1M45A

Crystal structure of mlc1p bound to iq2 of myo2p, a class v myosin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
146
structure length
142
Chain Sequence
TRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINASLASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle protein
molecule keywords Myosin light chain
total genus 36
structure length 142
sequence length 146
ec nomenclature
pdb deposition date 2002-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m45A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m45A01
1ALVA 1K94A 3BUNB 3KEVA 1FI6A 1FPWA 2M9GA 2Q91A 4PDZA 3CS1A 1SNLA 3TUYB 3SG7A 1TRFA 1Y6WA 3EVVA 2JZIA 1IJ6A 1F71A 1QVIZ 3EK8A 1LA0A 2M49B 2JXCA 4ORAB 2Y5IA 4QJ3B 4AOMA 1CLBA 2BKIB 2MRDA 3LLEA 5HLOA 1NYAA 1MUXA 3CGAA 2H2KA 4IL1A 1CMGA 2KDHA 4DS7A 5DKRA 1OSAA 2K2AA 2EC6C 3BUOB 2DOQA 1CFFA 1DJGA 3BYAA 4YGDB 2G9BA 1DJIA 1NWDA 3VRRA 1R6PA 4A4CA 4C0JA 2E6WA 4GUKA 1S3PA 2SCPA 1G4YR 4GGNA 1TTXA 2L4HA 4N5XA 3JTDB 2KFHA 3I5HC 5AFPA 1UHIA 3I5HB 2L5XB 4I5KA 2BKHB 3I5FB 1G8IA 1C7VA 1EG4A 1B8LA 1K8UA 1XO5A 1RK9A 1MWNA 2KOTA 4CFRA 4C0LA 2ZNDA 1QV0A 1EG3A 3EVUA 4WRIA 4YBHB 3NSIA 2M3WA 3OHMB 4PHKA 4ZCUA 4UPGA 1NUBA 4JPZB 1AK8A 2GGZA 2HPSA 2JT0A 2I7AA 3BOWB 3KO0A 4YGBB 4YGAA 4CPVA 1IKUA 1CFCA 2JXLA 2BECA 1YUSA 1M39A 1AP4A 3GK2A 2KNEA 3VRQA 3K21A 1KK8C 3F45A 2CXJA 1OZOA 1EJ3A 1CKKA 1SY9A 1UHHA 3O4YA 1QIWA 1PULA 1PALA 3VGOA 3PATA 2BCXA 2KBMA 1MR8A 1YRTB 1SPYA 2FOTA 1WLZA 1CFPA 3EKJA 4C0KA 2KGRA 1QX5B 2LM5A 1BF5A 4GPLB 2NZ0A 1K90D 1XK4C 4BY5A 5AEQA 3GK1A 1TNQA 3FWBA 5IBWA 1OMRA 2Y1MA 1CLLA 2KAVA 1DJZA 2PVBA 3WXAA 3VRNA 1KFUS 3H4SE 1XFYO 1Q80A 3TUYC 2LUXA 2PRUA 3WHUB 5KU1A 2CT9A 4P2YB 3AKBA 2ZN9A 2HQWA 5I2LA 3AKAA 3SG4A 4GFTA 4PCWA 1IGVA 3CR4X 1QXPA 4DCKA 2IS9A 3OX6A 1NX3A 2JT3A 2LLSA 2P6BB 1CDPA 1S6CA 1CDLA 1JUOA 2K61A 2K7CA 5CSNA 1CDNA 4DUQA 2QACA 2WCBA 4OKHA 3VRPA 3TDUA 1WLMA 2NCOA 4MEWA 4MSPA 1BJFA 1KFXS 1QTXA 5PALA 1WDCB 1WY9A 1JFJA 3WNXB 3TDIA 2MJWB 2K7OA 1F55A 1UURA 2GGMA 1H4BA 2KYFA 4PE1A 1EXRA 3BXKA 3TS5B 3BQ3A 1J7QA 2LLTA 1L2OC 1QS7A 1OOJA 1IWQA 3AAJA 1CFDA 4GGFA 1ZUZA 2JTTA 3OP0A 2BBMA 1U5IA 2KBIA 2ZNEA 4XJKB 1XFZO 3NXAA 1XFUO 1VRKA 4I5LB 3SJSA 3KF9A 1SR6B 3CR5X 2PALA 2D8NA 1K96A 4GGFC 2LVKA 5CSIA 3HCMA 2K0JA 1BG1A 5AXIA 2K7DA 1LVCD 2H61C 2EGDA 1R2UA 1NPQA 1BOCA 2MAZA 1YURA 1CB1A 2HETA 1F54A 1QLKA 2ZN8A 1F4QA 2JPTA 3ICBA 2PMYA 1B4CA 3CWGA 3NSOA 2LANA 5HKWA 1AVSA 1J1DA 1SR6C 1HQVA 3TZ1A 4MLWA 1CMFA 5J3XA 1WDCC 1BR4B 1K9UA 1FF1A 1SYMA 1SMGA 3HX4A 3JVTC 1J7PA 1CLMA 4FTGA 1NCZA 1TCOB 1NCYA 2JWWA 3PN7B 2LHIA 3PN7C 4HRGA 3OB1B 2M1UA 1MXEA 1OQPA 2EHBA 1HT9A 3PM8A 2WC8A 3CTNA 1KWOB 3PALA 1A03A 1ALWA 2BE6A 2LP2A 1XFVO 1BODA 2KGBC 2JRFA 2KQYA 1WRZA 2O60A 4A4BA 4ICBA 2LNKA 1S6JA 1J7RA 4XYNA 1S26D 1NIWA 2L98A 3BOWA 4WQ3A 3SG6A 1K95A 4F0ZB 1B7TZ 3PLFB 1OE9B 4M2PA 2AAOA 2I2RE 1QATA 2KYCA 2LMTA 2MLFC 1S6IA 4ETOA 3BUXB 3NSLA 2M1KB 2Y1NA 4NQGA 5ER5A 1C07A 3EK4A 1LKJA 1U5IB 3I5GC 4GNKB 5AERA 1XFWO 3IF7A 3BUMB 3D0YA 3DVJA 1OMDA 3I5GB 1JWDA 2FJUB 1FW4A 1YVHA 1YUTA 1PRWA 4MRYA 3A8RA 4R1EA 1F8HA 3MSEB 1QASA 4HREE 1KQVA 1KSOA 2F2OA 2KAXA 2B1UA 1KK8B 1DJHA 2JOJA 3LK0A 3QRXA 1YX7A 1LXFC 1A75A 2G2BA 5CSJA 1C7WA 2LHLA 1M63B 1PK0D 1Y0VH 3I5IC 1N2DA 3ZWHA 1S5GY 1FI5A 1V1GA 5I2OA 4BY4A 1AJ4A 3PSRA 2M8UA 1DGVA 3EK7A 1NP8A 1L7ZA 2MLEC 1K9PA 2L0PA 1DGUA 1PSBA 1IQ5A 2KFFA 2KAYA 1BR1B 3NSKA 1SW8A 1BT6A 2RGIA 1CTRA 1A29A 5B8IB 1WRLA 2AMIA 1LA3A 3GK4X 3I5FC 5D69A 2BCAA 1Y1UA 4FQOA 1F70A 5JOLA 1NSHA 1JF0A 3SIAA 4CLNA 1IH0A 3OB2B 1BLQA 1SL7A 1N65A 2LCPA 4USLA 2AUCA 4OR9B 4GAOA 1K93D 3OX5A 4L9MA 4QJ5B 4E68A 2MHHA 1YUUA 1J1EA 1GQMA 1S5GZ 2OS8C 2LMUA 2OTGC 4CFQA 5AANA 2F2PA 4MZJA 2L2EA 2O5GA 5CSFA 1A2XA 2TN4A 1ZFSA 4TNCA 1IJ5A 1MF8B 2F33A 2KI4C 4OV2A 3O6BA 4MVFA 1DJWA 1JF2A 2K2FA 3DF0B 4M2OA 2MBXA 1JFKA 3KHEA 1A4PA 5HKYA 1RTP1 2LP3A 1MQ1A 2JU0A 1EL4A 1B8RA 2Q4UA 1ZMZA 3E3RA 4JWQA 5KSZA 5KTYA 3FS7A 2OPOA 1PSRA 2PASA 5HKZA 1Y1AA 1ZOTB 5I2QA 1XK4A 2EC6B 3TS5C 1IG5A 1AHRA 3VROA 4AQJA 1A75B 2JC2A 1KK7Z 2ZRSA 2K7BA 2LAPA 2M97A 5ER4X 4YI9A 4QJ4B 1FBVA 2CBLA 5TNCA 3PFVA 1E8AA 4NDCA 1M45A 1CM4A 1KWOC 1RROA 2BE4A 4PHJA 2BL0B 2CTNA 2HF5A 1ZACA 1AJ5A 2PSRA 4ORBB 1SRAA 2A4JA 2JNFA 2KFGA 1DF0A 5G08A 1B9AA 1G33A 3FIAA 1RJVA 1RFJA 4YGCB 4PHNA 3ZNIA 2SASA 3FWCA 1K9KA 1LINA 4I5JA 1SBJA 1KCYA 4N1GA 1KFUL 2M29A 2ZFDA 1QVIY 1JSAA 1W7JB 2I94A 2F8PA 4YRUA 1NCXA 2OTGB 1DTLA 2F3ZA 4U8DA 5I8NA 1DF0B 4NDBA 1SCVA 5FYXA 2JQ6A 4P5OE 2M7NA 2WCEA 4DIRA 1DJYA 3AAKA 1UHJA 3IQOA 5F6TA 4OCIA 1QV1A 1DJXA 4OVNF 1TCFA 2BBNA 1QJTA 1PVBA 2Y4QA 4ZCVA 1RECA 1K2HA 1XA5A 2JTZA 4HSZA 2VRGA 1J7OA 1OMVA 2NCPA 1M46A 1SCMB 1M31A 1N0YA 3IQQA 5DKQA 4XJKA 1IQ3A 1JC2A 1SKTA 1AUIB 2LVVA 4Q04A 1NX2A 2L4IA 2CCMA 1TOPA 2ZRTA 1V1FA 4HRHA 1BMOA 3RLZA 1CM1A 2ZKMX 3O78A 2NLNA 1DT7B 1XFXO 1UHNA 4PE7A 2HQ8A 1YVLA 1KQMC 2LUCA 3JTDC 1Y1XA 2JT8A 1UHKA 2K8MB 1D1OA 1OZSA 2JNXA 1S36A 3CLNA 3LL8B 4ORCB 1B47A 1NX0A 1TN4A 3I5IB 3TDZA 2KHNA 4YI8A 1NX1A 1UWOA 4WQ2A 3DD4A 1YX8A 2V53A 5D7FA 2WORA 1YTZC 3SIBA 1L2OB 4NDDA 1B7TY 1CNPA 3CZTX 1DVIA 2BL0C 2F3YA 1TNWA 1S1EA 1MXLC 1KFXL 2M0RA 2MA2A 3SG3A 3C1VA 1QIVA 2FCDA 3DF0A 4PHMA 2R2IA 4CIDA 3DVKA 5HYDA 5JJGA 3D0YB 2LC5A 3SG2A 2KI6C 4M2QA 4YGEB 2H61A 2LE9B 2LVJA 4PE4A 2L51A 1XYDA 1W7IB 3BUWB 3SG5A 2LLUA 2KSPA 2BCBA 5BPJA 1X02A 4MBEA 4I5NB 2COLB 3D10A 2WCFA 1GGZA 1TNPA 1UUSA 1YRUB 4MRXA 1SCMC 1UP5A 1KK7Y 2KI6D 2LVIA 1WRKA 2LV7A 2JULA 2OS8B 3GOFA 3JVTB 4GBAA 4MZLA 1IRJA 2KQ6A 1RWYA 1JBAA 3EVRA 1ODBA 4PALA 1XVJA 1GGWA 1BU3A 4PE0A 3A4UB 1TNXA 4N1FA 2WNDA 3LK1A 2QPTA 1B8CA 1B1GA 1F4OA 3M0WA 2L50A 2WOSA 1EH2A 3RM1A 1J55A 3CR2A 1QX2A 4MN0A 1QLSA 2GV5A 1QX7A 5HLVA 2I18A 3WHTB 1SK6D 1H8BA 3LCPC 1YR5A 2KI4B 3KPXA 2E30A 2ISDA 1MHOA 4DRWA 1SL9A 4MZKA 3DVMA 1SL8A 2FCEA 3O2PA 1KSMA 2LMVA 1DMOA 4JQ0D 2M7LA 5GQQC 2CNPA 3DVEA 1CDMA 5K89A 1TIZA 1GJYA 5CPVA 4AQIA 5DKNA 1PVAA 3EKHA 2NXQA 4D1EA 1KQMB
chains in the Genus database with same CATH superfamily
1ALVA 1K94A 3BUNB 3KEVA 1FI6A 1FPWA 4PT1A 2M9GA 3NHIA 2Q91A 3R1VA 3D74A 3L4AA 2PQLA 4PDZA 3CS1A 1SNLA 3TUYB 3SG7A 1TRFA 1Y6WA 3EVVA 2JZIA 1IJ6A 1F71A 1QVIZ 2K60A 1LA0A 2M49B 2JXCA 3EK8A 2Y5IA 4ORAB 4QJ3B 4AOMA 1CLBA 2BKIB 2MRDA 3LLEA 5HLOA 1NYAA 1MUXA 3CGAA 4JD9A 2H2KA 4IL1A 1CMGA 2KDHA 4DS7A 5DKRA 1OSAA 2K2AA 2EC6C 3BUOB 2DOQA 1CFFA 1DJGA 3BYAA 2PYQA 4YGDB 2G9BA 1DJIA 1NWDA 3VRRA 1R6PA 4A4CA 4C0JA 2E6WA 4GUKA 1S3PA 2SCPA 1G4YR 4GGNA 1TTXA 2L4HA 4N5XA 3JTDB 2KFHA 3I5HC 5AFPA 1UHIA 3I5HB 2L5XB 4I5KA 2BKHB 3I5FB 1G8IA 1C7VA 1EG4A 1B8LA 1K8UA 1XO5A 1RK9A 1MWNA 2YGUA 2KOTA 4CFRA 4C0LA 2H8VA 2ZNDA 3FE8A 1QV0A 1EG3A 3EVUA 4WRIA 4YBHB 3DYEA 3NSIA 2M3WA 3OHMB 4PHKA 1TUJA 4ZCUA 4UPGA 1NUBA 4JPZB 1AK8A 2GGZA 2HPSA 2WCHA 3FE6A 3QMEA 3D75A 2JT0A 3DY9A 2I7AA 3BOWB 3CABA 3KO0A 4YGBB 4YGAA 4CPVA 1IKUA 1CFCA 2JXLA 2BECA 1YUSA 1M39A 1AP4A 3GK2A 2KNEA 3VRQA 4IJ7A 3K21A 1KK8C 3F45A 2CXJA 1OZOA 1EJ3A 1CKKA 1SY9A 1UHHA 2QDIA 3O4YA 1QIWA 1PULA 5EL2A 3S0GA 1OOHA 1PALA 3VGOA 3PATA 2BCXA 2KBMA 1MR8A 1YRTB 1SPYA 2FOTA 1WLZA 1CFPA 3EKJA 4C0KA 2BAPA 2KGRA 1QX5B 2LM5A 1BF5A 4GPLB 2NZ0A 1K90D 1XK4C 4BY5A 5AEQA 3UO9A 3GK1A 1TNQA 3FWBA 5IBWA 1OMRA 2Y1MA 1CLLA 2KAVA 1DJZA 2PVBA 3WXAA 3VRNA 1KFUS 3H4SE 2BNXA 1XFYO 3S0AA 1Q80A 3TUYC 2LUXA 2PRUA 3WHUB 5KU1A 2CT9A 4P2YB 3AKBA 2ZN9A 2HQWA 3O4XA 4JKTA 3AKAA 5I2LA 3SG4A 4GFTA 2P70A 1ORGA 4PCWA 1Z4HA 1IGVA 3CR4X 1QXPA 4DCKA 2IS9A 3D76A 3OX6A 1NX3A 5HL1A 2JT3A 2LLSA 2P6BB 1CDPA 1S6CA 1CDLA 1JUOA 2K61A 2K7CA 5CSNA 1CDNA 4DUQA 2QACA 2WCBA 4OKHA 3VRPA 3TDUA 2L5YA 1WLMA 2NCOA 4MEWA 4MSPA 1BJFA 1KFXS 1QTXA 5PALA 1WDCB 1WY9A 2WC6A 3WNXB 3TDIA 1JFJA 2MJWB 2K7OA 1F55A 1UURA 4FQTA 2GGMA 1H4BA 2KYFA 4PE1A 1EXRA 3BXKA 3UNWA 2WCLA 1OOGA 3BQ3A 3TS5B 1J7QA 2LLTA 1L2OC 1QS7A 1OOJA 1IWQA 3AAJA 1CFDA 3FE9A 4GGFA 1ZUZA 3Q8IA 2JTTA 3OP0A 2BBMA 1TUZA 1U5IA 2KBIA 2ZNEA 4XJKB 1XFZO 3NXAA 1XFUO 1VRKA 4I5LB 3SJSA 3KF9A 1SR6B 3CR5X 2PALA 2D8NA 1K96A 4GGFC 2LVKA 5CSIA 3HCMA 2K0JA 1BG1A 5AXIA 2K7DA 1LVCD 2H61C 2EGDA 1R2UA 1NPQA 1BOCA 2MAZA 1YURA 1CB1A 2HETA 1F54A 1QLKA 2ZN8A 1XFRA 1F4QA 2JPTA 3ICBA 1JWDA 2PMYA 1B4CA 3CWGA 3NSOA 2LANA 5HKWA 1AVSA 1J1DA 1SR6C 1HQVA 3TZ1A 4MLWA 1CMFA 5J3XA 1WDCC 4INWA 1BR4B 1K9UA 1FF1A 1SYMA 1SMGA 3HX4A 3JVTC 1J7PA 1CLMA 4FTGA 1NCZA 1TCOB 1NCYA 2JWWA 3PN7B 2LHIA 3B86A 3PN7C 4HRGA 3OB1B 2M1UA 1MXEA 3NHTA 1OQPA 2EHBA 5I94A 1HT9A 1P28A 3PM8A 2WC8A 3CTNA 1KWOB 3PALA 3OGNA 1A03A 1ALWA 2BE6A 2LP2A 1XFVO 1DC1A 1BODA 2KGBC 2JRFA 2KQYA 1WRZA 2O60A 4A4BA 4ICBA 2LNKA 1S6JA 1J7RA 4XYNA 1S26D 1NIWA 2L98A 3BOWA 4WQ3A 3SG6A 1K95A 4F0ZB 1B7TZ 2FJYA 3PLFB 5FI6A 1OE9B 3L4LA 4M2PA 2AAOA 1OOFA 1QATA 2I2RE 2KYCA 2LMTA 2MLFC 1S6IA 4ETOA 3RZSA 3BFHA 3BUXB 3NSLA 2M1KB 2Y1NA 4NQGA 5ER5A 1C07A 3EK4A 1LKJA 1W9ZA 1U5IB 3I5GC 4GNKB 3OBVA 5AERA 1XFWO 3BFAA 3BUMB 3D0YA 3DVJA 1OMDA 3I5GB 3IF7A 1FW4A 2FJUB 1YVHA 1YUTA 1PRWA 4MRYA 3A8RA 4R1EA 3D78A 3B7AA 1F8HA 3MSEB 3BJHA 3IVTA 1QASA 4HREE 1KQVA 1KSOA 2F2OA 2ERBA 2KAXA 3L47A 2B1UA 1KK8B 1DJHA 1Z2CB 2JOJA 3LK0A 1YX7A 1LXFC 3QRXA 3R1PA 1A75A 3CDNA 2G2BA 5CSJA 1LS8A 1C7WA 2LHLA 1M63B 1PK0D 2QEHA 1Y0VH 3I5IC 1N2DA 3ZWHA 5FI2A 1S5GY 1FI5A 1V1GA 5I2OA 4BY4A 1AJ4A 3PSRA 2M8UA 1DGVA 4F7FA 3PJIA 3EK7A 3S0BA 1NP8A 1L7ZA 1GM0A 2MLEC 1K9PA 2L0PA 2JPOA 1DGUA 1PSBA 1IQ5A 2KFFA 2KAYA 1BR1B 3NSKA 1SW8A 1BT6A 3B88A 2RGIA 1CTRA 1A29A 5B8IB 3SS3A 3V2LA 1WRLA 2AMIA 1LA3A 3GK4X 3I5FC 5D69A 2BCAA 1Y1UA 4FQOA 1F70A 3R1OA 1NSHA 1JF0A 3PM2A 5JOLA 3SIAA 4CLNA 1IH0A 3OB2B 3R72A 1BLQA 1SL7A 1N65A 2LCPA 4USLA 2AUCA 4OR9B 4GAOA 1K93D 3OX5A 4L9MA 4QJ5B 4E68A 2MHHA 3VB1A 1YUUA 1J1EA 2GTEA 1GQMA 2QEVA 1S5GZ 2OS8C 2LMUA 2OTGC 4CFQA 5AANA 2F2PA 4MZJA 2L2EA 2O5GA 5CSFA 1A2XA 2KLDA 1ZFSA 2TN4A 2WCJA 1IJ5A 4TNCA 1MF8B 2F33A 1QWVA 2KI4C 4OV2A 3O6BA 4MVFA 1DJWA 1JF2A 2K2FA 3DF0B 4M2OA 2MBXA 1JFKA 3KHEA 1A4PA 5HKYA 1RTP1 2LP3A 1MQ1A 2JU0A 1EL4A 4OZDA 1B8RA 2Q4UA 1ZMZA 3E3RA 4JWQA 5KSZA 5KTYA 3FS7A 2OPOA 1PSRA 2PASA 5HKZA 1Y1AA 1ZOTB 5I2QA 1XK4A 2EC6B 3TS5C 1IG5A 1AHRA 3VROA 4AQJA 1A75B 2JC2A 1KK7Z 2ZRSA 2K7BA 2LAPA 2M97A 5ER4X 4YI9A 2QEOA 5FI7A 4QJ4B 1FBVA 2CBLA 2L2CA 3BFBA 1E8AA 3PFVA 1M45A 1CM4A 4NDCA 1KWOC 1RROA 5TNCA 2BE4A 4PHJA 2BL0B 2CTNA 2HF5A 1ZACA 1AJ5A 2PSRA 4ORBB 1SRAA 2A4JA 2JNFA 2KFGA 1DF0A 5G08A 1B9AA 1G33A 3FIAA 1RJVA 3SS4A 1RFJA 4YGCB 4PHNA 3ZNIA 2SASA 3FWCA 1K9KA 1LINA 4I5JA 1SBJA 1KCYA 4N1GA 1KFUL 2M29A 2ZFDA 1QVIY 1JSAA 1W7JB 2I94A 2F8PA 4YRUA 1NCXA 2OTGB 1DTLA 2QEBA 2F3ZA 3B6XA 4U8DA 5I8NA 1DF0B 4NDBA 1SCVA 5FYXA 2JQ6A 4P5OE 2M7NA 1DELA 2WCEA 4DIRA 1DJYA 3AAKA 1UHJA 3IQOA 5F6TA 4OCIA 1DQEA 1QV1A 1DJXA 4OVNF 1TCFA 2BBNA 3B87A 1QJTA 1PVBA 2Y4QA 4ZCVA 1RECA 1K2HA 1XA5A 2JTZA 3DXLA 4HSZA 2VRGA 1J7OA 1OMVA 2NCPA 1M46A 1SCMB 1M31A 1N0YA 3IQQA 5DKQA 4XJKA 1IQ3A 1JC2A 1SKTA 1AUIB 2LVVA 4Q04A 1NX2A 2L4IA 2CCMA 1TOPA 2ZRTA 1V1FA 4HRHA 1BMOA 3RLZA 1CM1A 2ZKMX 3O78A 2WCMA 2NLNA 1DT7B 1XFXO 1UHNA 4PE7A 5D3OA 2HQ8A 1YVLA 1KQMC 2LUCA 3D73A 1Y1XA 2JT8A 1UHKA 2K8MB 3CZ0A 3JTDC 1D1OA 1OZSA 2JNXA 1S36A 3CLNA 3LL8B 4ORCB 1B47A 1NX0A 1TN4A 1TWOA 3I5IB 3TDZA 3S0FA 2KHNA 4YI8A 1NX1A 1UWOA 1C3YA 4WQ2A 3DD4A 1YX8A 2V53A 5D7FA 2WORA 1YTZC 3SIBA 1L2OB 4NDDA 1B7TY 1OW4A 1CNPA 3CZTX 1DVIA 2BL0C 2F3YA 1TNWA 1S1EA 3K1EA 1MXLC 1KFXL 2M0RA 2MA2A 3SG3A 3CZ1A 3S0DA 3C1VA 1QIVA 2FCDA 3DF0A 4PHMA 2R2IA 3S0EA 3DVKA 4CIDA 5HYDA 5JJGA 3D0YB 2LC5A 3CZ2A 3SG2A 2KI6C 3DZTA 4M2QA 4YGEB 2H61A 2LE9B 2LVJA 2WC5A 4PE4A 2L51A 1XYDA 1W7IB 3BUWB 4KYNA 3SS5A 3SG5A 2LLUA 2KSPA 2BCBA 5BPJA 1X02A 4MBEA 4I5NB 2COLB 3D10A 1T14A 2WCFA 1GGZA 1TNPA 3NGVA 1UUSA 1YRUB 4MRXA 1SCMC 1UP5A 1KK7Y 2KI6D 2LVIA 1WRKA 2LV7A 2JULA 2OS8B 3GOFA 3JVTB 3N7HA 4GBAA 4MZLA 1IRJA 2KQ6A 1RWYA 1JBAA 3EVRA 1C3ZA 1ODBA 2P71A 4PALA 1XVJA 1GGWA 1BU3A 4PE0A 3A4UB 1TNXA 3EG5B 2WNDA 3LK1A 2QPTA 4N1FA 1B8CA 1B1GA 1F4OA 3CYZA 3M0WA 2L50A 2WOSA 1EH2A 3RM1A 1J55A 3CR2A 1QX2A 4INXA 4MN0A 1QLSA 2GV5A 1IIOA 1SSEB 5DICA 2KPHA 1QX7A 5HLVA 2I18A 3WHTB 1SK6D 1H8BA 3D77A 3LCPC 1YR5A 2KI4B 3KPXA 2E30A 2ISDA 1MHOA 4DRWA 1SL9A 4MZKA 3DVMA 1OOIX 1SL8A 2FCEA 3O2PA 1KSMA 2LMVA 1DMOA 4JQ0D 2M7LA 5GQQC 2CNPA 3DVEA 1CDMA 5K89A 1TIZA 1GJYA 5CPVA 4AQIA 1DEKA 5DKNA 2KLEA 1PVAA 2WCKA 3EKHA 2NXQA 4D1EA 1KQMB
chains in the Genus database with same CATH topology
1ALVA 1K94A 3BUNB 3KEVA 1FI6A 1FPWA 2M9GA 2Q91A 4PDZA 3CS1A 1SNLA 3TUYB 3SG7A 1TRFA 1Y6WA 3EVVA 2JZIA 1IJ6A 1F71A 1QVIZ 3EK8A 1LA0A 2M49B 2JXCA 4ORAB 2Y5IA 4QJ3B 4AOMA 1CLBA 2BKIB 2MRDA 3LLEA 5HLOA 1NYAA 1MUXA 3CGAA 2H2KA 4IL1A 1CMGA 2KDHA 4DS7A 5DKRA 1OSAA 2K2AA 2EC6C 3BUOB 2DOQA 1CFFA 1DJGA 3BYAA 4YGDB 2G9BA 1DJIA 1NWDA 3VRRA 1R6PA 4A4CA 4C0JA 2E6WA 4GUKA 1S3PA 2SCPA 1G4YR 4GGNA 1TTXA 2L4HA 4N5XA 3JTDB 2KFHA 3I5HC 5AFPA 1UHIA 3I5HB 2L5XB 4I5KA 2BKHB 3I5FB 1G8IA 1C7VA 1EG4A 1B8LA 1K8UA 1XO5A 1RK9A 1MWNA 2KOTA 4CFRA 4C0LA 2ZNDA 1QV0A 1EG3A 3EVUA 4WRIA 4YBHB 3NSIA 2M3WA 3OHMB 4PHKA 4ZCUA 4UPGA 1NUBA 4JPZB 1AK8A 2GGZA 2HPSA 2JT0A 2I7AA 3BOWB 3KO0A 4YGBB 4YGAA 4CPVA 1IKUA 1CFCA 2JXLA 2BECA 1YUSA 1M39A 1AP4A 3GK2A 2KNEA 3VRQA 3K21A 1KK8C 3F45A 2CXJA 1OZOA 1EJ3A 1CKKA 1SY9A 1UHHA 3O4YA 1QIWA 1PULA 1PALA 3VGOA 3PATA 2BCXA 2KBMA 1MR8A 1YRTB 1SPYA 2FOTA 1WLZA 1CFPA 3EKJA 4C0KA 2KGRA 1QX5B 2LM5A 1BF5A 4GPLB 2NZ0A 1K90D 1XK4C 4BY5A 5AEQA 3GK1A 1TNQA 3FWBA 5IBWA 1OMRA 2Y1MA 1CLLA 2KAVA 1DJZA 2PVBA 3WXAA 3VRNA 1KFUS 3H4SE 1XFYO 1Q80A 3TUYC 2LUXA 2PRUA 3WHUB 5KU1A 2CT9A 4P2YB 3AKBA 2ZN9A 2HQWA 5I2LA 3AKAA 3SG4A 4GFTA 4PCWA 1IGVA 3CR4X 1QXPA 4DCKA 2IS9A 3OX6A 1NX3A 2JT3A 2LLSA 2P6BB 1CDPA 1S6CA 1CDLA 1JUOA 2K61A 2K7CA 5CSNA 1CDNA 4DUQA 2QACA 2WCBA 4OKHA 3VRPA 3TDUA 1WLMA 2NCOA 4MEWA 4MSPA 1BJFA 1KFXS 1QTXA 5PALA 1WDCB 1WY9A 1JFJA 3WNXB 3TDIA 2MJWB 2K7OA 1F55A 1UURA 2GGMA 1H4BA 2KYFA 4PE1A 1EXRA 3BXKA 3TS5B 3BQ3A 1J7QA 2LLTA 1L2OC 1QS7A 1OOJA 1IWQA 3AAJA 1CFDA 4GGFA 1ZUZA 2JTTA 3OP0A 2BBMA 1U5IA 2KBIA 2ZNEA 4XJKB 1XFZO 3NXAA 1XFUO 1VRKA 4I5LB 3SJSA 3KF9A 1SR6B 3CR5X 2PALA 2D8NA 1K96A 4GGFC 2LVKA 5CSIA 3HCMA 2K0JA 1BG1A 5AXIA 2K7DA 1LVCD 2H61C 2EGDA 1R2UA 1NPQA 1BOCA 2MAZA 1YURA 1CB1A 2HETA 1F54A 1QLKA 2ZN8A 1F4QA 2JPTA 3ICBA 2PMYA 1B4CA 3CWGA 3NSOA 2LANA 5HKWA 1AVSA 1J1DA 1SR6C 1HQVA 3TZ1A 4MLWA 1CMFA 5J3XA 1WDCC 1BR4B 1K9UA 1FF1A 1SYMA 1SMGA 3HX4A 3JVTC 1J7PA 1CLMA 4FTGA 1NCZA 1TCOB 1NCYA 2JWWA 3PN7B 2LHIA 3PN7C 4HRGA 3OB1B 2M1UA 1MXEA 1OQPA 2EHBA 1HT9A 3PM8A 2WC8A 3CTNA 1KWOB 3PALA 1A03A 1ALWA 2BE6A 2LP2A 1XFVO 1BODA 2KGBC 2JRFA 2KQYA 1WRZA 2O60A 4A4BA 4ICBA 2LNKA 1S6JA 1J7RA 4XYNA 1S26D 1NIWA 2L98A 3BOWA 4WQ3A 3SG6A 1K95A 4F0ZB 1B7TZ 3PLFB 1OE9B 4M2PA 2AAOA 2I2RE 1QATA 2KYCA 2LMTA 2MLFC 1S6IA 4ETOA 3BUXB 3NSLA 2M1KB 2Y1NA 4NQGA 5ER5A 1C07A 3EK4A 1LKJA 1U5IB 3I5GC 4GNKB 5AERA 1XFWO 3IF7A 3BUMB 3D0YA 3DVJA 1OMDA 3I5GB 1JWDA 2FJUB 1FW4A 1YVHA 1YUTA 1PRWA 4MRYA 3A8RA 4R1EA 1F8HA 3MSEB 1QASA 4HREE 1KQVA 1KSOA 2F2OA 2KAXA 2B1UA 1KK8B 1DJHA 2JOJA 3LK0A 3QRXA 1YX7A 1LXFC 1A75A 2G2BA 5CSJA 1C7WA 2LHLA 1M63B 1PK0D 1Y0VH 3I5IC 1N2DA 3ZWHA 1S5GY 1FI5A 1V1GA 5I2OA 4BY4A 1AJ4A 3PSRA 2M8UA 1DGVA 3EK7A 1NP8A 1L7ZA 2MLEC 1K9PA 2L0PA 1DGUA 1PSBA 1IQ5A 2KFFA 2KAYA 1BR1B 3NSKA 1SW8A 1BT6A 2RGIA 1CTRA 1A29A 5B8IB 1WRLA 2AMIA 1LA3A 3GK4X 3I5FC 5D69A 2BCAA 1Y1UA 4FQOA 1F70A 5JOLA 1NSHA 1JF0A 3SIAA 4CLNA 1IH0A 3OB2B 1BLQA 1SL7A 1N65A 2LCPA 4USLA 2AUCA 4OR9B 4GAOA 1K93D 3OX5A 4L9MA 4QJ5B 4E68A 2MHHA 1YUUA 1J1EA 1GQMA 1S5GZ 2OS8C 2LMUA 2OTGC 4CFQA 5AANA 2F2PA 4MZJA 2L2EA 2O5GA 5CSFA 1A2XA 2TN4A 1ZFSA 4TNCA 1IJ5A 1MF8B 2F33A 2KI4C 4OV2A 3O6BA 4MVFA 1DJWA 1JF2A 2K2FA 3DF0B 4M2OA 2MBXA 1JFKA 3KHEA 1A4PA 5HKYA 1RTP1 2LP3A 1MQ1A 2JU0A 1EL4A 1B8RA 2Q4UA 1ZMZA 3E3RA 4JWQA 5KSZA 5KTYA 3FS7A 2OPOA 1PSRA 2PASA 5HKZA 1Y1AA 1ZOTB 5I2QA 1XK4A 2EC6B 3TS5C 1IG5A 1AHRA 3VROA 4AQJA 1A75B 2JC2A 1KK7Z 2ZRSA 2K7BA 2LAPA 2M97A 5ER4X 4YI9A 4QJ4B 1FBVA 2CBLA 5TNCA 3PFVA 1E8AA 4NDCA 1M45A 1CM4A 1KWOC 1RROA 2BE4A 4PHJA 2BL0B 2CTNA 2HF5A 1ZACA 1AJ5A 2PSRA 4ORBB 1SRAA 2A4JA 2JNFA 2KFGA 1DF0A 5G08A 1B9AA 1G33A 3FIAA 1RJVA 1RFJA 4YGCB 4PHNA 3ZNIA 2SASA 3FWCA 1K9KA 1LINA 4I5JA 1SBJA 1KCYA 4N1GA 1KFUL 2M29A 2ZFDA 1QVIY 1JSAA 1W7JB 2I94A 2F8PA 4YRUA 1NCXA 2OTGB 1DTLA 2F3ZA 4U8DA 5I8NA 1DF0B 4NDBA 1SCVA 5FYXA 2JQ6A 4P5OE 2M7NA 2WCEA 4DIRA 1DJYA 3AAKA 1UHJA 3IQOA 5F6TA 4OCIA 1QV1A 1DJXA 4OVNF 1TCFA 2BBNA 1QJTA 1PVBA 2Y4QA 4ZCVA 1RECA 1K2HA 1XA5A 2JTZA 4HSZA 2VRGA 1J7OA 1OMVA 2NCPA 1M46A 1SCMB 1M31A 1N0YA 3IQQA 5DKQA 4XJKA 1IQ3A 1JC2A 1SKTA 1AUIB 2LVVA 4Q04A 1NX2A 2L4IA 2CCMA 1TOPA 2ZRTA 1V1FA 4HRHA 1BMOA 3RLZA 1CM1A 2ZKMX 3O78A 2NLNA 1DT7B 1XFXO 1UHNA 4PE7A 2HQ8A 1YVLA 1KQMC 2LUCA 3JTDC 1Y1XA 2JT8A 1UHKA 2K8MB 1D1OA 1OZSA 2JNXA 1S36A 3CLNA 3LL8B 4ORCB 1B47A 1NX0A 1TN4A 3I5IB 3TDZA 2KHNA 4YI8A 1NX1A 1UWOA 4WQ2A 3DD4A 1YX8A 2V53A 5D7FA 2WORA 1YTZC 3SIBA 1L2OB 4NDDA 1B7TY 1CNPA 3CZTX 1DVIA 2BL0C 2F3YA 1TNWA 1S1EA 1MXLC 1KFXL 2M0RA 2MA2A 3SG3A 3C1VA 1QIVA 2FCDA 3DF0A 4PHMA 2R2IA 4CIDA 3DVKA 5HYDA 5JJGA 3D0YB 2LC5A 3SG2A 2KI6C 4M2QA 4YGEB 2H61A 2LE9B 2LVJA 4PE4A 2L51A 1XYDA 1W7IB 3BUWB 3SG5A 2LLUA 2KSPA 2BCBA 5BPJA 1X02A 4MBEA 4I5NB 2COLB 3D10A 2WCFA 1GGZA 1TNPA 1UUSA 1YRUB 4MRXA 1SCMC 1UP5A 1KK7Y 2KI6D 2LVIA 1WRKA 2LV7A 2JULA 2OS8B 3GOFA 3JVTB 4GBAA 4MZLA 1IRJA 2KQ6A 1RWYA 1JBAA 3EVRA 1ODBA 4PALA 1XVJA 1GGWA 1BU3A 4PE0A 3A4UB 1TNXA 4N1FA 2WNDA 3LK1A 2QPTA 1B8CA 1B1GA 1F4OA 3M0WA 2L50A 2WOSA 1EH2A 3RM1A 1J55A 3CR2A 1QX2A 4MN0A 1QLSA 2GV5A 1QX7A 5HLVA 2I18A 3WHTB 1SK6D 1H8BA 3LCPC 1YR5A 2KI4B 3KPXA 2E30A 2ISDA 1MHOA 4DRWA 1SL9A 4MZKA 3DVMA 1SL8A 2FCEA 3O2PA 1KSMA 2LMVA 1DMOA 4JQ0D 2M7LA 5GQQC 2CNPA 3DVEA 1CDMA 5K89A 1TIZA 1GJYA 5CPVA 4AQIA 5DKNA 1PVAA 3EKHA 2NXQA 4D1EA 1KQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALV A;  1K94 A;  3BUN B;  3KEV A;  1FI6 A;  1FPW A;  2M9G A;  2Q91 A;  4PDZ A;  3CS1 A;  1SNL A;  3TUY B;  3SG7 A;  1TRF A;  1Y6W A;  3EVV A;  2JZI A;  1IJ6 A;  1F71 A;  1QVI Z;  3EK8 A;  1LA0 A;  2M49 B;  2JXC A;  4ORA B;  2Y5I A;  4QJ3 B;  4AOM A;  1CLB A;  2BKI B;  2MRD A;  3LLE A;  5HLO A;  1NYA A;  1MUX A;  3CGA A;  2H2K A;  4IL1 A;  1CMG A;  2KDH A;  4DS7 A;  5DKR A;  1OSA A;  2K2A A;  2EC6 C;  3BUO B;  2DOQ A;  1CFF A;  1DJG A;  3BYA A;  4YGD B;  2G9B A;  1DJI A;  1NWD A;  3VRR A;  1R6P A;  4A4C A;  4C0J A;  2E6W A;  4GUK A;  1S3P A;  2SCP A;  1G4Y R;  4GGN A;  1TTX A;  2L4H A;  4N5X A;  3JTD B;  2KFH A;  3I5H C;  5AFP A;  1UHI A;  3I5H B;  2L5X B;  4I5K A;  2BKH B;  3I5F B;  1G8I A;  1C7V A;  1EG4 A;  1B8L A;  1K8U A;  1XO5 A;  1RK9 A;  1MWN A;  2KOT A;  4CFR A;  4C0L A;  2ZND A;  1QV0 A;  1EG3 A;  3EVU A;  4WRI A;  4YBH B;  3NSI A;  2M3W A;  3OHM B;  4PHK A;  4ZCU A;  4UPG A;  1NUB A;  4JPZ B;  1AK8 A;  2GGZ A;  2HPS A;  2JT0 A;  2I7A A;  3BOW B;  3KO0 A;  4YGB B;  4YGA A;  4CPV A;  1IKU A;  1CFC A;  2JXL A;  2BEC A;  1YUS A;  1M39 A;  1AP4 A;  3GK2 A;  2KNE A;  3VRQ A;  3K21 A;  1KK8 C;  3F45 A;  2CXJ A;  1OZO A;  1EJ3 A;  1CKK A;  1SY9 A;  1UHH A;  3O4Y A;  1QIW A;  1PUL A;  1PAL A;  3VGO A;  3PAT A;  2BCX A;  2KBM A;  1MR8 A;  1YRT B;  1SPY A;  2FOT A;  1WLZ A;  1CFP A;  3EKJ A;  4C0K A;  2KGR A;  1QX5 B;  2LM5 A;  1BF5 A;  4GPL B;  2NZ0 A;  1K90 D;  1XK4 C;  4BY5 A;  5AEQ A;  3GK1 A;  1TNQ A;  3FWB A;  5IBW A;  1OMR A;  2Y1M A;  1CLL A;  2KAV A;  1DJZ A;  2PVB A;  3WXA A;  3VRN A;  1KFU S;  3H4S E;  1XFY O;  1Q80 A;  3TUY C;  2LUX A;  2PRU A;  3WHU B;  5KU1 A;  2CT9 A;  4P2Y B;  3AKB A;  2ZN9 A;  2HQW A;  5I2L A;  3AKA A;  3SG4 A;  4GFT A;  4PCW A;  1IGV A;  3CR4 X;  1QXP A;  4DCK A;  2IS9 A;  3OX6 A;  1NX3 A;  2JT3 A;  2LLS A;  2P6B B;  1CDP A;  1S6C A;  1CDL A;  1JUO A;  2K61 A;  2K7C A;  5CSN A;  1CDN A;  4DUQ A;  2QAC A;  2WCB A;  4OKH A;  3VRP A;  3TDU A;  1WLM A;  2NCO A;  4MEW A;  4MSP A;  1BJF A;  1KFX S;  1QTX A;  5PAL A;  1WDC B;  1WY9 A;  1JFJ A;  3WNX B;  3TDI A;  2MJW B;  2K7O A;  1F55 A;  1UUR A;  2GGM A;  1H4B A;  2KYF A;  4PE1 A;  1EXR A;  3BXK A;  3TS5 B;  3BQ3 A;  1J7Q A;  2LLT A;  1L2O C;  1QS7 A;  1OOJ A;  1IWQ A;  3AAJ A;  1CFD A;  4GGF A;  1ZUZ A;  2JTT A;  3OP0 A;  2BBM A;  1U5I A;  2KBI A;  2ZNE A;  4XJK B;  1XFZ O;  3NXA A;  1XFU O;  1VRK A;  4I5L B;  3SJS A;  3KF9 A;  1SR6 B;  3CR5 X;  2PAL A;  2D8N A;  1K96 A;  4GGF C;  2LVK A;  5CSI A;  3HCM A;  2K0J A;  1BG1 A;  5AXI A;  2K7D A;  1LVC D;  2H61 C;  2EGD A;  1R2U A;  1NPQ A;  1BOC A;  2MAZ A;  1YUR A;  1CB1 A;  2HET A;  1F54 A;  1QLK A;  2ZN8 A;  1F4Q A;  2JPT A;  3ICB A;  2PMY A;  1B4C A;  3CWG A;  3NSO A;  2LAN A;  5HKW A;  1AVS A;  1J1D A;  1SR6 C;  1HQV A;  3TZ1 A;  4MLW A;  1CMF A;  5J3X A;  1WDC C;  1BR4 B;  1K9U A;  1FF1 A;  1SYM A;  1SMG A;  3HX4 A;  3JVT C;  1J7P A;  1CLM A;  4FTG A;  1NCZ A;  1TCO B;  1NCY A;  2JWW A;  3PN7 B;  2LHI A;  3PN7 C;  4HRG A;  3OB1 B;  2M1U A;  1MXE A;  1OQP A;  2EHB A;  1HT9 A;  3PM8 A;  2WC8 A;  3CTN A;  1KWO B;  3PAL A;  1A03 A;  1ALW A;  2BE6 A;  2LP2 A;  1XFV O;  1BOD A;  2KGB C;  2JRF A;  2KQY A;  1WRZ A;  2O60 A;  4A4B A;  4ICB A;  2LNK A;  1S6J A;  1J7R A;  4XYN A;  1S26 D;  1NIW A;  2L98 A;  3BOW A;  4WQ3 A;  3SG6 A;  1K95 A;  4F0Z B;  1B7T Z;  3PLF B;  1OE9 B;  4M2P A;  2AAO A;  2I2R E;  1QAT A;  2KYC A;  2LMT A;  2MLF C;  1S6I A;  4ETO A;  3BUX B;  3NSL A;  2M1K B;  2Y1N A;  4NQG A;  5ER5 A;  1C07 A;  3EK4 A;  1LKJ A;  1U5I B;  3I5G C;  4GNK B;  5AER A;  1XFW O;  3IF7 A;  3BUM B;  3D0Y A;  3DVJ A;  1OMD A;  3I5G B;  1JWD A;  2FJU B;  1FW4 A;  1YVH A;  1YUT A;  1PRW A;  4MRY A;  3A8R A;  4R1E A;  1F8H A;  3MSE B;  1QAS A;  4HRE E;  1KQV A;  1KSO A;  2F2O A;  2KAX A;  2B1U A;  1KK8 B;  1DJH A;  2JOJ A;  3LK0 A;  3QRX A;  1YX7 A;  1LXF C;  1A75 A;  2G2B A;  5CSJ A;  1C7W A;  2LHL A;  1M63 B;  1PK0 D;  1Y0V H;  3I5I C;  1N2D A;  3ZWH A;  1S5G Y;  1FI5 A;  1V1G A;  5I2O A;  4BY4 A;  1AJ4 A;  3PSR A;  2M8U A;  1DGV A;  3EK7 A;  1NP8 A;  1L7Z A;  2MLE C;  1K9P A;  2L0P A;  1DGU A;  1PSB A;  1IQ5 A;  2KFF A;  2KAY A;  1BR1 B;  3NSK A;  1SW8 A;  1BT6 A;  2RGI A;  1CTR A;  1A29 A;  5B8I B;  1WRL A;  2AMI A;  1LA3 A;  3GK4 X;  3I5F C;  5D69 A;  2BCA A;  1Y1U A;  4FQO A;  1F70 A;  5JOL A;  1NSH A;  1JF0 A;  3SIA A;  4CLN A;  1IH0 A;  3OB2 B;  1BLQ A;  1SL7 A;  1N65 A;  2LCP A;  4USL A;  2AUC A;  4OR9 B;  4GAO A;  1K93 D;  3OX5 A;  4L9M A;  4QJ5 B;  4E68 A;  2MHH A;  1YUU A;  1J1E A;  1GQM A;  1S5G Z;  2OS8 C;  2LMU A;  2OTG C;  4CFQ A;  5AAN A;  2F2P A;  4MZJ A;  2L2E A;  2O5G A;  5CSF A;  1A2X A;  2TN4 A;  1ZFS A;  4TNC A;  1IJ5 A;  1MF8 B;  2F33 A;  2KI4 C;  4OV2 A;  3O6B A;  4MVF A;  1DJW A;  1JF2 A;  2K2F A;  3DF0 B;  4M2O A;  2MBX A;  1JFK A;  3KHE A;  1A4P A;  5HKY A;  1RTP 1;  2LP3 A;  1MQ1 A;  2JU0 A;  1EL4 A;  1B8R A;  2Q4U A;  1ZMZ A;  3E3R A;  4JWQ A;  5KSZ A;  5KTY A;  3FS7 A;  2OPO A;  1PSR A;  2PAS A;  5HKZ A;  1Y1A A;  1ZOT B;  5I2Q A;  1XK4 A;  2EC6 B;  3TS5 C;  1IG5 A;  1AHR A;  3VRO A;  4AQJ A;  1A75 B;  2JC2 A;  1KK7 Z;  2ZRS A;  2K7B A;  2LAP A;  2M97 A;  5ER4 X;  4YI9 A;  4QJ4 B;  1FBV A;  2CBL A;  5TNC A;  3PFV A;  1E8A A;  4NDC A;  1M45 A;  1CM4 A;  1KWO C;  1RRO A;  2BE4 A;  4PHJ A;  2BL0 B;  2CTN A;  2HF5 A;  1ZAC A;  1AJ5 A;  2PSR A;  4ORB B;  1SRA A;  2A4J A;  2JNF A;  2KFG A;  1DF0 A;  5G08 A;  1B9A A;  1G33 A;  3FIA A;  1RJV A;  1RFJ A;  4YGC B;  4PHN A;  3ZNI A;  2SAS A;  3FWC A;  1K9K A;  1LIN A;  4I5J A;  1SBJ A;  1KCY A;  4N1G A;  1KFU L;  2M29 A;  2ZFD A;  1QVI Y;  1JSA A;  1W7J B;  2I94 A;  2F8P A;  4YRU A;  1NCX A;  2OTG B;  1DTL A;  2F3Z A;  4U8D A;  5I8N A;  1DF0 B;  4NDB A;  1SCV A;  5FYX A;  2JQ6 A;  4P5O E;  2M7N A;  2WCE A;  4DIR A;  1DJY A;  3AAK A;  1UHJ A;  3IQO A;  5F6T A;  4OCI A;  1QV1 A;  1DJX A;  4OVN F;  1TCF A;  2BBN A;  1QJT A;  1PVB A;  2Y4Q A;  4ZCV A;  1REC A;  1K2H A;  1XA5 A;  2JTZ A;  4HSZ A;  2VRG A;  1J7O A;  1OMV A;  2NCP A;  1M46 A;  1SCM B;  1M31 A;  1N0Y A;  3IQQ A;  5DKQ A;  4XJK A;  1IQ3 A;  1JC2 A;  1SKT A;  1AUI B;  2LVV A;  4Q04 A;  1NX2 A;  2L4I A;  2CCM A;  1TOP A;  2ZRT A;  1V1F A;  4HRH A;  1BMO A;  3RLZ A;  1CM1 A;  2ZKM X;  3O78 A;  2NLN A;  1DT7 B;  1XFX O;  1UHN A;  4PE7 A;  2HQ8 A;  1YVL A;  1KQM C;  2LUC A;  3JTD C;  1Y1X A;  2JT8 A;  1UHK A;  2K8M B;  1D1O A;  1OZS A;  2JNX A;  1S36 A;  3CLN A;  3LL8 B;  4ORC B;  1B47 A;  1NX0 A;  1TN4 A;  3I5I B;  3TDZ A;  2KHN A;  4YI8 A;  1NX1 A;  1UWO A;  4WQ2 A;  3DD4 A;  1YX8 A;  2V53 A;  5D7F A;  2WOR A;  1YTZ C;  3SIB A;  1L2O B;  4NDD A;  1B7T Y;  1CNP A;  3CZT X;  1DVI A;  2BL0 C;  2F3Y A;  1TNW A;  1S1E A;  1MXL C;  1KFX L;  2M0R A;  2MA2 A;  3SG3 A;  3C1V A;  1QIV A;  2FCD A;  3DF0 A;  4PHM A;  2R2I A;  4CID A;  3DVK A;  5HYD A;  5JJG A;  3D0Y B;  2LC5 A;  3SG2 A;  2KI6 C;  4M2Q A;  4YGE B;  2H61 A;  2LE9 B;  2LVJ A;  4PE4 A;  2L51 A;  1XYD A;  1W7I B;  3BUW B;  3SG5 A;  2LLU A;  2KSP A;  2BCB A;  5BPJ A;  1X02 A;  4MBE A;  4I5N B;  2COL B;  3D10 A;  2WCF A;  1GGZ A;  1TNP A;  1UUS A;  1YRU B;  4MRX A;  1SCM C;  1UP5 A;  1KK7 Y;  2KI6 D;  2LVI A;  1WRK A;  2LV7 A;  2JUL A;  2OS8 B;  3GOF A;  3JVT B;  4GBA A;  4MZL A;  1IRJ A;  2KQ6 A;  1RWY A;  1JBA A;  3EVR A;  1ODB A;  4PAL A;  1XVJ A;  1GGW A;  1BU3 A;  4PE0 A;  3A4U B;  1TNX A;  4N1F A;  2WND A;  3LK1 A;  2QPT A;  1B8C A;  1B1G A;  1F4O A;  3M0W A;  2L50 A;  2WOS A;  1EH2 A;  3RM1 A;  1J55 A;  3CR2 A;  1QX2 A;  4MN0 A;  1QLS A;  2GV5 A;  1QX7 A;  5HLV A;  2I18 A;  3WHT B;  1SK6 D;  1H8B A;  3LCP C;  1YR5 A;  2KI4 B;  3KPX A;  2E30 A;  2ISD A;  1MHO A;  4DRW A;  1SL9 A;  4MZK A;  3DVM A;  1SL8 A;  2FCE A;  3O2P A;  1KSM A;  2LMV A;  1DMO A;  4JQ0 D;  2M7L A;  5GQQ C;  2CNP A;  3DVE A;  1CDM A;  5K89 A;  1TIZ A;  1GJY A;  5CPV A;  4AQI A;  5DKN A;  1PVA A;  3EKH A;  2NXQ A;  4D1E A;  1KQM B; 
#chains in the Genus database with same CATH topology
 1ALV A;  1K94 A;  3BUN B;  3KEV A;  1FI6 A;  1FPW A;  4PT1 A;  2M9G A;  3NHI A;  2Q91 A;  3R1V A;  3D74 A;  3L4A A;  2PQL A;  4PDZ A;  3CS1 A;  1SNL A;  3TUY B;  3SG7 A;  1TRF A;  1Y6W A;  3EVV A;  2JZI A;  1IJ6 A;  1F71 A;  1QVI Z;  2K60 A;  1LA0 A;  2M49 B;  2JXC A;  3EK8 A;  2Y5I A;  4ORA B;  4QJ3 B;  4AOM A;  1CLB A;  2BKI B;  2MRD A;  3LLE A;  5HLO A;  1NYA A;  1MUX A;  3CGA A;  4JD9 A;  2H2K A;  4IL1 A;  1CMG A;  2KDH A;  4DS7 A;  5DKR A;  1OSA A;  2K2A A;  2EC6 C;  3BUO B;  2DOQ A;  1CFF A;  1DJG A;  3BYA A;  2PYQ A;  4YGD B;  2G9B A;  1DJI A;  1NWD A;  3VRR A;  1R6P A;  4A4C A;  4C0J A;  2E6W A;  4GUK A;  1S3P A;  2SCP A;  1G4Y R;  4GGN A;  1TTX A;  2L4H A;  4N5X A;  3JTD B;  2KFH A;  3I5H C;  5AFP A;  1UHI A;  3I5H B;  2L5X B;  4I5K A;  2BKH B;  3I5F B;  1G8I A;  1C7V A;  1EG4 A;  1B8L A;  1K8U A;  1XO5 A;  1RK9 A;  1MWN A;  2YGU A;  2KOT A;  4CFR A;  4C0L A;  2H8V A;  2ZND A;  3FE8 A;  1QV0 A;  1EG3 A;  3EVU A;  4WRI A;  4YBH B;  3DYE A;  3NSI A;  2M3W A;  3OHM B;  4PHK A;  1TUJ A;  4ZCU A;  4UPG A;  1NUB A;  4JPZ B;  1AK8 A;  2GGZ A;  2HPS A;  2WCH A;  3FE6 A;  3QME A;  3D75 A;  2JT0 A;  3DY9 A;  2I7A A;  3BOW B;  3CAB A;  3KO0 A;  4YGB B;  4YGA A;  4CPV A;  1IKU A;  1CFC A;  2JXL A;  2BEC A;  1YUS A;  1M39 A;  1AP4 A;  3GK2 A;  2KNE A;  3VRQ A;  4IJ7 A;  3K21 A;  1KK8 C;  3F45 A;  2CXJ A;  1OZO A;  1EJ3 A;  1CKK A;  1SY9 A;  1UHH A;  2QDI A;  3O4Y A;  1QIW A;  1PUL A;  5EL2 A;  3S0G A;  1OOH A;  1PAL A;  3VGO A;  3PAT A;  2BCX A;  2KBM A;  1MR8 A;  1YRT B;  1SPY A;  2FOT A;  1WLZ A;  1CFP A;  3EKJ A;  4C0K A;  2BAP A;  2KGR A;  1QX5 B;  2LM5 A;  1BF5 A;  4GPL B;  2NZ0 A;  1K90 D;  1XK4 C;  4BY5 A;  5AEQ A;  3UO9 A;  3GK1 A;  1TNQ A;  3FWB A;  5IBW A;  1OMR A;  2Y1M A;  1CLL A;  2KAV A;  1DJZ A;  2PVB A;  3WXA A;  3VRN A;  1KFU S;  3H4S E;  2BNX A;  1XFY O;  3S0A A;  1Q80 A;  3TUY C;  2LUX A;  2PRU A;  3WHU B;  5KU1 A;  2CT9 A;  4P2Y B;  3AKB A;  2ZN9 A;  2HQW A;  3O4X A;  4JKT A;  3AKA A;  5I2L A;  3SG4 A;  4GFT A;  2P70 A;  1ORG A;  4PCW A;  1Z4H A;  1IGV A;  3CR4 X;  1QXP A;  4DCK A;  2IS9 A;  3D76 A;  3OX6 A;  1NX3 A;  5HL1 A;  2JT3 A;  2LLS A;  2P6B B;  1CDP A;  1S6C A;  1CDL A;  1JUO A;  2K61 A;  2K7C A;  5CSN A;  1CDN A;  4DUQ A;  2QAC A;  2WCB A;  4OKH A;  3VRP A;  3TDU A;  2L5Y A;  1WLM A;  2NCO A;  4MEW A;  4MSP A;  1BJF A;  1KFX S;  1QTX A;  5PAL A;  1WDC B;  1WY9 A;  2WC6 A;  3WNX B;  3TDI A;  1JFJ A;  2MJW B;  2K7O A;  1F55 A;  1UUR A;  4FQT A;  2GGM A;  1H4B A;  2KYF A;  4PE1 A;  1EXR A;  3BXK A;  3UNW A;  2WCL A;  1OOG A;  3BQ3 A;  3TS5 B;  1J7Q A;  2LLT A;  1L2O C;  1QS7 A;  1OOJ A;  1IWQ A;  3AAJ A;  1CFD A;  3FE9 A;  4GGF A;  1ZUZ A;  3Q8I A;  2JTT A;  3OP0 A;  2BBM A;  1TUZ A;  1U5I A;  2KBI A;  2ZNE A;  4XJK B;  1XFZ O;  3NXA A;  1XFU O;  1VRK A;  4I5L B;  3SJS A;  3KF9 A;  1SR6 B;  3CR5 X;  2PAL A;  2D8N A;  1K96 A;  4GGF C;  2LVK A;  5CSI A;  3HCM A;  2K0J A;  1BG1 A;  5AXI A;  2K7D A;  1LVC D;  2H61 C;  2EGD A;  1R2U A;  1NPQ A;  1BOC A;  2MAZ A;  1YUR A;  1CB1 A;  2HET A;  1F54 A;  1QLK A;  2ZN8 A;  1XFR A;  1F4Q A;  2JPT A;  3ICB A;  1JWD A;  2PMY A;  1B4C A;  3CWG A;  3NSO A;  2LAN A;  5HKW A;  1AVS A;  1J1D A;  1SR6 C;  1HQV A;  3TZ1 A;  4MLW A;  1CMF A;  5J3X A;  1WDC C;  4INW A;  1BR4 B;  1K9U A;  1FF1 A;  1SYM A;  1SMG A;  3HX4 A;  3JVT C;  1J7P A;  1CLM A;  4FTG A;  1NCZ A;  1TCO B;  1NCY A;  2JWW A;  3PN7 B;  2LHI A;  3B86 A;  3PN7 C;  4HRG A;  3OB1 B;  2M1U A;  1MXE A;  3NHT A;  1OQP A;  2EHB A;  5I94 A;  1HT9 A;  1P28 A;  3PM8 A;  2WC8 A;  3CTN A;  1KWO B;  3PAL A;  3OGN A;  1A03 A;  1ALW A;  2BE6 A;  2LP2 A;  1XFV O;  1DC1 A;  1BOD A;  2KGB C;  2JRF A;  2KQY A;  1WRZ A;  2O60 A;  4A4B A;  4ICB A;  2LNK A;  1S6J A;  1J7R A;  4XYN A;  1S26 D;  1NIW A;  2L98 A;  3BOW A;  4WQ3 A;  3SG6 A;  1K95 A;  4F0Z B;  1B7T Z;  2FJY A;  3PLF B;  5FI6 A;  1OE9 B;  3L4L A;  4M2P A;  2AAO A;  1OOF A;  1QAT A;  2I2R E;  2KYC A;  2LMT A;  2MLF C;  1S6I A;  4ETO A;  3RZS A;  3BFH A;  3BUX B;  3NSL A;  2M1K B;  2Y1N A;  4NQG A;  5ER5 A;  1C07 A;  3EK4 A;  1LKJ A;  1W9Z A;  1U5I B;  3I5G C;  4GNK B;  3OBV A;  5AER A;  1XFW O;  3BFA A;  3BUM B;  3D0Y A;  3DVJ A;  1OMD A;  3I5G B;  3IF7 A;  1FW4 A;  2FJU B;  1YVH A;  1YUT A;  1PRW A;  4MRY A;  3A8R A;  4R1E A;  3D78 A;  3B7A A;  1F8H A;  3MSE B;  3BJH A;  3IVT A;  1QAS A;  4HRE E;  1KQV A;  1KSO A;  2F2O A;  2ERB A;  2KAX A;  3L47 A;  2B1U A;  1KK8 B;  1DJH A;  1Z2C B;  2JOJ A;  3LK0 A;  1YX7 A;  1LXF C;  3QRX A;  3R1P A;  1A75 A;  3CDN A;  2G2B A;  5CSJ A;  1LS8 A;  1C7W A;  2LHL A;  1M63 B;  1PK0 D;  2QEH A;  1Y0V H;  3I5I C;  1N2D A;  3ZWH A;  5FI2 A;  1S5G Y;  1FI5 A;  1V1G A;  5I2O A;  4BY4 A;  1AJ4 A;  3PSR A;  2M8U A;  1DGV A;  4F7F A;  3PJI A;  3EK7 A;  3S0B A;  1NP8 A;  1L7Z A;  1GM0 A;  2MLE C;  1K9P A;  2L0P A;  2JPO A;  1DGU A;  1PSB A;  1IQ5 A;  2KFF A;  2KAY A;  1BR1 B;  3NSK A;  1SW8 A;  1BT6 A;  3B88 A;  2RGI A;  1CTR A;  1A29 A;  5B8I B;  3SS3 A;  3V2L A;  1WRL A;  2AMI A;  1LA3 A;  3GK4 X;  3I5F C;  5D69 A;  2BCA A;  1Y1U A;  4FQO A;  1F70 A;  3R1O A;  1NSH A;  1JF0 A;  3PM2 A;  5JOL A;  3SIA A;  4CLN A;  1IH0 A;  3OB2 B;  3R72 A;  1BLQ A;  1SL7 A;  1N65 A;  2LCP A;  4USL A;  2AUC A;  4OR9 B;  4GAO A;  1K93 D;  3OX5 A;  4L9M A;  4QJ5 B;  4E68 A;  2MHH A;  3VB1 A;  1YUU A;  1J1E A;  2GTE A;  1GQM A;  2QEV A;  1S5G Z;  2OS8 C;  2LMU A;  2OTG C;  4CFQ A;  5AAN A;  2F2P A;  4MZJ A;  2L2E A;  2O5G A;  5CSF A;  1A2X A;  2KLD A;  1ZFS A;  2TN4 A;  2WCJ A;  1IJ5 A;  4TNC A;  1MF8 B;  2F33 A;  1QWV A;  2KI4 C;  4OV2 A;  3O6B A;  4MVF A;  1DJW A;  1JF2 A;  2K2F A;  3DF0 B;  4M2O A;  2MBX A;  1JFK A;  3KHE A;  1A4P A;  5HKY A;  1RTP 1;  2LP3 A;  1MQ1 A;  2JU0 A;  1EL4 A;  4OZD A;  1B8R A;  2Q4U A;  1ZMZ A;  3E3R A;  4JWQ A;  5KSZ A;  5KTY A;  3FS7 A;  2OPO A;  1PSR A;  2PAS A;  5HKZ A;  1Y1A A;  1ZOT B;  5I2Q A;  1XK4 A;  2EC6 B;  3TS5 C;  1IG5 A;  1AHR A;  3VRO A;  4AQJ A;  1A75 B;  2JC2 A;  1KK7 Z;  2ZRS A;  2K7B A;  2LAP A;  2M97 A;  5ER4 X;  4YI9 A;  2QEO A;  5FI7 A;  4QJ4 B;  1FBV A;  2CBL A;  2L2C A;  3BFB A;  1E8A A;  3PFV A;  1M45 A;  1CM4 A;  4NDC A;  1KWO C;  1RRO A;  5TNC A;  2BE4 A;  4PHJ A;  2BL0 B;  2CTN A;  2HF5 A;  1ZAC A;  1AJ5 A;  2PSR A;  4ORB B;  1SRA A;  2A4J A;  2JNF A;  2KFG A;  1DF0 A;  5G08 A;  1B9A A;  1G33 A;  3FIA A;  1RJV A;  3SS4 A;  1RFJ A;  4YGC B;  4PHN A;  3ZNI A;  2SAS A;  3FWC A;  1K9K A;  1LIN A;  4I5J A;  1SBJ A;  1KCY A;  4N1G A;  1KFU L;  2M29 A;  2ZFD A;  1QVI Y;  1JSA A;  1W7J B;  2I94 A;  2F8P A;  4YRU A;  1NCX A;  2OTG B;  1DTL A;  2QEB A;  2F3Z A;  3B6X A;  4U8D A;  5I8N A;  1DF0 B;  4NDB A;  1SCV A;  5FYX A;  2JQ6 A;  4P5O E;  2M7N A;  1DEL A;  2WCE A;  4DIR A;  1DJY A;  3AAK A;  1UHJ A;  3IQO A;  5F6T A;  4OCI A;  1DQE A;  1QV1 A;  1DJX A;  4OVN F;  1TCF A;  2BBN A;  3B87 A;  1QJT A;  1PVB A;  2Y4Q A;  4ZCV A;  1REC A;  1K2H A;  1XA5 A;  2JTZ A;  3DXL A;  4HSZ A;  2VRG A;  1J7O A;  1OMV A;  2NCP A;  1M46 A;  1SCM B;  1M31 A;  1N0Y A;  3IQQ A;  5DKQ A;  4XJK A;  1IQ3 A;  1JC2 A;  1SKT A;  1AUI B;  2LVV A;  4Q04 A;  1NX2 A;  2L4I A;  2CCM A;  1TOP A;  2ZRT A;  1V1F A;  4HRH A;  1BMO A;  3RLZ A;  1CM1 A;  2ZKM X;  3O78 A;  2WCM A;  2NLN A;  1DT7 B;  1XFX O;  1UHN A;  4PE7 A;  5D3O A;  2HQ8 A;  1YVL A;  1KQM C;  2LUC A;  3D73 A;  1Y1X A;  2JT8 A;  1UHK A;  2K8M B;  3CZ0 A;  3JTD C;  1D1O A;  1OZS A;  2JNX A;  1S36 A;  3CLN A;  3LL8 B;  4ORC B;  1B47 A;  1NX0 A;  1TN4 A;  1TWO A;  3I5I B;  3TDZ A;  3S0F A;  2KHN A;  4YI8 A;  1NX1 A;  1UWO A;  1C3Y A;  4WQ2 A;  3DD4 A;  1YX8 A;  2V53 A;  5D7F A;  2WOR A;  1YTZ C;  3SIB A;  1L2O B;  4NDD A;  1B7T Y;  1OW4 A;  1CNP A;  3CZT X;  1DVI A;  2BL0 C;  2F3Y A;  1TNW A;  1S1E A;  3K1E A;  1MXL C;  1KFX L;  2M0R A;  2MA2 A;  3SG3 A;  3CZ1 A;  3S0D A;  3C1V A;  1QIV A;  2FCD A;  3DF0 A;  4PHM A;  2R2I A;  3S0E A;  3DVK A;  4CID A;  5HYD A;  5JJG A;  3D0Y B;  2LC5 A;  3CZ2 A;  3SG2 A;  2KI6 C;  3DZT A;  4M2Q A;  4YGE B;  2H61 A;  2LE9 B;  2LVJ A;  2WC5 A;  4PE4 A;  2L51 A;  1XYD A;  1W7I B;  3BUW B;  4KYN A;  3SS5 A;  3SG5 A;  2LLU A;  2KSP A;  2BCB A;  5BPJ A;  1X02 A;  4MBE A;  4I5N B;  2COL B;  3D10 A;  1T14 A;  2WCF A;  1GGZ A;  1TNP A;  3NGV A;  1UUS A;  1YRU B;  4MRX A;  1SCM C;  1UP5 A;  1KK7 Y;  2KI6 D;  2LVI A;  1WRK A;  2LV7 A;  2JUL A;  2OS8 B;  3GOF A;  3JVT B;  3N7H A;  4GBA A;  4MZL A;  1IRJ A;  2KQ6 A;  1RWY A;  1JBA A;  3EVR A;  1C3Z A;  1ODB A;  2P71 A;  4PAL A;  1XVJ A;  1GGW A;  1BU3 A;  4PE0 A;  3A4U B;  1TNX A;  3EG5 B;  2WND A;  3LK1 A;  2QPT A;  4N1F A;  1B8C A;  1B1G A;  1F4O A;  3CYZ A;  3M0W A;  2L50 A;  2WOS A;  1EH2 A;  3RM1 A;  1J55 A;  3CR2 A;  1QX2 A;  4INX A;  4MN0 A;  1QLS A;  2GV5 A;  1IIO A;  1SSE B;  5DIC A;  2KPH A;  1QX7 A;  5HLV A;  2I18 A;  3WHT B;  1SK6 D;  1H8B A;  3D77 A;  3LCP C;  1YR5 A;  2KI4 B;  3KPX A;  2E30 A;  2ISD A;  1MHO A;  4DRW A;  1SL9 A;  4MZK A;  3DVM A;  1OOI X;  1SL8 A;  2FCE A;  3O2P A;  1KSM A;  2LMV A;  1DMO A;  4JQ0 D;  2M7L A;  5GQQ C;  2CNP A;  3DVE A;  1CDM A;  5K89 A;  1TIZ A;  1GJY A;  5CPV A;  4AQI A;  1DEK A;  5DKN A;  2KLE A;  1PVA A;  2WCK A;  3EKH A;  2NXQ A;  4D1E A;  1KQM B; 
#chains in the Genus database with same CATH homology
 1ALV A;  1K94 A;  3BUN B;  3KEV A;  1FI6 A;  1FPW A;  2M9G A;  2Q91 A;  4PDZ A;  3CS1 A;  1SNL A;  3TUY B;  3SG7 A;  1TRF A;  1Y6W A;  3EVV A;  2JZI A;  1IJ6 A;  1F71 A;  1QVI Z;  3EK8 A;  1LA0 A;  2M49 B;  2JXC A;  4ORA B;  2Y5I A;  4QJ3 B;  4AOM A;  1CLB A;  2BKI B;  2MRD A;  3LLE A;  5HLO A;  1NYA A;  1MUX A;  3CGA A;  2H2K A;  4IL1 A;  1CMG A;  2KDH A;  4DS7 A;  5DKR A;  1OSA A;  2K2A A;  2EC6 C;  3BUO B;  2DOQ A;  1CFF A;  1DJG A;  3BYA A;  4YGD B;  2G9B A;  1DJI A;  1NWD A;  3VRR A;  1R6P A;  4A4C A;  4C0J A;  2E6W A;  4GUK A;  1S3P A;  2SCP A;  1G4Y R;  4GGN A;  1TTX A;  2L4H A;  4N5X A;  3JTD B;  2KFH A;  3I5H C;  5AFP A;  1UHI A;  3I5H B;  2L5X B;  4I5K A;  2BKH B;  3I5F B;  1G8I A;  1C7V A;  1EG4 A;  1B8L A;  1K8U A;  1XO5 A;  1RK9 A;  1MWN A;  2KOT A;  4CFR A;  4C0L A;  2ZND A;  1QV0 A;  1EG3 A;  3EVU A;  4WRI A;  4YBH B;  3NSI A;  2M3W A;  3OHM B;  4PHK A;  4ZCU A;  4UPG A;  1NUB A;  4JPZ B;  1AK8 A;  2GGZ A;  2HPS A;  2JT0 A;  2I7A A;  3BOW B;  3KO0 A;  4YGB B;  4YGA A;  4CPV A;  1IKU A;  1CFC A;  2JXL A;  2BEC A;  1YUS A;  1M39 A;  1AP4 A;  3GK2 A;  2KNE A;  3VRQ A;  3K21 A;  1KK8 C;  3F45 A;  2CXJ A;  1OZO A;  1EJ3 A;  1CKK A;  1SY9 A;  1UHH A;  3O4Y A;  1QIW A;  1PUL A;  1PAL A;  3VGO A;  3PAT A;  2BCX A;  2KBM A;  1MR8 A;  1YRT B;  1SPY A;  2FOT A;  1WLZ A;  1CFP A;  3EKJ A;  4C0K A;  2KGR A;  1QX5 B;  2LM5 A;  1BF5 A;  4GPL B;  2NZ0 A;  1K90 D;  1XK4 C;  4BY5 A;  5AEQ A;  3GK1 A;  1TNQ A;  3FWB A;  5IBW A;  1OMR A;  2Y1M A;  1CLL A;  2KAV A;  1DJZ A;  2PVB A;  3WXA A;  3VRN A;  1KFU S;  3H4S E;  1XFY O;  1Q80 A;  3TUY C;  2LUX A;  2PRU A;  3WHU B;  5KU1 A;  2CT9 A;  4P2Y B;  3AKB A;  2ZN9 A;  2HQW A;  5I2L A;  3AKA A;  3SG4 A;  4GFT A;  4PCW A;  1IGV A;  3CR4 X;  1QXP A;  4DCK A;  2IS9 A;  3OX6 A;  1NX3 A;  2JT3 A;  2LLS A;  2P6B B;  1CDP A;  1S6C A;  1CDL A;  1JUO A;  2K61 A;  2K7C A;  5CSN A;  1CDN A;  4DUQ A;  2QAC A;  2WCB A;  4OKH A;  3VRP A;  3TDU A;  1WLM A;  2NCO A;  4MEW A;  4MSP A;  1BJF A;  1KFX S;  1QTX A;  5PAL A;  1WDC B;  1WY9 A;  1JFJ A;  3WNX B;  3TDI A;  2MJW B;  2K7O A;  1F55 A;  1UUR A;  2GGM A;  1H4B A;  2KYF A;  4PE1 A;  1EXR A;  3BXK A;  3TS5 B;  3BQ3 A;  1J7Q A;  2LLT A;  1L2O C;  1QS7 A;  1OOJ A;  1IWQ A;  3AAJ A;  1CFD A;  4GGF A;  1ZUZ A;  2JTT A;  3OP0 A;  2BBM A;  1U5I A;  2KBI A;  2ZNE A;  4XJK B;  1XFZ O;  3NXA A;  1XFU O;  1VRK A;  4I5L B;  3SJS A;  3KF9 A;  1SR6 B;  3CR5 X;  2PAL A;  2D8N A;  1K96 A;  4GGF C;  2LVK A;  5CSI A;  3HCM A;  2K0J A;  1BG1 A;  5AXI A;  2K7D A;  1LVC D;  2H61 C;  2EGD A;  1R2U A;  1NPQ A;  1BOC A;  2MAZ A;  1YUR A;  1CB1 A;  2HET A;  1F54 A;  1QLK A;  2ZN8 A;  1F4Q A;  2JPT A;  3ICB A;  2PMY A;  1B4C A;  3CWG A;  3NSO A;  2LAN A;  5HKW A;  1AVS A;  1J1D A;  1SR6 C;  1HQV A;  3TZ1 A;  4MLW A;  1CMF A;  5J3X A;  1WDC C;  1BR4 B;  1K9U A;  1FF1 A;  1SYM A;  1SMG A;  3HX4 A;  3JVT C;  1J7P A;  1CLM A;  4FTG A;  1NCZ A;  1TCO B;  1NCY A;  2JWW A;  3PN7 B;  2LHI A;  3PN7 C;  4HRG A;  3OB1 B;  2M1U A;  1MXE A;  1OQP A;  2EHB A;  1HT9 A;  3PM8 A;  2WC8 A;  3CTN A;  1KWO B;  3PAL A;  1A03 A;  1ALW A;  2BE6 A;  2LP2 A;  1XFV O;  1BOD A;  2KGB C;  2JRF A;  2KQY A;  1WRZ A;  2O60 A;  4A4B A;  4ICB A;  2LNK A;  1S6J A;  1J7R A;  4XYN A;  1S26 D;  1NIW A;  2L98 A;  3BOW A;  4WQ3 A;  3SG6 A;  1K95 A;  4F0Z B;  1B7T Z;  3PLF B;  1OE9 B;  4M2P A;  2AAO A;  2I2R E;  1QAT A;  2KYC A;  2LMT A;  2MLF C;  1S6I A;  4ETO A;  3BUX B;  3NSL A;  2M1K B;  2Y1N A;  4NQG A;  5ER5 A;  1C07 A;  3EK4 A;  1LKJ A;  1U5I B;  3I5G C;  4GNK B;  5AER A;  1XFW O;  3IF7 A;  3BUM B;  3D0Y A;  3DVJ A;  1OMD A;  3I5G B;  1JWD A;  2FJU B;  1FW4 A;  1YVH A;  1YUT A;  1PRW A;  4MRY A;  3A8R A;  4R1E A;  1F8H A;  3MSE B;  1QAS A;  4HRE E;  1KQV A;  1KSO A;  2F2O A;  2KAX A;  2B1U A;  1KK8 B;  1DJH A;  2JOJ A;  3LK0 A;  3QRX A;  1YX7 A;  1LXF C;  1A75 A;  2G2B A;  5CSJ A;  1C7W A;  2LHL A;  1M63 B;  1PK0 D;  1Y0V H;  3I5I C;  1N2D A;  3ZWH A;  1S5G Y;  1FI5 A;  1V1G A;  5I2O A;  4BY4 A;  1AJ4 A;  3PSR A;  2M8U A;  1DGV A;  3EK7 A;  1NP8 A;  1L7Z A;  2MLE C;  1K9P A;  2L0P A;  1DGU A;  1PSB A;  1IQ5 A;  2KFF A;  2KAY A;  1BR1 B;  3NSK A;  1SW8 A;  1BT6 A;  2RGI A;  1CTR A;  1A29 A;  5B8I B;  1WRL A;  2AMI A;  1LA3 A;  3GK4 X;  3I5F C;  5D69 A;  2BCA A;  1Y1U A;  4FQO A;  1F70 A;  5JOL A;  1NSH A;  1JF0 A;  3SIA A;  4CLN A;  1IH0 A;  3OB2 B;  1BLQ A;  1SL7 A;  1N65 A;  2LCP A;  4USL A;  2AUC A;  4OR9 B;  4GAO A;  1K93 D;  3OX5 A;  4L9M A;  4QJ5 B;  4E68 A;  2MHH A;  1YUU A;  1J1E A;  1GQM A;  1S5G Z;  2OS8 C;  2LMU A;  2OTG C;  4CFQ A;  5AAN A;  2F2P A;  4MZJ A;  2L2E A;  2O5G A;  5CSF A;  1A2X A;  2TN4 A;  1ZFS A;  4TNC A;  1IJ5 A;  1MF8 B;  2F33 A;  2KI4 C;  4OV2 A;  3O6B A;  4MVF A;  1DJW A;  1JF2 A;  2K2F A;  3DF0 B;  4M2O A;  2MBX A;  1JFK A;  3KHE A;  1A4P A;  5HKY A;  1RTP 1;  2LP3 A;  1MQ1 A;  2JU0 A;  1EL4 A;  1B8R A;  2Q4U A;  1ZMZ A;  3E3R A;  4JWQ A;  5KSZ A;  5KTY A;  3FS7 A;  2OPO A;  1PSR A;  2PAS A;  5HKZ A;  1Y1A A;  1ZOT B;  5I2Q A;  1XK4 A;  2EC6 B;  3TS5 C;  1IG5 A;  1AHR A;  3VRO A;  4AQJ A;  1A75 B;  2JC2 A;  1KK7 Z;  2ZRS A;  2K7B A;  2LAP A;  2M97 A;  5ER4 X;  4YI9 A;  4QJ4 B;  1FBV A;  2CBL A;  5TNC A;  3PFV A;  1E8A A;  4NDC A;  1M45 A;  1CM4 A;  1KWO C;  1RRO A;  2BE4 A;  4PHJ A;  2BL0 B;  2CTN A;  2HF5 A;  1ZAC A;  1AJ5 A;  2PSR A;  4ORB B;  1SRA A;  2A4J A;  2JNF A;  2KFG A;  1DF0 A;  5G08 A;  1B9A A;  1G33 A;  3FIA A;  1RJV A;  1RFJ A;  4YGC B;  4PHN A;  3ZNI A;  2SAS A;  3FWC A;  1K9K A;  1LIN A;  4I5J A;  1SBJ A;  1KCY A;  4N1G A;  1KFU L;  2M29 A;  2ZFD A;  1QVI Y;  1JSA A;  1W7J B;  2I94 A;  2F8P A;  4YRU A;  1NCX A;  2OTG B;  1DTL A;  2F3Z A;  4U8D A;  5I8N A;  1DF0 B;  4NDB A;  1SCV A;  5FYX A;  2JQ6 A;  4P5O E;  2M7N A;  2WCE A;  4DIR A;  1DJY A;  3AAK A;  1UHJ A;  3IQO A;  5F6T A;  4OCI A;  1QV1 A;  1DJX A;  4OVN F;  1TCF A;  2BBN A;  1QJT A;  1PVB A;  2Y4Q A;  4ZCV A;  1REC A;  1K2H A;  1XA5 A;  2JTZ A;  4HSZ A;  2VRG A;  1J7O A;  1OMV A;  2NCP A;  1M46 A;  1SCM B;  1M31 A;  1N0Y A;  3IQQ A;  5DKQ A;  4XJK A;  1IQ3 A;  1JC2 A;  1SKT A;  1AUI B;  2LVV A;  4Q04 A;  1NX2 A;  2L4I A;  2CCM A;  1TOP A;  2ZRT A;  1V1F A;  4HRH A;  1BMO A;  3RLZ A;  1CM1 A;  2ZKM X;  3O78 A;  2NLN A;  1DT7 B;  1XFX O;  1UHN A;  4PE7 A;  2HQ8 A;  1YVL A;  1KQM C;  2LUC A;  3JTD C;  1Y1X A;  2JT8 A;  1UHK A;  2K8M B;  1D1O A;  1OZS A;  2JNX A;  1S36 A;  3CLN A;  3LL8 B;  4ORC B;  1B47 A;  1NX0 A;  1TN4 A;  3I5I B;  3TDZ A;  2KHN A;  4YI8 A;  1NX1 A;  1UWO A;  4WQ2 A;  3DD4 A;  1YX8 A;  2V53 A;  5D7F A;  2WOR A;  1YTZ C;  3SIB A;  1L2O B;  4NDD A;  1B7T Y;  1CNP A;  3CZT X;  1DVI A;  2BL0 C;  2F3Y A;  1TNW A;  1S1E A;  1MXL C;  1KFX L;  2M0R A;  2MA2 A;  3SG3 A;  3C1V A;  1QIV A;  2FCD A;  3DF0 A;  4PHM A;  2R2I A;  4CID A;  3DVK A;  5HYD A;  5JJG A;  3D0Y B;  2LC5 A;  3SG2 A;  2KI6 C;  4M2Q A;  4YGE B;  2H61 A;  2LE9 B;  2LVJ A;  4PE4 A;  2L51 A;  1XYD A;  1W7I B;  3BUW B;  3SG5 A;  2LLU A;  2KSP A;  2BCB A;  5BPJ A;  1X02 A;  4MBE A;  4I5N B;  2COL B;  3D10 A;  2WCF A;  1GGZ A;  1TNP A;  1UUS A;  1YRU B;  4MRX A;  1SCM C;  1UP5 A;  1KK7 Y;  2KI6 D;  2LVI A;  1WRK A;  2LV7 A;  2JUL A;  2OS8 B;  3GOF A;  3JVT B;  4GBA A;  4MZL A;  1IRJ A;  2KQ6 A;  1RWY A;  1JBA A;  3EVR A;  1ODB A;  4PAL A;  1XVJ A;  1GGW A;  1BU3 A;  4PE0 A;  3A4U B;  1TNX A;  4N1F A;  2WND A;  3LK1 A;  2QPT A;  1B8C A;  1B1G A;  1F4O A;  3M0W A;  2L50 A;  2WOS A;  1EH2 A;  3RM1 A;  1J55 A;  3CR2 A;  1QX2 A;  4MN0 A;  1QLS A;  2GV5 A;  1QX7 A;  5HLV A;  2I18 A;  3WHT B;  1SK6 D;  1H8B A;  3LCP C;  1YR5 A;  2KI4 B;  3KPX A;  2E30 A;  2ISD A;  1MHO A;  4DRW A;  1SL9 A;  4MZK A;  3DVM A;  1SL8 A;  2FCE A;  3O2P A;  1KSM A;  2LMV A;  1DMO A;  4JQ0 D;  2M7L A;  5GQQ C;  2CNP A;  3DVE A;  1CDM A;  5K89 A;  1TIZ A;  1GJY A;  5CPV A;  4AQI A;  5DKN A;  1PVA A;  3EKH A;  2NXQ A;  4D1E A;  1KQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...