2ZNEA

Crystal structure of zn2+-bound form of des3-23alg-2 complexed with alix abs peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
168
structure length
168
Chain Sequence
DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Programmed cell death protein 6
publication title Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zneA00
1F4OA 2L51A 1BT6A 1J1DA 4D1EA 3BYAA 5CSNA 2RGIA 1CNPA 3ZWHA 1IJ6A 4MRYA 4XJKB 4MN0A 3DD4A 4YGAA 1VRKA 1JFJA 1NCZA 1RWYA 2SASA 1S36A 1XK4C 1E8AA 2KBIA 1ODBA 1LINA 1C07A 4CFRA 3EKHA 4HRGA 1SL9A 3SG3A 3DVMA 3OB2B 4I5LB 4A4CA 5B8IB 1FW4A 1S5GZ 2FOTA 4PDZA 2LANA 3EVRA 1QLSA 3CR2A 1W7IB 3H4SE 1J7OA 1WDCC 2O60A 3KHEA 3KEVA 1H4BA 1YUTA 4F0ZB 2LLTA 1G8IA 2M7LA 2ZRSA 4MZLA 4CFQA 1S3PA 3NSKA 2BE6A 2WCEA 2JC2A 2ZNEA 1LA3A 1QIVA 3I5HC 3TZ1A 3TDIA 2WORA 2KHNA 2DOQA 2F33A 1QS7A 4N1FA 3PN7B 1PSRA 3DF0A 3NSIA 2TN4A 1N65A 3KO0A 1TN4A 1BOCA 4BY4A 2EC6B 2BKHB 3M0WA 1K9UA 1IG5A 2KI6C 2M97A 2JTZA 4GUKA 3GK2A 1CFPA 1GJYA 2L50A 2LVVA 5PALA 1RJVA 2M29A 4GGNA 1L2OC 1V1FA 3DF0B 3QRXA 1PULA 2CXJA 1S6JA 2KAXA 4WQ3A 1MHOA 4ORBB 3EK8A 1NX3A 2JZIA 1SK6D 1ALVA 5D69A 1F8HA 3A8RA 4GGFC 2CTNA 1UURA 2VRGA 1CFFA 2L4IA 1G33A 3IF7A 3O6BA 5AXIA 1PK0D 1B1GA 1IJ5A 1SYMA 2MHHA 2NLNA 1B8LA 1IRJA 5CSFA 3SG7A 4OV2A 1DJWA 1BODA 3ZNIA 2LHLA 4JWQA 1TIZA 2B1UA 2JPTA 1AHRA 1G4YR 4XYNA 1UHNA 4PALA 3FS7A 1KK7Y 2BECA 1SCMC 4PCWA 1EL4A 1J55A 2GGMA 2M49B 2BCBA 2F3YA 3BXKA 5AFPA 1NSHA 1RTP1 4MSPA 1IQ3A 3TS5B 3VRPA 2L5XB 4MZJA 1H8BA 1MUXA 1TNPA 2D8NA 2AAOA 1ZOTB 1TTXA 3I5FC 2A4JA 2QACA 3NSLA 1CDPA 1DVIA 2JNFA 5DKRA 5I2QA 2K2FA 2OTGC 1JC2A 2ZN9A 4MRXA 2LMTA 4TNCA 2G9BA 1U5IA 4QJ4B 5KU1A 3LCPC 2Y1NA 1B8RA 1JWDA 1GQMA 1D1OA 5CPVA 5J3XA 2KSPA 1SPYA 2MLFC 5I2OA 1CTRA 1DGVA 1J7RA 2LV7A 1MXEA 1IKUA 1C7VA 3NXAA 4AQIA 1UWOA 5CSJA 1X02A 3I5IB 1SR6B 2KAVA 5HLOA 4OCIA 1XK4A 2OPOA 4I5JA 2BBMA 1CLBA 3GK1A 1KQMC 1WRLA 3BOWA 4GAOA 1N2DA 3SG6A 1SMGA 2I94A 2KI4C 3BUOB 1JF2A 1UHKA 1K94A 4ORAB 1IWQA 3AKBA 2WOSA 1XVJA 3FWCA 1PVAA 1L7ZA 4I5KA 3WHUB 2K2AA 1SNLA 1CM4A 2EHBA 1YUSA 2LMUA 1EG4A 3BOWB 2BCXA 3KPXA 3OB1B 4GPLB 1KWOC 1UHIA 2JQ6A 2K7OA 1BR1B 1NCXA 4AQJA 4Q04A 1QIWA 3RM1A 3BUNB 1WDCB 2MAZA 3CTNA 1RFJA 1CDMA 3D10A 1QTXA 2CBLA 1OZSA 1CLLA 1JSAA 3O2PA 2F2OA 4MBEA 3O4YA 1JF0A 4DIRA 1YRUB 2KFHA 2ZNDA 1WRKA 1ZACA 2COLB 3F45A 3I5HB 2KGBC 2KNEA 4P2YB 1AJ5A 4CLNA 2M3WA 2ZFDA 1SW8A 2CT9A 5JOLA 1QJTA 3EVVA 3TDUA 2GV5A 1TNWA 3I5GC 4NDCA 1CM1A 2M8UA 2K7CA 5F6TA 2ZKMX 1SRAA 1OSAA 1MR8A 3AAJA 4FQOA 3WHTB 4C0KA 4GGFA 1AJ4A 1A2XA 2LP2A 1DJZA 3EVUA 3WXAA 1L2OB 2LAPA 1OMRA 2FCEA 1NIWA 3BUWB 2JU0A 4L9MA 2JXLA 3BQ3A 1A75B 1J7PA 2Y1MA 4ETOA 1XFVO 4N1GA 1AK8A 1NUBA 2MLEC 3AAKA 1F71A 4ICBA 4YGEB 1XFWO 2HPSA 1Q80A 1JUOA 2IS9A 2BCAA 1F54A 1TNQA 1YUUA 1Y0VH 1R2UA 3NSOA 4YGBB 1BMOA 1CLMA 1GGZA 1LKJA 1N0YA 3SG2A 2K0JA 1XFYO 2JWWA 2MA2A 3CGAA 2Y5IA 2L2EA 4A4BA 1UUSA 2BL0C 1QX2A 3IQOA 5ER5A 5HYDA 4GBAA 4JQ0D 4YI9A 1SCMB 1DJYA 3PFVA 1LA0A 4GFTA 4P5OE 2MRDA 2KGRA 4ZCVA 3IQQA 2F2PA 4C0LA 4E68A 2JT3A 1NX2A 1PVBA 1S6CA 1UHJA 2LC5A 3PATA 1LVCD 2NCOA 1EXRA 4PHMA 1RROA 1SL8A 1XYDA 3I5FB 1PALA 2M0RA 4MEWA 2KQ6A 1DJGA 1YRTB 1KFUS 2I18A 1DF0B 2H61A 1J1EA 2OTGB 2PRUA 1ZUZA 3PSRA 1KQVA 1FF1A 4NDDA 2Q4UA 3LLEA 1KFXS 1B8CA 5CSIA 1C7WA 3CZTX 2F8PA 2AUCA 2H2KA 3JTDB 3BUMB 2BBNA 3LK1A 3OHMB 1A29A 3CLNA 4NDBA 1YX8A 3JVTC 1DJIA 2EGDA 3WNXB 1K93D 1QVIY 1CMFA 1AUIB 3LL8B 2ISDA 2CNPA 2QPTA 1QV0A 2E30A 4MLWA 3TUYC 4BY5A 1KK7Z 1QXPA 5TNCA 1KFUL 3K21A 3JTDC 4M2QA 1K8UA 4WQ2A 2R2IA 3SG4A 2KYCA 1KQMB 1DMOA 1CMGA 3PM8A 2KI4B 2LM5A 5BPJA 1NPQA 5HKWA 3LK0A 1M46A 1KFXL 3C1VA 1WRZA 2LVIA 2PVBA 1LXFC 1OOJA 3A4UB 4OKHA 4PE1A 1UP5A 4PHNA 2LLSA 1Y1AA 2PALA 2SCPA 2LLUA 2BKIB 1KWOB 4OR9B 1Y6WA 2JT0A 4PE0A 4CIDA 1YTZC 2HF5A 2NCPA 1NP8A 5IBWA 1JFKA 1MWNA 1TRFA 2V53A 2NZ0A 1YX7A 1XFXO 2K7BA 3FIAA 5G08A 1A4PA 3CWGA 4IL1A 1S6IA 2HQ8A 1DT7B 2MJWB 1JBAA 2LNKA 3D0YB 2LUCA 1BLQA 2OS8C 1OQPA 5DKNA 2LHIA 2LVJA 3I5GB 4R1EA 3PLFB 2L4HA 2NXQA 1S5GY 4UPGA 1SBJA 3HCMA 2JRFA 1M45A 2LVKA 4HREE 1OMVA 2JULA 1ZFSA 1QASA 2E6WA 1KK8C 1YVLA 2LE9B 2LUXA 3E3RA 5KSZA 1K2HA 1J7QA 2PMYA 1ZMZA 2PASA 3FWBA 3KF9A 1OE9B 1FBVA 5AANA 5JJGA 1NYAA 1NX0A 2LP3A 3BUXB 1DJHA 1KCYA 3VGOA 4YGDB 3TS5C 2AMIA 1A75A 1BU3A 2JT8A 2HETA 2WCFA 1EG3A 1IGVA 2WC8A 3CS1A 3VROA 2FCDA 5AERA 5HKYA 1FPWA 1RK9A 1SY9A 2I7AA 2KDHA 1TNXA 4YGCB 1SCVA 1DTLA 3HX4A 4PE7A 1ALWA 2I2RE 2ZN8A 2LCPA 5ER4X 4HRHA 4FTGA 2L98A 5AEQA 1AP4A 2KI6D 1S26D 3GK4X 2BL0B 4WRIA 1M31A 2MBXA 1HT9A 2KQYA 2M1UA 3CR5X 3ICBA 2JXCA 1NX1A 4YI8A 2P6BB 3EK4A 2WNDA 1V1GA 1QX7A 2WCBA 1RECA 4USLA 4DUQA 4ZCUA 2M1KB 1DJXA 1M63B 1BG1A 1CFDA 2LMVA 1HQVA 2K8MB 1QV1A 1TOPA 2JNXA 4QJ5B 1DF0A 1XA5A 1A03A 1AVSA 4M2PA 1TCFA 4ORCB 1R6PA 3PN7C 2KFFA 2G2BA 1CB1A 5I8NA 2EC6C 1PRWA 1MXLC 1B4CA 1DGUA 4CPVA 4MZKA 4PHKA 2KOTA 2O5GA 4M2OA 1CFCA 3VRRA 2M9GA 2CCMA 1MQ1A 2FJUB 3JVTB 5FYXA 3OX5A 1TCOB 1F4QA 4U8DA 2KBMA 1MF8B 1OZOA 2Q91A 3TUYB 3EK7A 1CDNA 1YR5A 3VRNA 4NQGA 4AOMA 1XFZO 1IQ5A 1YVHA 3SIAA 5HKZA 2KYFA 1K90D 4C0JA 2F3ZA 2M7NA 2ZRTA 2K61A 1BJFA 3O78A 1Y1XA 1GGWA 1NWDA 4N5XA 2BE4A 2JOJA 1QATA 3CR4X 4PHJA 5DKQA 1FI6A 1EJ3A 4HSZA 1NCYA 1K96A 1YURA 4DS7A 1SL7A 4JPZB 4QJ3B 1IH0A 1B47A 1Y1UA 1WY9A 1FI5A 4MVFA 5GQQC 1PSBA 3OP0A 4YRUA 3DVJA 3SG5A 2KAYA 1WLMA 2Y4QA 3MSEB 3SIBA 1W7JB 3RLZA 5KTYA 1F70A 1XFUO 5K89A 1K95A 1KSMA 3D0YA 1B7TY 3EKJA 3DVKA 4I5NB 1QVIZ 1K9KA 2PSRA 3PALA 2JTTA 4OVNF 5HLVA 5I2LA 2H61C 2OS8B 1F55A 1CKKA 1BF5A 1QLKA 3SJSA 4GNKB 1QX5B 3OX6A 2GGZA 3DVEA 3GOFA 1U5IB 1OMDA 2L0PA 2HQWA 2KFGA 1SKTA 4PE4A 1M39A 1KK8B 1CDLA 1WLZA 3TDZA 1K9PA 4DCKA 4DRWA 1BR4B 4XJKA 5D7FA 1UHHA 2K7DA 1S1EA 1EH2A 3VRQA 3I5IC 4YBHB 1KSOA 1SR6C 1XO5A 3AKAA 1B9AA 1B7TZ
chains in the Genus database with same CATH superfamily
1F4OA 2L51A 1BT6A 1J1DA 2JPOA 3BFAA 4D1EA 3BYAA 2WC5A 2RGIA 5CSNA 1CNPA 3ZWHA 1IJ6A 4MRYA 1IIOA 5AERA 4XJKB 4MN0A 3SG4A 3DD4A 4YGAA 1VRKA 1OW4A 1JFJA 1NCZA 1RWYA 2SASA 1S36A 1XK4C 1E8AA 2KBIA 1ODBA 1LINA 5D3OA 1C07A 4KYNA 4CFRA 3EKHA 4HRGA 1SL9A 2ERBA 3B7AA 3SG3A 3CDNA 3DVMA 3OB2B 4I5LB 4A4CA 5B8IB 1FW4A 1S5GZ 2FOTA 4PDZA 3V2LA 2LANA 3EVRA 1QLSA 3CR2A 1W7IB 1XFRA 3H4SE 1J7OA 1WDCC 2O60A 3KHEA 3KEVA 1H4BA 1YUTA 4F0ZB 2LLTA 1G8IA 2M7LA 2FJYA 2ZRSA 4MZLA 4CFQA 1S3PA 2QEHA 3NSKA 2BE6A 2WCEA 2JC2A 2ZNEA 1LA3A 1QIVA 3I5HC 3TZ1A 3TDIA 2WORA 2L2CA 2KHNA 2DOQA 2F33A 1QS7A 3OGNA 4N1FA 4PT1A 3PN7B 1PSRA 3DF0A 3NSIA 2TN4A 1N65A 3KO0A 1TN4A 1BOCA 4BY4A 2EC6B 2BKHB 3M0WA 1K9UA 1IG5A 2KI6C 2M97A 2JTZA 4GUKA 3GK2A 1CFPA 1GJYA 2L50A 2LVVA 5PALA 1RJVA 2M29A 4GGNA 1L2OC 1V1FA 3DF0B 3QRXA 1PULA 2CXJA 1S6JA 2KAXA 4WQ3A 1MHOA 4ORBB 5I94A 3EK8A 1NX3A 2JZIA 3K1EA 1SK6D 1ALVA 5D69A 1F8HA 3A8RA 4GGFC 3NHTA 2CTNA 1UURA 2VRGA 1CFFA 2L4IA 1G33A 3IF7A 3O6BA 5AXIA 1PK0D 1B1GA 1IJ5A 2K60A 1SYMA 2MHHA 2P70A 2NLNA 1B8LA 1IRJA 5FI6A 5CSFA 3SG7A 4OV2A 1DJWA 3Q8IA 1BODA 3ZNIA 2LHLA 4JWQA 1TIZA 2B1UA 2JPTA 1AHRA 1G4YR 2WCKA 4XYNA 1UHNA 4PALA 3FS7A 1KK7Y 2BECA 1SCMC 4PCWA 1EL4A 1J55A 2GGMA 2M49B 2BCBA 2F3YA 3BXKA 5AFPA 1NSHA 1RTP1 3R1VA 4MSPA 1IQ3A 3TS5B 3VRPA 2L5XB 4MZJA 1H8BA 1MUXA 1TNPA 2D8NA 2AAOA 1ZOTB 1TTXA 3I5FC 2A4JA 2QACA 3NSLA 1CDPA 1DVIA 2JNFA 5DKRA 1LS8A 3CYZA 5I2QA 2K2FA 2OTGC 1JC2A 2ZN9A 4MRXA 2LMTA 4TNCA 2WCHA 3VB1A 2G9BA 1U5IA 4QJ4B 5KU1A 3LCPC 2Y1NA 3D74A 1B8RA 1JWDA 1GQMA 1D1OA 5CPVA 5J3XA 3S0GA 2KSPA 1SPYA 2MLFC 3PM2A 1CTRA 1DGVA 1J7RA 2LV7A 1MXEA 5I2OA 1IKUA 1C7VA 3NXAA 4AQIA 1UWOA 5CSJA 1X02A 3L4LA 1QWVA 3I5IB 3S0AA 1SR6B 2KAVA 5HLOA 3B6XA 3BFHA 4OCIA 1XK4A 2OPOA 4I5JA 1KCYA 2BBMA 1CLBA 3GK1A 1KQMC 1WRLA 3BOWA 4GAOA 1N2DA 3SG6A 1SMGA 2I94A 2KI4C 3BUOB 1JF2A 1UHKA 1K94A 4ORAB 1IWQA 3AKBA 2WOSA 1XVJA 3FWCA 1PVAA 1L7ZA 4I5KA 3WHUB 2K2AA 1SNLA 1CM4A 2EHBA 5FI2A 1Z4HA 1YUSA 1W9ZA 2LMUA 1EG4A 3BOWB 2BCXA 3KPXA 3OB1B 4GPLB 5DICA 1KWOC 1UHIA 3SS5A 2JQ6A 2K7OA 4FQTA 1BR1B 1NCXA 4AQJA 4Q04A 1QIWA 3RM1A 3BUNB 1WDCB 2MAZA 3CTNA 1RFJA 1CDMA 3D10A 1QTXA 2CBLA 1OZSA 1CLLA 1JSAA 3O2PA 2QEBA 2F2OA 3EG5B 3B87A 3O4YA 1JF0A 1OOIX 4MBEA 1YRUB 4DIRA 2KFHA 2ZNDA 1WRKA 1ZACA 2COLB 3F45A 3I5HB 2KGBC 2KNEA 3L47A 4P2YB 1SSEB 1AJ5A 4CLNA 2M3WA 2ZFDA 1SW8A 2CT9A 3S0DA 5JOLA 1QJTA 3EVVA 3TDUA 3CZ1A 3D76A 1GM0A 2GV5A 2H8VA 1TNWA 3I5GC 4NDCA 1CM1A 2M8UA 2K7CA 1T14A 2ZKMX 5F6TA 1SRAA 1OSAA 1MR8A 3AAJA 4FQOA 1C3ZA 3WHTB 4C0KA 4GGFA 1AJ4A 1A2XA 2LP2A 1DJZA 3DY9A 3EVUA 3WXAA 1L2OB 2LAPA 1OMRA 2FCEA 1NIWA 3L4AA 2QEOA 3BUWB 2JU0A 4L9MA 3IVTA 2JXLA 3BQ3A 1A75B 1J7PA 2Y1MA 4ETOA 1XFVO 4N1GA 1AK8A 1NUBA 2MLEC 2PYQA 3AAKA 4ICBA 1F71A 4YGEB 1XFWO 2HPSA 1Q80A 1JUOA 2IS9A 2BCAA 1F54A 1TNQA 1YUUA 1Y0VH 1R2UA 3NSOA 2KLDA 1BMOA 1CLMA 1GGZA 1LKJA 1N0YA 4YGBB 3SG2A 2K0JA 3RZSA 1XFYO 2JWWA 2MA2A 3CGAA 2Y5IA 2L2EA 4A4BA 1UUSA 2BL0C 1QX2A 3IQOA 5ER5A 5HYDA 4GBAA 4JQ0D 4YI9A 1SCMB 1TUJA 3CABA 1DJYA 3PFVA 1LA0A 4GFTA 4P5OE 2MRDA 2KGRA 4ZCVA 5HL1A 3IQQA 2F2PA 4C0LA 4E68A 3CZ2A 2JT3A 1NX2A 1PVBA 1S6CA 1UHJA 2LC5A 3FE6A 1LVCD 2NCOA 3D75A 1EXRA 3PATA 4PHMA 1RROA 1SL8A 2WCJA 1XYDA 3I5FB 1PALA 2M0RA 4MEWA 1C3YA 4JD9A 2KQ6A 1DJGA 1YRTB 1KFUS 2I18A 1DF0B 2H61A 1J1EA 3D78A 2OTGB 2PRUA 1ZUZA 2WCMA 3B88A 3PSRA 1KQVA 1FF1A 3UO9A 1OOFA 4NDDA 2Q4UA 3LLEA 1KFXS 1B8CA 5CSIA 1C7WA 1ORGA 3CZTX 2F8PA 2AUCA 2H2KA 3DXLA 3BUMB 2BBNA 3JTDB 3LK1A 3SS4A 3OHMB 1A29A 3CLNA 4NDBA 1YX8A 3JVTC 1DJIA 2EGDA 2QEVA 3WNXB 1K93D 1QVIY 1CMFA 1AUIB 3LL8B 1Z2CB 2ISDA 2CNPA 2QPTA 1QV0A 2E30A 4MLWA 5EL2A 3TUYC 4BY5A 1KK7Z 1QXPA 5TNCA 1KFUL 2PQLA 3JTDC 3K21A 1K8UA 4M2QA 2R2IA 4WQ2A 2KYCA 1KQMB 2QDIA 1TWOA 1DMOA 1CMGA 3PM8A 2KI4B 2LM5A 5BPJA 1NPQA 2KPHA 5HKWA 3LK0A 1M46A 1KFXL 3C1VA 1WRZA 2LVIA 2PVBA 1LXFC 1OOJA 3A4UB 4OKHA 4PE1A 1UP5A 4PHNA 2LLSA 1Y1AA 3N7HA 2PALA 2SCPA 2LLUA 2BKIB 1KWOB 4OR9B 1Y6WA 2JT0A 4PE0A 4CIDA 1YTZC 2HF5A 2NCPA 1NP8A 5IBWA 1JFKA 1MWNA 1TRFA 2V53A 2NZ0A 1YX7A 1XFXO 3BFBA 2K7BA 3FIAA 5G08A 1A4PA 3CWGA 4IL1A 1S6IA 2HQ8A 1DT7B 2MJWB 1JBAA 2LNKA 3D0YB 2LUCA 1BLQA 1DELA 2OS8C 1OQPA 3D77A 5DKNA 2L5YA 2LHIA 2LVJA 3I5GB 4R1EA 3PLFB 2WCLA 2L4HA 2NXQA 1S5GY 4UPGA 1SBJA 3HCMA 2JRFA 1M45A 2LVKA 4HREE 1OMVA 2JULA 1ZFSA 1QASA 2E6WA 1KK8C 1YVLA 2LE9B 2LUXA 3E3RA 5KSZA 2GTEA 1K2HA 1J7QA 2PMYA 1ZMZA 2PASA 3FWBA 3KF9A 1OE9B 1FBVA 3R1OA 5AANA 1NYAA 1NX0A 2LP3A 3BUXB 1DJHA 3SS3A 3VGOA 5JJGA 4F7FA 3UNWA 4YGDB 3TS5C 2AMIA 1A75A 1BU3A 2JT8A 2HETA 2WCFA 1EG3A 1IGVA 2WC8A 2YGUA 3CS1A 2FCDA 3VROA 5HKYA 1FPWA 1RK9A 1SY9A 2I7AA 2KDHA 1TNXA 4YGCB 1SCVA 1DTLA 3HX4A 4PE7A 1ALWA 2I2RE 2ZN8A 2LCPA 3R72A 5ER4X 4HRHA 4FTGA 2L98A 5AEQA 1AP4A 2KI6D 1S26D 3GK4X 2KLEA 2BL0B 4WRIA 4IJ7A 1M31A 2MBXA 2P71A 1HT9A 2KQYA 2M1UA 3CR5X 2BNXA 3ICBA 2JXCA 1NX1A 4YI8A 2P6BB 3EK4A 2WNDA 1V1GA 1QX7A 3R1PA 2WCBA 1RECA 4USLA 4DUQA 4ZCUA 1DEKA 2M1KB 1DJXA 1M63B 3BJHA 1BG1A 1CFDA 2LMVA 1HQVA 2K8MB 1QV1A 1TOPA 2JNXA 4QJ5B 1DF0A 1XA5A 1A03A 1AVSA 1P28A 4M2PA 1TCFA 4ORCB 1R6PA 3PN7C 2BAPA 2KFFA 2G2BA 1CB1A 5I8NA 2EC6C 3B86A 1PRWA 1MXLC 1B4CA 1DGUA 4CPVA 1OOGA 4MZKA 4PHKA 2KOTA 1OOHA 2O5GA 4M2OA 1CFCA 3S0FA 3DYEA 5FI7A 3VRRA 2M9GA 2CCMA 1MQ1A 2FJUB 3JVTB 5FYXA 3OX5A 1TCOB 1F4QA 4U8DA 2KBMA 1MF8B 1OZOA 2Q91A 3NHIA 3TUYB 3EK7A 1CDNA 1YR5A 3VRNA 4NQGA 4AOMA 1XFZO 1IQ5A 3QMEA 1YVHA 3SIAA 5HKZA 2KYFA 1K90D 4C0JA 2F3ZA 2M7NA 2ZRTA 2K61A 1BJFA 3O78A 1Y1XA 1GGWA 1NWDA 4N5XA 2BE4A 2JOJA 1QATA 3CR4X 4PHJA 5DKQA 1FI6A 1TUZA 1EJ3A 4HSZA 1NCYA 1K96A 1YURA 3CZ0A 4JKTA 4DS7A 1SL7A 4JPZB 4QJ3B 1IH0A 1B47A 1Y1UA 1WY9A 1FI5A 4MVFA 3S0BA 1DQEA 5GQQC 1PSBA 3OP0A 4YRUA 3DVJA 3SG5A 2KAYA 1WLMA 2Y4QA 2WC6A 4INWA 3MSEB 3SIBA 1W7JB 3RLZA 3PJIA 5KTYA 1F70A 1XFUO 5K89A 1K95A 1KSMA 3D0YA 1B7TY 3EKJA 3DVKA 4I5NB 3S0EA 1DC1A 1QVIZ 1K9KA 2PSRA 3PALA 2JTTA 4OVNF 5HLVA 5I2LA 2H61C 2OS8B 1F55A 1CKKA 1BF5A 1QLKA 3SJSA 4GNKB 4OZDA 3DZTA 1QX5B 3NGVA 3OX6A 2GGZA 3DVEA 3GOFA 1U5IB 3OBVA 1OMDA 2L0PA 2HQWA 2KFGA 1SKTA 4PE4A 1M39A 1KK8B 1CDLA 1WLZA 3TDZA 1K9PA 4DCKA 4DRWA 3FE8A 1BR4B 4XJKA 5D7FA 1UHHA 2K7DA 3D73A 1S1EA 3O4XA 4INXA 1EH2A 3FE9A 3VRQA 3I5IC 4YBHB 1KSOA 1SR6C 1XO5A 3AKAA 1B9AA 1B7TZ
chains in the Genus database with same CATH topology
1F4OA 2L51A 1BT6A 1J1DA 4D1EA 3BYAA 5CSNA 2RGIA 1CNPA 3ZWHA 1IJ6A 4MRYA 4XJKB 4MN0A 3DD4A 4YGAA 1VRKA 1JFJA 1NCZA 1RWYA 2SASA 1S36A 1XK4C 1E8AA 2KBIA 1ODBA 1LINA 1C07A 4CFRA 3EKHA 4HRGA 1SL9A 3SG3A 3DVMA 3OB2B 4I5LB 4A4CA 5B8IB 1FW4A 1S5GZ 2FOTA 4PDZA 2LANA 3EVRA 1QLSA 3CR2A 1W7IB 3H4SE 1J7OA 1WDCC 2O60A 3KHEA 3KEVA 1H4BA 1YUTA 4F0ZB 2LLTA 1G8IA 2M7LA 2ZRSA 4MZLA 4CFQA 1S3PA 3NSKA 2BE6A 2WCEA 2JC2A 2ZNEA 1LA3A 1QIVA 3I5HC 3TZ1A 3TDIA 2WORA 2KHNA 2DOQA 2F33A 1QS7A 4N1FA 3PN7B 1PSRA 3DF0A 3NSIA 2TN4A 1N65A 3KO0A 1TN4A 1BOCA 4BY4A 2EC6B 2BKHB 3M0WA 1K9UA 1IG5A 2KI6C 2M97A 2JTZA 4GUKA 3GK2A 1CFPA 1GJYA 2L50A 2LVVA 5PALA 1RJVA 2M29A 4GGNA 1L2OC 1V1FA 3DF0B 3QRXA 1PULA 2CXJA 1S6JA 2KAXA 4WQ3A 1MHOA 4ORBB 3EK8A 1NX3A 2JZIA 1SK6D 1ALVA 5D69A 1F8HA 3A8RA 4GGFC 2CTNA 1UURA 2VRGA 1CFFA 2L4IA 1G33A 3IF7A 3O6BA 5AXIA 1PK0D 1B1GA 1IJ5A 1SYMA 2MHHA 2NLNA 1B8LA 1IRJA 5CSFA 3SG7A 4OV2A 1DJWA 1BODA 3ZNIA 2LHLA 4JWQA 1TIZA 2B1UA 2JPTA 1AHRA 1G4YR 4XYNA 1UHNA 4PALA 3FS7A 1KK7Y 2BECA 1SCMC 4PCWA 1EL4A 1J55A 2GGMA 2M49B 2BCBA 2F3YA 3BXKA 5AFPA 1NSHA 1RTP1 4MSPA 1IQ3A 3TS5B 3VRPA 2L5XB 4MZJA 1H8BA 1MUXA 1TNPA 2D8NA 2AAOA 1ZOTB 1TTXA 3I5FC 2A4JA 2QACA 3NSLA 1CDPA 1DVIA 2JNFA 5DKRA 5I2QA 2K2FA 2OTGC 1JC2A 2ZN9A 4MRXA 2LMTA 4TNCA 2G9BA 1U5IA 4QJ4B 5KU1A 3LCPC 2Y1NA 1B8RA 1JWDA 1GQMA 1D1OA 5CPVA 5J3XA 2KSPA 1SPYA 2MLFC 5I2OA 1CTRA 1DGVA 1J7RA 2LV7A 1MXEA 1IKUA 1C7VA 3NXAA 4AQIA 1UWOA 5CSJA 1X02A 3I5IB 1SR6B 2KAVA 5HLOA 4OCIA 1XK4A 2OPOA 4I5JA 2BBMA 1CLBA 3GK1A 1KQMC 1WRLA 3BOWA 4GAOA 1N2DA 3SG6A 1SMGA 2I94A 2KI4C 3BUOB 1JF2A 1UHKA 1K94A 4ORAB 1IWQA 3AKBA 2WOSA 1XVJA 3FWCA 1PVAA 1L7ZA 4I5KA 3WHUB 2K2AA 1SNLA 1CM4A 2EHBA 1YUSA 2LMUA 1EG4A 3BOWB 2BCXA 3KPXA 3OB1B 4GPLB 1KWOC 1UHIA 2JQ6A 2K7OA 1BR1B 1NCXA 4AQJA 4Q04A 1QIWA 3RM1A 3BUNB 1WDCB 2MAZA 3CTNA 1RFJA 1CDMA 3D10A 1QTXA 2CBLA 1OZSA 1CLLA 1JSAA 3O2PA 2F2OA 4MBEA 3O4YA 1JF0A 4DIRA 1YRUB 2KFHA 2ZNDA 1WRKA 1ZACA 2COLB 3F45A 3I5HB 2KGBC 2KNEA 4P2YB 1AJ5A 4CLNA 2M3WA 2ZFDA 1SW8A 2CT9A 5JOLA 1QJTA 3EVVA 3TDUA 2GV5A 1TNWA 3I5GC 4NDCA 1CM1A 2M8UA 2K7CA 5F6TA 2ZKMX 1SRAA 1OSAA 1MR8A 3AAJA 4FQOA 3WHTB 4C0KA 4GGFA 1AJ4A 1A2XA 2LP2A 1DJZA 3EVUA 3WXAA 1L2OB 2LAPA 1OMRA 2FCEA 1NIWA 3BUWB 2JU0A 4L9MA 2JXLA 3BQ3A 1A75B 1J7PA 2Y1MA 4ETOA 1XFVO 4N1GA 1AK8A 1NUBA 2MLEC 3AAKA 1F71A 4ICBA 4YGEB 1XFWO 2HPSA 1Q80A 1JUOA 2IS9A 2BCAA 1F54A 1TNQA 1YUUA 1Y0VH 1R2UA 3NSOA 4YGBB 1BMOA 1CLMA 1GGZA 1LKJA 1N0YA 3SG2A 2K0JA 1XFYO 2JWWA 2MA2A 3CGAA 2Y5IA 2L2EA 4A4BA 1UUSA 2BL0C 1QX2A 3IQOA 5ER5A 5HYDA 4GBAA 4JQ0D 4YI9A 1SCMB 1DJYA 3PFVA 1LA0A 4GFTA 4P5OE 2MRDA 2KGRA 4ZCVA 3IQQA 2F2PA 4C0LA 4E68A 2JT3A 1NX2A 1PVBA 1S6CA 1UHJA 2LC5A 3PATA 1LVCD 2NCOA 1EXRA 4PHMA 1RROA 1SL8A 1XYDA 3I5FB 1PALA 2M0RA 4MEWA 2KQ6A 1DJGA 1YRTB 1KFUS 2I18A 1DF0B 2H61A 1J1EA 2OTGB 2PRUA 1ZUZA 3PSRA 1KQVA 1FF1A 4NDDA 2Q4UA 3LLEA 1KFXS 1B8CA 5CSIA 1C7WA 3CZTX 2F8PA 2AUCA 2H2KA 3JTDB 3BUMB 2BBNA 3LK1A 3OHMB 1A29A 3CLNA 4NDBA 1YX8A 3JVTC 1DJIA 2EGDA 3WNXB 1K93D 1QVIY 1CMFA 1AUIB 3LL8B 2ISDA 2CNPA 2QPTA 1QV0A 2E30A 4MLWA 3TUYC 4BY5A 1KK7Z 1QXPA 5TNCA 1KFUL 3K21A 3JTDC 4M2QA 1K8UA 4WQ2A 2R2IA 3SG4A 2KYCA 1KQMB 1DMOA 1CMGA 3PM8A 2KI4B 2LM5A 5BPJA 1NPQA 5HKWA 3LK0A 1M46A 1KFXL 3C1VA 1WRZA 2LVIA 2PVBA 1LXFC 1OOJA 3A4UB 4OKHA 4PE1A 1UP5A 4PHNA 2LLSA 1Y1AA 2PALA 2SCPA 2LLUA 2BKIB 1KWOB 4OR9B 1Y6WA 2JT0A 4PE0A 4CIDA 1YTZC 2HF5A 2NCPA 1NP8A 5IBWA 1JFKA 1MWNA 1TRFA 2V53A 2NZ0A 1YX7A 1XFXO 2K7BA 3FIAA 5G08A 1A4PA 3CWGA 4IL1A 1S6IA 2HQ8A 1DT7B 2MJWB 1JBAA 2LNKA 3D0YB 2LUCA 1BLQA 2OS8C 1OQPA 5DKNA 2LHIA 2LVJA 3I5GB 4R1EA 3PLFB 2L4HA 2NXQA 1S5GY 4UPGA 1SBJA 3HCMA 2JRFA 1M45A 2LVKA 4HREE 1OMVA 2JULA 1ZFSA 1QASA 2E6WA 1KK8C 1YVLA 2LE9B 2LUXA 3E3RA 5KSZA 1K2HA 1J7QA 2PMYA 1ZMZA 2PASA 3FWBA 3KF9A 1OE9B 1FBVA 5AANA 5JJGA 1NYAA 1NX0A 2LP3A 3BUXB 1DJHA 1KCYA 3VGOA 4YGDB 3TS5C 2AMIA 1A75A 1BU3A 2JT8A 2HETA 2WCFA 1EG3A 1IGVA 2WC8A 3CS1A 3VROA 2FCDA 5AERA 5HKYA 1FPWA 1RK9A 1SY9A 2I7AA 2KDHA 1TNXA 4YGCB 1SCVA 1DTLA 3HX4A 4PE7A 1ALWA 2I2RE 2ZN8A 2LCPA 5ER4X 4HRHA 4FTGA 2L98A 5AEQA 1AP4A 2KI6D 1S26D 3GK4X 2BL0B 4WRIA 1M31A 2MBXA 1HT9A 2KQYA 2M1UA 3CR5X 3ICBA 2JXCA 1NX1A 4YI8A 2P6BB 3EK4A 2WNDA 1V1GA 1QX7A 2WCBA 1RECA 4USLA 4DUQA 4ZCUA 2M1KB 1DJXA 1M63B 1BG1A 1CFDA 2LMVA 1HQVA 2K8MB 1QV1A 1TOPA 2JNXA 4QJ5B 1DF0A 1XA5A 1A03A 1AVSA 4M2PA 1TCFA 4ORCB 1R6PA 3PN7C 2KFFA 2G2BA 1CB1A 5I8NA 2EC6C 1PRWA 1MXLC 1B4CA 1DGUA 4CPVA 4MZKA 4PHKA 2KOTA 2O5GA 4M2OA 1CFCA 3VRRA 2M9GA 2CCMA 1MQ1A 2FJUB 3JVTB 5FYXA 3OX5A 1TCOB 1F4QA 4U8DA 2KBMA 1MF8B 1OZOA 2Q91A 3TUYB 3EK7A 1CDNA 1YR5A 3VRNA 4NQGA 4AOMA 1XFZO 1IQ5A 1YVHA 3SIAA 5HKZA 2KYFA 1K90D 4C0JA 2F3ZA 2M7NA 2ZRTA 2K61A 1BJFA 3O78A 1Y1XA 1GGWA 1NWDA 4N5XA 2BE4A 2JOJA 1QATA 3CR4X 4PHJA 5DKQA 1FI6A 1EJ3A 4HSZA 1NCYA 1K96A 1YURA 4DS7A 1SL7A 4JPZB 4QJ3B 1IH0A 1B47A 1Y1UA 1WY9A 1FI5A 4MVFA 5GQQC 1PSBA 3OP0A 4YRUA 3DVJA 3SG5A 2KAYA 1WLMA 2Y4QA 3MSEB 3SIBA 1W7JB 3RLZA 5KTYA 1F70A 1XFUO 5K89A 1K95A 1KSMA 3D0YA 1B7TY 3EKJA 3DVKA 4I5NB 1QVIZ 1K9KA 2PSRA 3PALA 2JTTA 4OVNF 5HLVA 5I2LA 2H61C 2OS8B 1F55A 1CKKA 1BF5A 1QLKA 3SJSA 4GNKB 1QX5B 3OX6A 2GGZA 3DVEA 3GOFA 1U5IB 1OMDA 2L0PA 2HQWA 2KFGA 1SKTA 4PE4A 1M39A 1KK8B 1CDLA 1WLZA 3TDZA 1K9PA 4DCKA 4DRWA 1BR4B 4XJKA 5D7FA 1UHHA 2K7DA 1S1EA 1EH2A 3VRQA 3I5IC 4YBHB 1KSOA 1SR6C 1XO5A 3AKAA 1B9AA 1B7TZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4O A;  2L51 A;  1BT6 A;  1J1D A;  4D1E A;  3BYA A;  5CSN A;  2RGI A;  1CNP A;  3ZWH A;  1IJ6 A;  4MRY A;  4XJK B;  4MN0 A;  3DD4 A;  4YGA A;  1VRK A;  1JFJ A;  1NCZ A;  1RWY A;  2SAS A;  1S36 A;  1XK4 C;  1E8A A;  2KBI A;  1ODB A;  1LIN A;  1C07 A;  4CFR A;  3EKH A;  4HRG A;  1SL9 A;  3SG3 A;  3DVM A;  3OB2 B;  4I5L B;  4A4C A;  5B8I B;  1FW4 A;  1S5G Z;  2FOT A;  4PDZ A;  2LAN A;  3EVR A;  1QLS A;  3CR2 A;  1W7I B;  3H4S E;  1J7O A;  1WDC C;  2O60 A;  3KHE A;  3KEV A;  1H4B A;  1YUT A;  4F0Z B;  2LLT A;  1G8I A;  2M7L A;  2ZRS A;  4MZL A;  4CFQ A;  1S3P A;  3NSK A;  2BE6 A;  2WCE A;  2JC2 A;  2ZNE A;  1LA3 A;  1QIV A;  3I5H C;  3TZ1 A;  3TDI A;  2WOR A;  2KHN A;  2DOQ A;  2F33 A;  1QS7 A;  4N1F A;  3PN7 B;  1PSR A;  3DF0 A;  3NSI A;  2TN4 A;  1N65 A;  3KO0 A;  1TN4 A;  1BOC A;  4BY4 A;  2EC6 B;  2BKH B;  3M0W A;  1K9U A;  1IG5 A;  2KI6 C;  2M97 A;  2JTZ A;  4GUK A;  3GK2 A;  1CFP A;  1GJY A;  2L50 A;  2LVV A;  5PAL A;  1RJV A;  2M29 A;  4GGN A;  1L2O C;  1V1F A;  3DF0 B;  3QRX A;  1PUL A;  2CXJ A;  1S6J A;  2KAX A;  4WQ3 A;  1MHO A;  4ORB B;  3EK8 A;  1NX3 A;  2JZI A;  1SK6 D;  1ALV A;  5D69 A;  1F8H A;  3A8R A;  4GGF C;  2CTN A;  1UUR A;  2VRG A;  1CFF A;  2L4I A;  1G33 A;  3IF7 A;  3O6B A;  5AXI A;  1PK0 D;  1B1G A;  1IJ5 A;  1SYM A;  2MHH A;  2NLN A;  1B8L A;  1IRJ A;  5CSF A;  3SG7 A;  4OV2 A;  1DJW A;  1BOD A;  3ZNI A;  2LHL A;  4JWQ A;  1TIZ A;  2B1U A;  2JPT A;  1AHR A;  1G4Y R;  4XYN A;  1UHN A;  4PAL A;  3FS7 A;  1KK7 Y;  2BEC A;  1SCM C;  4PCW A;  1EL4 A;  1J55 A;  2GGM A;  2M49 B;  2BCB A;  2F3Y A;  3BXK A;  5AFP A;  1NSH A;  1RTP 1;  4MSP A;  1IQ3 A;  3TS5 B;  3VRP A;  2L5X B;  4MZJ A;  1H8B A;  1MUX A;  1TNP A;  2D8N A;  2AAO A;  1ZOT B;  1TTX A;  3I5F C;  2A4J A;  2QAC A;  3NSL A;  1CDP A;  1DVI A;  2JNF A;  5DKR A;  5I2Q A;  2K2F A;  2OTG C;  1JC2 A;  2ZN9 A;  4MRX A;  2LMT A;  4TNC A;  2G9B A;  1U5I A;  4QJ4 B;  5KU1 A;  3LCP C;  2Y1N A;  1B8R A;  1JWD A;  1GQM A;  1D1O A;  5CPV A;  5J3X A;  2KSP A;  1SPY A;  2MLF C;  5I2O A;  1CTR A;  1DGV A;  1J7R A;  2LV7 A;  1MXE A;  1IKU A;  1C7V A;  3NXA A;  4AQI A;  1UWO A;  5CSJ A;  1X02 A;  3I5I B;  1SR6 B;  2KAV A;  5HLO A;  4OCI A;  1XK4 A;  2OPO A;  4I5J A;  2BBM A;  1CLB A;  3GK1 A;  1KQM C;  1WRL A;  3BOW A;  4GAO A;  1N2D A;  3SG6 A;  1SMG A;  2I94 A;  2KI4 C;  3BUO B;  1JF2 A;  1UHK A;  1K94 A;  4ORA B;  1IWQ A;  3AKB A;  2WOS A;  1XVJ A;  3FWC A;  1PVA A;  1L7Z A;  4I5K A;  3WHU B;  2K2A A;  1SNL A;  1CM4 A;  2EHB A;  1YUS A;  2LMU A;  1EG4 A;  3BOW B;  2BCX A;  3KPX A;  3OB1 B;  4GPL B;  1KWO C;  1UHI A;  2JQ6 A;  2K7O A;  1BR1 B;  1NCX A;  4AQJ A;  4Q04 A;  1QIW A;  3RM1 A;  3BUN B;  1WDC B;  2MAZ A;  3CTN A;  1RFJ A;  1CDM A;  3D10 A;  1QTX A;  2CBL A;  1OZS A;  1CLL A;  1JSA A;  3O2P A;  2F2O A;  4MBE A;  3O4Y A;  1JF0 A;  4DIR A;  1YRU B;  2KFH A;  2ZND A;  1WRK A;  1ZAC A;  2COL B;  3F45 A;  3I5H B;  2KGB C;  2KNE A;  4P2Y B;  1AJ5 A;  4CLN A;  2M3W A;  2ZFD A;  1SW8 A;  2CT9 A;  5JOL A;  1QJT A;  3EVV A;  3TDU A;  2GV5 A;  1TNW A;  3I5G C;  4NDC A;  1CM1 A;  2M8U A;  2K7C A;  5F6T A;  2ZKM X;  1SRA A;  1OSA A;  1MR8 A;  3AAJ A;  4FQO A;  3WHT B;  4C0K A;  4GGF A;  1AJ4 A;  1A2X A;  2LP2 A;  1DJZ A;  3EVU A;  3WXA A;  1L2O B;  2LAP A;  1OMR A;  2FCE A;  1NIW A;  3BUW B;  2JU0 A;  4L9M A;  2JXL A;  3BQ3 A;  1A75 B;  1J7P A;  2Y1M A;  4ETO A;  1XFV O;  4N1G A;  1AK8 A;  1NUB A;  2MLE C;  3AAK A;  1F71 A;  4ICB A;  4YGE B;  1XFW O;  2HPS A;  1Q80 A;  1JUO A;  2IS9 A;  2BCA A;  1F54 A;  1TNQ A;  1YUU A;  1Y0V H;  1R2U A;  3NSO A;  4YGB B;  1BMO A;  1CLM A;  1GGZ A;  1LKJ A;  1N0Y A;  3SG2 A;  2K0J A;  1XFY O;  2JWW A;  2MA2 A;  3CGA A;  2Y5I A;  2L2E A;  4A4B A;  1UUS A;  2BL0 C;  1QX2 A;  3IQO A;  5ER5 A;  5HYD A;  4GBA A;  4JQ0 D;  4YI9 A;  1SCM B;  1DJY A;  3PFV A;  1LA0 A;  4GFT A;  4P5O E;  2MRD A;  2KGR A;  4ZCV A;  3IQQ A;  2F2P A;  4C0L A;  4E68 A;  2JT3 A;  1NX2 A;  1PVB A;  1S6C A;  1UHJ A;  2LC5 A;  3PAT A;  1LVC D;  2NCO A;  1EXR A;  4PHM A;  1RRO A;  1SL8 A;  1XYD A;  3I5F B;  1PAL A;  2M0R A;  4MEW A;  2KQ6 A;  1DJG A;  1YRT B;  1KFU S;  2I18 A;  1DF0 B;  2H61 A;  1J1E A;  2OTG B;  2PRU A;  1ZUZ A;  3PSR A;  1KQV A;  1FF1 A;  4NDD A;  2Q4U A;  3LLE A;  1KFX S;  1B8C A;  5CSI A;  1C7W A;  3CZT X;  2F8P A;  2AUC A;  2H2K A;  3JTD B;  3BUM B;  2BBN A;  3LK1 A;  3OHM B;  1A29 A;  3CLN A;  4NDB A;  1YX8 A;  3JVT C;  1DJI A;  2EGD A;  3WNX B;  1K93 D;  1QVI Y;  1CMF A;  1AUI B;  3LL8 B;  2ISD A;  2CNP A;  2QPT A;  1QV0 A;  2E30 A;  4MLW A;  3TUY C;  4BY5 A;  1KK7 Z;  1QXP A;  5TNC A;  1KFU L;  3K21 A;  3JTD C;  4M2Q A;  1K8U A;  4WQ2 A;  2R2I A;  3SG4 A;  2KYC A;  1KQM B;  1DMO A;  1CMG A;  3PM8 A;  2KI4 B;  2LM5 A;  5BPJ A;  1NPQ A;  5HKW A;  3LK0 A;  1M46 A;  1KFX L;  3C1V A;  1WRZ A;  2LVI A;  2PVB A;  1LXF C;  1OOJ A;  3A4U B;  4OKH A;  4PE1 A;  1UP5 A;  4PHN A;  2LLS A;  1Y1A A;  2PAL A;  2SCP A;  2LLU A;  2BKI B;  1KWO B;  4OR9 B;  1Y6W A;  2JT0 A;  4PE0 A;  4CID A;  1YTZ C;  2HF5 A;  2NCP A;  1NP8 A;  5IBW A;  1JFK A;  1MWN A;  1TRF A;  2V53 A;  2NZ0 A;  1YX7 A;  1XFX O;  2K7B A;  3FIA A;  5G08 A;  1A4P A;  3CWG A;  4IL1 A;  1S6I A;  2HQ8 A;  1DT7 B;  2MJW B;  1JBA A;  2LNK A;  3D0Y B;  2LUC A;  1BLQ A;  2OS8 C;  1OQP A;  5DKN A;  2LHI A;  2LVJ A;  3I5G B;  4R1E A;  3PLF B;  2L4H A;  2NXQ A;  1S5G Y;  4UPG A;  1SBJ A;  3HCM A;  2JRF A;  1M45 A;  2LVK A;  4HRE E;  1OMV A;  2JUL A;  1ZFS A;  1QAS A;  2E6W A;  1KK8 C;  1YVL A;  2LE9 B;  2LUX A;  3E3R A;  5KSZ A;  1K2H A;  1J7Q A;  2PMY A;  1ZMZ A;  2PAS A;  3FWB A;  3KF9 A;  1OE9 B;  1FBV A;  5AAN A;  5JJG A;  1NYA A;  1NX0 A;  2LP3 A;  3BUX B;  1DJH A;  1KCY A;  3VGO A;  4YGD B;  3TS5 C;  2AMI A;  1A75 A;  1BU3 A;  2JT8 A;  2HET A;  2WCF A;  1EG3 A;  1IGV A;  2WC8 A;  3CS1 A;  3VRO A;  2FCD A;  5AER A;  5HKY A;  1FPW A;  1RK9 A;  1SY9 A;  2I7A A;  2KDH A;  1TNX A;  4YGC B;  1SCV A;  1DTL A;  3HX4 A;  4PE7 A;  1ALW A;  2I2R E;  2ZN8 A;  2LCP A;  5ER4 X;  4HRH A;  4FTG A;  2L98 A;  5AEQ A;  1AP4 A;  2KI6 D;  1S26 D;  3GK4 X;  2BL0 B;  4WRI A;  1M31 A;  2MBX A;  1HT9 A;  2KQY A;  2M1U A;  3CR5 X;  3ICB A;  2JXC A;  1NX1 A;  4YI8 A;  2P6B B;  3EK4 A;  2WND A;  1V1G A;  1QX7 A;  2WCB A;  1REC A;  4USL A;  4DUQ A;  4ZCU A;  2M1K B;  1DJX A;  1M63 B;  1BG1 A;  1CFD A;  2LMV A;  1HQV A;  2K8M B;  1QV1 A;  1TOP A;  2JNX A;  4QJ5 B;  1DF0 A;  1XA5 A;  1A03 A;  1AVS A;  4M2P A;  1TCF A;  4ORC B;  1R6P A;  3PN7 C;  2KFF A;  2G2B A;  1CB1 A;  5I8N A;  2EC6 C;  1PRW A;  1MXL C;  1B4C A;  1DGU A;  4CPV A;  4MZK A;  4PHK A;  2KOT A;  2O5G A;  4M2O A;  1CFC A;  3VRR A;  2M9G A;  2CCM A;  1MQ1 A;  2FJU B;  3JVT B;  5FYX A;  3OX5 A;  1TCO B;  1F4Q A;  4U8D A;  2KBM A;  1MF8 B;  1OZO A;  2Q91 A;  3TUY B;  3EK7 A;  1CDN A;  1YR5 A;  3VRN A;  4NQG A;  4AOM A;  1XFZ O;  1IQ5 A;  1YVH A;  3SIA A;  5HKZ A;  2KYF A;  1K90 D;  4C0J A;  2F3Z A;  2M7N A;  2ZRT A;  2K61 A;  1BJF A;  3O78 A;  1Y1X A;  1GGW A;  1NWD A;  4N5X A;  2BE4 A;  2JOJ A;  1QAT A;  3CR4 X;  4PHJ A;  5DKQ A;  1FI6 A;  1EJ3 A;  4HSZ A;  1NCY A;  1K96 A;  1YUR A;  4DS7 A;  1SL7 A;  4JPZ B;  4QJ3 B;  1IH0 A;  1B47 A;  1Y1U A;  1WY9 A;  1FI5 A;  4MVF A;  5GQQ C;  1PSB A;  3OP0 A;  4YRU A;  3DVJ A;  3SG5 A;  2KAY A;  1WLM A;  2Y4Q A;  3MSE B;  3SIB A;  1W7J B;  3RLZ A;  5KTY A;  1F70 A;  1XFU O;  5K89 A;  1K95 A;  1KSM A;  3D0Y A;  1B7T Y;  3EKJ A;  3DVK A;  4I5N B;  1QVI Z;  1K9K A;  2PSR A;  3PAL A;  2JTT A;  4OVN F;  5HLV A;  5I2L A;  2H61 C;  2OS8 B;  1F55 A;  1CKK A;  1BF5 A;  1QLK A;  3SJS A;  4GNK B;  1QX5 B;  3OX6 A;  2GGZ A;  3DVE A;  3GOF A;  1U5I B;  1OMD A;  2L0P A;  2HQW A;  2KFG A;  1SKT A;  4PE4 A;  1M39 A;  1KK8 B;  1CDL A;  1WLZ A;  3TDZ A;  1K9P A;  4DCK A;  4DRW A;  1BR4 B;  4XJK A;  5D7F A;  1UHH A;  2K7D A;  1S1E A;  1EH2 A;  3VRQ A;  3I5I C;  4YBH B;  1KSO A;  1SR6 C;  1XO5 A;  3AKA A;  1B9A A;  1B7T Z; 
#chains in the Genus database with same CATH topology
 1F4O A;  2L51 A;  1BT6 A;  1J1D A;  2JPO A;  3BFA A;  4D1E A;  3BYA A;  2WC5 A;  2RGI A;  5CSN A;  1CNP A;  3ZWH A;  1IJ6 A;  4MRY A;  1IIO A;  5AER A;  4XJK B;  4MN0 A;  3SG4 A;  3DD4 A;  4YGA A;  1VRK A;  1OW4 A;  1JFJ A;  1NCZ A;  1RWY A;  2SAS A;  1S36 A;  1XK4 C;  1E8A A;  2KBI A;  1ODB A;  1LIN A;  5D3O A;  1C07 A;  4KYN A;  4CFR A;  3EKH A;  4HRG A;  1SL9 A;  2ERB A;  3B7A A;  3SG3 A;  3CDN A;  3DVM A;  3OB2 B;  4I5L B;  4A4C A;  5B8I B;  1FW4 A;  1S5G Z;  2FOT A;  4PDZ A;  3V2L A;  2LAN A;  3EVR A;  1QLS A;  3CR2 A;  1W7I B;  1XFR A;  3H4S E;  1J7O A;  1WDC C;  2O60 A;  3KHE A;  3KEV A;  1H4B A;  1YUT A;  4F0Z B;  2LLT A;  1G8I A;  2M7L A;  2FJY A;  2ZRS A;  4MZL A;  4CFQ A;  1S3P A;  2QEH A;  3NSK A;  2BE6 A;  2WCE A;  2JC2 A;  2ZNE A;  1LA3 A;  1QIV A;  3I5H C;  3TZ1 A;  3TDI A;  2WOR A;  2L2C A;  2KHN A;  2DOQ A;  2F33 A;  1QS7 A;  3OGN A;  4N1F A;  4PT1 A;  3PN7 B;  1PSR A;  3DF0 A;  3NSI A;  2TN4 A;  1N65 A;  3KO0 A;  1TN4 A;  1BOC A;  4BY4 A;  2EC6 B;  2BKH B;  3M0W A;  1K9U A;  1IG5 A;  2KI6 C;  2M97 A;  2JTZ A;  4GUK A;  3GK2 A;  1CFP A;  1GJY A;  2L50 A;  2LVV A;  5PAL A;  1RJV A;  2M29 A;  4GGN A;  1L2O C;  1V1F A;  3DF0 B;  3QRX A;  1PUL A;  2CXJ A;  1S6J A;  2KAX A;  4WQ3 A;  1MHO A;  4ORB B;  5I94 A;  3EK8 A;  1NX3 A;  2JZI A;  3K1E A;  1SK6 D;  1ALV A;  5D69 A;  1F8H A;  3A8R A;  4GGF C;  3NHT A;  2CTN A;  1UUR A;  2VRG A;  1CFF A;  2L4I A;  1G33 A;  3IF7 A;  3O6B A;  5AXI A;  1PK0 D;  1B1G A;  1IJ5 A;  2K60 A;  1SYM A;  2MHH A;  2P70 A;  2NLN A;  1B8L A;  1IRJ A;  5FI6 A;  5CSF A;  3SG7 A;  4OV2 A;  1DJW A;  3Q8I A;  1BOD A;  3ZNI A;  2LHL A;  4JWQ A;  1TIZ A;  2B1U A;  2JPT A;  1AHR A;  1G4Y R;  2WCK A;  4XYN A;  1UHN A;  4PAL A;  3FS7 A;  1KK7 Y;  2BEC A;  1SCM C;  4PCW A;  1EL4 A;  1J55 A;  2GGM A;  2M49 B;  2BCB A;  2F3Y A;  3BXK A;  5AFP A;  1NSH A;  1RTP 1;  3R1V A;  4MSP A;  1IQ3 A;  3TS5 B;  3VRP A;  2L5X B;  4MZJ A;  1H8B A;  1MUX A;  1TNP A;  2D8N A;  2AAO A;  1ZOT B;  1TTX A;  3I5F C;  2A4J A;  2QAC A;  3NSL A;  1CDP A;  1DVI A;  2JNF A;  5DKR A;  1LS8 A;  3CYZ A;  5I2Q A;  2K2F A;  2OTG C;  1JC2 A;  2ZN9 A;  4MRX A;  2LMT A;  4TNC A;  2WCH A;  3VB1 A;  2G9B A;  1U5I A;  4QJ4 B;  5KU1 A;  3LCP C;  2Y1N A;  3D74 A;  1B8R A;  1JWD A;  1GQM A;  1D1O A;  5CPV A;  5J3X A;  3S0G A;  2KSP A;  1SPY A;  2MLF C;  3PM2 A;  1CTR A;  1DGV A;  1J7R A;  2LV7 A;  1MXE A;  5I2O A;  1IKU A;  1C7V A;  3NXA A;  4AQI A;  1UWO A;  5CSJ A;  1X02 A;  3L4L A;  1QWV A;  3I5I B;  3S0A A;  1SR6 B;  2KAV A;  5HLO A;  3B6X A;  3BFH A;  4OCI A;  1XK4 A;  2OPO A;  4I5J A;  1KCY A;  2BBM A;  1CLB A;  3GK1 A;  1KQM C;  1WRL A;  3BOW A;  4GAO A;  1N2D A;  3SG6 A;  1SMG A;  2I94 A;  2KI4 C;  3BUO B;  1JF2 A;  1UHK A;  1K94 A;  4ORA B;  1IWQ A;  3AKB A;  2WOS A;  1XVJ A;  3FWC A;  1PVA A;  1L7Z A;  4I5K A;  3WHU B;  2K2A A;  1SNL A;  1CM4 A;  2EHB A;  5FI2 A;  1Z4H A;  1YUS A;  1W9Z A;  2LMU A;  1EG4 A;  3BOW B;  2BCX A;  3KPX A;  3OB1 B;  4GPL B;  5DIC A;  1KWO C;  1UHI A;  3SS5 A;  2JQ6 A;  2K7O A;  4FQT A;  1BR1 B;  1NCX A;  4AQJ A;  4Q04 A;  1QIW A;  3RM1 A;  3BUN B;  1WDC B;  2MAZ A;  3CTN A;  1RFJ A;  1CDM A;  3D10 A;  1QTX A;  2CBL A;  1OZS A;  1CLL A;  1JSA A;  3O2P A;  2QEB A;  2F2O A;  3EG5 B;  3B87 A;  3O4Y A;  1JF0 A;  1OOI X;  4MBE A;  1YRU B;  4DIR A;  2KFH A;  2ZND A;  1WRK A;  1ZAC A;  2COL B;  3F45 A;  3I5H B;  2KGB C;  2KNE A;  3L47 A;  4P2Y B;  1SSE B;  1AJ5 A;  4CLN A;  2M3W A;  2ZFD A;  1SW8 A;  2CT9 A;  3S0D A;  5JOL A;  1QJT A;  3EVV A;  3TDU A;  3CZ1 A;  3D76 A;  1GM0 A;  2GV5 A;  2H8V A;  1TNW A;  3I5G C;  4NDC A;  1CM1 A;  2M8U A;  2K7C A;  1T14 A;  2ZKM X;  5F6T A;  1SRA A;  1OSA A;  1MR8 A;  3AAJ A;  4FQO A;  1C3Z A;  3WHT B;  4C0K A;  4GGF A;  1AJ4 A;  1A2X A;  2LP2 A;  1DJZ A;  3DY9 A;  3EVU A;  3WXA A;  1L2O B;  2LAP A;  1OMR A;  2FCE A;  1NIW A;  3L4A A;  2QEO A;  3BUW B;  2JU0 A;  4L9M A;  3IVT A;  2JXL A;  3BQ3 A;  1A75 B;  1J7P A;  2Y1M A;  4ETO A;  1XFV O;  4N1G A;  1AK8 A;  1NUB A;  2MLE C;  2PYQ A;  3AAK A;  4ICB A;  1F71 A;  4YGE B;  1XFW O;  2HPS A;  1Q80 A;  1JUO A;  2IS9 A;  2BCA A;  1F54 A;  1TNQ A;  1YUU A;  1Y0V H;  1R2U A;  3NSO A;  2KLD A;  1BMO A;  1CLM A;  1GGZ A;  1LKJ A;  1N0Y A;  4YGB B;  3SG2 A;  2K0J A;  3RZS A;  1XFY O;  2JWW A;  2MA2 A;  3CGA A;  2Y5I A;  2L2E A;  4A4B A;  1UUS A;  2BL0 C;  1QX2 A;  3IQO A;  5ER5 A;  5HYD A;  4GBA A;  4JQ0 D;  4YI9 A;  1SCM B;  1TUJ A;  3CAB A;  1DJY A;  3PFV A;  1LA0 A;  4GFT A;  4P5O E;  2MRD A;  2KGR A;  4ZCV A;  5HL1 A;  3IQQ A;  2F2P A;  4C0L A;  4E68 A;  3CZ2 A;  2JT3 A;  1NX2 A;  1PVB A;  1S6C A;  1UHJ A;  2LC5 A;  3FE6 A;  1LVC D;  2NCO A;  3D75 A;  1EXR A;  3PAT A;  4PHM A;  1RRO A;  1SL8 A;  2WCJ A;  1XYD A;  3I5F B;  1PAL A;  2M0R A;  4MEW A;  1C3Y A;  4JD9 A;  2KQ6 A;  1DJG A;  1YRT B;  1KFU S;  2I18 A;  1DF0 B;  2H61 A;  1J1E A;  3D78 A;  2OTG B;  2PRU A;  1ZUZ A;  2WCM A;  3B88 A;  3PSR A;  1KQV A;  1FF1 A;  3UO9 A;  1OOF A;  4NDD A;  2Q4U A;  3LLE A;  1KFX S;  1B8C A;  5CSI A;  1C7W A;  1ORG A;  3CZT X;  2F8P A;  2AUC A;  2H2K A;  3DXL A;  3BUM B;  2BBN A;  3JTD B;  3LK1 A;  3SS4 A;  3OHM B;  1A29 A;  3CLN A;  4NDB A;  1YX8 A;  3JVT C;  1DJI A;  2EGD A;  2QEV A;  3WNX B;  1K93 D;  1QVI Y;  1CMF A;  1AUI B;  3LL8 B;  1Z2C B;  2ISD A;  2CNP A;  2QPT A;  1QV0 A;  2E30 A;  4MLW A;  5EL2 A;  3TUY C;  4BY5 A;  1KK7 Z;  1QXP A;  5TNC A;  1KFU L;  2PQL A;  3JTD C;  3K21 A;  1K8U A;  4M2Q A;  2R2I A;  4WQ2 A;  2KYC A;  1KQM B;  2QDI A;  1TWO A;  1DMO A;  1CMG A;  3PM8 A;  2KI4 B;  2LM5 A;  5BPJ A;  1NPQ A;  2KPH A;  5HKW A;  3LK0 A;  1M46 A;  1KFX L;  3C1V A;  1WRZ A;  2LVI A;  2PVB A;  1LXF C;  1OOJ A;  3A4U B;  4OKH A;  4PE1 A;  1UP5 A;  4PHN A;  2LLS A;  1Y1A A;  3N7H A;  2PAL A;  2SCP A;  2LLU A;  2BKI B;  1KWO B;  4OR9 B;  1Y6W A;  2JT0 A;  4PE0 A;  4CID A;  1YTZ C;  2HF5 A;  2NCP A;  1NP8 A;  5IBW A;  1JFK A;  1MWN A;  1TRF A;  2V53 A;  2NZ0 A;  1YX7 A;  1XFX O;  3BFB A;  2K7B A;  3FIA A;  5G08 A;  1A4P A;  3CWG A;  4IL1 A;  1S6I A;  2HQ8 A;  1DT7 B;  2MJW B;  1JBA A;  2LNK A;  3D0Y B;  2LUC A;  1BLQ A;  1DEL A;  2OS8 C;  1OQP A;  3D77 A;  5DKN A;  2L5Y A;  2LHI A;  2LVJ A;  3I5G B;  4R1E A;  3PLF B;  2WCL A;  2L4H A;  2NXQ A;  1S5G Y;  4UPG A;  1SBJ A;  3HCM A;  2JRF A;  1M45 A;  2LVK A;  4HRE E;  1OMV A;  2JUL A;  1ZFS A;  1QAS A;  2E6W A;  1KK8 C;  1YVL A;  2LE9 B;  2LUX A;  3E3R A;  5KSZ A;  2GTE A;  1K2H A;  1J7Q A;  2PMY A;  1ZMZ A;  2PAS A;  3FWB A;  3KF9 A;  1OE9 B;  1FBV A;  3R1O A;  5AAN A;  1NYA A;  1NX0 A;  2LP3 A;  3BUX B;  1DJH A;  3SS3 A;  3VGO A;  5JJG A;  4F7F A;  3UNW A;  4YGD B;  3TS5 C;  2AMI A;  1A75 A;  1BU3 A;  2JT8 A;  2HET A;  2WCF A;  1EG3 A;  1IGV A;  2WC8 A;  2YGU A;  3CS1 A;  2FCD A;  3VRO A;  5HKY A;  1FPW A;  1RK9 A;  1SY9 A;  2I7A A;  2KDH A;  1TNX A;  4YGC B;  1SCV A;  1DTL A;  3HX4 A;  4PE7 A;  1ALW A;  2I2R E;  2ZN8 A;  2LCP A;  3R72 A;  5ER4 X;  4HRH A;  4FTG A;  2L98 A;  5AEQ A;  1AP4 A;  2KI6 D;  1S26 D;  3GK4 X;  2KLE A;  2BL0 B;  4WRI A;  4IJ7 A;  1M31 A;  2MBX A;  2P71 A;  1HT9 A;  2KQY A;  2M1U A;  3CR5 X;  2BNX A;  3ICB A;  2JXC A;  1NX1 A;  4YI8 A;  2P6B B;  3EK4 A;  2WND A;  1V1G A;  1QX7 A;  3R1P A;  2WCB A;  1REC A;  4USL A;  4DUQ A;  4ZCU A;  1DEK A;  2M1K B;  1DJX A;  1M63 B;  3BJH A;  1BG1 A;  1CFD A;  2LMV A;  1HQV A;  2K8M B;  1QV1 A;  1TOP A;  2JNX A;  4QJ5 B;  1DF0 A;  1XA5 A;  1A03 A;  1AVS A;  1P28 A;  4M2P A;  1TCF A;  4ORC B;  1R6P A;  3PN7 C;  2BAP A;  2KFF A;  2G2B A;  1CB1 A;  5I8N A;  2EC6 C;  3B86 A;  1PRW A;  1MXL C;  1B4C A;  1DGU A;  4CPV A;  1OOG A;  4MZK A;  4PHK A;  2KOT A;  1OOH A;  2O5G A;  4M2O A;  1CFC A;  3S0F A;  3DYE A;  5FI7 A;  3VRR A;  2M9G A;  2CCM A;  1MQ1 A;  2FJU B;  3JVT B;  5FYX A;  3OX5 A;  1TCO B;  1F4Q A;  4U8D A;  2KBM A;  1MF8 B;  1OZO A;  2Q91 A;  3NHI A;  3TUY B;  3EK7 A;  1CDN A;  1YR5 A;  3VRN A;  4NQG A;  4AOM A;  1XFZ O;  1IQ5 A;  3QME A;  1YVH A;  3SIA A;  5HKZ A;  2KYF A;  1K90 D;  4C0J A;  2F3Z A;  2M7N A;  2ZRT A;  2K61 A;  1BJF A;  3O78 A;  1Y1X A;  1GGW A;  1NWD A;  4N5X A;  2BE4 A;  2JOJ A;  1QAT A;  3CR4 X;  4PHJ A;  5DKQ A;  1FI6 A;  1TUZ A;  1EJ3 A;  4HSZ A;  1NCY A;  1K96 A;  1YUR A;  3CZ0 A;  4JKT A;  4DS7 A;  1SL7 A;  4JPZ B;  4QJ3 B;  1IH0 A;  1B47 A;  1Y1U A;  1WY9 A;  1FI5 A;  4MVF A;  3S0B A;  1DQE A;  5GQQ C;  1PSB A;  3OP0 A;  4YRU A;  3DVJ A;  3SG5 A;  2KAY A;  1WLM A;  2Y4Q A;  2WC6 A;  4INW A;  3MSE B;  3SIB A;  1W7J B;  3RLZ A;  3PJI A;  5KTY A;  1F70 A;  1XFU O;  5K89 A;  1K95 A;  1KSM A;  3D0Y A;  1B7T Y;  3EKJ A;  3DVK A;  4I5N B;  3S0E A;  1DC1 A;  1QVI Z;  1K9K A;  2PSR A;  3PAL A;  2JTT A;  4OVN F;  5HLV A;  5I2L A;  2H61 C;  2OS8 B;  1F55 A;  1CKK A;  1BF5 A;  1QLK A;  3SJS A;  4GNK B;  4OZD A;  3DZT A;  1QX5 B;  3NGV A;  3OX6 A;  2GGZ A;  3DVE A;  3GOF A;  1U5I B;  3OBV A;  1OMD A;  2L0P A;  2HQW A;  2KFG A;  1SKT A;  4PE4 A;  1M39 A;  1KK8 B;  1CDL A;  1WLZ A;  3TDZ A;  1K9P A;  4DCK A;  4DRW A;  3FE8 A;  1BR4 B;  4XJK A;  5D7F A;  1UHH A;  2K7D A;  3D73 A;  1S1E A;  3O4X A;  4INX A;  1EH2 A;  3FE9 A;  3VRQ A;  3I5I C;  4YBH B;  1KSO A;  1SR6 C;  1XO5 A;  3AKA A;  1B9A A;  1B7T Z; 
#chains in the Genus database with same CATH homology
 1F4O A;  2L51 A;  1BT6 A;  1J1D A;  4D1E A;  3BYA A;  5CSN A;  2RGI A;  1CNP A;  3ZWH A;  1IJ6 A;  4MRY A;  4XJK B;  4MN0 A;  3DD4 A;  4YGA A;  1VRK A;  1JFJ A;  1NCZ A;  1RWY A;  2SAS A;  1S36 A;  1XK4 C;  1E8A A;  2KBI A;  1ODB A;  1LIN A;  1C07 A;  4CFR A;  3EKH A;  4HRG A;  1SL9 A;  3SG3 A;  3DVM A;  3OB2 B;  4I5L B;  4A4C A;  5B8I B;  1FW4 A;  1S5G Z;  2FOT A;  4PDZ A;  2LAN A;  3EVR A;  1QLS A;  3CR2 A;  1W7I B;  3H4S E;  1J7O A;  1WDC C;  2O60 A;  3KHE A;  3KEV A;  1H4B A;  1YUT A;  4F0Z B;  2LLT A;  1G8I A;  2M7L A;  2ZRS A;  4MZL A;  4CFQ A;  1S3P A;  3NSK A;  2BE6 A;  2WCE A;  2JC2 A;  2ZNE A;  1LA3 A;  1QIV A;  3I5H C;  3TZ1 A;  3TDI A;  2WOR A;  2KHN A;  2DOQ A;  2F33 A;  1QS7 A;  4N1F A;  3PN7 B;  1PSR A;  3DF0 A;  3NSI A;  2TN4 A;  1N65 A;  3KO0 A;  1TN4 A;  1BOC A;  4BY4 A;  2EC6 B;  2BKH B;  3M0W A;  1K9U A;  1IG5 A;  2KI6 C;  2M97 A;  2JTZ A;  4GUK A;  3GK2 A;  1CFP A;  1GJY A;  2L50 A;  2LVV A;  5PAL A;  1RJV A;  2M29 A;  4GGN A;  1L2O C;  1V1F A;  3DF0 B;  3QRX A;  1PUL A;  2CXJ A;  1S6J A;  2KAX A;  4WQ3 A;  1MHO A;  4ORB B;  3EK8 A;  1NX3 A;  2JZI A;  1SK6 D;  1ALV A;  5D69 A;  1F8H A;  3A8R A;  4GGF C;  2CTN A;  1UUR A;  2VRG A;  1CFF A;  2L4I A;  1G33 A;  3IF7 A;  3O6B A;  5AXI A;  1PK0 D;  1B1G A;  1IJ5 A;  1SYM A;  2MHH A;  2NLN A;  1B8L A;  1IRJ A;  5CSF A;  3SG7 A;  4OV2 A;  1DJW A;  1BOD A;  3ZNI A;  2LHL A;  4JWQ A;  1TIZ A;  2B1U A;  2JPT A;  1AHR A;  1G4Y R;  4XYN A;  1UHN A;  4PAL A;  3FS7 A;  1KK7 Y;  2BEC A;  1SCM C;  4PCW A;  1EL4 A;  1J55 A;  2GGM A;  2M49 B;  2BCB A;  2F3Y A;  3BXK A;  5AFP A;  1NSH A;  1RTP 1;  4MSP A;  1IQ3 A;  3TS5 B;  3VRP A;  2L5X B;  4MZJ A;  1H8B A;  1MUX A;  1TNP A;  2D8N A;  2AAO A;  1ZOT B;  1TTX A;  3I5F C;  2A4J A;  2QAC A;  3NSL A;  1CDP A;  1DVI A;  2JNF A;  5DKR A;  5I2Q A;  2K2F A;  2OTG C;  1JC2 A;  2ZN9 A;  4MRX A;  2LMT A;  4TNC A;  2G9B A;  1U5I A;  4QJ4 B;  5KU1 A;  3LCP C;  2Y1N A;  1B8R A;  1JWD A;  1GQM A;  1D1O A;  5CPV A;  5J3X A;  2KSP A;  1SPY A;  2MLF C;  5I2O A;  1CTR A;  1DGV A;  1J7R A;  2LV7 A;  1MXE A;  1IKU A;  1C7V A;  3NXA A;  4AQI A;  1UWO A;  5CSJ A;  1X02 A;  3I5I B;  1SR6 B;  2KAV A;  5HLO A;  4OCI A;  1XK4 A;  2OPO A;  4I5J A;  2BBM A;  1CLB A;  3GK1 A;  1KQM C;  1WRL A;  3BOW A;  4GAO A;  1N2D A;  3SG6 A;  1SMG A;  2I94 A;  2KI4 C;  3BUO B;  1JF2 A;  1UHK A;  1K94 A;  4ORA B;  1IWQ A;  3AKB A;  2WOS A;  1XVJ A;  3FWC A;  1PVA A;  1L7Z A;  4I5K A;  3WHU B;  2K2A A;  1SNL A;  1CM4 A;  2EHB A;  1YUS A;  2LMU A;  1EG4 A;  3BOW B;  2BCX A;  3KPX A;  3OB1 B;  4GPL B;  1KWO C;  1UHI A;  2JQ6 A;  2K7O A;  1BR1 B;  1NCX A;  4AQJ A;  4Q04 A;  1QIW A;  3RM1 A;  3BUN B;  1WDC B;  2MAZ A;  3CTN A;  1RFJ A;  1CDM A;  3D10 A;  1QTX A;  2CBL A;  1OZS A;  1CLL A;  1JSA A;  3O2P A;  2F2O A;  4MBE A;  3O4Y A;  1JF0 A;  4DIR A;  1YRU B;  2KFH A;  2ZND A;  1WRK A;  1ZAC A;  2COL B;  3F45 A;  3I5H B;  2KGB C;  2KNE A;  4P2Y B;  1AJ5 A;  4CLN A;  2M3W A;  2ZFD A;  1SW8 A;  2CT9 A;  5JOL A;  1QJT A;  3EVV A;  3TDU A;  2GV5 A;  1TNW A;  3I5G C;  4NDC A;  1CM1 A;  2M8U A;  2K7C A;  5F6T A;  2ZKM X;  1SRA A;  1OSA A;  1MR8 A;  3AAJ A;  4FQO A;  3WHT B;  4C0K A;  4GGF A;  1AJ4 A;  1A2X A;  2LP2 A;  1DJZ A;  3EVU A;  3WXA A;  1L2O B;  2LAP A;  1OMR A;  2FCE A;  1NIW A;  3BUW B;  2JU0 A;  4L9M A;  2JXL A;  3BQ3 A;  1A75 B;  1J7P A;  2Y1M A;  4ETO A;  1XFV O;  4N1G A;  1AK8 A;  1NUB A;  2MLE C;  3AAK A;  1F71 A;  4ICB A;  4YGE B;  1XFW O;  2HPS A;  1Q80 A;  1JUO A;  2IS9 A;  2BCA A;  1F54 A;  1TNQ A;  1YUU A;  1Y0V H;  1R2U A;  3NSO A;  4YGB B;  1BMO A;  1CLM A;  1GGZ A;  1LKJ A;  1N0Y A;  3SG2 A;  2K0J A;  1XFY O;  2JWW A;  2MA2 A;  3CGA A;  2Y5I A;  2L2E A;  4A4B A;  1UUS A;  2BL0 C;  1QX2 A;  3IQO A;  5ER5 A;  5HYD A;  4GBA A;  4JQ0 D;  4YI9 A;  1SCM B;  1DJY A;  3PFV A;  1LA0 A;  4GFT A;  4P5O E;  2MRD A;  2KGR A;  4ZCV A;  3IQQ A;  2F2P A;  4C0L A;  4E68 A;  2JT3 A;  1NX2 A;  1PVB A;  1S6C A;  1UHJ A;  2LC5 A;  3PAT A;  1LVC D;  2NCO A;  1EXR A;  4PHM A;  1RRO A;  1SL8 A;  1XYD A;  3I5F B;  1PAL A;  2M0R A;  4MEW A;  2KQ6 A;  1DJG A;  1YRT B;  1KFU S;  2I18 A;  1DF0 B;  2H61 A;  1J1E A;  2OTG B;  2PRU A;  1ZUZ A;  3PSR A;  1KQV A;  1FF1 A;  4NDD A;  2Q4U A;  3LLE A;  1KFX S;  1B8C A;  5CSI A;  1C7W A;  3CZT X;  2F8P A;  2AUC A;  2H2K A;  3JTD B;  3BUM B;  2BBN A;  3LK1 A;  3OHM B;  1A29 A;  3CLN A;  4NDB A;  1YX8 A;  3JVT C;  1DJI A;  2EGD A;  3WNX B;  1K93 D;  1QVI Y;  1CMF A;  1AUI B;  3LL8 B;  2ISD A;  2CNP A;  2QPT A;  1QV0 A;  2E30 A;  4MLW A;  3TUY C;  4BY5 A;  1KK7 Z;  1QXP A;  5TNC A;  1KFU L;  3K21 A;  3JTD C;  4M2Q A;  1K8U A;  4WQ2 A;  2R2I A;  3SG4 A;  2KYC A;  1KQM B;  1DMO A;  1CMG A;  3PM8 A;  2KI4 B;  2LM5 A;  5BPJ A;  1NPQ A;  5HKW A;  3LK0 A;  1M46 A;  1KFX L;  3C1V A;  1WRZ A;  2LVI A;  2PVB A;  1LXF C;  1OOJ A;  3A4U B;  4OKH A;  4PE1 A;  1UP5 A;  4PHN A;  2LLS A;  1Y1A A;  2PAL A;  2SCP A;  2LLU A;  2BKI B;  1KWO B;  4OR9 B;  1Y6W A;  2JT0 A;  4PE0 A;  4CID A;  1YTZ C;  2HF5 A;  2NCP A;  1NP8 A;  5IBW A;  1JFK A;  1MWN A;  1TRF A;  2V53 A;  2NZ0 A;  1YX7 A;  1XFX O;  2K7B A;  3FIA A;  5G08 A;  1A4P A;  3CWG A;  4IL1 A;  1S6I A;  2HQ8 A;  1DT7 B;  2MJW B;  1JBA A;  2LNK A;  3D0Y B;  2LUC A;  1BLQ A;  2OS8 C;  1OQP A;  5DKN A;  2LHI A;  2LVJ A;  3I5G B;  4R1E A;  3PLF B;  2L4H A;  2NXQ A;  1S5G Y;  4UPG A;  1SBJ A;  3HCM A;  2JRF A;  1M45 A;  2LVK A;  4HRE E;  1OMV A;  2JUL A;  1ZFS A;  1QAS A;  2E6W A;  1KK8 C;  1YVL A;  2LE9 B;  2LUX A;  3E3R A;  5KSZ A;  1K2H A;  1J7Q A;  2PMY A;  1ZMZ A;  2PAS A;  3FWB A;  3KF9 A;  1OE9 B;  1FBV A;  5AAN A;  5JJG A;  1NYA A;  1NX0 A;  2LP3 A;  3BUX B;  1DJH A;  1KCY A;  3VGO A;  4YGD B;  3TS5 C;  2AMI A;  1A75 A;  1BU3 A;  2JT8 A;  2HET A;  2WCF A;  1EG3 A;  1IGV A;  2WC8 A;  3CS1 A;  3VRO A;  2FCD A;  5AER A;  5HKY A;  1FPW A;  1RK9 A;  1SY9 A;  2I7A A;  2KDH A;  1TNX A;  4YGC B;  1SCV A;  1DTL A;  3HX4 A;  4PE7 A;  1ALW A;  2I2R E;  2ZN8 A;  2LCP A;  5ER4 X;  4HRH A;  4FTG A;  2L98 A;  5AEQ A;  1AP4 A;  2KI6 D;  1S26 D;  3GK4 X;  2BL0 B;  4WRI A;  1M31 A;  2MBX A;  1HT9 A;  2KQY A;  2M1U A;  3CR5 X;  3ICB A;  2JXC A;  1NX1 A;  4YI8 A;  2P6B B;  3EK4 A;  2WND A;  1V1G A;  1QX7 A;  2WCB A;  1REC A;  4USL A;  4DUQ A;  4ZCU A;  2M1K B;  1DJX A;  1M63 B;  1BG1 A;  1CFD A;  2LMV A;  1HQV A;  2K8M B;  1QV1 A;  1TOP A;  2JNX A;  4QJ5 B;  1DF0 A;  1XA5 A;  1A03 A;  1AVS A;  4M2P A;  1TCF A;  4ORC B;  1R6P A;  3PN7 C;  2KFF A;  2G2B A;  1CB1 A;  5I8N A;  2EC6 C;  1PRW A;  1MXL C;  1B4C A;  1DGU A;  4CPV A;  4MZK A;  4PHK A;  2KOT A;  2O5G A;  4M2O A;  1CFC A;  3VRR A;  2M9G A;  2CCM A;  1MQ1 A;  2FJU B;  3JVT B;  5FYX A;  3OX5 A;  1TCO B;  1F4Q A;  4U8D A;  2KBM A;  1MF8 B;  1OZO A;  2Q91 A;  3TUY B;  3EK7 A;  1CDN A;  1YR5 A;  3VRN A;  4NQG A;  4AOM A;  1XFZ O;  1IQ5 A;  1YVH A;  3SIA A;  5HKZ A;  2KYF A;  1K90 D;  4C0J A;  2F3Z A;  2M7N A;  2ZRT A;  2K61 A;  1BJF A;  3O78 A;  1Y1X A;  1GGW A;  1NWD A;  4N5X A;  2BE4 A;  2JOJ A;  1QAT A;  3CR4 X;  4PHJ A;  5DKQ A;  1FI6 A;  1EJ3 A;  4HSZ A;  1NCY A;  1K96 A;  1YUR A;  4DS7 A;  1SL7 A;  4JPZ B;  4QJ3 B;  1IH0 A;  1B47 A;  1Y1U A;  1WY9 A;  1FI5 A;  4MVF A;  5GQQ C;  1PSB A;  3OP0 A;  4YRU A;  3DVJ A;  3SG5 A;  2KAY A;  1WLM A;  2Y4Q A;  3MSE B;  3SIB A;  1W7J B;  3RLZ A;  5KTY A;  1F70 A;  1XFU O;  5K89 A;  1K95 A;  1KSM A;  3D0Y A;  1B7T Y;  3EKJ A;  3DVK A;  4I5N B;  1QVI Z;  1K9K A;  2PSR A;  3PAL A;  2JTT A;  4OVN F;  5HLV A;  5I2L A;  2H61 C;  2OS8 B;  1F55 A;  1CKK A;  1BF5 A;  1QLK A;  3SJS A;  4GNK B;  1QX5 B;  3OX6 A;  2GGZ A;  3DVE A;  3GOF A;  1U5I B;  1OMD A;  2L0P A;  2HQW A;  2KFG A;  1SKT A;  4PE4 A;  1M39 A;  1KK8 B;  1CDL A;  1WLZ A;  3TDZ A;  1K9P A;  4DCK A;  4DRW A;  1BR4 B;  4XJK A;  5D7F A;  1UHH A;  2K7D A;  1S1E A;  1EH2 A;  3VRQ A;  3I5I C;  4YBH B;  1KSO A;  1SR6 C;  1XO5 A;  3AKA A;  1B9A A;  1B7T Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...