU L;  3EK4 A;  5HKW A;  2MBX A;  2ZN8 A;  3ZNI A;  3VGO A;  3PSR A;  3HCM A;  2LUX A;  3SIB A;  3D0Y A;  4DCK A;  1N2D A;  5AFP A;  2LVI A;  2CXJ A;  1SYM A;  1L2O B;  2VRG A;  1LA0 A;  1YX7 A;  4PHN A;  4N1F A;  3SG4 A;  2K8M B;  1WLM A;  3BOW A;  1M63 B;  3TDU A;  5K89 A;  1FBV A;  1J7P A;  1JFJ A;  2K7C A;  1K9U A;  3DF0 B;  1EG3 A;  1RFJ A;  2LE9 B;  1ZMZ A;  1B4C A;  1K95 A;  1G8I A;  4ZCU A;  1JF2 A;  3EK8 A;  1CFC A;  3TDI A;  1DVI A;  1NIW A;  5D7F A;  1U5I B;  1UUS A;  3OX6 A;  4NDC A;  1ALW A;  4AQI A;  1C7V A;  1SR6 C;  1GGW A;  3CWG A;  4YGE B;  1CFP A;  1EJ3 A;  4JQ0 D;  3BUO B;  1DJX A;  2Y1N A;  2MJW B;  3ICB A;  4DRW A;  2M0R A;  4N5X A;  2JNX A;  2M1K B;  2OTG C;  2SAS A;  2KYF A;  4GBA A;  2Y5I A;  1S36 A;  5B8I B;  2PRU A;  1S1E A;  2ZRT A;  1S5G Z;  2R2I A;  1XFY O;  3KO0 A;  1NWD A;  2I18 A;  1UHJ A;  1NX2 A;  1Y1A A;  1TN4 A;  3BUM B;  1FPW A;  4ETO A;  3VRP A;  1NCZ A;  1L2O C;  3JVT B;  1F71 A;  2NXQ A;  3PLF B;  1BG1 A;  1CNP A;  5BPJ A;  2JT0 A;  1PUL A;  2EHB A;  5J3X A;  2KFH A;  4XJK B;  2LVJ A;  1BLQ A;  2CCM A;  1YVH A;  4GFT A;  1U5I A;  2GV5 A;  3PM8 A;  3VRR A;  1ZOT B;  2BBN A;  2G9B A;  2QPT A;  1BT6 A;  2LC5 A;  3I5F B;  3CS1 A;  1XFV O;  4UPG A;  2FCD A;  3AKB A;  3TUY B;  1JUO A;  1M45 A;  1NX3 A;  1KQM B;  1IJ6 A;  2MA2 A;  1YUU A;  1EG4 A;  1BOD A;  5AEQ A;  1KWO B;  2OS8 B;  1XO5 A;  2PAS A;  4GUK A;  3AAK A;  1BF5 A;  4YGA A;  3GK4 X;  1SW8 A;  3DD4 A;  1JSA A;  1OQP A;  4MZK A;  1KQV A;  2KI6 D;  1TNW A;  2LNK A;  2F3Y A;  4BY4 A;  1B7T Y;  1L7Z A;  2BE4 A;  3JVT C;  1MQ1 A;  2JZI A;  3GK1 A;  1X02 A;  4DS7 A;  1LXF C;  1DJH A;  1OE9 B;  1AVS A;  2LHI A;  2V53 A;  2BCX A;  4XJK A;  4NDD A;  1QIW A;  4ORA B;  1HQV A;  1J1E A;  1JFK A;  1V1G A;  1BMO A;  2F2P A;  2WCE A;  3FWC A;  1A29 A;  1KK7 Y;  1G33 A;  5HLO A;  1OMV A;  1ALV A;  3SIA A;  1YR5 A;  3QRX A;  1JWD A;  2CT9 A;  2KHN A;  3I5F C;  4YI9 A;  3I5G B;  3FIA A;  1QAS A;  4AOM A;  1QTX A;  4ORC B;  1PAL A;  3TUY C;  1MWN A;  2M1U A;  1KQM C;  3BUX B;  3IF7 A;  1CDN A;  1DMO A;  2JC2 A;  1SCV A;  2M49 B;  1KWO C;  5JOL A;  1UHH A;  2OS8 C;  2WC8 A;  1B47 A;  2WOS A;  3BOW B;  4I5K A;  5JJG A;  2NLN A;  2L51 A;  3A4U B;  1TIZ A;  3A8R A;  2F3Z A;  1B8L A;  1IGV A;  3WNX B;  1AUI B;  1D1O A;  2M8U A;  1NP8 A;  1MF8 B;  1XFU O;  1XYD A;  3PAT A;  4MEW A;  5I2L A;  3TZ1 A;  1E8A A;  2BBM A;  2LLT A;  2PSR A;  2K7O A;  3NSL A;  2I94 A;  1ZFS A;  4PCW A;  1V1F A;  1DF0 B;  2L2E A;  1KFX L;  4PHK A;  1K94 A;  1F70 A;  3CZT X;  1C07 A;  1WRK A;  1NX1 A;  4CLN A;  2H61 A;  2JQ6 A;  3EKH A;  1LKJ A;  2E6W A;  3I5I B;  1S5G Y;  3I5H B;  4PHJ A;  2ZKM X;  3RM1 A;  5I2O A;  4CFQ A;  1BJF A;  2Q4U A;  1SK6 D;  4P2Y B;  1F55 A;  2ZN9 A;  2K2A A;  3I5G C;  1PSB A;  2KGR A;  2M29 A;  2WOR A;  3E3R A;  3BUW B;  1CM4 A;  1SBJ A;  2EC6 B;  3WHU B;  3VRN A;  2B1U A;  2ZRS A;  3NSI A;  1CTR A;  1K93 D;  1R6P A;  1KK8 B;  2A4J A;  4HSZ A;  1RRO A;  4I5J A;  4M2O A;  5ER4 X;  1WRL A;  1REC A;  1XVJ A;  2KFG A;  4I5N B;  4WQ3 A;  1S6I A;  5DKR A;  1DJI A;  4NDB A;  1DF0 A;  3GOF A;  2MHH A;  4GPL B;  1CM1 A;  2KBI A;  2BL0 B;  4GGN A;  2KAY A;  1B1G A;  1HT9 A;  1Q80 A;  3DVM A;  3FWB A;  3I5I C;  1KSO A;  1CFF A;  1K2H A;  1XFZ O;  3I5H C;  5DKQ A;  1LA3 A;  2F33 A;  4C0K A;  1FW4 A;  4C0L A;  3CR4 X;  4U8D A;  1BR4 B;  1OMR A;  4L9M A;  3LK1 A;  2L4H A;  2LUC A;  4FTG A;  1TTX A;  4IL1 A;  1PSR A;  1OZO A;  1QS7 A;  2FJU B;  4OCI A;  5KSZ A;  2LV7 A;  2MRD A;  2KDH A;  2EC6 C;  1SL8 A;  1CDL A;  1JF0 A;  2KGB C;  1WRZ A;  2JWW A;  1AJ4 A;  5KU1 A;  1Y6W A;  1KK8 C;  3KPX A;  1AK8 A;  1IRJ A;  1RTP 1;  2KQ6 A;  2NZ0 A;  2KBM A;  1N0Y A;  2I7A A;  2LMT A;  1YTZ C;  1CDM A;  5IBW A;  4F0Z B;  2COL B;  4WRI A;  1G4Y R;  4HRG A;  2KNE A;  4CFR A;  2BL0 C;  1UHI A;  3LCP C;  4ZCV A;  1EXR A;  1A2X A;  4P5O E;  1K9K A;  2PAL A;  1QV0 A;  2LHL A;  3AKA A;  2KOT A;  2ZND A;  3EVU A;  4GNK B;  1IH0 A;  4BY5 A;  2LM5 A;  3D10 A;  4TNC A;  4XYN A;  1YX8 A;  1DTL A;  2M9G A;  1RK9 A;  1Y0V H;  2LLS A;  4YGC B;  2LLU A;  1A75 B;  3BUN B;  1KFX S;  1YRT B;  2KQY A;  1SL7 A;  3DVE A;  1DGV A;  1J1D A;  3VRO A;  1SRA A;  2BKI B;  3SG5 A;  3PN7 B;  4FQO A;  1LVC D;  2M97 A;  5CSF A;  2SCP A;  3LLE A;  1YRU B;  2HPS A;  2LCP A;  4CPV A;  1MUX A;  3CGA A;  2PMY A;  5HLV A;  2LP3 A;  5AXI A;  1KFU S;  4ICB A;  2ISD A;  3O6B A;  1XFX O;  2G2B A;  5GQQ C;  4WQ2 A;  1XFW O;  1YVL A;  2WCB A;  3OHM B;  3KHE A;  1GQM A;  1TNQ A;  1SNL A;  1NCX A;  1MHO A;  1GJY A;  4PDZ A;  1BOC A;  1W7J B;  4E68 A;  1OOJ A;  1QIV A;  2MAZ A;  1TCF A;  2JRF A;  1ODB A;  1FI6 A;  1NX0 A;  4A4C A;  4ORB B;  5CPV A;  2Q91 A;  1R2U A;  1A75 A;  3K21 A;  1LIN A;  1YUT A;  1EH2 A;  2HF5 A;  1YUS A;  1DJG A;  2JT3 A;  3SG2 A;  1PK0 D;  2CTN A;  3LL8 B;  1BR1 B;  2FCE A;  1CMG A;  1S26 D;  3O4Y A;  3PN7 C;  1IKU A;  2H61 C;  1S6J A;  2WCF A;  1J7R A;  2O5G A;  3O2P A;  3TDZ A;  1DT7 B;  3IQO A;  4YI8 A;  5CSI A;  1B9A A;  4I5L B;  4R1E A;  2HQW A;  3LK0 A;  4QJ3 B;  1UWO A;  4M2Q A;  5G08 A;  1IJ5 A;  1W7I B;  1MXL C;  1QVI Z;  2KFF A;  1AHR A;  1S6C A;  3KF9 A;  2L4I A;  1WY9 A;  1FI5 A;  1BU3 A;  1OMD A;  3CR2 A;  3TS5 B;  5HKZ A;  2M7N A;  3PAL A;  1TRF A;  4PHM A;  1M39 A;  1QX5 B;  4NQG A;  1A4P A;  3JTD B;  2K7B A;  2L98 A;  4MRY A;  4PE1 A;  2JOJ A;  5HKY A;  4GAO A;  4QJ5 B;  1F4Q A;  3RLZ A;  2L50 A;  1H8B A;  4USL A;  1N65 A;  1JBA A;  2LMU A;  2L5X B;  1K96 A;  3MSE B;  4DUQ A;  3PFV A;  4D1E A;  1NPQ A;  2BCA A;  1IWQ A;  1TOP A;  1H4B A;  2OPO A;  2K0J A;  2H2K A;  1CDP A;  2QAC A;  2HET A;  5D69 A;  1F8H A;  1WLZ A;  4OVN F;  1RWY A;  2L0P A;  1CMF A;  1PRW A;  3OP0 A;  1JC2 A;  3EVV A;  2JXL A;  2K7D A;  3BYA A;  2JT8 A;  2JUL A;  3C1V A;  5HYD A;  4QJ4 B;  1IQ5 A;  1OSA A;  4YGB B;  2E30 A;  2EGD A;  2PVB A;  2M7L A;  4OKH A;  3EVR A;  2K2F A;  1SCM B;  1OZS A;  2HQ8 A;  3GK2 A;  1DGU A;  2JNF A;  2ZNE A;  3TS5 C;  4PAL A;  5I8N A;  5ER5 A;  4MZJ A;  1SL9 A;  4M2P A;  1M31 A;  2P6B B;  5FYX A;  1IQ3 A;  4Q04 A;  1K9P A;  3JTD C;  2JTT A;  1CLB A;  1PVB A;  1IG5 A;  3H4S E;  4MN0 A;  1DJW A;  3WXA A;  5CSN A;  4MLW A;  4MZL A;  2BKH B;  1CLL A;  1QX7 A;  1Y1X A;  3AAJ A;  3SG6 A;  1J7O A;  3F45 A;  2KYC A;  5AER A;  4CID A;  1QLS A;  4N1G A;  5CSJ A;  4YGD B;  3DF0 A;  1FF1 A;  3OB1 B;  1K90 D;  1SMG A;  5KTY A;  1NYA A;  1J55 A;  1WDC B;  1UHN A;  2DOQ A; 
#chains in the Genus database with same CATH topology
 3NSK A;  3EG5 B;  1QV1 A;  2F8P A;  5AAN A;  1F4O A;  2KAV A;  1SCM C;  2NCP A;  4JWQ A;  3SG3 A;  2JXC A;  2Y1M A;  3DVK A;  3VRQ A;  2IS9 A;  2QEV A;  2ERB A;  1C3Z A;  2WND A;  2GGZ A;  4HRE E;  2AMI A;  1NCY A;  1T14 A;  2CBL A;  1RJV A;  2NCO A;  2JTZ A;  1AP4 A;  3PM2 A;  4MBE A;  1XK4 A;  2KI4 B;  2JU0 A;  4C0J A;  1XK4 C;  1MXE A;  1K8U A;  1YUR A;  2MLE C;  2MLF C;  3CLN A;  4YRU A;  4AQJ A;  2JPT A;  1GGZ A;  1QVI Y;  1QLK A;  2AUC A;  1KCY A;  4YBH B;  2LP2 A;  4PE4 A;  3EKJ A;  3OX5 A;  4PE0 A;  1DJY A;  3KEV A;  3NXA A;  4PE7 A;  1UHK A;  3PJI A;  1C7W A;  5F6T A;  5TNC A;  3HX4 A;  1GM0 A;  3WHT B;  3OB2 B;  3CR5 X;  1WDC C;  3NSO A;  2LVV A;  2BEC A;  4MSP A;  2ZFD A;  1NUB A;  1SY9 A;  5FI7 A;  1J7Q A;  2Y4Q A;  1CLM A;  1OW4 A;  1Y1U A;  1QAT A;  1UUR A;  4A4B A;  4DIR A;  2TN4 A;  2BCB A;  1QXP A;  3CZ2 A;  2KI6 C;  1AJ5 A;  2D8N A;  3D0Y B;  3D78 A;  4GGF A;  4GGF C;  1SKT A;  1TCO B;  2FOT A;  3BFA A;  2PYQ A;  4OR9 B;  1KSM A;  4JPZ B;  1XA5 A;  4IJ7 A;  2LVK A;  2KI4 C;  2M3W A;  2K61 A;  2RGI A;  1QX2 A;  1M46 A;  3NHT A;  3CZ1 A;  1UP5 A;  2AAO A;  2GTE A;  2LMV A;  5FI6 A;  3ZWH A;  4HRH A;  2LAP A;  3FS7 A;  3R1V A;  1CKK A;  3S0D A;  3IQQ A;  1ZUZ A;  2O60 A;  1VRK A;  3SJS A;  4MRX A;  5DKN A;  1EL4 A;  1TNP A;  1SR6 B;  3BXK A;  1NSH A;  2I2R E;  2QDI A;  3BQ3 A;  3DVJ A;  4MVF A;  1B7T Z;  3SG7 A;  1CB1 A;  1B8R A;  1CFD A;  2KSP A;  1ZAC A;  1DJZ A;  1QJT A;  2GGM A;  5I2Q A;  1F54 A;  2LAN A;  1SPY A;  5PAL A;  2OTG B;  2CNP A;  3M0W A;  4OV2 A;  3O78 A;  3QME A;  1S3P A;  2KAX A;  3B7A A;  3N7H A;  1TNX A;  1DC1 A;  3EK7 A;  1PVA A;  1B8C A;  1KK7 Z;  2BE6 A;  2F2O A;  3CTN A;  1A03 A;  1MR8 A;  1KFU L;  3EK4 A;  5HKW A;  2MBX A;  2ZN8 A;  3ZNI A;  3VGO A;  3PSR A;  3HCM A;  2LUX A;  3SIB A;  3D0Y A;  4DCK A;  1N2D A;  5AFP A;  2LVI A;  3B86 A;  2CXJ A;  3CZ0 A;  1SYM A;  1L2O B;  2VRG A;  1YX7 A;  1LA0 A;  4PHN A;  4N1F A;  3SG4 A;  2K8M B;  1WLM A;  3BOW A;  1M63 B;  3TDU A;  5K89 A;  1FBV A;  1J7P A;  1JFJ A;  2K7C A;  1K9U A;  1Z4H A;  1EG3 A;  3DF0 B;  1RFJ A;  2LE9 B;  1ZMZ A;  1B4C A;  1K95 A;  1G8I A;  4ZCU A;  1JF2 A;  3EK8 A;  1W9Z A;  3TDI A;  1DVI A;  1CFC A;  1NIW A;  3BJH A;  1U5I B;  5D7F A;  3B87 A;  1UUS A;  3OX6 A;  4NDC A;  1ALW A;  4AQI A;  5EL2 A;  1C7V A;  1SR6 C;  1GGW A;  1OOH A;  3CWG A;  4YGE B;  1CFP A;  1EJ3 A;  4JQ0 D;  3BUO B;  5DIC A;  1DJX A;  2Y1N A;  2MJW B;  3ICB A;  4DRW A;  2M0R A;  4N5X A;  3SS3 A;  2JNX A;  3K1E A;  2M1K B;  2OTG C;  2SAS A;  2KYF A;  4GBA A;  2Y5I A;  1S36 A;  5B8I B;  2PRU A;  1S1E A;  2ZRT A;  1S5G Z;  2R2I A;  1XFY O;  3NHI A;  2QEH A;  3KO0 A;  1NWD A;  2I18 A;  1UHJ A;  1NX2 A;  1Y1A A;  1TN4 A;  3BUM B;  3SS4 A;  2PQL A;  1FPW A;  4ETO A;  3S0A A;  3VRP A;  1NCZ A;  1L2O C;  3JVT B;  1F71 A;  2NXQ A;  3PLF B;  1BG1 A;  1CNP A;  5BPJ A;  2JT0 A;  1PUL A;  2EHB A;  5J3X A;  2KFH A;  4XJK B;  2LVJ A;  5HL1 A;  1BLQ A;  2CCM A;  4F7F A;  1YVH A;  4GFT A;  1U5I A;  2GV5 A;  3PM8 A;  3VRR A;  1ZOT B;  2BBN A;  2G9B A;  2QPT A;  1BT6 A;  2LC5 A;  3I5F B;  3V2L A;  3CS1 A;  1XFV O;  4UPG A;  2FCD A;  3AKB A;  3TUY B;  1JUO A;  1M45 A;  2WC6 A;  1NX3 A;  1KQM B;  1IJ6 A;  2MA2 A;  3DY9 A;  1YUU A;  1EG4 A;  1BOD A;  4KYN A;  5AEQ A;  1KWO B;  2OS8 B;  1XO5 A;  2PAS A;  4GUK A;  3S0G A;  3AAK A;  1BF5 A;  4YGA A;  3GK4 X;  1SW8 A;  3DD4 A;  1JSA A;  2YGU A;  1OQP A;  4MZK A;  1KQV A;  2KI6 D;  1TNW A;  2LNK A;  2F3Y A;  2QEO A;  4BY4 A;  1B7T Y;  1L7Z A;  3S0B A;  2BE4 A;  3JVT C;  1MQ1 A;  2JZI A;  3GK1 A;  1X02 A;  3DYE A;  4DS7 A;  1LXF C;  1DJH A;  1OE9 B;  1AVS A;  2LHI A;  2V53 A;  2BCX A;  4XJK A;  4NDD A;  1QIW A;  4ORA B;  4JKT A;  1HQV A;  1J1E A;  1JFK A;  1V1G A;  1BMO A;  2F2P A;  3OBV A;  2WCE A;  3FWC A;  1A29 A;  3D76 A;  1KK7 Y;  2FJY A;  1G33 A;  5HLO A;  1OMV A;  1ALV A;  3SIA A;  1YR5 A;  3QRX A;  1JWD A;  2CT9 A;  2KHN A;  3I5F C;  4YI9 A;  3I5G B;  1TWO A;  3FIA A;  1QAS A;  4AOM A;  1QTX A;  4ORC B;  1PAL A;  3TUY C;  1MWN A;  2M1U A;  1KQM C;  3BUX B;  3IF7 A;  1CDN A;  1DMO A;  2JC2 A;  3RZS A;  1SCV A;  2M49 B;  1KWO C;  5JOL A;  1UHH A;  4OZD A;  2OS8 C;  2WC8 A;  1B47 A;  2WOS A;  3BOW B;  4I5K A;  5JJG A;  2KPH A;  1TUZ A;  2NLN A;  2L51 A;  3A4U B;  1TIZ A;  3A8R A;  2F3Z A;  1B8L A;  1IGV A;  3WNX B;  1AUI B;  1D1O A;  2M8U A;  1NP8 A;  1MF8 B;  1XFU O;  1XYD A;  3PAT A;  4MEW A;  5I2L A;  3TZ1 A;  1E8A A;  2BBM A;  2LLT A;  3IVT A;  2PSR A;  2L5Y A;  2K7O A;  3NSL A;  2I94 A;  1ZFS A;  4PCW A;  1V1F A;  1DF0 B;  2L2E A;  1KFX L;  4PHK A;  1K94 A;  1F70 A;  3CZT X;  1C07 A;  1WRK A;  1NX1 A;  2WCJ A;  4CLN A;  2WCM A;  2H61 A;  2JQ6 A;  2BNX A;  2WCK A;  1LKJ A;  2E6W A;  3EKH A;  3I5I B;  1S5G Y;  3I5H B;  4PHJ A;  2ZKM X;  3RM1 A;  5I2O A;  4CFQ A;  1BJF A;  2Q4U A;  1SK6 D;  4P2Y B;  1F55 A;  2ZN9 A;  2K2A A;  3I5G C;  3O4X A;  4INW A;  1P28 A;  1PSB A;  2KGR A;  2M29 A;  2WOR A;  3D75 A;  3E3R A;  3BUW B;  3FE6 A;  1CM4 A;  1SBJ A;  2EC6 B;  3WHU B;  3VRN A;  2B1U A;  2ZRS A;  3NSI A;  1CTR A;  2P70 A;  1K93 D;  1R6P A;  1KK8 B;  2A4J A;  4HSZ A;  1RRO A;  4I5J A;  4M2O A;  5ER4 X;  2BAP A;  1WRL A;  1REC A;  3S0E A;  1XVJ A;  2KFG A;  4I5N B;  4WQ3 A;  1S6I A;  5DKR A;  1DJI A;  3R1O A;  4NDB A;  1DF0 A;  3GOF A;  3L4L A;  2MHH A;  4GPL B;  1CM1 A;  2KBI A;  2BL0 B;  3B6X A;  4GGN A;  2KAY A;  1B1G A;  1HT9 A;  1Q80 A;  3DVM A;  3FWB A;  3I5I C;  1KSO A;  1CFF A;  1K2H A;  1XFZ O;  3I5H C;  5DKQ A;  1LA3 A;  2F33 A;  3BFB A;  3SS5 A;  1DQE A;  4C0K A;  1FW4 A;  4C0L A;  3CR4 X;  4U8D A;  3R1P A;  1BR4 B;  1OMR A;  4L9M A;  1Z2C B;  3LK1 A;  3B88 A;  2L4H A;  2LUC A;  4FTG A;  1TTX A;  4IL1 A;  1PSR A;  1OZO A;  1QS7 A;  2FJU B;  4OCI A;  5KSZ A;  2LV7 A;  2MRD A;  2KDH A;  3Q8I A;  2EC6 C;  1OOF A;  1TUJ A;  1SL8 A;  1CDL A;  1JF0 A;  2KGB C;  3DXL A;  1WRZ A;  2JWW A;  1AJ4 A;  3FE9 A;  5KU1 A;  1Y6W A;  1KK8 C;  3KPX A;  1AK8 A;  2H8V A;  1IRJ A;  1RTP 1;  2KQ6 A;  2NZ0 A;  2KBM A;  1N0Y A;  2I7A A;  2LMT A;  1YTZ C;  1CDM A;  5IBW A;  2WCH A;  4F0Z B;  2COL B;  4WRI A;  1G4Y R;  4HRG A;  2KNE A;  4INX A;  4CFR A;  2BL0 C;  1UHI A;  2K60 A;  3NGV A;  3LCP C;  4ZCV A;  1EXR A;  1A2X A;  4P5O E;  1K9K A;  2PAL A;  1QV0 A;  2LHL A;  3AKA A;  2KOT A;  2ZND A;  3EVU A;  4GNK B;  1IH0 A;  4BY5 A;  2LM5 A;  3D10 A;  4TNC A;  4XYN A;  1YX8 A;  1DTL A;  2M9G A;  1RK9 A;  1Y0V H;  4JD9 A;  2LLS A;  2JPO A;  3UO9 A;  4YGC B;  2LLU A;  1A75 B;  3BUN B;  1KFX S;  3D74 A;  1YRT B;  2KQY A;  1SL7 A;  3DVE A;  1DGV A;  1OOI X;  1J1D A;  3R72 A;  3VRO A;  1SRA A;  2BKI B;  3SG5 A;  3PN7 B;  4FQO A;  1LVC D;  2M97 A;  5CSF A;  2SCP A;  3LLE A;  1YRU B;  3CAB A;  2HPS A;  2LCP A;  4CPV A;  1MUX A;  3CGA A;  2PMY A;  5HLV A;  2LP3 A;  5AXI A;  1OOG A;  1KFU S;  2WC5 A;  4ICB A;  2ISD A;  1DEL A;  3O6B A;  1XFX O;  2G2B A;  5GQQ C;  4WQ2 A;  3CDN A;  1XFW O;  1YVL A;  2WCB A;  3OHM B;  3KHE A;  1GQM A;  1TNQ A;  3BFH A;  1SNL A;  1NCX A;  1MHO A;  3L4A A;  1GJY A;  4PDZ A;  1BOC A;  1W7J B;  2KLE A;  4E68 A;  4PT1 A;  1OOJ A;  1DEK A;  1QIV A;  2MAZ A;  1TCF A;  2JRF A;  1ODB A;  1FI6 A;  1NX0 A;  3FE8 A;  4A4C A;  4ORB B;  3S0F A;  5CPV A;  2Q91 A;  2QEB A;  1R2U A;  5FI2 A;  1A75 A;  3K21 A;  1LIN A;  1YUT A;  1EH2 A;  2HF5 A;  1YUS A;  1DJG A;  2JT3 A;  3SG2 A;  1PK0 D;  2CTN A;  3LL8 B;  1BR1 B;  2FCE A;  1CMG A;  3UNW A;  1S26 D;  3O4Y A;  3PN7 C;  1IKU A;  2H61 C;  1QWV A;  1S6J A;  2WCF A;  1J7R A;  2O5G A;  3O2P A;  3TDZ A;  1DT7 B;  3IQO A;  4YI8 A;  1XFR A;  5CSI A;  1B9A A;  3L47 A;  1SSE B;  4I5L B;  4R1E A;  2HQW A;  3LK0 A;  4QJ3 B;  1UWO A;  4M2Q A;  5G08 A;  1IJ5 A;  1W7I B;  1MXL C;  1QVI Z;  2KFF A;  2P71 A;  1C3Y A;  1AHR A;  1S6C A;  3KF9 A;  2L4I A;  1WY9 A;  3VB1 A;  1BU3 A;  1OMD A;  3CR2 A;  3TS5 B;  1FI5 A;  5HKZ A;  2M7N A;  2L2C A;  3PAL A;  1TRF A;  4PHM A;  1M39 A;  1QX5 B;  3CYZ A;  4NQG A;  1A4P A;  3JTD B;  2K7B A;  2L98 A;  3D77 A;  4MRY A;  2JOJ A;  4PE1 A;  5HKY A;  4GAO A;  4QJ5 B;  1F4Q A;  3RLZ A;  2L50 A;  1H8B A;  4USL A;  1ORG A;  1N65 A;  1JBA A;  2LMU A;  2L5X B;  1K96 A;  3MSE B;  4DUQ A;  3PFV A;  4D1E A;  1NPQ A;  2BCA A;  4FQT A;  1IWQ A;  1TOP A;  1H4B A;  2OPO A;  2K0J A;  2H2K A;  1CDP A;  2QAC A;  2HET A;  5D69 A;  1F8H A;  1WLZ A;  4OVN F;  1RWY A;  2L0P A;  1CMF A;  1PRW A;  3OP0 A;  1JC2 A;  3EVV A;  2JXL A;  2K7D A;  3BYA A;  2JT8 A;  2JUL A;  3C1V A;  5HYD A;  4QJ4 B;  1IQ5 A;  1OSA A;  2WCL A;  4YGB B;  2E30 A;  2EGD A;  2PVB A;  2M7L A;  5I94 A;  4OKH A;  3EVR A;  5D3O A;  2K2F A;  1SCM B;  1OZS A;  2HQ8 A;  3GK2 A;  1DGU A;  2JNF A;  2ZNE A;  3DZT A;  3TS5 C;  4PAL A;  5I8N A;  5ER5 A;  4MZJ A;  1SL9 A;  3OGN A;  4M2P A;  1M31 A;  2P6B B;  5FYX A;  1IQ3 A;  2KLD A;  4Q04 A;  1K9P A;  3JTD C;  2JTT A;  1CLB A;  1PVB A;  1IG5 A;  1LS8 A;  3H4S E;  4MN0 A;  1DJW A;  3WXA A;  1IIO A;  5CSN A;  4MLW A;  4MZL A;  2BKH B;  1CLL A;  1Y1X A;  1QX7 A;  3AAJ A;  3SG6 A;  1J7O A;  3F45 A;  2KYC A;  5AER A;  4CID A;  1QLS A;  4N1G A;  5CSJ A;  4YGD B;  3DF0 A;  1FF1 A;  3OB1 B;  1K90 D;  1SMG A;  5KTY A;  1NYA A;  1J55 A;  1WDC B;  3D73 A;  1UHN A;  2DOQ A; 
#chains in the Genus database with same CATH homology
 3NSK A;  1QV1 A;  2F8P A;  5AAN A;  1F4O A;  2KAV A;  1SCM C;  2NCP A;  4JWQ A;  3SG3 A;  2JXC A;  2Y1M A;  3DVK A;  3VRQ A;  2IS9 A;  2WND A;  2GGZ A;  4HRE E;  2AMI A;  1NCY A;  2CBL A;  1RJV A;  2NCO A;  2JTZ A;  1AP4 A;  4MBE A;  1XK4 A;  2KI4 B;  2JU0 A;  4C0J A;  1XK4 C;  1MXE A;  1K8U A;  1YUR A;  2MLE C;  2MLF C;  3CLN A;  4YRU A;  4AQJ A;  2JPT A;  1GGZ A;  1QVI Y;  1QLK A;  2AUC A;  1KCY A;  4YBH B;  2LP2 A;  4PE4 A;  3EKJ A;  3OX5 A;  4PE0 A;  1DJY A;  3KEV A;  3NXA A;  4PE7 A;  1UHK A;  1C7W A;  5F6T A;  5TNC A;  3HX4 A;  3WHT B;  3OB2 B;  3CR5 X;  1WDC C;  3NSO A;  2LVV A;  2BEC A;  4MSP A;  2ZFD A;  1NUB A;  1SY9 A;  1J7Q A;  2Y4Q A;  1CLM A;  1Y1U A;  1QAT A;  1UUR A;  4A4B A;  4DIR A;  2TN4 A;  2BCB A;  1QXP A;  3D0Y B;  2KI6 C;  1AJ5 A;  2D8N A;  4GGF A;  4OR9 B;  4GGF C;  1SKT A;  1TCO B;  2FOT A;  1KSM A;  4JPZ B;  1XA5 A;  2LVK A;  2KI4 C;  2M3W A;  2K61 A;  2RGI A;  1QX2 A;  1M46 A;  1UP5 A;  2AAO A;  2LMV A;  3ZWH A;  4HRH A;  2LAP A;  3FS7 A;  1CKK A;  3IQQ A;  1ZUZ A;  2O60 A;  1VRK A;  3SJS A;  4MRX A;  5DKN A;  1EL4 A;  1TNP A;  1SR6 B;  3BXK A;  1NSH A;  2I2R E;  3BQ3 A;  3DVJ A;  4MVF A;  1B7T Z;  3SG7 A;  1CB1 A;  1B8R A;  1CFD A;  2KSP A;  1ZAC A;  1DJZ A;  1QJT A;  2GGM A;  5I2Q A;  1F54 A;  2LAN A;  1SPY A;  5PAL A;  2OTG B;  2CNP A;  3M0W A;  4OV2 A;  3O78 A;  1S3P A;  2KAX A;  1TNX A;  3EK7 A;  1PVA A;  1B8C A;  1KK7 Z;  2BE6 A;  2F2O A;  3CTN A;  1A03 A;  1MR8 A;  1KFU L;  3EK4 A;  5HKW A;  2MBX A;  2ZN8 A;  3ZNI A;  3VGO A;  3PSR A;  3HCM A;  2LUX A;  3SIB A;  3D0Y A;  4DCK A;  1N2D A;  5AFP A;  2LVI A;  2CXJ A;  1SYM A;  1L2O B;  2VRG A;  1LA0 A;  1YX7 A;  4PHN A;  4N1F A;  3SG4 A;  2K8M B;  1WLM A;  3BOW A;  1M63 B;  3TDU A;  5K89 A;  1FBV A;  1J7P A;  1JFJ A;  2K7C A;  1K9U A;  3DF0 B;  1EG3 A;  1RFJ A;  2LE9 B;  1ZMZ A;  1B4C A;  1K95 A;  1G8I A;  4ZCU A;  1JF2 A;  3EK8 A;  1CFC A;  3TDI A;  1DVI A;  1NIW A;  5D7F A;  1U5I B;  1UUS A;  3OX6 A;  4NDC A;  1ALW A;  4AQI A;  1C7V A;  1SR6 C;  1GGW A;  3CWG A;  4YGE B;  1CFP A;  1EJ3 A;  4JQ0 D;  3BUO B;  1DJX A;  2Y1N A;  2MJW B;  3ICB A;  4DRW A;  2M0R A;  4N5X A;  2JNX A;  2M1K B;  2OTG C;  2SAS A;  2KYF A;  4GBA A;  2Y5I A;  1S36 A;  5B8I B;  2PRU A;  1S1E A;  2ZRT A;  1S5G Z;  2R2I A;  1XFY O;  3KO0 A;  1NWD A;  2I18 A;  1UHJ A;  1NX2 A;  1Y1A A;  1TN4 A;  3BUM B;  1FPW A;  4ETO A;  3VRP A;  1NCZ A;  1L2O C;  3JVT B;  1F71 A;  2NXQ A;  3PLF B;  1BG1 A;  1CNP A;  5BPJ A;  2JT0 A;  1PUL A;  2EHB A;  5J3X A;  2KFH A;  4XJK B;  2LVJ A;  1BLQ A;  2CCM A;  1YVH A;  4GFT A;  1U5I A;  2GV5 A;  3PM8 A;  3VRR A;  1ZOT B;  2BBN A;  2G9B A;  2QPT A;  1BT6 A;  2LC5 A;  3I5F B;  3CS1 A;  1XFV O;  4UPG A;  2FCD A;  3AKB A;  3TUY B;  1JUO A;  1M45 A;  1NX3 A;  1KQM B;  1IJ6 A;  2MA2 A;  1YUU A;  1EG4 A;  1BOD A;  5AEQ A;  1KWO B;  2OS8 B;  1XO5 A;  2PAS A;  4GUK A;  3AAK A;  1BF5 A;  4YGA A;  3GK4 X;  1SW8 A;  3DD4 A;  1JSA A;  1OQP A;  4MZK A;  1KQV A;  2KI6 D;  1TNW A;  2LNK A;  2F3Y A;  4BY4 A;  1B7T Y;  1L7Z A;  2BE4 A;  3JVT C;  1MQ1 A;  2JZI A;  3GK1 A;  1X02 A;  4DS7 A;  1LXF C;  1DJH A;  1OE9 B;  1AVS A;  2LHI A;  2V53 A;  2BCX A;  4XJK A;  4NDD A;  1QIW A;  4ORA B;  1HQV A;  1J1E A;  1JFK A;  1V1G A;  1BMO A;  2F2P A;  2WCE A;  3FWC A;  1A29 A;  1KK7 Y;  1G33 A;  5HLO A;  1OMV A;  1ALV A;  3SIA A;  1YR5 A;  3QRX A;  1JWD A;  2CT9 A;  2KHN A;  3I5F C;  4YI9 A;  3I5G B;  3FIA A;  1QAS A;  4AOM A;  1QTX A;  4ORC B;  1PAL A;  3TUY C;  1MWN A;  2M1U A;  1KQM C;  3BUX B;  3IF7 A;  1CDN A;  1DMO A;  2JC2 A;  1SCV A;  2M49 B;  1KWO C;  5JOL A;  1UHH A;  2OS8 C;  2WC8 A;  1B47 A;  2WOS A;  3BOW B;  4I5K A;  5JJG A;  2NLN A;  2L51 A;  3A4U B;  1TIZ A;  3A8R A;  2F3Z A;  1B8L A;  1IGV A;  3WNX B;  1AUI B;  1D1O A;  2M8U A;  1NP8 A;  1MF8 B;  1XFU O;  1XYD A;  3PAT A;  4MEW A;  5I2L A;  3TZ1 A;  1E8A A;  2BBM A;  2LLT A;  2PSR A;  2K7O A;  3NSL A;  2I94 A;  1ZFS A;  4PCW A;  1V1F A;  1DF0 B;  2L2E A;  1KFX L;  4PHK A;  1K94 A;  1F70 A;  3CZT X;  1C07 A;  1WRK A;  1NX1 A;  4CLN A;  2H61 A;  2JQ6 A;  3EKH A;  1LKJ A;  2E6W A;  3I5I B;  1S5G Y;  3I5H B;  4PHJ A;  2ZKM X;  3RM1 A;  5I2O A;  4CFQ A;  1BJF A;  2Q4U A;  1SK6 D;  4P2Y B;  1F55 A;  2ZN9 A;  2K2A A;  3I5G C;  1PSB A;  2KGR A;  2M29 A;  2WOR A;  3E3R A;  3BUW B;  1CM4 A;  1SBJ A;  2EC6 B;  3WHU B;  3VRN A;  2B1U A;  2ZRS A;  3NSI A;  1CTR A;  1K93 D;  1R6P A;  1KK8 B;  2A4J A;  4HSZ A;  1RRO A;  4I5J A;  4M2O A;  5ER4 X;  1WRL A;  1REC A;  1XVJ A;  2KFG A;  4I5N B;  4WQ3 A;  1S6I A;  5DKR A;  1DJI A;  4NDB A;  1DF0 A;  3GOF A;  2MHH A;  4GPL B;  1CM1 A;  2KBI A;  2BL0 B;  4GGN A;  2KAY A;  1B1G A;  1HT9 A;  1Q80 A;  3DVM A;  3FWB A;  3I5I C;  1KSO A;  1CFF A;  1K2H A;  1XFZ O;  3I5H C;  5DKQ A;  1LA3 A;  2F33 A;  4C0K A;  1FW4 A;  4C0L A;  3CR4 X;  4U8D A;  1BR4 B;  1OMR A;  4L9M A;  3LK1 A;  2L4H A;  2LUC A;  4FTG A;  1TTX A;  4IL1 A;  1PSR A;  1OZO A;  1QS7 A;  2FJU B;  4OCI A;  5KSZ A;  2LV7 A;  2MRD A;  2KDH A;  2EC6 C;  1SL8 A;  1CDL A;  1JF0 A;  2KGB C;  1WRZ A;  2JWW A;  1AJ4 A;  5KU1 A;  1Y6W A;  1KK8 C;  3KPX A;  1AK8 A;  1IRJ A;  1RTP 1;  2KQ6 A;  2NZ0 A;  2KBM A;  1N0Y A;  2I7A A;  2LMT A;  1YTZ C;  1CDM A;  5IBW A;  4F0Z B;  2COL B;  4WRI A;  1G4Y R;  4HRG A;  2KNE A;  4CFR A;  2BL0 C;  1UHI A;  3LCP C;  4ZCV A;  1EXR A;  1A2X A;  4P5O E;  1K9K A;  2PAL A;  1QV0 A;  2LHL A;  3AKA A;  2KOT A;  2ZND A;  3EVU A;  4GNK B;  1IH0 A;  4BY5 A;  2LM5 A;  3D10 A;  4TNC A;  4XYN A;  1YX8 A;  1DTL A;  2M9G A;  1RK9 A;  1Y0V H;  2LLS A;  4YGC B;  2LLU A;  1A75 B;  3BUN B;  1KFX S;  1YRT B;  2KQY A;  1SL7 A;  3DVE A;  1DGV A;  1J1D A;  3VRO A;  1SRA A;  2BKI B;  3SG5 A;  3PN7 B;  4FQO A;  1LVC D;  2M97 A;  5CSF A;  2SCP A;  3LLE A;  1YRU B;  2HPS A;  2LCP A;  4CPV A;  1MUX A;  3CGA A;  2PMY A;  5HLV A;  2LP3 A;  5AXI A;  1KFU S;  4ICB A;  2ISD A;  3O6B A;  1XFX O;  2G2B A;  5GQQ C;  4WQ2 A;  1XFW O;  1YVL A;  2WCB A;  3OHM B;  3KHE A;  1GQM A;  1TNQ A;  1SNL A;  1NCX A;  1MHO A;  1GJY A;  4PDZ A;  1BOC A;  1W7J B;  4E68 A;  1OOJ A;  1QIV A;  2MAZ A;  1TCF A;  2JRF A;  1ODB A;  1FI6 A;  1NX0 A;  4A4C A;  4ORB B;  5CPV A;  2Q91 A;  1R2U A;  1A75 A;  3K21 A;  1LIN A;  1YUT A;  1EH2 A;  2HF5 A;  1YUS A;  1DJG A;  2JT3 A;  3SG2 A;  1PK0 D;  2CTN A;  3LL8 B;  1BR1 B;  2FCE A;  1CMG A;  1S26 D;  3O4Y A;  3PN7 C;  1IKU A;  2H61 C;  1S6J A;  2WCF A;  1J7R A;  2O5G A;  3O2P A;  3TDZ A;  1DT7 B;  3IQO A;  4YI8 A;  5CSI A;  1B9A A;  4I5L B;  4R1E A;  2HQW A;  3LK0 A;  4QJ3 B;  1UWO A;  4M2Q A;  5G08 A;  1IJ5 A;  1W7I B;  1MXL C;  1QVI Z;  2KFF A;  1AHR A;  1S6C A;  3KF9 A;  2L4I A;  1WY9 A;  1FI5 A;  1BU3 A;  1OMD A;  3CR2 A;  3TS5 B;  5HKZ A;  2M7N A;  3PAL A;  1TRF A;  4PHM A;  1M39 A;  1QX5 B;  4NQG A;  1A4P A;  3JTD B;  2K7B A;  2L98 A;  4MRY A;  4PE1 A;  2JOJ A;  5HKY A;  4GAO A;  4QJ5 B;  1F4Q A;  3RLZ A;  2L50 A;  1H8B A;  4USL A;  1N65 A;  1JBA A;  2LMU A;  2L5X B;  1K96 A;  3MSE B;  4DUQ A;  3PFV A;  4D1E A;  1NPQ A;  2BCA A;  1IWQ A;  1TOP A;  1H4B A;  2OPO A;  2K0J A;  2H2K A;  1CDP A;  2QAC A;  2HET A;  5D69 A;  1F8H A;  1WLZ A;  4OVN F;  1RWY A;  2L0P A;  1CMF A;  1PRW A;  3OP0 A;  1JC2 A;  3EVV A;  2JXL A;  2K7D A;  3BYA A;  2JT8 A;  2JUL A;  3C1V A;  5HYD A;  4QJ4 B;  1IQ5 A;  1OSA A;  4YGB B;  2E30 A;  2EGD A;  2PVB A;  2M7L A;  4OKH A;  3EVR A;  2K2F A;  1SCM B;  1OZS A;  2HQ8 A;  3GK2 A;  1DGU A;  2JNF A;  2ZNE A;  3TS5 C;  4PAL A;  5I8N A;  5ER5 A;  4MZJ A;  1SL9 A;  4M2P A;  1M31 A;  2P6B B;  5FYX A;  1IQ3 A;  4Q04 A;  1K9P A;  3JTD C;  2JTT A;  1CLB A;  1PVB A;  1IG5 A;  3H4S E;  4MN0 A;  1DJW A;  3WXA A;  5CSN A;  4MLW A;  4MZL A;  2BKH B;  1CLL A;  1QX7 A;  1Y1X A;  3AAJ A;  3SG6 A;  1J7O A;  3F45 A;  2KYC A;  5AER A;  4CID A;  1QLS A;  4N1G A;  5CSJ A;  4YGD B;  3DF0 A;  1FF1 A;  3OB1 B;  1K90 D;  1SMG A;  5KTY A;  1NYA A;  1J55 A;  1WDC B;  1UHN A;  2DOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...