1M45A

Crystal structure of mlc1p bound to iq2 of myo2p, a class v myosin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
146
structure length
142
Chain Sequence
TRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINASLASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle protein
molecule keywords Myosin light chain
publication title Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 142
sequence length 146
ec nomenclature
pdb deposition date 2002-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m45A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m45A01
1JF0A 2G9BA 1UP5A 3ZNIA 1XVJA 1BLQA 1YUUA 3I5GB 1KFUL 1ZMZA 1CFDA 2BE4A 2V53A 1M39A 3PN7B 1LA3A 1QLKA 3EVRA 3OB2B 3SG5A 1PULA 3A8RA 1YR5A 1G33A 2LM5A 1KK8C 1S6CA 1V1FA 2L5XB 3D0YA 4MZKA 4D1EA 2LP3A 1CFPA 2K8MB 4ORBB 3VGOA 1DJYA 1SNLA 2JNXA 1PK0D 2O5GA 4JPZB 3WNXB 1NX0A 1S5GY 3JVTC 1K90D 3WHTB 2LVJA 1G4YR 1UHKA 2MBXA 4OKHA 1CMGA 5HLVA 4U8DA 4PCWA 1DGVA 1BMOA 2LVVA 3BYAA 2LANA 1PALA 2PRUA 2Q91A 1KQMC 1RFJA 3LK1A 1JC2A 4MEWA 4R1EA 1AJ5A 2K61A 3IQQA 1SL7A 1L2OC 4CFRA 5J3XA 1IQ5A 1WLMA 4ETOA 1WRKA 3KF9A 1MHOA 1F71A 5ER4X 4ZCUA 1DTLA 2HQ8A 1U5IA 1XFZO 3SG6A 1MXEA 1TCOB 1A2XA 2O60A 1ALWA 3OHMB 2Q4UA 3KO0A 1QV0A 4PALA 2Y1NA 3OX5A 4GGNA 1FPWA 1G8IA 1GQMA 5HKWA 1QASA 4OCIA 2MAZA 1SCMB 1M45A 2F3ZA 2BKIB 1XK4A 2KFFA 1A4PA 2JU0A 4ORCB 1YVHA 1QVIY 1XFWO 1KCYA 1BU3A 1B8RA 2G2BA 2COLB 1B7TY 3VROA 2ZFDA 2ZRTA 1QX7A 3I5FB 3O78A 3PSRA 5KTYA 2F2PA 1IGVA 3O2PA 1J7OA 2AUCA 4DUQA 1V1GA 4I5NB 3IQOA 4P2YB 2BBMA 1UHNA 2I94A 1MWNA 1YVLA 1C7WA 2I2RE 2KHNA 4PHMA 1JFKA 2CCMA 1EXRA 2KDHA 2VRGA 2MLFC 1KFXS 2WNDA 2LVKA 1EG3A 5AERA 1FBVA 1UHJA 1IRJA 2KNEA 3LK0A 1YRTB 2JTZA 2EHBA 3WXAA 1X02A 1K2HA 4DIRA 4CFQA 2ZNEA 2BL0C 4GGFA 1OSAA 2L4HA 2SCPA 4GUKA 4PDZA 5FYXA 3SG2A 2M9GA 1Y6WA 3E3RA 1J55A 1QV1A 1AUIB 2JZIA 2KGRA 3EKHA 1IQ3A 1A29A 2JULA 1JSAA 1FF1A 1CTRA 1DJHA 2H61A 5CPVA 1TNPA 1M46A 4CPVA 1YX8A 1CFCA 1YTZC 2F2OA 1OZOA 5PALA 2P6BB 1SR6C 2ZNDA 2M0RA 2QACA 2H2KA 2Y4QA 1DF0B 2DOQA 1TNWA 2LUCA 3PLFB 2NLNA 1KK7Y 3AAJA 3K21A 1LKJA 1J7RA 1DGUA 1QTXA 2PMYA 4CLNA 2L98A 2CBLA 3QRXA 2MA2A 4N1FA 2LV7A 3GOFA 2EC6C 1BJFA 1A75A 2E6WA 2B1UA 4DS7A 2KI6D 5D7FA 1YURA 1KSMA 1K96A 3CTNA 2WC8A 4GBAA 1K93D 1EH2A 4N1GA 4HSZA 1SL9A 1WRZA 4M2PA 2OS8B 4QJ3B 4USLA 1HT9A 1K95A 3SIBA 2LMVA 4BY4A 5AFPA 2ZRSA 4YGAA 1XFXO 3CR4X 1NX2A 3GK4X 3JTDB 1F54A 4CIDA 2KBMA 5KU1A 1ZUZA 4NDBA 2Y5IA 4GGFC 3EK4A 2CXJA 2ZN9A 3AKAA 3NSOA 4MLWA 3I5GC 3WHUB 4NDCA 3I5IB 1EL4A 1NX1A 3PM8A 1F8HA 2I18A 1AVSA 1OQPA 3KHEA 5HKYA 4A4CA 3PN7C 2M97A 1CDNA 1KFUS 3TS5C 2EGDA 4YI8A 1ZFSA 2M7NA 5G08A 3LL8B 5HKZA 2LC5A 3SG7A 1TCFA 3TDIA 1N65A 1CDMA 1WDCB 4IL1A 1A75B 1LINA 3BUNB 2K0JA 4ZCVA 2NCOA 1YRUB 1TNQA 1R6PA 1MQ1A 4E68A 2KAYA 2PASA 5HLOA 5DKRA 3PFVA 3H4SE 2FCEA 2JRFA 3FWBA 2LUXA 1BG1A 1CM4A 1RJVA 1DJZA 4MVFA 3FS7A 3FIAA 1OOJA 2KFHA 2A4JA 4N5XA 4XJKB 5AXIA 4YGCB 1J1EA 2KQYA 3HX4A 1LVCD 5HYDA 2M1UA 5GQQC 2GV5A 5BPJA 2AAOA 3GK1A 1IWQA 1C7VA 1JBAA 1CLLA 1CDLA 1NCYA 1EJ3A 2JXCA 1S6JA 1H8BA 2L4IA 2RGIA 5I2OA 3BOWB 4PHKA 3DVKA 1KSOA 1TIZA 2BCXA 5ER5A 4MN0A 4MRYA 4XYNA 4AQIA 3BUMB 1TN4A 4WRIA 1A03A 1ZOTB 2FJUB 1GGWA 5IBWA 1XYDA 5DKQA 1RROA 5I2LA 1BODA 2LLSA 1SCMC 4JWQA 4MZJA 1DF0A 3TUYB 1H4BA 2KSPA 2L0PA 3ZWHA 1F4QA 4FQOA 3RLZA 4PHJA 3O6BA 1M63B 1Y1XA 2JQ6A 1J7PA 1S5GZ 1Y0VH 3I5FC 2OPOA 4ICBA 1QXPA 1FI5A 2K7DA 2JT8A 2GGMA 3CS1A 4OV2A 1FW4A 2NXQA 3CR2A 1EG4A 2JNFA 2KI4C 4I5LB 1NCZA 1YUSA 5KSZA 1IJ5A 2MRDA 1SK6D 4GNKB 3BXKA 5CSIA 5AANA 3BQ3A 2WORA 4A4BA 4YGBB 2HF5A 3VRPA 3FWCA 1UHHA 2F3YA 1JUOA 1QLSA 1XFYO 2BCBA 1RK9A 2JPTA 1R2UA 4AQJA 1MF8B 4QJ5B 1W7JB 2LLUA 3CWGA 3GK2A 1DJWA 4AOMA 5I8NA 1E8AA 2JXLA 4DCKA 1VRKA 2LP2A 3RM1A 1FI6A 3C1VA 4DRWA 1XK4C 3TDUA 4GPLB 3OX6A 4M2QA 3KEVA 1KWOB 2KAXA 2D8NA 2LMUA 1CB1A 2R2IA 3BUWB 3SIAA 3DVMA 1DJGA 2JT0A 2LVIA 1QS7A 1ALVA 3NXAA 2WCFA 1IH0A 1N2DA 3OP0A 1UUSA 2M3WA 1B9AA 1WRLA 2PALA 2K2FA 3EVVA 4HRHA 4C0JA 1Y1UA 2KQ6A 1XO5A 3DVJA 1ODBA 1B7TZ 1B47A 1SL8A 2L50A 1IKUA 1M31A 2SASA 1BR4B 1CLMA 1BT6A 2OTGC 2ZKMX 3I5HC 2LHIA 1BOCA 1SW8A 1SPYA 1S6IA 1TRFA 4ORAB 4XJKA 1KK8B 2MLEC 1AJ4A 1TNXA 2JC2A 2M8UA 2HQWA 4F0ZB 1B8CA 1QIVA 1Q80A 1YX7A 1JFJA 2FCDA 1RECA 2NCPA 2PVBA 1MR8A 1L7ZA 1NX3A 1QX5B 3JVTB 2OS8C 2WCEA 3KPXA 3BOWA 1J7QA 2LE9B 5JJGA 3EK8A 3DF0A 5AEQA 2LMTA 1NIWA 2BKHB 2L51A 2H61C 3CGAA 1CFFA 3TS5B 3JTDC 3AAKA 1SMGA 4WQ2A 1IJ6A 1XFUO 2KYFA 2M49B 3MSEB 4OR9B 4PE4A 1KQMB 2CT9A 1B4CA 1OZSA 5CSFA 1OMRA 1PRWA 1RWYA 2JTTA 3LLEA 3I5IC 2BBNA 1K8UA 3DVEA 3EK7A 1YUTA 4QJ4B 3TDZA 1F70A 1L2OB 1S26D 1S3PA 4L9MA 4M2OA 1OMVA 1GGZA 1WLZA 5B8IB 1AHRA 2I7AA 2BE6A 1CMFA 1DVIA 3EVUA 5F6TA 1QATA 3CR5X 3SG3A 1SBJA 2MHHA 1SYMA 1SRAA 4HREE 4WQ3A 1WDCC 4MZLA 3DD4A 1HQVA 2KGBC 1KK7Z 2M1KB 5I2QA 3SJSA 1LXFC 2LLTA 3NSLA 2ISDA 4C0LA 1JF2A 1CDPA 2HETA 1MUXA 2KFGA 4GAOA 4NQGA 1NPQA 4OVNF 4TNCA 1ZACA 3BUOB 4BY5A 2WOSA 1BF5A 3CLNA 3DF0B 3NSIA 2CTNA 3PATA 2LHLA 4MBEA 1K9PA 2TN4A 3VRRA 1QJTA 2KI6C 3O4YA 3D0YB 4YBHB 4PE1A 5DKNA 2M7LA 1OMDA 2K7OA 2QPTA 4PE7A 4GFTA 1TTXA 1KFXL 1K9UA 4PE0A 1CNPA 5TNCA 3CZTX 2L2EA 1CLBA 2F33A 1NUBA 2K2AA 4MSPA 2BCAA 1DJIA 1DMOA 3F45A 3AKBA 1GJYA 3EKJA 4P5OE 2BECA 2IS9A 1BR1B 4PHNA 2FOTA 3NSKA 1QX2A 1PSBA 1UHIA 1NSHA 1F55A 2NZ0A 3M0WA 3TUYC 2BL0B 1JWDA 1SKTA 1W7IB 2MJWB 1B1GA 2E30A 3VRQA 1TOPA 1UWOA 2F8PA 2KI4B 3VRNA 1PVAA 1Y1AA 5K89A 1XFVO 1DJXA 1S1EA 1NCXA 3IF7A 5CSNA 1U5IB 2PSRA 3D10A 3SG4A 5JOLA 4NDDA 2JT3A 1N0YA 4YGDB 4JQ0D 2Y1MA 3LCPC 1SR6B 1NWDA 2WCBA 1F4OA 2JOJA 2AMIA 2KBIA 1OE9B 1S36A 4YI9A 1PSRA 1SCVA 4MRXA 3BUXB 3HCMA 3TZ1A 1J1DA 1AK8A 2GGZA 2M29A 1RTP1 2ZN8A 4I5KA 2K7BA 1NYAA 1K9KA 3PALA 2LCPA 1PVBA 2JWWA 1QVIZ 2EC6B 5D69A 4YGEB 1D1OA 1AP4A 3A4UB 4I5JA 1KWOC 2KAVA 1C07A 1CKKA 1MXLC 1QIWA 1CM1A 4HRGA 1WY9A 1B8LA 2KYCA 2HPSA 2KOTA 1KQVA 1UURA 1LA0A 1IG5A 2K7CA 4FTGA 1NP8A 2OTGB 1K94A 2LNKA 2CNPA 3I5HB 3OB1B 4Q04A 4YRUA 1DT7B 4UPGA 1SY9A 1XA5A 2LAPA 5CSJA 4C0KA 3ICBA
chains in the Genus database with same CATH superfamily
1JF0A 2G9BA 1UP5A 3ZNIA 1XVJA 1BLQA 1YUUA 2GTEA 5CSJA 4JKTA 3I5GB 1KFUL 1ZMZA 3S0FA 1CFDA 2BE4A 3CZ0A 2V53A 1M39A 3PN7B 1LA3A 1QLKA 3EVRA 3OB2B 3SG5A 1PULA 3A8RA 1YR5A 1G33A 2LM5A 1KK8C 1S6CA 1V1FA 2L5XB 3BFBA 3D0YA 3OBVA 4MZKA 4D1EA 2LP3A 1DEKA 1CFPA 2K8MB 4ORBB 3VGOA 1DJYA 1SNLA 2JNXA 1PK0D 2O5GA 4JPZB 3WNXB 1NX0A 1S5GY 3JVTC 1K90D 3WHTB 2LVJA 2WCHA 1G4YR 1UHKA 2MBXA 1Z2CB 2P71A 4OKHA 3B87A 1CMGA 5HLVA 4U8DA 4PCWA 1DGVA 1BMOA 2LVVA 3BYAA 1OOGA 2LANA 1PALA 2PRUA 2QEHA 2Q91A 1KQMC 1RFJA 3LK1A 1JC2A 4MEWA 4R1EA 2PQLA 1AJ5A 2K61A 3IQQA 3Q8IA 1SL7A 1L2OC 4CFRA 5J3XA 1IQ5A 1WLMA 4ETOA 1WRKA 3KF9A 1MHOA 1ORGA 3B88A 1F71A 5ER4X 4ZCUA 1DTLA 2WC5A 2HQ8A 1U5IA 1XFZO 3SG6A 1MXEA 1TCOB 1A2XA 2O60A 1ALWA 3OHMB 2Q4UA 3KO0A 1QV0A 4PALA 2Y1NA 3SS5A 3D75A 3OX5A 4GGNA 1FPWA 1G8IA 1GQMA 5HKWA 1QASA 4OCIA 2MAZA 1SCMB 1M45A 2F3ZA 2BKIB 1XK4A 2K60A 2KFFA 1A4PA 2JU0A 4ORCB 1YVHA 1QVIY 1XFWO 3R1VA 1KCYA 1BU3A 1OW4A 1B8RA 2G2BA 2YGUA 2COLB 1B7TY 3VROA 2ZFDA 2ZRTA 1QX7A 3FE6A 3I5FB 3O78A 3PSRA 5KTYA 2F2PA 1IGVA 3O2PA 1J7OA 2WCKA 2AUCA 2WC6A 5EL2A 1V1GA 4DUQA 4I5NB 3IQOA 4P2YB 2BBMA 1UHNA 2I94A 1MWNA 1YVLA 1C7WA 2I2RE 2KHNA 4PHMA 1JFKA 2CCMA 4JD9A 1EXRA 2KDHA 2VRGA 2MLFC 3DZTA 1KFXS 2WNDA 3K1EA 2LVKA 1EG3A 5AERA 1FBVA 1UHJA 1IRJA 2KNEA 5HL1A 3LK0A 1YRTB 3D74A 2JTZA 3D73A 1DQEA 2EHBA 3WXAA 1X02A 1K2HA 4DIRA 4CFQA 2ZNEA 2BL0C 4GGFA 1OSAA 1DELA 2L4HA 2SCPA 4GUKA 4PDZA 5FYXA 2JPOA 3SG2A 2M9GA 1Y6WA 3E3RA 1J55A 1QV1A 1AUIB 2JZIA 3BFHA 2KGRA 3EKHA 1IQ3A 1OOFA 1A29A 2JULA 1JSAA 1FF1A 1CTRA 1DJHA 2H61A 2PYQA 5CPVA 1TNPA 1M46A 4CPVA 1YX8A 3S0AA 3CZ1A 1CFCA 1YTZC 2F2OA 1OZOA 5PALA 1C3YA 2P6BB 1SR6C 2ZNDA 2M0RA 2QACA 2H2KA 2Y4QA 3L4LA 1DF0B 2DOQA 1TNWA 2LUCA 3PLFB 2NLNA 3OGNA 1KK7Y 3AAJA 3K21A 4PT1A 1LKJA 1J7RA 1DGUA 1QTXA 2PMYA 4CLNA 2L98A 2CBLA 3DYEA 3QRXA 2MA2A 4N1FA 2LV7A 4IJ7A 3GOFA 2EC6C 1BJFA 1A75A 2E6WA 2B1UA 3DXLA 4DS7A 2KI6D 5D7FA 1YURA 1KSMA 1K96A 3CTNA 2WC8A 4GBAA 1K93D 1EH2A 4N1GA 3NHIA 4HSZA 1SL9A 1WRZA 4M2PA 2OS8B 4QJ3B 4USLA 1HT9A 1K95A 3SIBA 2LMVA 4BY4A 5FI2A 5AFPA 2KLDA 2ZRSA 4YGAA 1XFXO 3CR4X 1NX2A 3GK4X 3JTDB 1F54A 4CIDA 5DICA 2KBMA 5KU1A 1ZUZA 4NDBA 2Y5IA 1GM0A 4GGFC 3EK4A 2CXJA 2ZN9A 2FJYA 3AKAA 3NSOA 3I5GC 2KLEA 4MLWA 4NDCA 3WHUB 3I5IB 1EL4A 1NX1A 3PM8A 1F8HA 2I18A 1AVSA 1OQPA 3KHEA 5HKYA 3D78A 4A4CA 3PN7C 2M97A 1CDNA 1KFUS 3R1OA 3S0GA 2EGDA 4YI8A 3TS5C 1ZFSA 2M7NA 5G08A 3LL8B 5HKZA 2LC5A 3SG7A 1TCFA 3TDIA 3O4XA 1N65A 1CDMA 1WDCB 4IL1A 1A75B 1LINA 3BUNB 2K0JA 4ZCVA 2NCOA 1YRUB 1TNQA 1R6PA 3CDNA 1MQ1A 4E68A 2KAYA 2PASA 5HLOA 3RZSA 5DKRA 3PFVA 3R72A 3H4SE 2FCEA 2JRFA 3FWBA 2LUXA 1BG1A 1CM4A 1RJVA 1DJZA 5I94A 4MVFA 3FS7A 3FIAA 3SS4A 1OOJA 2KFHA 2ERBA 2A4JA 4N5XA 4XJKB 5AXIA 4YGCB 1J1EA 2KQYA 3HX4A 1LVCD 5HYDA 2M1UA 5GQQC 2GV5A 5BPJA 2AAOA 3GK1A 1IWQA 4OZDA 1C7VA 1JBAA 1CLLA 1CDLA 1NCYA 1EJ3A 2JXCA 1S6JA 1H8BA 2L4IA 2RGIA 5I2OA 3BOWB 4PHKA 3DVKA 1KSOA 1TIZA 2BCXA 5ER5A 4MN0A 4MRYA 3S0EA 3BJHA 4XYNA 4AQIA 3BUMB 1TN4A 4WRIA 1A03A 1ZOTB 2FJUB 1GGWA 5IBWA 1XYDA 5DKQA 1RROA 5I2LA 1BODA 3IVTA 2LLSA 3EG5B 1SCMC 2WCLA 1TUJA 4FQTA 4JWQA 4MZJA 1DF0A 3TUYB 1H4BA 2KSPA 2L0PA 3ZWHA 1F4QA 4FQOA 3RLZA 4PHJA 3O6BA 1M63B 1Y1XA 2JQ6A 1J7PA 5FI7A 1S5GZ 1Y0VH 3I5FC 2OPOA 4ICBA 1QXPA 1FI5A 1SSEB 2K7DA 2JT8A 3PJIA 2H8VA 2GGMA 3CS1A 4OV2A 1FW4A 2NXQA 3L4AA 3CR2A 3QMEA 1EG4A 2JNFA 2KI4C 3NHTA 1NCZA 1YUSA 4I5LB 1IJ5A 2MRDA 1SK6D 4GNKB 3BXKA 5KSZA 5CSIA 5AANA 3BQ3A 2WORA 4A4BA 4YGBB 2HF5A 3VRPA 3FWCA 1UHHA 2F3YA 1JUOA 1QLSA 1XFYO 2BCBA 1RK9A 2JPTA 1R2UA 4AQJA 3L47A 1C3ZA 1MF8B 4QJ5B 1W7JB 2LLUA 3CWGA 3GK2A 1DJWA 4AOMA 5I8NA 1E8AA 2JXLA 4DCKA 1VRKA 2LP2A 3RM1A 1FI6A 3C1VA 4DRWA 3BFAA 3B86A 1XK4C 3TDUA 4GPLB 3OX6A 4M2QA 3KEVA 1KWOB 3CABA 2KAXA 2D8NA 2LMUA 1CB1A 2R2IA 3BUWB 1TUZA 3DVMA 1DJGA 2JT0A 3SIAA 2LVIA 1QS7A 1ALVA 3NXAA 2WCFA 1TWOA 1IH0A 1N2DA 3OP0A 1UUSA 2M3WA 1B9AA 1WRLA 2PALA 2K2FA 3EVVA 4HRHA 4C0JA 1Y1UA 2KQ6A 1XO5A 3DVJA 1ODBA 1B7TZ 1B47A 1SL8A 2L50A 1IKUA 1M31A 2SASA 1BR4B 1CLMA 1BT6A 2OTGC 2ZKMX 2WCMA 3I5HC 2WCJA 2LHIA 1BOCA 1SW8A 1SPYA 1S6IA 3UO9A 1TRFA 4ORAB 4XJKA 1KK8B 2MLEC 1AJ4A 1TNXA 2JC2A 4INXA 2M8UA 2HQWA 4F0ZB 1B8CA 1QIVA 1Q80A 1YX7A 1JFJA 2FCDA 1RECA 2NCPA 2PVBA 1LS8A 1MR8A 1L7ZA 1NX3A 1QX5B 3D76A 3JVTB 2OS8C 2WCEA 3KPXA 3BOWA 1J7QA 2LE9B 5JJGA 3EK8A 3CYZA 3DF0A 3FE9A 5AEQA 2LMTA 1NIWA 2BKHB 2L51A 2H61C 3CGAA 1Z4HA 1CFFA 3TS5B 3JTDC 3AAKA 1SMGA 4WQ2A 1IJ6A 1XFUO 3V2LA 2KYFA 2M49B 3MSEB 4OR9B 4PE4A 1KQMB 2CT9A 1B4CA 3VB1A 1OZSA 5CSFA 1OMRA 1PRWA 1RWYA 2JTTA 3LLEA 3I5IC 2BBNA 1K8UA 3DVEA 3EK7A 1YUTA 4QJ4B 3TDZA 1F70A 1L2OB 1S26D 1S3PA 1P28A 4L9MA 4M2OA 1OMVA 1GGZA 1WLZA 5B8IB 1AHRA 2I7AA 2BE6A 1CMFA 1DVIA 3EVUA 3B7AA 5F6TA 1OOHA 1QATA 3CR5X 3SG3A 1SBJA 2MHHA 1SYMA 1SRAA 4HREE 4WQ3A 1WDCC 4MZLA 3DD4A 1HQVA 2QEBA 2KGBC 3CZ2A 1KK7Z 2M1KB 5I2QA 3SJSA 1LXFC 2LLTA 3NSLA 2ISDA 4C0LA 1JF2A 1CDPA 2HETA 1MUXA 2KFGA 2P70A 4GAOA 4NQGA 1NPQA 3UNWA 4F7FA 4OVNF 4TNCA 1ZACA 3BUOB 4BY5A 2WOSA 1XFRA 3B6XA 1BF5A 3CLNA 3DF0B 3R1PA 3NSIA 2CTNA 3PATA 2LHLA 4MBEA 1K9PA 2TN4A 3S0BA 3VRRA 1QJTA 2KI6C 3D77A 3D0YB 3O4YA 4PE1A 4YBHB 5DKNA 2M7LA 1OMDA 2K7OA 2QPTA 4PE7A 4GFTA 4INWA 1TTXA 1KFXL 1K9UA 4PE0A 2BNXA 1W9ZA 1CNPA 4KYNA 5TNCA 3CZTX 2L2EA 1CLBA 2F33A 1IIOA 1NUBA 2K2AA 3NGVA 4MSPA 2BCAA 1DJIA 1DMOA 3F45A 3AKBA 1GJYA 3EKJA 4P5OE 2BECA 2IS9A 1BR1B 4PHNA 2FOTA 3NSKA 1QX2A 1PSBA 1UHIA 1NSHA 1F55A 2NZ0A 3M0WA 3TUYC 2BL0B 2QDIA 1JWDA 1SKTA 3SS3A 1W7IB 2MJWB 1B1GA 2E30A 2QEOA 2KPHA 3VRQA 1TOPA 1UWOA 2F8PA 2KI4B 3VRNA 1PVAA 1Y1AA 5K89A 1XFVO 1DJXA 1S1EA 1NCXA 3IF7A 5D3OA 5CSNA 1U5IB 3N7HA 2PSRA 3D10A 1QWVA 3SG4A 5JOLA 4NDDA 2JT3A 3DY9A 1N0YA 4YGDB 1DC1A 2L5YA 3S0DA 4JQ0D 2Y1MA 3LCPC 1SR6B 1NWDA 2WCBA 1F4OA 2JOJA 2AMIA 2KBIA 1OE9B 1S36A 4YI9A 1PSRA 1SCVA 4MRXA 3BUXB 3HCMA 3TZ1A 1J1DA 1AK8A 1OOIX 2GGZA 2M29A 1RTP1 2ZN8A 4I5KA 2K7BA 1NYAA 1K9KA 3PALA 2LCPA 1PVBA 2JWWA 1QVIZ 2EC6B 5D69A 4YGEB 1D1OA 2L2CA 1AP4A 3A4UB 3PM2A 5FI6A 4I5JA 1KWOC 2KAVA 1C07A 1CKKA 1MXLC 1QIWA 1CM1A 4HRGA 1WY9A 1B8LA 2KYCA 2HPSA 2KOTA 1KQVA 1UURA 1LA0A 1IG5A 2K7CA 4FTGA 1NP8A 2OTGB 1K94A 2LNKA 2CNPA 3I5HB 3OB1B 4Q04A 4YRUA 1DT7B 2QEVA 4UPGA 1SY9A 1XA5A 2LAPA 3FE8A 1T14A 4C0KA 2BAPA 3ICBA
chains in the Genus database with same CATH topology
1JF0A 2G9BA 1UP5A 3ZNIA 1XVJA 1BLQA 1YUUA 3I5GB 1KFUL 1ZMZA 1CFDA 2BE4A 2V53A 1M39A 3PN7B 1LA3A 1QLKA 3EVRA 3OB2B 3SG5A 1PULA 3A8RA 1YR5A 1G33A 2LM5A 1KK8C 1S6CA 1V1FA 2L5XB 3D0YA 4MZKA 4D1EA 2LP3A 1CFPA 2K8MB 4ORBB 3VGOA 1DJYA 1SNLA 2JNXA 1PK0D 2O5GA 4JPZB 3WNXB 1NX0A 1S5GY 3JVTC 1K90D 3WHTB 2LVJA 1G4YR 1UHKA 2MBXA 4OKHA 1CMGA 5HLVA 4U8DA 4PCWA 1DGVA 1BMOA 2LVVA 3BYAA 2LANA 1PALA 2PRUA 2Q91A 1KQMC 1RFJA 3LK1A 1JC2A 4MEWA 4R1EA 1AJ5A 2K61A 3IQQA 1SL7A 1L2OC 4CFRA 5J3XA 1IQ5A 1WLMA 4ETOA 1WRKA 3KF9A 1MHOA 1F71A 5ER4X 4ZCUA 1DTLA 2HQ8A 1U5IA 1XFZO 3SG6A 1MXEA 1TCOB 1A2XA 2O60A 1ALWA 3OHMB 2Q4UA 3KO0A 1QV0A 4PALA 2Y1NA 3OX5A 4GGNA 1FPWA 1G8IA 1GQMA 5HKWA 1QASA 4OCIA 2MAZA 1SCMB 1M45A 2F3ZA 2BKIB 1XK4A 2KFFA 1A4PA 2JU0A 4ORCB 1YVHA 1QVIY 1XFWO 1KCYA 1BU3A 1B8RA 2G2BA 2COLB 1B7TY 3VROA 2ZFDA 2ZRTA 1QX7A 3I5FB 3O78A 3PSRA 5KTYA 2F2PA 1IGVA 3O2PA 1J7OA 2AUCA 4DUQA 1V1GA 4I5NB 3IQOA 4P2YB 2BBMA 1UHNA 2I94A 1MWNA 1YVLA 1C7WA 2I2RE 2KHNA 4PHMA 1JFKA 2CCMA 1EXRA 2KDHA 2VRGA 2MLFC 1KFXS 2WNDA 2LVKA 1EG3A 5AERA 1FBVA 1UHJA 1IRJA 2KNEA 3LK0A 1YRTB 2JTZA 2EHBA 3WXAA 1X02A 1K2HA 4DIRA 4CFQA 2ZNEA 2BL0C 4GGFA 1OSAA 2L4HA 2SCPA 4GUKA 4PDZA 5FYXA 3SG2A 2M9GA 1Y6WA 3E3RA 1J55A 1QV1A 1AUIB 2JZIA 2KGRA 3EKHA 1IQ3A 1A29A 2JULA 1JSAA 1FF1A 1CTRA 1DJHA 2H61A 5CPVA 1TNPA 1M46A 4CPVA 1YX8A 1CFCA 1YTZC 2F2OA 1OZOA 5PALA 2P6BB 1SR6C 2ZNDA 2M0RA 2QACA 2H2KA 2Y4QA 1DF0B 2DOQA 1TNWA 2LUCA 3PLFB 2NLNA 1KK7Y 3AAJA 3K21A 1LKJA 1J7RA 1DGUA 1QTXA 2PMYA 4CLNA 2L98A 2CBLA 3QRXA 2MA2A 4N1FA 2LV7A 3GOFA 2EC6C 1BJFA 1A75A 2E6WA 2B1UA 4DS7A 2KI6D 5D7FA 1YURA 1KSMA 1K96A 3CTNA 2WC8A 4GBAA 1K93D 1EH2A 4N1GA 4HSZA 1SL9A 1WRZA 4M2PA 2OS8B 4QJ3B 4USLA 1HT9A 1K95A 3SIBA 2LMVA 4BY4A 5AFPA 2ZRSA 4YGAA 1XFXO 3CR4X 1NX2A 3GK4X 3JTDB 1F54A 4CIDA 2KBMA 5KU1A 1ZUZA 4NDBA 2Y5IA 4GGFC 3EK4A 2CXJA 2ZN9A 3AKAA 3NSOA 4MLWA 3I5GC 3WHUB 4NDCA 3I5IB 1EL4A 1NX1A 3PM8A 1F8HA 2I18A 1AVSA 1OQPA 3KHEA 5HKYA 4A4CA 3PN7C 2M97A 1CDNA 1KFUS 3TS5C 2EGDA 4YI8A 1ZFSA 2M7NA 5G08A 3LL8B 5HKZA 2LC5A 3SG7A 1TCFA 3TDIA 1N65A 1CDMA 1WDCB 4IL1A 1A75B 1LINA 3BUNB 2K0JA 4ZCVA 2NCOA 1YRUB 1TNQA 1R6PA 1MQ1A 4E68A 2KAYA 2PASA 5HLOA 5DKRA 3PFVA 3H4SE 2FCEA 2JRFA 3FWBA 2LUXA 1BG1A 1CM4A 1RJVA 1DJZA 4MVFA 3FS7A 3FIAA 1OOJA 2KFHA 2A4JA 4N5XA 4XJKB 5AXIA 4YGCB 1J1EA 2KQYA 3HX4A 1LVCD 5HYDA 2M1UA 5GQQC 2GV5A 5BPJA 2AAOA 3GK1A 1IWQA 1C7VA 1JBAA 1CLLA 1CDLA 1NCYA 1EJ3A 2JXCA 1S6JA 1H8BA 2L4IA 2RGIA 5I2OA 3BOWB 4PHKA 3DVKA 1KSOA 1TIZA 2BCXA 5ER5A 4MN0A 4MRYA 4XYNA 4AQIA 3BUMB 1TN4A 4WRIA 1A03A 1ZOTB 2FJUB 1GGWA 5IBWA 1XYDA 5DKQA 1RROA 5I2LA 1BODA 2LLSA 1SCMC 4JWQA 4MZJA 1DF0A 3TUYB 1H4BA 2KSPA 2L0PA 3ZWHA 1F4QA 4FQOA 3RLZA 4PHJA 3O6BA 1M63B 1Y1XA 2JQ6A 1J7PA 1S5GZ 1Y0VH 3I5FC 2OPOA 4ICBA 1QXPA 1FI5A 2K7DA 2JT8A 2GGMA 3CS1A 4OV2A 1FW4A 2NXQA 3CR2A 1EG4A 2JNFA 2KI4C 4I5LB 1NCZA 1YUSA 5KSZA 1IJ5A 2MRDA 1SK6D 4GNKB 3BXKA 5CSIA 5AANA 3BQ3A 2WORA 4A4BA 4YGBB 2HF5A 3VRPA 3FWCA 1UHHA 2F3YA 1JUOA 1QLSA 1XFYO 2BCBA 1RK9A 2JPTA 1R2UA 4AQJA 1MF8B 4QJ5B 1W7JB 2LLUA 3CWGA 3GK2A 1DJWA 4AOMA 5I8NA 1E8AA 2JXLA 4DCKA 1VRKA 2LP2A 3RM1A 1FI6A 3C1VA 4DRWA 1XK4C 3TDUA 4GPLB 3OX6A 4M2QA 3KEVA 1KWOB 2KAXA 2D8NA 2LMUA 1CB1A 2R2IA 3BUWB 3SIAA 3DVMA 1DJGA 2JT0A 2LVIA 1QS7A 1ALVA 3NXAA 2WCFA 1IH0A 1N2DA 3OP0A 1UUSA 2M3WA 1B9AA 1WRLA 2PALA 2K2FA 3EVVA 4HRHA 4C0JA 1Y1UA 2KQ6A 1XO5A 3DVJA 1ODBA 1B7TZ 1B47A 1SL8A 2L50A 1IKUA 1M31A 2SASA 1BR4B 1CLMA 1BT6A 2OTGC 2ZKMX 3I5HC 2LHIA 1BOCA 1SW8A 1SPYA 1S6IA 1TRFA 4ORAB 4XJKA 1KK8B 2MLEC 1AJ4A 1TNXA 2JC2A 2M8UA 2HQWA 4F0ZB 1B8CA 1QIVA 1Q80A 1YX7A 1JFJA 2FCDA 1RECA 2NCPA 2PVBA 1MR8A 1L7ZA 1NX3A 1QX5B 3JVTB 2OS8C 2WCEA 3KPXA 3BOWA 1J7QA 2LE9B 5JJGA 3EK8A 3DF0A 5AEQA 2LMTA 1NIWA 2BKHB 2L51A 2H61C 3CGAA 1CFFA 3TS5B 3JTDC 3AAKA 1SMGA 4WQ2A 1IJ6A 1XFUO 2KYFA 2M49B 3MSEB 4OR9B 4PE4A 1KQMB 2CT9A 1B4CA 1OZSA 5CSFA 1OMRA 1PRWA 1RWYA 2JTTA 3LLEA 3I5IC 2BBNA 1K8UA 3DVEA 3EK7A 1YUTA 4QJ4B 3TDZA 1F70A 1L2OB 1S26D 1S3PA 4L9MA 4M2OA 1OMVA 1GGZA 1WLZA 5B8IB 1AHRA 2I7AA 2BE6A 1CMFA 1DVIA 3EVUA 5F6TA 1QATA 3CR5X 3SG3A 1SBJA 2MHHA 1SYMA 1SRAA 4HREE 4WQ3A 1WDCC 4MZLA 3DD4A 1HQVA 2KGBC 1KK7Z 2M1KB 5I2QA 3SJSA 1LXFC 2LLTA 3NSLA 2ISDA 4C0LA 1JF2A 1CDPA 2HETA 1MUXA 2KFGA 4GAOA 4NQGA 1NPQA 4OVNF 4TNCA 1ZACA 3BUOB 4BY5A 2WOSA 1BF5A 3CLNA 3DF0B 3NSIA 2CTNA 3PATA 2LHLA 4MBEA 1K9PA 2TN4A 3VRRA 1QJTA 2KI6C 3O4YA 3D0YB 4YBHB 4PE1A 5DKNA 2M7LA 1OMDA 2K7OA 2QPTA 4PE7A 4GFTA 1TTXA 1KFXL 1K9UA 4PE0A 1CNPA 5TNCA 3CZTX 2L2EA 1CLBA 2F33A 1NUBA 2K2AA 4MSPA 2BCAA 1DJIA 1DMOA 3F45A 3AKBA 1GJYA 3EKJA 4P5OE 2BECA 2IS9A 1BR1B 4PHNA 2FOTA 3NSKA 1QX2A 1PSBA 1UHIA 1NSHA 1F55A 2NZ0A 3M0WA 3TUYC 2BL0B 1JWDA 1SKTA 1W7IB 2MJWB 1B1GA 2E30A 3VRQA 1TOPA 1UWOA 2F8PA 2KI4B 3VRNA 1PVAA 1Y1AA 5K89A 1XFVO 1DJXA 1S1EA 1NCXA 3IF7A 5CSNA 1U5IB 2PSRA 3D10A 3SG4A 5JOLA 4NDDA 2JT3A 1N0YA 4YGDB 4JQ0D 2Y1MA 3LCPC 1SR6B 1NWDA 2WCBA 1F4OA 2JOJA 2AMIA 2KBIA 1OE9B 1S36A 4YI9A 1PSRA 1SCVA 4MRXA 3BUXB 3HCMA 3TZ1A 1J1DA 1AK8A 2GGZA 2M29A 1RTP1 2ZN8A 4I5KA 2K7BA 1NYAA 1K9KA 3PALA 2LCPA 1PVBA 2JWWA 1QVIZ 2EC6B 5D69A 4YGEB 1D1OA 1AP4A 3A4UB 4I5JA 1KWOC 2KAVA 1C07A 1CKKA 1MXLC 1QIWA 1CM1A 4HRGA 1WY9A 1B8LA 2KYCA 2HPSA 2KOTA 1KQVA 1UURA 1LA0A 1IG5A 2K7CA 4FTGA 1NP8A 2OTGB 1K94A 2LNKA 2CNPA 3I5HB 3OB1B 4Q04A 4YRUA 1DT7B 4UPGA 1SY9A 1XA5A 2LAPA 5CSJA 4C0KA 3ICBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JF0 A;  2G9B A;  1UP5 A;  3ZNI A;  1XVJ A;  1BLQ A;  1YUU A;  3I5G B;  1KFU L;  1ZMZ A;  1CFD A;  2BE4 A;  2V53 A;  1M39 A;  3PN7 B;  1LA3 A;  1QLK A;  3EVR A;  3OB2 B;  3SG5 A;  1PUL A;  3A8R A;  1YR5 A;  1G33 A;  2LM5 A;  1KK8 C;  1S6C A;  1V1F A;  2L5X B;  3D0Y A;  4MZK A;  4D1E A;  2LP3 A;  1CFP A;  2K8M B;  4ORB B;  3VGO A;  1DJY A;  1SNL A;  2JNX A;  1PK0 D;  2O5G A;  4JPZ B;  3WNX B;  1NX0 A;  1S5G Y;  3JVT C;  1K90 D;  3WHT B;  2LVJ A;  1G4Y R;  1UHK A;  2MBX A;  4OKH A;  1CMG A;  5HLV A;  4U8D A;  4PCW A;  1DGV A;  1BMO A;  2LVV A;  3BYA A;  2LAN A;  1PAL A;  2PRU A;  2Q91 A;  1KQM C;  1RFJ A;  3LK1 A;  1JC2 A;  4MEW A;  4R1E A;  1AJ5 A;  2K61 A;  3IQQ A;  1SL7 A;  1L2O C;  4CFR A;  5J3X A;  1IQ5 A;  1WLM A;  4ETO A;  1WRK A;  3KF9 A;  1MHO A;  1F71 A;  5ER4 X;  4ZCU A;  1DTL A;  2HQ8 A;  1U5I A;  1XFZ O;  3SG6 A;  1MXE A;  1TCO B;  1A2X A;  2O60 A;  1ALW A;  3OHM B;  2Q4U A;  3KO0 A;  1QV0 A;  4PAL A;  2Y1N A;  3OX5 A;  4GGN A;  1FPW A;  1G8I A;  1GQM A;  5HKW A;  1QAS A;  4OCI A;  2MAZ A;  1SCM B;  1M45 A;  2F3Z A;  2BKI B;  1XK4 A;  2KFF A;  1A4P A;  2JU0 A;  4ORC B;  1YVH A;  1QVI Y;  1XFW O;  1KCY A;  1BU3 A;  1B8R A;  2G2B A;  2COL B;  1B7T Y;  3VRO A;  2ZFD A;  2ZRT A;  1QX7 A;  3I5F B;  3O78 A;  3PSR A;  5KTY A;  2F2P A;  1IGV A;  3O2P A;  1J7O A;  2AUC A;  4DUQ A;  1V1G A;  4I5N B;  3IQO A;  4P2Y B;  2BBM A;  1UHN A;  2I94 A;  1MWN A;  1YVL A;  1C7W A;  2I2R E;  2KHN A;  4PHM A;  1JFK A;  2CCM A;  1EXR A;  2KDH A;  2VRG A;  2MLF C;  1KFX S;  2WND A;  2LVK A;  1EG3 A;  5AER A;  1FBV A;  1UHJ A;  1IRJ A;  2KNE A;  3LK0 A;  1YRT B;  2JTZ A;  2EHB A;  3WXA A;  1X02 A;  1K2H A;  4DIR A;  4CFQ A;  2ZNE A;  2BL0 C;  4GGF A;  1OSA A;  2L4H A;  2SCP A;  4GUK A;  4PDZ A;  5FYX A;  3SG2 A;  2M9G A;  1Y6W A;  3E3R A;  1J55 A;  1QV1 A;  1AUI B;  2JZI A;  2KGR A;  3EKH A;  1IQ3 A;  1A29 A;  2JUL A;  1JSA A;  1FF1 A;  1CTR A;  1DJH A;  2H61 A;  5CPV A;  1TNP A;  1M46 A;  4CPV A;  1YX8 A;  1CFC A;  1YTZ C;  2F2O A;  1OZO A;  5PAL A;  2P6B B;  1SR6 C;  2ZND A;  2M0R A;  2QAC A;  2H2K A;  2Y4Q A;  1DF0 B;  2DOQ A;  1TNW A;  2LUC A;  3PLF B;  2NLN A;  1KK7 Y;  3AAJ A;  3K21 A;  1LKJ A;  1J7R A;  1DGU A;  1QTX A;  2PMY A;  4CLN A;  2L98 A;  2CBL A;  3QRX A;  2MA2 A;  4N1F A;  2LV7 A;  3GOF A;  2EC6 C;  1BJF A;  1A75 A;  2E6W A;  2B1U A;  4DS7 A;  2KI6 D;  5D7F A;  1YUR A;  1KSM A;  1K96 A;  3CTN A;  2WC8 A;  4GBA A;  1K93 D;  1EH2 A;  4N1G A;  4HSZ A;  1SL9 A;  1WRZ A;  4M2P A;  2OS8 B;  4QJ3 B;  4USL A;  1HT9 A;  1K95 A;  3SIB A;  2LMV A;  4BY4 A;  5AFP A;  2ZRS A;  4YGA A;  1XFX O;  3CR4 X;  1NX2 A;  3GK4 X;  3JTD B;  1F54 A;  4CID A;  2KBM A;  5KU1 A;  1ZUZ A;  4NDB A;  2Y5I A;  4GGF C;  3EK4 A;  2CXJ A;  2ZN9 A;  3AKA A;  3NSO A;  4MLW A;  3I5G C;  3WHU B;  4NDC A;  3I5I B;  1EL4 A;  1NX1 A;  3PM8 A;  1F8H A;  2I18 A;  1AVS A;  1OQP A;  3KHE A;  5HKY A;  4A4C A;  3PN7 C;  2M97 A;  1CDN A;  1KFU S;  3TS5 C;  2EGD A;  4YI8 A;  1ZFS A;  2M7N A;  5G08 A;  3LL8 B;  5HKZ A;  2LC5 A;  3SG7 A;  1TCF A;  3TDI A;  1N65 A;  1CDM A;  1WDC B;  4IL1 A;  1A75 B;  1LIN A;  3BUN B;  2K0J A;  4ZCV A;  2NCO A;  1YRU B;  1TNQ A;  1R6P A;  1MQ1 A;  4E68 A;  2KAY A;  2PAS A;  5HLO A;  5DKR A;  3PFV A;  3H4S E;  2FCE A;  2JRF A;  3FWB A;  2LUX A;  1BG1 A;  1CM4 A;  1RJV A;  1DJZ A;  4MVF A;  3FS7 A;  3FIA A;  1OOJ A;  2KFH A;  2A4J A;  4N5X A;  4XJK B;  5AXI A;  4YGC B;  1J1E A;  2KQY A;  3HX4 A;  1LVC D;  5HYD A;  2M1U A;  5GQQ C;  2GV5 A;  5BPJ A;  2AAO A;  3GK1 A;  1IWQ A;  1C7V A;  1JBA A;  1CLL A;  1CDL A;  1NCY A;  1EJ3 A;  2JXC A;  1S6J A;  1H8B A;  2L4I A;  2RGI A;  5I2O A;  3BOW B;  4PHK A;  3DVK A;  1KSO A;  1TIZ A;  2BCX A;  5ER5 A;  4MN0 A;  4MRY A;  4XYN A;  4AQI A;  3BUM B;  1TN4 A;  4WRI A;  1A03 A;  1ZOT B;  2FJU B;  1GGW A;  5IBW A;  1XYD A;  5DKQ A;  1RRO A;  5I2L A;  1BOD A;  2LLS A;  1SCM C;  4JWQ A;  4MZJ A;  1DF0 A;  3TUY B;  1H4B A;  2KSP A;  2L0P A;  3ZWH A;  1F4Q A;  4FQO A;  3RLZ A;  4PHJ A;  3O6B A;  1M63 B;  1Y1X A;  2JQ6 A;  1J7P A;  1S5G Z;  1Y0V H;  3I5F C;  2OPO A;  4ICB A;  1QXP A;  1FI5 A;  2K7D A;  2JT8 A;  2GGM A;  3CS1 A;  4OV2 A;  1FW4 A;  2NXQ A;  3CR2 A;  1EG4 A;  2JNF A;  2KI4 C;  4I5L B;  1NCZ A;  1YUS A;  5KSZ A;  1IJ5 A;  2MRD A;  1SK6 D;  4GNK B;  3BXK A;  5CSI A;  5AAN A;  3BQ3 A;  2WOR A;  4A4B A;  4YGB B;  2HF5 A;  3VRP A;  3FWC A;  1UHH A;  2F3Y A;  1JUO A;  1QLS A;  1XFY O;  2BCB A;  1RK9 A;  2JPT A;  1R2U A;  4AQJ A;  1MF8 B;  4QJ5 B;  1W7J B;  2LLU A;  3CWG A;  3GK2 A;  1DJW A;  4AOM A;  5I8N A;  1E8A A;  2JXL A;  4DCK A;  1VRK A;  2LP2 A;  3RM1 A;  1FI6 A;  3C1V A;  4DRW A;  1XK4 C;  3TDU A;  4GPL B;  3OX6 A;  4M2Q A;  3KEV A;  1KWO B;  2KAX A;  2D8N A;  2LMU A;  1CB1 A;  2R2I A;  3BUW B;  3SIA A;  3DVM A;  1DJG A;  2JT0 A;  2LVI A;  1QS7 A;  1ALV A;  3NXA A;  2WCF A;  1IH0 A;  1N2D A;  3OP0 A;  1UUS A;  2M3W A;  1B9A A;  1WRL A;  2PAL A;  2K2F A;  3EVV A;  4HRH A;  4C0J A;  1Y1U A;  2KQ6 A;  1XO5 A;  3DVJ A;  1ODB A;  1B7T Z;  1B47 A;  1SL8 A;  2L50 A;  1IKU A;  1M31 A;  2SAS A;  1BR4 B;  1CLM A;  1BT6 A;  2OTG C;  2ZKM X;  3I5H C;  2LHI A;  1BOC A;  1SW8 A;  1SPY A;  1S6I A;  1TRF A;  4ORA B;  4XJK A;  1KK8 B;  2MLE C;  1AJ4 A;  1TNX A;  2JC2 A;  2M8U A;  2HQW A;  4F0Z B;  1B8C A;  1QIV A;  1Q80 A;  1YX7 A;  1JFJ A;  2FCD A;  1REC A;  2NCP A;  2PVB A;  1MR8 A;  1L7Z A;  1NX3 A;  1QX5 B;  3JVT B;  2OS8 C;  2WCE A;  3KPX A;  3BOW A;  1J7Q A;  2LE9 B;  5JJG A;  3EK8 A;  3DF0 A;  5AEQ A;  2LMT A;  1NIW A;  2BKH B;  2L51 A;  2H61 C;  3CGA A;  1CFF A;  3TS5 B;  3JTD C;  3AAK A;  1SMG A;  4WQ2 A;  1IJ6 A;  1XFU O;  2KYF A;  2M49 B;  3MSE B;  4OR9 B;  4PE4 A;  1KQM B;  2CT9 A;  1B4C A;  1OZS A;  5CSF A;  1OMR A;  1PRW A;  1RWY A;  2JTT A;  3LLE A;  3I5I C;  2BBN A;  1K8U A;  3DVE A;  3EK7 A;  1YUT A;  4QJ4 B;  3TDZ A;  1F70 A;  1L2O B;  1S26 D;  1S3P A;  4L9M A;  4M2O A;  1OMV A;  1GGZ A;  1WLZ A;  5B8I B;  1AHR A;  2I7A A;  2BE6 A;  1CMF A;  1DVI A;  3EVU A;  5F6T A;  1QAT A;  3CR5 X;  3SG3 A;  1SBJ A;  2MHH A;  1SYM A;  1SRA A;  4HRE E;  4WQ3 A;  1WDC C;  4MZL A;  3DD4 A;  1HQV A;  2KGB C;  1KK7 Z;  2M1K B;  5I2Q A;  3SJS A;  1LXF C;  2LLT A;  3NSL A;  2ISD A;  4C0L A;  1JF2 A;  1CDP A;  2HET A;  1MUX A;  2KFG A;  4GAO A;  4NQG A;  1NPQ A;  4OVN F;  4TNC A;  1ZAC A;  3BUO B;  4BY5 A;  2WOS A;  1BF5 A;  3CLN A;  3DF0 B;  3NSI A;  2CTN A;  3PAT A;  2LHL A;  4MBE A;  1K9P A;  2TN4 A;  3VRR A;  1QJT A;  2KI6 C;  3O4Y A;  3D0Y B;  4YBH B;  4PE1 A;  5DKN A;  2M7L A;  1OMD A;  2K7O A;  2QPT A;  4PE7 A;  4GFT A;  1TTX A;  1KFX L;  1K9U A;  4PE0 A;  1CNP A;  5TNC A;  3CZT X;  2L2E A;  1CLB A;  2F33 A;  1NUB A;  2K2A A;  4MSP A;  2BCA A;  1DJI A;  1DMO A;  3F45 A;  3AKB A;  1GJY A;  3EKJ A;  4P5O E;  2BEC A;  2IS9 A;  1BR1 B;  4PHN A;  2FOT A;  3NSK A;  1QX2 A;  1PSB A;  1UHI A;  1NSH A;  1F55 A;  2NZ0 A;  3M0W A;  3TUY C;  2BL0 B;  1JWD A;  1SKT A;  1W7I B;  2MJW B;  1B1G A;  2E30 A;  3VRQ A;  1TOP A;  1UWO A;  2F8P A;  2KI4 B;  3VRN A;  1PVA A;  1Y1A A;  5K89 A;  1XFV O;  1DJX A;  1S1E A;  1NCX A;  3IF7 A;  5CSN A;  1U5I B;  2PSR A;  3D10 A;  3SG4 A;  5JOL A;  4NDD A;  2JT3 A;  1N0Y A;  4YGD B;  4JQ0 D;  2Y1M A;  3LCP C;  1SR6 B;  1NWD A;  2WCB A;  1F4O A;  2JOJ A;  2AMI A;  2KBI A;  1OE9 B;  1S36 A;  4YI9 A;  1PSR A;  1SCV A;  4MRX A;  3BUX B;  3HCM A;  3TZ1 A;  1J1D A;  1AK8 A;  2GGZ A;  2M29 A;  1RTP 1;  2ZN8 A;  4I5K A;  2K7B A;  1NYA A;  1K9K A;  3PAL A;  2LCP A;  1PVB A;  2JWW A;  1QVI Z;  2EC6 B;  5D69 A;  4YGE B;  1D1O A;  1AP4 A;  3A4U B;  4I5J A;  1KWO C;  2KAV A;  1C07 A;  1CKK A;  1MXL C;  1QIW A;  1CM1 A;  4HRG A;  1WY9 A;  1B8L A;  2KYC A;  2HPS A;  2KOT A;  1KQV A;  1UUR A;  1LA0 A;  1IG5 A;  2K7C A;  4FTG A;  1NP8 A;  2OTG B;  1K94 A;  2LNK A;  2CNP A;  3I5H B;  3OB1 B;  4Q04 A;  4YRU A;  1DT7 B;  4UPG A;  1SY9 A;  1XA5 A;  2LAP A;  5CSJ A;  4C0K A;  3ICB A; 
#chains in the Genus database with same CATH topology
 1JF0 A;  2G9B A;  1UP5 A;  3ZNI A;  1XVJ A;  1BLQ A;  1YUU A;  2GTE A;  5CSJ A;  4JKT A;  3I5G B;  1KFU L;  1ZMZ A;  3S0F A;  1CFD A;  2BE4 A;  3CZ0 A;  2V53 A;  1M39 A;  3PN7 B;  1LA3 A;  1QLK A;  3EVR A;  3OB2 B;  3SG5 A;  1PUL A;  3A8R A;  1YR5 A;  1G33 A;  2LM5 A;  1KK8 C;  1S6C A;  1V1F A;  2L5X B;  3BFB A;  3D0Y A;  3OBV A;  4MZK A;  4D1E A;  2LP3 A;  1DEK A;  1CFP A;  2K8M B;  4ORB B;  3VGO A;  1DJY A;  1SNL A;  2JNX A;  1PK0 D;  2O5G A;  4JPZ B;  3WNX B;  1NX0 A;  1S5G Y;  3JVT C;  1K90 D;  3WHT B;  2LVJ A;  2WCH A;  1G4Y R;  1UHK A;  2MBX A;  1Z2C B;  2P71 A;  4OKH A;  3B87 A;  1CMG A;  5HLV A;  4U8D A;  4PCW A;  1DGV A;  1BMO A;  2LVV A;  3BYA A;  1OOG A;  2LAN A;  1PAL A;  2PRU A;  2QEH A;  2Q91 A;  1KQM C;  1RFJ A;  3LK1 A;  1JC2 A;  4MEW A;  4R1E A;  2PQL A;  1AJ5 A;  2K61 A;  3IQQ A;  3Q8I A;  1SL7 A;  1L2O C;  4CFR A;  5J3X A;  1IQ5 A;  1WLM A;  4ETO A;  1WRK A;  3KF9 A;  1MHO A;  1ORG A;  3B88 A;  1F71 A;  5ER4 X;  4ZCU A;  1DTL A;  2WC5 A;  2HQ8 A;  1U5I A;  1XFZ O;  3SG6 A;  1MXE A;  1TCO B;  1A2X A;  2O60 A;  1ALW A;  3OHM B;  2Q4U A;  3KO0 A;  1QV0 A;  4PAL A;  2Y1N A;  3SS5 A;  3D75 A;  3OX5 A;  4GGN A;  1FPW A;  1G8I A;  1GQM A;  5HKW A;  1QAS A;  4OCI A;  2MAZ A;  1SCM B;  1M45 A;  2F3Z A;  2BKI B;  1XK4 A;  2K60 A;  2KFF A;  1A4P A;  2JU0 A;  4ORC B;  1YVH A;  1QVI Y;  1XFW O;  3R1V A;  1KCY A;  1BU3 A;  1OW4 A;  1B8R A;  2G2B A;  2YGU A;  2COL B;  1B7T Y;  3VRO A;  2ZFD A;  2ZRT A;  1QX7 A;  3FE6 A;  3I5F B;  3O78 A;  3PSR A;  5KTY A;  2F2P A;  1IGV A;  3O2P A;  1J7O A;  2WCK A;  2AUC A;  2WC6 A;  5EL2 A;  1V1G A;  4DUQ A;  4I5N B;  3IQO A;  4P2Y B;  2BBM A;  1UHN A;  2I94 A;  1MWN A;  1YVL A;  1C7W A;  2I2R E;  2KHN A;  4PHM A;  1JFK A;  2CCM A;  4JD9 A;  1EXR A;  2KDH A;  2VRG A;  2MLF C;  3DZT A;  1KFX S;  2WND A;  3K1E A;  2LVK A;  1EG3 A;  5AER A;  1FBV A;  1UHJ A;  1IRJ A;  2KNE A;  5HL1 A;  3LK0 A;  1YRT B;  3D74 A;  2JTZ A;  3D73 A;  1DQE A;  2EHB A;  3WXA A;  1X02 A;  1K2H A;  4DIR A;  4CFQ A;  2ZNE A;  2BL0 C;  4GGF A;  1OSA A;  1DEL A;  2L4H A;  2SCP A;  4GUK A;  4PDZ A;  5FYX A;  2JPO A;  3SG2 A;  2M9G A;  1Y6W A;  3E3R A;  1J55 A;  1QV1 A;  1AUI B;  2JZI A;  3BFH A;  2KGR A;  3EKH A;  1IQ3 A;  1OOF A;  1A29 A;  2JUL A;  1JSA A;  1FF1 A;  1CTR A;  1DJH A;  2H61 A;  2PYQ A;  5CPV A;  1TNP A;  1M46 A;  4CPV A;  1YX8 A;  3S0A A;  3CZ1 A;  1CFC A;  1YTZ C;  2F2O A;  1OZO A;  5PAL A;  1C3Y A;  2P6B B;  1SR6 C;  2ZND A;  2M0R A;  2QAC A;  2H2K A;  2Y4Q A;  3L4L A;  1DF0 B;  2DOQ A;  1TNW A;  2LUC A;  3PLF B;  2NLN A;  3OGN A;  1KK7 Y;  3AAJ A;  3K21 A;  4PT1 A;  1LKJ A;  1J7R A;  1DGU A;  1QTX A;  2PMY A;  4CLN A;  2L98 A;  2CBL A;  3DYE A;  3QRX A;  2MA2 A;  4N1F A;  2LV7 A;  4IJ7 A;  3GOF A;  2EC6 C;  1BJF A;  1A75 A;  2E6W A;  2B1U A;  3DXL A;  4DS7 A;  2KI6 D;  5D7F A;  1YUR A;  1KSM A;  1K96 A;  3CTN A;  2WC8 A;  4GBA A;  1K93 D;  1EH2 A;  4N1G A;  3NHI A;  4HSZ A;  1SL9 A;  1WRZ A;  4M2P A;  2OS8 B;  4QJ3 B;  4USL A;  1HT9 A;  1K95 A;  3SIB A;  2LMV A;  4BY4 A;  5FI2 A;  5AFP A;  2KLD A;  2ZRS A;  4YGA A;  1XFX O;  3CR4 X;  1NX2 A;  3GK4 X;  3JTD B;  1F54 A;  4CID A;  5DIC A;  2KBM A;  5KU1 A;  1ZUZ A;  4NDB A;  2Y5I A;  1GM0 A;  4GGF C;  3EK4 A;  2CXJ A;  2ZN9 A;  2FJY A;  3AKA A;  3NSO A;  3I5G C;  2KLE A;  4MLW A;  4NDC A;  3WHU B;  3I5I B;  1EL4 A;  1NX1 A;  3PM8 A;  1F8H A;  2I18 A;  1AVS A;  1OQP A;  3KHE A;  5HKY A;  3D78 A;  4A4C A;  3PN7 C;  2M97 A;  1CDN A;  1KFU S;  3R1O A;  3S0G A;  2EGD A;  4YI8 A;  3TS5 C;  1ZFS A;  2M7N A;  5G08 A;  3LL8 B;  5HKZ A;  2LC5 A;  3SG7 A;  1TCF A;  3TDI A;  3O4X A;  1N65 A;  1CDM A;  1WDC B;  4IL1 A;  1A75 B;  1LIN A;  3BUN B;  2K0J A;  4ZCV A;  2NCO A;  1YRU B;  1TNQ A;  1R6P A;  3CDN A;  1MQ1 A;  4E68 A;  2KAY A;  2PAS A;  5HLO A;  3RZS A;  5DKR A;  3PFV A;  3R72 A;  3H4S E;  2FCE A;  2JRF A;  3FWB A;  2LUX A;  1BG1 A;  1CM4 A;  1RJV A;  1DJZ A;  5I94 A;  4MVF A;  3FS7 A;  3FIA A;  3SS4 A;  1OOJ A;  2KFH A;  2ERB A;  2A4J A;  4N5X A;  4XJK B;  5AXI A;  4YGC B;  1J1E A;  2KQY A;  3HX4 A;  1LVC D;  5HYD A;  2M1U A;  5GQQ C;  2GV5 A;  5BPJ A;  2AAO A;  3GK1 A;  1IWQ A;  4OZD A;  1C7V A;  1JBA A;  1CLL A;  1CDL A;  1NCY A;  1EJ3 A;  2JXC A;  1S6J A;  1H8B A;  2L4I A;  2RGI A;  5I2O A;  3BOW B;  4PHK A;  3DVK A;  1KSO A;  1TIZ A;  2BCX A;  5ER5 A;  4MN0 A;  4MRY A;  3S0E A;  3BJH A;  4XYN A;  4AQI A;  3BUM B;  1TN4 A;  4WRI A;  1A03 A;  1ZOT B;  2FJU B;  1GGW A;  5IBW A;  1XYD A;  5DKQ A;  1RRO A;  5I2L A;  1BOD A;  3IVT A;  2LLS A;  3EG5 B;  1SCM C;  2WCL A;  1TUJ A;  4FQT A;  4JWQ A;  4MZJ A;  1DF0 A;  3TUY B;  1H4B A;  2KSP A;  2L0P A;  3ZWH A;  1F4Q A;  4FQO A;  3RLZ A;  4PHJ A;  3O6B A;  1M63 B;  1Y1X A;  2JQ6 A;  1J7P A;  5FI7 A;  1S5G Z;  1Y0V H;  3I5F C;  2OPO A;  4ICB A;  1QXP A;  1FI5 A;  1SSE B;  2K7D A;  2JT8 A;  3PJI A;  2H8V A;  2GGM A;  3CS1 A;  4OV2 A;  1FW4 A;  2NXQ A;  3L4A A;  3CR2 A;  3QME A;  1EG4 A;  2JNF A;  2KI4 C;  3NHT A;  1NCZ A;  1YUS A;  4I5L B;  1IJ5 A;  2MRD A;  1SK6 D;  4GNK B;  3BXK A;  5KSZ A;  5CSI A;  5AAN A;  3BQ3 A;  2WOR A;  4A4B A;  4YGB B;  2HF5 A;  3VRP A;  3FWC A;  1UHH A;  2F3Y A;  1JUO A;  1QLS A;  1XFY O;  2BCB A;  1RK9 A;  2JPT A;  1R2U A;  4AQJ A;  3L47 A;  1C3Z A;  1MF8 B;  4QJ5 B;  1W7J B;  2LLU A;  3CWG A;  3GK2 A;  1DJW A;  4AOM A;  5I8N A;  1E8A A;  2JXL A;  4DCK A;  1VRK A;  2LP2 A;  3RM1 A;  1FI6 A;  3C1V A;  4DRW A;  3BFA A;  3B86 A;  1XK4 C;  3TDU A;  4GPL B;  3OX6 A;  4M2Q A;  3KEV A;  1KWO B;  3CAB A;  2KAX A;  2D8N A;  2LMU A;  1CB1 A;  2R2I A;  3BUW B;  1TUZ A;  3DVM A;  1DJG A;  2JT0 A;  3SIA A;  2LVI A;  1QS7 A;  1ALV A;  3NXA A;  2WCF A;  1TWO A;  1IH0 A;  1N2D A;  3OP0 A;  1UUS A;  2M3W A;  1B9A A;  1WRL A;  2PAL A;  2K2F A;  3EVV A;  4HRH A;  4C0J A;  1Y1U A;  2KQ6 A;  1XO5 A;  3DVJ A;  1ODB A;  1B7T Z;  1B47 A;  1SL8 A;  2L50 A;  1IKU A;  1M31 A;  2SAS A;  1BR4 B;  1CLM A;  1BT6 A;  2OTG C;  2ZKM X;  2WCM A;  3I5H C;  2WCJ A;  2LHI A;  1BOC A;  1SW8 A;  1SPY A;  1S6I A;  3UO9 A;  1TRF A;  4ORA B;  4XJK A;  1KK8 B;  2MLE C;  1AJ4 A;  1TNX A;  2JC2 A;  4INX A;  2M8U A;  2HQW A;  4F0Z B;  1B8C A;  1QIV A;  1Q80 A;  1YX7 A;  1JFJ A;  2FCD A;  1REC A;  2NCP A;  2PVB A;  1LS8 A;  1MR8 A;  1L7Z A;  1NX3 A;  1QX5 B;  3D76 A;  3JVT B;  2OS8 C;  2WCE A;  3KPX A;  3BOW A;  1J7Q A;  2LE9 B;  5JJG A;  3EK8 A;  3CYZ A;  3DF0 A;  3FE9 A;  5AEQ A;  2LMT A;  1NIW A;  2BKH B;  2L51 A;  2H61 C;  3CGA A;  1Z4H A;  1CFF A;  3TS5 B;  3JTD C;  3AAK A;  1SMG A;  4WQ2 A;  1IJ6 A;  1XFU O;  3V2L A;  2KYF A;  2M49 B;  3MSE B;  4OR9 B;  4PE4 A;  1KQM B;  2CT9 A;  1B4C A;  3VB1 A;  1OZS A;  5CSF A;  1OMR A;  1PRW A;  1RWY A;  2JTT A;  3LLE A;  3I5I C;  2BBN A;  1K8U A;  3DVE A;  3EK7 A;  1YUT A;  4QJ4 B;  3TDZ A;  1F70 A;  1L2O B;  1S26 D;  1S3P A;  1P28 A;  4L9M A;  4M2O A;  1OMV A;  1GGZ A;  1WLZ A;  5B8I B;  1AHR A;  2I7A A;  2BE6 A;  1CMF A;  1DVI A;  3EVU A;  3B7A A;  5F6T A;  1OOH A;  1QAT A;  3CR5 X;  3SG3 A;  1SBJ A;  2MHH A;  1SYM A;  1SRA A;  4HRE E;  4WQ3 A;  1WDC C;  4MZL A;  3DD4 A;  1HQV A;  2QEB A;  2KGB C;  3CZ2 A;  1KK7 Z;  2M1K B;  5I2Q A;  3SJS A;  1LXF C;  2LLT A;  3NSL A;  2ISD A;  4C0L A;  1JF2 A;  1CDP A;  2HET A;  1MUX A;  2KFG A;  2P70 A;  4GAO A;  4NQG A;  1NPQ A;  3UNW A;  4F7F A;  4OVN F;  4TNC A;  1ZAC A;  3BUO B;  4BY5 A;  2WOS A;  1XFR A;  3B6X A;  1BF5 A;  3CLN A;  3DF0 B;  3R1P A;  3NSI A;  2CTN A;  3PAT A;  2LHL A;  4MBE A;  1K9P A;  2TN4 A;  3S0B A;  3VRR A;  1QJT A;  2KI6 C;  3D77 A;  3D0Y B;  3O4Y A;  4PE1 A;  4YBH B;  5DKN A;  2M7L A;  1OMD A;  2K7O A;  2QPT A;  4PE7 A;  4GFT A;  4INW A;  1TTX A;  1KFX L;  1K9U A;  4PE0 A;  2BNX A;  1W9Z A;  1CNP A;  4KYN A;  5TNC A;  3CZT X;  2L2E A;  1CLB A;  2F33 A;  1IIO A;  1NUB A;  2K2A A;  3NGV A;  4MSP A;  2BCA A;  1DJI A;  1DMO A;  3F45 A;  3AKB A;  1GJY A;  3EKJ A;  4P5O E;  2BEC A;  2IS9 A;  1BR1 B;  4PHN A;  2FOT A;  3NSK A;  1QX2 A;  1PSB A;  1UHI A;  1NSH A;  1F55 A;  2NZ0 A;  3M0W A;  3TUY C;  2BL0 B;  2QDI A;  1JWD A;  1SKT A;  3SS3 A;  1W7I B;  2MJW B;  1B1G A;  2E30 A;  2QEO A;  2KPH A;  3VRQ A;  1TOP A;  1UWO A;  2F8P A;  2KI4 B;  3VRN A;  1PVA A;  1Y1A A;  5K89 A;  1XFV O;  1DJX A;  1S1E A;  1NCX A;  3IF7 A;  5D3O A;  5CSN A;  1U5I B;  3N7H A;  2PSR A;  3D10 A;  1QWV A;  3SG4 A;  5JOL A;  4NDD A;  2JT3 A;  3DY9 A;  1N0Y A;  4YGD B;  1DC1 A;  2L5Y A;  3S0D A;  4JQ0 D;  2Y1M A;  3LCP C;  1SR6 B;  1NWD A;  2WCB A;  1F4O A;  2JOJ A;  2AMI A;  2KBI A;  1OE9 B;  1S36 A;  4YI9 A;  1PSR A;  1SCV A;  4MRX A;  3BUX B;  3HCM A;  3TZ1 A;  1J1D A;  1AK8 A;  1OOI X;  2GGZ A;  2M29 A;  1RTP 1;  2ZN8 A;  4I5K A;  2K7B A;  1NYA A;  1K9K A;  3PAL A;  2LCP A;  1PVB A;  2JWW A;  1QVI Z;  2EC6 B;  5D69 A;  4YGE B;  1D1O A;  2L2C A;  1AP4 A;  3A4U B;  3PM2 A;  5FI6 A;  4I5J A;  1KWO C;  2KAV A;  1C07 A;  1CKK A;  1MXL C;  1QIW A;  1CM1 A;  4HRG A;  1WY9 A;  1B8L A;  2KYC A;  2HPS A;  2KOT A;  1KQV A;  1UUR A;  1LA0 A;  1IG5 A;  2K7C A;  4FTG A;  1NP8 A;  2OTG B;  1K94 A;  2LNK A;  2CNP A;  3I5H B;  3OB1 B;  4Q04 A;  4YRU A;  1DT7 B;  2QEV A;  4UPG A;  1SY9 A;  1XA5 A;  2LAP A;  3FE8 A;  1T14 A;  4C0K A;  2BAP A;  3ICB A; 
#chains in the Genus database with same CATH homology
 1JF0 A;  2G9B A;  1UP5 A;  3ZNI A;  1XVJ A;  1BLQ A;  1YUU A;  3I5G B;  1KFU L;  1ZMZ A;  1CFD A;  2BE4 A;  2V53 A;  1M39 A;  3PN7 B;  1LA3 A;  1QLK A;  3EVR A;  3OB2 B;  3SG5 A;  1PUL A;  3A8R A;  1YR5 A;  1G33 A;  2LM5 A;  1KK8 C;  1S6C A;  1V1F A;  2L5X B;  3D0Y A;  4MZK A;  4D1E A;  2LP3 A;  1CFP A;  2K8M B;  4ORB B;  3VGO A;  1DJY A;  1SNL A;  2JNX A;  1PK0 D;  2O5G A;  4JPZ B;  3WNX B;  1NX0 A;  1S5G Y;  3JVT C;  1K90 D;  3WHT B;  2LVJ A;  1G4Y R;  1UHK A;  2MBX A;  4OKH A;  1CMG A;  5HLV A;  4U8D A;  4PCW A;  1DGV A;  1BMO A;  2LVV A;  3BYA A;  2LAN A;  1PAL A;  2PRU A;  2Q91 A;  1KQM C;  1RFJ A;  3LK1 A;  1JC2 A;  4MEW A;  4R1E A;  1AJ5 A;  2K61 A;  3IQQ A;  1SL7 A;  1L2O C;  4CFR A;  5J3X A;  1IQ5 A;  1WLM A;  4ETO A;  1WRK A;  3KF9 A;  1MHO A;  1F71 A;  5ER4 X;  4ZCU A;  1DTL A;  2HQ8 A;  1U5I A;  1XFZ O;  3SG6 A;  1MXE A;  1TCO B;  1A2X A;  2O60 A;  1ALW A;  3OHM B;  2Q4U A;  3KO0 A;  1QV0 A;  4PAL A;  2Y1N A;  3OX5 A;  4GGN A;  1FPW A;  1G8I A;  1GQM A;  5HKW A;  1QAS A;  4OCI A;  2MAZ A;  1SCM B;  1M45 A;  2F3Z A;  2BKI B;  1XK4 A;  2KFF A;  1A4P A;  2JU0 A;  4ORC B;  1YVH A;  1QVI Y;  1XFW O;  1KCY A;  1BU3 A;  1B8R A;  2G2B A;  2COL B;  1B7T Y;  3VRO A;  2ZFD A;  2ZRT A;  1QX7 A;  3I5F B;  3O78 A;  3PSR A;  5KTY A;  2F2P A;  1IGV A;  3O2P A;  1J7O A;  2AUC A;  4DUQ A;  1V1G A;  4I5N B;  3IQO A;  4P2Y B;  2BBM A;  1UHN A;  2I94 A;  1MWN A;  1YVL A;  1C7W A;  2I2R E;  2KHN A;  4PHM A;  1JFK A;  2CCM A;  1EXR A;  2KDH A;  2VRG A;  2MLF C;  1KFX S;  2WND A;  2LVK A;  1EG3 A;  5AER A;  1FBV A;  1UHJ A;  1IRJ A;  2KNE A;  3LK0 A;  1YRT B;  2JTZ A;  2EHB A;  3WXA A;  1X02 A;  1K2H A;  4DIR A;  4CFQ A;  2ZNE A;  2BL0 C;  4GGF A;  1OSA A;  2L4H A;  2SCP A;  4GUK A;  4PDZ A;  5FYX A;  3SG2 A;  2M9G A;  1Y6W A;  3E3R A;  1J55 A;  1QV1 A;  1AUI B;  2JZI A;  2KGR A;  3EKH A;  1IQ3 A;  1A29 A;  2JUL A;  1JSA A;  1FF1 A;  1CTR A;  1DJH A;  2H61 A;  5CPV A;  1TNP A;  1M46 A;  4CPV A;  1YX8 A;  1CFC A;  1YTZ C;  2F2O A;  1OZO A;  5PAL A;  2P6B B;  1SR6 C;  2ZND A;  2M0R A;  2QAC A;  2H2K A;  2Y4Q A;  1DF0 B;  2DOQ A;  1TNW A;  2LUC A;  3PLF B;  2NLN A;  1KK7 Y;  3AAJ A;  3K21 A;  1LKJ A;  1J7R A;  1DGU A;  1QTX A;  2PMY A;  4CLN A;  2L98 A;  2CBL A;  3QRX A;  2MA2 A;  4N1F A;  2LV7 A;  3GOF A;  2EC6 C;  1BJF A;  1A75 A;  2E6W A;  2B1U A;  4DS7 A;  2KI6 D;  5D7F A;  1YUR A;  1KSM A;  1K96 A;  3CTN A;  2WC8 A;  4GBA A;  1K93 D;  1EH2 A;  4N1G A;  4HSZ A;  1SL9 A;  1WRZ A;  4M2P A;  2OS8 B;  4QJ3 B;  4USL A;  1HT9 A;  1K95 A;  3SIB A;  2LMV A;  4BY4 A;  5AFP A;  2ZRS A;  4YGA A;  1XFX O;  3CR4 X;  1NX2 A;  3GK4 X;  3JTD B;  1F54 A;  4CID A;  2KBM A;  5KU1 A;  1ZUZ A;  4NDB A;  2Y5I A;  4GGF C;  3EK4 A;  2CXJ A;  2ZN9 A;  3AKA A;  3NSO A;  4MLW A;  3I5G C;  3WHU B;  4NDC A;  3I5I B;  1EL4 A;  1NX1 A;  3PM8 A;  1F8H A;  2I18 A;  1AVS A;  1OQP A;  3KHE A;  5HKY A;  4A4C A;  3PN7 C;  2M97 A;  1CDN A;  1KFU S;  3TS5 C;  2EGD A;  4YI8 A;  1ZFS A;  2M7N A;  5G08 A;  3LL8 B;  5HKZ A;  2LC5 A;  3SG7 A;  1TCF A;  3TDI A;  1N65 A;  1CDM A;  1WDC B;  4IL1 A;  1A75 B;  1LIN A;  3BUN B;  2K0J A;  4ZCV A;  2NCO A;  1YRU B;  1TNQ A;  1R6P A;  1MQ1 A;  4E68 A;  2KAY A;  2PAS A;  5HLO A;  5DKR A;  3PFV A;  3H4S E;  2FCE A;  2JRF A;  3FWB A;  2LUX A;  1BG1 A;  1CM4 A;  1RJV A;  1DJZ A;  4MVF A;  3FS7 A;  3FIA A;  1OOJ A;  2KFH A;  2A4J A;  4N5X A;  4XJK B;  5AXI A;  4YGC B;  1J1E A;  2KQY A;  3HX4 A;  1LVC D;  5HYD A;  2M1U A;  5GQQ C;  2GV5 A;  5BPJ A;  2AAO A;  3GK1 A;  1IWQ A;  1C7V A;  1JBA A;  1CLL A;  1CDL A;  1NCY A;  1EJ3 A;  2JXC A;  1S6J A;  1H8B A;  2L4I A;  2RGI A;  5I2O A;  3BOW B;  4PHK A;  3DVK A;  1KSO A;  1TIZ A;  2BCX A;  5ER5 A;  4MN0 A;  4MRY A;  4XYN A;  4AQI A;  3BUM B;  1TN4 A;  4WRI A;  1A03 A;  1ZOT B;  2FJU B;  1GGW A;  5IBW A;  1XYD A;  5DKQ A;  1RRO A;  5I2L A;  1BOD A;  2LLS A;  1SCM C;  4JWQ A;  4MZJ A;  1DF0 A;  3TUY B;  1H4B A;  2KSP A;  2L0P A;  3ZWH A;  1F4Q A;  4FQO A;  3RLZ A;  4PHJ A;  3O6B A;  1M63 B;  1Y1X A;  2JQ6 A;  1J7P A;  1S5G Z;  1Y0V H;  3I5F C;  2OPO A;  4ICB A;  1QXP A;  1FI5 A;  2K7D A;  2JT8 A;  2GGM A;  3CS1 A;  4OV2 A;  1FW4 A;  2NXQ A;  3CR2 A;  1EG4 A;  2JNF A;  2KI4 C;  4I5L B;  1NCZ A;  1YUS A;  5KSZ A;  1IJ5 A;  2MRD A;  1SK6 D;  4GNK B;  3BXK A;  5CSI A;  5AAN A;  3BQ3 A;  2WOR A;  4A4B A;  4YGB B;  2HF5 A;  3VRP A;  3FWC A;  1UHH A;  2F3Y A;  1JUO A;  1QLS A;  1XFY O;  2BCB A;  1RK9 A;  2JPT A;  1R2U A;  4AQJ A;  1MF8 B;  4QJ5 B;  1W7J B;  2LLU A;  3CWG A;  3GK2 A;  1DJW A;  4AOM A;  5I8N A;  1E8A A;  2JXL A;  4DCK A;  1VRK A;  2LP2 A;  3RM1 A;  1FI6 A;  3C1V A;  4DRW A;  1XK4 C;  3TDU A;  4GPL B;  3OX6 A;  4M2Q A;  3KEV A;  1KWO B;  2KAX A;  2D8N A;  2LMU A;  1CB1 A;  2R2I A;  3BUW B;  3SIA A;  3DVM A;  1DJG A;  2JT0 A;  2LVI A;  1QS7 A;  1ALV A;  3NXA A;  2WCF A;  1IH0 A;  1N2D A;  3OP0 A;  1UUS A;  2M3W A;  1B9A A;  1WRL A;  2PAL A;  2K2F A;  3EVV A;  4HRH A;  4C0J A;  1Y1U A;  2KQ6 A;  1XO5 A;  3DVJ A;  1ODB A;  1B7T Z;  1B47 A;  1SL8 A;  2L50 A;  1IKU A;  1M31 A;  2SAS A;  1BR4 B;  1CLM A;  1BT6 A;  2OTG C;  2ZKM X;  3I5H C;  2LHI A;  1BOC A;  1SW8 A;  1SPY A;  1S6I A;  1TRF A;  4ORA B;  4XJK A;  1KK8 B;  2MLE C;  1AJ4 A;  1TNX A;  2JC2 A;  2M8U A;  2HQW A;  4F0Z B;  1B8C A;  1QIV A;  1Q80 A;  1YX7 A;  1JFJ A;  2FCD A;  1REC A;  2NCP A;  2PVB A;  1MR8 A;  1L7Z A;  1NX3 A;  1QX5 B;  3JVT B;  2OS8 C;  2WCE A;  3KPX A;  3BOW A;  1J7Q A;  2LE9 B;  5JJG A;  3EK8 A;  3DF0 A;  5AEQ A;  2LMT A;  1NIW A;  2BKH B;  2L51 A;  2H61 C;  3CGA A;  1CFF A;  3TS5 B;  3JTD C;  3AAK A;  1SMG A;  4WQ2 A;  1IJ6 A;  1XFU O;  2KYF A;  2M49 B;  3MSE B;  4OR9 B;  4PE4 A;  1KQM B;  2CT9 A;  1B4C A;  1OZS A;  5CSF A;  1OMR A;  1PRW A;  1RWY A;  2JTT A;  3LLE A;  3I5I C;  2BBN A;  1K8U A;  3DVE A;  3EK7 A;  1YUT A;  4QJ4 B;  3TDZ A;  1F70 A;  1L2O B;  1S26 D;  1S3P A;  4L9M A;  4M2O A;  1OMV A;  1GGZ A;  1WLZ A;  5B8I B;  1AHR A;  2I7A A;  2BE6 A;  1CMF A;  1DVI A;  3EVU A;  5F6T A;  1QAT A;  3CR5 X;  3SG3 A;  1SBJ A;  2MHH A;  1SYM A;  1SRA A;  4HRE E;  4WQ3 A;  1WDC C;  4MZL A;  3DD4 A;  1HQV A;  2KGB C;  1KK7 Z;  2M1K B;  5I2Q A;  3SJS A;  1LXF C;  2LLT A;  3NSL A;  2ISD A;  4C0L A;  1JF2 A;  1CDP A;  2HET A;  1MUX A;  2KFG A;  4GAO A;  4NQG A;  1NPQ A;  4OVN F;  4TNC A;  1ZAC A;  3BUO B;  4BY5 A;  2WOS A;  1BF5 A;  3CLN A;  3DF0 B;  3NSI A;  2CTN A;  3PAT A;  2LHL A;  4MBE A;  1K9P A;  2TN4 A;  3VRR A;  1QJT A;  2KI6 C;  3O4Y A;  3D0Y B;  4YBH B;  4PE1 A;  5DKN A;  2M7L A;  1OMD A;  2K7O A;  2QPT A;  4PE7 A;  4GFT A;  1TTX A;  1KFX L;  1K9U A;  4PE0 A;  1CNP A;  5TNC A;  3CZT X;  2L2E A;  1CLB A;  2F33 A;  1NUB A;  2K2A A;  4MSP A;  2BCA A;  1DJI A;  1DMO A;  3F45 A;  3AKB A;  1GJY A;  3EKJ A;  4P5O E;  2BEC A;  2IS9 A;  1BR1 B;  4PHN A;  2FOT A;  3NSK A;  1QX2 A;  1PSB A;  1UHI A;  1NSH A;  1F55 A;  2NZ0 A;  3M0W A;  3TUY C;  2BL0 B;  1JWD A;  1SKT A;  1W7I B;  2MJW B;  1B1G A;  2E30 A;  3VRQ A;  1TOP A;  1UWO A;  2F8P A;  2KI4 B;  3VRN A;  1PVA A;  1Y1A A;  5K89 A;  1XFV O;  1DJX A;  1S1E A;  1NCX A;  3IF7 A;  5CSN A;  1U5I B;  2PSR A;  3D10 A;  3SG4 A;  5JOL A;  4NDD A;  2JT3 A;  1N0Y A;  4YGD B;  4JQ0 D;  2Y1M A;  3LCP C;  1SR6 B;  1NWD A;  2WCB A;  1F4O A;  2JOJ A;  2AMI A;  2KBI A;  1OE9 B;  1S36 A;  4YI9 A;  1PSR A;  1SCV A;  4MRX A;  3BUX B;  3HCM A;  3TZ1 A;  1J1D A;  1AK8 A;  2GGZ A;  2M29 A;  1RTP 1;  2ZN8 A;  4I5K A;  2K7B A;  1NYA A;  1K9K A;  3PAL A;  2LCP A;  1PVB A;  2JWW A;  1QVI Z;  2EC6 B;  5D69 A;  4YGE B;  1D1O A;  1AP4 A;  3A4U B;  4I5J A;  1KWO C;  2KAV A;  1C07 A;  1CKK A;  1MXL C;  1QIW A;  1CM1 A;  4HRG A;  1WY9 A;  1B8L A;  2KYC A;  2HPS A;  2KOT A;  1KQV A;  1UUR A;  1LA0 A;  1IG5 A;  2K7C A;  4FTG A;  1NP8 A;  2OTG B;  1K94 A;  2LNK A;  2CNP A;  3I5H B;  3OB1 B;  4Q04 A;  4YRU A;  1DT7 B;  4UPG A;  1SY9 A;  1XA5 A;  2LAP A;  5CSJ A;  4C0K A;  3ICB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...