1M45A

Crystal structure of mlc1p bound to iq2 of myo2p, a class v myosin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
146
structure length
142
Chain Sequence
b'TRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINASLASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain
publication title Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle protein
total genus 36
structure length 142
sequence length 146
ec nomenclature
pdb deposition date 2002-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m45A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m45A01
1QASA 1SCMB 1KQVA 1G33A 2KDHA 4R1EA 3EK4A 2CT9A 1CLBA 2EC6C 2M7NA 4PE4A 5D69A 1SR6C 4MRXA 1J7PA 1QV0A 5KSZA 2TN4A 2F3ZA 4NDDA 2M7LA 5I8NA 1PSBA 2LVVA 1DF0B 2K7OA 4P2YB 1KFUL 3LCPC 3BUWB 1PULA 1ZACA 3OP0A 2ZKMX 3BUMB 3CWGA 1TNWA 4I5LB 2Y1NA 3DVKA 4ICBA 2M1UA 2QPTA 2P6BB 2QACA 2MHHA 2CXJA 5GQQC 4XJKB 3WHUB 3PALA 2F8PA 2BBNA 3PFVA 2CBLA 4BY4A 3RM1A 2LCPA 5HYDA 1YVHA 3GK2A 5HLVA 2M9GA 5AXIA 4GGFC 1SNLA 1F4OA 2L51A 3KHEA 3BUOB 5DKRA 1RECA 1TN4A 1BMOA 2F3YA 2JQ6A 3I5FB 2BKHB 1R2UA 1GGZA 1DGVA 3EKJA 1NX0A 1IRJA 3VRRA 1MUXA 4CPVA 4OV2A 3A8RA 4MRYA 1XFUO 1K94A 4CIDA 1AJ4A 3PM8A 3AKBA 1FW4A 2ZN9A 4M2PA 2JOJA 3SG5A 1SL9A 1F54A 2NXQA 1IG5A 3GK4X 2ISDA 1IGVA 3EK8A 2LAPA 4ORCB 3I5IC 2GV5A 4PDZA 2K7BA 1KQMC 2BBMA 5HKZA 5TNCA 2KFFA 2KAVA 2LVIA 1L7ZA 1KFUS 1OMRA 1Y0VH 3SJSA 1YVLA 1D1OA 1NYAA 1QLKA 2H61A 2ZNDA 1B8RA 1X02A 2K2FA 2Y4QA 1JWDA 2IS9A 4AOMA 2L4IA 2JTTA 2OS8C 2I18A 3D0YB 4GPLB 4PHMA 2WORA 3CLNA 4CFRA 1HQVA 2VRGA 1RTP1 2JULA 3FIAA 1RK9A 2ZN8A 4GAOA 3DVJA 2KAXA 1XYDA 3TZ1A 1S6IA 3BXKA 3PN7C 2JNXA 4WRIA 2K7CA 2JC2A 5DKNA 4MN0A 4YGDB 2L5XB 2LV7A 3BOWA 2L4HA 1TNQA 5HKWA 3I5HC 2KGBC 1BR4B 3FWBA 2FOTA 2CTNA 1M39A 4PCWA 1SBJA 1U5IB 3ZWHA 3TUYC 1CLLA 3O78A 1CDPA 3BQ3A 1SCVA 1GJYA 2O5GA 3ZNIA 1E8AA 2COLB 4D1EA 1UWOA 3GK1A 1A75B 2GGMA 2CCMA 2PVBA 2JPTA 4HRHA 1SY9A 1W7JB 1BU3A 1OE9B 2M1KB 2LANA 1XFZO 3SG6A 2MJWB 1SW8A 1YX8A 2KFGA 1LKJA 1W7IB 3WXAA 1CFPA 1AUIB 5ER5A 4QJ5B 4PE0A 3M0WA 1SKTA 1MXLC 4E68A 1KFXL 1QX7A 1NCXA 3LK0A 2KI6D 3NXAA 1NWDA 4FQOA 3NSLA 3KF9A 3SG3A 1CDLA 2LP3A 1DF0A 3QRXA 1JBAA 3AKAA 1XK4A 2JT3A 1TRFA 2KI4C 2JXLA 1CKKA 2MAZA 2HETA 3JVTB 1F8HA 1RROA 1WDCB 2ZRSA 1AJ5A 1K90D 1M46A 1QIWA 1UHJA 2ZRTA 4MZKA 4XJKA 4AQJA 4AQIA 1F70A 1N2DA 3SG4A 1H4BA 1IH0A 2EC6B 2NZ0A 3PLFB 5CSNA 3OX5A 2PMYA 3WNXB 1JC2A 1NX3A 5FYXA 1KSMA 4ZCUA 2GGZA 4A4CA 3TS5C 4C0JA 1N0YA 1NIWA 1Y1XA 2M8UA 1EL4A 3SG2A 2LNKA 1K9PA 3NSKA 1YX7A 3TDZA 3H4SE 1ZFSA 1PK0D 1UHNA 3VRQA 2K61A 1UUSA 3CR4X 1A29A 2BL0C 1K95A 1SMGA 1JF2A 5CSJA 1B1GA 2JNFA 3LL8B 2MRDA 3FS7A 4ORBB 2MBXA 5F6TA 1SCMC 1DJGA 2KBIA 1S3PA 1NX1A 3VRPA 1WRZA 2JXCA 2V53A 4GBAA 4P5OE 1S5GZ 1YRTB 2BCXA 1MQ1A 5JOLA 5ER4X 2LVJA 2K2AA 2M3WA 3KO0A 1KK7Z 1KSOA 1OOJA 1RFJA 1KFXS 4YI9A 2HPSA 1XK4C 4Q04A 3EVRA 1CFFA 2KBMA 1DJIA 4MLWA 2O60A 1CLMA 2JU0A 4YGBB 2L50A 4MZLA 1QX2A 3A4UB 2WOSA 4CLNA 1IQ3A 1BR1B 3C1VA 1QIVA 3I5GC 1JUOA 3WHTB 2M49B 1B47A 1LXFC 3D0YA 5KU1A 1CDNA 1EG3A 1PVAA 2LLUA 2PSRA 1HT9A 3I5IB 1B9AA 1S5GY 1V1FA 2BE6A 2D8NA 4TNCA 1KK7Y 5IBWA 1IWQA 2KFHA 1XVJA 1CB1A 2HF5A 2JT8A 1FBVA 2G9BA 3PATA 2SCPA 4CFQA 4ZCVA 1BODA 2I2RE 1EH2A 2L2EA 1B7TZ 1L2OC 4DUQA 2AMIA 1NCYA 2KYFA 2KNEA 1MWNA 1BG1A 1BOCA 5AANA 1XFXO 4BY5A 1TCOB 3LK1A 1U5IA 5AFPA 1XO5A 2WCFA 2ZNEA 1AVSA 2KAYA 2LMVA 1NCZA 2I94A 1M63B 3PN7B 2WCEA 2ZFDA 3CS1A 3JTDC 3CGAA 4UPGA 3IQOA 1A75A 2K8MB 2LC5A 4HRGA 2AAOA 1C7WA 1MHOA 1UURA 2BE4A 2JWWA 1KK8C 3OHMB 1Q80A 1JSAA 2KSPA 2M0RA 4OCIA 4DRWA 1G8IA 1IJ5A 1DVIA 1PRWA 3O4YA 3TUYB 4I5NB 3AAJA 1UP5A 4FTGA 2EGDA 5G08A 1KWOB 1K96A 1JFJA 1WY9A 1B8CA 3EK7A 1CFCA 3BYAA 1SPYA 3DF0B 2LMTA 1A03A 1CFDA 3E3RA 3CR2A 1NP8A 4L9MA 2LP2A 2E30A 1N65A 4OKHA 3CZTX 1AP4A 1FI5A 1UHHA 1S26D 1K93D 2RGIA 1XFVO 5KTYA 2H61C 1Y6WA 1RJVA 3CR5X 4ORAB 5I2OA 4PHKA 1TIZA 2KQYA 2KI6C 2F33A 5JJGA 1ZMZA 4GNKB 1SL8A 1CMGA 2BCBA 4MEWA 2WCBA 1QV1A 5B8IB 4I5JA 4HSZA 1S6JA 1WLZA 5AEQA 1DT7B 1KCYA 5I2QA 4XYNA 4WQ2A 2JTZA 3SIBA 5CSFA 2LLSA 1JF0A 3MSEB 1SL7A 1K9UA 4GFTA 4N1FA 1SYMA 3KEVA 4PALA 1G4YR 2KYCA 3AAKA 4QJ3B 3O2PA 4C0LA 2Y5IA 1SR6B 2JZIA 1BT6A 1YUUA 4GGFA 4DS7A 1QXPA 3VGOA 4GGNA 1NX2A 1YURA 1J55A 1YRUB 2NLNA 1ODBA 2OTGC 1OMDA 2HQ8A 1K8UA 1LVCD 4F0ZB 1OSAA 1DJXA 2PALA 1J7RA 1ZOTB 2BL0B 2K7DA 1F4QA 3IQQA 3SG7A 1ALWA 3EVUA 1QLSA 1QATA 1TCFA 2R2IA 1MXEA 3D10A 3HCMA 1XA5A 1IQ5A 1DJZA 1BF5A 1C07A 1Y1AA 2WC8A 1FF1A 5BPJA 1V1GA 3BUXB 3NSOA 1J1EA 2FCEA 3LLEA 4JPZB 2DOQA 1NUBA 1A2XA 1GGWA 2LM5A 4NDCA 1DTLA 2NCPA 1DMOA 1DJWA 1OQPA 1ZUZA 1OZOA 1YUTA 2MA2A 3I5GB 1QVIZ 4NDBA 4YBHB 1F71A 2KOTA 1AK8A 1IJ6A 1YTZC 1TNXA 3ICBA 2LE9B 4HREE 1KQMB 2FJUB 3EVVA 3VROA 2LLTA 1ALVA 1S6CA 3I5FC 1DGUA 2BECA 3BUNB 1J7QA 2A4JA 3DD4A 4M2QA 4YGEB 5I2LA 4YRUA 4PE7A 1M45A 1FI6A 1RWYA 1L2OB 2BKIB 4PHNA 1SK6D 1QS7A 5J3XA 1YR5A 1QX5B 1S36A 1MF8B 4OR9B 2JT0A 1QVIY 2OS8B 3NSIA 2KHNA 3DVMA 3O6BA 2F2OA 4IL1A 2PASA 2EHBA 2Q4UA 1AHRA 1BLQA 1PALA 2OPOA 2L98A 4DCKA 1B8LA 4MVFA 3JTDB 2PRUA 1CM4A 1LINA 2CNPA 3DF0A 1M31A 1K2HA 2K0JA 2I7AA 3FWCA 3K21A 1K9KA 4A4BA 1KK8B 1WRLA 2FCDA 2M29A 2BCAA 4WQ3A 2LHIA 3I5HB 3OB1B 1B7TY 1QJTA 1PVBA 1CMFA 1DJHA 1TNPA 3OX6A 4ETOA 4JQ0D 4PE1A 1CDMA 4N1GA 3SIAA 1JFKA 2MLFC 4YGCB 2Q91A 5D7FA 1DJYA 1YUSA 4QJ4B 2LHLA 4GUKA 4DIRA 2NCOA 4I5KA 5DKQA 1J7OA 2KGRA 1QTXA 2KQ6A 1UHKA 3DVEA 4MSPA 2WNDA 5CSIA 1WRKA 1H8BA 1A4PA 5CPVA 1EG4A 2LVKA 1B4CA 1OZSA 1CNPA 3F45A 3KPXA 4NQGA 1C7VA 2HQWA 4JWQA 4N5XA 1XFWO 3GOFA 3PSRA 1BJFA 3IF7A 1SRAA 2SASA 3VRNA 1IKUA 5K89A 1XFYO 2G2BA 2H2KA 1OMVA 2LUXA 1KWOC 1NSHA 2MLEC 4YI8A 3TDIA 1UHIA 2M97A 3TDUA 1LA0A 1PSRA 2KI4B 1TTXA 4M2OA 2E6WA 3EKHA 1FPWA 1EXRA 3BOWB 4U8DA 5HLOA 5PALA 2L0PA 1CTRA 4MZJA 1F55A 4YGAA 1NPQA 3CTNA 1WLMA 1MR8A 1S1EA 4PHJA 3TS5B 1R6PA 2F2PA 2LMUA 2JRFA 4USLA 5AERA 4C0KA 2AUCA 2OTGB 3HX4A 5HKYA 1CM1A 1J1DA 1GQMA 3RLZA 4MBEA 2B1UA 3OB2B 2Y1MA 1LA3A 2LUCA 1TOPA 1EJ3A 1VRKA 4OVNF 3JVTC 1Y1UA 1WDCC
chains in the Genus database with same CATH superfamily
1QASA 1SCMB 3BJHA 1KQVA 2JPOA 1G33A 2KDHA 4R1EA 3EK4A 5D3OA 2CT9A 1CLBA 2EC6C 2M7NA 4PE4A 5D69A 1SR6C 4F7FA 4MRXA 1J7PA 3R72A 1QV0A 5KSZA 2TN4A 4IJ7A 2F3ZA 4NDDA 2M7LA 5I8NA 1PSBA 2LVVA 1DF0B 2K7OA 4P2YB 1KFUL 3LCPC 3BUWB 1PULA 1ZACA 3OP0A 2ZKMX 3BUMB 3CWGA 1TNWA 4I5LB 2Y1NA 3DVKA 4ICBA 2M1UA 2QPTA 2P6BB 2QACA 2MHHA 2CXJA 5GQQC 4XJKB 3WHUB 3PALA 2F8PA 2L5YA 2BBNA 3PFVA 3DY9A 2CBLA 4BY4A 2WCKA 3RM1A 2LCPA 5HYDA 1YVHA 3GK2A 5HLVA 2M9GA 3DYEA 5AXIA 4GGFC 1SNLA 1F4OA 2L51A 3KHEA 3BUOB 5DKRA 1RECA 1TN4A 1BMOA 2F3YA 2JQ6A 3I5FB 2BKHB 1R2UA 1GGZA 1DGVA 3EKJA 1NX0A 1Z4HA 1IRJA 3Q8IA 3VRRA 2WCJA 2PYQA 1MUXA 4CPVA 4OV2A 2QEVA 3A8RA 4MRYA 1XFUO 1K94A 4CIDA 1AJ4A 3PM8A 3R1VA 4JD9A 3AKBA 3FE9A 1FW4A 2ZN9A 4M2PA 2JOJA 3SG5A 1SL9A 1F54A 2NXQA 1IG5A 3GK4X 2ISDA 1IGVA 3EK8A 2LAPA 4ORCB 3I5IC 2GV5A 4PDZA 2K7BA 1KQMC 3SS4A 2BBMA 5HKZA 5TNCA 2KFFA 3DZTA 2KAVA 2LVIA 1L7ZA 4PT1A 1KFUS 1OMRA 1Y0VH 3SJSA 1YVLA 1D1OA 1NYAA 3S0DA 1QLKA 2H61A 2ZNDA 1B8RA 1X02A 2K2FA 2Y4QA 3FE6A 2IS9A 4AOMA 1JWDA 2L4IA 2JTTA 2OS8C 2I18A 3D0YB 4GPLB 3L4AA 2WORA 3CLNA 4PHMA 4CFRA 1HQVA 3DXLA 2VRGA 1RTP1 2JULA 3FIAA 1RK9A 2ZN8A 4GAOA 1DC1A 3DVJA 2KAXA 1XYDA 3TZ1A 1S6IA 3BXKA 3PN7C 2KLDA 2JNXA 4WRIA 2K7CA 2JC2A 5DKNA 4MN0A 4YGDB 2L5XB 2LV7A 3BOWA 2L4HA 3FE8A 1TNQA 5HKWA 3I5HC 2KGBC 1BR4B 3FWBA 2FOTA 2CTNA 1W9ZA 1M39A 2QEOA 4PCWA 1SBJA 3RZSA 1U5IB 2FJYA 3ZWHA 3TUYC 1CLLA 3O78A 1CDPA 3BQ3A 1SCVA 1GJYA 2O5GA 3ZNIA 5FI6A 1E8AA 2COLB 4D1EA 1UWOA 3GK1A 1A75B 2GGMA 2CCMA 2PVBA 2JPTA 4HRHA 1SY9A 1W7JB 3CYZA 1BU3A 1IIOA 1OE9B 2M1KB 2LANA 1XFZO 3SG6A 2MJWB 1SW8A 1YX8A 2KFGA 1LKJA 1W7IB 3WXAA 1CFPA 1AUIB 5ER5A 3D76A 4QJ5B 4PE0A 3M0WA 1SKTA 1MXLC 4E68A 1KFXL 1QX7A 1NCXA 3LK0A 2KI6D 3NXAA 1NWDA 4FQOA 3NSLA 5DICA 3KF9A 3SG3A 1CDLA 2LP3A 1DF0A 3QRXA 1JBAA 3AKAA 1XK4A 2JT3A 1TRFA 2KI4C 2JXLA 3N7HA 2MAZA 1CKKA 2HETA 3JVTB 1C3YA 1F8HA 1RROA 1WDCB 2ZRSA 1AJ5A 1K90D 1M46A 1QIWA 1UHJA 2ZRTA 4MZKA 4XJKA 4AQJA 4AQIA 1F70A 1N2DA 3SG4A 1H4BA 1IH0A 2EC6B 2NZ0A 3PLFB 3D77A 4KYNA 5CSNA 3OX5A 2PMYA 3WNXB 3OBVA 1JC2A 1NX3A 1P28A 5FYXA 1KSMA 3BFAA 4ZCUA 2GGZA 4A4CA 3TS5C 4C0JA 1N0YA 1NIWA 1Y1XA 2M8UA 1EL4A 3SG2A 2LNKA 1K9PA 3NSKA 1TUZA 1YX7A 3L47A 3TDZA 3H4SE 1ZFSA 1PK0D 1UHNA 3VRQA 1QWVA 2K61A 1UUSA 3CR4X 1A29A 2BL0C 1K95A 1SMGA 5EL2A 1JF2A 5CSJA 3V2LA 1B1GA 2JNFA 3LL8B 2MRDA 3FS7A 3BFBA 3OGNA 4ORBB 5F6TA 1SCMC 1DJGA 2KBIA 1DELA 1NX1A 1S3PA 3VRPA 1GM0A 1WRZA 2JXCA 2V53A 4GBAA 4P5OE 2KLEA 2WCMA 5FI7A 1S5GZ 1YRTB 2BCXA 1MQ1A 5JOLA 5ER4X 2LVJA 5FI2A 2K2AA 2M3WA 3KO0A 1KK7Z 1KSOA 1OOJA 1RFJA 1KFXS 4YI9A 2HPSA 1XK4C 4Q04A 3EVRA 1CFFA 2KBMA 3S0FA 1DJIA 4MLWA 2O60A 1CLMA 2JU0A 4YGBB 2L50A 2BNXA 4OZDA 4MZLA 1QX2A 3A4UB 2WOSA 3CZ1A 3D75A 4CLNA 1IQ3A 1BR1B 3C1VA 1QIVA 3I5GC 1JUOA 3WHTB 2M49B 1B47A 1LXFC 3D0YA 3EG5B 5KU1A 1CDNA 1EG3A 1PVAA 2LLUA 2PSRA 1HT9A 3I5IB 1B9AA 1S5GY 1V1FA 4INXA 2BE6A 3K1EA 2D8NA 4TNCA 1KK7Y 5IBWA 1IWQA 2KFHA 1XVJA 1CB1A 2HF5A 2JT8A 1FBVA 2G9BA 3PATA 2SCPA 3B87A 4CFQA 1XFRA 4ZCVA 1BODA 2I2RE 2BAPA 1EH2A 2L2EA 1B7TZ 1L2OC 4DUQA 2AMIA 1NCYA 2KYFA 2KNEA 1MWNA 3VB1A 1BG1A 1BOCA 5AANA 1XFXO 3L4LA 4BY5A 1TCOB 3LK1A 1U5IA 1DEKA 5AFPA 1XO5A 2KPHA 3PJIA 2WCFA 2ZNEA 1AVSA 1LS8A 2KAYA 2LMVA 1NCZA 2I94A 1M63B 2QEHA 2P70A 3PN7B 2WCEA 2WC5A 2ZFDA 1OOGA 3CS1A 3JTDC 3CGAA 3SS3A 4UPGA 3IQOA 1A75A 2K8MB 2LC5A 4HRGA 2AAOA 1C7WA 1MHOA 1UURA 2BE4A 2JWWA 1KK8C 3OHMB 1Q80A 1JSAA 2KSPA 3B88A 4INWA 2M0RA 4OCIA 4DRWA 1G8IA 1IJ5A 1DVIA 1PRWA 3O4YA 2P71A 3TUYB 4I5NB 3AAJA 1UP5A 4FTGA 3SS5A 2EGDA 5G08A 1KWOB 1K96A 1JFJA 1WY9A 1B8CA 3EK7A 1CFCA 3BYAA 3CDNA 1SPYA 3DF0B 2LMTA 1A03A 1CFDA 3E3RA 3CR2A 1NP8A 4L9MA 2LP2A 3S0EA 2E30A 1N65A 4OKHA 3CZTX 3UO9A 1AP4A 1FI5A 1UHHA 1S26D 1K93D 2RGIA 1XFVO 4JKTA 5KTYA 2H61C 1Y6WA 1RJVA 3CR5X 4ORAB 5I2OA 1SSEB 4PHKA 1TIZA 2KQYA 2KI6C 2F33A 5JJGA 1ZMZA 4GNKB 1SL8A 1CMGA 2BCBA 1DQEA 4MEWA 2WCBA 1QV1A 5B8IB 4I5JA 4HSZA 1S6JA 2K60A 1WLZA 5AEQA 1DT7B 1KCYA 5I2QA 4XYNA 1OOIX 3IVTA 4WQ2A 2JTZA 3SIBA 5CSFA 2LLSA 1JF0A 3MSEB 1SL7A 1K9UA 4GFTA 4N1FA 1SYMA 3KEVA 4PALA 1G4YR 2KYCA 3AAKA 4QJ3B 3O2PA 4C0LA 3QMEA 3S0AA 2Y5IA 1SR6B 3NHTA 2JZIA 1BT6A 1YUUA 4GGFA 4DS7A 1QXPA 1OW4A 3VGOA 4GGNA 1NX2A 1YURA 1J55A 2H8VA 1YRUB 2NLNA 1ODBA 2OTGC 3S0BA 1OMDA 2HQ8A 1K8UA 1LVCD 3B6XA 1OOHA 3PM2A 4F0ZB 1OSAA 2WC6A 1DJXA 2PALA 1J7RA 5HL1A 1ZOTB 2BL0B 2K7DA 1F4QA 3IQQA 3SG7A 1ALWA 3EVUA 1QLSA 1ORGA 1C3ZA 1QATA 1TCFA 2R2IA 1MXEA 3D10A 3HCMA 1XA5A 1IQ5A 3NHIA 1DJZA 1BF5A 1C07A 1Y1AA 2WC8A 1FF1A 5BPJA 1V1GA 3BUXB 3D74A 3NSOA 1J1EA 2FCEA 3LLEA 4JPZB 2DOQA 1NUBA 1A2XA 2PQLA 1GGWA 2LM5A 4NDCA 1DTLA 2NCPA 1DMOA 1DJWA 1OQPA 1ZUZA 2YGUA 1OZOA 1YUTA 2MA2A 3I5GB 1QVIZ 3R1PA 4NDBA 4YBHB 1F71A 2KOTA 2QEBA 1AK8A 3B86A 1IJ6A 1YTZC 1TNXA 3ICBA 2LE9B 4HREE 1KQMB 2FJUB 3EVVA 3VROA 2LLTA 1ALVA 1S6CA 3I5FC 1DGUA 2BECA 3D73A 3O4XA 3BUNB 1J7QA 2A4JA 3DD4A 4M2QA 4YGEB 5I2LA 4YRUA 4PE7A 1M45A 1FI6A 1RWYA 1L2OB 2BKIB 4PHNA 1SK6D 1QS7A 5J3XA 1YR5A 1QX5B 1S36A 1Z2CB 1MF8B 4OR9B 2JT0A 1QVIY 2OS8B 3NSIA 3CZ2A 2KHNA 3DVMA 3O6BA 2MBXA 2F2OA 3CABA 4FQTA 4IL1A 2PASA 2EHBA 2Q4UA 1AHRA 1BLQA 1PALA 2OPOA 3S0GA 2L98A 4DCKA 1B8LA 4MVFA 3JTDB 2PRUA 1CM4A 1LINA 2CNPA 3DF0A 1M31A 1K2HA 2K0JA 2I7AA 3FWCA 3R1OA 3K21A 1K9KA 1T14A 4A4BA 1KK8B 1WRLA 2FCDA 2M29A 2BCAA 4WQ3A 2LHIA 3I5HB 3OB1B 1B7TY 1QJTA 1PVBA 1CMFA 1DJHA 1TNPA 3OX6A 4ETOA 4JQ0D 4PE1A 1CDMA 4N1GA 3SIAA 1JFKA 2MLFC 4YGCB 2Q91A 5D7FA 1DJYA 1YUSA 4QJ4B 2LHLA 4GUKA 4DIRA 1OOFA 2NCOA 4I5KA 5DKQA 1J7OA 2KGRA 3BFHA 2WCLA 1QTXA 2KQ6A 1UHKA 3DVEA 4MSPA 2WNDA 5CSIA 1WRKA 1H8BA 2ERBA 1A4PA 5CPVA 1EG4A 2LVKA 1B4CA 1OZSA 1CNPA 3F45A 3KPXA 4NQGA 1C7VA 2HQWA 4JWQA 4N5XA 1XFWO 2QDIA 3GOFA 3PSRA 1BJFA 3IF7A 1SRAA 2SASA 3VRNA 1IKUA 5K89A 1XFYO 3B7AA 2G2BA 2H2KA 1OMVA 2LUXA 1KWOC 1NSHA 2MLEC 4YI8A 3TDIA 5I94A 1UHIA 2M97A 3NGVA 3TDUA 1LA0A 1PSRA 2KI4B 1TTXA 4M2OA 2E6WA 3EKHA 3UNWA 3D78A 1FPWA 1EXRA 2L2CA 3BOWB 4U8DA 5HLOA 5PALA 2L0PA 1CTRA 4MZJA 1TUJA 1F55A 4YGAA 2GTEA 1NPQA 3CTNA 1WLMA 3CZ0A 1MR8A 1S1EA 4PHJA 3TS5B 1R6PA 2F2PA 2LMUA 2JRFA 4USLA 5AERA 4C0KA 2AUCA 2OTGB 2WCHA 3HX4A 5HKYA 1CM1A 1J1DA 1GQMA 3RLZA 4MBEA 2B1UA 3OB2B 2Y1MA 1LA3A 2LUCA 1TOPA 1EJ3A 1VRKA 4OVNF 3JVTC 1TWOA 1Y1UA 1WDCC
chains in the Genus database with same CATH topology
1QASA 1SCMB 1KQVA 1G33A 2KDHA 4R1EA 3EK4A 2CT9A 1CLBA 2EC6C 2M7NA 4PE4A 5D69A 1SR6C 4MRXA 1J7PA 1QV0A 5KSZA 2TN4A 2F3ZA 4NDDA 2M7LA 5I8NA 1PSBA 2LVVA 1DF0B 2K7OA 4P2YB 1KFUL 3LCPC 3BUWB 1PULA 1ZACA 3OP0A 2ZKMX 3BUMB 3CWGA 1TNWA 4I5LB 2Y1NA 3DVKA 4ICBA 2M1UA 2QPTA 2P6BB 2QACA 2MHHA 2CXJA 5GQQC 4XJKB 3WHUB 3PALA 2F8PA 2BBNA 3PFVA 2CBLA 4BY4A 3RM1A 2LCPA 5HYDA 1YVHA 3GK2A 5HLVA 2M9GA 5AXIA 4GGFC 1SNLA 1F4OA 2L51A 3KHEA 3BUOB 5DKRA 1RECA 1TN4A 1BMOA 2F3YA 2JQ6A 3I5FB 2BKHB 1R2UA 1GGZA 1DGVA 3EKJA 1NX0A 1IRJA 3VRRA 1MUXA 4CPVA 4OV2A 3A8RA 4MRYA 1XFUO 1K94A 4CIDA 1AJ4A 3PM8A 3AKBA 1FW4A 2ZN9A 4M2PA 2JOJA 3SG5A 1SL9A 1F54A 2NXQA 1IG5A 3GK4X 2ISDA 1IGVA 3EK8A 2LAPA 4ORCB 3I5IC 2GV5A 4PDZA 2K7BA 1KQMC 2BBMA 5HKZA 5TNCA 2KFFA 2KAVA 2LVIA 1L7ZA 1KFUS 1OMRA 1Y0VH 3SJSA 1YVLA 1D1OA 1NYAA 1QLKA 2H61A 2ZNDA 1B8RA 1X02A 2K2FA 2Y4QA 1JWDA 2IS9A 4AOMA 2L4IA 2JTTA 2OS8C 2I18A 3D0YB 4GPLB 4PHMA 2WORA 3CLNA 4CFRA 1HQVA 2VRGA 1RTP1 2JULA 3FIAA 1RK9A 2ZN8A 4GAOA 3DVJA 2KAXA 1XYDA 3TZ1A 1S6IA 3BXKA 3PN7C 2JNXA 4WRIA 2K7CA 2JC2A 5DKNA 4MN0A 4YGDB 2L5XB 2LV7A 3BOWA 2L4HA 1TNQA 5HKWA 3I5HC 2KGBC 1BR4B 3FWBA 2FOTA 2CTNA 1M39A 4PCWA 1SBJA 1U5IB 3ZWHA 3TUYC 1CLLA 3O78A 1CDPA 3BQ3A 1SCVA 1GJYA 2O5GA 3ZNIA 1E8AA 2COLB 4D1EA 1UWOA 3GK1A 1A75B 2GGMA 2CCMA 2PVBA 2JPTA 4HRHA 1SY9A 1W7JB 1BU3A 1OE9B 2M1KB 2LANA 1XFZO 3SG6A 2MJWB 1SW8A 1YX8A 2KFGA 1LKJA 1W7IB 3WXAA 1CFPA 1AUIB 5ER5A 4QJ5B 4PE0A 3M0WA 1SKTA 1MXLC 4E68A 1KFXL 1QX7A 1NCXA 3LK0A 2KI6D 3NXAA 1NWDA 4FQOA 3NSLA 3KF9A 3SG3A 1CDLA 2LP3A 1DF0A 3QRXA 1JBAA 3AKAA 1XK4A 2JT3A 1TRFA 2KI4C 2JXLA 1CKKA 2MAZA 2HETA 3JVTB 1F8HA 1RROA 1WDCB 2ZRSA 1AJ5A 1K90D 1M46A 1QIWA 1UHJA 2ZRTA 4MZKA 4XJKA 4AQJA 4AQIA 1F70A 1N2DA 3SG4A 1H4BA 1IH0A 2EC6B 2NZ0A 3PLFB 5CSNA 3OX5A 2PMYA 3WNXB 1JC2A 1NX3A 5FYXA 1KSMA 4ZCUA 2GGZA 4A4CA 3TS5C 4C0JA 1N0YA 1NIWA 1Y1XA 2M8UA 1EL4A 3SG2A 2LNKA 1K9PA 3NSKA 1YX7A 3TDZA 3H4SE 1ZFSA 1PK0D 1UHNA 3VRQA 2K61A 1UUSA 3CR4X 1A29A 2BL0C 1K95A 1SMGA 1JF2A 5CSJA 1B1GA 2JNFA 3LL8B 2MRDA 3FS7A 4ORBB 2MBXA 5F6TA 1SCMC 1DJGA 2KBIA 1S3PA 1NX1A 3VRPA 1WRZA 2JXCA 2V53A 4GBAA 4P5OE 1S5GZ 1YRTB 2BCXA 1MQ1A 5JOLA 5ER4X 2LVJA 2K2AA 2M3WA 3KO0A 1KK7Z 1KSOA 1OOJA 1RFJA 1KFXS 4YI9A 2HPSA 1XK4C 4Q04A 3EVRA 1CFFA 2KBMA 1DJIA 4MLWA 2O60A 1CLMA 2JU0A 4YGBB 2L50A 4MZLA 1QX2A 3A4UB 2WOSA 4CLNA 1IQ3A 1BR1B 3C1VA 1QIVA 3I5GC 1JUOA 3WHTB 2M49B 1B47A 1LXFC 3D0YA 5KU1A 1CDNA 1EG3A 1PVAA 2LLUA 2PSRA 1HT9A 3I5IB 1B9AA 1S5GY 1V1FA 2BE6A 2D8NA 4TNCA 1KK7Y 5IBWA 1IWQA 2KFHA 1XVJA 1CB1A 2HF5A 2JT8A 1FBVA 2G9BA 3PATA 2SCPA 4CFQA 4ZCVA 1BODA 2I2RE 1EH2A 2L2EA 1B7TZ 1L2OC 4DUQA 2AMIA 1NCYA 2KYFA 2KNEA 1MWNA 1BG1A 1BOCA 5AANA 1XFXO 4BY5A 1TCOB 3LK1A 1U5IA 5AFPA 1XO5A 2WCFA 2ZNEA 1AVSA 2KAYA 2LMVA 1NCZA 2I94A 1M63B 3PN7B 2WCEA 2ZFDA 3CS1A 3JTDC 3CGAA 4UPGA 3IQOA 1A75A 2K8MB 2LC5A 4HRGA 2AAOA 1C7WA 1MHOA 1UURA 2BE4A 2JWWA 1KK8C 3OHMB 1Q80A 1JSAA 2KSPA 2M0RA 4OCIA 4DRWA 1G8IA 1IJ5A 1DVIA 1PRWA 3O4YA 3TUYB 4I5NB 3AAJA 1UP5A 4FTGA 2EGDA 5G08A 1KWOB 1K96A 1JFJA 1WY9A 1B8CA 3EK7A 1CFCA 3BYAA 1SPYA 3DF0B 2LMTA 1A03A 1CFDA 3E3RA 3CR2A 1NP8A 4L9MA 2LP2A 2E30A 1N65A 4OKHA 3CZTX 1AP4A 1FI5A 1UHHA 1S26D 1K93D 2RGIA 1XFVO 5KTYA 2H61C 1Y6WA 1RJVA 3CR5X 4ORAB 5I2OA 4PHKA 1TIZA 2KQYA 2KI6C 2F33A 5JJGA 1ZMZA 4GNKB 1SL8A 1CMGA 2BCBA 4MEWA 2WCBA 1QV1A 5B8IB 4I5JA 4HSZA 1S6JA 1WLZA 5AEQA 1DT7B 1KCYA 5I2QA 4XYNA 4WQ2A 2JTZA 3SIBA 5CSFA 2LLSA 1JF0A 3MSEB 1SL7A 1K9UA 4GFTA 4N1FA 1SYMA 3KEVA 4PALA 1G4YR 2KYCA 3AAKA 4QJ3B 3O2PA 4C0LA 2Y5IA 1SR6B 2JZIA 1BT6A 1YUUA 4GGFA 4DS7A 1QXPA 3VGOA 4GGNA 1NX2A 1YURA 1J55A 1YRUB 2NLNA 1ODBA 2OTGC 1OMDA 2HQ8A 1K8UA 1LVCD 4F0ZB 1OSAA 1DJXA 2PALA 1J7RA 1ZOTB 2BL0B 2K7DA 1F4QA 3IQQA 3SG7A 1ALWA 3EVUA 1QLSA 1QATA 1TCFA 2R2IA 1MXEA 3D10A 3HCMA 1XA5A 1IQ5A 1DJZA 1BF5A 1C07A 1Y1AA 2WC8A 1FF1A 5BPJA 1V1GA 3BUXB 3NSOA 1J1EA 2FCEA 3LLEA 4JPZB 2DOQA 1NUBA 1A2XA 1GGWA 2LM5A 4NDCA 1DTLA 2NCPA 1DMOA 1DJWA 1OQPA 1ZUZA 1OZOA 1YUTA 2MA2A 3I5GB 1QVIZ 4NDBA 4YBHB 1F71A 2KOTA 1AK8A 1IJ6A 1YTZC 1TNXA 3ICBA 2LE9B 4HREE 1KQMB 2FJUB 3EVVA 3VROA 2LLTA 1ALVA 1S6CA 3I5FC 1DGUA 2BECA 3BUNB 1J7QA 2A4JA 3DD4A 4M2QA 4YGEB 5I2LA 4YRUA 4PE7A 1M45A 1FI6A 1RWYA 1L2OB 2BKIB 4PHNA 1SK6D 1QS7A 5J3XA 1YR5A 1QX5B 1S36A 1MF8B 4OR9B 2JT0A 1QVIY 2OS8B 3NSIA 2KHNA 3DVMA 3O6BA 2F2OA 4IL1A 2PASA 2EHBA 2Q4UA 1AHRA 1BLQA 1PALA 2OPOA 2L98A 4DCKA 1B8LA 4MVFA 3JTDB 2PRUA 1CM4A 1LINA 2CNPA 3DF0A 1M31A 1K2HA 2K0JA 2I7AA 3FWCA 3K21A 1K9KA 4A4BA 1KK8B 1WRLA 2FCDA 2M29A 2BCAA 4WQ3A 2LHIA 3I5HB 3OB1B 1B7TY 1QJTA 1PVBA 1CMFA 1DJHA 1TNPA 3OX6A 4ETOA 4JQ0D 4PE1A 1CDMA 4N1GA 3SIAA 1JFKA 2MLFC 4YGCB 2Q91A 5D7FA 1DJYA 1YUSA 4QJ4B 2LHLA 4GUKA 4DIRA 2NCOA 4I5KA 5DKQA 1J7OA 2KGRA 1QTXA 2KQ6A 1UHKA 3DVEA 4MSPA 2WNDA 5CSIA 1WRKA 1H8BA 1A4PA 5CPVA 1EG4A 2LVKA 1B4CA 1OZSA 1CNPA 3F45A 3KPXA 4NQGA 1C7VA 2HQWA 4JWQA 4N5XA 1XFWO 3GOFA 3PSRA 1BJFA 3IF7A 1SRAA 2SASA 3VRNA 1IKUA 5K89A 1XFYO 2G2BA 2H2KA 1OMVA 2LUXA 1KWOC 1NSHA 2MLEC 4YI8A 3TDIA 1UHIA 2M97A 3TDUA 1LA0A 1PSRA 2KI4B 1TTXA 4M2OA 2E6WA 3EKHA 1FPWA 1EXRA 3BOWB 4U8DA 5HLOA 5PALA 2L0PA 1CTRA 4MZJA 1F55A 4YGAA 1NPQA 3CTNA 1WLMA 1MR8A 1S1EA 4PHJA 3TS5B 1R6PA 2F2PA 2LMUA 2JRFA 4USLA 5AERA 4C0KA 2AUCA 2OTGB 3HX4A 5HKYA 1CM1A 1J1DA 1GQMA 3RLZA 4MBEA 2B1UA 3OB2B 2Y1MA 1LA3A 2LUCA 1TOPA 1EJ3A 1VRKA 4OVNF 3JVTC 1Y1UA 1WDCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAS A;  1SCM B;  1KQV A;  1G33 A;  2KDH A;  4R1E A;  3EK4 A;  2CT9 A;  1CLB A;  2EC6 C;  2M7N A;  4PE4 A;  5D69 A;  1SR6 C;  4MRX A;  1J7P A;  1QV0 A;  5KSZ A;  2TN4 A;  2F3Z A;  4NDD A;  2M7L A;  5I8N A;  1PSB A;  2LVV A;  1DF0 B;  2K7O A;  4P2Y B;  1KFU L;  3LCP C;  3BUW B;  1PUL A;  1ZAC A;  3OP0 A;  2ZKM X;  3BUM B;  3CWG A;  1TNW A;  4I5L B;  2Y1N A;  3DVK A;  4ICB A;  2M1U A;  2QPT A;  2P6B B;  2QAC A;  2MHH A;  2CXJ A;  5GQQ C;  4XJK B;  3WHU B;  3PAL A;  2F8P A;  2BBN A;  3PFV A;  2CBL A;  4BY4 A;  3RM1 A;  2LCP A;  5HYD A;  1YVH A;  3GK2 A;  5HLV A;  2M9G A;  5AXI A;  4GGF C;  1SNL A;  1F4O A;  2L51 A;  3KHE A;  3BUO B;  5DKR A;  1REC A;  1TN4 A;  1BMO A;  2F3Y A;  2JQ6 A;  3I5F B;  2BKH B;  1R2U A;  1GGZ A;  1DGV A;  3EKJ A;  1NX0 A;  1IRJ A;  3VRR A;  1MUX A;  4CPV A;  4OV2 A;  3A8R A;  4MRY A;  1XFU O;  1K94 A;  4CID A;  1AJ4 A;  3PM8 A;  3AKB A;  1FW4 A;  2ZN9 A;  4M2P A;  2JOJ A;  3SG5 A;  1SL9 A;  1F54 A;  2NXQ A;  1IG5 A;  3GK4 X;  2ISD A;  1IGV A;  3EK8 A;  2LAP A;  4ORC B;  3I5I C;  2GV5 A;  4PDZ A;  2K7B A;  1KQM C;  2BBM A;  5HKZ A;  5TNC A;  2KFF A;  2KAV A;  2LVI A;  1L7Z A;  1KFU S;  1OMR A;  1Y0V H;  3SJS A;  1YVL A;  1D1O A;  1NYA A;  1QLK A;  2H61 A;  2ZND A;  1B8R A;  1X02 A;  2K2F A;  2Y4Q A;  1JWD A;  2IS9 A;  4AOM A;  2L4I A;  2JTT A;  2OS8 C;  2I18 A;  3D0Y B;  4GPL B;  4PHM A;  2WOR A;  3CLN A;  4CFR A;  1HQV A;  2VRG A;  1RTP 1;  2JUL A;  3FIA A;  1RK9 A;  2ZN8 A;  4GAO A;  3DVJ A;  2KAX A;  1XYD A;  3TZ1 A;  1S6I A;  3BXK A;  3PN7 C;  2JNX A;  4WRI A;  2K7C A;  2JC2 A;  5DKN A;  4MN0 A;  4YGD B;  2L5X B;  2LV7 A;  3BOW A;  2L4H A;  1TNQ A;  5HKW A;  3I5H C;  2KGB C;  1BR4 B;  3FWB A;  2FOT A;  2CTN A;  1M39 A;  4PCW A;  1SBJ A;  1U5I B;  3ZWH A;  3TUY C;  1CLL A;  3O78 A;  1CDP A;  3BQ3 A;  1SCV A;  1GJY A;  2O5G A;  3ZNI A;  1E8A A;  2COL B;  4D1E A;  1UWO A;  3GK1 A;  1A75 B;  2GGM A;  2CCM A;  2PVB A;  2JPT A;  4HRH A;  1SY9 A;  1W7J B;  1BU3 A;  1OE9 B;  2M1K B;  2LAN A;  1XFZ O;  3SG6 A;  2MJW B;  1SW8 A;  1YX8 A;  2KFG A;  1LKJ A;  1W7I B;  3WXA A;  1CFP A;  1AUI B;  5ER5 A;  4QJ5 B;  4PE0 A;  3M0W A;  1SKT A;  1MXL C;  4E68 A;  1KFX L;  1QX7 A;  1NCX A;  3LK0 A;  2KI6 D;  3NXA A;  1NWD A;  4FQO A;  3NSL A;  3KF9 A;  3SG3 A;  1CDL A;  2LP3 A;  1DF0 A;  3QRX A;  1JBA A;  3AKA A;  1XK4 A;  2JT3 A;  1TRF A;  2KI4 C;  2JXL A;  1CKK A;  2MAZ A;  2HET A;  3JVT B;  1F8H A;  1RRO A;  1WDC B;  2ZRS A;  1AJ5 A;  1K90 D;  1M46 A;  1QIW A;  1UHJ A;  2ZRT A;  4MZK A;  4XJK A;  4AQJ A;  4AQI A;  1F70 A;  1N2D A;  3SG4 A;  1H4B A;  1IH0 A;  2EC6 B;  2NZ0 A;  3PLF B;  5CSN A;  3OX5 A;  2PMY A;  3WNX B;  1JC2 A;  1NX3 A;  5FYX A;  1KSM A;  4ZCU A;  2GGZ A;  4A4C A;  3TS5 C;  4C0J A;  1N0Y A;  1NIW A;  1Y1X A;  2M8U A;  1EL4 A;  3SG2 A;  2LNK A;  1K9P A;  3NSK A;  1YX7 A;  3TDZ A;  3H4S E;  1ZFS A;  1PK0 D;  1UHN A;  3VRQ A;  2K61 A;  1UUS A;  3CR4 X;  1A29 A;  2BL0 C;  1K95 A;  1SMG A;  1JF2 A;  5CSJ A;  1B1G A;  2JNF A;  3LL8 B;  2MRD A;  3FS7 A;  4ORB B;  2MBX A;  5F6T A;  1SCM C;  1DJG A;  2KBI A;  1S3P A;  1NX1 A;  3VRP A;  1WRZ A;  2JXC A;  2V53 A;  4GBA A;  4P5O E;  1S5G Z;  1YRT B;  2BCX A;  1MQ1 A;  5JOL A;  5ER4 X;  2LVJ A;  2K2A A;  2M3W A;  3KO0 A;  1KK7 Z;  1KSO A;  1OOJ A;  1RFJ A;  1KFX S;  4YI9 A;  2HPS A;  1XK4 C;  4Q04 A;  3EVR A;  1CFF A;  2KBM A;  1DJI A;  4MLW A;  2O60 A;  1CLM A;  2JU0 A;  4YGB B;  2L50 A;  4MZL A;  1QX2 A;  3A4U B;  2WOS A;  4CLN A;  1IQ3 A;  1BR1 B;  3C1V A;  1QIV A;  3I5G C;  1JUO A;  3WHT B;  2M49 B;  1B47 A;  1LXF C;  3D0Y A;  5KU1 A;  1CDN A;  1EG3 A;  1PVA A;  2LLU A;  2PSR A;  1HT9 A;  3I5I B;  1B9A A;  1S5G Y;  1V1F A;  2BE6 A;  2D8N A;  4TNC A;  1KK7 Y;  5IBW A;  1IWQ A;  2KFH A;  1XVJ A;  1CB1 A;  2HF5 A;  2JT8 A;  1FBV A;  2G9B A;  3PAT A;  2SCP A;  4CFQ A;  4ZCV A;  1BOD A;  2I2R E;  1EH2 A;  2L2E A;  1B7T Z;  1L2O C;  4DUQ A;  2AMI A;  1NCY A;  2KYF A;  2KNE A;  1MWN A;  1BG1 A;  1BOC A;  5AAN A;  1XFX O;  4BY5 A;  1TCO B;  3LK1 A;  1U5I A;  5AFP A;  1XO5 A;  2WCF A;  2ZNE A;  1AVS A;  2KAY A;  2LMV A;  1NCZ A;  2I94 A;  1M63 B;  3PN7 B;  2WCE A;  2ZFD A;  3CS1 A;  3JTD C;  3CGA A;  4UPG A;  3IQO A;  1A75 A;  2K8M B;  2LC5 A;  4HRG A;  2AAO A;  1C7W A;  1MHO A;  1UUR A;  2BE4 A;  2JWW A;  1KK8 C;  3OHM B;  1Q80 A;  1JSA A;  2KSP A;  2M0R A;  4OCI A;  4DRW A;  1G8I A;  1IJ5 A;  1DVI A;  1PRW A;  3O4Y A;  3TUY B;  4I5N B;  3AAJ A;  1UP5 A;  4FTG A;  2EGD A;  5G08 A;  1KWO B;  1K96 A;  1JFJ A;  1WY9 A;  1B8C A;  3EK7 A;  1CFC A;  3BYA A;  1SPY A;  3DF0 B;  2LMT A;  1A03 A;  1CFD A;  3E3R A;  3CR2 A;  1NP8 A;  4L9M A;  2LP2 A;  2E30 A;  1N65 A;  4OKH A;  3CZT X;  1AP4 A;  1FI5 A;  1UHH A;  1S26 D;  1K93 D;  2RGI A;  1XFV O;  5KTY A;  2H61 C;  1Y6W A;  1RJV A;  3CR5 X;  4ORA B;  5I2O A;  4PHK A;  1TIZ A;  2KQY A;  2KI6 C;  2F33 A;  5JJG A;  1ZMZ A;  4GNK B;  1SL8 A;  1CMG A;  2BCB A;  4MEW A;  2WCB A;  1QV1 A;  5B8I B;  4I5J A;  4HSZ A;  1S6J A;  1WLZ A;  5AEQ A;  1DT7 B;  1KCY A;  5I2Q A;  4XYN A;  4WQ2 A;  2JTZ A;  3SIB A;  5CSF A;  2LLS A;  1JF0 A;  3MSE B;  1SL7 A;  1K9U A;  4GFT A;  4N1F A;  1SYM A;  3KEV A;  4PAL A;  1G4Y R;  2KYC A;  3AAK A;  4QJ3 B;  3O2P A;  4C0L A;  2Y5I A;  1SR6 B;  2JZI A;  1BT6 A;  1YUU A;  4GGF A;  4DS7 A;  1QXP A;  3VGO A;  4GGN A;  1NX2 A;  1YUR A;  1J55 A;  1YRU B;  2NLN A;  1ODB A;  2OTG C;  1OMD A;  2HQ8 A;  1K8U A;  1LVC D;  4F0Z B;  1OSA A;  1DJX A;  2PAL A;  1J7R A;  1ZOT B;  2BL0 B;  2K7D A;  1F4Q A;  3IQQ A;  3SG7 A;  1ALW A;  3EVU A;  1QLS A;  1QAT A;  1TCF A;  2R2I A;  1MXE A;  3D10 A;  3HCM A;  1XA5 A;  1IQ5 A;  1DJZ A;  1BF5 A;  1C07 A;  1Y1A A;  2WC8 A;  1FF1 A;  5BPJ A;  1V1G A;  3BUX B;  3NSO A;  1J1E A;  2FCE A;  3LLE A;  4JPZ B;  2DOQ A;  1NUB A;  1A2X A;  1GGW A;  2LM5 A;  4NDC A;  1DTL A;  2NCP A;  1DMO A;  1DJW A;  1OQP A;  1ZUZ A;  1OZO A;  1YUT A;  2MA2 A;  3I5G B;  1QVI Z;  4NDB A;  4YBH B;  1F71 A;  2KOT A;  1AK8 A;  1IJ6 A;  1YTZ C;  1TNX A;  3ICB A;  2LE9 B;  4HRE E;  1KQM B;  2FJU B;  3EVV A;  3VRO A;  2LLT A;  1ALV A;  1S6C A;  3I5F C;  1DGU A;  2BEC A;  3BUN B;  1J7Q A;  2A4J A;  3DD4 A;  4M2Q A;  4YGE B;  5I2L A;  4YRU A;  4PE7 A;  1M45 A;  1FI6 A;  1RWY A;  1L2O B;  2BKI B;  4PHN A;  1SK6 D;  1QS7 A;  5J3X A;  1YR5 A;  1QX5 B;  1S36 A;  1MF8 B;  4OR9 B;  2JT0 A;  1QVI Y;  2OS8 B;  3NSI A;  2KHN A;  3DVM A;  3O6B A;  2F2O A;  4IL1 A;  2PAS A;  2EHB A;  2Q4U A;  1AHR A;  1BLQ A;  1PAL A;  2OPO A;  2L98 A;  4DCK A;  1B8L A;  4MVF A;  3JTD B;  2PRU A;  1CM4 A;  1LIN A;  2CNP A;  3DF0 A;  1M31 A;  1K2H A;  2K0J A;  2I7A A;  3FWC A;  3K21 A;  1K9K A;  4A4B A;  1KK8 B;  1WRL A;  2FCD A;  2M29 A;  2BCA A;  4WQ3 A;  2LHI A;  3I5H B;  3OB1 B;  1B7T Y;  1QJT A;  1PVB A;  1CMF A;  1DJH A;  1TNP A;  3OX6 A;  4ETO A;  4JQ0 D;  4PE1 A;  1CDM A;  4N1G A;  3SIA A;  1JFK A;  2MLF C;  4YGC B;  2Q91 A;  5D7F A;  1DJY A;  1YUS A;  4QJ4 B;  2LHL A;  4GUK A;  4DIR A;  2NCO A;  4I5K A;  5DKQ A;  1J7O A;  2KGR A;  1QTX A;  2KQ6 A;  1UHK A;  3DVE A;  4MSP A;  2WND A;  5CSI A;  1WRK A;  1H8B A;  1A4P A;  5CPV A;  1EG4 A;  2LVK A;  1B4C A;  1OZS A;  1CNP A;  3F45 A;  3KPX A;  4NQG A;  1C7V A;  2HQW A;  4JWQ A;  4N5X A;  1XFW O;  3GOF A;  3PSR A;  1BJF A;  3IF7 A;  1SRA A;  2SAS A;  3VRN A;  1IKU A;  5K89 A;  1XFY O;  2G2B A;  2H2K A;  1OMV A;  2LUX A;  1KWO C;  1NSH A;  2MLE C;  4YI8 A;  3TDI A;  1UHI A;  2M97 A;  3TDU A;  1LA0 A;  1PSR A;  2KI4 B;  1TTX A;  4M2O A;  2E6W A;  3EKH A;  1FPW A;  1EXR A;  3BOW B;  4U8D A;  5HLO A;  5PAL A;  2L0P A;  1CTR A;  4MZJ A;  1F55 A;  4YGA A;  1NPQ A;  3CTN A;  1WLM A;  1MR8 A;  1S1E A;  4PHJ A;  3TS5 B;  1R6P A;  2F2P A;  2LMU A;  2JRF A;  4USL A;  5AER A;  4C0K A;  2AUC A;  2OTG B;  3HX4 A;  5HKY A;  1CM1 A;  1J1D A;  1GQM A;  3RLZ A;  4MBE A;  2B1U A;  3OB2 B;  2Y1M A;  1LA3 A;  2LUC A;  1TOP A;  1EJ3 A;  1VRK A;  4OVN F;  3JVT C;  1Y1U A;  1WDC C; 
#chains in the Genus database with same CATH topology
 1QAS A;  1SCM B;  3BJH A;  1KQV A;  2JPO A;  1G33 A;  2KDH A;  4R1E A;  3EK4 A;  5D3O A;  2CT9 A;  1CLB A;  2EC6 C;  2M7N A;  4PE4 A;  5D69 A;  1SR6 C;  4F7F A;  4MRX A;  1J7P A;  3R72 A;  1QV0 A;  5KSZ A;  2TN4 A;  4IJ7 A;  2F3Z A;  4NDD A;  2M7L A;  5I8N A;  1PSB A;  2LVV A;  1DF0 B;  2K7O A;  4P2Y B;  1KFU L;  3LCP C;  3BUW B;  1PUL A;  1ZAC A;  3OP0 A;  2ZKM X;  3BUM B;  3CWG A;  1TNW A;  4I5L B;  2Y1N A;  3DVK A;  4ICB A;  2M1U A;  2QPT A;  2P6B B;  2QAC A;  2MHH A;  2CXJ A;  5GQQ C;  4XJK B;  3WHU B;  3PAL A;  2F8P A;  2L5Y A;  2BBN A;  3PFV A;  3DY9 A;  2CBL A;  4BY4 A;  2WCK A;  3RM1 A;  2LCP A;  5HYD A;  1YVH A;  3GK2 A;  5HLV A;  2M9G A;  3DYE A;  5AXI A;  4GGF C;  1SNL A;  1F4O A;  2L51 A;  3KHE A;  3BUO B;  5DKR A;  1REC A;  1TN4 A;  1BMO A;  2F3Y A;  2JQ6 A;  3I5F B;  2BKH B;  1R2U A;  1GGZ A;  1DGV A;  3EKJ A;  1NX0 A;  1Z4H A;  1IRJ A;  3Q8I A;  3VRR A;  2WCJ A;  2PYQ A;  1MUX A;  4CPV A;  4OV2 A;  2QEV A;  3A8R A;  4MRY A;  1XFU O;  1K94 A;  4CID A;  1AJ4 A;  3PM8 A;  3R1V A;  4JD9 A;  3AKB A;  3FE9 A;  1FW4 A;  2ZN9 A;  4M2P A;  2JOJ A;  3SG5 A;  1SL9 A;  1F54 A;  2NXQ A;  1IG5 A;  3GK4 X;  2ISD A;  1IGV A;  3EK8 A;  2LAP A;  4ORC B;  3I5I C;  2GV5 A;  4PDZ A;  2K7B A;  1KQM C;  3SS4 A;  2BBM A;  5HKZ A;  5TNC A;  2KFF A;  3DZT A;  2KAV A;  2LVI A;  1L7Z A;  4PT1 A;  1KFU S;  1OMR A;  1Y0V H;  3SJS A;  1YVL A;  1D1O A;  1NYA A;  3S0D A;  1QLK A;  2H61 A;  2ZND A;  1B8R A;  1X02 A;  2K2F A;  2Y4Q A;  3FE6 A;  2IS9 A;  4AOM A;  1JWD A;  2L4I A;  2JTT A;  2OS8 C;  2I18 A;  3D0Y B;  4GPL B;  3L4A A;  2WOR A;  3CLN A;  4PHM A;  4CFR A;  1HQV A;  3DXL A;  2VRG A;  1RTP 1;  2JUL A;  3FIA A;  1RK9 A;  2ZN8 A;  4GAO A;  1DC1 A;  3DVJ A;  2KAX A;  1XYD A;  3TZ1 A;  1S6I A;  3BXK A;  3PN7 C;  2KLD A;  2JNX A;  4WRI A;  2K7C A;  2JC2 A;  5DKN A;  4MN0 A;  4YGD B;  2L5X B;  2LV7 A;  3BOW A;  2L4H A;  3FE8 A;  1TNQ A;  5HKW A;  3I5H C;  2KGB C;  1BR4 B;  3FWB A;  2FOT A;  2CTN A;  1W9Z A;  1M39 A;  2QEO A;  4PCW A;  1SBJ A;  3RZS A;  1U5I B;  2FJY A;  3ZWH A;  3TUY C;  1CLL A;  3O78 A;  1CDP A;  3BQ3 A;  1SCV A;  1GJY A;  2O5G A;  3ZNI A;  5FI6 A;  1E8A A;  2COL B;  4D1E A;  1UWO A;  3GK1 A;  1A75 B;  2GGM A;  2CCM A;  2PVB A;  2JPT A;  4HRH A;  1SY9 A;  1W7J B;  3CYZ A;  1BU3 A;  1IIO A;  1OE9 B;  2M1K B;  2LAN A;  1XFZ O;  3SG6 A;  2MJW B;  1SW8 A;  1YX8 A;  2KFG A;  1LKJ A;  1W7I B;  3WXA A;  1CFP A;  1AUI B;  5ER5 A;  3D76 A;  4QJ5 B;  4PE0 A;  3M0W A;  1SKT A;  1MXL C;  4E68 A;  1KFX L;  1QX7 A;  1NCX A;  3LK0 A;  2KI6 D;  3NXA A;  1NWD A;  4FQO A;  3NSL A;  5DIC A;  3KF9 A;  3SG3 A;  1CDL A;  2LP3 A;  1DF0 A;  3QRX A;  1JBA A;  3AKA A;  1XK4 A;  2JT3 A;  1TRF A;  2KI4 C;  2JXL A;  3N7H A;  2MAZ A;  1CKK A;  2HET A;  3JVT B;  1C3Y A;  1F8H A;  1RRO A;  1WDC B;  2ZRS A;  1AJ5 A;  1K90 D;  1M46 A;  1QIW A;  1UHJ A;  2ZRT A;  4MZK A;  4XJK A;  4AQJ A;  4AQI A;  1F70 A;  1N2D A;  3SG4 A;  1H4B A;  1IH0 A;  2EC6 B;  2NZ0 A;  3PLF B;  3D77 A;  4KYN A;  5CSN A;  3OX5 A;  2PMY A;  3WNX B;  3OBV A;  1JC2 A;  1NX3 A;  1P28 A;  5FYX A;  1KSM A;  3BFA A;  4ZCU A;  2GGZ A;  4A4C A;  3TS5 C;  4C0J A;  1N0Y A;  1NIW A;  1Y1X A;  2M8U A;  1EL4 A;  3SG2 A;  2LNK A;  1K9P A;  3NSK A;  1TUZ A;  1YX7 A;  3L47 A;  3TDZ A;  3H4S E;  1ZFS A;  1PK0 D;  1UHN A;  3VRQ A;  1QWV A;  2K61 A;  1UUS A;  3CR4 X;  1A29 A;  2BL0 C;  1K95 A;  1SMG A;  5EL2 A;  1JF2 A;  5CSJ A;  3V2L A;  1B1G A;  2JNF A;  3LL8 B;  2MRD A;  3FS7 A;  3BFB A;  3OGN A;  4ORB B;  5F6T A;  1SCM C;  1DJG A;  2KBI A;  1DEL A;  1NX1 A;  1S3P A;  3VRP A;  1GM0 A;  1WRZ A;  2JXC A;  2V53 A;  4GBA A;  4P5O E;  2KLE A;  2WCM A;  5FI7 A;  1S5G Z;  1YRT B;  2BCX A;  1MQ1 A;  5JOL A;  5ER4 X;  2LVJ A;  5FI2 A;  2K2A A;  2M3W A;  3KO0 A;  1KK7 Z;  1KSO A;  1OOJ A;  1RFJ A;  1KFX S;  4YI9 A;  2HPS A;  1XK4 C;  4Q04 A;  3EVR A;  1CFF A;  2KBM A;  3S0F A;  1DJI A;  4MLW A;  2O60 A;  1CLM A;  2JU0 A;  4YGB B;  2L50 A;  2BNX A;  4OZD A;  4MZL A;  1QX2 A;  3A4U B;  2WOS A;  3CZ1 A;  3D75 A;  4CLN A;  1IQ3 A;  1BR1 B;  3C1V A;  1QIV A;  3I5G C;  1JUO A;  3WHT B;  2M49 B;  1B47 A;  1LXF C;  3D0Y A;  3EG5 B;  5KU1 A;  1CDN A;  1EG3 A;  1PVA A;  2LLU A;  2PSR A;  1HT9 A;  3I5I B;  1B9A A;  1S5G Y;  1V1F A;  4INX A;  2BE6 A;  3K1E A;  2D8N A;  4TNC A;  1KK7 Y;  5IBW A;  1IWQ A;  2KFH A;  1XVJ A;  1CB1 A;  2HF5 A;  2JT8 A;  1FBV A;  2G9B A;  3PAT A;  2SCP A;  3B87 A;  4CFQ A;  1XFR A;  4ZCV A;  1BOD A;  2I2R E;  2BAP A;  1EH2 A;  2L2E A;  1B7T Z;  1L2O C;  4DUQ A;  2AMI A;  1NCY A;  2KYF A;  2KNE A;  1MWN A;  3VB1 A;  1BG1 A;  1BOC A;  5AAN A;  1XFX O;  3L4L A;  4BY5 A;  1TCO B;  3LK1 A;  1U5I A;  1DEK A;  5AFP A;  1XO5 A;  2KPH A;  3PJI A;  2WCF A;  2ZNE A;  1AVS A;  1LS8 A;  2KAY A;  2LMV A;  1NCZ A;  2I94 A;  1M63 B;  2QEH A;  2P70 A;  3PN7 B;  2WCE A;  2WC5 A;  2ZFD A;  1OOG A;  3CS1 A;  3JTD C;  3CGA A;  3SS3 A;  4UPG A;  3IQO A;  1A75 A;  2K8M B;  2LC5 A;  4HRG A;  2AAO A;  1C7W A;  1MHO A;  1UUR A;  2BE4 A;  2JWW A;  1KK8 C;  3OHM B;  1Q80 A;  1JSA A;  2KSP A;  3B88 A;  4INW A;  2M0R A;  4OCI A;  4DRW A;  1G8I A;  1IJ5 A;  1DVI A;  1PRW A;  3O4Y A;  2P71 A;  3TUY B;  4I5N B;  3AAJ A;  1UP5 A;  4FTG A;  3SS5 A;  2EGD A;  5G08 A;  1KWO B;  1K96 A;  1JFJ A;  1WY9 A;  1B8C A;  3EK7 A;  1CFC A;  3BYA A;  3CDN A;  1SPY A;  3DF0 B;  2LMT A;  1A03 A;  1CFD A;  3E3R A;  3CR2 A;  1NP8 A;  4L9M A;  2LP2 A;  3S0E A;  2E30 A;  1N65 A;  4OKH A;  3CZT X;  3UO9 A;  1AP4 A;  1FI5 A;  1UHH A;  1S26 D;  1K93 D;  2RGI A;  1XFV O;  4JKT A;  5KTY A;  2H61 C;  1Y6W A;  1RJV A;  3CR5 X;  4ORA B;  5I2O A;  1SSE B;  4PHK A;  1TIZ A;  2KQY A;  2KI6 C;  2F33 A;  5JJG A;  1ZMZ A;  4GNK B;  1SL8 A;  1CMG A;  2BCB A;  1DQE A;  4MEW A;  2WCB A;  1QV1 A;  5B8I B;  4I5J A;  4HSZ A;  1S6J A;  2K60 A;  1WLZ A;  5AEQ A;  1DT7 B;  1KCY A;  5I2Q A;  4XYN A;  1OOI X;  3IVT A;  4WQ2 A;  2JTZ A;  3SIB A;  5CSF A;  2LLS A;  1JF0 A;  3MSE B;  1SL7 A;  1K9U A;  4GFT A;  4N1F A;  1SYM A;  3KEV A;  4PAL A;  1G4Y R;  2KYC A;  3AAK A;  4QJ3 B;  3O2P A;  4C0L A;  3QME A;  3S0A A;  2Y5I A;  1SR6 B;  3NHT A;  2JZI A;  1BT6 A;  1YUU A;  4GGF A;  4DS7 A;  1QXP A;  1OW4 A;  3VGO A;  4GGN A;  1NX2 A;  1YUR A;  1J55 A;  2H8V A;  1YRU B;  2NLN A;  1ODB A;  2OTG C;  3S0B A;  1OMD A;  2HQ8 A;  1K8U A;  1LVC D;  3B6X A;  1OOH A;  3PM2 A;  4F0Z B;  1OSA A;  2WC6 A;  1DJX A;  2PAL A;  1J7R A;  5HL1 A;  1ZOT B;  2BL0 B;  2K7D A;  1F4Q A;  3IQQ A;  3SG7 A;  1ALW A;  3EVU A;  1QLS A;  1ORG A;  1C3Z A;  1QAT A;  1TCF A;  2R2I A;  1MXE A;  3D10 A;  3HCM A;  1XA5 A;  1IQ5 A;  3NHI A;  1DJZ A;  1BF5 A;  1C07 A;  1Y1A A;  2WC8 A;  1FF1 A;  5BPJ A;  1V1G A;  3BUX B;  3D74 A;  3NSO A;  1J1E A;  2FCE A;  3LLE A;  4JPZ B;  2DOQ A;  1NUB A;  1A2X A;  2PQL A;  1GGW A;  2LM5 A;  4NDC A;  1DTL A;  2NCP A;  1DMO A;  1DJW A;  1OQP A;  1ZUZ A;  2YGU A;  1OZO A;  1YUT A;  2MA2 A;  3I5G B;  1QVI Z;  3R1P A;  4NDB A;  4YBH B;  1F71 A;  2KOT A;  2QEB A;  1AK8 A;  3B86 A;  1IJ6 A;  1YTZ C;  1TNX A;  3ICB A;  2LE9 B;  4HRE E;  1KQM B;  2FJU B;  3EVV A;  3VRO A;  2LLT A;  1ALV A;  1S6C A;  3I5F C;  1DGU A;  2BEC A;  3D73 A;  3O4X A;  3BUN B;  1J7Q A;  2A4J A;  3DD4 A;  4M2Q A;  4YGE B;  5I2L A;  4YRU A;  4PE7 A;  1M45 A;  1FI6 A;  1RWY A;  1L2O B;  2BKI B;  4PHN A;  1SK6 D;  1QS7 A;  5J3X A;  1YR5 A;  1QX5 B;  1S36 A;  1Z2C B;  1MF8 B;  4OR9 B;  2JT0 A;  1QVI Y;  2OS8 B;  3NSI A;  3CZ2 A;  2KHN A;  3DVM A;  3O6B A;  2MBX A;  2F2O A;  3CAB A;  4FQT A;  4IL1 A;  2PAS A;  2EHB A;  2Q4U A;  1AHR A;  1BLQ A;  1PAL A;  2OPO A;  3S0G A;  2L98 A;  4DCK A;  1B8L A;  4MVF A;  3JTD B;  2PRU A;  1CM4 A;  1LIN A;  2CNP A;  3DF0 A;  1M31 A;  1K2H A;  2K0J A;  2I7A A;  3FWC A;  3R1O A;  3K21 A;  1K9K A;  1T14 A;  4A4B A;  1KK8 B;  1WRL A;  2FCD A;  2M29 A;  2BCA A;  4WQ3 A;  2LHI A;  3I5H B;  3OB1 B;  1B7T Y;  1QJT A;  1PVB A;  1CMF A;  1DJH A;  1TNP A;  3OX6 A;  4ETO A;  4JQ0 D;  4PE1 A;  1CDM A;  4N1G A;  3SIA A;  1JFK A;  2MLF C;  4YGC B;  2Q91 A;  5D7F A;  1DJY A;  1YUS A;  4QJ4 B;  2LHL A;  4GUK A;  4DIR A;  1OOF A;  2NCO A;  4I5K A;  5DKQ A;  1J7O A;  2KGR A;  3BFH A;  2WCL A;  1QTX A;  2KQ6 A;  1UHK A;  3DVE A;  4MSP A;  2WND A;  5CSI A;  1WRK A;  1H8B A;  2ERB A;  1A4P A;  5CPV A;  1EG4 A;  2LVK A;  1B4C A;  1OZS A;  1CNP A;  3F45 A;  3KPX A;  4NQG A;  1C7V A;  2HQW A;  4JWQ A;  4N5X A;  1XFW O;  2QDI A;  3GOF A;  3PSR A;  1BJF A;  3IF7 A;  1SRA A;  2SAS A;  3VRN A;  1IKU A;  5K89 A;  1XFY O;  3B7A A;  2G2B A;  2H2K A;  1OMV A;  2LUX A;  1KWO C;  1NSH A;  2MLE C;  4YI8 A;  3TDI A;  5I94 A;  1UHI A;  2M97 A;  3NGV A;  3TDU A;  1LA0 A;  1PSR A;  2KI4 B;  1TTX A;  4M2O A;  2E6W A;  3EKH A;  3UNW A;  3D78 A;  1FPW A;  1EXR A;  2L2C A;  3BOW B;  4U8D A;  5HLO A;  5PAL A;  2L0P A;  1CTR A;  4MZJ A;  1TUJ A;  1F55 A;  4YGA A;  2GTE A;  1NPQ A;  3CTN A;  1WLM A;  3CZ0 A;  1MR8 A;  1S1E A;  4PHJ A;  3TS5 B;  1R6P A;  2F2P A;  2LMU A;  2JRF A;  4USL A;  5AER A;  4C0K A;  2AUC A;  2OTG B;  2WCH A;  3HX4 A;  5HKY A;  1CM1 A;  1J1D A;  1GQM A;  3RLZ A;  4MBE A;  2B1U A;  3OB2 B;  2Y1M A;  1LA3 A;  2LUC A;  1TOP A;  1EJ3 A;  1VRK A;  4OVN F;  3JVT C;  1TWO A;  1Y1U A;  1WDC C; 
#chains in the Genus database with same CATH homology
 1QAS A;  1SCM B;  1KQV A;  1G33 A;  2KDH A;  4R1E A;  3EK4 A;  2CT9 A;  1CLB A;  2EC6 C;  2M7N A;  4PE4 A;  5D69 A;  1SR6 C;  4MRX A;  1J7P A;  1QV0 A;  5KSZ A;  2TN4 A;  2F3Z A;  4NDD A;  2M7L A;  5I8N A;  1PSB A;  2LVV A;  1DF0 B;  2K7O A;  4P2Y B;  1KFU L;  3LCP C;  3BUW B;  1PUL A;  1ZAC A;  3OP0 A;  2ZKM X;  3BUM B;  3CWG A;  1TNW A;  4I5L B;  2Y1N A;  3DVK A;  4ICB A;  2M1U A;  2QPT A;  2P6B B;  2QAC A;  2MHH A;  2CXJ A;  5GQQ C;  4XJK B;  3WHU B;  3PAL A;  2F8P A;  2BBN A;  3PFV A;  2CBL A;  4BY4 A;  3RM1 A;  2LCP A;  5HYD A;  1YVH A;  3GK2 A;  5HLV A;  2M9G A;  5AXI A;  4GGF C;  1SNL A;  1F4O A;  2L51 A;  3KHE A;  3BUO B;  5DKR A;  1REC A;  1TN4 A;  1BMO A;  2F3Y A;  2JQ6 A;  3I5F B;  2BKH B;  1R2U A;  1GGZ A;  1DGV A;  3EKJ A;  1NX0 A;  1IRJ A;  3VRR A;  1MUX A;  4CPV A;  4OV2 A;  3A8R A;  4MRY A;  1XFU O;  1K94 A;  4CID A;  1AJ4 A;  3PM8 A;  3AKB A;  1FW4 A;  2ZN9 A;  4M2P A;  2JOJ A;  3SG5 A;  1SL9 A;  1F54 A;  2NXQ A;  1IG5 A;  3GK4 X;  2ISD A;  1IGV A;  3EK8 A;  2LAP A;  4ORC B;  3I5I C;  2GV5 A;  4PDZ A;  2K7B A;  1KQM C;  2BBM A;  5HKZ A;  5TNC A;  2KFF A;  2KAV A;  2LVI A;  1L7Z A;  1KFU S;  1OMR A;  1Y0V H;  3SJS A;  1YVL A;  1D1O A;  1NYA A;  1QLK A;  2H61 A;  2ZND A;  1B8R A;  1X02 A;  2K2F A;  2Y4Q A;  1JWD A;  2IS9 A;  4AOM A;  2L4I A;  2JTT A;  2OS8 C;  2I18 A;  3D0Y B;  4GPL B;  4PHM A;  2WOR A;  3CLN A;  4CFR A;  1HQV A;  2VRG A;  1RTP 1;  2JUL A;  3FIA A;  1RK9 A;  2ZN8 A;  4GAO A;  3DVJ A;  2KAX A;  1XYD A;  3TZ1 A;  1S6I A;  3BXK A;  3PN7 C;  2JNX A;  4WRI A;  2K7C A;  2JC2 A;  5DKN A;  4MN0 A;  4YGD B;  2L5X B;  2LV7 A;  3BOW A;  2L4H A;  1TNQ A;  5HKW A;  3I5H C;  2KGB C;  1BR4 B;  3FWB A;  2FOT A;  2CTN A;  1M39 A;  4PCW A;  1SBJ A;  1U5I B;  3ZWH A;  3TUY C;  1CLL A;  3O78 A;  1CDP A;  3BQ3 A;  1SCV A;  1GJY A;  2O5G A;  3ZNI A;  1E8A A;  2COL B;  4D1E A;  1UWO A;  3GK1 A;  1A75 B;  2GGM A;  2CCM A;  2PVB A;  2JPT A;  4HRH A;  1SY9 A;  1W7J B;  1BU3 A;  1OE9 B;  2M1K B;  2LAN A;  1XFZ O;  3SG6 A;  2MJW B;  1SW8 A;  1YX8 A;  2KFG A;  1LKJ A;  1W7I B;  3WXA A;  1CFP A;  1AUI B;  5ER5 A;  4QJ5 B;  4PE0 A;  3M0W A;  1SKT A;  1MXL C;  4E68 A;  1KFX L;  1QX7 A;  1NCX A;  3LK0 A;  2KI6 D;  3NXA A;  1NWD A;  4FQO A;  3NSL A;  3KF9 A;  3SG3 A;  1CDL A;  2LP3 A;  1DF0 A;  3QRX A;  1JBA A;  3AKA A;  1XK4 A;  2JT3 A;  1TRF A;  2KI4 C;  2JXL A;  1CKK A;  2MAZ A;  2HET A;  3JVT B;  1F8H A;  1RRO A;  1WDC B;  2ZRS A;  1AJ5 A;  1K90 D;  1M46 A;  1QIW A;  1UHJ A;  2ZRT A;  4MZK A;  4XJK A;  4AQJ A;  4AQI A;  1F70 A;  1N2D A;  3SG4 A;  1H4B A;  1IH0 A;  2EC6 B;  2NZ0 A;  3PLF B;  5CSN A;  3OX5 A;  2PMY A;  3WNX B;  1JC2 A;  1NX3 A;  5FYX A;  1KSM A;  4ZCU A;  2GGZ A;  4A4C A;  3TS5 C;  4C0J A;  1N0Y A;  1NIW A;  1Y1X A;  2M8U A;  1EL4 A;  3SG2 A;  2LNK A;  1K9P A;  3NSK A;  1YX7 A;  3TDZ A;  3H4S E;  1ZFS A;  1PK0 D;  1UHN A;  3VRQ A;  2K61 A;  1UUS A;  3CR4 X;  1A29 A;  2BL0 C;  1K95 A;  1SMG A;  1JF2 A;  5CSJ A;  1B1G A;  2JNF A;  3LL8 B;  2MRD A;  3FS7 A;  4ORB B;  2MBX A;  5F6T A;  1SCM C;  1DJG A;  2KBI A;  1S3P A;  1NX1 A;  3VRP A;  1WRZ A;  2JXC A;  2V53 A;  4GBA A;  4P5O E;  1S5G Z;  1YRT B;  2BCX A;  1MQ1 A;  5JOL A;  5ER4 X;  2LVJ A;  2K2A A;  2M3W A;  3KO0 A;  1KK7 Z;  1KSO A;  1OOJ A;  1RFJ A;  1KFX S;  4YI9 A;  2HPS A;  1XK4 C;  4Q04 A;  3EVR A;  1CFF A;  2KBM A;  1DJI A;  4MLW A;  2O60 A;  1CLM A;  2JU0 A;  4YGB B;  2L50 A;  4MZL A;  1QX2 A;  3A4U B;  2WOS A;  4CLN A;  1IQ3 A;  1BR1 B;  3C1V A;  1QIV A;  3I5G C;  1JUO A;  3WHT B;  2M49 B;  1B47 A;  1LXF C;  3D0Y A;  5KU1 A;  1CDN A;  1EG3 A;  1PVA A;  2LLU A;  2PSR A;  1HT9 A;  3I5I B;  1B9A A;  1S5G Y;  1V1F A;  2BE6 A;  2D8N A;  4TNC A;  1KK7 Y;  5IBW A;  1IWQ A;  2KFH A;  1XVJ A;  1CB1 A;  2HF5 A;  2JT8 A;  1FBV A;  2G9B A;  3PAT A;  2SCP A;  4CFQ A;  4ZCV A;  1BOD A;  2I2R E;  1EH2 A;  2L2E A;  1B7T Z;  1L2O C;  4DUQ A;  2AMI A;  1NCY A;  2KYF A;  2KNE A;  1MWN A;  1BG1 A;  1BOC A;  5AAN A;  1XFX O;  4BY5 A;  1TCO B;  3LK1 A;  1U5I A;  5AFP A;  1XO5 A;  2WCF A;  2ZNE A;  1AVS A;  2KAY A;  2LMV A;  1NCZ A;  2I94 A;  1M63 B;  3PN7 B;  2WCE A;  2ZFD A;  3CS1 A;  3JTD C;  3CGA A;  4UPG A;  3IQO A;  1A75 A;  2K8M B;  2LC5 A;  4HRG A;  2AAO A;  1C7W A;  1MHO A;  1UUR A;  2BE4 A;  2JWW A;  1KK8 C;  3OHM B;  1Q80 A;  1JSA A;  2KSP A;  2M0R A;  4OCI A;  4DRW A;  1G8I A;  1IJ5 A;  1DVI A;  1PRW A;  3O4Y A;  3TUY B;  4I5N B;  3AAJ A;  1UP5 A;  4FTG A;  2EGD A;  5G08 A;  1KWO B;  1K96 A;  1JFJ A;  1WY9 A;  1B8C A;  3EK7 A;  1CFC A;  3BYA A;  1SPY A;  3DF0 B;  2LMT A;  1A03 A;  1CFD A;  3E3R A;  3CR2 A;  1NP8 A;  4L9M A;  2LP2 A;  2E30 A;  1N65 A;  4OKH A;  3CZT X;  1AP4 A;  1FI5 A;  1UHH A;  1S26 D;  1K93 D;  2RGI A;  1XFV O;  5KTY A;  2H61 C;  1Y6W A;  1RJV A;  3CR5 X;  4ORA B;  5I2O A;  4PHK A;  1TIZ A;  2KQY A;  2KI6 C;  2F33 A;  5JJG A;  1ZMZ A;  4GNK B;  1SL8 A;  1CMG A;  2BCB A;  4MEW A;  2WCB A;  1QV1 A;  5B8I B;  4I5J A;  4HSZ A;  1S6J A;  1WLZ A;  5AEQ A;  1DT7 B;  1KCY A;  5I2Q A;  4XYN A;  4WQ2 A;  2JTZ A;  3SIB A;  5CSF A;  2LLS A;  1JF0 A;  3MSE B;  1SL7 A;  1K9U A;  4GFT A;  4N1F A;  1SYM A;  3KEV A;  4PAL A;  1G4Y R;  2KYC A;  3AAK A;  4QJ3 B;  3O2P A;  4C0L A;  2Y5I A;  1SR6 B;  2JZI A;  1BT6 A;  1YUU A;  4GGF A;  4DS7 A;  1QXP A;  3VGO A;  4GGN A;  1NX2 A;  1YUR A;  1J55 A;  1YRU B;  2NLN A;  1ODB A;  2OTG C;  1OMD A;  2HQ8 A;  1K8U A;  1LVC D;  4F0Z B;  1OSA A;  1DJX A;  2PAL A;  1J7R A;  1ZOT B;  2BL0 B;  2K7D A;  1F4Q A;  3IQQ A;  3SG7 A;  1ALW A;  3EVU A;  1QLS A;  1QAT A;  1TCF A;  2R2I A;  1MXE A;  3D10 A;  3HCM A;  1XA5 A;  1IQ5 A;  1DJZ A;  1BF5 A;  1C07 A;  1Y1A A;  2WC8 A;  1FF1 A;  5BPJ A;  1V1G A;  3BUX B;  3NSO A;  1J1E A;  2FCE A;  3LLE A;  4JPZ B;  2DOQ A;  1NUB A;  1A2X A;  1GGW A;  2LM5 A;  4NDC A;  1DTL A;  2NCP A;  1DMO A;  1DJW A;  1OQP A;  1ZUZ A;  1OZO A;  1YUT A;  2MA2 A;  3I5G B;  1QVI Z;  4NDB A;  4YBH B;  1F71 A;  2KOT A;  1AK8 A;  1IJ6 A;  1YTZ C;  1TNX A;  3ICB A;  2LE9 B;  4HRE E;  1KQM B;  2FJU B;  3EVV A;  3VRO A;  2LLT A;  1ALV A;  1S6C A;  3I5F C;  1DGU A;  2BEC A;  3BUN B;  1J7Q A;  2A4J A;  3DD4 A;  4M2Q A;  4YGE B;  5I2L A;  4YRU A;  4PE7 A;  1M45 A;  1FI6 A;  1RWY A;  1L2O B;  2BKI B;  4PHN A;  1SK6 D;  1QS7 A;  5J3X A;  1YR5 A;  1QX5 B;  1S36 A;  1MF8 B;  4OR9 B;  2JT0 A;  1QVI Y;  2OS8 B;  3NSI A;  2KHN A;  3DVM A;  3O6B A;  2F2O A;  4IL1 A;  2PAS A;  2EHB A;  2Q4U A;  1AHR A;  1BLQ A;  1PAL A;  2OPO A;  2L98 A;  4DCK A;  1B8L A;  4MVF A;  3JTD B;  2PRU A;  1CM4 A;  1LIN A;  2CNP A;  3DF0 A;  1M31 A;  1K2H A;  2K0J A;  2I7A A;  3FWC A;  3K21 A;  1K9K A;  4A4B A;  1KK8 B;  1WRL A;  2FCD A;  2M29 A;  2BCA A;  4WQ3 A;  2LHI A;  3I5H B;  3OB1 B;  1B7T Y;  1QJT A;  1PVB A;  1CMF A;  1DJH A;  1TNP A;  3OX6 A;  4ETO A;  4JQ0 D;  4PE1 A;  1CDM A;  4N1G A;  3SIA A;  1JFK A;  2MLF C;  4YGC B;  2Q91 A;  5D7F A;  1DJY A;  1YUS A;  4QJ4 B;  2LHL A;  4GUK A;  4DIR A;  2NCO A;  4I5K A;  5DKQ A;  1J7O A;  2KGR A;  1QTX A;  2KQ6 A;  1UHK A;  3DVE A;  4MSP A;  2WND A;  5CSI A;  1WRK A;  1H8B A;  1A4P A;  5CPV A;  1EG4 A;  2LVK A;  1B4C A;  1OZS A;  1CNP A;  3F45 A;  3KPX A;  4NQG A;  1C7V A;  2HQW A;  4JWQ A;  4N5X A;  1XFW O;  3GOF A;  3PSR A;  1BJF A;  3IF7 A;  1SRA A;  2SAS A;  3VRN A;  1IKU A;  5K89 A;  1XFY O;  2G2B A;  2H2K A;  1OMV A;  2LUX A;  1KWO C;  1NSH A;  2MLE C;  4YI8 A;  3TDI A;  1UHI A;  2M97 A;  3TDU A;  1LA0 A;  1PSR A;  2KI4 B;  1TTX A;  4M2O A;  2E6W A;  3EKH A;  1FPW A;  1EXR A;  3BOW B;  4U8D A;  5HLO A;  5PAL A;  2L0P A;  1CTR A;  4MZJ A;  1F55 A;  4YGA A;  1NPQ A;  3CTN A;  1WLM A;  1MR8 A;  1S1E A;  4PHJ A;  3TS5 B;  1R6P A;  2F2P A;  2LMU A;  2JRF A;  4USL A;  5AER A;  4C0K A;  2AUC A;  2OTG B;  3HX4 A;  5HKY A;  1CM1 A;  1J1D A;  1GQM A;  3RLZ A;  4MBE A;  2B1U A;  3OB2 B;  2Y1M A;  1LA3 A;  2LUC A;  1TOP A;  1EJ3 A;  1VRK A;  4OVN F;  3JVT C;  1Y1U A;  1WDC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...