3IQQA

X-ray structure of bovine trtk12-ca(2+)-s100b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The Effects of CapZ Peptide (TRTK-12) Binding to S100B-Ca(2+) as Examined by NMR and X-ray Crystallography
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3iqqA00
3SG6A 3VRRA 2MBXA 1QS7A 1FBVA 1C7WA 3VGOA 2PVBA 2L5XB 2MJWB 2ZKMX 1WRLA 1F8HA 1RK9A 1NWDA 1YVLA 2D8NA 1B1GA 5I2OA 2HF5A 1B8LA 2KSPA 1CFDA 2KFGA 5D69A 3FS7A 2LVIA 3OHMB 2V53A 4QJ5B 2JC2A 3OX6A 1HT9A 3KEVA 2LNKA 1S1EA 5D7FA 5K89A 1N0YA 1SKTA 1Y6WA 1NX3A 1A03A 4P2YB 1CLMA 1XA5A 3IF7A 2WNDA 1XFZO 1NP8A 1UHKA 2FCDA 3AKAA 1E8AA 2OS8C 3NSOA 4U8DA 1C07A 1A2XA 1EH2A 1FPWA 2NZ0A 3ZWHA 1S5GZ 5I8NA 1L7ZA 3WXAA 1Y1UA 1IKUA 1CLLA 1KK7Z 1QLKA 3OP0A 2Y5IA 1YUSA 3E3RA 2L0PA 2ZN8A 1DJWA 4N1GA 1BR1B 4F0ZB 1SL8A 1CFFA 3GK2A 2L4IA 5ER4X 1DJGA 1SR6C 1DVIA 3EK7A 3AKBA 4GAOA 1CLBA 3EVVA 2JPTA 2BKHB 4HSZA 1WRKA 3I5IC 3SIBA 1L2OC 4AQIA 1B9AA 1BG1A 4GUKA 1KK8C 2LHLA 2Y1NA 3LK1A 2L51A 4I5JA 3I5HB 4MSPA 1M31A 1CMFA 5HLOA 2HETA 3HX4A 1M63B 3SIAA 3NXAA 2FOTA 3BUWB 1OMVA 4R1EA 1K96A 1F54A 1OSAA 2EC6B 4A4CA 1JFJA 1KFXS 2EGDA 2M29A 2BE6A 3SG2A 1WDCC 4JWQA 2I94A 2F3ZA 1XK4C 2KHNA 2KYCA 3CZTX 2OS8B 4DUQA 3O6BA 4IL1A 1YTZC 2H61C 2ISDA 4JQ0D 2KFHA 2FCEA 1YX7A 1SRAA 4PE7A 1SPYA 2JT8A 2MAZA 1YVHA 1JC2A 2KGRA 4MLWA 1B8CA 3NSKA 4YI8A 1NCYA 4M2PA 2K7DA 1XYDA 4YI9A 1PSBA 1C7VA 2K2AA 1RFJA 5F6TA 3C1VA 3I5FC 1J7RA 3DVEA 3PALA 4PE0A 2LVJA 1QIVA 3SG7A 1RWYA 1SW8A 1QVIZ 2QACA 3PSRA 1J1EA 2KI6C 4FQOA 3EKJA 2LANA 3OB1B 2AMIA 4ZCUA 5HKWA 4BY4A 1H8BA 1JF0A 1JFKA 2BBNA 2M8UA 3LLEA 2BCBA 2JWWA 5I2LA 1U5IA 1TIZA 4MN0A 2OTGC 3WHUB 1CTRA 1K93D 2BCAA 2JZIA 2KAXA 1BLQA 3DF0B 1J1DA 4NQGA 1A4PA 2K2FA 1CM1A 3GK1A 1DJIA 1WDCB 2AUCA 3RLZA 5KU1A 1TNPA 2I7AA 1OZOA 1IGVA 3D10A 1F55A 2O60A 1MXEA 3TUYB 1N2DA 1V1FA 2LMUA 3BUXB 1J7PA 4PDZA 4YGAA 1FW4A 4GNKB 1OOJA 2LE9B 2ZRTA 4USLA 5AANA 1K90D 1W7JB 4MBEA 2Q4UA 1CDNA 2F2OA 2KOTA 4OV2A 3FWBA 4OVNF 3EKHA 4DRWA 1X02A 1BMOA 1GGZA 3BQ3A 1IQ5A 2M97A 1YRUB 2LMTA 5AFPA 2M49B 3I5FB 1RECA 2JOJA 2KI4C 3FWCA 1FI5A 3O4YA 5JOLA 2WCFA 1K9UA 1MUXA 2JT3A 2K0JA 1KWOC 1ZUZA 4MZKA 5KTYA 1M46A 1A75B 1CDMA 2FJUB 2M7NA 3OB2B 4JPZB 2HPSA 1QASA 3IQOA 1RROA 2HQ8A 3A8RA 1YURA 2ZRSA 2WORA 1DJXA 3GK4X 3SG4A 1NCXA 2M0RA 2OTGB 1PK0D 1CMGA 1AJ4A 1KSOA 3BYAA 2AAOA 4WQ3A 1GGWA 2Y4QA 4OKHA 1IQ3A 4NDCA 2PALA 4D1EA 2NCPA 3KF9A 1WLZA 2JT0A 5B8IB 5JJGA 5CPVA 4GPLB 3CR2A 4QJ3B 1SK6D 1ALWA 1LA0A 3IQQA 1IH0A 2JTZA 1DMOA 3CR4X 3JVTB 1OE9B 4YGBB 1VRKA 1XFYO 5AXIA 1B4CA 4DCKA 1TN4A 1MXLC 1RTP1 1UWOA 3BUOB 1S6CA 2LP3A 2CBLA 5CSNA 4P5OE 1WRZA 1DF0B 1TRFA 1IJ5A 1TCOB 1K9KA 4AOMA 1UP5A 5FYXA 4Q04A 3DD4A 3PLFB 1K9PA 3D0YB 1PVAA 2R2IA 5DKNA 2Q91A 4GGFA 4WQ2A 4HREE 3RM1A 5HKZA 1WLMA 1JF2A 4GFTA 1B7TY 1GJYA 2JNXA 3GOFA 2CTNA 3EK4A 2F2PA 1OMRA 4PHMA 2M1UA 1R6PA 3ZNIA 1LVCD 1UURA 1SCMC 5CSFA 4HRHA 2LAPA 2IS9A 4CPVA 4DS7A 1DJZA 4NDBA 3AAJA 2JRFA 1NSHA 3PN7C 4DIRA 2BKIB 1UHIA 1JSAA 1J7QA 5AEQA 1YX8A 4ORAB 1TOPA 1JBAA 1CM4A 2JTTA 1NX0A 1OMDA 2E6WA 1TNQA 1YR5A 3CTNA 1ZOTB 2LUXA 3HCMA 4HRGA 1BODA 1DJYA 1DGUA 4PHNA 1AVSA 1SR6B 2WOSA 4UPGA 1ALVA 1AK8A 1QX7A 2L50A 3O2PA 2KFFA 4MRXA 4MVFA 2BCXA 4PHJA 3I5IB 3JTDC 4XJKB 4OR9B 1L2OB 1JWDA 3BOWB 3MSEB 4C0JA 1KK8B 2BL0C 3KPXA 4WRIA 1WY9A 4MZJA 2B1UA 1S5GY 2CNPA 4TNCA 1YUTA 3TZ1A 4CLNA 1KK7Y 1IJ6A 2CT9A 2F8PA 2SCPA 2LP2A 3LL8B 4PHKA 1ZFSA 3LK0A 3NSIA 3A4UB 1AUIB 1K8UA 1EJ3A 4YRUA 1PSRA 1CFCA 2DOQA 2F33A 1SCMB 1BT6A 2K8MB 1S36A 3PATA 1LINA 2COLB 2MHHA 2LLSA 3PN7B 2P6BB 2NCOA 1SL7A 1TNXA 1MHOA 1PALA 3CGAA 4YGEB 2BECA 1K95A 3SJSA 1FI6A 4CIDA 2LCPA 3KO0A 4MEWA 1MF8B 2KBMA 1OZSA 1TNWA 2M3WA 1QJTA 1S6IA 3AAKA 1PRWA 1PVBA 1QV0A 1SNLA 2LVKA 3OX5A 1S26D 2KQYA 5KSZA 4YBHB 2L2EA 1NUBA 1PULA 1XVJA 1DJHA 1Y1XA 1XFXO 2LC5A 1AP4A 1QLSA 1KSMA 1XFUO 4CFRA 3CS1A 2KI6D 1V1GA 1KQMC 1UHNA 1AJ5A 2BL0B 3BXKA 5J3XA 3I5GC 1BR4B 1ZMZA 1F4QA 2PSRA 1UHJA 2GV5A 1R2UA 2L4HA 4ZCVA 4ORCB 4ORBB 3M0WA 3EK8A 3QRXA 2I18A 3D0YA 2L98A 3BUMB 1UUSA 5HKYA 4ETOA 2HQWA 3NSLA 1HQVA 2G9BA 3H4SE 3TS5C 1BU3A 5I2QA 2JXCA 1U5IB 4YGDB 2MLFC 5TNCA 3VRPA 3I5HC 2K7BA 1BJFA 1TCFA 3SG5A 2EC6C 3TDIA 3PM8A 2PMYA 1MWNA 4PE4A 2LMVA 4I5KA 1BOCA 4I5LB 1QVIY 1MR8A 1GQMA 1KQVA 1JUOA 1K94A 1NCZA 3CWGA 3FIAA 1SCVA 4MZLA 4XYNA 4CFQA 1CDLA 1ODBA 2WCEA 4MRYA 2KNEA 3ICBA 4GGNA 1SMGA 4N5XA 3EVUA 2LV7A 2M9GA 1KFXL 2PASA 2SASA 1EG4A 2WCBA 2LLTA 2KI4B 1K2HA 2ZFDA 4QJ4B 4BY5A 1KWOB 1SL9A 1XO5A 1NYAA 3VROA 3WNXB 4C0LA 1KQMB 3SG3A 3TDZA 5G08A 3I5GB 1Y0VH 1DGVA 2LLUA 4XJKA 3DVJA 3K21A 1KCYA 3KHEA 2ZNDA 3BOWA 1CKKA 4GGFC 3TDUA 1FF1A 4ICBA 2O5GA 1G33A 2ZN9A 1F4OA 1NX2A 3VRNA 3TS5B 2BE4A 1A29A 2F3YA 4NDDA 4PCWA 3CLNA 2QPTA 2I2RE 1YRTB 3DF0A 1W7IB 2VRGA 2RGIA 5HYDA 4PE1A 2K7OA 3CR5X 1MQ1A 1N65A 2BBMA 1XK4A 2LUCA 1NIWA 3WHTB 2H61A 1KFUL 1NPQA 1IWQA 1CNPA 4M2OA 5AERA 2LM5A 1J55A 2MRDA 3BUNB 1QIWA 1H4BA 2KAVA 2WC8A 4FTGA 2JULA 4N1FA 2KDHA 2K61A 5BPJA 1QX5B 2EHBA 4OCIA 2LHIA 2M7LA 3TUYC 2KBIA 4AQJA 4GBAA 2JU0A 2GGZA 1CDPA 3O78A 2KYFA 5CSIA 5IBWA 3DVKA 4E68A 2KGBC 2NLNA 2LVVA 2MA2A 2PRUA 1QV1A 1XFWO 2A4JA 5PALA 3EVRA 1B8RA 2CXJA 1EG3A 2M1KB 1DTLA 2CCMA 1A75A 1S6JA 2E30A 1DT7B 1YUUA 4C0KA 3VRQA 1LXFC 2ZNEA 1QATA 3DVMA 1QX2A 1KFUS 2G2BA 1F71A 1Q80A 1SBJA 1J7OA 4I5NB 2Y1MA 4PALA 5ER5A 1ZACA 5GQQC 2GGMA 1XFVO 1RJVA 2JXLA 2K7CA 2KQ6A 2JNFA 3LCPC 2H2KA 1S3PA 2TN4A 1BF5A 1AHRA 5DKRA 4A4BA 4M2QA 2NXQA 5HLVA 3PFVA 2OPOA 1SY9A 2JQ6A 3F45A 1EL4A 1QXPA 2MLEC 1LKJA 1B7TZ 1IRJA 1G4YR 1LA3A 3JTDB 1SYMA 1B47A 2KAYA 1CFPA 4YGCB 1QTXA 1CB1A 5CSJA 1EXRA 1F70A 1D1OA 1M45A 1UHHA 1OQPA 1DF0A 1TTXA 1G8IA 5DKQA 1NX1A 3JVTC 1Y1AA 1M39A 1IG5A 4L9MA
chains in the Genus database with same CATH superfamily
3SG6A 3VRRA 4IJ7A 1QS7A 1FBVA 1C7WA 2MBXA 3VGOA 2PQLA 2PVBA 2L5XB 5HL1A 2MJWB 2ZKMX 1WRLA 1F8HA 1RK9A 1NWDA 1YVLA 2D8NA 1Z4HA 3L4AA 2HF5A 5I2OA 1B1GA 1B8LA 2FJYA 2KSPA 3CZ2A 1CFDA 2KFGA 5D69A 3FS7A 2LVIA 3BFHA 3OHMB 2V53A 1P28A 3B86A 4QJ5B 2JC2A 3OX6A 3R1VA 1HT9A 3KEVA 1IIOA 2LNKA 1S1EA 5D7FA 5K89A 2BNXA 1N0YA 1SKTA 1Y6WA 1NX3A 2WCKA 3DY9A 1DC1A 3FE6A 1A03A 4P2YB 1CLMA 1XA5A 3IF7A 2WNDA 1XFZO 1NP8A 1UHKA 2FCDA 3AKAA 1E8AA 2OS8C 3NSOA 3O4XA 4U8DA 1A2XA 1C07A 1EH2A 2NZ0A 1FPWA 2WC6A 1S5GZ 3ZWHA 5I8NA 3UO9A 1C3YA 1L7ZA 3WXAA 1Y1UA 1IKUA 1CLLA 1KK7Z 1QLKA 3OP0A 2Y5IA 1OOHA 1YUSA 3E3RA 3S0DA 2L0PA 2ZN8A 1DJWA 4N1GA 2JPOA 1BR1B 4F0ZB 1SL8A 1CFFA 3GK2A 2L4IA 5ER4X 1DJGA 1SR6C 3CZ1A 1DVIA 3EK7A 2PYQA 3AKBA 4GAOA 1CLBA 3EVVA 2JPTA 4PT1A 2BKHB 4HSZA 1WRKA 3I5IC 3SIBA 2QEVA 3BFAA 1L2OC 4AQIA 1B9AA 1BG1A 4GUKA 1KK8C 2LHLA 2Y1NA 3LK1A 2L51A 4I5JA 3I5HB 4MSPA 1M31A 1CMFA 5HLOA 2HETA 3HX4A 2QDIA 1M63B 3SIAA 3NXAA 2FOTA 3BUWB 1OMVA 3B6XA 1K96A 4R1EA 1OSAA 1F54A 2EC6B 4A4CA 1JFJA 5FI7A 1KFXS 2EGDA 2M29A 2BE6A 3SG2A 1WDCC 4JWQA 5I94A 2I94A 2F3ZA 1XK4C 2KHNA 2K60A 2KYCA 3CZTX 2OS8B 4DUQA 3O6BA 3CYZA 4IL1A 1YTZC 2H61C 2GTEA 2ISDA 4JQ0D 2KFHA 2YGUA 2FCEA 1SSEB 1YX7A 3DXLA 1SRAA 4PE7A 1SPYA 2JT8A 3R72A 2MAZA 1YVHA 1JC2A 2KGRA 4MLWA 3S0AA 1B8CA 3NSKA 4YI8A 1NCYA 4M2PA 2K7DA 1XYDA 4YI9A 1PSBA 1C7VA 1QWVA 2K2AA 1DELA 1RFJA 3DYEA 5F6TA 3C1VA 3I5FC 1J7RA 3DVEA 3PALA 4PE0A 2LVJA 1QIVA 3SG7A 1RWYA 1SW8A 1QVIZ 2QACA 3PSRA 1J1EA 2KI6C 4FQOA 3EKJA 2LANA 3OB1B 2AMIA 3EG5B 4ZCUA 5HKWA 4BY4A 1JF0A 1H8BA 1JFKA 2BBNA 2M8UA 3LLEA 2BCBA 2JWWA 5I2LA 1U5IA 1TIZA 4MN0A 2OTGC 3WHUB 1CTRA 1K93D 2BCAA 2JZIA 2KAXA 2KPHA 1BLQA 3DF0B 1J1DA 4NQGA 1A4PA 2K2FA 1CM1A 3GK1A 1DJIA 1WDCB 2AUCA 3RLZA 1ORGA 5KU1A 1TNPA 2I7AA 1OZOA 1IGVA 3D10A 1F55A 2O60A 1MXEA 3TUYB 1N2DA 1V1FA 2LMUA 3BUXB 1J7PA 4PDZA 4YGAA 1FW4A 3NGVA 2WCHA 4GNKB 3SS5A 1OOJA 2LE9B 2ZRTA 4USLA 5AANA 1K90D 1W7JB 3NHTA 2QEOA 4MBEA 2Q4UA 1CDNA 2F2OA 2KOTA 4OV2A 3FWBA 4OVNF 3EKHA 4DRWA 1X02A 1BMOA 1GGZA 3BQ3A 5DICA 1IQ5A 2M97A 1YRUB 1XFRA 2LMTA 5AFPA 2M49B 3I5FB 1RECA 2JOJA 2KI4C 3FWCA 1FI5A 3O4YA 5JOLA 3CABA 2WCFA 1K9UA 1MUXA 2JT3A 2K0JA 1KWOC 1ZUZA 4MZKA 3L4LA 1M46A 5KTYA 1A75B 1CDMA 2FJUB 2M7NA 3OB2B 4JPZB 2HPSA 1QASA 3IQOA 3B87A 3N7HA 1RROA 2HQ8A 3A8RA 1YURA 2ZRSA 2WORA 1DJXA 3GK4X 3SG4A 1NCXA 2M0RA 2OTGB 1PK0D 1CMGA 1AJ4A 1KSOA 3BYAA 2AAOA 4WQ3A 1GGWA 2Y4QA 2WC5A 4OKHA 1IQ3A 1TUZA 4NDCA 2PALA 4D1EA 2NCPA 3KF9A 4KYNA 1WLZA 2JT0A 3BFBA 5B8IB 5CPVA 5JJGA 3D77A 4GPLB 1DEKA 3CR2A 4QJ3B 1SK6D 1ALWA 1LA0A 1T14A 3IQQA 1OOGA 1IH0A 3B7AA 2JTZA 1DMOA 3CR4X 3D73A 1OE9B 3JVTB 1VRKA 1XFYO 4YGBB 1GM0A 5AXIA 1B4CA 4DCKA 1TN4A 1MXLC 1RTP1 1UWOA 3BUOB 1S6CA 2LP3A 1OOFA 2CBLA 5CSNA 4P5OE 1WRZA 1DF0B 1TRFA 1IJ5A 1TCOB 1K9KA 4AOMA 5D3OA 1UP5A 5FYXA 4Q04A 3DD4A 3PLFB 1K9PA 3D0YB 1PVAA 2R2IA 5DKNA 2Q91A 4GGFA 4WQ2A 4HREE 3RM1A 5HKZA 1WLMA 1JF2A 4GFTA 3CDNA 1B7TY 1GJYA 2JNXA 3GOFA 2CTNA 3EK4A 2F2PA 1OMRA 4PHMA 2M1UA 1R6PA 3ZNIA 1LVCD 1UURA 1SCMC 5CSFA 4HRHA 2LAPA 2IS9A 4CPVA 4DS7A 1DJZA 4NDBA 3AAJA 2JRFA 1NSHA 3PN7C 4DIRA 1UHIA 2BKIB 1JSAA 1J7QA 5AEQA 1YX8A 4ORAB 1TOPA 1W9ZA 1CM4A 2JTTA 1JBAA 1NX0A 1OMDA 2E6WA 1TNQA 1YR5A 3CTNA 1ZOTB 3NHIA 2LUXA 3HCMA 2QEHA 4FQTA 4HRGA 1BODA 1DJYA 1DGUA 4PHNA 3IVTA 1AVSA 1SR6B 2WOSA 4UPGA 1ALVA 1AK8A 1QX7A 2L50A 3PJIA 3O2PA 2KFFA 3DZTA 4MRXA 4MVFA 3S0EA 2BCXA 4PHJA 3I5IB 3JTDC 4XJKB 4OR9B 1L2OB 1JWDA 3BOWB 4INXA 3MSEB 4C0JA 1KK8B 2BL0C 3KPXA 4WRIA 1WY9A 4MZJA 2B1UA 1S5GY 2CNPA 1OOIX 1YUTA 4TNCA 3TZ1A 4CLNA 1KK7Y 1IJ6A 2CT9A 2F8PA 2SCPA 2LP2A 3LL8B 4PHKA 1ZFSA 3LK0A 3NSIA 3A4UB 1AUIB 1K8UA 1C3ZA 1EJ3A 4YRUA 1PSRA 3B88A 3R1OA 1CFCA 2DOQA 2F33A 1SCMB 1BT6A 2K8MB 1S36A 3PATA 1LINA 2COLB 2MHHA 2LLSA 3PN7B 2P6BB 2NCOA 1SL7A 1TNXA 1MHOA 1PALA 3CGAA 4YGEB 2BECA 1K95A 3SJSA 1FI6A 4CIDA 2LCPA 3KO0A 4MEWA 1MF8B 2KBMA 1OZSA 1TNWA 2M3WA 1QJTA 1S6IA 3AAKA 1PRWA 1PVBA 2ERBA 1QV0A 1SNLA 2LVKA 3OX5A 3PM2A 1S26D 2KQYA 3OBVA 2KLEA 5KSZA 4YBHB 3VB1A 2L2EA 1NUBA 1PULA 1XVJA 2L5YA 1DJHA 5FI2A 1Y1XA 1XFXO 2LC5A 1AP4A 1QLSA 1KSMA 2WCJA 1XFUO 3CZ0A 4CFRA 3CS1A 2KI6D 1V1GA 1KQMC 1UHNA 1AJ5A 2BL0B 3BXKA 3Q8IA 5J3XA 3SS3A 3I5GC 1BR4B 1ZMZA 1F4QA 2PSRA 1UHJA 3SS4A 2GV5A 1R2UA 2L4HA 4ZCVA 4ORCB 4ORBB 3M0WA 3EK8A 3QRXA 2I18A 3D0YA 2L98A 3BUMB 1UUSA 5HKYA 4ETOA 2HQWA 2KLDA 1HQVA 2G9BA 3NSLA 3H4SE 3TS5C 1BU3A 3S0GA 5I2QA 2JXCA 1U5IB 4YGDB 2MLFC 5TNCA 3VRPA 3I5HC 3RZSA 2K7BA 1BJFA 1TCFA 3SG5A 4JD9A 2EC6C 1DQEA 3S0FA 3TDIA 3PM8A 2PMYA 1MWNA 4PE4A 2LMVA 4I5KA 1BOCA 4I5LB 1QVIY 2WCMA 1MR8A 3OGNA 1GQMA 1KQVA 1JUOA 1K94A 1NCZA 3CWGA 3FIAA 1SCVA 4MZLA 4XYNA 4CFQA 1CDLA 1ODBA 2WCEA 4MRYA 2KNEA 3ICBA 3D76A 1SMGA 4GGNA 4N5XA 3EVUA 3D78A 2LV7A 2M9GA 1KFXL 3UNWA 2PASA 2SASA 1EG4A 2WCBA 2LLTA 2H8VA 2KI4B 1K2HA 2ZFDA 4QJ4B 4JKTA 4BY5A 1KWOB 1SL9A 1XO5A 1NYAA 3VROA 3WNXB 4C0LA 1KQMB 3SG3A 3TDZA 5G08A 3V2LA 3I5GB 1Y0VH 1DGVA 2LLUA 3D75A 4XJKA 5EL2A 3DVJA 3K21A 1KCYA 3KHEA 2ZNDA 3BOWA 3D74A 1CKKA 4GGFC 3TDUA 3FE9A 1FF1A 3R1PA 4ICBA 4INWA 2O5GA 2WCLA 1G33A 2ZN9A 1F4OA 1OW4A 1NX2A 3VRNA 3TS5B 2BE4A 1A29A 2F3YA 4NDDA 4PCWA 3CLNA 2QPTA 2I2RE 1YRTB 3DF0A 1W7IB 2VRGA 2RGIA 5HYDA 4PE1A 2K7OA 3CR5X 1MQ1A 1N65A 2BBMA 2P71A 3BJHA 1XK4A 2LUCA 4F7FA 1NIWA 1TUJA 3WHTB 2H61A 1KFUL 1NPQA 1IWQA 1CNPA 4M2OA 5AERA 2LM5A 1J55A 2BAPA 2MRDA 1QIWA 3BUNB 1H4BA 2KAVA 2WC8A 4FTGA 2JULA 4N1FA 2KDHA 2K61A 5BPJA 1QX5B 2EHBA 4OCIA 2LHIA 2M7LA 3TUYC 2KBIA 2P70A 4AQJA 4GBAA 2JU0A 2GGZA 1CDPA 3O78A 2KYFA 3S0BA 3QMEA 5FI6A 5CSIA 5IBWA 3DVKA 4E68A 2KGBC 2NLNA 2LVVA 2MA2A 2PRUA 1QV1A 1XFWO 2A4JA 5PALA 3EVRA 1B8RA 2CXJA 1EG3A 2M1KB 1DTLA 2CCMA 1A75A 1S6JA 2E30A 1DT7B 1YUUA 4C0KA 3K1EA 1LXFC 2QEBA 3VRQA 2ZNEA 4OZDA 1QATA 3DVMA 1QX2A 1KFUS 2G2BA 3FE8A 1F71A 1Q80A 1SBJA 1J7OA 4I5NB 2Y1MA 4PALA 5ER5A 1ZACA 5GQQC 2GGMA 1XFVO 1RJVA 2JXLA 2K7CA 2KQ6A 2JNFA 3LCPC 2H2KA 1S3PA 2TN4A 1BF5A 1AHRA 5DKRA 4A4BA 2L2CA 4M2QA 2NXQA 5HLVA 3PFVA 2OPOA 1SY9A 2JQ6A 3F45A 1EL4A 1Z2CB 1QXPA 2MLEC 1LKJA 1B7TZ 1LS8A 1IRJA 1G4YR 1LA3A 3JTDB 1SYMA 1B47A 2KAYA 1CFPA 4YGCB 1QTXA 1CB1A 5CSJA 1EXRA 1F70A 1D1OA 1M45A 1UHHA 1OQPA 1DF0A 1TTXA 1G8IA 5DKQA 1NX1A 1TWOA 1Y1AA 1M39A 3JVTC 3L47A 1IG5A 4L9MA
chains in the Genus database with same CATH topology
3SG6A 3VRRA 2MBXA 1QS7A 1FBVA 1C7WA 3VGOA 2PVBA 2L5XB 2MJWB 2ZKMX 1WRLA 1F8HA 1RK9A 1NWDA 1YVLA 2D8NA 1B1GA 5I2OA 2HF5A 1B8LA 2KSPA 1CFDA 2KFGA 5D69A 3FS7A 2LVIA 3OHMB 2V53A 4QJ5B 2JC2A 3OX6A 1HT9A 3KEVA 2LNKA 1S1EA 5D7FA 5K89A 1N0YA 1SKTA 1Y6WA 1NX3A 1A03A 4P2YB 1CLMA 1XA5A 3IF7A 2WNDA 1XFZO 1NP8A 1UHKA 2FCDA 3AKAA 1E8AA 2OS8C 3NSOA 4U8DA 1C07A 1A2XA 1EH2A 1FPWA 2NZ0A 3ZWHA 1S5GZ 5I8NA 1L7ZA 3WXAA 1Y1UA 1IKUA 1CLLA 1KK7Z 1QLKA 3OP0A 2Y5IA 1YUSA 3E3RA 2L0PA 2ZN8A 1DJWA 4N1GA 1BR1B 4F0ZB 1SL8A 1CFFA 3GK2A 2L4IA 5ER4X 1DJGA 1SR6C 1DVIA 3EK7A 3AKBA 4GAOA 1CLBA 3EVVA 2JPTA 2BKHB 4HSZA 1WRKA 3I5IC 3SIBA 1L2OC 4AQIA 1B9AA 1BG1A 4GUKA 1KK8C 2LHLA 2Y1NA 3LK1A 2L51A 4I5JA 3I5HB 4MSPA 1M31A 1CMFA 5HLOA 2HETA 3HX4A 1M63B 3SIAA 3NXAA 2FOTA 3BUWB 1OMVA 4R1EA 1K96A 1F54A 1OSAA 2EC6B 4A4CA 1JFJA 1KFXS 2EGDA 2M29A 2BE6A 3SG2A 1WDCC 4JWQA 2I94A 2F3ZA 1XK4C 2KHNA 2KYCA 3CZTX 2OS8B 4DUQA 3O6BA 4IL1A 1YTZC 2H61C 2ISDA 4JQ0D 2KFHA 2FCEA 1YX7A 1SRAA 4PE7A 1SPYA 2JT8A 2MAZA 1YVHA 1JC2A 2KGRA 4MLWA 1B8CA 3NSKA 4YI8A 1NCYA 4M2PA 2K7DA 1XYDA 4YI9A 1PSBA 1C7VA 2K2AA 1RFJA 5F6TA 3C1VA 3I5FC 1J7RA 3DVEA 3PALA 4PE0A 2LVJA 1QIVA 3SG7A 1RWYA 1SW8A 1QVIZ 2QACA 3PSRA 1J1EA 2KI6C 4FQOA 3EKJA 2LANA 3OB1B 2AMIA 4ZCUA 5HKWA 4BY4A 1H8BA 1JF0A 1JFKA 2BBNA 2M8UA 3LLEA 2BCBA 2JWWA 5I2LA 1U5IA 1TIZA 4MN0A 2OTGC 3WHUB 1CTRA 1K93D 2BCAA 2JZIA 2KAXA 1BLQA 3DF0B 1J1DA 4NQGA 1A4PA 2K2FA 1CM1A 3GK1A 1DJIA 1WDCB 2AUCA 3RLZA 5KU1A 1TNPA 2I7AA 1OZOA 1IGVA 3D10A 1F55A 2O60A 1MXEA 3TUYB 1N2DA 1V1FA 2LMUA 3BUXB 1J7PA 4PDZA 4YGAA 1FW4A 4GNKB 1OOJA 2LE9B 2ZRTA 4USLA 5AANA 1K90D 1W7JB 4MBEA 2Q4UA 1CDNA 2F2OA 2KOTA 4OV2A 3FWBA 4OVNF 3EKHA 4DRWA 1X02A 1BMOA 1GGZA 3BQ3A 1IQ5A 2M97A 1YRUB 2LMTA 5AFPA 2M49B 3I5FB 1RECA 2JOJA 2KI4C 3FWCA 1FI5A 3O4YA 5JOLA 2WCFA 1K9UA 1MUXA 2JT3A 2K0JA 1KWOC 1ZUZA 4MZKA 5KTYA 1M46A 1A75B 1CDMA 2FJUB 2M7NA 3OB2B 4JPZB 2HPSA 1QASA 3IQOA 1RROA 2HQ8A 3A8RA 1YURA 2ZRSA 2WORA 1DJXA 3GK4X 3SG4A 1NCXA 2M0RA 2OTGB 1PK0D 1CMGA 1AJ4A 1KSOA 3BYAA 2AAOA 4WQ3A 1GGWA 2Y4QA 4OKHA 1IQ3A 4NDCA 2PALA 4D1EA 2NCPA 3KF9A 1WLZA 2JT0A 5B8IB 5JJGA 5CPVA 4GPLB 3CR2A 4QJ3B 1SK6D 1ALWA 1LA0A 3IQQA 1IH0A 2JTZA 1DMOA 3CR4X 3JVTB 1OE9B 4YGBB 1VRKA 1XFYO 5AXIA 1B4CA 4DCKA 1TN4A 1MXLC 1RTP1 1UWOA 3BUOB 1S6CA 2LP3A 2CBLA 5CSNA 4P5OE 1WRZA 1DF0B 1TRFA 1IJ5A 1TCOB 1K9KA 4AOMA 1UP5A 5FYXA 4Q04A 3DD4A 3PLFB 1K9PA 3D0YB 1PVAA 2R2IA 5DKNA 2Q91A 4GGFA 4WQ2A 4HREE 3RM1A 5HKZA 1WLMA 1JF2A 4GFTA 1B7TY 1GJYA 2JNXA 3GOFA 2CTNA 3EK4A 2F2PA 1OMRA 4PHMA 2M1UA 1R6PA 3ZNIA 1LVCD 1UURA 1SCMC 5CSFA 4HRHA 2LAPA 2IS9A 4CPVA 4DS7A 1DJZA 4NDBA 3AAJA 2JRFA 1NSHA 3PN7C 4DIRA 2BKIB 1UHIA 1JSAA 1J7QA 5AEQA 1YX8A 4ORAB 1TOPA 1JBAA 1CM4A 2JTTA 1NX0A 1OMDA 2E6WA 1TNQA 1YR5A 3CTNA 1ZOTB 2LUXA 3HCMA 4HRGA 1BODA 1DJYA 1DGUA 4PHNA 1AVSA 1SR6B 2WOSA 4UPGA 1ALVA 1AK8A 1QX7A 2L50A 3O2PA 2KFFA 4MRXA 4MVFA 2BCXA 4PHJA 3I5IB 3JTDC 4XJKB 4OR9B 1L2OB 1JWDA 3BOWB 3MSEB 4C0JA 1KK8B 2BL0C 3KPXA 4WRIA 1WY9A 4MZJA 2B1UA 1S5GY 2CNPA 4TNCA 1YUTA 3TZ1A 4CLNA 1KK7Y 1IJ6A 2CT9A 2F8PA 2SCPA 2LP2A 3LL8B 4PHKA 1ZFSA 3LK0A 3NSIA 3A4UB 1AUIB 1K8UA 1EJ3A 4YRUA 1PSRA 1CFCA 2DOQA 2F33A 1SCMB 1BT6A 2K8MB 1S36A 3PATA 1LINA 2COLB 2MHHA 2LLSA 3PN7B 2P6BB 2NCOA 1SL7A 1TNXA 1MHOA 1PALA 3CGAA 4YGEB 2BECA 1K95A 3SJSA 1FI6A 4CIDA 2LCPA 3KO0A 4MEWA 1MF8B 2KBMA 1OZSA 1TNWA 2M3WA 1QJTA 1S6IA 3AAKA 1PRWA 1PVBA 1QV0A 1SNLA 2LVKA 3OX5A 1S26D 2KQYA 5KSZA 4YBHB 2L2EA 1NUBA 1PULA 1XVJA 1DJHA 1Y1XA 1XFXO 2LC5A 1AP4A 1QLSA 1KSMA 1XFUO 4CFRA 3CS1A 2KI6D 1V1GA 1KQMC 1UHNA 1AJ5A 2BL0B 3BXKA 5J3XA 3I5GC 1BR4B 1ZMZA 1F4QA 2PSRA 1UHJA 2GV5A 1R2UA 2L4HA 4ZCVA 4ORCB 4ORBB 3M0WA 3EK8A 3QRXA 2I18A 3D0YA 2L98A 3BUMB 1UUSA 5HKYA 4ETOA 2HQWA 3NSLA 1HQVA 2G9BA 3H4SE 3TS5C 1BU3A 5I2QA 2JXCA 1U5IB 4YGDB 2MLFC 5TNCA 3VRPA 3I5HC 2K7BA 1BJFA 1TCFA 3SG5A 2EC6C 3TDIA 3PM8A 2PMYA 1MWNA 4PE4A 2LMVA 4I5KA 1BOCA 4I5LB 1QVIY 1MR8A 1GQMA 1KQVA 1JUOA 1K94A 1NCZA 3CWGA 3FIAA 1SCVA 4MZLA 4XYNA 4CFQA 1CDLA 1ODBA 2WCEA 4MRYA 2KNEA 3ICBA 4GGNA 1SMGA 4N5XA 3EVUA 2LV7A 2M9GA 1KFXL 2PASA 2SASA 1EG4A 2WCBA 2LLTA 2KI4B 1K2HA 2ZFDA 4QJ4B 4BY5A 1KWOB 1SL9A 1XO5A 1NYAA 3VROA 3WNXB 4C0LA 1KQMB 3SG3A 3TDZA 5G08A 3I5GB 1Y0VH 1DGVA 2LLUA 4XJKA 3DVJA 3K21A 1KCYA 3KHEA 2ZNDA 3BOWA 1CKKA 4GGFC 3TDUA 1FF1A 4ICBA 2O5GA 1G33A 2ZN9A 1F4OA 1NX2A 3VRNA 3TS5B 2BE4A 1A29A 2F3YA 4NDDA 4PCWA 3CLNA 2QPTA 2I2RE 1YRTB 3DF0A 1W7IB 2VRGA 2RGIA 5HYDA 4PE1A 2K7OA 3CR5X 1MQ1A 1N65A 2BBMA 1XK4A 2LUCA 1NIWA 3WHTB 2H61A 1KFUL 1NPQA 1IWQA 1CNPA 4M2OA 5AERA 2LM5A 1J55A 2MRDA 3BUNB 1QIWA 1H4BA 2KAVA 2WC8A 4FTGA 2JULA 4N1FA 2KDHA 2K61A 5BPJA 1QX5B 2EHBA 4OCIA 2LHIA 2M7LA 3TUYC 2KBIA 4AQJA 4GBAA 2JU0A 2GGZA 1CDPA 3O78A 2KYFA 5CSIA 5IBWA 3DVKA 4E68A 2KGBC 2NLNA 2LVVA 2MA2A 2PRUA 1QV1A 1XFWO 2A4JA 5PALA 3EVRA 1B8RA 2CXJA 1EG3A 2M1KB 1DTLA 2CCMA 1A75A 1S6JA 2E30A 1DT7B 1YUUA 4C0KA 3VRQA 1LXFC 2ZNEA 1QATA 3DVMA 1QX2A 1KFUS 2G2BA 1F71A 1Q80A 1SBJA 1J7OA 4I5NB 2Y1MA 4PALA 5ER5A 1ZACA 5GQQC 2GGMA 1XFVO 1RJVA 2JXLA 2K7CA 2KQ6A 2JNFA 3LCPC 2H2KA 1S3PA 2TN4A 1BF5A 1AHRA 5DKRA 4A4BA 4M2QA 2NXQA 5HLVA 3PFVA 2OPOA 1SY9A 2JQ6A 3F45A 1EL4A 1QXPA 2MLEC 1LKJA 1B7TZ 1IRJA 1G4YR 1LA3A 3JTDB 1SYMA 1B47A 2KAYA 1CFPA 4YGCB 1QTXA 1CB1A 5CSJA 1EXRA 1F70A 1D1OA 1M45A 1UHHA 1OQPA 1DF0A 1TTXA 1G8IA 5DKQA 1NX1A 3JVTC 1Y1AA 1M39A 1IG5A 4L9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG6 A;  3VRR A;  2MBX A;  1QS7 A;  1FBV A;  1C7W A;  3VGO A;  2PVB A;  2L5X B;  2MJW B;  2ZKM X;  1WRL A;  1F8H A;  1RK9 A;  1NWD A;  1YVL A;  2D8N A;  1B1G A;  5I2O A;  2HF5 A;  1B8L A;  2KSP A;  1CFD A;  2KFG A;  5D69 A;  3FS7 A;  2LVI A;  3OHM B;  2V53 A;  4QJ5 B;  2JC2 A;  3OX6 A;  1HT9 A;  3KEV A;  2LNK A;  1S1E A;  5D7F A;  5K89 A;  1N0Y A;  1SKT A;  1Y6W A;  1NX3 A;  1A03 A;  4P2Y B;  1CLM A;  1XA5 A;  3IF7 A;  2WND A;  1XFZ O;  1NP8 A;  1UHK A;  2FCD A;  3AKA A;  1E8A A;  2OS8 C;  3NSO A;  4U8D A;  1C07 A;  1A2X A;  1EH2 A;  1FPW A;  2NZ0 A;  3ZWH A;  1S5G Z;  5I8N A;  1L7Z A;  3WXA A;  1Y1U A;  1IKU A;  1CLL A;  1KK7 Z;  1QLK A;  3OP0 A;  2Y5I A;  1YUS A;  3E3R A;  2L0P A;  2ZN8 A;  1DJW A;  4N1G A;  1BR1 B;  4F0Z B;  1SL8 A;  1CFF A;  3GK2 A;  2L4I A;  5ER4 X;  1DJG A;  1SR6 C;  1DVI A;  3EK7 A;  3AKB A;  4GAO A;  1CLB A;  3EVV A;  2JPT A;  2BKH B;  4HSZ A;  1WRK A;  3I5I C;  3SIB A;  1L2O C;  4AQI A;  1B9A A;  1BG1 A;  4GUK A;  1KK8 C;  2LHL A;  2Y1N A;  3LK1 A;  2L51 A;  4I5J A;  3I5H B;  4MSP A;  1M31 A;  1CMF A;  5HLO A;  2HET A;  3HX4 A;  1M63 B;  3SIA A;  3NXA A;  2FOT A;  3BUW B;  1OMV A;  4R1E A;  1K96 A;  1F54 A;  1OSA A;  2EC6 B;  4A4C A;  1JFJ A;  1KFX S;  2EGD A;  2M29 A;  2BE6 A;  3SG2 A;  1WDC C;  4JWQ A;  2I94 A;  2F3Z A;  1XK4 C;  2KHN A;  2KYC A;  3CZT X;  2OS8 B;  4DUQ A;  3O6B A;  4IL1 A;  1YTZ C;  2H61 C;  2ISD A;  4JQ0 D;  2KFH A;  2FCE A;  1YX7 A;  1SRA A;  4PE7 A;  1SPY A;  2JT8 A;  2MAZ A;  1YVH A;  1JC2 A;  2KGR A;  4MLW A;  1B8C A;  3NSK A;  4YI8 A;  1NCY A;  4M2P A;  2K7D A;  1XYD A;  4YI9 A;  1PSB A;  1C7V A;  2K2A A;  1RFJ A;  5F6T A;  3C1V A;  3I5F C;  1J7R A;  3DVE A;  3PAL A;  4PE0 A;  2LVJ A;  1QIV A;  3SG7 A;  1RWY A;  1SW8 A;  1QVI Z;  2QAC A;  3PSR A;  1J1E A;  2KI6 C;  4FQO A;  3EKJ A;  2LAN A;  3OB1 B;  2AMI A;  4ZCU A;  5HKW A;  4BY4 A;  1H8B A;  1JF0 A;  1JFK A;  2BBN A;  2M8U A;  3LLE A;  2BCB A;  2JWW A;  5I2L A;  1U5I A;  1TIZ A;  4MN0 A;  2OTG C;  3WHU B;  1CTR A;  1K93 D;  2BCA A;  2JZI A;  2KAX A;  1BLQ A;  3DF0 B;  1J1D A;  4NQG A;  1A4P A;  2K2F A;  1CM1 A;  3GK1 A;  1DJI A;  1WDC B;  2AUC A;  3RLZ A;  5KU1 A;  1TNP A;  2I7A A;  1OZO A;  1IGV A;  3D10 A;  1F55 A;  2O60 A;  1MXE A;  3TUY B;  1N2D A;  1V1F A;  2LMU A;  3BUX B;  1J7P A;  4PDZ A;  4YGA A;  1FW4 A;  4GNK B;  1OOJ A;  2LE9 B;  2ZRT A;  4USL A;  5AAN A;  1K90 D;  1W7J B;  4MBE A;  2Q4U A;  1CDN A;  2F2O A;  2KOT A;  4OV2 A;  3FWB A;  4OVN F;  3EKH A;  4DRW A;  1X02 A;  1BMO A;  1GGZ A;  3BQ3 A;  1IQ5 A;  2M97 A;  1YRU B;  2LMT A;  5AFP A;  2M49 B;  3I5F B;  1REC A;  2JOJ A;  2KI4 C;  3FWC A;  1FI5 A;  3O4Y A;  5JOL A;  2WCF A;  1K9U A;  1MUX A;  2JT3 A;  2K0J A;  1KWO C;  1ZUZ A;  4MZK A;  5KTY A;  1M46 A;  1A75 B;  1CDM A;  2FJU B;  2M7N A;  3OB2 B;  4JPZ B;  2HPS A;  1QAS A;  3IQO A;  1RRO A;  2HQ8 A;  3A8R A;  1YUR A;  2ZRS A;  2WOR A;  1DJX A;  3GK4 X;  3SG4 A;  1NCX A;  2M0R A;  2OTG B;  1PK0 D;  1CMG A;  1AJ4 A;  1KSO A;  3BYA A;  2AAO A;  4WQ3 A;  1GGW A;  2Y4Q A;  4OKH A;  1IQ3 A;  4NDC A;  2PAL A;  4D1E A;  2NCP A;  3KF9 A;  1WLZ A;  2JT0 A;  5B8I B;  5JJG A;  5CPV A;  4GPL B;  3CR2 A;  4QJ3 B;  1SK6 D;  1ALW A;  1LA0 A;  3IQQ A;  1IH0 A;  2JTZ A;  1DMO A;  3CR4 X;  3JVT B;  1OE9 B;  4YGB B;  1VRK A;  1XFY O;  5AXI A;  1B4C A;  4DCK A;  1TN4 A;  1MXL C;  1RTP 1;  1UWO A;  3BUO B;  1S6C A;  2LP3 A;  2CBL A;  5CSN A;  4P5O E;  1WRZ A;  1DF0 B;  1TRF A;  1IJ5 A;  1TCO B;  1K9K A;  4AOM A;  1UP5 A;  5FYX A;  4Q04 A;  3DD4 A;  3PLF B;  1K9P A;  3D0Y B;  1PVA A;  2R2I A;  5DKN A;  2Q91 A;  4GGF A;  4WQ2 A;  4HRE E;  3RM1 A;  5HKZ A;  1WLM A;  1JF2 A;  4GFT A;  1B7T Y;  1GJY A;  2JNX A;  3GOF A;  2CTN A;  3EK4 A;  2F2P A;  1OMR A;  4PHM A;  2M1U A;  1R6P A;  3ZNI A;  1LVC D;  1UUR A;  1SCM C;  5CSF A;  4HRH A;  2LAP A;  2IS9 A;  4CPV A;  4DS7 A;  1DJZ A;  4NDB A;  3AAJ A;  2JRF A;  1NSH A;  3PN7 C;  4DIR A;  2BKI B;  1UHI A;  1JSA A;  1J7Q A;  5AEQ A;  1YX8 A;  4ORA B;  1TOP A;  1JBA A;  1CM4 A;  2JTT A;  1NX0 A;  1OMD A;  2E6W A;  1TNQ A;  1YR5 A;  3CTN A;  1ZOT B;  2LUX A;  3HCM A;  4HRG A;  1BOD A;  1DJY A;  1DGU A;  4PHN A;  1AVS A;  1SR6 B;  2WOS A;  4UPG A;  1ALV A;  1AK8 A;  1QX7 A;  2L50 A;  3O2P A;  2KFF A;  4MRX A;  4MVF A;  2BCX A;  4PHJ A;  3I5I B;  3JTD C;  4XJK B;  4OR9 B;  1L2O B;  1JWD A;  3BOW B;  3MSE B;  4C0J A;  1KK8 B;  2BL0 C;  3KPX A;  4WRI A;  1WY9 A;  4MZJ A;  2B1U A;  1S5G Y;  2CNP A;  4TNC A;  1YUT A;  3TZ1 A;  4CLN A;  1KK7 Y;  1IJ6 A;  2CT9 A;  2F8P A;  2SCP A;  2LP2 A;  3LL8 B;  4PHK A;  1ZFS A;  3LK0 A;  3NSI A;  3A4U B;  1AUI B;  1K8U A;  1EJ3 A;  4YRU A;  1PSR A;  1CFC A;  2DOQ A;  2F33 A;  1SCM B;  1BT6 A;  2K8M B;  1S36 A;  3PAT A;  1LIN A;  2COL B;  2MHH A;  2LLS A;  3PN7 B;  2P6B B;  2NCO A;  1SL7 A;  1TNX A;  1MHO A;  1PAL A;  3CGA A;  4YGE B;  2BEC A;  1K95 A;  3SJS A;  1FI6 A;  4CID A;  2LCP A;  3KO0 A;  4MEW A;  1MF8 B;  2KBM A;  1OZS A;  1TNW A;  2M3W A;  1QJT A;  1S6I A;  3AAK A;  1PRW A;  1PVB A;  1QV0 A;  1SNL A;  2LVK A;  3OX5 A;  1S26 D;  2KQY A;  5KSZ A;  4YBH B;  2L2E A;  1NUB A;  1PUL A;  1XVJ A;  1DJH A;  1Y1X A;  1XFX O;  2LC5 A;  1AP4 A;  1QLS A;  1KSM A;  1XFU O;  4CFR A;  3CS1 A;  2KI6 D;  1V1G A;  1KQM C;  1UHN A;  1AJ5 A;  2BL0 B;  3BXK A;  5J3X A;  3I5G C;  1BR4 B;  1ZMZ A;  1F4Q A;  2PSR A;  1UHJ A;  2GV5 A;  1R2U A;  2L4H A;  4ZCV A;  4ORC B;  4ORB B;  3M0W A;  3EK8 A;  3QRX A;  2I18 A;  3D0Y A;  2L98 A;  3BUM B;  1UUS A;  5HKY A;  4ETO A;  2HQW A;  3NSL A;  1HQV A;  2G9B A;  3H4S E;  3TS5 C;  1BU3 A;  5I2Q A;  2JXC A;  1U5I B;  4YGD B;  2MLF C;  5TNC A;  3VRP A;  3I5H C;  2K7B A;  1BJF A;  1TCF A;  3SG5 A;  2EC6 C;  3TDI A;  3PM8 A;  2PMY A;  1MWN A;  4PE4 A;  2LMV A;  4I5K A;  1BOC A;  4I5L B;  1QVI Y;  1MR8 A;  1GQM A;  1KQV A;  1JUO A;  1K94 A;  1NCZ A;  3CWG A;  3FIA A;  1SCV A;  4MZL A;  4XYN A;  4CFQ A;  1CDL A;  1ODB A;  2WCE A;  4MRY A;  2KNE A;  3ICB A;  4GGN A;  1SMG A;  4N5X A;  3EVU A;  2LV7 A;  2M9G A;  1KFX L;  2PAS A;  2SAS A;  1EG4 A;  2WCB A;  2LLT A;  2KI4 B;  1K2H A;  2ZFD A;  4QJ4 B;  4BY5 A;  1KWO B;  1SL9 A;  1XO5 A;  1NYA A;  3VRO A;  3WNX B;  4C0L A;  1KQM B;  3SG3 A;  3TDZ A;  5G08 A;  3I5G B;  1Y0V H;  1DGV A;  2LLU A;  4XJK A;  3DVJ A;  3K21 A;  1KCY A;  3KHE A;  2ZND A;  3BOW A;  1CKK A;  4GGF C;  3TDU A;  1FF1 A;  4ICB A;  2O5G A;  1G33 A;  2ZN9 A;  1F4O A;  1NX2 A;  3VRN A;  3TS5 B;  2BE4 A;  1A29 A;  2F3Y A;  4NDD A;  4PCW A;  3CLN A;  2QPT A;  2I2R E;  1YRT B;  3DF0 A;  1W7I B;  2VRG A;  2RGI A;  5HYD A;  4PE1 A;  2K7O A;  3CR5 X;  1MQ1 A;  1N65 A;  2BBM A;  1XK4 A;  2LUC A;  1NIW A;  3WHT B;  2H61 A;  1KFU L;  1NPQ A;  1IWQ A;  1CNP A;  4M2O A;  5AER A;  2LM5 A;  1J55 A;  2MRD A;  3BUN B;  1QIW A;  1H4B A;  2KAV A;  2WC8 A;  4FTG A;  2JUL A;  4N1F A;  2KDH A;  2K61 A;  5BPJ A;  1QX5 B;  2EHB A;  4OCI A;  2LHI A;  2M7L A;  3TUY C;  2KBI A;  4AQJ A;  4GBA A;  2JU0 A;  2GGZ A;  1CDP A;  3O78 A;  2KYF A;  5CSI A;  5IBW A;  3DVK A;  4E68 A;  2KGB C;  2NLN A;  2LVV A;  2MA2 A;  2PRU A;  1QV1 A;  1XFW O;  2A4J A;  5PAL A;  3EVR A;  1B8R A;  2CXJ A;  1EG3 A;  2M1K B;  1DTL A;  2CCM A;  1A75 A;  1S6J A;  2E30 A;  1DT7 B;  1YUU A;  4C0K A;  3VRQ A;  1LXF C;  2ZNE A;  1QAT A;  3DVM A;  1QX2 A;  1KFU S;  2G2B A;  1F71 A;  1Q80 A;  1SBJ A;  1J7O A;  4I5N B;  2Y1M A;  4PAL A;  5ER5 A;  1ZAC A;  5GQQ C;  2GGM A;  1XFV O;  1RJV A;  2JXL A;  2K7C A;  2KQ6 A;  2JNF A;  3LCP C;  2H2K A;  1S3P A;  2TN4 A;  1BF5 A;  1AHR A;  5DKR A;  4A4B A;  4M2Q A;  2NXQ A;  5HLV A;  3PFV A;  2OPO A;  1SY9 A;  2JQ6 A;  3F45 A;  1EL4 A;  1QXP A;  2MLE C;  1LKJ A;  1B7T Z;  1IRJ A;  1G4Y R;  1LA3 A;  3JTD B;  1SYM A;  1B47 A;  2KAY A;  1CFP A;  4YGC B;  1QTX A;  1CB1 A;  5CSJ A;  1EXR A;  1F70 A;  1D1O A;  1M45 A;  1UHH A;  1OQP A;  1DF0 A;  1TTX A;  1G8I A;  5DKQ A;  1NX1 A;  3JVT C;  1Y1A A;  1M39 A;  1IG5 A;  4L9M A; 
#chains in the Genus database with same CATH topology
 3SG6 A;  3VRR A;  4IJ7 A;  1QS7 A;  1FBV A;  1C7W A;  2MBX A;  3VGO A;  2PQL A;  2PVB A;  2L5X B;  5HL1 A;  2MJW B;  2ZKM X;  1WRL A;  1F8H A;  1RK9 A;  1NWD A;  1YVL A;  2D8N A;  1Z4H A;  3L4A A;  2HF5 A;  5I2O A;  1B1G A;  1B8L A;  2FJY A;  2KSP A;  3CZ2 A;  1CFD A;  2KFG A;  5D69 A;  3FS7 A;  2LVI A;  3BFH A;  3OHM B;  2V53 A;  1P28 A;  3B86 A;  4QJ5 B;  2JC2 A;  3OX6 A;  3R1V A;  1HT9 A;  3KEV A;  1IIO A;  2LNK A;  1S1E A;  5D7F A;  5K89 A;  2BNX A;  1N0Y A;  1SKT A;  1Y6W A;  1NX3 A;  2WCK A;  3DY9 A;  1DC1 A;  3FE6 A;  1A03 A;  4P2Y B;  1CLM A;  1XA5 A;  3IF7 A;  2WND A;  1XFZ O;  1NP8 A;  1UHK A;  2FCD A;  3AKA A;  1E8A A;  2OS8 C;  3NSO A;  3O4X A;  4U8D A;  1A2X A;  1C07 A;  1EH2 A;  2NZ0 A;  1FPW A;  2WC6 A;  1S5G Z;  3ZWH A;  5I8N A;  3UO9 A;  1C3Y A;  1L7Z A;  3WXA A;  1Y1U A;  1IKU A;  1CLL A;  1KK7 Z;  1QLK A;  3OP0 A;  2Y5I A;  1OOH A;  1YUS A;  3E3R A;  3S0D A;  2L0P A;  2ZN8 A;  1DJW A;  4N1G A;  2JPO A;  1BR1 B;  4F0Z B;  1SL8 A;  1CFF A;  3GK2 A;  2L4I A;  5ER4 X;  1DJG A;  1SR6 C;  3CZ1 A;  1DVI A;  3EK7 A;  2PYQ A;  3AKB A;  4GAO A;  1CLB A;  3EVV A;  2JPT A;  4PT1 A;  2BKH B;  4HSZ A;  1WRK A;  3I5I C;  3SIB A;  2QEV A;  3BFA A;  1L2O C;  4AQI A;  1B9A A;  1BG1 A;  4GUK A;  1KK8 C;  2LHL A;  2Y1N A;  3LK1 A;  2L51 A;  4I5J A;  3I5H B;  4MSP A;  1M31 A;  1CMF A;  5HLO A;  2HET A;  3HX4 A;  2QDI A;  1M63 B;  3SIA A;  3NXA A;  2FOT A;  3BUW B;  1OMV A;  3B6X A;  1K96 A;  4R1E A;  1OSA A;  1F54 A;  2EC6 B;  4A4C A;  1JFJ A;  5FI7 A;  1KFX S;  2EGD A;  2M29 A;  2BE6 A;  3SG2 A;  1WDC C;  4JWQ A;  5I94 A;  2I94 A;  2F3Z A;  1XK4 C;  2KHN A;  2K60 A;  2KYC A;  3CZT X;  2OS8 B;  4DUQ A;  3O6B A;  3CYZ A;  4IL1 A;  1YTZ C;  2H61 C;  2GTE A;  2ISD A;  4JQ0 D;  2KFH A;  2YGU A;  2FCE A;  1SSE B;  1YX7 A;  3DXL A;  1SRA A;  4PE7 A;  1SPY A;  2JT8 A;  3R72 A;  2MAZ A;  1YVH A;  1JC2 A;  2KGR A;  4MLW A;  3S0A A;  1B8C A;  3NSK A;  4YI8 A;  1NCY A;  4M2P A;  2K7D A;  1XYD A;  4YI9 A;  1PSB A;  1C7V A;  1QWV A;  2K2A A;  1DEL A;  1RFJ A;  3DYE A;  5F6T A;  3C1V A;  3I5F C;  1J7R A;  3DVE A;  3PAL A;  4PE0 A;  2LVJ A;  1QIV A;  3SG7 A;  1RWY A;  1SW8 A;  1QVI Z;  2QAC A;  3PSR A;  1J1E A;  2KI6 C;  4FQO A;  3EKJ A;  2LAN A;  3OB1 B;  2AMI A;  3EG5 B;  4ZCU A;  5HKW A;  4BY4 A;  1JF0 A;  1H8B A;  1JFK A;  2BBN A;  2M8U A;  3LLE A;  2BCB A;  2JWW A;  5I2L A;  1U5I A;  1TIZ A;  4MN0 A;  2OTG C;  3WHU B;  1CTR A;  1K93 D;  2BCA A;  2JZI A;  2KAX A;  2KPH A;  1BLQ A;  3DF0 B;  1J1D A;  4NQG A;  1A4P A;  2K2F A;  1CM1 A;  3GK1 A;  1DJI A;  1WDC B;  2AUC A;  3RLZ A;  1ORG A;  5KU1 A;  1TNP A;  2I7A A;  1OZO A;  1IGV A;  3D10 A;  1F55 A;  2O60 A;  1MXE A;  3TUY B;  1N2D A;  1V1F A;  2LMU A;  3BUX B;  1J7P A;  4PDZ A;  4YGA A;  1FW4 A;  3NGV A;  2WCH A;  4GNK B;  3SS5 A;  1OOJ A;  2LE9 B;  2ZRT A;  4USL A;  5AAN A;  1K90 D;  1W7J B;  3NHT A;  2QEO A;  4MBE A;  2Q4U A;  1CDN A;  2F2O A;  2KOT A;  4OV2 A;  3FWB A;  4OVN F;  3EKH A;  4DRW A;  1X02 A;  1BMO A;  1GGZ A;  3BQ3 A;  5DIC A;  1IQ5 A;  2M97 A;  1YRU B;  1XFR A;  2LMT A;  5AFP A;  2M49 B;  3I5F B;  1REC A;  2JOJ A;  2KI4 C;  3FWC A;  1FI5 A;  3O4Y A;  5JOL A;  3CAB A;  2WCF A;  1K9U A;  1MUX A;  2JT3 A;  2K0J A;  1KWO C;  1ZUZ A;  4MZK A;  3L4L A;  1M46 A;  5KTY A;  1A75 B;  1CDM A;  2FJU B;  2M7N A;  3OB2 B;  4JPZ B;  2HPS A;  1QAS A;  3IQO A;  3B87 A;  3N7H A;  1RRO A;  2HQ8 A;  3A8R A;  1YUR A;  2ZRS A;  2WOR A;  1DJX A;  3GK4 X;  3SG4 A;  1NCX A;  2M0R A;  2OTG B;  1PK0 D;  1CMG A;  1AJ4 A;  1KSO A;  3BYA A;  2AAO A;  4WQ3 A;  1GGW A;  2Y4Q A;  2WC5 A;  4OKH A;  1IQ3 A;  1TUZ A;  4NDC A;  2PAL A;  4D1E A;  2NCP A;  3KF9 A;  4KYN A;  1WLZ A;  2JT0 A;  3BFB A;  5B8I B;  5CPV A;  5JJG A;  3D77 A;  4GPL B;  1DEK A;  3CR2 A;  4QJ3 B;  1SK6 D;  1ALW A;  1LA0 A;  1T14 A;  3IQQ A;  1OOG A;  1IH0 A;  3B7A A;  2JTZ A;  1DMO A;  3CR4 X;  3D73 A;  1OE9 B;  3JVT B;  1VRK A;  1XFY O;  4YGB B;  1GM0 A;  5AXI A;  1B4C A;  4DCK A;  1TN4 A;  1MXL C;  1RTP 1;  1UWO A;  3BUO B;  1S6C A;  2LP3 A;  1OOF A;  2CBL A;  5CSN A;  4P5O E;  1WRZ A;  1DF0 B;  1TRF A;  1IJ5 A;  1TCO B;  1K9K A;  4AOM A;  5D3O A;  1UP5 A;  5FYX A;  4Q04 A;  3DD4 A;  3PLF B;  1K9P A;  3D0Y B;  1PVA A;  2R2I A;  5DKN A;  2Q91 A;  4GGF A;  4WQ2 A;  4HRE E;  3RM1 A;  5HKZ A;  1WLM A;  1JF2 A;  4GFT A;  3CDN A;  1B7T Y;  1GJY A;  2JNX A;  3GOF A;  2CTN A;  3EK4 A;  2F2P A;  1OMR A;  4PHM A;  2M1U A;  1R6P A;  3ZNI A;  1LVC D;  1UUR A;  1SCM C;  5CSF A;  4HRH A;  2LAP A;  2IS9 A;  4CPV A;  4DS7 A;  1DJZ A;  4NDB A;  3AAJ A;  2JRF A;  1NSH A;  3PN7 C;  4DIR A;  1UHI A;  2BKI B;  1JSA A;  1J7Q A;  5AEQ A;  1YX8 A;  4ORA B;  1TOP A;  1W9Z A;  1CM4 A;  2JTT A;  1JBA A;  1NX0 A;  1OMD A;  2E6W A;  1TNQ A;  1YR5 A;  3CTN A;  1ZOT B;  3NHI A;  2LUX A;  3HCM A;  2QEH A;  4FQT A;  4HRG A;  1BOD A;  1DJY A;  1DGU A;  4PHN A;  3IVT A;  1AVS A;  1SR6 B;  2WOS A;  4UPG A;  1ALV A;  1AK8 A;  1QX7 A;  2L50 A;  3PJI A;  3O2P A;  2KFF A;  3DZT A;  4MRX A;  4MVF A;  3S0E A;  2BCX A;  4PHJ A;  3I5I B;  3JTD C;  4XJK B;  4OR9 B;  1L2O B;  1JWD A;  3BOW B;  4INX A;  3MSE B;  4C0J A;  1KK8 B;  2BL0 C;  3KPX A;  4WRI A;  1WY9 A;  4MZJ A;  2B1U A;  1S5G Y;  2CNP A;  1OOI X;  1YUT A;  4TNC A;  3TZ1 A;  4CLN A;  1KK7 Y;  1IJ6 A;  2CT9 A;  2F8P A;  2SCP A;  2LP2 A;  3LL8 B;  4PHK A;  1ZFS A;  3LK0 A;  3NSI A;  3A4U B;  1AUI B;  1K8U A;  1C3Z A;  1EJ3 A;  4YRU A;  1PSR A;  3B88 A;  3R1O A;  1CFC A;  2DOQ A;  2F33 A;  1SCM B;  1BT6 A;  2K8M B;  1S36 A;  3PAT A;  1LIN A;  2COL B;  2MHH A;  2LLS A;  3PN7 B;  2P6B B;  2NCO A;  1SL7 A;  1TNX A;  1MHO A;  1PAL A;  3CGA A;  4YGE B;  2BEC A;  1K95 A;  3SJS A;  1FI6 A;  4CID A;  2LCP A;  3KO0 A;  4MEW A;  1MF8 B;  2KBM A;  1OZS A;  1TNW A;  2M3W A;  1QJT A;  1S6I A;  3AAK A;  1PRW A;  1PVB A;  2ERB A;  1QV0 A;  1SNL A;  2LVK A;  3OX5 A;  3PM2 A;  1S26 D;  2KQY A;  3OBV A;  2KLE A;  5KSZ A;  4YBH B;  3VB1 A;  2L2E A;  1NUB A;  1PUL A;  1XVJ A;  2L5Y A;  1DJH A;  5FI2 A;  1Y1X A;  1XFX O;  2LC5 A;  1AP4 A;  1QLS A;  1KSM A;  2WCJ A;  1XFU O;  3CZ0 A;  4CFR A;  3CS1 A;  2KI6 D;  1V1G A;  1KQM C;  1UHN A;  1AJ5 A;  2BL0 B;  3BXK A;  3Q8I A;  5J3X A;  3SS3 A;  3I5G C;  1BR4 B;  1ZMZ A;  1F4Q A;  2PSR A;  1UHJ A;  3SS4 A;  2GV5 A;  1R2U A;  2L4H A;  4ZCV A;  4ORC B;  4ORB B;  3M0W A;  3EK8 A;  3QRX A;  2I18 A;  3D0Y A;  2L98 A;  3BUM B;  1UUS A;  5HKY A;  4ETO A;  2HQW A;  2KLD A;  1HQV A;  2G9B A;  3NSL A;  3H4S E;  3TS5 C;  1BU3 A;  3S0G A;  5I2Q A;  2JXC A;  1U5I B;  4YGD B;  2MLF C;  5TNC A;  3VRP A;  3I5H C;  3RZS A;  2K7B A;  1BJF A;  1TCF A;  3SG5 A;  4JD9 A;  2EC6 C;  1DQE A;  3S0F A;  3TDI A;  3PM8 A;  2PMY A;  1MWN A;  4PE4 A;  2LMV A;  4I5K A;  1BOC A;  4I5L B;  1QVI Y;  2WCM A;  1MR8 A;  3OGN A;  1GQM A;  1KQV A;  1JUO A;  1K94 A;  1NCZ A;  3CWG A;  3FIA A;  1SCV A;  4MZL A;  4XYN A;  4CFQ A;  1CDL A;  1ODB A;  2WCE A;  4MRY A;  2KNE A;  3ICB A;  3D76 A;  1SMG A;  4GGN A;  4N5X A;  3EVU A;  3D78 A;  2LV7 A;  2M9G A;  1KFX L;  3UNW A;  2PAS A;  2SAS A;  1EG4 A;  2WCB A;  2LLT A;  2H8V A;  2KI4 B;  1K2H A;  2ZFD A;  4QJ4 B;  4JKT A;  4BY5 A;  1KWO B;  1SL9 A;  1XO5 A;  1NYA A;  3VRO A;  3WNX B;  4C0L A;  1KQM B;  3SG3 A;  3TDZ A;  5G08 A;  3V2L A;  3I5G B;  1Y0V H;  1DGV A;  2LLU A;  3D75 A;  4XJK A;  5EL2 A;  3DVJ A;  3K21 A;  1KCY A;  3KHE A;  2ZND A;  3BOW A;  3D74 A;  1CKK A;  4GGF C;  3TDU A;  3FE9 A;  1FF1 A;  3R1P A;  4ICB A;  4INW A;  2O5G A;  2WCL A;  1G33 A;  2ZN9 A;  1F4O A;  1OW4 A;  1NX2 A;  3VRN A;  3TS5 B;  2BE4 A;  1A29 A;  2F3Y A;  4NDD A;  4PCW A;  3CLN A;  2QPT A;  2I2R E;  1YRT B;  3DF0 A;  1W7I B;  2VRG A;  2RGI A;  5HYD A;  4PE1 A;  2K7O A;  3CR5 X;  1MQ1 A;  1N65 A;  2BBM A;  2P71 A;  3BJH A;  1XK4 A;  2LUC A;  4F7F A;  1NIW A;  1TUJ A;  3WHT B;  2H61 A;  1KFU L;  1NPQ A;  1IWQ A;  1CNP A;  4M2O A;  5AER A;  2LM5 A;  1J55 A;  2BAP A;  2MRD A;  1QIW A;  3BUN B;  1H4B A;  2KAV A;  2WC8 A;  4FTG A;  2JUL A;  4N1F A;  2KDH A;  2K61 A;  5BPJ A;  1QX5 B;  2EHB A;  4OCI A;  2LHI A;  2M7L A;  3TUY C;  2KBI A;  2P70 A;  4AQJ A;  4GBA A;  2JU0 A;  2GGZ A;  1CDP A;  3O78 A;  2KYF A;  3S0B A;  3QME A;  5FI6 A;  5CSI A;  5IBW A;  3DVK A;  4E68 A;  2KGB C;  2NLN A;  2LVV A;  2MA2 A;  2PRU A;  1QV1 A;  1XFW O;  2A4J A;  5PAL A;  3EVR A;  1B8R A;  2CXJ A;  1EG3 A;  2M1K B;  1DTL A;  2CCM A;  1A75 A;  1S6J A;  2E30 A;  1DT7 B;  1YUU A;  4C0K A;  3K1E A;  1LXF C;  2QEB A;  3VRQ A;  2ZNE A;  4OZD A;  1QAT A;  3DVM A;  1QX2 A;  1KFU S;  2G2B A;  3FE8 A;  1F71 A;  1Q80 A;  1SBJ A;  1J7O A;  4I5N B;  2Y1M A;  4PAL A;  5ER5 A;  1ZAC A;  5GQQ C;  2GGM A;  1XFV O;  1RJV A;  2JXL A;  2K7C A;  2KQ6 A;  2JNF A;  3LCP C;  2H2K A;  1S3P A;  2TN4 A;  1BF5 A;  1AHR A;  5DKR A;  4A4B A;  2L2C A;  4M2Q A;  2NXQ A;  5HLV A;  3PFV A;  2OPO A;  1SY9 A;  2JQ6 A;  3F45 A;  1EL4 A;  1Z2C B;  1QXP A;  2MLE C;  1LKJ A;  1B7T Z;  1LS8 A;  1IRJ A;  1G4Y R;  1LA3 A;  3JTD B;  1SYM A;  1B47 A;  2KAY A;  1CFP A;  4YGC B;  1QTX A;  1CB1 A;  5CSJ A;  1EXR A;  1F70 A;  1D1O A;  1M45 A;  1UHH A;  1OQP A;  1DF0 A;  1TTX A;  1G8I A;  5DKQ A;  1NX1 A;  1TWO A;  1Y1A A;  1M39 A;  3JVT C;  3L47 A;  1IG5 A;  4L9M A; 
#chains in the Genus database with same CATH homology
 3SG6 A;  3VRR A;  2MBX A;  1QS7 A;  1FBV A;  1C7W A;  3VGO A;  2PVB A;  2L5X B;  2MJW B;  2ZKM X;  1WRL A;  1F8H A;  1RK9 A;  1NWD A;  1YVL A;  2D8N A;  1B1G A;  5I2O A;  2HF5 A;  1B8L A;  2KSP A;  1CFD A;  2KFG A;  5D69 A;  3FS7 A;  2LVI A;  3OHM B;  2V53 A;  4QJ5 B;  2JC2 A;  3OX6 A;  1HT9 A;  3KEV A;  2LNK A;  1S1E A;  5D7F A;  5K89 A;  1N0Y A;  1SKT A;  1Y6W A;  1NX3 A;  1A03 A;  4P2Y B;  1CLM A;  1XA5 A;  3IF7 A;  2WND A;  1XFZ O;  1NP8 A;  1UHK A;  2FCD A;  3AKA A;  1E8A A;  2OS8 C;  3NSO A;  4U8D A;  1C07 A;  1A2X A;  1EH2 A;  1FPW A;  2NZ0 A;  3ZWH A;  1S5G Z;  5I8N A;  1L7Z A;  3WXA A;  1Y1U A;  1IKU A;  1CLL A;  1KK7 Z;  1QLK A;  3OP0 A;  2Y5I A;  1YUS A;  3E3R A;  2L0P A;  2ZN8 A;  1DJW A;  4N1G A;  1BR1 B;  4F0Z B;  1SL8 A;  1CFF A;  3GK2 A;  2L4I A;  5ER4 X;  1DJG A;  1SR6 C;  1DVI A;  3EK7 A;  3AKB A;  4GAO A;  1CLB A;  3EVV A;  2JPT A;  2BKH B;  4HSZ A;  1WRK A;  3I5I C;  3SIB A;  1L2O C;  4AQI A;  1B9A A;  1BG1 A;  4GUK A;  1KK8 C;  2LHL A;  2Y1N A;  3LK1 A;  2L51 A;  4I5J A;  3I5H B;  4MSP A;  1M31 A;  1CMF A;  5HLO A;  2HET A;  3HX4 A;  1M63 B;  3SIA A;  3NXA A;  2FOT A;  3BUW B;  1OMV A;  4R1E A;  1K96 A;  1F54 A;  1OSA A;  2EC6 B;  4A4C A;  1JFJ A;  1KFX S;  2EGD A;  2M29 A;  2BE6 A;  3SG2 A;  1WDC C;  4JWQ A;  2I94 A;  2F3Z A;  1XK4 C;  2KHN A;  2KYC A;  3CZT X;  2OS8 B;  4DUQ A;  3O6B A;  4IL1 A;  1YTZ C;  2H61 C;  2ISD A;  4JQ0 D;  2KFH A;  2FCE A;  1YX7 A;  1SRA A;  4PE7 A;  1SPY A;  2JT8 A;  2MAZ A;  1YVH A;  1JC2 A;  2KGR A;  4MLW A;  1B8C A;  3NSK A;  4YI8 A;  1NCY A;  4M2P A;  2K7D A;  1XYD A;  4YI9 A;  1PSB A;  1C7V A;  2K2A A;  1RFJ A;  5F6T A;  3C1V A;  3I5F C;  1J7R A;  3DVE A;  3PAL A;  4PE0 A;  2LVJ A;  1QIV A;  3SG7 A;  1RWY A;  1SW8 A;  1QVI Z;  2QAC A;  3PSR A;  1J1E A;  2KI6 C;  4FQO A;  3EKJ A;  2LAN A;  3OB1 B;  2AMI A;  4ZCU A;  5HKW A;  4BY4 A;  1H8B A;  1JF0 A;  1JFK A;  2BBN A;  2M8U A;  3LLE A;  2BCB A;  2JWW A;  5I2L A;  1U5I A;  1TIZ A;  4MN0 A;  2OTG C;  3WHU B;  1CTR A;  1K93 D;  2BCA A;  2JZI A;  2KAX A;  1BLQ A;  3DF0 B;  1J1D A;  4NQG A;  1A4P A;  2K2F A;  1CM1 A;  3GK1 A;  1DJI A;  1WDC B;  2AUC A;  3RLZ A;  5KU1 A;  1TNP A;  2I7A A;  1OZO A;  1IGV A;  3D10 A;  1F55 A;  2O60 A;  1MXE A;  3TUY B;  1N2D A;  1V1F A;  2LMU A;  3BUX B;  1J7P A;  4PDZ A;  4YGA A;  1FW4 A;  4GNK B;  1OOJ A;  2LE9 B;  2ZRT A;  4USL A;  5AAN A;  1K90 D;  1W7J B;  4MBE A;  2Q4U A;  1CDN A;  2F2O A;  2KOT A;  4OV2 A;  3FWB A;  4OVN F;  3EKH A;  4DRW A;  1X02 A;  1BMO A;  1GGZ A;  3BQ3 A;  1IQ5 A;  2M97 A;  1YRU B;  2LMT A;  5AFP A;  2M49 B;  3I5F B;  1REC A;  2JOJ A;  2KI4 C;  3FWC A;  1FI5 A;  3O4Y A;  5JOL A;  2WCF A;  1K9U A;  1MUX A;  2JT3 A;  2K0J A;  1KWO C;  1ZUZ A;  4MZK A;  5KTY A;  1M46 A;  1A75 B;  1CDM A;  2FJU B;  2M7N A;  3OB2 B;  4JPZ B;  2HPS A;  1QAS A;  3IQO A;  1RRO A;  2HQ8 A;  3A8R A;  1YUR A;  2ZRS A;  2WOR A;  1DJX A;  3GK4 X;  3SG4 A;  1NCX A;  2M0R A;  2OTG B;  1PK0 D;  1CMG A;  1AJ4 A;  1KSO A;  3BYA A;  2AAO A;  4WQ3 A;  1GGW A;  2Y4Q A;  4OKH A;  1IQ3 A;  4NDC A;  2PAL A;  4D1E A;  2NCP A;  3KF9 A;  1WLZ A;  2JT0 A;  5B8I B;  5JJG A;  5CPV A;  4GPL B;  3CR2 A;  4QJ3 B;  1SK6 D;  1ALW A;  1LA0 A;  3IQQ A;  1IH0 A;  2JTZ A;  1DMO A;  3CR4 X;  3JVT B;  1OE9 B;  4YGB B;  1VRK A;  1XFY O;  5AXI A;  1B4C A;  4DCK A;  1TN4 A;  1MXL C;  1RTP 1;  1UWO A;  3BUO B;  1S6C A;  2LP3 A;  2CBL A;  5CSN A;  4P5O E;  1WRZ A;  1DF0 B;  1TRF A;  1IJ5 A;  1TCO B;  1K9K A;  4AOM A;  1UP5 A;  5FYX A;  4Q04 A;  3DD4 A;  3PLF B;  1K9P A;  3D0Y B;  1PVA A;  2R2I A;  5DKN A;  2Q91 A;  4GGF A;  4WQ2 A;  4HRE E;  3RM1 A;  5HKZ A;  1WLM A;  1JF2 A;  4GFT A;  1B7T Y;  1GJY A;  2JNX A;  3GOF A;  2CTN A;  3EK4 A;  2F2P A;  1OMR A;  4PHM A;  2M1U A;  1R6P A;  3ZNI A;  1LVC D;  1UUR A;  1SCM C;  5CSF A;  4HRH A;  2LAP A;  2IS9 A;  4CPV A;  4DS7 A;  1DJZ A;  4NDB A;  3AAJ A;  2JRF A;  1NSH A;  3PN7 C;  4DIR A;  2BKI B;  1UHI A;  1JSA A;  1J7Q A;  5AEQ A;  1YX8 A;  4ORA B;  1TOP A;  1JBA A;  1CM4 A;  2JTT A;  1NX0 A;  1OMD A;  2E6W A;  1TNQ A;  1YR5 A;  3CTN A;  1ZOT B;  2LUX A;  3HCM A;  4HRG A;  1BOD A;  1DJY A;  1DGU A;  4PHN A;  1AVS A;  1SR6 B;  2WOS A;  4UPG A;  1ALV A;  1AK8 A;  1QX7 A;  2L50 A;  3O2P A;  2KFF A;  4MRX A;  4MVF A;  2BCX A;  4PHJ A;  3I5I B;  3JTD C;  4XJK B;  4OR9 B;  1L2O B;  1JWD A;  3BOW B;  3MSE B;  4C0J A;  1KK8 B;  2BL0 C;  3KPX A;  4WRI A;  1WY9 A;  4MZJ A;  2B1U A;  1S5G Y;  2CNP A;  4TNC A;  1YUT A;  3TZ1 A;  4CLN A;  1KK7 Y;  1IJ6 A;  2CT9 A;  2F8P A;  2SCP A;  2LP2 A;  3LL8 B;  4PHK A;  1ZFS A;  3LK0 A;  3NSI A;  3A4U B;  1AUI B;  1K8U A;  1EJ3 A;  4YRU A;  1PSR A;  1CFC A;  2DOQ A;  2F33 A;  1SCM B;  1BT6 A;  2K8M B;  1S36 A;  3PAT A;  1LIN A;  2COL B;  2MHH A;  2LLS A;  3PN7 B;  2P6B B;  2NCO A;  1SL7 A;  1TNX A;  1MHO A;  1PAL A;  3CGA A;  4YGE B;  2BEC A;  1K95 A;  3SJS A;  1FI6 A;  4CID A;  2LCP A;  3KO0 A;  4MEW A;  1MF8 B;  2KBM A;  1OZS A;  1TNW A;  2M3W A;  1QJT A;  1S6I A;  3AAK A;  1PRW A;  1PVB A;  1QV0 A;  1SNL A;  2LVK A;  3OX5 A;  1S26 D;  2KQY A;  5KSZ A;  4YBH B;  2L2E A;  1NUB A;  1PUL A;  1XVJ A;  1DJH A;  1Y1X A;  1XFX O;  2LC5 A;  1AP4 A;  1QLS A;  1KSM A;  1XFU O;  4CFR A;  3CS1 A;  2KI6 D;  1V1G A;  1KQM C;  1UHN A;  1AJ5 A;  2BL0 B;  3BXK A;  5J3X A;  3I5G C;  1BR4 B;  1ZMZ A;  1F4Q A;  2PSR A;  1UHJ A;  2GV5 A;  1R2U A;  2L4H A;  4ZCV A;  4ORC B;  4ORB B;  3M0W A;  3EK8 A;  3QRX A;  2I18 A;  3D0Y A;  2L98 A;  3BUM B;  1UUS A;  5HKY A;  4ETO A;  2HQW A;  3NSL A;  1HQV A;  2G9B A;  3H4S E;  3TS5 C;  1BU3 A;  5I2Q A;  2JXC A;  1U5I B;  4YGD B;  2MLF C;  5TNC A;  3VRP A;  3I5H C;  2K7B A;  1BJF A;  1TCF A;  3SG5 A;  2EC6 C;  3TDI A;  3PM8 A;  2PMY A;  1MWN A;  4PE4 A;  2LMV A;  4I5K A;  1BOC A;  4I5L B;  1QVI Y;  1MR8 A;  1GQM A;  1KQV A;  1JUO A;  1K94 A;  1NCZ A;  3CWG A;  3FIA A;  1SCV A;  4MZL A;  4XYN A;  4CFQ A;  1CDL A;  1ODB A;  2WCE A;  4MRY A;  2KNE A;  3ICB A;  4GGN A;  1SMG A;  4N5X A;  3EVU A;  2LV7 A;  2M9G A;  1KFX L;  2PAS A;  2SAS A;  1EG4 A;  2WCB A;  2LLT A;  2KI4 B;  1K2H A;  2ZFD A;  4QJ4 B;  4BY5 A;  1KWO B;  1SL9 A;  1XO5 A;  1NYA A;  3VRO A;  3WNX B;  4C0L A;  1KQM B;  3SG3 A;  3TDZ A;  5G08 A;  3I5G B;  1Y0V H;  1DGV A;  2LLU A;  4XJK A;  3DVJ A;  3K21 A;  1KCY A;  3KHE A;  2ZND A;  3BOW A;  1CKK A;  4GGF C;  3TDU A;  1FF1 A;  4ICB A;  2O5G A;  1G33 A;  2ZN9 A;  1F4O A;  1NX2 A;  3VRN A;  3TS5 B;  2BE4 A;  1A29 A;  2F3Y A;  4NDD A;  4PCW A;  3CLN A;  2QPT A;  2I2R E;  1YRT B;  3DF0 A;  1W7I B;  2VRG A;  2RGI A;  5HYD A;  4PE1 A;  2K7O A;  3CR5 X;  1MQ1 A;  1N65 A;  2BBM A;  1XK4 A;  2LUC A;  1NIW A;  3WHT B;  2H61 A;  1KFU L;  1NPQ A;  1IWQ A;  1CNP A;  4M2O A;  5AER A;  2LM5 A;  1J55 A;  2MRD A;  3BUN B;  1QIW A;  1H4B A;  2KAV A;  2WC8 A;  4FTG A;  2JUL A;  4N1F A;  2KDH A;  2K61 A;  5BPJ A;  1QX5 B;  2EHB A;  4OCI A;  2LHI A;  2M7L A;  3TUY C;  2KBI A;  4AQJ A;  4GBA A;  2JU0 A;  2GGZ A;  1CDP A;  3O78 A;  2KYF A;  5CSI A;  5IBW A;  3DVK A;  4E68 A;  2KGB C;  2NLN A;  2LVV A;  2MA2 A;  2PRU A;  1QV1 A;  1XFW O;  2A4J A;  5PAL A;  3EVR A;  1B8R A;  2CXJ A;  1EG3 A;  2M1K B;  1DTL A;  2CCM A;  1A75 A;  1S6J A;  2E30 A;  1DT7 B;  1YUU A;  4C0K A;  3VRQ A;  1LXF C;  2ZNE A;  1QAT A;  3DVM A;  1QX2 A;  1KFU S;  2G2B A;  1F71 A;  1Q80 A;  1SBJ A;  1J7O A;  4I5N B;  2Y1M A;  4PAL A;  5ER5 A;  1ZAC A;  5GQQ C;  2GGM A;  1XFV O;  1RJV A;  2JXL A;  2K7C A;  2KQ6 A;  2JNF A;  3LCP C;  2H2K A;  1S3P A;  2TN4 A;  1BF5 A;  1AHR A;  5DKR A;  4A4B A;  4M2Q A;  2NXQ A;  5HLV A;  3PFV A;  2OPO A;  1SY9 A;  2JQ6 A;  3F45 A;  1EL4 A;  1QXP A;  2MLE C;  1LKJ A;  1B7T Z;  1IRJ A;  1G4Y R;  1LA3 A;  3JTD B;  1SYM A;  1B47 A;  2KAY A;  1CFP A;  4YGC B;  1QTX A;  1CB1 A;  5CSJ A;  1EXR A;  1F70 A;  1D1O A;  1M45 A;  1UHH A;  1OQP A;  1DF0 A;  1TTX A;  1G8I A;  5DKQ A;  1NX1 A;  3JVT C;  1Y1A A;  1M39 A;  1IG5 A;  4L9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...