2ZNEA

Crystal structure of zn2+-bound form of des3-23alg-2 complexed with alix abs peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
168
structure length
168
Chain Sequence
DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 58
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zneA00
1F54A 1XFZO 3I5GC 1SRAA 2L50A 4PCWA 1SPYA 2MLFC 5I2OA 1UHJA 4CLNA 1QV0A 1U5IA 2ZFDA 1MQ1A 4HSZA 4ZCUA 1DF0A 1TNXA 3I5FB 1K9UA 1KWOC 2LAPA 3NSOA 4MZKA 4XJKA 4YRUA 4JPZB 2KAXA 1YUSA 1V1FA 2KHNA 5I2QA 5KSZA 1IJ5A 1MHOA 1UHNA 1F71A 2L98A 2BBMA 2NZ0A 1TCOB 5JOLA 4N1GA 2M49B 3I5GB 3LL8B 3VRQA 4C0KA 1Y1XA 4GGNA 1F70A 2BCBA 1PRWA 5AFPA 1XFVO 1KWOB 1Y0VH 2MLEC 1XFUO 2JZIA 4TNCA 2CBLA 1AP4A 2GGZA 2FOTA 1Y1AA 3O78A 3SJSA 1OE9B 2Y4QA 1YVLA 2Y1MA 1UHIA 1LVCD 1TNPA 5TNCA 5BPJA 2F3YA 1S5GZ 2M8UA 4ZCVA 4MRXA 3RM1A 5B8IB 2WCEA 1SW8A 4HREE 4A4BA 4GFTA 1QJTA 3CS1A 3CZTX 1A29A 1TIZA 1DJHA 2F2PA 1EG4A 1DTLA 3EKJA 1DJXA 4E68A 1BF5A 1B8LA 3C1VA 4N1FA 3AKBA 1CDLA 1J7QA 1L2OC 1J7RA 4R1EA 2LNKA 3BOWB 4JQ0D 2R2IA 3GK1A 1YX7A 3FIAA 1AJ4A 4DIRA 1CM4A 2O5GA 3SIBA 2MJWB 2OPOA 1F4QA 5DKNA 1SCVA 1LA3A 3O6BA 1SKTA 1D1OA 1ALWA 2JTZA 3PALA 2TN4A 1L2OB 1XFXO 1IJ6A 3BUMB 4GUKA 1B1GA 5J3XA 3VRRA 3TDUA 4C0LA 2LVKA 1S6JA 1BLQA 1UUSA 4OR9B 2F2OA 5HLVA 2AAOA 2JULA 2VRGA 4OCIA 4MSPA 1YR5A 2LUCA 2M3WA 1OSAA 4N5XA 1BG1A 1CFDA 1PULA 2WOSA 1QLKA 1KSOA 3VGOA 2KI6C 2E30A 4OKHA 2CXJA 1JF2A 2L0PA 2CT9A 2LLTA 4YGBB 2HETA 2BKIB 1YURA 4GPLB 1OOJA 1TOPA 1NSHA 1SBJA 4FTGA 2LMTA 1KK7Z 2M29A 3JVTC 2M9GA 1LINA 1JF0A 1NIWA 1N0YA 1MXLC 2M1KB 1CNPA 1BU3A 2SASA 1J55A 4NDBA 1U5IB 3PM8A 3LCPC 1DF0B 1FW4A 4XJKB 1YX8A 2OS8C 1WRKA 1HT9A 3PN7C 4NQGA 1UWOA 1SCMC 3NXAA 1GGWA 1DMOA 4FQOA 3ZNIA 1YUUA 1XFWO 3TDZA 2PSRA 2WCBA 3DVJA 1QX2A 2JNFA 3OP0A 1LXFC 2KFGA 3GK4X 5I8NA 1J7PA 2KYFA 1KFXL 1EXRA 2HPSA 1SR6C 1TN4A 1PSBA 3AKAA 3BQ3A 3PN7B 4QJ4B 1SCMB 4MZJA 5HKWA 3FWCA 1KFUL 2JOJA 1KK7Y 4P5OE 1BR1B 1JWDA 3IF7A 1B7TZ 3I5IC 1PVBA 3DF0B 2CCMA 3GK2A 2M0RA 1K96A 2LHLA 1MWNA 1DJZA 2LE9B 1ZFSA 4M2PA 2Q91A 1SR6B 3IQOA 4DCKA 1J1EA 2AUCA 2ZN8A 2KFFA 2NLNA 1NX3A 3H4SE 1OZOA 3KPXA 1K93D 3BUOB 2JWWA 2ZNEA 1AK8A 2EC6C 2WORA 3CR2A 2JC2A 4ORBB 4OV2A 3I5IB 1KCYA 1CFCA 2FCDA 1A75A 3SG2A 2PMYA 5FYXA 1FI6A 2Y1NA 3E3RA 2HF5A 2NCPA 1WRZA 2ZRSA 3WNXB 2BL0C 2JU0A 1WLZA 2L2EA 1SMGA 3O4YA 4I5NB 4AOMA 1JUOA 1G8IA 1KK8C 2KQYA 2EC6B 1OMVA 2KNEA 1F4OA 1M63B 1BR4B 2KFHA 4PE4A 3D0YA 4MEWA 3BUXB 2L4IA 1IQ3A 2QPTA 1PVAA 1IKUA 1QTXA 1TNWA 3AAJA 2LMUA 3CGAA 1L7ZA 1LA0A 2BL0B 5AERA 1J7OA 2BCXA 1OMDA 5AANA 2KDHA 3CWGA 1QATA 1KK8B 4MRYA 3PFVA 4MLWA 1H8BA 1QIWA 2EHBA 3DVMA 1A03A 4HRHA 1UHKA 1K2HA 1KQMC 1CB1A 1M39A 4PE1A 5F6TA 2MA2A 1QASA 5HYDA 2JNXA 1RJVA 3OB1B 4YGAA 2MBXA 1C07A 1SYMA 1B8CA 1CLLA 1CDNA 2ZN9A 1NPQA 1KSMA 1NX0A 4CIDA 3PLFB 1B9AA 1YVHA 4JWQA 1Y6WA 2PALA 3WXAA 3EKHA 1TTXA 1TCFA 1KQMB 2ZRTA 2KOTA 1WY9A 1XVJA 3BYAA 2B1UA 3EK8A 3GOFA 1JFJA 1S5GY 5IBWA 2RGIA 2K2AA 2F8PA 5ER4X 3VRNA 1F8HA 2K61A 1MXEA 3BXKA 1JC2A 1IWQA 1QV1A 4YGEB 1ALVA 4AQJA 2PASA 2OTGC 1CDMA 3RLZA 1W7IB 2JQ6A 3OX5A 3QRXA 4YBHB 1B8RA 1QVIZ 1N2DA 4HRGA 2I2RE 2K2FA 3FS7A 2LP3A 2JPTA 4ORCB 2JTTA 2CTNA 3BUNB 5KTYA 2H2KA 4CFRA 4YI8A 1KQVA 5G08A 3PSRA 5AXIA 5JJGA 3SG3A 4YGCB 3A8RA 1EH2A 5CSIA 2Y5IA 2KGRA 5CSNA 1Y1UA 2ZNDA 1MF8B 1CFPA 2FJUB 1RK9A 4DRWA 4MZLA 2LC5A 1CFFA 4YGDB 1C7WA 1AUIB 2QACA 2G2BA 1A2XA 3AAKA 1UURA 1K8UA 2NCOA 4NDCA 2M97A 4UPGA 4CFQA 2BBNA 2D8NA 2KBIA 1PALA 3SG4A 1SNLA 3CLNA 1PK0D 1XK4A 2LVIA 4DS7A 1NYAA 1S1EA 1OMRA 1IG5A 1QIVA 2M1UA 3BUWB 3EVRA 3JVTB 2JT3A 5CSFA 3TS5C 4OVNF 1S26D 1ZOTB 1QVIY 2PVBA 2I7AA 3I5HC 1A75B 2BECA 2L51A 1DJGA 2LP2A 3TUYC 1JBAA 1DJWA 1EJ3A 2OS8B 3SIAA 2COLB 4PALA 1BJFA 3TS5B 1XFYO 1BODA 3OHMB 4PHMA 1FBVA 3I5HB 2SCPA 5HKZA 3D0YB 3TUYB 4GGFA 1PSRA 3CR5X 4L9MA 1DVIA 3FWBA 2WC8A 3DVEA 2H61A 2LLSA 1GGZA 5AEQA 4NDDA 4ICBA 2KAYA 1RECA 3EK4A 3LLEA 4A4CA 2I94A 5DKRA 1GJYA 2JRFA 3KF9A 1GQMA 2JXLA 2K7BA 1YRTB 1CM1A 2F3ZA 1BMOA 1ODBA 2FCEA 2CNPA 2LHIA 4PHNA 1YUTA 1R2UA 4GAOA 2KAVA 4PE0A 5HLOA 5DKQA 1B47A 1NCXA 1FF1A 3OX6A 1F55A 1UP5A 5CSJA 1QX5B 4Q04A 2WCFA 3SG6A 1KFXS 1NUBA 1RROA 4DUQA 2WNDA 1NCZA 1NWDA 1SL9A 1B7TY 1MUXA 3EK7A 4WQ2A 3TDIA 2Q4UA 1KFUS 4ETOA 5D7FA 5ER5A 2BCAA 1K9KA 2KQ6A 1FI5A 3OB2B 4PHKA 1M46A 1BOCA 1IGVA 1EG3A 2PRUA 1FPWA 2L4HA 1RTP1 1AJ5A 3IQQA 4QJ3B 2GGMA 1OQPA 3KO0A 3EVVA 3LK0A 2ISDA 2P6BB 1Q80A 1NP8A 1LKJA 2K7OA 1S6CA 2K7DA 2LM5A 4WQ3A 5GQQC 1SL8A 2LVVA 3DF0A 3ZWHA 5HKYA 2MAZA 3JTDC 2K8MB 4YI9A 2KBMA 3MSEB 1SK6D 1ZACA 4GNKB 3WHUB 1JSAA 2JT8A 2GV5A 2KYCA 3O2PA 2EGDA 1XK4C 2IS9A 2G9BA 2NXQA 4PDZA 1SL7A 1W7JB 1TRFA 1WDCC 3KHEA 2O60A 1V1GA 3F45A 1AVSA 2L5XB 1B4CA 3JTDB 1C7VA 1E8AA 4WRIA 3VROA 4I5LB 2A4JA 4CPVA 4ORAB 1IRJA 1QLSA 2K7CA 2KI6D 3K21A 4AQIA 1DGUA 1YTZC 1G33A 4BY4A 4P2YB 1K94A 1WDCB 1QXPA 1WRLA 5D69A 2K0JA 2LMVA 2LVJA 1SY9A 2ZKMX 2AMIA 2LUXA 2M7LA 2I18A 3NSKA 1H4BA 4GGFC 1CDPA 1J1DA 2HQWA 2V53A 2OTGB 3CTNA 4GBAA 4PE7A 2KGBC 1AHRA 1K90D 2H61C 4C0JA 1N65A 1ZUZA 2MRDA 5PALA 1DGVA 1MR8A 1NX1A 4M2OA 4QJ5B 2M7NA 1BT6A 1S36A 1OZSA 1CLBA 1CKKA 3BOWA 1RFJA 4BY5A 1QX7A 1XO5A 1XYDA 1CMGA 3HCMA 3PATA 1HQVA 1S3PA 1JFKA 2JT0A 1K95A 5KU1A 2JXCA 1CMFA 3A4UB 5K89A 1A4PA 1NCYA 1IQ5A 1ZMZA 1CLMA 4MBEA 4MVFA 3NSIA 1RWYA 2KI4C 2LV7A 5I2LA 2BE6A 1DJYA 3ICBA 2BE4A 1WLMA 3NSLA 4D1EA 1UHHA 3CR4X 1M31A 1XA5A 2DOQA 2LCPA 3DVKA 2E6WA 2KSPA 3EVUA 2LANA 2BKHB 1X02A 1R6PA 4M2QA 3DD4A 1CTRA 1K9PA 2HQ8A 1VRKA 4U8DA 4I5KA 1IH0A 2KI4B 5CPVA 3TZ1A 4IL1A 3D10A 3SG7A 1NX2A 2LLUA 3SG5A 1M45A 3WHTB 3I5FC 1TNQA 1YRUB 4USLA 1DJIA 2MHHA 1QS7A 1S6IA 4MN0A 3HX4A 3VRPA 4F0ZB 3KEVA 1DT7B 3M0WA 1G4YR 2F33A 4I5JA 1EL4A 4PHJA 4XYNA 3LK1A
chains in the Genus database with same CATH superfamily
1F54A 1XFZO 3I5GC 1SRAA 2L50A 4PCWA 1SPYA 2MLFC 3B6XA 5I2OA 1UHJA 3CABA 2JPOA 1QV0A 1U5IA 4INXA 3UNWA 4CLNA 2ZFDA 1MQ1A 4HSZA 4ZCUA 1DF0A 1TNXA 3I5FB 1K9UA 1KWOC 2LAPA 3NSOA 4MZKA 4XJKA 4YRUA 4JPZB 2KAXA 1YUSA 1V1FA 2H8VA 2KHNA 5I2QA 5KSZA 1IJ5A 1MHOA 1UHNA 1F71A 2L98A 2BBMA 2NZ0A 1TCOB 5JOLA 4N1GA 2M49B 3I5GB 3LL8B 5EL2A 3VRQA 4C0KA 1Y1XA 4GGNA 1F70A 2BCBA 1PRWA 3DY9A 3UO9A 5AFPA 1XFVO 2QEVA 3B87A 1KWOB 1Y0VH 2MLEC 3RZSA 1XFUO 2JZIA 4TNCA 2CBLA 1AP4A 2GGZA 2FOTA 1Y1AA 3O78A 3SJSA 1OE9B 2Y4QA 1YVLA 1IIOA 2Y1MA 1UHIA 1LVCD 1TNPA 5TNCA 5BPJA 4PHJA 1XFRA 2F3YA 1S5GZ 2M8UA 4ZCVA 2BNXA 4MRXA 3RM1A 5B8IB 3DZTA 2WCEA 1SW8A 4HREE 4A4BA 4GFTA 1QJTA 3CS1A 3CZTX 1A29A 1TIZA 1DJHA 2F2PA 1EG4A 1DTLA 3EKJA 1DJXA 2GTEA 4E68A 1BF5A 1B8LA 3C1VA 3D74A 4N1FA 3AKBA 1CDLA 1J7QA 1L2OC 1J7RA 4R1EA 2LNKA 3BOWB 4JQ0D 2QEHA 3NHTA 2R2IA 3GK1A 1YX7A 3FIAA 1AJ4A 4DIRA 1CM4A 2O5GA 1OOFA 3SIBA 2MJWB 2OPOA 1F4QA 5DKNA 1SCVA 1LA3A 3O6BA 1SKTA 1D1OA 1ALWA 2JTZA 3PALA 2TN4A 1L2OB 1XFXO 1IJ6A 3BUMB 4GUKA 1B1GA 5J3XA 2QEOA 3VRRA 3TDUA 4C0LA 2LVKA 1TWOA 1S6JA 1BLQA 1UUSA 4OR9B 2F2OA 5HLVA 2AAOA 2JULA 2KLDA 2VRGA 4OCIA 3S0GA 4MSPA 1YR5A 2LUCA 2M3WA 3VB1A 1OSAA 4N5XA 1BG1A 1CFDA 1PULA 2WOSA 1QLKA 1KSOA 3VGOA 2KI6C 2E30A 4OKHA 2CXJA 1JF2A 2L0PA 2CT9A 2LLTA 4YGBB 2HETA 2WC6A 2BKIB 1YURA 4GPLB 1OOJA 2L2CA 1TOPA 1NSHA 1SBJA 4FTGA 2LMTA 1KK7Z 2M29A 3JVTC 5FI6A 2M9GA 1LINA 1JF0A 1NIWA 1N0YA 1MXLC 2M1KB 1CNPA 1BU3A 2SASA 1J55A 4NDBA 1U5IB 3PM8A 3LCPC 1DF0B 1FW4A 4XJKB 1YX8A 2OS8C 1WRKA 1HT9A 3PN7C 4NQGA 1UWOA 1SCMC 3NXAA 1OW4A 3R1OA 3BFHA 1DMOA 1GGWA 4FQOA 3ZNIA 1YUUA 1XFWO 3TDZA 3R72A 3OGNA 2PSRA 2WCBA 3DVJA 1QX2A 2JNFA 1T14A 1LXFC 2KFGA 3GK4X 3OP0A 5I8NA 2KYFA 1KFXL 1J7PA 1EXRA 2HPSA 1SR6C 1TN4A 1PSBA 3AKAA 3BQ3A 3PN7B 4QJ4B 1SCMB 4MZJA 5HKWA 3FWCA 3S0BA 1KFUL 2JOJA 1KK7Y 4P5OE 1BR1B 1C3YA 1JWDA 3IF7A 1B7TZ 3I5IC 1PVBA 3DF0B 2CCMA 3GK2A 2M0RA 1K96A 2LHLA 1MWNA 1DJZA 2LE9B 1ZFSA 4M2PA 2P71A 2Q91A 1SR6B 3IQOA 3EG5B 4PT1A 1J1EA 2AUCA 2ZN8A 2KFFA 2NLNA 1NX3A 3H4SE 1OZOA 3KPXA 1K93D 3BUOB 2JWWA 2ZNEA 1AK8A 2EC6C 2WORA 3CR2A 3S0EA 2JC2A 4ORBB 4OV2A 3I5IB 1KCYA 1CFCA 2FCDA 1A75A 3CZ1A 2PMYA 3NHIA 5FYXA 3SG2A 1FI6A 2Y1NA 3E3RA 2HF5A 3PM2A 2NCPA 3D73A 1WRZA 2ZRSA 3WNXB 2BL0C 2JU0A 1WLZA 2L2EA 1SMGA 3O4YA 4I5NB 4AOMA 1JUOA 1G8IA 1KK8C 2KQYA 1LS8A 2EC6B 1OMVA 2KNEA 1F4OA 1DQEA 1M63B 1BR4B 2KFHA 4PE4A 3D0YA 4MEWA 3BUXB 2L4IA 1IQ3A 2QPTA 1PVAA 1IKUA 1QTXA 3Q8IA 1TNWA 3AAJA 2LMUA 3K1EA 3CGAA 1QWVA 1L7ZA 1LA0A 2BL0B 5AERA 1J7OA 2BCXA 1OMDA 5AANA 2KDHA 3CWGA 1QATA 1KK8B 1TUJA 4MRYA 5I94A 3PFVA 4MLWA 1H8BA 4F7FA 1QIWA 2EHBA 3DVMA 4JKTA 4HRHA 1UHKA 1A03A 1K2HA 1KQMC 2WCLA 1CB1A 1M39A 4PE1A 3B86A 5F6TA 2MA2A 1QASA 3DYEA 5HYDA 2JNXA 1RJVA 3OB1B 4YGAA 3D78A 2MBXA 1SYMA 4DCKA 1B8CA 1CLLA 1C07A 1CDNA 2ZN9A 1NPQA 1KSMA 1NX0A 4CIDA 3PLFB 1B9AA 1YVHA 4JWQA 1Y6WA 2PALA 3WXAA 3EKHA 1TTXA 1TCFA 1KQMB 2ZRTA 2KOTA 3SS4A 1WY9A 1XVJA 3BYAA 2B1UA 3EK8A 3GOFA 5HL1A 1JFJA 1S5GY 5IBWA 2RGIA 2K2AA 2F8PA 2BAPA 5ER4X 3VRNA 2WCKA 4INWA 1F8HA 2K61A 1MXEA 3BXKA 1JC2A 1IWQA 1QV1A 4YGEB 3B88A 1ALVA 4AQJA 2PASA 2K60A 2OTGC 1CDMA 3D75A 3RLZA 1W7IB 2JQ6A 3OX5A 3QRXA 4YBHB 1B8RA 1QVIZ 1C3ZA 1N2DA 4HRGA 2I2RE 2K2FA 3FS7A 2LP3A 2JPTA 4ORCB 3SS5A 2JTTA 2CTNA 3BJHA 3BUNB 5KTYA 2H2KA 4CFRA 3V2LA 3S0DA 4YI8A 1KQVA 3L4AA 3PSRA 5G08A 3QMEA 5AXIA 5JJGA 3SG3A 4YGCB 3A8RA 5FI2A 1EH2A 5CSIA 2Y5IA 2KGRA 5CSNA 1Y1UA 2ZNDA 1MF8B 5FI7A 1CFPA 2FJUB 1RK9A 4DRWA 4MZLA 2LC5A 1CFFA 4YGDB 1C7WA 1AUIB 2KPHA 2QACA 2G2BA 1A2XA 3AAKA 1UURA 1K8UA 2NCOA 4NDCA 2M97A 3BFAA 4UPGA 4CFQA 2BBNA 1DC1A 2D8NA 2KBIA 2WC5A 1PALA 3SG4A 1SNLA 3CLNA 1PK0D 1XK4A 2LVIA 4DS7A 1NYAA 1S1EA 1OMRA 1IG5A 1QIVA 2M1UA 3BUWB 3EVRA 3JVTB 3NGVA 2JT3A 5CSFA 3TS5C 4OVNF 1S26D 1ZOTB 1QVIY 2PVBA 2I7AA 3I5HC 1GM0A 1A75B 3DXLA 2BECA 2L51A 1DJGA 2LP2A 3TUYC 1JBAA 1DJWA 1EJ3A 2OS8B 3SIAA 2COLB 2WCJA 1OOIX 4PALA 1BJFA 3TS5B 1XFYO 1BODA 3OHMB 4PHMA 3S0AA 1FBVA 3I5HB 2SCPA 5HKZA 3D0YB 3TUYB 4GGFA 1PSRA 3CR5X 1Z4HA 4L9MA 3R1VA 1DVIA 3B7AA 3FWBA 2WC8A 3DVEA 3OBVA 2H61A 2LLSA 1GGZA 5AEQA 4NDDA 2QEBA 2KAYA 4ICBA 1RECA 3EK4A 3LLEA 4A4CA 2I94A 5DKRA 1GJYA 2JRFA 3KF9A 1GQMA 2JXLA 2K7BA 1YRTB 1CM1A 2F3ZA 1BMOA 1ODBA 2FCEA 2CNPA 2LHIA 4PHNA 1YUTA 1R2UA 4GAOA 2KAVA 3FE9A 4PE0A 5HLOA 4OZDA 5DKQA 3O4XA 1B47A 1NCXA 1FF1A 3OX6A 1F55A 1UP5A 5CSJA 1QX5B 4Q04A 2WCFA 3SG6A 1KFXS 1NUBA 1RROA 4DUQA 2WNDA 1NCZA 1NWDA 1SL9A 1B7TY 1OOGA 1TUZA 1MUXA 3EK7A 4WQ2A 3TDIA 2Q4UA 1KFUS 4ETOA 3SS3A 1W9ZA 5D7FA 5ER5A 2BCAA 1K9KA 2KQ6A 1FI5A 3OB2B 4PHKA 1M46A 1BOCA 1IGVA 1EG3A 2PRUA 1FPWA 2L4HA 1RTP1 1AJ5A 3IQQA 4QJ3B 2GGMA 3L47A 1OQPA 2PYQA 3EVVA 3KO0A 3LK0A 2ISDA 2P6BB 1Q80A 1NP8A 1LKJA 2K7OA 1S6CA 2K7DA 2LM5A 4WQ3A 5GQQC 1ORGA 1SL8A 2LVVA 3DF0A 3ZWHA 5HKYA 2MAZA 3JTDC 2K8MB 4YI9A 2KBMA 3MSEB 1SK6D 1ZACA 3FE6A 4GNKB 3WHUB 3N7HA 1JSAA 2JT8A 2GV5A 2KYCA 1P28A 3O2PA 2EGDA 1XK4C 2IS9A 2G9BA 2NXQA 3R1PA 4PDZA 1SL7A 1W7JB 1TRFA 1WDCC 3KHEA 2WCMA 2O60A 1V1GA 3F45A 3BFBA 1AVSA 2L5XB 1B4CA 1SSEB 3JTDB 1C7VA 1OOHA 3CYZA 1E8AA 2ERBA 4WRIA 3VROA 4I5LB 2A4JA 4CPVA 4ORAB 4KYNA 1IRJA 1QLSA 2K7CA 2KI6D 3CZ2A 3K21A 4AQIA 1DGUA 1YTZC 1G33A 4BY4A 4IJ7A 4P2YB 1K94A 1WDCB 1QXPA 1WRLA 5D69A 2K0JA 2LMVA 2LVJA 2P70A 1SY9A 2ZKMX 2AMIA 2LUXA 2M7LA 2WCHA 2I18A 3NSKA 3D76A 1H4BA 4GGFC 1CDPA 1J1DA 2HQWA 2V53A 2OTGB 3CTNA 4GBAA 4PE7A 2KGBC 1AHRA 1K90D 2H61C 4C0JA 1N65A 1ZUZA 2MRDA 5PALA 1DGVA 1MR8A 1NX1A 4M2OA 1Z2CB 4QJ5B 2M7NA 1BT6A 1S36A 1OZSA 1CLBA 1CKKA 3BOWA 1RFJA 3L4LA 2YGUA 4BY5A 3D77A 1QX7A 1XO5A 2QDIA 1XYDA 1CMGA 3HCMA 3PATA 1HQVA 1S3PA 1JFKA 2JT0A 1K95A 2FJYA 2JXCA 5KU1A 1CMFA 2PQLA 3A4UB 5K89A 1A4PA 1NCYA 1IQ5A 1ZMZA 3CDNA 4FQTA 1CLMA 4MBEA 4MVFA 3NSIA 1RWYA 2KI4C 2LV7A 3IVTA 5DICA 5I2LA 2BE6A 1DJYA 3ICBA 2BE4A 1WLMA 3NSLA 4D1EA 1UHHA 3CR4X 1M31A 1XA5A 2DOQA 2LCPA 2KLEA 3DVKA 2E6WA 2KSPA 3EVUA 2LANA 2BKHB 1X02A 1R6PA 4M2QA 3DD4A 3CZ0A 1CTRA 2L5YA 1K9PA 2HQ8A 1VRKA 4U8DA 4I5KA 3FE8A 1IH0A 1DEKA 2KI4B 3S0FA 5CPVA 3TZ1A 4IL1A 3D10A 3SG7A 1NX2A 2LLUA 4JD9A 5D3OA 3SG5A 1M45A 3WHTB 3I5FC 1TNQA 1YRUB 4USLA 1DJIA 2MHHA 3PJIA 1QS7A 1S6IA 4MN0A 3HX4A 3VRPA 4F0ZB 3KEVA 1DT7B 3M0WA 1G4YR 2F33A 4I5JA 1EL4A 1DELA 4XYNA 3LK1A
chains in the Genus database with same CATH topology
1F54A 1XFZO 3I5GC 1SRAA 2L50A 4PCWA 1SPYA 2MLFC 5I2OA 1UHJA 4CLNA 1QV0A 1U5IA 2ZFDA 1MQ1A 4HSZA 4ZCUA 1DF0A 1TNXA 3I5FB 1K9UA 1KWOC 2LAPA 3NSOA 4MZKA 4XJKA 4YRUA 4JPZB 2KAXA 1YUSA 1V1FA 2KHNA 5I2QA 5KSZA 1IJ5A 1MHOA 1UHNA 1F71A 2L98A 2BBMA 2NZ0A 1TCOB 5JOLA 4N1GA 2M49B 3I5GB 3LL8B 3VRQA 4C0KA 1Y1XA 4GGNA 1F70A 2BCBA 1PRWA 5AFPA 1XFVO 1KWOB 1Y0VH 2MLEC 1XFUO 2JZIA 4TNCA 2CBLA 1AP4A 2GGZA 2FOTA 1Y1AA 3O78A 3SJSA 1OE9B 2Y4QA 1YVLA 2Y1MA 1UHIA 1LVCD 1TNPA 5TNCA 5BPJA 2F3YA 1S5GZ 2M8UA 4ZCVA 4MRXA 3RM1A 5B8IB 2WCEA 1SW8A 4HREE 4A4BA 4GFTA 1QJTA 3CS1A 3CZTX 1A29A 1TIZA 1DJHA 2F2PA 1EG4A 1DTLA 3EKJA 1DJXA 4E68A 1BF5A 1B8LA 3C1VA 4N1FA 3AKBA 1CDLA 1J7QA 1L2OC 1J7RA 4R1EA 2LNKA 3BOWB 4JQ0D 2R2IA 3GK1A 1YX7A 3FIAA 1AJ4A 4DIRA 1CM4A 2O5GA 3SIBA 2MJWB 2OPOA 1F4QA 5DKNA 1SCVA 1LA3A 3O6BA 1SKTA 1D1OA 1ALWA 2JTZA 3PALA 2TN4A 1L2OB 1XFXO 1IJ6A 3BUMB 4GUKA 1B1GA 5J3XA 3VRRA 3TDUA 4C0LA 2LVKA 1S6JA 1BLQA 1UUSA 4OR9B 2F2OA 5HLVA 2AAOA 2JULA 2VRGA 4OCIA 4MSPA 1YR5A 2LUCA 2M3WA 1OSAA 4N5XA 1BG1A 1CFDA 1PULA 2WOSA 1QLKA 1KSOA 3VGOA 2KI6C 2E30A 4OKHA 2CXJA 1JF2A 2L0PA 2CT9A 2LLTA 4YGBB 2HETA 2BKIB 1YURA 4GPLB 1OOJA 1TOPA 1NSHA 1SBJA 4FTGA 2LMTA 1KK7Z 2M29A 3JVTC 2M9GA 1LINA 1JF0A 1NIWA 1N0YA 1MXLC 2M1KB 1CNPA 1BU3A 2SASA 1J55A 4NDBA 1U5IB 3PM8A 3LCPC 1DF0B 1FW4A 4XJKB 1YX8A 2OS8C 1WRKA 1HT9A 3PN7C 4NQGA 1UWOA 1SCMC 3NXAA 1GGWA 1DMOA 4FQOA 3ZNIA 1YUUA 1XFWO 3TDZA 2PSRA 2WCBA 3DVJA 1QX2A 2JNFA 3OP0A 1LXFC 2KFGA 3GK4X 5I8NA 1J7PA 2KYFA 1KFXL 1EXRA 2HPSA 1SR6C 1TN4A 1PSBA 3AKAA 3BQ3A 3PN7B 4QJ4B 1SCMB 4MZJA 5HKWA 3FWCA 1KFUL 2JOJA 1KK7Y 4P5OE 1BR1B 1JWDA 3IF7A 1B7TZ 3I5IC 1PVBA 3DF0B 2CCMA 3GK2A 2M0RA 1K96A 2LHLA 1MWNA 1DJZA 2LE9B 1ZFSA 4M2PA 2Q91A 1SR6B 3IQOA 4DCKA 1J1EA 2AUCA 2ZN8A 2KFFA 2NLNA 1NX3A 3H4SE 1OZOA 3KPXA 1K93D 3BUOB 2JWWA 2ZNEA 1AK8A 2EC6C 2WORA 3CR2A 2JC2A 4ORBB 4OV2A 3I5IB 1KCYA 1CFCA 2FCDA 1A75A 3SG2A 2PMYA 5FYXA 1FI6A 2Y1NA 3E3RA 2HF5A 2NCPA 1WRZA 2ZRSA 3WNXB 2BL0C 2JU0A 1WLZA 2L2EA 1SMGA 3O4YA 4I5NB 4AOMA 1JUOA 1G8IA 1KK8C 2KQYA 2EC6B 1OMVA 2KNEA 1F4OA 1M63B 1BR4B 2KFHA 4PE4A 3D0YA 4MEWA 3BUXB 2L4IA 1IQ3A 2QPTA 1PVAA 1IKUA 1QTXA 1TNWA 3AAJA 2LMUA 3CGAA 1L7ZA 1LA0A 2BL0B 5AERA 1J7OA 2BCXA 1OMDA 5AANA 2KDHA 3CWGA 1QATA 1KK8B 4MRYA 3PFVA 4MLWA 1H8BA 1QIWA 2EHBA 3DVMA 1A03A 4HRHA 1UHKA 1K2HA 1KQMC 1CB1A 1M39A 4PE1A 5F6TA 2MA2A 1QASA 5HYDA 2JNXA 1RJVA 3OB1B 4YGAA 2MBXA 1C07A 1SYMA 1B8CA 1CLLA 1CDNA 2ZN9A 1NPQA 1KSMA 1NX0A 4CIDA 3PLFB 1B9AA 1YVHA 4JWQA 1Y6WA 2PALA 3WXAA 3EKHA 1TTXA 1TCFA 1KQMB 2ZRTA 2KOTA 1WY9A 1XVJA 3BYAA 2B1UA 3EK8A 3GOFA 1JFJA 1S5GY 5IBWA 2RGIA 2K2AA 2F8PA 5ER4X 3VRNA 1F8HA 2K61A 1MXEA 3BXKA 1JC2A 1IWQA 1QV1A 4YGEB 1ALVA 4AQJA 2PASA 2OTGC 1CDMA 3RLZA 1W7IB 2JQ6A 3OX5A 3QRXA 4YBHB 1B8RA 1QVIZ 1N2DA 4HRGA 2I2RE 2K2FA 3FS7A 2LP3A 2JPTA 4ORCB 2JTTA 2CTNA 3BUNB 5KTYA 2H2KA 4CFRA 4YI8A 1KQVA 5G08A 3PSRA 5AXIA 5JJGA 3SG3A 4YGCB 3A8RA 1EH2A 5CSIA 2Y5IA 2KGRA 5CSNA 1Y1UA 2ZNDA 1MF8B 1CFPA 2FJUB 1RK9A 4DRWA 4MZLA 2LC5A 1CFFA 4YGDB 1C7WA 1AUIB 2QACA 2G2BA 1A2XA 3AAKA 1UURA 1K8UA 2NCOA 4NDCA 2M97A 4UPGA 4CFQA 2BBNA 2D8NA 2KBIA 1PALA 3SG4A 1SNLA 3CLNA 1PK0D 1XK4A 2LVIA 4DS7A 1NYAA 1S1EA 1OMRA 1IG5A 1QIVA 2M1UA 3BUWB 3EVRA 3JVTB 2JT3A 5CSFA 3TS5C 4OVNF 1S26D 1ZOTB 1QVIY 2PVBA 2I7AA 3I5HC 1A75B 2BECA 2L51A 1DJGA 2LP2A 3TUYC 1JBAA 1DJWA 1EJ3A 2OS8B 3SIAA 2COLB 4PALA 1BJFA 3TS5B 1XFYO 1BODA 3OHMB 4PHMA 1FBVA 3I5HB 2SCPA 5HKZA 3D0YB 3TUYB 4GGFA 1PSRA 3CR5X 4L9MA 1DVIA 3FWBA 2WC8A 3DVEA 2H61A 2LLSA 1GGZA 5AEQA 4NDDA 4ICBA 2KAYA 1RECA 3EK4A 3LLEA 4A4CA 2I94A 5DKRA 1GJYA 2JRFA 3KF9A 1GQMA 2JXLA 2K7BA 1YRTB 1CM1A 2F3ZA 1BMOA 1ODBA 2FCEA 2CNPA 2LHIA 4PHNA 1YUTA 1R2UA 4GAOA 2KAVA 4PE0A 5HLOA 5DKQA 1B47A 1NCXA 1FF1A 3OX6A 1F55A 1UP5A 5CSJA 1QX5B 4Q04A 2WCFA 3SG6A 1KFXS 1NUBA 1RROA 4DUQA 2WNDA 1NCZA 1NWDA 1SL9A 1B7TY 1MUXA 3EK7A 4WQ2A 3TDIA 2Q4UA 1KFUS 4ETOA 5D7FA 5ER5A 2BCAA 1K9KA 2KQ6A 1FI5A 3OB2B 4PHKA 1M46A 1BOCA 1IGVA 1EG3A 2PRUA 1FPWA 2L4HA 1RTP1 1AJ5A 3IQQA 4QJ3B 2GGMA 1OQPA 3KO0A 3EVVA 3LK0A 2ISDA 2P6BB 1Q80A 1NP8A 1LKJA 2K7OA 1S6CA 2K7DA 2LM5A 4WQ3A 5GQQC 1SL8A 2LVVA 3DF0A 3ZWHA 5HKYA 2MAZA 3JTDC 2K8MB 4YI9A 2KBMA 3MSEB 1SK6D 1ZACA 4GNKB 3WHUB 1JSAA 2JT8A 2GV5A 2KYCA 3O2PA 2EGDA 1XK4C 2IS9A 2G9BA 2NXQA 4PDZA 1SL7A 1W7JB 1TRFA 1WDCC 3KHEA 2O60A 1V1GA 3F45A 1AVSA 2L5XB 1B4CA 3JTDB 1C7VA 1E8AA 4WRIA 3VROA 4I5LB 2A4JA 4CPVA 4ORAB 1IRJA 1QLSA 2K7CA 2KI6D 3K21A 4AQIA 1DGUA 1YTZC 1G33A 4BY4A 4P2YB 1K94A 1WDCB 1QXPA 1WRLA 5D69A 2K0JA 2LMVA 2LVJA 1SY9A 2ZKMX 2AMIA 2LUXA 2M7LA 2I18A 3NSKA 1H4BA 4GGFC 1CDPA 1J1DA 2HQWA 2V53A 2OTGB 3CTNA 4GBAA 4PE7A 2KGBC 1AHRA 1K90D 2H61C 4C0JA 1N65A 1ZUZA 2MRDA 5PALA 1DGVA 1MR8A 1NX1A 4M2OA 4QJ5B 2M7NA 1BT6A 1S36A 1OZSA 1CLBA 1CKKA 3BOWA 1RFJA 4BY5A 1QX7A 1XO5A 1XYDA 1CMGA 3HCMA 3PATA 1HQVA 1S3PA 1JFKA 2JT0A 1K95A 5KU1A 2JXCA 1CMFA 3A4UB 5K89A 1A4PA 1NCYA 1IQ5A 1ZMZA 1CLMA 4MBEA 4MVFA 3NSIA 1RWYA 2KI4C 2LV7A 5I2LA 2BE6A 1DJYA 3ICBA 2BE4A 1WLMA 3NSLA 4D1EA 1UHHA 3CR4X 1M31A 1XA5A 2DOQA 2LCPA 3DVKA 2E6WA 2KSPA 3EVUA 2LANA 2BKHB 1X02A 1R6PA 4M2QA 3DD4A 1CTRA 1K9PA 2HQ8A 1VRKA 4U8DA 4I5KA 1IH0A 2KI4B 5CPVA 3TZ1A 4IL1A 3D10A 3SG7A 1NX2A 2LLUA 3SG5A 1M45A 3WHTB 3I5FC 1TNQA 1YRUB 4USLA 1DJIA 2MHHA 1QS7A 1S6IA 4MN0A 3HX4A 3VRPA 4F0ZB 3KEVA 1DT7B 3M0WA 1G4YR 2F33A 4I5JA 1EL4A 4PHJA 4XYNA 3LK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F54 A;  1XFZ O;  3I5G C;  1SRA A;  2L50 A;  4PCW A;  1SPY A;  2MLF C;  5I2O A;  1UHJ A;  4CLN A;  1QV0 A;  1U5I A;  2ZFD A;  1MQ1 A;  4HSZ A;  4ZCU A;  1DF0 A;  1TNX A;  3I5F B;  1K9U A;  1KWO C;  2LAP A;  3NSO A;  4MZK A;  4XJK A;  4YRU A;  4JPZ B;  2KAX A;  1YUS A;  1V1F A;  2KHN A;  5I2Q A;  5KSZ A;  1IJ5 A;  1MHO A;  1UHN A;  1F71 A;  2L98 A;  2BBM A;  2NZ0 A;  1TCO B;  5JOL A;  4N1G A;  2M49 B;  3I5G B;  3LL8 B;  3VRQ A;  4C0K A;  1Y1X A;  4GGN A;  1F70 A;  2BCB A;  1PRW A;  5AFP A;  1XFV O;  1KWO B;  1Y0V H;  2MLE C;  1XFU O;  2JZI A;  4TNC A;  2CBL A;  1AP4 A;  2GGZ A;  2FOT A;  1Y1A A;  3O78 A;  3SJS A;  1OE9 B;  2Y4Q A;  1YVL A;  2Y1M A;  1UHI A;  1LVC D;  1TNP A;  5TNC A;  5BPJ A;  2F3Y A;  1S5G Z;  2M8U A;  4ZCV A;  4MRX A;  3RM1 A;  5B8I B;  2WCE A;  1SW8 A;  4HRE E;  4A4B A;  4GFT A;  1QJT A;  3CS1 A;  3CZT X;  1A29 A;  1TIZ A;  1DJH A;  2F2P A;  1EG4 A;  1DTL A;  3EKJ A;  1DJX A;  4E68 A;  1BF5 A;  1B8L A;  3C1V A;  4N1F A;  3AKB A;  1CDL A;  1J7Q A;  1L2O C;  1J7R A;  4R1E A;  2LNK A;  3BOW B;  4JQ0 D;  2R2I A;  3GK1 A;  1YX7 A;  3FIA A;  1AJ4 A;  4DIR A;  1CM4 A;  2O5G A;  3SIB A;  2MJW B;  2OPO A;  1F4Q A;  5DKN A;  1SCV A;  1LA3 A;  3O6B A;  1SKT A;  1D1O A;  1ALW A;  2JTZ A;  3PAL A;  2TN4 A;  1L2O B;  1XFX O;  1IJ6 A;  3BUM B;  4GUK A;  1B1G A;  5J3X A;  3VRR A;  3TDU A;  4C0L A;  2LVK A;  1S6J A;  1BLQ A;  1UUS A;  4OR9 B;  2F2O A;  5HLV A;  2AAO A;  2JUL A;  2VRG A;  4OCI A;  4MSP A;  1YR5 A;  2LUC A;  2M3W A;  1OSA A;  4N5X A;  1BG1 A;  1CFD A;  1PUL A;  2WOS A;  1QLK A;  1KSO A;  3VGO A;  2KI6 C;  2E30 A;  4OKH A;  2CXJ A;  1JF2 A;  2L0P A;  2CT9 A;  2LLT A;  4YGB B;  2HET A;  2BKI B;  1YUR A;  4GPL B;  1OOJ A;  1TOP A;  1NSH A;  1SBJ A;  4FTG A;  2LMT A;  1KK7 Z;  2M29 A;  3JVT C;  2M9G A;  1LIN A;  1JF0 A;  1NIW A;  1N0Y A;  1MXL C;  2M1K B;  1CNP A;  1BU3 A;  2SAS A;  1J55 A;  4NDB A;  1U5I B;  3PM8 A;  3LCP C;  1DF0 B;  1FW4 A;  4XJK B;  1YX8 A;  2OS8 C;  1WRK A;  1HT9 A;  3PN7 C;  4NQG A;  1UWO A;  1SCM C;  3NXA A;  1GGW A;  1DMO A;  4FQO A;  3ZNI A;  1YUU A;  1XFW O;  3TDZ A;  2PSR A;  2WCB A;  3DVJ A;  1QX2 A;  2JNF A;  3OP0 A;  1LXF C;  2KFG A;  3GK4 X;  5I8N A;  1J7P A;  2KYF A;  1KFX L;  1EXR A;  2HPS A;  1SR6 C;  1TN4 A;  1PSB A;  3AKA A;  3BQ3 A;  3PN7 B;  4QJ4 B;  1SCM B;  4MZJ A;  5HKW A;  3FWC A;  1KFU L;  2JOJ A;  1KK7 Y;  4P5O E;  1BR1 B;  1JWD A;  3IF7 A;  1B7T Z;  3I5I C;  1PVB A;  3DF0 B;  2CCM A;  3GK2 A;  2M0R A;  1K96 A;  2LHL A;  1MWN A;  1DJZ A;  2LE9 B;  1ZFS A;  4M2P A;  2Q91 A;  1SR6 B;  3IQO A;  4DCK A;  1J1E A;  2AUC A;  2ZN8 A;  2KFF A;  2NLN A;  1NX3 A;  3H4S E;  1OZO A;  3KPX A;  1K93 D;  3BUO B;  2JWW A;  2ZNE A;  1AK8 A;  2EC6 C;  2WOR A;  3CR2 A;  2JC2 A;  4ORB B;  4OV2 A;  3I5I B;  1KCY A;  1CFC A;  2FCD A;  1A75 A;  3SG2 A;  2PMY A;  5FYX A;  1FI6 A;  2Y1N A;  3E3R A;  2HF5 A;  2NCP A;  1WRZ A;  2ZRS A;  3WNX B;  2BL0 C;  2JU0 A;  1WLZ A;  2L2E A;  1SMG A;  3O4Y A;  4I5N B;  4AOM A;  1JUO A;  1G8I A;  1KK8 C;  2KQY A;  2EC6 B;  1OMV A;  2KNE A;  1F4O A;  1M63 B;  1BR4 B;  2KFH A;  4PE4 A;  3D0Y A;  4MEW A;  3BUX B;  2L4I A;  1IQ3 A;  2QPT A;  1PVA A;  1IKU A;  1QTX A;  1TNW A;  3AAJ A;  2LMU A;  3CGA A;  1L7Z A;  1LA0 A;  2BL0 B;  5AER A;  1J7O A;  2BCX A;  1OMD A;  5AAN A;  2KDH A;  3CWG A;  1QAT A;  1KK8 B;  4MRY A;  3PFV A;  4MLW A;  1H8B A;  1QIW A;  2EHB A;  3DVM A;  1A03 A;  4HRH A;  1UHK A;  1K2H A;  1KQM C;  1CB1 A;  1M39 A;  4PE1 A;  5F6T A;  2MA2 A;  1QAS A;  5HYD A;  2JNX A;  1RJV A;  3OB1 B;  4YGA A;  2MBX A;  1C07 A;  1SYM A;  1B8C A;  1CLL A;  1CDN A;  2ZN9 A;  1NPQ A;  1KSM A;  1NX0 A;  4CID A;  3PLF B;  1B9A A;  1YVH A;  4JWQ A;  1Y6W A;  2PAL A;  3WXA A;  3EKH A;  1TTX A;  1TCF A;  1KQM B;  2ZRT A;  2KOT A;  1WY9 A;  1XVJ A;  3BYA A;  2B1U A;  3EK8 A;  3GOF A;  1JFJ A;  1S5G Y;  5IBW A;  2RGI A;  2K2A A;  2F8P A;  5ER4 X;  3VRN A;  1F8H A;  2K61 A;  1MXE A;  3BXK A;  1JC2 A;  1IWQ A;  1QV1 A;  4YGE B;  1ALV A;  4AQJ A;  2PAS A;  2OTG C;  1CDM A;  3RLZ A;  1W7I B;  2JQ6 A;  3OX5 A;  3QRX A;  4YBH B;  1B8R A;  1QVI Z;  1N2D A;  4HRG A;  2I2R E;  2K2F A;  3FS7 A;  2LP3 A;  2JPT A;  4ORC B;  2JTT A;  2CTN A;  3BUN B;  5KTY A;  2H2K A;  4CFR A;  4YI8 A;  1KQV A;  5G08 A;  3PSR A;  5AXI A;  5JJG A;  3SG3 A;  4YGC B;  3A8R A;  1EH2 A;  5CSI A;  2Y5I A;  2KGR A;  5CSN A;  1Y1U A;  2ZND A;  1MF8 B;  1CFP A;  2FJU B;  1RK9 A;  4DRW A;  4MZL A;  2LC5 A;  1CFF A;  4YGD B;  1C7W A;  1AUI B;  2QAC A;  2G2B A;  1A2X A;  3AAK A;  1UUR A;  1K8U A;  2NCO A;  4NDC A;  2M97 A;  4UPG A;  4CFQ A;  2BBN A;  2D8N A;  2KBI A;  1PAL A;  3SG4 A;  1SNL A;  3CLN A;  1PK0 D;  1XK4 A;  2LVI A;  4DS7 A;  1NYA A;  1S1E A;  1OMR A;  1IG5 A;  1QIV A;  2M1U A;  3BUW B;  3EVR A;  3JVT B;  2JT3 A;  5CSF A;  3TS5 C;  4OVN F;  1S26 D;  1ZOT B;  1QVI Y;  2PVB A;  2I7A A;  3I5H C;  1A75 B;  2BEC A;  2L51 A;  1DJG A;  2LP2 A;  3TUY C;  1JBA A;  1DJW A;  1EJ3 A;  2OS8 B;  3SIA A;  2COL B;  4PAL A;  1BJF A;  3TS5 B;  1XFY O;  1BOD A;  3OHM B;  4PHM A;  1FBV A;  3I5H B;  2SCP A;  5HKZ A;  3D0Y B;  3TUY B;  4GGF A;  1PSR A;  3CR5 X;  4L9M A;  1DVI A;  3FWB A;  2WC8 A;  3DVE A;  2H61 A;  2LLS A;  1GGZ A;  5AEQ A;  4NDD A;  4ICB A;  2KAY A;  1REC A;  3EK4 A;  3LLE A;  4A4C A;  2I94 A;  5DKR A;  1GJY A;  2JRF A;  3KF9 A;  1GQM A;  2JXL A;  2K7B A;  1YRT B;  1CM1 A;  2F3Z A;  1BMO A;  1ODB A;  2FCE A;  2CNP A;  2LHI A;  4PHN A;  1YUT A;  1R2U A;  4GAO A;  2KAV A;  4PE0 A;  5HLO A;  5DKQ A;  1B47 A;  1NCX A;  1FF1 A;  3OX6 A;  1F55 A;  1UP5 A;  5CSJ A;  1QX5 B;  4Q04 A;  2WCF A;  3SG6 A;  1KFX S;  1NUB A;  1RRO A;  4DUQ A;  2WND A;  1NCZ A;  1NWD A;  1SL9 A;  1B7T Y;  1MUX A;  3EK7 A;  4WQ2 A;  3TDI A;  2Q4U A;  1KFU S;  4ETO A;  5D7F A;  5ER5 A;  2BCA A;  1K9K A;  2KQ6 A;  1FI5 A;  3OB2 B;  4PHK A;  1M46 A;  1BOC A;  1IGV A;  1EG3 A;  2PRU A;  1FPW A;  2L4H A;  1RTP 1;  1AJ5 A;  3IQQ A;  4QJ3 B;  2GGM A;  1OQP A;  3KO0 A;  3EVV A;  3LK0 A;  2ISD A;  2P6B B;  1Q80 A;  1NP8 A;  1LKJ A;  2K7O A;  1S6C A;  2K7D A;  2LM5 A;  4WQ3 A;  5GQQ C;  1SL8 A;  2LVV A;  3DF0 A;  3ZWH A;  5HKY A;  2MAZ A;  3JTD C;  2K8M B;  4YI9 A;  2KBM A;  3MSE B;  1SK6 D;  1ZAC A;  4GNK B;  3WHU B;  1JSA A;  2JT8 A;  2GV5 A;  2KYC A;  3O2P A;  2EGD A;  1XK4 C;  2IS9 A;  2G9B A;  2NXQ A;  4PDZ A;  1SL7 A;  1W7J B;  1TRF A;  1WDC C;  3KHE A;  2O60 A;  1V1G A;  3F45 A;  1AVS A;  2L5X B;  1B4C A;  3JTD B;  1C7V A;  1E8A A;  4WRI A;  3VRO A;  4I5L B;  2A4J A;  4CPV A;  4ORA B;  1IRJ A;  1QLS A;  2K7C A;  2KI6 D;  3K21 A;  4AQI A;  1DGU A;  1YTZ C;  1G33 A;  4BY4 A;  4P2Y B;  1K94 A;  1WDC B;  1QXP A;  1WRL A;  5D69 A;  2K0J A;  2LMV A;  2LVJ A;  1SY9 A;  2ZKM X;  2AMI A;  2LUX A;  2M7L A;  2I18 A;  3NSK A;  1H4B A;  4GGF C;  1CDP A;  1J1D A;  2HQW A;  2V53 A;  2OTG B;  3CTN A;  4GBA A;  4PE7 A;  2KGB C;  1AHR A;  1K90 D;  2H61 C;  4C0J A;  1N65 A;  1ZUZ A;  2MRD A;  5PAL A;  1DGV A;  1MR8 A;  1NX1 A;  4M2O A;  4QJ5 B;  2M7N A;  1BT6 A;  1S36 A;  1OZS A;  1CLB A;  1CKK A;  3BOW A;  1RFJ A;  4BY5 A;  1QX7 A;  1XO5 A;  1XYD A;  1CMG A;  3HCM A;  3PAT A;  1HQV A;  1S3P A;  1JFK A;  2JT0 A;  1K95 A;  5KU1 A;  2JXC A;  1CMF A;  3A4U B;  5K89 A;  1A4P A;  1NCY A;  1IQ5 A;  1ZMZ A;  1CLM A;  4MBE A;  4MVF A;  3NSI A;  1RWY A;  2KI4 C;  2LV7 A;  5I2L A;  2BE6 A;  1DJY A;  3ICB A;  2BE4 A;  1WLM A;  3NSL A;  4D1E A;  1UHH A;  3CR4 X;  1M31 A;  1XA5 A;  2DOQ A;  2LCP A;  3DVK A;  2E6W A;  2KSP A;  3EVU A;  2LAN A;  2BKH B;  1X02 A;  1R6P A;  4M2Q A;  3DD4 A;  1CTR A;  1K9P A;  2HQ8 A;  1VRK A;  4U8D A;  4I5K A;  1IH0 A;  2KI4 B;  5CPV A;  3TZ1 A;  4IL1 A;  3D10 A;  3SG7 A;  1NX2 A;  2LLU A;  3SG5 A;  1M45 A;  3WHT B;  3I5F C;  1TNQ A;  1YRU B;  4USL A;  1DJI A;  2MHH A;  1QS7 A;  1S6I A;  4MN0 A;  3HX4 A;  3VRP A;  4F0Z B;  3KEV A;  1DT7 B;  3M0W A;  1G4Y R;  2F33 A;  4I5J A;  1EL4 A;  4PHJ A;  4XYN A;  3LK1 A; 
#chains in the Genus database with same CATH topology
 1F54 A;  1XFZ O;  3I5G C;  1SRA A;  2L50 A;  4PCW A;  1SPY A;  2MLF C;  3B6X A;  5I2O A;  1UHJ A;  3CAB A;  2JPO A;  1QV0 A;  1U5I A;  4INX A;  3UNW A;  4CLN A;  2ZFD A;  1MQ1 A;  4HSZ A;  4ZCU A;  1DF0 A;  1TNX A;  3I5F B;  1K9U A;  1KWO C;  2LAP A;  3NSO A;  4MZK A;  4XJK A;  4YRU A;  4JPZ B;  2KAX A;  1YUS A;  1V1F A;  2H8V A;  2KHN A;  5I2Q A;  5KSZ A;  1IJ5 A;  1MHO A;  1UHN A;  1F71 A;  2L98 A;  2BBM A;  2NZ0 A;  1TCO B;  5JOL A;  4N1G A;  2M49 B;  3I5G B;  3LL8 B;  5EL2 A;  3VRQ A;  4C0K A;  1Y1X A;  4GGN A;  1F70 A;  2BCB A;  1PRW A;  3DY9 A;  3UO9 A;  5AFP A;  1XFV O;  2QEV A;  3B87 A;  1KWO B;  1Y0V H;  2MLE C;  3RZS A;  1XFU O;  2JZI A;  4TNC A;  2CBL A;  1AP4 A;  2GGZ A;  2FOT A;  1Y1A A;  3O78 A;  3SJS A;  1OE9 B;  2Y4Q A;  1YVL A;  1IIO A;  2Y1M A;  1UHI A;  1LVC D;  1TNP A;  5TNC A;  5BPJ A;  4PHJ A;  1XFR A;  2F3Y A;  1S5G Z;  2M8U A;  4ZCV A;  2BNX A;  4MRX A;  3RM1 A;  5B8I B;  3DZT A;  2WCE A;  1SW8 A;  4HRE E;  4A4B A;  4GFT A;  1QJT A;  3CS1 A;  3CZT X;  1A29 A;  1TIZ A;  1DJH A;  2F2P A;  1EG4 A;  1DTL A;  3EKJ A;  1DJX A;  2GTE A;  4E68 A;  1BF5 A;  1B8L A;  3C1V A;  3D74 A;  4N1F A;  3AKB A;  1CDL A;  1J7Q A;  1L2O C;  1J7R A;  4R1E A;  2LNK A;  3BOW B;  4JQ0 D;  2QEH A;  3NHT A;  2R2I A;  3GK1 A;  1YX7 A;  3FIA A;  1AJ4 A;  4DIR A;  1CM4 A;  2O5G A;  1OOF A;  3SIB A;  2MJW B;  2OPO A;  1F4Q A;  5DKN A;  1SCV A;  1LA3 A;  3O6B A;  1SKT A;  1D1O A;  1ALW A;  2JTZ A;  3PAL A;  2TN4 A;  1L2O B;  1XFX O;  1IJ6 A;  3BUM B;  4GUK A;  1B1G A;  5J3X A;  2QEO A;  3VRR A;  3TDU A;  4C0L A;  2LVK A;  1TWO A;  1S6J A;  1BLQ A;  1UUS A;  4OR9 B;  2F2O A;  5HLV A;  2AAO A;  2JUL A;  2KLD A;  2VRG A;  4OCI A;  3S0G A;  4MSP A;  1YR5 A;  2LUC A;  2M3W A;  3VB1 A;  1OSA A;  4N5X A;  1BG1 A;  1CFD A;  1PUL A;  2WOS A;  1QLK A;  1KSO A;  3VGO A;  2KI6 C;  2E30 A;  4OKH A;  2CXJ A;  1JF2 A;  2L0P A;  2CT9 A;  2LLT A;  4YGB B;  2HET A;  2WC6 A;  2BKI B;  1YUR A;  4GPL B;  1OOJ A;  2L2C A;  1TOP A;  1NSH A;  1SBJ A;  4FTG A;  2LMT A;  1KK7 Z;  2M29 A;  3JVT C;  5FI6 A;  2M9G A;  1LIN A;  1JF0 A;  1NIW A;  1N0Y A;  1MXL C;  2M1K B;  1CNP A;  1BU3 A;  2SAS A;  1J55 A;  4NDB A;  1U5I B;  3PM8 A;  3LCP C;  1DF0 B;  1FW4 A;  4XJK B;  1YX8 A;  2OS8 C;  1WRK A;  1HT9 A;  3PN7 C;  4NQG A;  1UWO A;  1SCM C;  3NXA A;  1OW4 A;  3R1O A;  3BFH A;  1DMO A;  1GGW A;  4FQO A;  3ZNI A;  1YUU A;  1XFW O;  3TDZ A;  3R72 A;  3OGN A;  2PSR A;  2WCB A;  3DVJ A;  1QX2 A;  2JNF A;  1T14 A;  1LXF C;  2KFG A;  3GK4 X;  3OP0 A;  5I8N A;  2KYF A;  1KFX L;  1J7P A;  1EXR A;  2HPS A;  1SR6 C;  1TN4 A;  1PSB A;  3AKA A;  3BQ3 A;  3PN7 B;  4QJ4 B;  1SCM B;  4MZJ A;  5HKW A;  3FWC A;  3S0B A;  1KFU L;  2JOJ A;  1KK7 Y;  4P5O E;  1BR1 B;  1C3Y A;  1JWD A;  3IF7 A;  1B7T Z;  3I5I C;  1PVB A;  3DF0 B;  2CCM A;  3GK2 A;  2M0R A;  1K96 A;  2LHL A;  1MWN A;  1DJZ A;  2LE9 B;  1ZFS A;  4M2P A;  2P71 A;  2Q91 A;  1SR6 B;  3IQO A;  3EG5 B;  4PT1 A;  1J1E A;  2AUC A;  2ZN8 A;  2KFF A;  2NLN A;  1NX3 A;  3H4S E;  1OZO A;  3KPX A;  1K93 D;  3BUO B;  2JWW A;  2ZNE A;  1AK8 A;  2EC6 C;  2WOR A;  3CR2 A;  3S0E A;  2JC2 A;  4ORB B;  4OV2 A;  3I5I B;  1KCY A;  1CFC A;  2FCD A;  1A75 A;  3CZ1 A;  2PMY A;  3NHI A;  5FYX A;  3SG2 A;  1FI6 A;  2Y1N A;  3E3R A;  2HF5 A;  3PM2 A;  2NCP A;  3D73 A;  1WRZ A;  2ZRS A;  3WNX B;  2BL0 C;  2JU0 A;  1WLZ A;  2L2E A;  1SMG A;  3O4Y A;  4I5N B;  4AOM A;  1JUO A;  1G8I A;  1KK8 C;  2KQY A;  1LS8 A;  2EC6 B;  1OMV A;  2KNE A;  1F4O A;  1DQE A;  1M63 B;  1BR4 B;  2KFH A;  4PE4 A;  3D0Y A;  4MEW A;  3BUX B;  2L4I A;  1IQ3 A;  2QPT A;  1PVA A;  1IKU A;  1QTX A;  3Q8I A;  1TNW A;  3AAJ A;  2LMU A;  3K1E A;  3CGA A;  1QWV A;  1L7Z A;  1LA0 A;  2BL0 B;  5AER A;  1J7O A;  2BCX A;  1OMD A;  5AAN A;  2KDH A;  3CWG A;  1QAT A;  1KK8 B;  1TUJ A;  4MRY A;  5I94 A;  3PFV A;  4MLW A;  1H8B A;  4F7F A;  1QIW A;  2EHB A;  3DVM A;  4JKT A;  4HRH A;  1UHK A;  1A03 A;  1K2H A;  1KQM C;  2WCL A;  1CB1 A;  1M39 A;  4PE1 A;  3B86 A;  5F6T A;  2MA2 A;  1QAS A;  3DYE A;  5HYD A;  2JNX A;  1RJV A;  3OB1 B;  4YGA A;  3D78 A;  2MBX A;  1SYM A;  4DCK A;  1B8C A;  1CLL A;  1C07 A;  1CDN A;  2ZN9 A;  1NPQ A;  1KSM A;  1NX0 A;  4CID A;  3PLF B;  1B9A A;  1YVH A;  4JWQ A;  1Y6W A;  2PAL A;  3WXA A;  3EKH A;  1TTX A;  1TCF A;  1KQM B;  2ZRT A;  2KOT A;  3SS4 A;  1WY9 A;  1XVJ A;  3BYA A;  2B1U A;  3EK8 A;  3GOF A;  5HL1 A;  1JFJ A;  1S5G Y;  5IBW A;  2RGI A;  2K2A A;  2F8P A;  2BAP A;  5ER4 X;  3VRN A;  2WCK A;  4INW A;  1F8H A;  2K61 A;  1MXE A;  3BXK A;  1JC2 A;  1IWQ A;  1QV1 A;  4YGE B;  3B88 A;  1ALV A;  4AQJ A;  2PAS A;  2K60 A;  2OTG C;  1CDM A;  3D75 A;  3RLZ A;  1W7I B;  2JQ6 A;  3OX5 A;  3QRX A;  4YBH B;  1B8R A;  1QVI Z;  1C3Z A;  1N2D A;  4HRG A;  2I2R E;  2K2F A;  3FS7 A;  2LP3 A;  2JPT A;  4ORC B;  3SS5 A;  2JTT A;  2CTN A;  3BJH A;  3BUN B;  5KTY A;  2H2K A;  4CFR A;  3V2L A;  3S0D A;  4YI8 A;  1KQV A;  3L4A A;  3PSR A;  5G08 A;  3QME A;  5AXI A;  5JJG A;  3SG3 A;  4YGC B;  3A8R A;  5FI2 A;  1EH2 A;  5CSI A;  2Y5I A;  2KGR A;  5CSN A;  1Y1U A;  2ZND A;  1MF8 B;  5FI7 A;  1CFP A;  2FJU B;  1RK9 A;  4DRW A;  4MZL A;  2LC5 A;  1CFF A;  4YGD B;  1C7W A;  1AUI B;  2KPH A;  2QAC A;  2G2B A;  1A2X A;  3AAK A;  1UUR A;  1K8U A;  2NCO A;  4NDC A;  2M97 A;  3BFA A;  4UPG A;  4CFQ A;  2BBN A;  1DC1 A;  2D8N A;  2KBI A;  2WC5 A;  1PAL A;  3SG4 A;  1SNL A;  3CLN A;  1PK0 D;  1XK4 A;  2LVI A;  4DS7 A;  1NYA A;  1S1E A;  1OMR A;  1IG5 A;  1QIV A;  2M1U A;  3BUW B;  3EVR A;  3JVT B;  3NGV A;  2JT3 A;  5CSF A;  3TS5 C;  4OVN F;  1S26 D;  1ZOT B;  1QVI Y;  2PVB A;  2I7A A;  3I5H C;  1GM0 A;  1A75 B;  3DXL A;  2BEC A;  2L51 A;  1DJG A;  2LP2 A;  3TUY C;  1JBA A;  1DJW A;  1EJ3 A;  2OS8 B;  3SIA A;  2COL B;  2WCJ A;  1OOI X;  4PAL A;  1BJF A;  3TS5 B;  1XFY O;  1BOD A;  3OHM B;  4PHM A;  3S0A A;  1FBV A;  3I5H B;  2SCP A;  5HKZ A;  3D0Y B;  3TUY B;  4GGF A;  1PSR A;  3CR5 X;  1Z4H A;  4L9M A;  3R1V A;  1DVI A;  3B7A A;  3FWB A;  2WC8 A;  3DVE A;  3OBV A;  2H61 A;  2LLS A;  1GGZ A;  5AEQ A;  4NDD A;  2QEB A;  2KAY A;  4ICB A;  1REC A;  3EK4 A;  3LLE A;  4A4C A;  2I94 A;  5DKR A;  1GJY A;  2JRF A;  3KF9 A;  1GQM A;  2JXL A;  2K7B A;  1YRT B;  1CM1 A;  2F3Z A;  1BMO A;  1ODB A;  2FCE A;  2CNP A;  2LHI A;  4PHN A;  1YUT A;  1R2U A;  4GAO A;  2KAV A;  3FE9 A;  4PE0 A;  5HLO A;  4OZD A;  5DKQ A;  3O4X A;  1B47 A;  1NCX A;  1FF1 A;  3OX6 A;  1F55 A;  1UP5 A;  5CSJ A;  1QX5 B;  4Q04 A;  2WCF A;  3SG6 A;  1KFX S;  1NUB A;  1RRO A;  4DUQ A;  2WND A;  1NCZ A;  1NWD A;  1SL9 A;  1B7T Y;  1OOG A;  1TUZ A;  1MUX A;  3EK7 A;  4WQ2 A;  3TDI A;  2Q4U A;  1KFU S;  4ETO A;  3SS3 A;  1W9Z A;  5D7F A;  5ER5 A;  2BCA A;  1K9K A;  2KQ6 A;  1FI5 A;  3OB2 B;  4PHK A;  1M46 A;  1BOC A;  1IGV A;  1EG3 A;  2PRU A;  1FPW A;  2L4H A;  1RTP 1;  1AJ5 A;  3IQQ A;  4QJ3 B;  2GGM A;  3L47 A;  1OQP A;  2PYQ A;  3EVV A;  3KO0 A;  3LK0 A;  2ISD A;  2P6B B;  1Q80 A;  1NP8 A;  1LKJ A;  2K7O A;  1S6C A;  2K7D A;  2LM5 A;  4WQ3 A;  5GQQ C;  1ORG A;  1SL8 A;  2LVV A;  3DF0 A;  3ZWH A;  5HKY A;  2MAZ A;  3JTD C;  2K8M B;  4YI9 A;  2KBM A;  3MSE B;  1SK6 D;  1ZAC A;  3FE6 A;  4GNK B;  3WHU B;  3N7H A;  1JSA A;  2JT8 A;  2GV5 A;  2KYC A;  1P28 A;  3O2P A;  2EGD A;  1XK4 C;  2IS9 A;  2G9B A;  2NXQ A;  3R1P A;  4PDZ A;  1SL7 A;  1W7J B;  1TRF A;  1WDC C;  3KHE A;  2WCM A;  2O60 A;  1V1G A;  3F45 A;  3BFB A;  1AVS A;  2L5X B;  1B4C A;  1SSE B;  3JTD B;  1C7V A;  1OOH A;  3CYZ A;  1E8A A;  2ERB A;  4WRI A;  3VRO A;  4I5L B;  2A4J A;  4CPV A;  4ORA B;  4KYN A;  1IRJ A;  1QLS A;  2K7C A;  2KI6 D;  3CZ2 A;  3K21 A;  4AQI A;  1DGU A;  1YTZ C;  1G33 A;  4BY4 A;  4IJ7 A;  4P2Y B;  1K94 A;  1WDC B;  1QXP A;  1WRL A;  5D69 A;  2K0J A;  2LMV A;  2LVJ A;  2P70 A;  1SY9 A;  2ZKM X;  2AMI A;  2LUX A;  2M7L A;  2WCH A;  2I18 A;  3NSK A;  3D76 A;  1H4B A;  4GGF C;  1CDP A;  1J1D A;  2HQW A;  2V53 A;  2OTG B;  3CTN A;  4GBA A;  4PE7 A;  2KGB C;  1AHR A;  1K90 D;  2H61 C;  4C0J A;  1N65 A;  1ZUZ A;  2MRD A;  5PAL A;  1DGV A;  1MR8 A;  1NX1 A;  4M2O A;  1Z2C B;  4QJ5 B;  2M7N A;  1BT6 A;  1S36 A;  1OZS A;  1CLB A;  1CKK A;  3BOW A;  1RFJ A;  3L4L A;  2YGU A;  4BY5 A;  3D77 A;  1QX7 A;  1XO5 A;  2QDI A;  1XYD A;  1CMG A;  3HCM A;  3PAT A;  1HQV A;  1S3P A;  1JFK A;  2JT0 A;  1K95 A;  2FJY A;  2JXC A;  5KU1 A;  1CMF A;  2PQL A;  3A4U B;  5K89 A;  1A4P A;  1NCY A;  1IQ5 A;  1ZMZ A;  3CDN A;  4FQT A;  1CLM A;  4MBE A;  4MVF A;  3NSI A;  1RWY A;  2KI4 C;  2LV7 A;  3IVT A;  5DIC A;  5I2L A;  2BE6 A;  1DJY A;  3ICB A;  2BE4 A;  1WLM A;  3NSL A;  4D1E A;  1UHH A;  3CR4 X;  1M31 A;  1XA5 A;  2DOQ A;  2LCP A;  2KLE A;  3DVK A;  2E6W A;  2KSP A;  3EVU A;  2LAN A;  2BKH B;  1X02 A;  1R6P A;  4M2Q A;  3DD4 A;  3CZ0 A;  1CTR A;  2L5Y A;  1K9P A;  2HQ8 A;  1VRK A;  4U8D A;  4I5K A;  3FE8 A;  1IH0 A;  1DEK A;  2KI4 B;  3S0F A;  5CPV A;  3TZ1 A;  4IL1 A;  3D10 A;  3SG7 A;  1NX2 A;  2LLU A;  4JD9 A;  5D3O A;  3SG5 A;  1M45 A;  3WHT B;  3I5F C;  1TNQ A;  1YRU B;  4USL A;  1DJI A;  2MHH A;  3PJI A;  1QS7 A;  1S6I A;  4MN0 A;  3HX4 A;  3VRP A;  4F0Z B;  3KEV A;  1DT7 B;  3M0W A;  1G4Y R;  2F33 A;  4I5J A;  1EL4 A;  1DEL A;  4XYN A;  3LK1 A; 
#chains in the Genus database with same CATH homology
 1F54 A;  1XFZ O;  3I5G C;  1SRA A;  2L50 A;  4PCW A;  1SPY A;  2MLF C;  5I2O A;  1UHJ A;  4CLN A;  1QV0 A;  1U5I A;  2ZFD A;  1MQ1 A;  4HSZ A;  4ZCU A;  1DF0 A;  1TNX A;  3I5F B;  1K9U A;  1KWO C;  2LAP A;  3NSO A;  4MZK A;  4XJK A;  4YRU A;  4JPZ B;  2KAX A;  1YUS A;  1V1F A;  2KHN A;  5I2Q A;  5KSZ A;  1IJ5 A;  1MHO A;  1UHN A;  1F71 A;  2L98 A;  2BBM A;  2NZ0 A;  1TCO B;  5JOL A;  4N1G A;  2M49 B;  3I5G B;  3LL8 B;  3VRQ A;  4C0K A;  1Y1X A;  4GGN A;  1F70 A;  2BCB A;  1PRW A;  5AFP A;  1XFV O;  1KWO B;  1Y0V H;  2MLE C;  1XFU O;  2JZI A;  4TNC A;  2CBL A;  1AP4 A;  2GGZ A;  2FOT A;  1Y1A A;  3O78 A;  3SJS A;  1OE9 B;  2Y4Q A;  1YVL A;  2Y1M A;  1UHI A;  1LVC D;  1TNP A;  5TNC A;  5BPJ A;  2F3Y A;  1S5G Z;  2M8U A;  4ZCV A;  4MRX A;  3RM1 A;  5B8I B;  2WCE A;  1SW8 A;  4HRE E;  4A4B A;  4GFT A;  1QJT A;  3CS1 A;  3CZT X;  1A29 A;  1TIZ A;  1DJH A;  2F2P A;  1EG4 A;  1DTL A;  3EKJ A;  1DJX A;  4E68 A;  1BF5 A;  1B8L A;  3C1V A;  4N1F A;  3AKB A;  1CDL A;  1J7Q A;  1L2O C;  1J7R A;  4R1E A;  2LNK A;  3BOW B;  4JQ0 D;  2R2I A;  3GK1 A;  1YX7 A;  3FIA A;  1AJ4 A;  4DIR A;  1CM4 A;  2O5G A;  3SIB A;  2MJW B;  2OPO A;  1F4Q A;  5DKN A;  1SCV A;  1LA3 A;  3O6B A;  1SKT A;  1D1O A;  1ALW A;  2JTZ A;  3PAL A;  2TN4 A;  1L2O B;  1XFX O;  1IJ6 A;  3BUM B;  4GUK A;  1B1G A;  5J3X A;  3VRR A;  3TDU A;  4C0L A;  2LVK A;  1S6J A;  1BLQ A;  1UUS A;  4OR9 B;  2F2O A;  5HLV A;  2AAO A;  2JUL A;  2VRG A;  4OCI A;  4MSP A;  1YR5 A;  2LUC A;  2M3W A;  1OSA A;  4N5X A;  1BG1 A;  1CFD A;  1PUL A;  2WOS A;  1QLK A;  1KSO A;  3VGO A;  2KI6 C;  2E30 A;  4OKH A;  2CXJ A;  1JF2 A;  2L0P A;  2CT9 A;  2LLT A;  4YGB B;  2HET A;  2BKI B;  1YUR A;  4GPL B;  1OOJ A;  1TOP A;  1NSH A;  1SBJ A;  4FTG A;  2LMT A;  1KK7 Z;  2M29 A;  3JVT C;  2M9G A;  1LIN A;  1JF0 A;  1NIW A;  1N0Y A;  1MXL C;  2M1K B;  1CNP A;  1BU3 A;  2SAS A;  1J55 A;  4NDB A;  1U5I B;  3PM8 A;  3LCP C;  1DF0 B;  1FW4 A;  4XJK B;  1YX8 A;  2OS8 C;  1WRK A;  1HT9 A;  3PN7 C;  4NQG A;  1UWO A;  1SCM C;  3NXA A;  1GGW A;  1DMO A;  4FQO A;  3ZNI A;  1YUU A;  1XFW O;  3TDZ A;  2PSR A;  2WCB A;  3DVJ A;  1QX2 A;  2JNF A;  3OP0 A;  1LXF C;  2KFG A;  3GK4 X;  5I8N A;  1J7P A;  2KYF A;  1KFX L;  1EXR A;  2HPS A;  1SR6 C;  1TN4 A;  1PSB A;  3AKA A;  3BQ3 A;  3PN7 B;  4QJ4 B;  1SCM B;  4MZJ A;  5HKW A;  3FWC A;  1KFU L;  2JOJ A;  1KK7 Y;  4P5O E;  1BR1 B;  1JWD A;  3IF7 A;  1B7T Z;  3I5I C;  1PVB A;  3DF0 B;  2CCM A;  3GK2 A;  2M0R A;  1K96 A;  2LHL A;  1MWN A;  1DJZ A;  2LE9 B;  1ZFS A;  4M2P A;  2Q91 A;  1SR6 B;  3IQO A;  4DCK A;  1J1E A;  2AUC A;  2ZN8 A;  2KFF A;  2NLN A;  1NX3 A;  3H4S E;  1OZO A;  3KPX A;  1K93 D;  3BUO B;  2JWW A;  2ZNE A;  1AK8 A;  2EC6 C;  2WOR A;  3CR2 A;  2JC2 A;  4ORB B;  4OV2 A;  3I5I B;  1KCY A;  1CFC A;  2FCD A;  1A75 A;  3SG2 A;  2PMY A;  5FYX A;  1FI6 A;  2Y1N A;  3E3R A;  2HF5 A;  2NCP A;  1WRZ A;  2ZRS A;  3WNX B;  2BL0 C;  2JU0 A;  1WLZ A;  2L2E A;  1SMG A;  3O4Y A;  4I5N B;  4AOM A;  1JUO A;  1G8I A;  1KK8 C;  2KQY A;  2EC6 B;  1OMV A;  2KNE A;  1F4O A;  1M63 B;  1BR4 B;  2KFH A;  4PE4 A;  3D0Y A;  4MEW A;  3BUX B;  2L4I A;  1IQ3 A;  2QPT A;  1PVA A;  1IKU A;  1QTX A;  1TNW A;  3AAJ A;  2LMU A;  3CGA A;  1L7Z A;  1LA0 A;  2BL0 B;  5AER A;  1J7O A;  2BCX A;  1OMD A;  5AAN A;  2KDH A;  3CWG A;  1QAT A;  1KK8 B;  4MRY A;  3PFV A;  4MLW A;  1H8B A;  1QIW A;  2EHB A;  3DVM A;  1A03 A;  4HRH A;  1UHK A;  1K2H A;  1KQM C;  1CB1 A;  1M39 A;  4PE1 A;  5F6T A;  2MA2 A;  1QAS A;  5HYD A;  2JNX A;  1RJV A;  3OB1 B;  4YGA A;  2MBX A;  1C07 A;  1SYM A;  1B8C A;  1CLL A;  1CDN A;  2ZN9 A;  1NPQ A;  1KSM A;  1NX0 A;  4CID A;  3PLF B;  1B9A A;  1YVH A;  4JWQ A;  1Y6W A;  2PAL A;  3WXA A;  3EKH A;  1TTX A;  1TCF A;  1KQM B;  2ZRT A;  2KOT A;  1WY9 A;  1XVJ A;  3BYA A;  2B1U A;  3EK8 A;  3GOF A;  1JFJ A;  1S5G Y;  5IBW A;  2RGI A;  2K2A A;  2F8P A;  5ER4 X;  3VRN A;  1F8H A;  2K61 A;  1MXE A;  3BXK A;  1JC2 A;  1IWQ A;  1QV1 A;  4YGE B;  1ALV A;  4AQJ A;  2PAS A;  2OTG C;  1CDM A;  3RLZ A;  1W7I B;  2JQ6 A;  3OX5 A;  3QRX A;  4YBH B;  1B8R A;  1QVI Z;  1N2D A;  4HRG A;  2I2R E;  2K2F A;  3FS7 A;  2LP3 A;  2JPT A;  4ORC B;  2JTT A;  2CTN A;  3BUN B;  5KTY A;  2H2K A;  4CFR A;  4YI8 A;  1KQV A;  5G08 A;  3PSR A;  5AXI A;  5JJG A;  3SG3 A;  4YGC B;  3A8R A;  1EH2 A;  5CSI A;  2Y5I A;  2KGR A;  5CSN A;  1Y1U A;  2ZND A;  1MF8 B;  1CFP A;  2FJU B;  1RK9 A;  4DRW A;  4MZL A;  2LC5 A;  1CFF A;  4YGD B;  1C7W A;  1AUI B;  2QAC A;  2G2B A;  1A2X A;  3AAK A;  1UUR A;  1K8U A;  2NCO A;  4NDC A;  2M97 A;  4UPG A;  4CFQ A;  2BBN A;  2D8N A;  2KBI A;  1PAL A;  3SG4 A;  1SNL A;  3CLN A;  1PK0 D;  1XK4 A;  2LVI A;  4DS7 A;  1NYA A;  1S1E A;  1OMR A;  1IG5 A;  1QIV A;  2M1U A;  3BUW B;  3EVR A;  3JVT B;  2JT3 A;  5CSF A;  3TS5 C;  4OVN F;  1S26 D;  1ZOT B;  1QVI Y;  2PVB A;  2I7A A;  3I5H C;  1A75 B;  2BEC A;  2L51 A;  1DJG A;  2LP2 A;  3TUY C;  1JBA A;  1DJW A;  1EJ3 A;  2OS8 B;  3SIA A;  2COL B;  4PAL A;  1BJF A;  3TS5 B;  1XFY O;  1BOD A;  3OHM B;  4PHM A;  1FBV A;  3I5H B;  2SCP A;  5HKZ A;  3D0Y B;  3TUY B;  4GGF A;  1PSR A;  3CR5 X;  4L9M A;  1DVI A;  3FWB A;  2WC8 A;  3DVE A;  2H61 A;  2LLS A;  1GGZ A;  5AEQ A;  4NDD A;  4ICB A;  2KAY A;  1REC A;  3EK4 A;  3LLE A;  4A4C A;  2I94 A;  5DKR A;  1GJY A;  2JRF A;  3KF9 A;  1GQM A;  2JXL A;  2K7B A;  1YRT B;  1CM1 A;  2F3Z A;  1BMO A;  1ODB A;  2FCE A;  2CNP A;  2LHI A;  4PHN A;  1YUT A;  1R2U A;  4GAO A;  2KAV A;  4PE0 A;  5HLO A;  5DKQ A;  1B47 A;  1NCX A;  1FF1 A;  3OX6 A;  1F55 A;  1UP5 A;  5CSJ A;  1QX5 B;  4Q04 A;  2WCF A;  3SG6 A;  1KFX S;  1NUB A;  1RRO A;  4DUQ A;  2WND A;  1NCZ A;  1NWD A;  1SL9 A;  1B7T Y;  1MUX A;  3EK7 A;  4WQ2 A;  3TDI A;  2Q4U A;  1KFU S;  4ETO A;  5D7F A;  5ER5 A;  2BCA A;  1K9K A;  2KQ6 A;  1FI5 A;  3OB2 B;  4PHK A;  1M46 A;  1BOC A;  1IGV A;  1EG3 A;  2PRU A;  1FPW A;  2L4H A;  1RTP 1;  1AJ5 A;  3IQQ A;  4QJ3 B;  2GGM A;  1OQP A;  3KO0 A;  3EVV A;  3LK0 A;  2ISD A;  2P6B B;  1Q80 A;  1NP8 A;  1LKJ A;  2K7O A;  1S6C A;  2K7D A;  2LM5 A;  4WQ3 A;  5GQQ C;  1SL8 A;  2LVV A;  3DF0 A;  3ZWH A;  5HKY A;  2MAZ A;  3JTD C;  2K8M B;  4YI9 A;  2KBM A;  3MSE B;  1SK6 D;  1ZAC A;  4GNK B;  3WHU B;  1JSA A;  2JT8 A;  2GV5 A;  2KYC A;  3O2P A;  2EGD A;  1XK4 C;  2IS9 A;  2G9B A;  2NXQ A;  4PDZ A;  1SL7 A;  1W7J B;  1TRF A;  1WDC C;  3KHE A;  2O60 A;  1V1G A;  3F45 A;  1AVS A;  2L5X B;  1B4C A;  3JTD B;  1C7V A;  1E8A A;  4WRI A;  3VRO A;  4I5L B;  2A4J A;  4CPV A;  4ORA B;  1IRJ A;  1QLS A;  2K7C A;  2KI6 D;  3K21 A;  4AQI A;  1DGU A;  1YTZ C;  1G33 A;  4BY4 A;  4P2Y B;  1K94 A;  1WDC B;  1QXP A;  1WRL A;  5D69 A;  2K0J A;  2LMV A;  2LVJ A;  1SY9 A;  2ZKM X;  2AMI A;  2LUX A;  2M7L A;  2I18 A;  3NSK A;  1H4B A;  4GGF C;  1CDP A;  1J1D A;  2HQW A;  2V53 A;  2OTG B;  3CTN A;  4GBA A;  4PE7 A;  2KGB C;  1AHR A;  1K90 D;  2H61 C;  4C0J A;  1N65 A;  1ZUZ A;  2MRD A;  5PAL A;  1DGV A;  1MR8 A;  1NX1 A;  4M2O A;  4QJ5 B;  2M7N A;  1BT6 A;  1S36 A;  1OZS A;  1CLB A;  1CKK A;  3BOW A;  1RFJ A;  4BY5 A;  1QX7 A;  1XO5 A;  1XYD A;  1CMG A;  3HCM A;  3PAT A;  1HQV A;  1S3P A;  1JFK A;  2JT0 A;  1K95 A;  5KU1 A;  2JXC A;  1CMF A;  3A4U B;  5K89 A;  1A4P A;  1NCY A;  1IQ5 A;  1ZMZ A;  1CLM A;  4MBE A;  4MVF A;  3NSI A;  1RWY A;  2KI4 C;  2LV7 A;  5I2L A;  2BE6 A;  1DJY A;  3ICB A;  2BE4 A;  1WLM A;  3NSL A;  4D1E A;  1UHH A;  3CR4 X;  1M31 A;  1XA5 A;  2DOQ A;  2LCP A;  3DVK A;  2E6W A;  2KSP A;  3EVU A;  2LAN A;  2BKH B;  1X02 A;  1R6P A;  4M2Q A;  3DD4 A;  1CTR A;  1K9P A;  2HQ8 A;  1VRK A;  4U8D A;  4I5K A;  1IH0 A;  2KI4 B;  5CPV A;  3TZ1 A;  4IL1 A;  3D10 A;  3SG7 A;  1NX2 A;  2LLU A;  3SG5 A;  1M45 A;  3WHT B;  3I5F C;  1TNQ A;  1YRU B;  4USL A;  1DJI A;  2MHH A;  1QS7 A;  1S6I A;  4MN0 A;  3HX4 A;  3VRP A;  4F0Z B;  3KEV A;  1DT7 B;  3M0W A;  1G4Y R;  2F33 A;  4I5J A;  1EL4 A;  4PHJ A;  4XYN A;  3LK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...