2ZNEA

Crystal structure of zn2+-bound form of des3-23alg-2 complexed with alix abs peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
168
structure length
168
Chain Sequence
b'DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 58
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zneA00
1AHRA 1F71A 1YRTB 1PK0D 1JF2A 2MBXA 1CM1A 2KDHA 3KEVA 1L2OC 5DKQA 1N2DA 1PVAA 2FJUB 1IQ5A 1S5GY 2ZN9A 2COLB 1BLQA 4E68A 1RFJA 3VRRA 1ALWA 4ZCUA 2PASA 2L0PA 1YX8A 3LK1A 1QX2A 1KSMA 4WQ3A 5G08A 1CFPA 1XYDA 1K93D 1NPQA 2Y4QA 1RK9A 1DJHA 3DVEA 1GQMA 3I5IB 2ZRTA 3KO0A 1A75A 1SYMA 2LLSA 5PALA 1YUUA 1ZFSA 2JQ6A 4MRXA 4MSPA 4N1GA 3SG7A 2LVJA 1U5IA 2LCPA 5B8IB 2KQ6A 1XFXO 1CFFA 1K90D 1JC2A 2ISDA 1CFDA 2JT0A 3GK1A 1RECA 5KTYA 4FQOA 1DJIA 4I5KA 1TNWA 5KU1A 2AUCA 2I2RE 1XFWO 3EK4A 1S3PA 1J7RA 4P2YB 2JWWA 4MVFA 1F8HA 5JOLA 3ZNIA 1HQVA 3TS5B 1QX5B 4YBHB 3I5HB 2KNEA 3KF9A 2LANA 1AJ4A 4R1EA 1F70A 2I18A 2BCXA 4JWQA 4ZCVA 4OVNF 5F6TA 1X02A 3BUMB 3LL8B 1UP5A 2BL0C 1CMFA 2MA2A 4M2OA 1DF0B 2AMIA 3C1VA 4C0KA 2MAZA 4OV2A 4PHNA 5AFPA 3HX4A 1DTLA 3DVKA 2L50A 2M9GA 1AK8A 4XJKB 4UPGA 2K0JA 2JRFA 1B7TY 1KK8C 1B9AA 4GAOA 2KAXA 2G9BA 2Y5IA 1XFUO 2WC8A 3EVRA 3BXKA 2PALA 2RGIA 4IL1A 3SG2A 3TUYC 3FWCA 1YVLA 1SL8A 1B8CA 1FI6A 4JQ0D 1UHHA 2D8NA 1M31A 3VROA 1CNPA 1NCZA 3GOFA 3PALA 1MHOA 2H2KA 1J7QA 1QIVA 1SKTA 3CR2A 1R2UA 2LV7A 3PM8A 1ALVA 1KSOA 3PLFB 3BUXB 2B1UA 3CR4X 4NDBA 1S6JA 2V53A 1TOPA 1XVJA 2LNKA 1K96A 2CNPA 2KFFA 2F8PA 1KFXS 1EL4A 1PALA 3LLEA 4BY4A 2MHHA 1LA3A 1H8BA 1NX2A 1QVIY 1EJ3A 1CTRA 3I5GC 2KYCA 3DF0B 2I94A 1AP4A 1A03A 3IQQA 4QJ5B 2BL0B 3I5FC 4ETOA 3D0YB 1WLMA 1OMDA 2CCMA 4NQGA 1MXLC 4PE0A 3K21A 4PDZA 1IRJA 2DOQA 1CLLA 2NCOA 2JTTA 5I2OA 3WNXB 2HETA 3KPXA 1Y1AA 3SG4A 2Q4UA 1W7IB 1OMRA 2KBMA 3OX5A 5IBWA 1NCXA 1RJVA 2JT3A 2LLUA 2LHLA 3CTNA 3GK4X 4USLA 1K9KA 4MZLA 3A4UB 1EH2A 1JF0A 1TCFA 4QJ3B 1AUIB 2JU0A 2LMUA 4MLWA 1K8UA 1ZOTB 2H61A 2KI4C 1CLBA 1QASA 2BBMA 1QVIZ 1NIWA 1K9PA 4D1EA 1JUOA 1SY9A 1WDCB 3WHUB 4GUKA 3EKHA 3AAJA 1DMOA 3WHTB 2JT8A 5I2QA 4CFRA 4M2QA 4C0JA 5D69A 3NSIA 1UHJA 1S36A 3CGAA 1OOJA 2MLFC 2KI6C 1BG1A 2L2EA 1TCOB 3I5GB 2PRUA 2JC2A 5DKRA 2LP3A 2BKIB 3BUOB 4PCWA 1QV1A 1LXFC 1CMGA 1NWDA 3I5FB 5AXIA 3FWBA 1K95A 2LAPA 1BU3A 1DGUA 1XFYO 3JVTC 1BT6A 1G4YR 1N0YA 2JZIA 1DGVA 1J1EA 2KYFA 4PE1A 4F0ZB 2ZFDA 1C07A 4A4CA 2EGDA 3SIAA 3NXAA 4M2PA 2K7CA 1V1FA 2R2IA 5I8NA 4CPVA 1YUTA 1RTP1 2L4IA 4GGFA 1MWNA 4C0LA 3LCPC 4OR9B 4AQJA 1Y1UA 1S5GZ 4YGBB 1K9UA 1DJWA 1PVBA 4ORCB 1FI5A 1PSBA 2JXLA 2LE9B 2M0RA 2K7DA 3BOWA 1QS7A 2KGRA 1OZSA 4ICBA 2FOTA 4TNCA 2EC6C 3NSLA 1PSRA 1CDLA 3JTDC 4I5LB 2KI4B 2M7LA 4BY5A 3D0YA 2F3YA 1M46A 1M63B 1L2OB 2M49B 4NDCA 2CTNA 2L5XB 1BR4B 1RWYA 3RLZA 2JPTA 3AKBA 4FTGA 2I7AA 2LMVA 1QATA 4GNKB 4Q04A 3EK8A 2JULA 1XFZO 1SCVA 3H4SE 1CM4A 1SR6C 2ZKMX 4OCIA 2M7NA 4YI8A 1R6PA 2A4JA 4GFTA 2GV5A 1BOCA 5CSJA 1BR1B 1F55A 1DJZA 2PSRA 1IJ5A 1SW8A 1QX7A 2K7BA 2PMYA 3HCMA 2NXQA 3JVTB 3NSKA 3BUNB 2M1KB 4DCKA 2BE6A 2BE4A 2Y1NA 5J3XA 4MZKA 5DKNA 1B8LA 1CFCA 1Q80A 1KCYA 1SK6D 2LP2A 1E8AA 1GJYA 1JFKA 1XK4A 2Q91A 3PN7C 1FBVA 1KQMC 1D1OA 2L51A 1XFVO 4YGCB 3AKAA 3TZ1A 5CSNA 2L4HA 2LVKA 4PALA 2LLTA 2OS8C 1PULA 2WOSA 4MEWA 1FW4A 3ZWHA 1IKUA 3SG6A 2G2BA 2EC6B 4GPLB 4MBEA 1A4PA 1UHKA 1J7OA 1K2HA 3JTDB 1A75B 3TDZA 2LMTA 1B7TZ 2JNXA 2LC5A 5BPJA 5JJGA 1U5IB 1YURA 4PHKA 2M97A 1V1GA 2P6BB 1S26D 2M8UA 4QJ4B 4YGDB 1K94A 2IS9A 1J55A 1C7VA 2LHIA 3NSOA 2BECA 1WY9A 2HPSA 3KHEA 1KK7Y 1NYAA 1WRKA 2K8MB 2LVIA 3FS7A 1KK8B 1SRAA 4HREE 1SR6B 2NLNA 3VGOA 1JWDA 1L7ZA 5GQQC 1GGWA 4CFQA 2MJWB 5AERA 1QIWA 3SG5A 2HF5A 3TUYB 2WNDA 3I5IC 1SL7A 2KI6D 4I5NB 1DJXA 1CDPA 1B8RA 1B47A 5HKYA 1LVCD 1Y6WA 1KQVA 1UURA 4N5XA 2QPTA 1NX1A 2NZ0A 2OPOA 5K89A 3DVMA 1DF0A 1A2XA 1YX7A 1BODA 1EXRA 2OTGC 2JTZA 3PN7B 1KQMB 4DUQA 3CR5X 1J7PA 4XJKA 4MRYA 1XA5A 2KAYA 2F3ZA 5HLVA 1DVIA 1MF8B 1OQPA 3TS5C 3O4YA 3D10A 3I5HC 5ER5A 2WCBA 1BMOA 2Y1MA 1SBJA 3DD4A 1YVHA 1OE9B 2O5GA 5AEQA 3PATA 3IQOA 1LINA 1F4QA 2QACA 1NX0A 5FYXA 1KFUS 1CB1A 4XYNA 1HT9A 2H61C 4HSZA 1KFUL 1TTXA 1NUBA 3BUWB 2E6WA 2TN4A 5HYDA 1OZOA 1YRUB 3EK7A 3MSEB 2BKHB 4PHMA 1DT7B 1QXPA 1OMVA 1TRFA 2BCAA 2KHNA 1S1EA 1SNLA 1TNXA 2EHBA 3RM1A 1YUSA 1F4OA 2KFHA 2K61A 4GGNA 2FCDA 4P5OE 3TDIA 2JNFA 2HQWA 1EG4A 1QTXA 3SIBA 1G8IA 3CWGA 1BJFA 3DF0A 2GGZA 2K7OA 2KQYA 3PFVA 1ZMZA 1WRLA 1IG5A 3VRNA 4CLNA 4YI9A 1CDNA 2MLEC 1AVSA 1Y1XA 2KGBC 1SL9A 2L98A 3E3RA 2OTGB 4OKHA 3CLNA 2SASA 5CPVA 1BF5A 4JPZB 3IF7A 3VRQA 3EKJA 3O78A 3VRPA 1C7WA 1TIZA 4PE4A 4ORBB 1CKKA 1FPWA 3AAKA 1XO5A 1B4CA 5HKZA 1SCMC 1AJ5A 1IJ6A 4WQ2A 4NDDA 4GGFC 1JFJA 1ZUZA 2WCFA 1TNQA 1NSHA 1TN4A 1MXEA 1QV0A 1VRKA 3PSRA 2KFGA 2F33A 5I2LA 2BCBA 5TNCA 3O6BA 3QRXA 1NCYA 3SG3A 2LVVA 3LK0A 4CIDA 1DJYA 2M29A 2CBLA 2GGMA 1FF1A 2WORA 1UHNA 1LA0A 1UHIA 1M45A 2WCEA 1KWOC 3TDUA 3OB2B 5ER4X 2F2OA 1S6CA 3F45A 1M39A 2K2AA 1JSAA 1B1GA 3O2PA 2ZRSA 5KSZA 1JBAA 1S6IA 1W7JB 2CT9A 4YGAA 1UUSA 3SJSA 1RROA 4YGEB 1QLSA 1WRZA 1A29A 4U8DA 4WRIA 3OHMB 4YRUA 1GGZA 4I5JA 1SPYA 1J1DA 1LKJA 3EVUA 1WLZA 3BYAA 5HLOA 2SCPA 1G33A 1H4BA 4N1FA 2BBNA 1WDCC 1TNPA 4A4BA 4PE7A 4HRHA 1IQ3A 1CDMA 1SCMB 1XK4C 4ORAB 5AANA 4DS7A 1IH0A 1OSAA 2NCPA 1NX3A 1IGVA 2ZNEA 2LUXA 1F54A 1UWOA 2M1UA 3OB1B 3ICBA 1DJGA 1PRWA 3WXAA 1KFXL 2O60A 4HRGA 2LUCA 3BOWB 2F2PA 1MR8A 1ODBA 1CLMA 1YTZC 4AQIA 3FIAA 2MRDA 1N65A 1YR5A 2K2FA 4MN0A 3EVVA 3BQ3A 2M3WA 2CXJA 2E30A 2KBIA 4GBAA 2KSPA 1KWOB 3DVJA 4PHJA 2KAVA 5D7FA 5CSIA 3CS1A 2JOJA 4AOMA 1SMGA 4DRWA 1IWQA 1QJTA 2HQ8A 4DIRA 1NP8A 3M0WA 4L9MA 1QLKA 2KOTA 3CZTX 2LM5A 1ZACA 2OS8B 3OP0A 2AAOA 1EG3A 3OX6A 1Y0VH 2FCEA 4MZJA 5CSFA 5HKWA 3A8RA 3GK2A 2JXCA 1MQ1A 1MUXA 1KK7Z 2PVBA 2VRGA 2ZNDA 2ZN8A
chains in the Genus database with same CATH superfamily
3BFAA 1AHRA 1F71A 1YRTB 1PK0D 1JF2A 1QWVA 2MBXA 1CM1A 2KDHA 3KEVA 1L2OC 5DKQA 1N2DA 1PVAA 2FJUB 1IQ5A 1S5GY 2ZN9A 2COLB 1BLQA 1TUJA 4E68A 1RFJA 3VRRA 1ORGA 1ALWA 3D77A 4ZCUA 3UO9A 2PASA 2L0PA 1YX8A 3LK1A 1QX2A 1KSMA 3OGNA 4WQ3A 5G08A 3RM1A 1CFPA 2WCMA 1XYDA 1K93D 1DC1A 1NPQA 2Y4QA 1RK9A 1DJHA 3DVEA 1GQMA 3CDNA 3I5IB 3L4AA 2ZRTA 3KO0A 1A75A 3S0EA 1SYMA 2LLSA 5PALA 1YUUA 1ZFSA 2JQ6A 4MRXA 4MSPA 4N1GA 3SG7A 2LVJA 1U5IA 2LCPA 5B8IB 2KQ6A 1XFXO 1CFFA 1K90D 1JC2A 2ISDA 1CFDA 2JT0A 3GK1A 1RECA 5KTYA 4FQOA 1DJIA 4I5KA 1TNWA 5KU1A 2AUCA 2I2RE 1XFWO 3EK4A 3BJHA 1S3PA 1J7RA 4P2YB 2JWWA 4MVFA 1F8HA 5JOLA 3ZNIA 1HQVA 3OBVA 3TS5B 1QX5B 4YBHB 3I5HB 2P70A 2KNEA 3KF9A 2LANA 1AJ4A 4R1EA 1F70A 1OOIX 2I18A 2BCXA 4JWQA 5D3OA 4ZCVA 4OVNF 5F6TA 5FI6A 4KYNA 1X02A 3BUMB 3LL8B 1UP5A 2BL0C 4IJ7A 1CMFA 2MA2A 4M2OA 1DF0B 3VB1A 2AMIA 3C1VA 4C0KA 2MAZA 4OV2A 4PHNA 4FQTA 5AFPA 1DELA 3HX4A 1DTLA 3DVKA 4OZDA 2L50A 2M9GA 5HL1A 4XJKB 1AK8A 4UPGA 2K0JA 2JRFA 1B7TY 1KK8C 1B9AA 4GAOA 2KAXA 2G9BA 2Y5IA 1XFUO 2WC8A 3EVRA 3BXKA 3O4XA 2PALA 2RGIA 4IL1A 3CZ0A 3SG2A 2QEVA 3TUYC 3FWCA 1YVLA 1SL8A 1B8CA 1FI6A 4JQ0D 1UHHA 2D8NA 1M31A 3VROA 1CNPA 1NCZA 3GOFA 3PALA 1MHOA 2H2KA 1J7QA 1QIVA 1SKTA 3CR2A 1R2UA 2FJYA 2LV7A 3PM8A 1ALVA 1KSOA 3PLFB 3BUXB 3SS5A 2B1UA 3CR4X 4NDBA 1S6JA 2V53A 1TOPA 1XVJA 2LNKA 1K96A 2PQLA 2CNPA 2KFFA 2F8PA 1KFXS 1EL4A 1PALA 3LLEA 2WCKA 4BY4A 2MHHA 1LA3A 1H8BA 1NX2A 1QVIY 1EJ3A 1CTRA 3I5GC 4JKTA 2KYCA 3DF0B 2KLEA 2I94A 1AP4A 1XFRA 3IQQA 4QJ5B 1A03A 2BL0B 3I5FC 4ETOA 3D0YB 1WLMA 1OMDA 2CCMA 4NQGA 1MXLC 4PE0A 3K21A 3PJIA 4PDZA 1IRJA 2DOQA 1CLLA 2NCOA 3NHTA 3CYZA 3NGVA 2JTTA 5I2OA 3WNXB 2HETA 3KPXA 1Y1AA 3N7HA 3SG4A 2Q4UA 1W7IB 1OMRA 2KBMA 3OX5A 5IBWA 1DQEA 1NCXA 1RJVA 3S0GA 2JT3A 2LLUA 2LHLA 3CTNA 3GK4X 4USLA 1K9KA 2QEBA 4MZLA 3A4UB 1EH2A 1JF0A 1TCFA 4QJ3B 1AUIB 2JU0A 2LMUA 4MLWA 1K8UA 1ZOTB 2H61A 2KI4C 1CLBA 1QASA 2BBMA 1QVIZ 1NIWA 1K9PA 4D1EA 1JUOA 1SY9A 1WDCB 3WHUB 4GUKA 3SS4A 3EKHA 3AAJA 3CZ1A 1DMOA 3WHTB 2JT8A 5I2QA 4CFRA 4M2QA 4C0JA 5D69A 3NSIA 1UHJA 1S36A 3CGAA 1OOJA 2MLFC 2KI6C 1BG1A 2L2EA 1TCOB 3I5GB 2PRUA 2JC2A 3CZ2A 2LP3A 5DKRA 2BKIB 3BUOB 4PCWA 3K1EA 1QV1A 1LXFC 1CMGA 1Z2CB 1NWDA 3I5FB 5AXIA 3FWBA 1K95A 2LAPA 1BU3A 1DGUA 1XFYO 3JVTC 1BT6A 1G4YR 1N0YA 1TUZA 2JZIA 1DGVA 1J1EA 2KYFA 4PE1A 4F0ZB 2ZFDA 1C07A 4A4CA 2EGDA 3SIAA 3NXAA 4M2PA 2K7CA 1V1FA 2ERBA 2R2IA 5I8NA 4CPVA 1YUTA 1RTP1 2L4IA 4GGFA 1MWNA 4C0LA 3LCPC 4OR9B 4AQJA 1Y1UA 1S5GZ 4YGBB 1K9UA 1DJWA 1PVBA 4ORCB 1FI5A 1PSBA 2JXLA 2LE9B 2M0RA 2K7DA 3BOWA 1QS7A 2KGRA 1OZSA 4ICBA 2FOTA 4TNCA 2EC6C 3NSLA 1PSRA 1CDLA 3JTDC 4I5LB 2KI4B 2M7LA 4BY5A 3D0YA 2F3YA 1M46A 3DYEA 1M63B 3FE9A 1L2OB 2M49B 4NDCA 2L5YA 2CTNA 2L5XB 1BR4B 1OOGA 1RWYA 3RLZA 2JPTA 3AKBA 4FTGA 2I7AA 2WC5A 3FE6A 2LMVA 1QATA 4GNKB 4Q04A 3EK8A 2JULA 3B88A 1XFZO 1SCVA 3H4SE 1CM4A 1SR6C 2ZKMX 3D74A 4OCIA 2M7NA 4YI8A 1R6PA 2A4JA 4GFTA 2GV5A 1BOCA 5CSJA 1BR1B 1F55A 1DJZA 2PSRA 1IJ5A 1SW8A 1QX7A 2K7BA 2PMYA 3HCMA 2NXQA 3JVTB 2JPOA 3BUNB 2M1KB 3NSKA 4DCKA 2BE6A 2BE4A 1C3ZA 2Y1NA 5J3XA 4MZKA 3EG5B 3S0DA 5DKNA 1B8LA 1CFCA 1Q80A 1KCYA 1SK6D 2LP2A 3IVTA 1E8AA 1GJYA 3S0FA 1JFKA 1XK4A 2Q91A 3PN7C 1FBVA 1KQMC 1D1OA 1DEKA 2BNXA 2L51A 1T14A 1XFVO 4YGCB 2QEHA 3AKAA 3TZ1A 3B86A 5CSNA 2L4HA 2LVKA 4PALA 2LLTA 2OS8C 1PULA 2WOSA 4MEWA 1FW4A 3ZWHA 1IKUA 3SG6A 2G2BA 2EC6B 4GPLB 4MBEA 1A4PA 1UHKA 1J7OA 1K2HA 3UNWA 3JTDB 3V2LA 1A75B 3TDZA 2LMTA 1B7TZ 2JNXA 2LC5A 3DXLA 1IIOA 5BPJA 5JJGA 1LS8A 3B7AA 3D73A 3DY9A 1U5IB 1YURA 4PHKA 2M97A 1V1GA 2P6BB 1S26D 2M8UA 4QJ4B 4YGDB 1K94A 2IS9A 1J55A 1C7VA 2LHIA 2YGUA 3PM2A 3NSOA 2BECA 1WY9A 2HPSA 3KHEA 1KK7Y 1NYAA 1WRKA 2K8MB 2LVIA 3B6XA 1KK8B 1SRAA 3FS7A 1SR6B 2NLNA 2P71A 4HREE 3VGOA 1JWDA 1L7ZA 5GQQC 1GGWA 3R1PA 3R1VA 4CFQA 2MJWB 5AERA 1QIWA 3SG5A 2L2CA 2HF5A 3TUYB 2WNDA 3I5IC 1SL7A 2KI6D 4I5NB 1DJXA 1CDPA 1B8RA 1B47A 4F7FA 5HKYA 1LVCD 1Y6WA 1KQVA 1UURA 4N5XA 2QPTA 1NX1A 2NZ0A 2OPOA 5K89A 3DVMA 1DF0A 1A2XA 3D78A 1YX7A 1BODA 1EXRA 2OTGC 2JTZA 3PN7B 1KQMB 4DUQA 3CR5X 5I94A 1J7PA 4XJKA 4MRYA 1XA5A 2KAYA 1W9ZA 2F3ZA 5HLVA 1DVIA 2KPHA 1MF8B 1OQPA 3TS5C 3O4YA 3D10A 3I5HC 2PYQA 5ER5A 2WCBA 1BMOA 2Y1MA 1SBJA 3DD4A 1YVHA 1OE9B 2O5GA 5AEQA 3PATA 2H8VA 3IQOA 3Q8IA 1LINA 1F4QA 2QACA 1NX0A 5FYXA 1KFUS 1CB1A 4XYNA 1HT9A 2H61C 4HSZA 1KFUL 1TTXA 4INXA 1NUBA 3BUWB 1OOHA 2E6WA 3SS3A 2TN4A 5HYDA 2K60A 2WCLA 1OZOA 1YRUB 3EK7A 3MSEB 2BKHB 4PHMA 1DT7B 1QXPA 1OMVA 4JD9A 1TRFA 2BCAA 2KHNA 1S1EA 1OOFA 1SNLA 1TNXA 2EHBA 3D76A 1YUSA 1F4OA 2KFHA 2K61A 4GGNA 2FCDA 4P5OE 3TDIA 2JNFA 2HQWA 1EG4A 1QTXA 3SIBA 1G8IA 3CWGA 1BJFA 3DF0A 2GGZA 2K7OA 2KQYA 3PFVA 1ZMZA 1WRLA 1IG5A 3VRNA 1OW4A 4CLNA 4YI9A 1CDNA 2MLEC 1AVSA 1Y1XA 2KGBC 1SL9A 2L98A 3E3RA 2OTGB 2GTEA 4OKHA 3CLNA 2SASA 5CPVA 1BF5A 4JPZB 3IF7A 3VRQA 3EKJA 3O78A 3VRPA 1C7WA 1TIZA 4PE4A 5FI7A 1Z4HA 4ORBB 1CKKA 1FPWA 3AAKA 3L47A 1XO5A 1B4CA 5HKZA 1SCMC 1TWOA 1AJ5A 1IJ6A 4WQ2A 4NDDA 4GGFC 1JFJA 1ZUZA 2WCFA 1TNQA 1NSHA 1GM0A 1TN4A 1MXEA 1QV0A 1VRKA 3PSRA 2BAPA 2KFGA 2F33A 5I2LA 2BCBA 5FI2A 5TNCA 3O6BA 3QRXA 1NCYA 5DICA 2LVVA 2QEOA 3DZTA 3LK0A 3SG3A 1DJYA 2M29A 4CIDA 2CBLA 2GGMA 3NHIA 1C3YA 1FF1A 2WORA 1UHNA 1LA0A 3FE8A 1SSEB 1UHIA 1M45A 2WCEA 1KWOC 3TDUA 4PT1A 3OB2B 5ER4X 2F2OA 1S6CA 3F45A 3BFBA 3QMEA 1M39A 2K2AA 1JSAA 1B1GA 3O2PA 2ZRSA 5KSZA 1JBAA 1S6IA 1W7JB 2CT9A 4YGAA 1UUSA 3SJSA 1RROA 4YGEB 1QLSA 1WRZA 1A29A 4U8DA 4WRIA 3OHMB 4YRUA 3B87A 1GGZA 4I5JA 3S0AA 5EL2A 1SPYA 3BFHA 1J1DA 1LKJA 3CABA 1WLZA 3BYAA 3EVUA 2SCPA 5HLOA 1G33A 3D75A 1H4BA 4N1FA 2BBNA 1WDCC 1TNPA 4A4BA 4PE7A 4HRHA 1IQ3A 1CDMA 1SCMB 1XK4C 4ORAB 5AANA 4DS7A 1IH0A 1P28A 1OSAA 2NCPA 1NX3A 1IGVA 2ZNEA 2LUXA 1F54A 1UWOA 2M1UA 3OB1B 3ICBA 1DJGA 1PRWA 3WXAA 1KFXL 2O60A 4HRGA 2LUCA 3BOWB 3RZSA 2QDIA 2F2PA 1MR8A 1ODBA 1CLMA 1YTZC 4AQIA 3FIAA 3R72A 2MRDA 2WCJA 1N65A 1YR5A 2K2FA 4MN0A 3S0BA 3EVVA 3BQ3A 2M3WA 2WCHA 4INWA 3R1OA 2CXJA 2E30A 2KBIA 4GBAA 2KSPA 1KWOB 3DVJA 3L4LA 4PHJA 2KAVA 5D7FA 5CSIA 3CS1A 2JOJA 4AOMA 1SMGA 4DRWA 1IWQA 1QJTA 2HQ8A 4DIRA 1NP8A 3M0WA 4L9MA 1QLKA 2KOTA 3CZTX 2LM5A 1ZACA 2OS8B 3OP0A 2AAOA 1EG3A 3OX6A 1Y0VH 2FCEA 2WC6A 4MZJA 2KLDA 5CSFA 5HKWA 3A8RA 3GK2A 2JXCA 1MQ1A 1MUXA 1KK7Z 2PVBA 2VRGA 2ZNDA 2ZN8A
chains in the Genus database with same CATH topology
1AHRA 1F71A 1YRTB 1PK0D 1JF2A 2MBXA 1CM1A 2KDHA 3KEVA 1L2OC 5DKQA 1N2DA 1PVAA 2FJUB 1IQ5A 1S5GY 2ZN9A 2COLB 1BLQA 4E68A 1RFJA 3VRRA 1ALWA 4ZCUA 2PASA 2L0PA 1YX8A 3LK1A 1QX2A 1KSMA 4WQ3A 5G08A 1CFPA 1XYDA 1K93D 1NPQA 2Y4QA 1RK9A 1DJHA 3DVEA 1GQMA 3I5IB 2ZRTA 3KO0A 1A75A 1SYMA 2LLSA 5PALA 1YUUA 1ZFSA 2JQ6A 4MRXA 4MSPA 4N1GA 3SG7A 2LVJA 1U5IA 2LCPA 5B8IB 2KQ6A 1XFXO 1CFFA 1K90D 1JC2A 2ISDA 1CFDA 2JT0A 3GK1A 1RECA 5KTYA 4FQOA 1DJIA 4I5KA 1TNWA 5KU1A 2AUCA 2I2RE 1XFWO 3EK4A 1S3PA 1J7RA 4P2YB 2JWWA 4MVFA 1F8HA 5JOLA 3ZNIA 1HQVA 3TS5B 1QX5B 4YBHB 3I5HB 2KNEA 3KF9A 2LANA 1AJ4A 4R1EA 1F70A 2I18A 2BCXA 4JWQA 4ZCVA 4OVNF 5F6TA 1X02A 3BUMB 3LL8B 1UP5A 2BL0C 1CMFA 2MA2A 4M2OA 1DF0B 2AMIA 3C1VA 4C0KA 2MAZA 4OV2A 4PHNA 5AFPA 3HX4A 1DTLA 3DVKA 2L50A 2M9GA 1AK8A 4XJKB 4UPGA 2K0JA 2JRFA 1B7TY 1KK8C 1B9AA 4GAOA 2KAXA 2G9BA 2Y5IA 1XFUO 2WC8A 3EVRA 3BXKA 2PALA 2RGIA 4IL1A 3SG2A 3TUYC 3FWCA 1YVLA 1SL8A 1B8CA 1FI6A 4JQ0D 1UHHA 2D8NA 1M31A 3VROA 1CNPA 1NCZA 3GOFA 3PALA 1MHOA 2H2KA 1J7QA 1QIVA 1SKTA 3CR2A 1R2UA 2LV7A 3PM8A 1ALVA 1KSOA 3PLFB 3BUXB 2B1UA 3CR4X 4NDBA 1S6JA 2V53A 1TOPA 1XVJA 2LNKA 1K96A 2CNPA 2KFFA 2F8PA 1KFXS 1EL4A 1PALA 3LLEA 4BY4A 2MHHA 1LA3A 1H8BA 1NX2A 1QVIY 1EJ3A 1CTRA 3I5GC 2KYCA 3DF0B 2I94A 1AP4A 1A03A 3IQQA 4QJ5B 2BL0B 3I5FC 4ETOA 3D0YB 1WLMA 1OMDA 2CCMA 4NQGA 1MXLC 4PE0A 3K21A 4PDZA 1IRJA 2DOQA 1CLLA 2NCOA 2JTTA 5I2OA 3WNXB 2HETA 3KPXA 1Y1AA 3SG4A 2Q4UA 1W7IB 1OMRA 2KBMA 3OX5A 5IBWA 1NCXA 1RJVA 2JT3A 2LLUA 2LHLA 3CTNA 3GK4X 4USLA 1K9KA 4MZLA 3A4UB 1EH2A 1JF0A 1TCFA 4QJ3B 1AUIB 2JU0A 2LMUA 4MLWA 1K8UA 1ZOTB 2H61A 2KI4C 1CLBA 1QASA 2BBMA 1QVIZ 1NIWA 1K9PA 4D1EA 1JUOA 1SY9A 1WDCB 3WHUB 4GUKA 3EKHA 3AAJA 1DMOA 3WHTB 2JT8A 5I2QA 4CFRA 4M2QA 4C0JA 5D69A 3NSIA 1UHJA 1S36A 3CGAA 1OOJA 2MLFC 2KI6C 1BG1A 2L2EA 1TCOB 3I5GB 2PRUA 2JC2A 5DKRA 2LP3A 2BKIB 3BUOB 4PCWA 1QV1A 1LXFC 1CMGA 1NWDA 3I5FB 5AXIA 3FWBA 1K95A 2LAPA 1BU3A 1DGUA 1XFYO 3JVTC 1BT6A 1G4YR 1N0YA 2JZIA 1DGVA 1J1EA 2KYFA 4PE1A 4F0ZB 2ZFDA 1C07A 4A4CA 2EGDA 3SIAA 3NXAA 4M2PA 2K7CA 1V1FA 2R2IA 5I8NA 4CPVA 1YUTA 1RTP1 2L4IA 4GGFA 1MWNA 4C0LA 3LCPC 4OR9B 4AQJA 1Y1UA 1S5GZ 4YGBB 1K9UA 1DJWA 1PVBA 4ORCB 1FI5A 1PSBA 2JXLA 2LE9B 2M0RA 2K7DA 3BOWA 1QS7A 2KGRA 1OZSA 4ICBA 2FOTA 4TNCA 2EC6C 3NSLA 1PSRA 1CDLA 3JTDC 4I5LB 2KI4B 2M7LA 4BY5A 3D0YA 2F3YA 1M46A 1M63B 1L2OB 2M49B 4NDCA 2CTNA 2L5XB 1BR4B 1RWYA 3RLZA 2JPTA 3AKBA 4FTGA 2I7AA 2LMVA 1QATA 4GNKB 4Q04A 3EK8A 2JULA 1XFZO 1SCVA 3H4SE 1CM4A 1SR6C 2ZKMX 4OCIA 2M7NA 4YI8A 1R6PA 2A4JA 4GFTA 2GV5A 1BOCA 5CSJA 1BR1B 1F55A 1DJZA 2PSRA 1IJ5A 1SW8A 1QX7A 2K7BA 2PMYA 3HCMA 2NXQA 3JVTB 3NSKA 3BUNB 2M1KB 4DCKA 2BE6A 2BE4A 2Y1NA 5J3XA 4MZKA 5DKNA 1B8LA 1CFCA 1Q80A 1KCYA 1SK6D 2LP2A 1E8AA 1GJYA 1JFKA 1XK4A 2Q91A 3PN7C 1FBVA 1KQMC 1D1OA 2L51A 1XFVO 4YGCB 3AKAA 3TZ1A 5CSNA 2L4HA 2LVKA 4PALA 2LLTA 2OS8C 1PULA 2WOSA 4MEWA 1FW4A 3ZWHA 1IKUA 3SG6A 2G2BA 2EC6B 4GPLB 4MBEA 1A4PA 1UHKA 1J7OA 1K2HA 3JTDB 1A75B 3TDZA 2LMTA 1B7TZ 2JNXA 2LC5A 5BPJA 5JJGA 1U5IB 1YURA 4PHKA 2M97A 1V1GA 2P6BB 1S26D 2M8UA 4QJ4B 4YGDB 1K94A 2IS9A 1J55A 1C7VA 2LHIA 3NSOA 2BECA 1WY9A 2HPSA 3KHEA 1KK7Y 1NYAA 1WRKA 2K8MB 2LVIA 3FS7A 1KK8B 1SRAA 4HREE 1SR6B 2NLNA 3VGOA 1JWDA 1L7ZA 5GQQC 1GGWA 4CFQA 2MJWB 5AERA 1QIWA 3SG5A 2HF5A 3TUYB 2WNDA 3I5IC 1SL7A 2KI6D 4I5NB 1DJXA 1CDPA 1B8RA 1B47A 5HKYA 1LVCD 1Y6WA 1KQVA 1UURA 4N5XA 2QPTA 1NX1A 2NZ0A 2OPOA 5K89A 3DVMA 1DF0A 1A2XA 1YX7A 1BODA 1EXRA 2OTGC 2JTZA 3PN7B 1KQMB 4DUQA 3CR5X 1J7PA 4XJKA 4MRYA 1XA5A 2KAYA 2F3ZA 5HLVA 1DVIA 1MF8B 1OQPA 3TS5C 3O4YA 3D10A 3I5HC 5ER5A 2WCBA 1BMOA 2Y1MA 1SBJA 3DD4A 1YVHA 1OE9B 2O5GA 5AEQA 3PATA 3IQOA 1LINA 1F4QA 2QACA 1NX0A 5FYXA 1KFUS 1CB1A 4XYNA 1HT9A 2H61C 4HSZA 1KFUL 1TTXA 1NUBA 3BUWB 2E6WA 2TN4A 5HYDA 1OZOA 1YRUB 3EK7A 3MSEB 2BKHB 4PHMA 1DT7B 1QXPA 1OMVA 1TRFA 2BCAA 2KHNA 1S1EA 1SNLA 1TNXA 2EHBA 3RM1A 1YUSA 1F4OA 2KFHA 2K61A 4GGNA 2FCDA 4P5OE 3TDIA 2JNFA 2HQWA 1EG4A 1QTXA 3SIBA 1G8IA 3CWGA 1BJFA 3DF0A 2GGZA 2K7OA 2KQYA 3PFVA 1ZMZA 1WRLA 1IG5A 3VRNA 4CLNA 4YI9A 1CDNA 2MLEC 1AVSA 1Y1XA 2KGBC 1SL9A 2L98A 3E3RA 2OTGB 4OKHA 3CLNA 2SASA 5CPVA 1BF5A 4JPZB 3IF7A 3VRQA 3EKJA 3O78A 3VRPA 1C7WA 1TIZA 4PE4A 4ORBB 1CKKA 1FPWA 3AAKA 1XO5A 1B4CA 5HKZA 1SCMC 1AJ5A 1IJ6A 4WQ2A 4NDDA 4GGFC 1JFJA 1ZUZA 2WCFA 1TNQA 1NSHA 1TN4A 1MXEA 1QV0A 1VRKA 3PSRA 2KFGA 2F33A 5I2LA 2BCBA 5TNCA 3O6BA 3QRXA 1NCYA 3SG3A 2LVVA 3LK0A 4CIDA 1DJYA 2M29A 2CBLA 2GGMA 1FF1A 2WORA 1UHNA 1LA0A 1UHIA 1M45A 2WCEA 1KWOC 3TDUA 3OB2B 5ER4X 2F2OA 1S6CA 3F45A 1M39A 2K2AA 1JSAA 1B1GA 3O2PA 2ZRSA 5KSZA 1JBAA 1S6IA 1W7JB 2CT9A 4YGAA 1UUSA 3SJSA 1RROA 4YGEB 1QLSA 1WRZA 1A29A 4U8DA 4WRIA 3OHMB 4YRUA 1GGZA 4I5JA 1SPYA 1J1DA 1LKJA 3EVUA 1WLZA 3BYAA 5HLOA 2SCPA 1G33A 1H4BA 4N1FA 2BBNA 1WDCC 1TNPA 4A4BA 4PE7A 4HRHA 1IQ3A 1CDMA 1SCMB 1XK4C 4ORAB 5AANA 4DS7A 1IH0A 1OSAA 2NCPA 1NX3A 1IGVA 2ZNEA 2LUXA 1F54A 1UWOA 2M1UA 3OB1B 3ICBA 1DJGA 1PRWA 3WXAA 1KFXL 2O60A 4HRGA 2LUCA 3BOWB 2F2PA 1MR8A 1ODBA 1CLMA 1YTZC 4AQIA 3FIAA 2MRDA 1N65A 1YR5A 2K2FA 4MN0A 3EVVA 3BQ3A 2M3WA 2CXJA 2E30A 2KBIA 4GBAA 2KSPA 1KWOB 3DVJA 4PHJA 2KAVA 5D7FA 5CSIA 3CS1A 2JOJA 4AOMA 1SMGA 4DRWA 1IWQA 1QJTA 2HQ8A 4DIRA 1NP8A 3M0WA 4L9MA 1QLKA 2KOTA 3CZTX 2LM5A 1ZACA 2OS8B 3OP0A 2AAOA 1EG3A 3OX6A 1Y0VH 2FCEA 4MZJA 5CSFA 5HKWA 3A8RA 3GK2A 2JXCA 1MQ1A 1MUXA 1KK7Z 2PVBA 2VRGA 2ZNDA 2ZN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHR A;  1F71 A;  1YRT B;  1PK0 D;  1JF2 A;  2MBX A;  1CM1 A;  2KDH A;  3KEV A;  1L2O C;  5DKQ A;  1N2D A;  1PVA A;  2FJU B;  1IQ5 A;  1S5G Y;  2ZN9 A;  2COL B;  1BLQ A;  4E68 A;  1RFJ A;  3VRR A;  1ALW A;  4ZCU A;  2PAS A;  2L0P A;  1YX8 A;  3LK1 A;  1QX2 A;  1KSM A;  4WQ3 A;  5G08 A;  1CFP A;  1XYD A;  1K93 D;  1NPQ A;  2Y4Q A;  1RK9 A;  1DJH A;  3DVE A;  1GQM A;  3I5I B;  2ZRT A;  3KO0 A;  1A75 A;  1SYM A;  2LLS A;  5PAL A;  1YUU A;  1ZFS A;  2JQ6 A;  4MRX A;  4MSP A;  4N1G A;  3SG7 A;  2LVJ A;  1U5I A;  2LCP A;  5B8I B;  2KQ6 A;  1XFX O;  1CFF A;  1K90 D;  1JC2 A;  2ISD A;  1CFD A;  2JT0 A;  3GK1 A;  1REC A;  5KTY A;  4FQO A;  1DJI A;  4I5K A;  1TNW A;  5KU1 A;  2AUC A;  2I2R E;  1XFW O;  3EK4 A;  1S3P A;  1J7R A;  4P2Y B;  2JWW A;  4MVF A;  1F8H A;  5JOL A;  3ZNI A;  1HQV A;  3TS5 B;  1QX5 B;  4YBH B;  3I5H B;  2KNE A;  3KF9 A;  2LAN A;  1AJ4 A;  4R1E A;  1F70 A;  2I18 A;  2BCX A;  4JWQ A;  4ZCV A;  4OVN F;  5F6T A;  1X02 A;  3BUM B;  3LL8 B;  1UP5 A;  2BL0 C;  1CMF A;  2MA2 A;  4M2O A;  1DF0 B;  2AMI A;  3C1V A;  4C0K A;  2MAZ A;  4OV2 A;  4PHN A;  5AFP A;  3HX4 A;  1DTL A;  3DVK A;  2L50 A;  2M9G A;  1AK8 A;  4XJK B;  4UPG A;  2K0J A;  2JRF A;  1B7T Y;  1KK8 C;  1B9A A;  4GAO A;  2KAX A;  2G9B A;  2Y5I A;  1XFU O;  2WC8 A;  3EVR A;  3BXK A;  2PAL A;  2RGI A;  4IL1 A;  3SG2 A;  3TUY C;  3FWC A;  1YVL A;  1SL8 A;  1B8C A;  1FI6 A;  4JQ0 D;  1UHH A;  2D8N A;  1M31 A;  3VRO A;  1CNP A;  1NCZ A;  3GOF A;  3PAL A;  1MHO A;  2H2K A;  1J7Q A;  1QIV A;  1SKT A;  3CR2 A;  1R2U A;  2LV7 A;  3PM8 A;  1ALV A;  1KSO A;  3PLF B;  3BUX B;  2B1U A;  3CR4 X;  4NDB A;  1S6J A;  2V53 A;  1TOP A;  1XVJ A;  2LNK A;  1K96 A;  2CNP A;  2KFF A;  2F8P A;  1KFX S;  1EL4 A;  1PAL A;  3LLE A;  4BY4 A;  2MHH A;  1LA3 A;  1H8B A;  1NX2 A;  1QVI Y;  1EJ3 A;  1CTR A;  3I5G C;  2KYC A;  3DF0 B;  2I94 A;  1AP4 A;  1A03 A;  3IQQ A;  4QJ5 B;  2BL0 B;  3I5F C;  4ETO A;  3D0Y B;  1WLM A;  1OMD A;  2CCM A;  4NQG A;  1MXL C;  4PE0 A;  3K21 A;  4PDZ A;  1IRJ A;  2DOQ A;  1CLL A;  2NCO A;  2JTT A;  5I2O A;  3WNX B;  2HET A;  3KPX A;  1Y1A A;  3SG4 A;  2Q4U A;  1W7I B;  1OMR A;  2KBM A;  3OX5 A;  5IBW A;  1NCX A;  1RJV A;  2JT3 A;  2LLU A;  2LHL A;  3CTN A;  3GK4 X;  4USL A;  1K9K A;  4MZL A;  3A4U B;  1EH2 A;  1JF0 A;  1TCF A;  4QJ3 B;  1AUI B;  2JU0 A;  2LMU A;  4MLW A;  1K8U A;  1ZOT B;  2H61 A;  2KI4 C;  1CLB A;  1QAS A;  2BBM A;  1QVI Z;  1NIW A;  1K9P A;  4D1E A;  1JUO A;  1SY9 A;  1WDC B;  3WHU B;  4GUK A;  3EKH A;  3AAJ A;  1DMO A;  3WHT B;  2JT8 A;  5I2Q A;  4CFR A;  4M2Q A;  4C0J A;  5D69 A;  3NSI A;  1UHJ A;  1S36 A;  3CGA A;  1OOJ A;  2MLF C;  2KI6 C;  1BG1 A;  2L2E A;  1TCO B;  3I5G B;  2PRU A;  2JC2 A;  5DKR A;  2LP3 A;  2BKI B;  3BUO B;  4PCW A;  1QV1 A;  1LXF C;  1CMG A;  1NWD A;  3I5F B;  5AXI A;  3FWB A;  1K95 A;  2LAP A;  1BU3 A;  1DGU A;  1XFY O;  3JVT C;  1BT6 A;  1G4Y R;  1N0Y A;  2JZI A;  1DGV A;  1J1E A;  2KYF A;  4PE1 A;  4F0Z B;  2ZFD A;  1C07 A;  4A4C A;  2EGD A;  3SIA A;  3NXA A;  4M2P A;  2K7C A;  1V1F A;  2R2I A;  5I8N A;  4CPV A;  1YUT A;  1RTP 1;  2L4I A;  4GGF A;  1MWN A;  4C0L A;  3LCP C;  4OR9 B;  4AQJ A;  1Y1U A;  1S5G Z;  4YGB B;  1K9U A;  1DJW A;  1PVB A;  4ORC B;  1FI5 A;  1PSB A;  2JXL A;  2LE9 B;  2M0R A;  2K7D A;  3BOW A;  1QS7 A;  2KGR A;  1OZS A;  4ICB A;  2FOT A;  4TNC A;  2EC6 C;  3NSL A;  1PSR A;  1CDL A;  3JTD C;  4I5L B;  2KI4 B;  2M7L A;  4BY5 A;  3D0Y A;  2F3Y A;  1M46 A;  1M63 B;  1L2O B;  2M49 B;  4NDC A;  2CTN A;  2L5X B;  1BR4 B;  1RWY A;  3RLZ A;  2JPT A;  3AKB A;  4FTG A;  2I7A A;  2LMV A;  1QAT A;  4GNK B;  4Q04 A;  3EK8 A;  2JUL A;  1XFZ O;  1SCV A;  3H4S E;  1CM4 A;  1SR6 C;  2ZKM X;  4OCI A;  2M7N A;  4YI8 A;  1R6P A;  2A4J A;  4GFT A;  2GV5 A;  1BOC A;  5CSJ A;  1BR1 B;  1F55 A;  1DJZ A;  2PSR A;  1IJ5 A;  1SW8 A;  1QX7 A;  2K7B A;  2PMY A;  3HCM A;  2NXQ A;  3JVT B;  3NSK A;  3BUN B;  2M1K B;  4DCK A;  2BE6 A;  2BE4 A;  2Y1N A;  5J3X A;  4MZK A;  5DKN A;  1B8L A;  1CFC A;  1Q80 A;  1KCY A;  1SK6 D;  2LP2 A;  1E8A A;  1GJY A;  1JFK A;  1XK4 A;  2Q91 A;  3PN7 C;  1FBV A;  1KQM C;  1D1O A;  2L51 A;  1XFV O;  4YGC B;  3AKA A;  3TZ1 A;  5CSN A;  2L4H A;  2LVK A;  4PAL A;  2LLT A;  2OS8 C;  1PUL A;  2WOS A;  4MEW A;  1FW4 A;  3ZWH A;  1IKU A;  3SG6 A;  2G2B A;  2EC6 B;  4GPL B;  4MBE A;  1A4P A;  1UHK A;  1J7O A;  1K2H A;  3JTD B;  1A75 B;  3TDZ A;  2LMT A;  1B7T Z;  2JNX A;  2LC5 A;  5BPJ A;  5JJG A;  1U5I B;  1YUR A;  4PHK A;  2M97 A;  1V1G A;  2P6B B;  1S26 D;  2M8U A;  4QJ4 B;  4YGD B;  1K94 A;  2IS9 A;  1J55 A;  1C7V A;  2LHI A;  3NSO A;  2BEC A;  1WY9 A;  2HPS A;  3KHE A;  1KK7 Y;  1NYA A;  1WRK A;  2K8M B;  2LVI A;  3FS7 A;  1KK8 B;  1SRA A;  4HRE E;  1SR6 B;  2NLN A;  3VGO A;  1JWD A;  1L7Z A;  5GQQ C;  1GGW A;  4CFQ A;  2MJW B;  5AER A;  1QIW A;  3SG5 A;  2HF5 A;  3TUY B;  2WND A;  3I5I C;  1SL7 A;  2KI6 D;  4I5N B;  1DJX A;  1CDP A;  1B8R A;  1B47 A;  5HKY A;  1LVC D;  1Y6W A;  1KQV A;  1UUR A;  4N5X A;  2QPT A;  1NX1 A;  2NZ0 A;  2OPO A;  5K89 A;  3DVM A;  1DF0 A;  1A2X A;  1YX7 A;  1BOD A;  1EXR A;  2OTG C;  2JTZ A;  3PN7 B;  1KQM B;  4DUQ A;  3CR5 X;  1J7P A;  4XJK A;  4MRY A;  1XA5 A;  2KAY A;  2F3Z A;  5HLV A;  1DVI A;  1MF8 B;  1OQP A;  3TS5 C;  3O4Y A;  3D10 A;  3I5H C;  5ER5 A;  2WCB A;  1BMO A;  2Y1M A;  1SBJ A;  3DD4 A;  1YVH A;  1OE9 B;  2O5G A;  5AEQ A;  3PAT A;  3IQO A;  1LIN A;  1F4Q A;  2QAC A;  1NX0 A;  5FYX A;  1KFU S;  1CB1 A;  4XYN A;  1HT9 A;  2H61 C;  4HSZ A;  1KFU L;  1TTX A;  1NUB A;  3BUW B;  2E6W A;  2TN4 A;  5HYD A;  1OZO A;  1YRU B;  3EK7 A;  3MSE B;  2BKH B;  4PHM A;  1DT7 B;  1QXP A;  1OMV A;  1TRF A;  2BCA A;  2KHN A;  1S1E A;  1SNL A;  1TNX A;  2EHB A;  3RM1 A;  1YUS A;  1F4O A;  2KFH A;  2K61 A;  4GGN A;  2FCD A;  4P5O E;  3TDI A;  2JNF A;  2HQW A;  1EG4 A;  1QTX A;  3SIB A;  1G8I A;  3CWG A;  1BJF A;  3DF0 A;  2GGZ A;  2K7O A;  2KQY A;  3PFV A;  1ZMZ A;  1WRL A;  1IG5 A;  3VRN A;  4CLN A;  4YI9 A;  1CDN A;  2MLE C;  1AVS A;  1Y1X A;  2KGB C;  1SL9 A;  2L98 A;  3E3R A;  2OTG B;  4OKH A;  3CLN A;  2SAS A;  5CPV A;  1BF5 A;  4JPZ B;  3IF7 A;  3VRQ A;  3EKJ A;  3O78 A;  3VRP A;  1C7W A;  1TIZ A;  4PE4 A;  4ORB B;  1CKK A;  1FPW A;  3AAK A;  1XO5 A;  1B4C A;  5HKZ A;  1SCM C;  1AJ5 A;  1IJ6 A;  4WQ2 A;  4NDD A;  4GGF C;  1JFJ A;  1ZUZ A;  2WCF A;  1TNQ A;  1NSH A;  1TN4 A;  1MXE A;  1QV0 A;  1VRK A;  3PSR A;  2KFG A;  2F33 A;  5I2L A;  2BCB A;  5TNC A;  3O6B A;  3QRX A;  1NCY A;  3SG3 A;  2LVV A;  3LK0 A;  4CID A;  1DJY A;  2M29 A;  2CBL A;  2GGM A;  1FF1 A;  2WOR A;  1UHN A;  1LA0 A;  1UHI A;  1M45 A;  2WCE A;  1KWO C;  3TDU A;  3OB2 B;  5ER4 X;  2F2O A;  1S6C A;  3F45 A;  1M39 A;  2K2A A;  1JSA A;  1B1G A;  3O2P A;  2ZRS A;  5KSZ A;  1JBA A;  1S6I A;  1W7J B;  2CT9 A;  4YGA A;  1UUS A;  3SJS A;  1RRO A;  4YGE B;  1QLS A;  1WRZ A;  1A29 A;  4U8D A;  4WRI A;  3OHM B;  4YRU A;  1GGZ A;  4I5J A;  1SPY A;  1J1D A;  1LKJ A;  3EVU A;  1WLZ A;  3BYA A;  5HLO A;  2SCP A;  1G33 A;  1H4B A;  4N1F A;  2BBN A;  1WDC C;  1TNP A;  4A4B A;  4PE7 A;  4HRH A;  1IQ3 A;  1CDM A;  1SCM B;  1XK4 C;  4ORA B;  5AAN A;  4DS7 A;  1IH0 A;  1OSA A;  2NCP A;  1NX3 A;  1IGV A;  2ZNE A;  2LUX A;  1F54 A;  1UWO A;  2M1U A;  3OB1 B;  3ICB A;  1DJG A;  1PRW A;  3WXA A;  1KFX L;  2O60 A;  4HRG A;  2LUC A;  3BOW B;  2F2P A;  1MR8 A;  1ODB A;  1CLM A;  1YTZ C;  4AQI A;  3FIA A;  2MRD A;  1N65 A;  1YR5 A;  2K2F A;  4MN0 A;  3EVV A;  3BQ3 A;  2M3W A;  2CXJ A;  2E30 A;  2KBI A;  4GBA A;  2KSP A;  1KWO B;  3DVJ A;  4PHJ A;  2KAV A;  5D7F A;  5CSI A;  3CS1 A;  2JOJ A;  4AOM A;  1SMG A;  4DRW A;  1IWQ A;  1QJT A;  2HQ8 A;  4DIR A;  1NP8 A;  3M0W A;  4L9M A;  1QLK A;  2KOT A;  3CZT X;  2LM5 A;  1ZAC A;  2OS8 B;  3OP0 A;  2AAO A;  1EG3 A;  3OX6 A;  1Y0V H;  2FCE A;  4MZJ A;  5CSF A;  5HKW A;  3A8R A;  3GK2 A;  2JXC A;  1MQ1 A;  1MUX A;  1KK7 Z;  2PVB A;  2VRG A;  2ZND A;  2ZN8 A; 
#chains in the Genus database with same CATH topology
 3BFA A;  1AHR A;  1F71 A;  1YRT B;  1PK0 D;  1JF2 A;  1QWV A;  2MBX A;  1CM1 A;  2KDH A;  3KEV A;  1L2O C;  5DKQ A;  1N2D A;  1PVA A;  2FJU B;  1IQ5 A;  1S5G Y;  2ZN9 A;  2COL B;  1BLQ A;  1TUJ A;  4E68 A;  1RFJ A;  3VRR A;  1ORG A;  1ALW A;  3D77 A;  4ZCU A;  3UO9 A;  2PAS A;  2L0P A;  1YX8 A;  3LK1 A;  1QX2 A;  1KSM A;  3OGN A;  4WQ3 A;  5G08 A;  3RM1 A;  1CFP A;  2WCM A;  1XYD A;  1K93 D;  1DC1 A;  1NPQ A;  2Y4Q A;  1RK9 A;  1DJH A;  3DVE A;  1GQM A;  3CDN A;  3I5I B;  3L4A A;  2ZRT A;  3KO0 A;  1A75 A;  3S0E A;  1SYM A;  2LLS A;  5PAL A;  1YUU A;  1ZFS A;  2JQ6 A;  4MRX A;  4MSP A;  4N1G A;  3SG7 A;  2LVJ A;  1U5I A;  2LCP A;  5B8I B;  2KQ6 A;  1XFX O;  1CFF A;  1K90 D;  1JC2 A;  2ISD A;  1CFD A;  2JT0 A;  3GK1 A;  1REC A;  5KTY A;  4FQO A;  1DJI A;  4I5K A;  1TNW A;  5KU1 A;  2AUC A;  2I2R E;  1XFW O;  3EK4 A;  3BJH A;  1S3P A;  1J7R A;  4P2Y B;  2JWW A;  4MVF A;  1F8H A;  5JOL A;  3ZNI A;  1HQV A;  3OBV A;  3TS5 B;  1QX5 B;  4YBH B;  3I5H B;  2P70 A;  2KNE A;  3KF9 A;  2LAN A;  1AJ4 A;  4R1E A;  1F70 A;  1OOI X;  2I18 A;  2BCX A;  4JWQ A;  5D3O A;  4ZCV A;  4OVN F;  5F6T A;  5FI6 A;  4KYN A;  1X02 A;  3BUM B;  3LL8 B;  1UP5 A;  2BL0 C;  4IJ7 A;  1CMF A;  2MA2 A;  4M2O A;  1DF0 B;  3VB1 A;  2AMI A;  3C1V A;  4C0K A;  2MAZ A;  4OV2 A;  4PHN A;  4FQT A;  5AFP A;  1DEL A;  3HX4 A;  1DTL A;  3DVK A;  4OZD A;  2L50 A;  2M9G A;  5HL1 A;  4XJK B;  1AK8 A;  4UPG A;  2K0J A;  2JRF A;  1B7T Y;  1KK8 C;  1B9A A;  4GAO A;  2KAX A;  2G9B A;  2Y5I A;  1XFU O;  2WC8 A;  3EVR A;  3BXK A;  3O4X A;  2PAL A;  2RGI A;  4IL1 A;  3CZ0 A;  3SG2 A;  2QEV A;  3TUY C;  3FWC A;  1YVL A;  1SL8 A;  1B8C A;  1FI6 A;  4JQ0 D;  1UHH A;  2D8N A;  1M31 A;  3VRO A;  1CNP A;  1NCZ A;  3GOF A;  3PAL A;  1MHO A;  2H2K A;  1J7Q A;  1QIV A;  1SKT A;  3CR2 A;  1R2U A;  2FJY A;  2LV7 A;  3PM8 A;  1ALV A;  1KSO A;  3PLF B;  3BUX B;  3SS5 A;  2B1U A;  3CR4 X;  4NDB A;  1S6J A;  2V53 A;  1TOP A;  1XVJ A;  2LNK A;  1K96 A;  2PQL A;  2CNP A;  2KFF A;  2F8P A;  1KFX S;  1EL4 A;  1PAL A;  3LLE A;  2WCK A;  4BY4 A;  2MHH A;  1LA3 A;  1H8B A;  1NX2 A;  1QVI Y;  1EJ3 A;  1CTR A;  3I5G C;  4JKT A;  2KYC A;  3DF0 B;  2KLE A;  2I94 A;  1AP4 A;  1XFR A;  3IQQ A;  4QJ5 B;  1A03 A;  2BL0 B;  3I5F C;  4ETO A;  3D0Y B;  1WLM A;  1OMD A;  2CCM A;  4NQG A;  1MXL C;  4PE0 A;  3K21 A;  3PJI A;  4PDZ A;  1IRJ A;  2DOQ A;  1CLL A;  2NCO A;  3NHT A;  3CYZ A;  3NGV A;  2JTT A;  5I2O A;  3WNX B;  2HET A;  3KPX A;  1Y1A A;  3N7H A;  3SG4 A;  2Q4U A;  1W7I B;  1OMR A;  2KBM A;  3OX5 A;  5IBW A;  1DQE A;  1NCX A;  1RJV A;  3S0G A;  2JT3 A;  2LLU A;  2LHL A;  3CTN A;  3GK4 X;  4USL A;  1K9K A;  2QEB A;  4MZL A;  3A4U B;  1EH2 A;  1JF0 A;  1TCF A;  4QJ3 B;  1AUI B;  2JU0 A;  2LMU A;  4MLW A;  1K8U A;  1ZOT B;  2H61 A;  2KI4 C;  1CLB A;  1QAS A;  2BBM A;  1QVI Z;  1NIW A;  1K9P A;  4D1E A;  1JUO A;  1SY9 A;  1WDC B;  3WHU B;  4GUK A;  3SS4 A;  3EKH A;  3AAJ A;  3CZ1 A;  1DMO A;  3WHT B;  2JT8 A;  5I2Q A;  4CFR A;  4M2Q A;  4C0J A;  5D69 A;  3NSI A;  1UHJ A;  1S36 A;  3CGA A;  1OOJ A;  2MLF C;  2KI6 C;  1BG1 A;  2L2E A;  1TCO B;  3I5G B;  2PRU A;  2JC2 A;  3CZ2 A;  2LP3 A;  5DKR A;  2BKI B;  3BUO B;  4PCW A;  3K1E A;  1QV1 A;  1LXF C;  1CMG A;  1Z2C B;  1NWD A;  3I5F B;  5AXI A;  3FWB A;  1K95 A;  2LAP A;  1BU3 A;  1DGU A;  1XFY O;  3JVT C;  1BT6 A;  1G4Y R;  1N0Y A;  1TUZ A;  2JZI A;  1DGV A;  1J1E A;  2KYF A;  4PE1 A;  4F0Z B;  2ZFD A;  1C07 A;  4A4C A;  2EGD A;  3SIA A;  3NXA A;  4M2P A;  2K7C A;  1V1F A;  2ERB A;  2R2I A;  5I8N A;  4CPV A;  1YUT A;  1RTP 1;  2L4I A;  4GGF A;  1MWN A;  4C0L A;  3LCP C;  4OR9 B;  4AQJ A;  1Y1U A;  1S5G Z;  4YGB B;  1K9U A;  1DJW A;  1PVB A;  4ORC B;  1FI5 A;  1PSB A;  2JXL A;  2LE9 B;  2M0R A;  2K7D A;  3BOW A;  1QS7 A;  2KGR A;  1OZS A;  4ICB A;  2FOT A;  4TNC A;  2EC6 C;  3NSL A;  1PSR A;  1CDL A;  3JTD C;  4I5L B;  2KI4 B;  2M7L A;  4BY5 A;  3D0Y A;  2F3Y A;  1M46 A;  3DYE A;  1M63 B;  3FE9 A;  1L2O B;  2M49 B;  4NDC A;  2L5Y A;  2CTN A;  2L5X B;  1BR4 B;  1OOG A;  1RWY A;  3RLZ A;  2JPT A;  3AKB A;  4FTG A;  2I7A A;  2WC5 A;  3FE6 A;  2LMV A;  1QAT A;  4GNK B;  4Q04 A;  3EK8 A;  2JUL A;  3B88 A;  1XFZ O;  1SCV A;  3H4S E;  1CM4 A;  1SR6 C;  2ZKM X;  3D74 A;  4OCI A;  2M7N A;  4YI8 A;  1R6P A;  2A4J A;  4GFT A;  2GV5 A;  1BOC A;  5CSJ A;  1BR1 B;  1F55 A;  1DJZ A;  2PSR A;  1IJ5 A;  1SW8 A;  1QX7 A;  2K7B A;  2PMY A;  3HCM A;  2NXQ A;  3JVT B;  2JPO A;  3BUN B;  2M1K B;  3NSK A;  4DCK A;  2BE6 A;  2BE4 A;  1C3Z A;  2Y1N A;  5J3X A;  4MZK A;  3EG5 B;  3S0D A;  5DKN A;  1B8L A;  1CFC A;  1Q80 A;  1KCY A;  1SK6 D;  2LP2 A;  3IVT A;  1E8A A;  1GJY A;  3S0F A;  1JFK A;  1XK4 A;  2Q91 A;  3PN7 C;  1FBV A;  1KQM C;  1D1O A;  1DEK A;  2BNX A;  2L51 A;  1T14 A;  1XFV O;  4YGC B;  2QEH A;  3AKA A;  3TZ1 A;  3B86 A;  5CSN A;  2L4H A;  2LVK A;  4PAL A;  2LLT A;  2OS8 C;  1PUL A;  2WOS A;  4MEW A;  1FW4 A;  3ZWH A;  1IKU A;  3SG6 A;  2G2B A;  2EC6 B;  4GPL B;  4MBE A;  1A4P A;  1UHK A;  1J7O A;  1K2H A;  3UNW A;  3JTD B;  3V2L A;  1A75 B;  3TDZ A;  2LMT A;  1B7T Z;  2JNX A;  2LC5 A;  3DXL A;  1IIO A;  5BPJ A;  5JJG A;  1LS8 A;  3B7A A;  3D73 A;  3DY9 A;  1U5I B;  1YUR A;  4PHK A;  2M97 A;  1V1G A;  2P6B B;  1S26 D;  2M8U A;  4QJ4 B;  4YGD B;  1K94 A;  2IS9 A;  1J55 A;  1C7V A;  2LHI A;  2YGU A;  3PM2 A;  3NSO A;  2BEC A;  1WY9 A;  2HPS A;  3KHE A;  1KK7 Y;  1NYA A;  1WRK A;  2K8M B;  2LVI A;  3B6X A;  1KK8 B;  1SRA A;  3FS7 A;  1SR6 B;  2NLN A;  2P71 A;  4HRE E;  3VGO A;  1JWD A;  1L7Z A;  5GQQ C;  1GGW A;  3R1P A;  3R1V A;  4CFQ A;  2MJW B;  5AER A;  1QIW A;  3SG5 A;  2L2C A;  2HF5 A;  3TUY B;  2WND A;  3I5I C;  1SL7 A;  2KI6 D;  4I5N B;  1DJX A;  1CDP A;  1B8R A;  1B47 A;  4F7F A;  5HKY A;  1LVC D;  1Y6W A;  1KQV A;  1UUR A;  4N5X A;  2QPT A;  1NX1 A;  2NZ0 A;  2OPO A;  5K89 A;  3DVM A;  1DF0 A;  1A2X A;  3D78 A;  1YX7 A;  1BOD A;  1EXR A;  2OTG C;  2JTZ A;  3PN7 B;  1KQM B;  4DUQ A;  3CR5 X;  5I94 A;  1J7P A;  4XJK A;  4MRY A;  1XA5 A;  2KAY A;  1W9Z A;  2F3Z A;  5HLV A;  1DVI A;  2KPH A;  1MF8 B;  1OQP A;  3TS5 C;  3O4Y A;  3D10 A;  3I5H C;  2PYQ A;  5ER5 A;  2WCB A;  1BMO A;  2Y1M A;  1SBJ A;  3DD4 A;  1YVH A;  1OE9 B;  2O5G A;  5AEQ A;  3PAT A;  2H8V A;  3IQO A;  3Q8I A;  1LIN A;  1F4Q A;  2QAC A;  1NX0 A;  5FYX A;  1KFU S;  1CB1 A;  4XYN A;  1HT9 A;  2H61 C;  4HSZ A;  1KFU L;  1TTX A;  4INX A;  1NUB A;  3BUW B;  1OOH A;  2E6W A;  3SS3 A;  2TN4 A;  5HYD A;  2K60 A;  2WCL A;  1OZO A;  1YRU B;  3EK7 A;  3MSE B;  2BKH B;  4PHM A;  1DT7 B;  1QXP A;  1OMV A;  4JD9 A;  1TRF A;  2BCA A;  2KHN A;  1S1E A;  1OOF A;  1SNL A;  1TNX A;  2EHB A;  3D76 A;  1YUS A;  1F4O A;  2KFH A;  2K61 A;  4GGN A;  2FCD A;  4P5O E;  3TDI A;  2JNF A;  2HQW A;  1EG4 A;  1QTX A;  3SIB A;  1G8I A;  3CWG A;  1BJF A;  3DF0 A;  2GGZ A;  2K7O A;  2KQY A;  3PFV A;  1ZMZ A;  1WRL A;  1IG5 A;  3VRN A;  1OW4 A;  4CLN A;  4YI9 A;  1CDN A;  2MLE C;  1AVS A;  1Y1X A;  2KGB C;  1SL9 A;  2L98 A;  3E3R A;  2OTG B;  2GTE A;  4OKH A;  3CLN A;  2SAS A;  5CPV A;  1BF5 A;  4JPZ B;  3IF7 A;  3VRQ A;  3EKJ A;  3O78 A;  3VRP A;  1C7W A;  1TIZ A;  4PE4 A;  5FI7 A;  1Z4H A;  4ORB B;  1CKK A;  1FPW A;  3AAK A;  3L47 A;  1XO5 A;  1B4C A;  5HKZ A;  1SCM C;  1TWO A;  1AJ5 A;  1IJ6 A;  4WQ2 A;  4NDD A;  4GGF C;  1JFJ A;  1ZUZ A;  2WCF A;  1TNQ A;  1NSH A;  1GM0 A;  1TN4 A;  1MXE A;  1QV0 A;  1VRK A;  3PSR A;  2BAP A;  2KFG A;  2F33 A;  5I2L A;  2BCB A;  5FI2 A;  5TNC A;  3O6B A;  3QRX A;  1NCY A;  5DIC A;  2LVV A;  2QEO A;  3DZT A;  3LK0 A;  3SG3 A;  1DJY A;  2M29 A;  4CID A;  2CBL A;  2GGM A;  3NHI A;  1C3Y A;  1FF1 A;  2WOR A;  1UHN A;  1LA0 A;  3FE8 A;  1SSE B;  1UHI A;  1M45 A;  2WCE A;  1KWO C;  3TDU A;  4PT1 A;  3OB2 B;  5ER4 X;  2F2O A;  1S6C A;  3F45 A;  3BFB A;  3QME A;  1M39 A;  2K2A A;  1JSA A;  1B1G A;  3O2P A;  2ZRS A;  5KSZ A;  1JBA A;  1S6I A;  1W7J B;  2CT9 A;  4YGA A;  1UUS A;  3SJS A;  1RRO A;  4YGE B;  1QLS A;  1WRZ A;  1A29 A;  4U8D A;  4WRI A;  3OHM B;  4YRU A;  3B87 A;  1GGZ A;  4I5J A;  3S0A A;  5EL2 A;  1SPY A;  3BFH A;  1J1D A;  1LKJ A;  3CAB A;  1WLZ A;  3BYA A;  3EVU A;  2SCP A;  5HLO A;  1G33 A;  3D75 A;  1H4B A;  4N1F A;  2BBN A;  1WDC C;  1TNP A;  4A4B A;  4PE7 A;  4HRH A;  1IQ3 A;  1CDM A;  1SCM B;  1XK4 C;  4ORA B;  5AAN A;  4DS7 A;  1IH0 A;  1P28 A;  1OSA A;  2NCP A;  1NX3 A;  1IGV A;  2ZNE A;  2LUX A;  1F54 A;  1UWO A;  2M1U A;  3OB1 B;  3ICB A;  1DJG A;  1PRW A;  3WXA A;  1KFX L;  2O60 A;  4HRG A;  2LUC A;  3BOW B;  3RZS A;  2QDI A;  2F2P A;  1MR8 A;  1ODB A;  1CLM A;  1YTZ C;  4AQI A;  3FIA A;  3R72 A;  2MRD A;  2WCJ A;  1N65 A;  1YR5 A;  2K2F A;  4MN0 A;  3S0B A;  3EVV A;  3BQ3 A;  2M3W A;  2WCH A;  4INW A;  3R1O A;  2CXJ A;  2E30 A;  2KBI A;  4GBA A;  2KSP A;  1KWO B;  3DVJ A;  3L4L A;  4PHJ A;  2KAV A;  5D7F A;  5CSI A;  3CS1 A;  2JOJ A;  4AOM A;  1SMG A;  4DRW A;  1IWQ A;  1QJT A;  2HQ8 A;  4DIR A;  1NP8 A;  3M0W A;  4L9M A;  1QLK A;  2KOT A;  3CZT X;  2LM5 A;  1ZAC A;  2OS8 B;  3OP0 A;  2AAO A;  1EG3 A;  3OX6 A;  1Y0V H;  2FCE A;  2WC6 A;  4MZJ A;  2KLD A;  5CSF A;  5HKW A;  3A8R A;  3GK2 A;  2JXC A;  1MQ1 A;  1MUX A;  1KK7 Z;  2PVB A;  2VRG A;  2ZND A;  2ZN8 A; 
#chains in the Genus database with same CATH homology
 1AHR A;  1F71 A;  1YRT B;  1PK0 D;  1JF2 A;  2MBX A;  1CM1 A;  2KDH A;  3KEV A;  1L2O C;  5DKQ A;  1N2D A;  1PVA A;  2FJU B;  1IQ5 A;  1S5G Y;  2ZN9 A;  2COL B;  1BLQ A;  4E68 A;  1RFJ A;  3VRR A;  1ALW A;  4ZCU A;  2PAS A;  2L0P A;  1YX8 A;  3LK1 A;  1QX2 A;  1KSM A;  4WQ3 A;  5G08 A;  1CFP A;  1XYD A;  1K93 D;  1NPQ A;  2Y4Q A;  1RK9 A;  1DJH A;  3DVE A;  1GQM A;  3I5I B;  2ZRT A;  3KO0 A;  1A75 A;  1SYM A;  2LLS A;  5PAL A;  1YUU A;  1ZFS A;  2JQ6 A;  4MRX A;  4MSP A;  4N1G A;  3SG7 A;  2LVJ A;  1U5I A;  2LCP A;  5B8I B;  2KQ6 A;  1XFX O;  1CFF A;  1K90 D;  1JC2 A;  2ISD A;  1CFD A;  2JT0 A;  3GK1 A;  1REC A;  5KTY A;  4FQO A;  1DJI A;  4I5K A;  1TNW A;  5KU1 A;  2AUC A;  2I2R E;  1XFW O;  3EK4 A;  1S3P A;  1J7R A;  4P2Y B;  2JWW A;  4MVF A;  1F8H A;  5JOL A;  3ZNI A;  1HQV A;  3TS5 B;  1QX5 B;  4YBH B;  3I5H B;  2KNE A;  3KF9 A;  2LAN A;  1AJ4 A;  4R1E A;  1F70 A;  2I18 A;  2BCX A;  4JWQ A;  4ZCV A;  4OVN F;  5F6T A;  1X02 A;  3BUM B;  3LL8 B;  1UP5 A;  2BL0 C;  1CMF A;  2MA2 A;  4M2O A;  1DF0 B;  2AMI A;  3C1V A;  4C0K A;  2MAZ A;  4OV2 A;  4PHN A;  5AFP A;  3HX4 A;  1DTL A;  3DVK A;  2L50 A;  2M9G A;  1AK8 A;  4XJK B;  4UPG A;  2K0J A;  2JRF A;  1B7T Y;  1KK8 C;  1B9A A;  4GAO A;  2KAX A;  2G9B A;  2Y5I A;  1XFU O;  2WC8 A;  3EVR A;  3BXK A;  2PAL A;  2RGI A;  4IL1 A;  3SG2 A;  3TUY C;  3FWC A;  1YVL A;  1SL8 A;  1B8C A;  1FI6 A;  4JQ0 D;  1UHH A;  2D8N A;  1M31 A;  3VRO A;  1CNP A;  1NCZ A;  3GOF A;  3PAL A;  1MHO A;  2H2K A;  1J7Q A;  1QIV A;  1SKT A;  3CR2 A;  1R2U A;  2LV7 A;  3PM8 A;  1ALV A;  1KSO A;  3PLF B;  3BUX B;  2B1U A;  3CR4 X;  4NDB A;  1S6J A;  2V53 A;  1TOP A;  1XVJ A;  2LNK A;  1K96 A;  2CNP A;  2KFF A;  2F8P A;  1KFX S;  1EL4 A;  1PAL A;  3LLE A;  4BY4 A;  2MHH A;  1LA3 A;  1H8B A;  1NX2 A;  1QVI Y;  1EJ3 A;  1CTR A;  3I5G C;  2KYC A;  3DF0 B;  2I94 A;  1AP4 A;  1A03 A;  3IQQ A;  4QJ5 B;  2BL0 B;  3I5F C;  4ETO A;  3D0Y B;  1WLM A;  1OMD A;  2CCM A;  4NQG A;  1MXL C;  4PE0 A;  3K21 A;  4PDZ A;  1IRJ A;  2DOQ A;  1CLL A;  2NCO A;  2JTT A;  5I2O A;  3WNX B;  2HET A;  3KPX A;  1Y1A A;  3SG4 A;  2Q4U A;  1W7I B;  1OMR A;  2KBM A;  3OX5 A;  5IBW A;  1NCX A;  1RJV A;  2JT3 A;  2LLU A;  2LHL A;  3CTN A;  3GK4 X;  4USL A;  1K9K A;  4MZL A;  3A4U B;  1EH2 A;  1JF0 A;  1TCF A;  4QJ3 B;  1AUI B;  2JU0 A;  2LMU A;  4MLW A;  1K8U A;  1ZOT B;  2H61 A;  2KI4 C;  1CLB A;  1QAS A;  2BBM A;  1QVI Z;  1NIW A;  1K9P A;  4D1E A;  1JUO A;  1SY9 A;  1WDC B;  3WHU B;  4GUK A;  3EKH A;  3AAJ A;  1DMO A;  3WHT B;  2JT8 A;  5I2Q A;  4CFR A;  4M2Q A;  4C0J A;  5D69 A;  3NSI A;  1UHJ A;  1S36 A;  3CGA A;  1OOJ A;  2MLF C;  2KI6 C;  1BG1 A;  2L2E A;  1TCO B;  3I5G B;  2PRU A;  2JC2 A;  5DKR A;  2LP3 A;  2BKI B;  3BUO B;  4PCW A;  1QV1 A;  1LXF C;  1CMG A;  1NWD A;  3I5F B;  5AXI A;  3FWB A;  1K95 A;  2LAP A;  1BU3 A;  1DGU A;  1XFY O;  3JVT C;  1BT6 A;  1G4Y R;  1N0Y A;  2JZI A;  1DGV A;  1J1E A;  2KYF A;  4PE1 A;  4F0Z B;  2ZFD A;  1C07 A;  4A4C A;  2EGD A;  3SIA A;  3NXA A;  4M2P A;  2K7C A;  1V1F A;  2R2I A;  5I8N A;  4CPV A;  1YUT A;  1RTP 1;  2L4I A;  4GGF A;  1MWN A;  4C0L A;  3LCP C;  4OR9 B;  4AQJ A;  1Y1U A;  1S5G Z;  4YGB B;  1K9U A;  1DJW A;  1PVB A;  4ORC B;  1FI5 A;  1PSB A;  2JXL A;  2LE9 B;  2M0R A;  2K7D A;  3BOW A;  1QS7 A;  2KGR A;  1OZS A;  4ICB A;  2FOT A;  4TNC A;  2EC6 C;  3NSL A;  1PSR A;  1CDL A;  3JTD C;  4I5L B;  2KI4 B;  2M7L A;  4BY5 A;  3D0Y A;  2F3Y A;  1M46 A;  1M63 B;  1L2O B;  2M49 B;  4NDC A;  2CTN A;  2L5X B;  1BR4 B;  1RWY A;  3RLZ A;  2JPT A;  3AKB A;  4FTG A;  2I7A A;  2LMV A;  1QAT A;  4GNK B;  4Q04 A;  3EK8 A;  2JUL A;  1XFZ O;  1SCV A;  3H4S E;  1CM4 A;  1SR6 C;  2ZKM X;  4OCI A;  2M7N A;  4YI8 A;  1R6P A;  2A4J A;  4GFT A;  2GV5 A;  1BOC A;  5CSJ A;  1BR1 B;  1F55 A;  1DJZ A;  2PSR A;  1IJ5 A;  1SW8 A;  1QX7 A;  2K7B A;  2PMY A;  3HCM A;  2NXQ A;  3JVT B;  3NSK A;  3BUN B;  2M1K B;  4DCK A;  2BE6 A;  2BE4 A;  2Y1N A;  5J3X A;  4MZK A;  5DKN A;  1B8L A;  1CFC A;  1Q80 A;  1KCY A;  1SK6 D;  2LP2 A;  1E8A A;  1GJY A;  1JFK A;  1XK4 A;  2Q91 A;  3PN7 C;  1FBV A;  1KQM C;  1D1O A;  2L51 A;  1XFV O;  4YGC B;  3AKA A;  3TZ1 A;  5CSN A;  2L4H A;  2LVK A;  4PAL A;  2LLT A;  2OS8 C;  1PUL A;  2WOS A;  4MEW A;  1FW4 A;  3ZWH A;  1IKU A;  3SG6 A;  2G2B A;  2EC6 B;  4GPL B;  4MBE A;  1A4P A;  1UHK A;  1J7O A;  1K2H A;  3JTD B;  1A75 B;  3TDZ A;  2LMT A;  1B7T Z;  2JNX A;  2LC5 A;  5BPJ A;  5JJG A;  1U5I B;  1YUR A;  4PHK A;  2M97 A;  1V1G A;  2P6B B;  1S26 D;  2M8U A;  4QJ4 B;  4YGD B;  1K94 A;  2IS9 A;  1J55 A;  1C7V A;  2LHI A;  3NSO A;  2BEC A;  1WY9 A;  2HPS A;  3KHE A;  1KK7 Y;  1NYA A;  1WRK A;  2K8M B;  2LVI A;  3FS7 A;  1KK8 B;  1SRA A;  4HRE E;  1SR6 B;  2NLN A;  3VGO A;  1JWD A;  1L7Z A;  5GQQ C;  1GGW A;  4CFQ A;  2MJW B;  5AER A;  1QIW A;  3SG5 A;  2HF5 A;  3TUY B;  2WND A;  3I5I C;  1SL7 A;  2KI6 D;  4I5N B;  1DJX A;  1CDP A;  1B8R A;  1B47 A;  5HKY A;  1LVC D;  1Y6W A;  1KQV A;  1UUR A;  4N5X A;  2QPT A;  1NX1 A;  2NZ0 A;  2OPO A;  5K89 A;  3DVM A;  1DF0 A;  1A2X A;  1YX7 A;  1BOD A;  1EXR A;  2OTG C;  2JTZ A;  3PN7 B;  1KQM B;  4DUQ A;  3CR5 X;  1J7P A;  4XJK A;  4MRY A;  1XA5 A;  2KAY A;  2F3Z A;  5HLV A;  1DVI A;  1MF8 B;  1OQP A;  3TS5 C;  3O4Y A;  3D10 A;  3I5H C;  5ER5 A;  2WCB A;  1BMO A;  2Y1M A;  1SBJ A;  3DD4 A;  1YVH A;  1OE9 B;  2O5G A;  5AEQ A;  3PAT A;  3IQO A;  1LIN A;  1F4Q A;  2QAC A;  1NX0 A;  5FYX A;  1KFU S;  1CB1 A;  4XYN A;  1HT9 A;  2H61 C;  4HSZ A;  1KFU L;  1TTX A;  1NUB A;  3BUW B;  2E6W A;  2TN4 A;  5HYD A;  1OZO A;  1YRU B;  3EK7 A;  3MSE B;  2BKH B;  4PHM A;  1DT7 B;  1QXP A;  1OMV A;  1TRF A;  2BCA A;  2KHN A;  1S1E A;  1SNL A;  1TNX A;  2EHB A;  3RM1 A;  1YUS A;  1F4O A;  2KFH A;  2K61 A;  4GGN A;  2FCD A;  4P5O E;  3TDI A;  2JNF A;  2HQW A;  1EG4 A;  1QTX A;  3SIB A;  1G8I A;  3CWG A;  1BJF A;  3DF0 A;  2GGZ A;  2K7O A;  2KQY A;  3PFV A;  1ZMZ A;  1WRL A;  1IG5 A;  3VRN A;  4CLN A;  4YI9 A;  1CDN A;  2MLE C;  1AVS A;  1Y1X A;  2KGB C;  1SL9 A;  2L98 A;  3E3R A;  2OTG B;  4OKH A;  3CLN A;  2SAS A;  5CPV A;  1BF5 A;  4JPZ B;  3IF7 A;  3VRQ A;  3EKJ A;  3O78 A;  3VRP A;  1C7W A;  1TIZ A;  4PE4 A;  4ORB B;  1CKK A;  1FPW A;  3AAK A;  1XO5 A;  1B4C A;  5HKZ A;  1SCM C;  1AJ5 A;  1IJ6 A;  4WQ2 A;  4NDD A;  4GGF C;  1JFJ A;  1ZUZ A;  2WCF A;  1TNQ A;  1NSH A;  1TN4 A;  1MXE A;  1QV0 A;  1VRK A;  3PSR A;  2KFG A;  2F33 A;  5I2L A;  2BCB A;  5TNC A;  3O6B A;  3QRX A;  1NCY A;  3SG3 A;  2LVV A;  3LK0 A;  4CID A;  1DJY A;  2M29 A;  2CBL A;  2GGM A;  1FF1 A;  2WOR A;  1UHN A;  1LA0 A;  1UHI A;  1M45 A;  2WCE A;  1KWO C;  3TDU A;  3OB2 B;  5ER4 X;  2F2O A;  1S6C A;  3F45 A;  1M39 A;  2K2A A;  1JSA A;  1B1G A;  3O2P A;  2ZRS A;  5KSZ A;  1JBA A;  1S6I A;  1W7J B;  2CT9 A;  4YGA A;  1UUS A;  3SJS A;  1RRO A;  4YGE B;  1QLS A;  1WRZ A;  1A29 A;  4U8D A;  4WRI A;  3OHM B;  4YRU A;  1GGZ A;  4I5J A;  1SPY A;  1J1D A;  1LKJ A;  3EVU A;  1WLZ A;  3BYA A;  5HLO A;  2SCP A;  1G33 A;  1H4B A;  4N1F A;  2BBN A;  1WDC C;  1TNP A;  4A4B A;  4PE7 A;  4HRH A;  1IQ3 A;  1CDM A;  1SCM B;  1XK4 C;  4ORA B;  5AAN A;  4DS7 A;  1IH0 A;  1OSA A;  2NCP A;  1NX3 A;  1IGV A;  2ZNE A;  2LUX A;  1F54 A;  1UWO A;  2M1U A;  3OB1 B;  3ICB A;  1DJG A;  1PRW A;  3WXA A;  1KFX L;  2O60 A;  4HRG A;  2LUC A;  3BOW B;  2F2P A;  1MR8 A;  1ODB A;  1CLM A;  1YTZ C;  4AQI A;  3FIA A;  2MRD A;  1N65 A;  1YR5 A;  2K2F A;  4MN0 A;  3EVV A;  3BQ3 A;  2M3W A;  2CXJ A;  2E30 A;  2KBI A;  4GBA A;  2KSP A;  1KWO B;  3DVJ A;  4PHJ A;  2KAV A;  5D7F A;  5CSI A;  3CS1 A;  2JOJ A;  4AOM A;  1SMG A;  4DRW A;  1IWQ A;  1QJT A;  2HQ8 A;  4DIR A;  1NP8 A;  3M0W A;  4L9M A;  1QLK A;  2KOT A;  3CZT X;  2LM5 A;  1ZAC A;  2OS8 B;  3OP0 A;  2AAO A;  1EG3 A;  3OX6 A;  1Y0V H;  2FCE A;  4MZJ A;  5CSF A;  5HKW A;  3A8R A;  3GK2 A;  2JXC A;  1MQ1 A;  1MUX A;  1KK7 Z;  2PVB A;  2VRG A;  2ZND A;  2ZN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...