1M45A

Crystal structure of mlc1p bound to iq2 of myo2p, a class v myosin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
146
structure length
142
Chain Sequence
TRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINASLASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain
publication title Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle protein
total genus 36
structure length 142
sequence length 146
ec nomenclature
pdb deposition date 2002-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m45A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m45A01
1NPQA 3KF9A 1DGVA 4MZKA 1G8IA 3OB1B 2JU0A 3TZ1A 2L51A 1NX2A 2ZRTA 2G9BA 2DOQA 1ZFSA 2EGDA 1B7TY 1SL7A 2E30A 1MWNA 4YBHB 1XFVO 1H8BA 1ZUZA 2L0PA 2PALA 3GK1A 1F4OA 3I5FB 4DS7A 2I18A 1CTRA 1KK8C 1QIWA 2JC2A 4USLA 1IJ5A 1X02A 4OKHA 1J7OA 3EK7A 4MLWA 2F3ZA 2OPOA 1KWOB 2LCPA 3ZWHA 2MA2A 3CR4X 1XK4C 2PVBA 1NX1A 1OOJA 1QS7A 1NX3A 1L2OC 1Y6WA 1UP5A 1FPWA 2BKIB 1YTZC 1S26D 2ZRSA 1GJYA 3EKJA 1AVSA 5FYXA 1WRKA 3JTDC 3CR2A 5I8NA 1Q80A 1IQ5A 2MAZA 1FF1A 1J1DA 3LK0A 2KFFA 1S6CA 4P2YB 4MZLA 4OVNF 3TDIA 1PK0D 1QASA 1W7JB 1OMRA 1A2XA 2MLFC 3TS5B 5JOLA 2JXLA 2GV5A 4GUKA 4L9MA 4YI9A 1FI6A 4HREE 1AUIB 4GFTA 4GPLB 2EC6B 2M29A 3I5HC 1CMGA 1C7VA 2KQ6A 1UHKA 1PSRA 1YUUA 1LA0A 1KFXS 4CLNA 1BLQA 4XYNA 2H61A 4YGDB 1F71A 3BOWB 4YRUA 4CIDA 1TRFA 2M8UA 2VRGA 3IF7A 1QXPA 1HQVA 3K21A 1G4YR 2KI6D 5J3XA 1IG5A 4JQ0D 2LVJA 3CTNA 1SBJA 3A4UB 3AAJA 3LL8B 1K90D 2JXCA 1JFKA 1CFDA 1XA5A 1CMFA 2G2BA 3DVKA 2LLTA 2KSPA 5HKWA 1GGZA 1MXLC 2KAYA 3TUYC 2K2AA 4HSZA 3DD4A 3LCPC 4CPVA 1GGWA 3OP0A 4OCIA 3HX4A 1J1EA 1S6JA 2Y1NA 1AP4A 2LANA 1XFUO 4CFRA 1V1GA 2GGZA 2HPSA 3NSIA 4PE0A 1M39A 5HLVA 1JSAA 4YGAA 3DVEA 1EXRA 3CZTX 2LC5A 5ER5A 4BY5A 4C0JA 2CXJA 2PRUA 2EHBA 2V53A 2BBMA 5KU1A 3CGAA 2AAOA 1Y1XA 1YUTA 1TIZA 2K7OA 3DVMA 4BY4A 4FTGA 3MSEB 1SR6B 1LKJA 1CLBA 1EG4A 1F4QA 4ZCUA 1B9AA 1IWQA 1BOCA 1RJVA 1FBVA 3O78A 1N2DA 4DUQA 1UURA 1M63B 1K9UA 1K8UA 1WDCC 1DF0B 2HETA 1OMDA 1B1GA 1U5IB 5CSNA 1RECA 2WCEA 2GGMA 2D8NA 1ALVA 1SNLA 1W7IB 1NCXA 2JT8A 1SYMA 1WLZA 2WC8A 2KNEA 3NSOA 1YX7A 3SG2A 1B8LA 2OS8C 2H61C 2OTGB 5CSFA 4ZCVA 4MBEA 3I5IB 3BUOB 2M3WA 4WQ2A 1IJ6A 2B1UA 1EG3A 4Q04A 4OV2A 4R1EA 3NSKA 3O6BA 1PALA 2BCAA 1IGVA 5AANA 3OB2B 1KK7Y 1LVCD 1QVIZ 1A03A 4JWQA 5K89A 1NCYA 2JOJA 1CDMA 1WLMA 3NXAA 1QX5B 2BCBA 2JPTA 2K2FA 2BL0C 3VRRA 1K95A 1J7RA 1KCYA 1XFYO 2R2IA 1KQMB 3PN7C 2LVIA 1S6IA 3D0YB 1AK8A 1JWDA 1B4CA 2F8PA 4F0ZB 1PULA 1SKTA 1F8HA 1DGUA 3HCMA 3GK2A 1TN4A 5B8IB 4YI8A 1KSMA 1TOPA 3SG3A 4GBAA 5BPJA 1M31A 1SCMC 3E3RA 1BODA 2JQ6A 3SIBA 1HT9A 2M1UA 1IKUA 1NWDA 1KFXL 2QACA 3DVJA 1TNPA 3FWCA 1KFUL 4ORAB 1KK8B 4GAOA 2HQWA 2LLUA 1RFJA 2WNDA 3NSLA 1QV1A 3JVTC 1C07A 4DCKA 3BUXB 1B8CA 1YVHA 1OQPA 3C1VA 1CM4A 1L2OB 3F45A 2FOTA 3KEVA 4QJ3B 2ZN8A 4I5JA 4P5OE 2LVVA 3SG4A 1QVIY 1MXEA 1TNXA 1OE9B 2K0JA 2LVKA 3JTDB 3QRXA 1A4PA 1S36A 4I5KA 3LK1A 1MR8A 5AFPA 1BR4B 5GQQC 3FS7A 1TTXA 4TNCA 2NCPA 2ISDA 2L4IA 2M49B 1YUSA 3IQQA 4NDBA 4GGNA 2IS9A 3OHMB 5I2LA 1B8RA 1KFUS 1VRKA 3I5HB 1AJ4A 3I5GC 5CPVA 4PE1A 2LLSA 3PALA 4MRYA 1DJWA 2CNPA 1LXFC 3CLNA 4MEWA 5DKQA 1LINA 2MRDA 1CDLA 2NCOA 3RM1A 3BXKA 1BJFA 4GGFA 5AXIA 1CFFA 1EL4A 4AOMA 2LMUA 2E6WA 1DMOA 3BUNB 3CR5X 2LHLA 2AMIA 4C0KA 2KYFA 3BYAA 3SG6A 2LP3A 1XFXO 2KGRA 2JTTA 1SK6D 1ZACA 4XJKA 1M46A 2ZKMX 1QX2A 5CSJA 4ICBA 1NYAA 1SRAA 2BE6A 4AQJA 3TUYB 1FW4A 4ORCB 3SJSA 4NQGA 1BR1B 3RLZA 1QTXA 4UPGA 2M7LA 1FI5A 1SPYA 1JF0A 1JUOA 4I5LB 1SL9A 3VGOA 1PVAA 1OZSA 3PLFB 1CB1A 2FJUB 2K7BA 3PFVA 1A75B 1QV0A 2WCFA 1YRTB 4I5NB 2JWWA 4OR9B 2JRFA 1J55A 2LMTA 1S1EA 3PSRA 3AAKA 2LM5A 2LUXA 1S5GZ 1Y0VH 3PATA 5AERA 3TDUA 1XK4A 2HF5A 3FIAA 2QPTA 5DKNA 1UHHA 1K96A 1WRZA 1UUSA 1OSAA 1TNWA 1WDCB 1YX8A 1DJYA 4NDCA 3KPXA 1B47A 1KSOA 2L5XB 3OX6A 1YURA 1WY9A 3EVRA 4DRWA 5I2QA 1L7ZA 4CFQA 1QJTA 2K61A 1NCZA 2L2EA 2OS8B 3O4YA 4MSPA 3WXAA 2JNFA 1QIVA 1NP8A 1XFWO 3VROA 5HLOA 4MN0A 5HKYA 3CWGA 4GGFC 1CDPA 1BF5A 2KAVA 3BOWA 4FQOA 1OZOA 2PSRA 1NSHA 2BBNA 1EH2A 1WRLA 2BL0B 4QJ5B 3O2PA 4A4BA 2KQYA 1CLLA 3WHTB 3PN7B 1F54A 5DKRA 3CS1A 1QLSA 5PALA 2KI4C 2LP2A 3BUWB 1IRJA 1JC2A 2O5GA 1YR5A 2JTZA 4M2PA 1ALWA 1S5GY 4PHMA 4PHJA 2CCMA 1XFZO 3VRQA 2LAPA 1QATA 1SCMB 2K7CA 4HRGA 2LMVA 1XO5A 1H4BA 1CDNA 1BT6A 4PE7A 1S3PA 3SG7A 4DIRA 3I5FC 4PCWA 5AEQA 4E68A 1NIWA 3EK8A 2A4JA 4N1FA 3SIAA 2BKHB 5D69A 2HQ8A 2KBMA 1AHRA 1PSBA 2LHIA 3JVTB 2F33A 3VRPA 5HKZA 4N1GA 4AQIA 1KWOC 1NUBA 2KAXA 2K8MB 2LV7A 1BG1A 1N65A 2JNXA 3D10A 2NZ0A 1UWOA 4YGCB 2KBIA 2JZIA 3KHEA 4MRXA 4PHKA 1A75A 2SCPA 4WQ3A 4WRIA 2PASA 1A29A 4NDDA 2TN4A 1CKKA 2KYCA 2WORA 3EK4A 1SW8A 4M2OA 2LNKA 4PE4A 1DF0A 5D7FA 3TS5C 1XVJA 2MHHA 3TDZA 1NX0A 1BU3A 3I5GB 1CFCA 1R6PA 1U5IA 2AUCA 3H4SE 2EC6C 1GQMA 2I94A 2O60A 2SASA 1IH0A 2I2RE 5CSIA 2BECA 1RWYA 2BCXA 2M0RA 2NLNA 3BQ3A 3BUMB 4N5XA 3DF0B 1CM1A 4PDZA 4A4CA 2WCBA 1ZOTB 2MJWB 1D1OA 2WOSA 3EVVA 3WNXB 4MVFA 1Y1UA 1DVIA 5KTYA 1C7WA 1DJHA 1K94A 2KOTA 3KO0A 1CFPA 2Q91A 1G33A 2M9GA 4HRHA 3EVUA 2LE9B 4JPZB 3D0YA 2JULA 1K9KA 3ZNIA 1LA3A 1DJZA 1SCVA 1UHIA 4YGEB 1QLKA 3IQOA 2F3YA 3OX5A 1K2HA 5F6TA 2BE4A 2K7DA 1YVLA 1Y1AA 1K9PA 1CLMA 1QX7A 4ORBB 1RTP1 1TNQA 2MLEC 1UHJA 5TNCA 2CTNA 4PALA 4PHNA 4U8DA 4D1EA 2KFGA 3LLEA 2MBXA 1JFJA 2NXQA 3GK4X 1SMGA 3VRNA 5G08A 1KK7Z 2L4HA 1AJ5A 1K93D 1PVBA 2KI6C 5KSZA 2CT9A 2RGIA 3AKBA 3FWBA 3SG5A 1YRUB 2KHNA 1TCOB 1J7PA 4GNKB 1XYDA 1JBAA 2F2OA 2Y4QA 5IBWA 1F70A 4C0LA 1ZMZA 1DTLA 1ODBA 2PMYA 1SR6C 1DJIA 1F55A 3ICBA 3GOFA 1B7TZ 1EJ3A 1JF2A 2M97A 2I7AA 4QJ4B 1J7QA 2JT3A 3AKAA 1RK9A 2H2KA 2L50A 3M0WA 1PRWA 2CBLA 3EKHA 1OMVA 1IQ3A 1UHNA 2M1KB 2P6BB 1N0YA 2Q4UA 1DJXA 1BMOA 3A8RA 1CNPA 1R2UA 1MF8B 1DT7B 4M2QA 4IL1A 1RROA 2KGBC 2M7NA 2COLB 2OTGC 2L98A 2Y5IA 3I5IC 1TCFA 2ZNDA 3PM8A 2LUCA 2JT0A 2FCDA 2ZNEA 5ER4X 2Y1MA 5JJGA 4YGBB 1MUXA 5I2OA 1V1FA 1SL8A 1SY9A 2KFHA 2KDHA 2F2PA 1DJGA 1MQ1A 2FCEA 4MZJA 4ETOA 5HYDA 3WHUB 3DF0A 1KQMC 2ZN9A 2KI4B 1KQVA 1E8AA 1MHOA 4XJKB 1M45A 2ZFDA
chains in the Genus database with same CATH superfamily
1NPQA 3KF9A 1DGVA 4MZKA 4OZDA 1G8IA 1TUZA 3DXLA 2K60A 2P70A 3OB1B 2JU0A 3TZ1A 2L51A 1NX2A 2ZRTA 3D76A 2G9BA 2DOQA 1ZFSA 2EGDA 1B7TY 1DQEA 1SL7A 1MWNA 2E30A 4YBHB 1XFVO 1H8BA 1ZUZA 2L0PA 2PALA 3GK1A 1F4OA 3I5FB 4JKTA 4DS7A 2I18A 1T14A 1CTRA 3FE9A 1KK8C 1QIWA 2JC2A 1DC1A 1ORGA 4USLA 1IJ5A 1X02A 4OKHA 1J7OA 3EK7A 4MLWA 4JD9A 2F3ZA 1Z4HA 1KWOB 2LCPA 2OPOA 3ZWHA 2MA2A 3CR4X 1XK4C 2PVBA 1NX1A 1OOJA 1QS7A 1NX3A 1L2OC 1Y6WA 1UP5A 2JPOA 1FPWA 3RZSA 2BKIB 1YTZC 1S26D 2ZRSA 1GJYA 3EKJA 1AVSA 5FYXA 1WRKA 3JTDC 3CR2A 5EL2A 1Q80A 1IQ5A 2MAZA 5I8NA 2P71A 1FF1A 1J1DA 3LK0A 2KFFA 1S6CA 4P2YB 4MZLA 2QEHA 4OVNF 3TDIA 1PK0D 1QASA 1W7JB 1OMRA 1A2XA 2MLFC 3TS5B 5JOLA 2JXLA 2GV5A 4GUKA 4L9MA 4YI9A 3VB1A 1FI6A 4HREE 1AUIB 4GFTA 4GPLB 2EC6B 2M29A 3I5HC 3L4LA 1CMGA 1C7VA 3S0EA 2KQ6A 1UHKA 1PSRA 1YUUA 1LA0A 1KFXS 4CLNA 1BLQA 4XYNA 3OGNA 2H61A 4YGDB 1F71A 3BOWB 4YRUA 4CIDA 1TRFA 2M8UA 3L4AA 2VRGA 3IF7A 1QXPA 1HQVA 3SS5A 2WCLA 3SS3A 3K21A 1G4YR 2KI6D 5J3XA 1IG5A 2H8VA 4JQ0D 2LVJA 3CTNA 1SBJA 3A4UB 3AAJA 3LL8B 1K90D 2JXCA 1QWVA 1JFKA 3DYEA 1CFDA 1XA5A 3BFHA 1CMFA 2G2BA 3R1VA 3DVKA 2LLTA 4IJ7A 2WCHA 3S0DA 2KSPA 5HKWA 1GGZA 1OOHA 1MXLC 2KAYA 3TUYC 3CYZA 2K2AA 2WCKA 4HSZA 3DD4A 3CZ0A 3LCPC 2BNXA 4CPVA 3OP0A 1GGWA 4OCIA 1P28A 3HX4A 1J1EA 1S6JA 2Y1NA 1AP4A 2LANA 1XFUO 4CFRA 1V1GA 2GGZA 2HPSA 3NSIA 4PE0A 1M39A 5HLVA 1JSAA 4YGAA 3DVEA 1EXRA 3CZTX 3SS4A 2PQLA 2LC5A 5ER5A 4BY5A 4C0JA 2CXJA 2PRUA 2EHBA 2V53A 2BBMA 3QMEA 5KU1A 3B6XA 3CGAA 2AAOA 1Y1XA 1YUTA 1TIZA 2K7OA 1SSEB 3DVMA 4BY4A 4FTGA 3MSEB 1SR6B 1LKJA 3IVTA 1EG4A 1F4QA 3OBVA 4ZCUA 1B9AA 1IWQA 1CLBA 1BOCA 1RJVA 1FBVA 3O78A 1N2DA 4DUQA 1UURA 1M63B 1K9UA 1K8UA 1WDCC 1DF0B 2HETA 1OMDA 1B1GA 1U5IB 5CSNA 1RECA 2WCEA 2GGMA 2D8NA 1ALVA 1SNLA 3B87A 3FE8A 1W7IB 1NCXA 2JT8A 1SYMA 1WLZA 2WC8A 1CFCA 2KNEA 3NSOA 1YX7A 3SG2A 1B8LA 2OS8C 2H61C 2OTGB 5CSFA 4ZCVA 4MBEA 3I5IB 3BUOB 2M3WA 4WQ2A 1IJ6A 2B1UA 1EG3A 4Q04A 4OV2A 4R1EA 3NSKA 3O6BA 3B88A 1PALA 2BCAA 1IGVA 5AANA 3OB2B 1C3YA 1KK7Y 1LVCD 1QVIZ 1A03A 4JWQA 5K89A 1NCYA 2JOJA 1OW4A 4INWA 2YGUA 1CDMA 1WLMA 3NXAA 1QX5B 2BCBA 2JPTA 2K2FA 2BL0C 2QEOA 3VRRA 1GM0A 1K95A 1J7RA 1KCYA 1XFYO 2R2IA 1KQMB 3PN7C 2LVIA 1S6IA 3D0YB 1AK8A 4PT1A 1B4CA 1JWDA 1Z2CB 2F8PA 4F0ZB 1PULA 1SKTA 1F8HA 1DGUA 3HCMA 3GK2A 1TN4A 5B8IB 4YI8A 1KSMA 1TOPA 3SG3A 4GBAA 5BPJA 2WC6A 1M31A 1SCMC 3E3RA 1BODA 3N7HA 2JQ6A 3SIBA 1HT9A 2M1UA 1IKUA 1NWDA 1KFXL 2QACA 3DVJA 1TNPA 3FWCA 1KFUL 4ORAB 1KK8B 3UNWA 4GAOA 2HQWA 2LLUA 1RFJA 2WNDA 3NSLA 1QV1A 3JVTC 1C07A 4DCKA 3BUXB 1B8CA 1YVHA 1OQPA 3C1VA 1CM4A 1L2OB 3F45A 2FOTA 3KEVA 2WC5A 4QJ3B 2ZN8A 4I5JA 4P5OE 2LVVA 3SG4A 3PJIA 1QVIY 1MXEA 1TNXA 1OE9B 2K0JA 2L2CA 2LVKA 3JTDB 3QRXA 1A4PA 1S36A 4I5KA 1W9ZA 3D74A 1MR8A 3LK1A 5AFPA 1BR4B 5GQQC 3FS7A 1TTXA 2PYQA 4TNCA 2NCPA 2ISDA 2L4IA 2M49B 1YUSA 3IQQA 4NDBA 4GGNA 2IS9A 3OHMB 5I2LA 1B8RA 1KFUS 1VRKA 3I5HB 1AJ4A 3I5GC 5CPVA 4PE1A 2LLSA 3PALA 4MRYA 1DJWA 2CNPA 1LXFC 3CLNA 4MEWA 1OOIX 5DKQA 3BJHA 1LINA 2MRDA 1CDLA 2NCOA 3RM1A 3BXKA 1BJFA 4GGFA 5I94A 5AXIA 1CFFA 1EL4A 4AOMA 1DELA 2LMUA 2E6WA 1DMOA 3BUNB 3CR5X 2LHLA 2AMIA 4C0KA 2KYFA 2GTEA 2FJYA 3BYAA 3SG6A 2LP3A 1XFXO 2KGRA 2JTTA 3FE6A 1SK6D 1ZACA 4XJKA 1M46A 2ZKMX 1QX2A 5CSJA 4ICBA 1NYAA 1SRAA 2BE6A 4AQJA 3TUYB 1FW4A 4ORCB 1OOFA 3SJSA 4NQGA 1BR1B 3RLZA 1C3ZA 1QTXA 4UPGA 2M7LA 1FI5A 1SPYA 1JF0A 1JUOA 4I5LB 1SL9A 3VGOA 1PVAA 3B7AA 1OZSA 3PM2A 3PLFB 1CB1A 2FJUB 2K7BA 3EG5B 3PFVA 1A75B 1QV0A 2WCFA 1YRTB 4I5NB 2JWWA 3Q8IA 2JRFA 4OR9B 5FI6A 3CABA 1J55A 2ERBA 2QEVA 2LMTA 1S1EA 3PSRA 3AAKA 2LM5A 2LUXA 3S0FA 1S5GZ 3BFAA 1Y0VH 3PATA 5AERA 2KLEA 3TDUA 1XK4A 2HF5A 3FIAA 2QPTA 5DKNA 1UHHA 1K96A 1WRZA 1UUSA 1OSAA 1TNWA 1WDCB 1YX8A 1DJYA 4NDCA 3KPXA 5D3OA 1B47A 1KSOA 2L5XB 3OX6A 1YURA 1WY9A 3EVRA 3NHTA 4DRWA 5I2QA 1L7ZA 4CFQA 1QJTA 2K61A 1NCZA 2L2EA 2OS8B 3O4YA 4MSPA 3WXAA 2JNFA 1QIVA 3D78A 5FI7A 1NP8A 1XFWO 3VROA 5HLOA 4MN0A 5HKYA 3CWGA 4GGFC 1CDPA 1BF5A 1OOGA 2KAVA 3BOWA 3S0BA 4FQOA 1OZOA 2PSRA 1NSHA 2BBNA 1EH2A 1WRLA 2BL0B 4KYNA 4QJ5B 3O2PA 4A4BA 2KQYA 1CLLA 3WHTB 3PN7B 1F54A 1IIOA 5DKRA 3CS1A 1QLSA 5PALA 2KI4C 2LP2A 3BUWB 1IRJA 4INXA 2O5GA 1JC2A 1TWOA 1YR5A 2JTZA 1ALWA 1S5GY 4M2PA 4PHMA 4PHJA 2CCMA 1XFZO 3VRQA 2LAPA 1QATA 1SCMB 2K7CA 3R1PA 4HRGA 2LMVA 1XO5A 1H4BA 2L5YA 1CDNA 1BT6A 4PE7A 1S3PA 3SG7A 4DIRA 3I5FC 4PCWA 5AEQA 4E68A 1NIWA 5DICA 3EK8A 2A4JA 4N1FA 3SIAA 2BKHB 5D69A 2HQ8A 2KBMA 5FI2A 1AHRA 1PSBA 2LHIA 2QEBA 3JVTB 2F33A 3S0GA 3VRPA 5HKZA 4N1GA 4AQIA 1KWOC 1NUBA 2KAXA 2K8MB 2LV7A 3BFBA 1BG1A 1N65A 2JNXA 3D10A 2NZ0A 1UWOA 4YGCB 2KBIA 2WCJA 2JZIA 3KHEA 4MRXA 4PHKA 1A75A 2SCPA 3D77A 4WQ3A 4WRIA 2PASA 1A29A 3DY9A 4NDDA 2TN4A 1CKKA 2KYCA 2WORA 3EK4A 4F7FA 1SW8A 1DEKA 4M2OA 2LNKA 4PE4A 1DF0A 5D7FA 3TS5C 1XVJA 2MHHA 3TDZA 1NX0A 1BU3A 2QDIA 3B86A 1R6PA 1U5IA 2AUCA 3I5GB 3H4SE 2EC6C 1GQMA 2I94A 2O60A 2SASA 1IH0A 1TUJA 2I2RE 5CSIA 2BECA 2KLDA 3NGVA 1RWYA 2BCXA 2M0RA 2NLNA 3BQ3A 3BUMB 2WCMA 4N5XA 3DF0B 1CM1A 3K1EA 3UO9A 4PDZA 4A4CA 2WCBA 1ZOTB 2MJWB 1D1OA 2WOSA 3EVVA 3WNXB 3R72A 3L47A 4MVFA 1Y1UA 1DVIA 5KTYA 3DZTA 1C7WA 1DJHA 1K94A 2KOTA 3CZ1A 3KO0A 2Q91A 1G33A 1CFPA 2M9GA 4HRHA 3EVUA 2LE9B 4JPZB 3D0YA 2JULA 1K9KA 3ZNIA 1LA3A 3D73A 1DJZA 1SCVA 1UHIA 4YGEB 1QLKA 3IQOA 2F3YA 3OX5A 1K2HA 5F6TA 1LS8A 2BE4A 2K7DA 1YVLA 1Y1AA 2KPHA 1K9PA 1CLMA 1QX7A 4ORBB 1RTP1 1TNQA 2MLEC 3D75A 1UHJA 5TNCA 2CTNA 4PALA 4PHNA 4U8DA 4D1EA 2KFGA 3LLEA 2MBXA 1JFJA 2NXQA 3S0AA 3GK4X 1SMGA 3VRNA 5G08A 1KK7Z 2L4HA 1AJ5A 1K93D 1PVBA 2KI6C 5KSZA 2CT9A 2RGIA 3AKBA 3FWBA 3SG5A 1YRUB 2KHNA 1TCOB 1J7PA 4GNKB 1XYDA 1JBAA 2F2OA 2Y4QA 5IBWA 1F70A 4C0LA 1ZMZA 1DTLA 1ODBA 2PMYA 1SR6C 1DJIA 1F55A 3ICBA 3GOFA 1B7TZ 1EJ3A 1JF2A 2M97A 2I7AA 4QJ4B 1J7QA 2JT3A 3AKAA 1RK9A 2H2KA 2L50A 3M0WA 1PRWA 2CBLA 3EKHA 1OMVA 4FQTA 1IQ3A 1UHNA 2M1KB 2P6BB 1N0YA 2Q4UA 1DJXA 1BMOA 3A8RA 1CNPA 1R2UA 1MF8B 3V2LA 1DT7B 4M2QA 3CZ2A 4IL1A 1RROA 2KGBC 2M7NA 2COLB 2OTGC 2L98A 2Y5IA 3R1OA 5HL1A 3I5IC 1TCFA 2ZNDA 3PM8A 3NHIA 2LUCA 2JT0A 1XFRA 2FCDA 2ZNEA 2BAPA 5ER4X 2Y1MA 5JJGA 4YGBB 1MUXA 3CDNA 5I2OA 1V1FA 1SL8A 1SY9A 2KFHA 2KDHA 2F2PA 1DJGA 1MQ1A 3O4XA 2FCEA 4MZJA 4ETOA 5HYDA 3WHUB 3DF0A 1KQMC 2ZN9A 2KI4B 1KQVA 1E8AA 1MHOA 4XJKB 1M45A 2ZFDA
chains in the Genus database with same CATH topology
1NPQA 3KF9A 1DGVA 4MZKA 1G8IA 3OB1B 2JU0A 3TZ1A 2L51A 1NX2A 2ZRTA 2G9BA 2DOQA 1ZFSA 2EGDA 1B7TY 1SL7A 2E30A 1MWNA 4YBHB 1XFVO 1H8BA 1ZUZA 2L0PA 2PALA 3GK1A 1F4OA 3I5FB 4DS7A 2I18A 1CTRA 1KK8C 1QIWA 2JC2A 4USLA 1IJ5A 1X02A 4OKHA 1J7OA 3EK7A 4MLWA 2F3ZA 2OPOA 1KWOB 2LCPA 3ZWHA 2MA2A 3CR4X 1XK4C 2PVBA 1NX1A 1OOJA 1QS7A 1NX3A 1L2OC 1Y6WA 1UP5A 1FPWA 2BKIB 1YTZC 1S26D 2ZRSA 1GJYA 3EKJA 1AVSA 5FYXA 1WRKA 3JTDC 3CR2A 5I8NA 1Q80A 1IQ5A 2MAZA 1FF1A 1J1DA 3LK0A 2KFFA 1S6CA 4P2YB 4MZLA 4OVNF 3TDIA 1PK0D 1QASA 1W7JB 1OMRA 1A2XA 2MLFC 3TS5B 5JOLA 2JXLA 2GV5A 4GUKA 4L9MA 4YI9A 1FI6A 4HREE 1AUIB 4GFTA 4GPLB 2EC6B 2M29A 3I5HC 1CMGA 1C7VA 2KQ6A 1UHKA 1PSRA 1YUUA 1LA0A 1KFXS 4CLNA 1BLQA 4XYNA 2H61A 4YGDB 1F71A 3BOWB 4YRUA 4CIDA 1TRFA 2M8UA 2VRGA 3IF7A 1QXPA 1HQVA 3K21A 1G4YR 2KI6D 5J3XA 1IG5A 4JQ0D 2LVJA 3CTNA 1SBJA 3A4UB 3AAJA 3LL8B 1K90D 2JXCA 1JFKA 1CFDA 1XA5A 1CMFA 2G2BA 3DVKA 2LLTA 2KSPA 5HKWA 1GGZA 1MXLC 2KAYA 3TUYC 2K2AA 4HSZA 3DD4A 3LCPC 4CPVA 1GGWA 3OP0A 4OCIA 3HX4A 1J1EA 1S6JA 2Y1NA 1AP4A 2LANA 1XFUO 4CFRA 1V1GA 2GGZA 2HPSA 3NSIA 4PE0A 1M39A 5HLVA 1JSAA 4YGAA 3DVEA 1EXRA 3CZTX 2LC5A 5ER5A 4BY5A 4C0JA 2CXJA 2PRUA 2EHBA 2V53A 2BBMA 5KU1A 3CGAA 2AAOA 1Y1XA 1YUTA 1TIZA 2K7OA 3DVMA 4BY4A 4FTGA 3MSEB 1SR6B 1LKJA 1CLBA 1EG4A 1F4QA 4ZCUA 1B9AA 1IWQA 1BOCA 1RJVA 1FBVA 3O78A 1N2DA 4DUQA 1UURA 1M63B 1K9UA 1K8UA 1WDCC 1DF0B 2HETA 1OMDA 1B1GA 1U5IB 5CSNA 1RECA 2WCEA 2GGMA 2D8NA 1ALVA 1SNLA 1W7IB 1NCXA 2JT8A 1SYMA 1WLZA 2WC8A 2KNEA 3NSOA 1YX7A 3SG2A 1B8LA 2OS8C 2H61C 2OTGB 5CSFA 4ZCVA 4MBEA 3I5IB 3BUOB 2M3WA 4WQ2A 1IJ6A 2B1UA 1EG3A 4Q04A 4OV2A 4R1EA 3NSKA 3O6BA 1PALA 2BCAA 1IGVA 5AANA 3OB2B 1KK7Y 1LVCD 1QVIZ 1A03A 4JWQA 5K89A 1NCYA 2JOJA 1CDMA 1WLMA 3NXAA 1QX5B 2BCBA 2JPTA 2K2FA 2BL0C 3VRRA 1K95A 1J7RA 1KCYA 1XFYO 2R2IA 1KQMB 3PN7C 2LVIA 1S6IA 3D0YB 1AK8A 1JWDA 1B4CA 2F8PA 4F0ZB 1PULA 1SKTA 1F8HA 1DGUA 3HCMA 3GK2A 1TN4A 5B8IB 4YI8A 1KSMA 1TOPA 3SG3A 4GBAA 5BPJA 1M31A 1SCMC 3E3RA 1BODA 2JQ6A 3SIBA 1HT9A 2M1UA 1IKUA 1NWDA 1KFXL 2QACA 3DVJA 1TNPA 3FWCA 1KFUL 4ORAB 1KK8B 4GAOA 2HQWA 2LLUA 1RFJA 2WNDA 3NSLA 1QV1A 3JVTC 1C07A 4DCKA 3BUXB 1B8CA 1YVHA 1OQPA 3C1VA 1CM4A 1L2OB 3F45A 2FOTA 3KEVA 4QJ3B 2ZN8A 4I5JA 4P5OE 2LVVA 3SG4A 1QVIY 1MXEA 1TNXA 1OE9B 2K0JA 2LVKA 3JTDB 3QRXA 1A4PA 1S36A 4I5KA 3LK1A 1MR8A 5AFPA 1BR4B 5GQQC 3FS7A 1TTXA 4TNCA 2NCPA 2ISDA 2L4IA 2M49B 1YUSA 3IQQA 4NDBA 4GGNA 2IS9A 3OHMB 5I2LA 1B8RA 1KFUS 1VRKA 3I5HB 1AJ4A 3I5GC 5CPVA 4PE1A 2LLSA 3PALA 4MRYA 1DJWA 2CNPA 1LXFC 3CLNA 4MEWA 5DKQA 1LINA 2MRDA 1CDLA 2NCOA 3RM1A 3BXKA 1BJFA 4GGFA 5AXIA 1CFFA 1EL4A 4AOMA 2LMUA 2E6WA 1DMOA 3BUNB 3CR5X 2LHLA 2AMIA 4C0KA 2KYFA 3BYAA 3SG6A 2LP3A 1XFXO 2KGRA 2JTTA 1SK6D 1ZACA 4XJKA 1M46A 2ZKMX 1QX2A 5CSJA 4ICBA 1NYAA 1SRAA 2BE6A 4AQJA 3TUYB 1FW4A 4ORCB 3SJSA 4NQGA 1BR1B 3RLZA 1QTXA 4UPGA 2M7LA 1FI5A 1SPYA 1JF0A 1JUOA 4I5LB 1SL9A 3VGOA 1PVAA 1OZSA 3PLFB 1CB1A 2FJUB 2K7BA 3PFVA 1A75B 1QV0A 2WCFA 1YRTB 4I5NB 2JWWA 4OR9B 2JRFA 1J55A 2LMTA 1S1EA 3PSRA 3AAKA 2LM5A 2LUXA 1S5GZ 1Y0VH 3PATA 5AERA 3TDUA 1XK4A 2HF5A 3FIAA 2QPTA 5DKNA 1UHHA 1K96A 1WRZA 1UUSA 1OSAA 1TNWA 1WDCB 1YX8A 1DJYA 4NDCA 3KPXA 1B47A 1KSOA 2L5XB 3OX6A 1YURA 1WY9A 3EVRA 4DRWA 5I2QA 1L7ZA 4CFQA 1QJTA 2K61A 1NCZA 2L2EA 2OS8B 3O4YA 4MSPA 3WXAA 2JNFA 1QIVA 1NP8A 1XFWO 3VROA 5HLOA 4MN0A 5HKYA 3CWGA 4GGFC 1CDPA 1BF5A 2KAVA 3BOWA 4FQOA 1OZOA 2PSRA 1NSHA 2BBNA 1EH2A 1WRLA 2BL0B 4QJ5B 3O2PA 4A4BA 2KQYA 1CLLA 3WHTB 3PN7B 1F54A 5DKRA 3CS1A 1QLSA 5PALA 2KI4C 2LP2A 3BUWB 1IRJA 1JC2A 2O5GA 1YR5A 2JTZA 4M2PA 1ALWA 1S5GY 4PHMA 4PHJA 2CCMA 1XFZO 3VRQA 2LAPA 1QATA 1SCMB 2K7CA 4HRGA 2LMVA 1XO5A 1H4BA 1CDNA 1BT6A 4PE7A 1S3PA 3SG7A 4DIRA 3I5FC 4PCWA 5AEQA 4E68A 1NIWA 3EK8A 2A4JA 4N1FA 3SIAA 2BKHB 5D69A 2HQ8A 2KBMA 1AHRA 1PSBA 2LHIA 3JVTB 2F33A 3VRPA 5HKZA 4N1GA 4AQIA 1KWOC 1NUBA 2KAXA 2K8MB 2LV7A 1BG1A 1N65A 2JNXA 3D10A 2NZ0A 1UWOA 4YGCB 2KBIA 2JZIA 3KHEA 4MRXA 4PHKA 1A75A 2SCPA 4WQ3A 4WRIA 2PASA 1A29A 4NDDA 2TN4A 1CKKA 2KYCA 2WORA 3EK4A 1SW8A 4M2OA 2LNKA 4PE4A 1DF0A 5D7FA 3TS5C 1XVJA 2MHHA 3TDZA 1NX0A 1BU3A 3I5GB 1CFCA 1R6PA 1U5IA 2AUCA 3H4SE 2EC6C 1GQMA 2I94A 2O60A 2SASA 1IH0A 2I2RE 5CSIA 2BECA 1RWYA 2BCXA 2M0RA 2NLNA 3BQ3A 3BUMB 4N5XA 3DF0B 1CM1A 4PDZA 4A4CA 2WCBA 1ZOTB 2MJWB 1D1OA 2WOSA 3EVVA 3WNXB 4MVFA 1Y1UA 1DVIA 5KTYA 1C7WA 1DJHA 1K94A 2KOTA 3KO0A 1CFPA 2Q91A 1G33A 2M9GA 4HRHA 3EVUA 2LE9B 4JPZB 3D0YA 2JULA 1K9KA 3ZNIA 1LA3A 1DJZA 1SCVA 1UHIA 4YGEB 1QLKA 3IQOA 2F3YA 3OX5A 1K2HA 5F6TA 2BE4A 2K7DA 1YVLA 1Y1AA 1K9PA 1CLMA 1QX7A 4ORBB 1RTP1 1TNQA 2MLEC 1UHJA 5TNCA 2CTNA 4PALA 4PHNA 4U8DA 4D1EA 2KFGA 3LLEA 2MBXA 1JFJA 2NXQA 3GK4X 1SMGA 3VRNA 5G08A 1KK7Z 2L4HA 1AJ5A 1K93D 1PVBA 2KI6C 5KSZA 2CT9A 2RGIA 3AKBA 3FWBA 3SG5A 1YRUB 2KHNA 1TCOB 1J7PA 4GNKB 1XYDA 1JBAA 2F2OA 2Y4QA 5IBWA 1F70A 4C0LA 1ZMZA 1DTLA 1ODBA 2PMYA 1SR6C 1DJIA 1F55A 3ICBA 3GOFA 1B7TZ 1EJ3A 1JF2A 2M97A 2I7AA 4QJ4B 1J7QA 2JT3A 3AKAA 1RK9A 2H2KA 2L50A 3M0WA 1PRWA 2CBLA 3EKHA 1OMVA 1IQ3A 1UHNA 2M1KB 2P6BB 1N0YA 2Q4UA 1DJXA 1BMOA 3A8RA 1CNPA 1R2UA 1MF8B 1DT7B 4M2QA 4IL1A 1RROA 2KGBC 2M7NA 2COLB 2OTGC 2L98A 2Y5IA 3I5IC 1TCFA 2ZNDA 3PM8A 2LUCA 2JT0A 2FCDA 2ZNEA 5ER4X 2Y1MA 5JJGA 4YGBB 1MUXA 5I2OA 1V1FA 1SL8A 1SY9A 2KFHA 2KDHA 2F2PA 1DJGA 1MQ1A 2FCEA 4MZJA 4ETOA 5HYDA 3WHUB 3DF0A 1KQMC 2ZN9A 2KI4B 1KQVA 1E8AA 1MHOA 4XJKB 1M45A 2ZFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPQ A;  3KF9 A;  1DGV A;  4MZK A;  1G8I A;  3OB1 B;  2JU0 A;  3TZ1 A;  2L51 A;  1NX2 A;  2ZRT A;  2G9B A;  2DOQ A;  1ZFS A;  2EGD A;  1B7T Y;  1SL7 A;  2E30 A;  1MWN A;  4YBH B;  1XFV O;  1H8B A;  1ZUZ A;  2L0P A;  2PAL A;  3GK1 A;  1F4O A;  3I5F B;  4DS7 A;  2I18 A;  1CTR A;  1KK8 C;  1QIW A;  2JC2 A;  4USL A;  1IJ5 A;  1X02 A;  4OKH A;  1J7O A;  3EK7 A;  4MLW A;  2F3Z A;  2OPO A;  1KWO B;  2LCP A;  3ZWH A;  2MA2 A;  3CR4 X;  1XK4 C;  2PVB A;  1NX1 A;  1OOJ A;  1QS7 A;  1NX3 A;  1L2O C;  1Y6W A;  1UP5 A;  1FPW A;  2BKI B;  1YTZ C;  1S26 D;  2ZRS A;  1GJY A;  3EKJ A;  1AVS A;  5FYX A;  1WRK A;  3JTD C;  3CR2 A;  5I8N A;  1Q80 A;  1IQ5 A;  2MAZ A;  1FF1 A;  1J1D A;  3LK0 A;  2KFF A;  1S6C A;  4P2Y B;  4MZL A;  4OVN F;  3TDI A;  1PK0 D;  1QAS A;  1W7J B;  1OMR A;  1A2X A;  2MLF C;  3TS5 B;  5JOL A;  2JXL A;  2GV5 A;  4GUK A;  4L9M A;  4YI9 A;  1FI6 A;  4HRE E;  1AUI B;  4GFT A;  4GPL B;  2EC6 B;  2M29 A;  3I5H C;  1CMG A;  1C7V A;  2KQ6 A;  1UHK A;  1PSR A;  1YUU A;  1LA0 A;  1KFX S;  4CLN A;  1BLQ A;  4XYN A;  2H61 A;  4YGD B;  1F71 A;  3BOW B;  4YRU A;  4CID A;  1TRF A;  2M8U A;  2VRG A;  3IF7 A;  1QXP A;  1HQV A;  3K21 A;  1G4Y R;  2KI6 D;  5J3X A;  1IG5 A;  4JQ0 D;  2LVJ A;  3CTN A;  1SBJ A;  3A4U B;  3AAJ A;  3LL8 B;  1K90 D;  2JXC A;  1JFK A;  1CFD A;  1XA5 A;  1CMF A;  2G2B A;  3DVK A;  2LLT A;  2KSP A;  5HKW A;  1GGZ A;  1MXL C;  2KAY A;  3TUY C;  2K2A A;  4HSZ A;  3DD4 A;  3LCP C;  4CPV A;  1GGW A;  3OP0 A;  4OCI A;  3HX4 A;  1J1E A;  1S6J A;  2Y1N A;  1AP4 A;  2LAN A;  1XFU O;  4CFR A;  1V1G A;  2GGZ A;  2HPS A;  3NSI A;  4PE0 A;  1M39 A;  5HLV A;  1JSA A;  4YGA A;  3DVE A;  1EXR A;  3CZT X;  2LC5 A;  5ER5 A;  4BY5 A;  4C0J A;  2CXJ A;  2PRU A;  2EHB A;  2V53 A;  2BBM A;  5KU1 A;  3CGA A;  2AAO A;  1Y1X A;  1YUT A;  1TIZ A;  2K7O A;  3DVM A;  4BY4 A;  4FTG A;  3MSE B;  1SR6 B;  1LKJ A;  1CLB A;  1EG4 A;  1F4Q A;  4ZCU A;  1B9A A;  1IWQ A;  1BOC A;  1RJV A;  1FBV A;  3O78 A;  1N2D A;  4DUQ A;  1UUR A;  1M63 B;  1K9U A;  1K8U A;  1WDC C;  1DF0 B;  2HET A;  1OMD A;  1B1G A;  1U5I B;  5CSN A;  1REC A;  2WCE A;  2GGM A;  2D8N A;  1ALV A;  1SNL A;  1W7I B;  1NCX A;  2JT8 A;  1SYM A;  1WLZ A;  2WC8 A;  2KNE A;  3NSO A;  1YX7 A;  3SG2 A;  1B8L A;  2OS8 C;  2H61 C;  2OTG B;  5CSF A;  4ZCV A;  4MBE A;  3I5I B;  3BUO B;  2M3W A;  4WQ2 A;  1IJ6 A;  2B1U A;  1EG3 A;  4Q04 A;  4OV2 A;  4R1E A;  3NSK A;  3O6B A;  1PAL A;  2BCA A;  1IGV A;  5AAN A;  3OB2 B;  1KK7 Y;  1LVC D;  1QVI Z;  1A03 A;  4JWQ A;  5K89 A;  1NCY A;  2JOJ A;  1CDM A;  1WLM A;  3NXA A;  1QX5 B;  2BCB A;  2JPT A;  2K2F A;  2BL0 C;  3VRR A;  1K95 A;  1J7R A;  1KCY A;  1XFY O;  2R2I A;  1KQM B;  3PN7 C;  2LVI A;  1S6I A;  3D0Y B;  1AK8 A;  1JWD A;  1B4C A;  2F8P A;  4F0Z B;  1PUL A;  1SKT A;  1F8H A;  1DGU A;  3HCM A;  3GK2 A;  1TN4 A;  5B8I B;  4YI8 A;  1KSM A;  1TOP A;  3SG3 A;  4GBA A;  5BPJ A;  1M31 A;  1SCM C;  3E3R A;  1BOD A;  2JQ6 A;  3SIB A;  1HT9 A;  2M1U A;  1IKU A;  1NWD A;  1KFX L;  2QAC A;  3DVJ A;  1TNP A;  3FWC A;  1KFU L;  4ORA B;  1KK8 B;  4GAO A;  2HQW A;  2LLU A;  1RFJ A;  2WND A;  3NSL A;  1QV1 A;  3JVT C;  1C07 A;  4DCK A;  3BUX B;  1B8C A;  1YVH A;  1OQP A;  3C1V A;  1CM4 A;  1L2O B;  3F45 A;  2FOT A;  3KEV A;  4QJ3 B;  2ZN8 A;  4I5J A;  4P5O E;  2LVV A;  3SG4 A;  1QVI Y;  1MXE A;  1TNX A;  1OE9 B;  2K0J A;  2LVK A;  3JTD B;  3QRX A;  1A4P A;  1S36 A;  4I5K A;  3LK1 A;  1MR8 A;  5AFP A;  1BR4 B;  5GQQ C;  3FS7 A;  1TTX A;  4TNC A;  2NCP A;  2ISD A;  2L4I A;  2M49 B;  1YUS A;  3IQQ A;  4NDB A;  4GGN A;  2IS9 A;  3OHM B;  5I2L A;  1B8R A;  1KFU S;  1VRK A;  3I5H B;  1AJ4 A;  3I5G C;  5CPV A;  4PE1 A;  2LLS A;  3PAL A;  4MRY A;  1DJW A;  2CNP A;  1LXF C;  3CLN A;  4MEW A;  5DKQ A;  1LIN A;  2MRD A;  1CDL A;  2NCO A;  3RM1 A;  3BXK A;  1BJF A;  4GGF A;  5AXI A;  1CFF A;  1EL4 A;  4AOM A;  2LMU A;  2E6W A;  1DMO A;  3BUN B;  3CR5 X;  2LHL A;  2AMI A;  4C0K A;  2KYF A;  3BYA A;  3SG6 A;  2LP3 A;  1XFX O;  2KGR A;  2JTT A;  1SK6 D;  1ZAC A;  4XJK A;  1M46 A;  2ZKM X;  1QX2 A;  5CSJ A;  4ICB A;  1NYA A;  1SRA A;  2BE6 A;  4AQJ A;  3TUY B;  1FW4 A;  4ORC B;  3SJS A;  4NQG A;  1BR1 B;  3RLZ A;  1QTX A;  4UPG A;  2M7L A;  1FI5 A;  1SPY A;  1JF0 A;  1JUO A;  4I5L B;  1SL9 A;  3VGO A;  1PVA A;  1OZS A;  3PLF B;  1CB1 A;  2FJU B;  2K7B A;  3PFV A;  1A75 B;  1QV0 A;  2WCF A;  1YRT B;  4I5N B;  2JWW A;  4OR9 B;  2JRF A;  1J55 A;  2LMT A;  1S1E A;  3PSR A;  3AAK A;  2LM5 A;  2LUX A;  1S5G Z;  1Y0V H;  3PAT A;  5AER A;  3TDU A;  1XK4 A;  2HF5 A;  3FIA A;  2QPT A;  5DKN A;  1UHH A;  1K96 A;  1WRZ A;  1UUS A;  1OSA A;  1TNW A;  1WDC B;  1YX8 A;  1DJY A;  4NDC A;  3KPX A;  1B47 A;  1KSO A;  2L5X B;  3OX6 A;  1YUR A;  1WY9 A;  3EVR A;  4DRW A;  5I2Q A;  1L7Z A;  4CFQ A;  1QJT A;  2K61 A;  1NCZ A;  2L2E A;  2OS8 B;  3O4Y A;  4MSP A;  3WXA A;  2JNF A;  1QIV A;  1NP8 A;  1XFW O;  3VRO A;  5HLO A;  4MN0 A;  5HKY A;  3CWG A;  4GGF C;  1CDP A;  1BF5 A;  2KAV A;  3BOW A;  4FQO A;  1OZO A;  2PSR A;  1NSH A;  2BBN A;  1EH2 A;  1WRL A;  2BL0 B;  4QJ5 B;  3O2P A;  4A4B A;  2KQY A;  1CLL A;  3WHT B;  3PN7 B;  1F54 A;  5DKR A;  3CS1 A;  1QLS A;  5PAL A;  2KI4 C;  2LP2 A;  3BUW B;  1IRJ A;  1JC2 A;  2O5G A;  1YR5 A;  2JTZ A;  4M2P A;  1ALW A;  1S5G Y;  4PHM A;  4PHJ A;  2CCM A;  1XFZ O;  3VRQ A;  2LAP A;  1QAT A;  1SCM B;  2K7C A;  4HRG A;  2LMV A;  1XO5 A;  1H4B A;  1CDN A;  1BT6 A;  4PE7 A;  1S3P A;  3SG7 A;  4DIR A;  3I5F C;  4PCW A;  5AEQ A;  4E68 A;  1NIW A;  3EK8 A;  2A4J A;  4N1F A;  3SIA A;  2BKH B;  5D69 A;  2HQ8 A;  2KBM A;  1AHR A;  1PSB A;  2LHI A;  3JVT B;  2F33 A;  3VRP A;  5HKZ A;  4N1G A;  4AQI A;  1KWO C;  1NUB A;  2KAX A;  2K8M B;  2LV7 A;  1BG1 A;  1N65 A;  2JNX A;  3D10 A;  2NZ0 A;  1UWO A;  4YGC B;  2KBI A;  2JZI A;  3KHE A;  4MRX A;  4PHK A;  1A75 A;  2SCP A;  4WQ3 A;  4WRI A;  2PAS A;  1A29 A;  4NDD A;  2TN4 A;  1CKK A;  2KYC A;  2WOR A;  3EK4 A;  1SW8 A;  4M2O A;  2LNK A;  4PE4 A;  1DF0 A;  5D7F A;  3TS5 C;  1XVJ A;  2MHH A;  3TDZ A;  1NX0 A;  1BU3 A;  3I5G B;  1CFC A;  1R6P A;  1U5I A;  2AUC A;  3H4S E;  2EC6 C;  1GQM A;  2I94 A;  2O60 A;  2SAS A;  1IH0 A;  2I2R E;  5CSI A;  2BEC A;  1RWY A;  2BCX A;  2M0R A;  2NLN A;  3BQ3 A;  3BUM B;  4N5X A;  3DF0 B;  1CM1 A;  4PDZ A;  4A4C A;  2WCB A;  1ZOT B;  2MJW B;  1D1O A;  2WOS A;  3EVV A;  3WNX B;  4MVF A;  1Y1U A;  1DVI A;  5KTY A;  1C7W A;  1DJH A;  1K94 A;  2KOT A;  3KO0 A;  1CFP A;  2Q91 A;  1G33 A;  2M9G A;  4HRH A;  3EVU A;  2LE9 B;  4JPZ B;  3D0Y A;  2JUL A;  1K9K A;  3ZNI A;  1LA3 A;  1DJZ A;  1SCV A;  1UHI A;  4YGE B;  1QLK A;  3IQO A;  2F3Y A;  3OX5 A;  1K2H A;  5F6T A;  2BE4 A;  2K7D A;  1YVL A;  1Y1A A;  1K9P A;  1CLM A;  1QX7 A;  4ORB B;  1RTP 1;  1TNQ A;  2MLE C;  1UHJ A;  5TNC A;  2CTN A;  4PAL A;  4PHN A;  4U8D A;  4D1E A;  2KFG A;  3LLE A;  2MBX A;  1JFJ A;  2NXQ A;  3GK4 X;  1SMG A;  3VRN A;  5G08 A;  1KK7 Z;  2L4H A;  1AJ5 A;  1K93 D;  1PVB A;  2KI6 C;  5KSZ A;  2CT9 A;  2RGI A;  3AKB A;  3FWB A;  3SG5 A;  1YRU B;  2KHN A;  1TCO B;  1J7P A;  4GNK B;  1XYD A;  1JBA A;  2F2O A;  2Y4Q A;  5IBW A;  1F70 A;  4C0L A;  1ZMZ A;  1DTL A;  1ODB A;  2PMY A;  1SR6 C;  1DJI A;  1F55 A;  3ICB A;  3GOF A;  1B7T Z;  1EJ3 A;  1JF2 A;  2M97 A;  2I7A A;  4QJ4 B;  1J7Q A;  2JT3 A;  3AKA A;  1RK9 A;  2H2K A;  2L50 A;  3M0W A;  1PRW A;  2CBL A;  3EKH A;  1OMV A;  1IQ3 A;  1UHN A;  2M1K B;  2P6B B;  1N0Y A;  2Q4U A;  1DJX A;  1BMO A;  3A8R A;  1CNP A;  1R2U A;  1MF8 B;  1DT7 B;  4M2Q A;  4IL1 A;  1RRO A;  2KGB C;  2M7N A;  2COL B;  2OTG C;  2L98 A;  2Y5I A;  3I5I C;  1TCF A;  2ZND A;  3PM8 A;  2LUC A;  2JT0 A;  2FCD A;  2ZNE A;  5ER4 X;  2Y1M A;  5JJG A;  4YGB B;  1MUX A;  5I2O A;  1V1F A;  1SL8 A;  1SY9 A;  2KFH A;  2KDH A;  2F2P A;  1DJG A;  1MQ1 A;  2FCE A;  4MZJ A;  4ETO A;  5HYD A;  3WHU B;  3DF0 A;  1KQM C;  2ZN9 A;  2KI4 B;  1KQV A;  1E8A A;  1MHO A;  4XJK B;  1M45 A;  2ZFD A; 
#chains in the Genus database with same CATH topology
 1NPQ A;  3KF9 A;  1DGV A;  4MZK A;  4OZD A;  1G8I A;  1TUZ A;  3DXL A;  2K60 A;  2P70 A;  3OB1 B;  2JU0 A;  3TZ1 A;  2L51 A;  1NX2 A;  2ZRT A;  3D76 A;  2G9B A;  2DOQ A;  1ZFS A;  2EGD A;  1B7T Y;  1DQE A;  1SL7 A;  1MWN A;  2E30 A;  4YBH B;  1XFV O;  1H8B A;  1ZUZ A;  2L0P A;  2PAL A;  3GK1 A;  1F4O A;  3I5F B;  4JKT A;  4DS7 A;  2I18 A;  1T14 A;  1CTR A;  3FE9 A;  1KK8 C;  1QIW A;  2JC2 A;  1DC1 A;  1ORG A;  4USL A;  1IJ5 A;  1X02 A;  4OKH A;  1J7O A;  3EK7 A;  4MLW A;  4JD9 A;  2F3Z A;  1Z4H A;  1KWO B;  2LCP A;  2OPO A;  3ZWH A;  2MA2 A;  3CR4 X;  1XK4 C;  2PVB A;  1NX1 A;  1OOJ A;  1QS7 A;  1NX3 A;  1L2O C;  1Y6W A;  1UP5 A;  2JPO A;  1FPW A;  3RZS A;  2BKI B;  1YTZ C;  1S26 D;  2ZRS A;  1GJY A;  3EKJ A;  1AVS A;  5FYX A;  1WRK A;  3JTD C;  3CR2 A;  5EL2 A;  1Q80 A;  1IQ5 A;  2MAZ A;  5I8N A;  2P71 A;  1FF1 A;  1J1D A;  3LK0 A;  2KFF A;  1S6C A;  4P2Y B;  4MZL A;  2QEH A;  4OVN F;  3TDI A;  1PK0 D;  1QAS A;  1W7J B;  1OMR A;  1A2X A;  2MLF C;  3TS5 B;  5JOL A;  2JXL A;  2GV5 A;  4GUK A;  4L9M A;  4YI9 A;  3VB1 A;  1FI6 A;  4HRE E;  1AUI B;  4GFT A;  4GPL B;  2EC6 B;  2M29 A;  3I5H C;  3L4L A;  1CMG A;  1C7V A;  3S0E A;  2KQ6 A;  1UHK A;  1PSR A;  1YUU A;  1LA0 A;  1KFX S;  4CLN A;  1BLQ A;  4XYN A;  3OGN A;  2H61 A;  4YGD B;  1F71 A;  3BOW B;  4YRU A;  4CID A;  1TRF A;  2M8U A;  3L4A A;  2VRG A;  3IF7 A;  1QXP A;  1HQV A;  3SS5 A;  2WCL A;  3SS3 A;  3K21 A;  1G4Y R;  2KI6 D;  5J3X A;  1IG5 A;  2H8V A;  4JQ0 D;  2LVJ A;  3CTN A;  1SBJ A;  3A4U B;  3AAJ A;  3LL8 B;  1K90 D;  2JXC A;  1QWV A;  1JFK A;  3DYE A;  1CFD A;  1XA5 A;  3BFH A;  1CMF A;  2G2B A;  3R1V A;  3DVK A;  2LLT A;  4IJ7 A;  2WCH A;  3S0D A;  2KSP A;  5HKW A;  1GGZ A;  1OOH A;  1MXL C;  2KAY A;  3TUY C;  3CYZ A;  2K2A A;  2WCK A;  4HSZ A;  3DD4 A;  3CZ0 A;  3LCP C;  2BNX A;  4CPV A;  3OP0 A;  1GGW A;  4OCI A;  1P28 A;  3HX4 A;  1J1E A;  1S6J A;  2Y1N A;  1AP4 A;  2LAN A;  1XFU O;  4CFR A;  1V1G A;  2GGZ A;  2HPS A;  3NSI A;  4PE0 A;  1M39 A;  5HLV A;  1JSA A;  4YGA A;  3DVE A;  1EXR A;  3CZT X;  3SS4 A;  2PQL A;  2LC5 A;  5ER5 A;  4BY5 A;  4C0J A;  2CXJ A;  2PRU A;  2EHB A;  2V53 A;  2BBM A;  3QME A;  5KU1 A;  3B6X A;  3CGA A;  2AAO A;  1Y1X A;  1YUT A;  1TIZ A;  2K7O A;  1SSE B;  3DVM A;  4BY4 A;  4FTG A;  3MSE B;  1SR6 B;  1LKJ A;  3IVT A;  1EG4 A;  1F4Q A;  3OBV A;  4ZCU A;  1B9A A;  1IWQ A;  1CLB A;  1BOC A;  1RJV A;  1FBV A;  3O78 A;  1N2D A;  4DUQ A;  1UUR A;  1M63 B;  1K9U A;  1K8U A;  1WDC C;  1DF0 B;  2HET A;  1OMD A;  1B1G A;  1U5I B;  5CSN A;  1REC A;  2WCE A;  2GGM A;  2D8N A;  1ALV A;  1SNL A;  3B87 A;  3FE8 A;  1W7I B;  1NCX A;  2JT8 A;  1SYM A;  1WLZ A;  2WC8 A;  1CFC A;  2KNE A;  3NSO A;  1YX7 A;  3SG2 A;  1B8L A;  2OS8 C;  2H61 C;  2OTG B;  5CSF A;  4ZCV A;  4MBE A;  3I5I B;  3BUO B;  2M3W A;  4WQ2 A;  1IJ6 A;  2B1U A;  1EG3 A;  4Q04 A;  4OV2 A;  4R1E A;  3NSK A;  3O6B A;  3B88 A;  1PAL A;  2BCA A;  1IGV A;  5AAN A;  3OB2 B;  1C3Y A;  1KK7 Y;  1LVC D;  1QVI Z;  1A03 A;  4JWQ A;  5K89 A;  1NCY A;  2JOJ A;  1OW4 A;  4INW A;  2YGU A;  1CDM A;  1WLM A;  3NXA A;  1QX5 B;  2BCB A;  2JPT A;  2K2F A;  2BL0 C;  2QEO A;  3VRR A;  1GM0 A;  1K95 A;  1J7R A;  1KCY A;  1XFY O;  2R2I A;  1KQM B;  3PN7 C;  2LVI A;  1S6I A;  3D0Y B;  1AK8 A;  4PT1 A;  1B4C A;  1JWD A;  1Z2C B;  2F8P A;  4F0Z B;  1PUL A;  1SKT A;  1F8H A;  1DGU A;  3HCM A;  3GK2 A;  1TN4 A;  5B8I B;  4YI8 A;  1KSM A;  1TOP A;  3SG3 A;  4GBA A;  5BPJ A;  2WC6 A;  1M31 A;  1SCM C;  3E3R A;  1BOD A;  3N7H A;  2JQ6 A;  3SIB A;  1HT9 A;  2M1U A;  1IKU A;  1NWD A;  1KFX L;  2QAC A;  3DVJ A;  1TNP A;  3FWC A;  1KFU L;  4ORA B;  1KK8 B;  3UNW A;  4GAO A;  2HQW A;  2LLU A;  1RFJ A;  2WND A;  3NSL A;  1QV1 A;  3JVT C;  1C07 A;  4DCK A;  3BUX B;  1B8C A;  1YVH A;  1OQP A;  3C1V A;  1CM4 A;  1L2O B;  3F45 A;  2FOT A;  3KEV A;  2WC5 A;  4QJ3 B;  2ZN8 A;  4I5J A;  4P5O E;  2LVV A;  3SG4 A;  3PJI A;  1QVI Y;  1MXE A;  1TNX A;  1OE9 B;  2K0J A;  2L2C A;  2LVK A;  3JTD B;  3QRX A;  1A4P A;  1S36 A;  4I5K A;  1W9Z A;  3D74 A;  1MR8 A;  3LK1 A;  5AFP A;  1BR4 B;  5GQQ C;  3FS7 A;  1TTX A;  2PYQ A;  4TNC A;  2NCP A;  2ISD A;  2L4I A;  2M49 B;  1YUS A;  3IQQ A;  4NDB A;  4GGN A;  2IS9 A;  3OHM B;  5I2L A;  1B8R A;  1KFU S;  1VRK A;  3I5H B;  1AJ4 A;  3I5G C;  5CPV A;  4PE1 A;  2LLS A;  3PAL A;  4MRY A;  1DJW A;  2CNP A;  1LXF C;  3CLN A;  4MEW A;  1OOI X;  5DKQ A;  3BJH A;  1LIN A;  2MRD A;  1CDL A;  2NCO A;  3RM1 A;  3BXK A;  1BJF A;  4GGF A;  5I94 A;  5AXI A;  1CFF A;  1EL4 A;  4AOM A;  1DEL A;  2LMU A;  2E6W A;  1DMO A;  3BUN B;  3CR5 X;  2LHL A;  2AMI A;  4C0K A;  2KYF A;  2GTE A;  2FJY A;  3BYA A;  3SG6 A;  2LP3 A;  1XFX O;  2KGR A;  2JTT A;  3FE6 A;  1SK6 D;  1ZAC A;  4XJK A;  1M46 A;  2ZKM X;  1QX2 A;  5CSJ A;  4ICB A;  1NYA A;  1SRA A;  2BE6 A;  4AQJ A;  3TUY B;  1FW4 A;  4ORC B;  1OOF A;  3SJS A;  4NQG A;  1BR1 B;  3RLZ A;  1C3Z A;  1QTX A;  4UPG A;  2M7L A;  1FI5 A;  1SPY A;  1JF0 A;  1JUO A;  4I5L B;  1SL9 A;  3VGO A;  1PVA A;  3B7A A;  1OZS A;  3PM2 A;  3PLF B;  1CB1 A;  2FJU B;  2K7B A;  3EG5 B;  3PFV A;  1A75 B;  1QV0 A;  2WCF A;  1YRT B;  4I5N B;  2JWW A;  3Q8I A;  2JRF A;  4OR9 B;  5FI6 A;  3CAB A;  1J55 A;  2ERB A;  2QEV A;  2LMT A;  1S1E A;  3PSR A;  3AAK A;  2LM5 A;  2LUX A;  3S0F A;  1S5G Z;  3BFA A;  1Y0V H;  3PAT A;  5AER A;  2KLE A;  3TDU A;  1XK4 A;  2HF5 A;  3FIA A;  2QPT A;  5DKN A;  1UHH A;  1K96 A;  1WRZ A;  1UUS A;  1OSA A;  1TNW A;  1WDC B;  1YX8 A;  1DJY A;  4NDC A;  3KPX A;  5D3O A;  1B47 A;  1KSO A;  2L5X B;  3OX6 A;  1YUR A;  1WY9 A;  3EVR A;  3NHT A;  4DRW A;  5I2Q A;  1L7Z A;  4CFQ A;  1QJT A;  2K61 A;  1NCZ A;  2L2E A;  2OS8 B;  3O4Y A;  4MSP A;  3WXA A;  2JNF A;  1QIV A;  3D78 A;  5FI7 A;  1NP8 A;  1XFW O;  3VRO A;  5HLO A;  4MN0 A;  5HKY A;  3CWG A;  4GGF C;  1CDP A;  1BF5 A;  1OOG A;  2KAV A;  3BOW A;  3S0B A;  4FQO A;  1OZO A;  2PSR A;  1NSH A;  2BBN A;  1EH2 A;  1WRL A;  2BL0 B;  4KYN A;  4QJ5 B;  3O2P A;  4A4B A;  2KQY A;  1CLL A;  3WHT B;  3PN7 B;  1F54 A;  1IIO A;  5DKR A;  3CS1 A;  1QLS A;  5PAL A;  2KI4 C;  2LP2 A;  3BUW B;  1IRJ A;  4INX A;  2O5G A;  1JC2 A;  1TWO A;  1YR5 A;  2JTZ A;  1ALW A;  1S5G Y;  4M2P A;  4PHM A;  4PHJ A;  2CCM A;  1XFZ O;  3VRQ A;  2LAP A;  1QAT A;  1SCM B;  2K7C A;  3R1P A;  4HRG A;  2LMV A;  1XO5 A;  1H4B A;  2L5Y A;  1CDN A;  1BT6 A;  4PE7 A;  1S3P A;  3SG7 A;  4DIR A;  3I5F C;  4PCW A;  5AEQ A;  4E68 A;  1NIW A;  5DIC A;  3EK8 A;  2A4J A;  4N1F A;  3SIA A;  2BKH B;  5D69 A;  2HQ8 A;  2KBM A;  5FI2 A;  1AHR A;  1PSB A;  2LHI A;  2QEB A;  3JVT B;  2F33 A;  3S0G A;  3VRP A;  5HKZ A;  4N1G A;  4AQI A;  1KWO C;  1NUB A;  2KAX A;  2K8M B;  2LV7 A;  3BFB A;  1BG1 A;  1N65 A;  2JNX A;  3D10 A;  2NZ0 A;  1UWO A;  4YGC B;  2KBI A;  2WCJ A;  2JZI A;  3KHE A;  4MRX A;  4PHK A;  1A75 A;  2SCP A;  3D77 A;  4WQ3 A;  4WRI A;  2PAS A;  1A29 A;  3DY9 A;  4NDD A;  2TN4 A;  1CKK A;  2KYC A;  2WOR A;  3EK4 A;  4F7F A;  1SW8 A;  1DEK A;  4M2O A;  2LNK A;  4PE4 A;  1DF0 A;  5D7F A;  3TS5 C;  1XVJ A;  2MHH A;  3TDZ A;  1NX0 A;  1BU3 A;  2QDI A;  3B86 A;  1R6P A;  1U5I A;  2AUC A;  3I5G B;  3H4S E;  2EC6 C;  1GQM A;  2I94 A;  2O60 A;  2SAS A;  1IH0 A;  1TUJ A;  2I2R E;  5CSI A;  2BEC A;  2KLD A;  3NGV A;  1RWY A;  2BCX A;  2M0R A;  2NLN A;  3BQ3 A;  3BUM B;  2WCM A;  4N5X A;  3DF0 B;  1CM1 A;  3K1E A;  3UO9 A;  4PDZ A;  4A4C A;  2WCB A;  1ZOT B;  2MJW B;  1D1O A;  2WOS A;  3EVV A;  3WNX B;  3R72 A;  3L47 A;  4MVF A;  1Y1U A;  1DVI A;  5KTY A;  3DZT A;  1C7W A;  1DJH A;  1K94 A;  2KOT A;  3CZ1 A;  3KO0 A;  2Q91 A;  1G33 A;  1CFP A;  2M9G A;  4HRH A;  3EVU A;  2LE9 B;  4JPZ B;  3D0Y A;  2JUL A;  1K9K A;  3ZNI A;  1LA3 A;  3D73 A;  1DJZ A;  1SCV A;  1UHI A;  4YGE B;  1QLK A;  3IQO A;  2F3Y A;  3OX5 A;  1K2H A;  5F6T A;  1LS8 A;  2BE4 A;  2K7D A;  1YVL A;  1Y1A A;  2KPH A;  1K9P A;  1CLM A;  1QX7 A;  4ORB B;  1RTP 1;  1TNQ A;  2MLE C;  3D75 A;  1UHJ A;  5TNC A;  2CTN A;  4PAL A;  4PHN A;  4U8D A;  4D1E A;  2KFG A;  3LLE A;  2MBX A;  1JFJ A;  2NXQ A;  3S0A A;  3GK4 X;  1SMG A;  3VRN A;  5G08 A;  1KK7 Z;  2L4H A;  1AJ5 A;  1K93 D;  1PVB A;  2KI6 C;  5KSZ A;  2CT9 A;  2RGI A;  3AKB A;  3FWB A;  3SG5 A;  1YRU B;  2KHN A;  1TCO B;  1J7P A;  4GNK B;  1XYD A;  1JBA A;  2F2O A;  2Y4Q A;  5IBW A;  1F70 A;  4C0L A;  1ZMZ A;  1DTL A;  1ODB A;  2PMY A;  1SR6 C;  1DJI A;  1F55 A;  3ICB A;  3GOF A;  1B7T Z;  1EJ3 A;  1JF2 A;  2M97 A;  2I7A A;  4QJ4 B;  1J7Q A;  2JT3 A;  3AKA A;  1RK9 A;  2H2K A;  2L50 A;  3M0W A;  1PRW A;  2CBL A;  3EKH A;  1OMV A;  4FQT A;  1IQ3 A;  1UHN A;  2M1K B;  2P6B B;  1N0Y A;  2Q4U A;  1DJX A;  1BMO A;  3A8R A;  1CNP A;  1R2U A;  1MF8 B;  3V2L A;  1DT7 B;  4M2Q A;  3CZ2 A;  4IL1 A;  1RRO A;  2KGB C;  2M7N A;  2COL B;  2OTG C;  2L98 A;  2Y5I A;  3R1O A;  5HL1 A;  3I5I C;  1TCF A;  2ZND A;  3PM8 A;  3NHI A;  2LUC A;  2JT0 A;  1XFR A;  2FCD A;  2ZNE A;  2BAP A;  5ER4 X;  2Y1M A;  5JJG A;  4YGB B;  1MUX A;  3CDN A;  5I2O A;  1V1F A;  1SL8 A;  1SY9 A;  2KFH A;  2KDH A;  2F2P A;  1DJG A;  1MQ1 A;  3O4X A;  2FCE A;  4MZJ A;  4ETO A;  5HYD A;  3WHU B;  3DF0 A;  1KQM C;  2ZN9 A;  2KI4 B;  1KQV A;  1E8A A;  1MHO A;  4XJK B;  1M45 A;  2ZFD A; 
#chains in the Genus database with same CATH homology
 1NPQ A;  3KF9 A;  1DGV A;  4MZK A;  1G8I A;  3OB1 B;  2JU0 A;  3TZ1 A;  2L51 A;  1NX2 A;  2ZRT A;  2G9B A;  2DOQ A;  1ZFS A;  2EGD A;  1B7T Y;  1SL7 A;  2E30 A;  1MWN A;  4YBH B;  1XFV O;  1H8B A;  1ZUZ A;  2L0P A;  2PAL A;  3GK1 A;  1F4O A;  3I5F B;  4DS7 A;  2I18 A;  1CTR A;  1KK8 C;  1QIW A;  2JC2 A;  4USL A;  1IJ5 A;  1X02 A;  4OKH A;  1J7O A;  3EK7 A;  4MLW A;  2F3Z A;  2OPO A;  1KWO B;  2LCP A;  3ZWH A;  2MA2 A;  3CR4 X;  1XK4 C;  2PVB A;  1NX1 A;  1OOJ A;  1QS7 A;  1NX3 A;  1L2O C;  1Y6W A;  1UP5 A;  1FPW A;  2BKI B;  1YTZ C;  1S26 D;  2ZRS A;  1GJY A;  3EKJ A;  1AVS A;  5FYX A;  1WRK A;  3JTD C;  3CR2 A;  5I8N A;  1Q80 A;  1IQ5 A;  2MAZ A;  1FF1 A;  1J1D A;  3LK0 A;  2KFF A;  1S6C A;  4P2Y B;  4MZL A;  4OVN F;  3TDI A;  1PK0 D;  1QAS A;  1W7J B;  1OMR A;  1A2X A;  2MLF C;  3TS5 B;  5JOL A;  2JXL A;  2GV5 A;  4GUK A;  4L9M A;  4YI9 A;  1FI6 A;  4HRE E;  1AUI B;  4GFT A;  4GPL B;  2EC6 B;  2M29 A;  3I5H C;  1CMG A;  1C7V A;  2KQ6 A;  1UHK A;  1PSR A;  1YUU A;  1LA0 A;  1KFX S;  4CLN A;  1BLQ A;  4XYN A;  2H61 A;  4YGD B;  1F71 A;  3BOW B;  4YRU A;  4CID A;  1TRF A;  2M8U A;  2VRG A;  3IF7 A;  1QXP A;  1HQV A;  3K21 A;  1G4Y R;  2KI6 D;  5J3X A;  1IG5 A;  4JQ0 D;  2LVJ A;  3CTN A;  1SBJ A;  3A4U B;  3AAJ A;  3LL8 B;  1K90 D;  2JXC A;  1JFK A;  1CFD A;  1XA5 A;  1CMF A;  2G2B A;  3DVK A;  2LLT A;  2KSP A;  5HKW A;  1GGZ A;  1MXL C;  2KAY A;  3TUY C;  2K2A A;  4HSZ A;  3DD4 A;  3LCP C;  4CPV A;  1GGW A;  3OP0 A;  4OCI A;  3HX4 A;  1J1E A;  1S6J A;  2Y1N A;  1AP4 A;  2LAN A;  1XFU O;  4CFR A;  1V1G A;  2GGZ A;  2HPS A;  3NSI A;  4PE0 A;  1M39 A;  5HLV A;  1JSA A;  4YGA A;  3DVE A;  1EXR A;  3CZT X;  2LC5 A;  5ER5 A;  4BY5 A;  4C0J A;  2CXJ A;  2PRU A;  2EHB A;  2V53 A;  2BBM A;  5KU1 A;  3CGA A;  2AAO A;  1Y1X A;  1YUT A;  1TIZ A;  2K7O A;  3DVM A;  4BY4 A;  4FTG A;  3MSE B;  1SR6 B;  1LKJ A;  1CLB A;  1EG4 A;  1F4Q A;  4ZCU A;  1B9A A;  1IWQ A;  1BOC A;  1RJV A;  1FBV A;  3O78 A;  1N2D A;  4DUQ A;  1UUR A;  1M63 B;  1K9U A;  1K8U A;  1WDC C;  1DF0 B;  2HET A;  1OMD A;  1B1G A;  1U5I B;  5CSN A;  1REC A;  2WCE A;  2GGM A;  2D8N A;  1ALV A;  1SNL A;  1W7I B;  1NCX A;  2JT8 A;  1SYM A;  1WLZ A;  2WC8 A;  2KNE A;  3NSO A;  1YX7 A;  3SG2 A;  1B8L A;  2OS8 C;  2H61 C;  2OTG B;  5CSF A;  4ZCV A;  4MBE A;  3I5I B;  3BUO B;  2M3W A;  4WQ2 A;  1IJ6 A;  2B1U A;  1EG3 A;  4Q04 A;  4OV2 A;  4R1E A;  3NSK A;  3O6B A;  1PAL A;  2BCA A;  1IGV A;  5AAN A;  3OB2 B;  1KK7 Y;  1LVC D;  1QVI Z;  1A03 A;  4JWQ A;  5K89 A;  1NCY A;  2JOJ A;  1CDM A;  1WLM A;  3NXA A;  1QX5 B;  2BCB A;  2JPT A;  2K2F A;  2BL0 C;  3VRR A;  1K95 A;  1J7R A;  1KCY A;  1XFY O;  2R2I A;  1KQM B;  3PN7 C;  2LVI A;  1S6I A;  3D0Y B;  1AK8 A;  1JWD A;  1B4C A;  2F8P A;  4F0Z B;  1PUL A;  1SKT A;  1F8H A;  1DGU A;  3HCM A;  3GK2 A;  1TN4 A;  5B8I B;  4YI8 A;  1KSM A;  1TOP A;  3SG3 A;  4GBA A;  5BPJ A;  1M31 A;  1SCM C;  3E3R A;  1BOD A;  2JQ6 A;  3SIB A;  1HT9 A;  2M1U A;  1IKU A;  1NWD A;  1KFX L;  2QAC A;  3DVJ A;  1TNP A;  3FWC A;  1KFU L;  4ORA B;  1KK8 B;  4GAO A;  2HQW A;  2LLU A;  1RFJ A;  2WND A;  3NSL A;  1QV1 A;  3JVT C;  1C07 A;  4DCK A;  3BUX B;  1B8C A;  1YVH A;  1OQP A;  3C1V A;  1CM4 A;  1L2O B;  3F45 A;  2FOT A;  3KEV A;  4QJ3 B;  2ZN8 A;  4I5J A;  4P5O E;  2LVV A;  3SG4 A;  1QVI Y;  1MXE A;  1TNX A;  1OE9 B;  2K0J A;  2LVK A;  3JTD B;  3QRX A;  1A4P A;  1S36 A;  4I5K A;  3LK1 A;  1MR8 A;  5AFP A;  1BR4 B;  5GQQ C;  3FS7 A;  1TTX A;  4TNC A;  2NCP A;  2ISD A;  2L4I A;  2M49 B;  1YUS A;  3IQQ A;  4NDB A;  4GGN A;  2IS9 A;  3OHM B;  5I2L A;  1B8R A;  1KFU S;  1VRK A;  3I5H B;  1AJ4 A;  3I5G C;  5CPV A;  4PE1 A;  2LLS A;  3PAL A;  4MRY A;  1DJW A;  2CNP A;  1LXF C;  3CLN A;  4MEW A;  5DKQ A;  1LIN A;  2MRD A;  1CDL A;  2NCO A;  3RM1 A;  3BXK A;  1BJF A;  4GGF A;  5AXI A;  1CFF A;  1EL4 A;  4AOM A;  2LMU A;  2E6W A;  1DMO A;  3BUN B;  3CR5 X;  2LHL A;  2AMI A;  4C0K A;  2KYF A;  3BYA A;  3SG6 A;  2LP3 A;  1XFX O;  2KGR A;  2JTT A;  1SK6 D;  1ZAC A;  4XJK A;  1M46 A;  2ZKM X;  1QX2 A;  5CSJ A;  4ICB A;  1NYA A;  1SRA A;  2BE6 A;  4AQJ A;  3TUY B;  1FW4 A;  4ORC B;  3SJS A;  4NQG A;  1BR1 B;  3RLZ A;  1QTX A;  4UPG A;  2M7L A;  1FI5 A;  1SPY A;  1JF0 A;  1JUO A;  4I5L B;  1SL9 A;  3VGO A;  1PVA A;  1OZS A;  3PLF B;  1CB1 A;  2FJU B;  2K7B A;  3PFV A;  1A75 B;  1QV0 A;  2WCF A;  1YRT B;  4I5N B;  2JWW A;  4OR9 B;  2JRF A;  1J55 A;  2LMT A;  1S1E A;  3PSR A;  3AAK A;  2LM5 A;  2LUX A;  1S5G Z;  1Y0V H;  3PAT A;  5AER A;  3TDU A;  1XK4 A;  2HF5 A;  3FIA A;  2QPT A;  5DKN A;  1UHH A;  1K96 A;  1WRZ A;  1UUS A;  1OSA A;  1TNW A;  1WDC B;  1YX8 A;  1DJY A;  4NDC A;  3KPX A;  1B47 A;  1KSO A;  2L5X B;  3OX6 A;  1YUR A;  1WY9 A;  3EVR A;  4DRW A;  5I2Q A;  1L7Z A;  4CFQ A;  1QJT A;  2K61 A;  1NCZ A;  2L2E A;  2OS8 B;  3O4Y A;  4MSP A;  3WXA A;  2JNF A;  1QIV A;  1NP8 A;  1XFW O;  3VRO A;  5HLO A;  4MN0 A;  5HKY A;  3CWG A;  4GGF C;  1CDP A;  1BF5 A;  2KAV A;  3BOW A;  4FQO A;  1OZO A;  2PSR A;  1NSH A;  2BBN A;  1EH2 A;  1WRL A;  2BL0 B;  4QJ5 B;  3O2P A;  4A4B A;  2KQY A;  1CLL A;  3WHT B;  3PN7 B;  1F54 A;  5DKR A;  3CS1 A;  1QLS A;  5PAL A;  2KI4 C;  2LP2 A;  3BUW B;  1IRJ A;  1JC2 A;  2O5G A;  1YR5 A;  2JTZ A;  4M2P A;  1ALW A;  1S5G Y;  4PHM A;  4PHJ A;  2CCM A;  1XFZ O;  3VRQ A;  2LAP A;  1QAT A;  1SCM B;  2K7C A;  4HRG A;  2LMV A;  1XO5 A;  1H4B A;  1CDN A;  1BT6 A;  4PE7 A;  1S3P A;  3SG7 A;  4DIR A;  3I5F C;  4PCW A;  5AEQ A;  4E68 A;  1NIW A;  3EK8 A;  2A4J A;  4N1F A;  3SIA A;  2BKH B;  5D69 A;  2HQ8 A;  2KBM A;  1AHR A;  1PSB A;  2LHI A;  3JVT B;  2F33 A;  3VRP A;  5HKZ A;  4N1G A;  4AQI A;  1KWO C;  1NUB A;  2KAX A;  2K8M B;  2LV7 A;  1BG1 A;  1N65 A;  2JNX A;  3D10 A;  2NZ0 A;  1UWO A;  4YGC B;  2KBI A;  2JZI A;  3KHE A;  4MRX A;  4PHK A;  1A75 A;  2SCP A;  4WQ3 A;  4WRI A;  2PAS A;  1A29 A;  4NDD A;  2TN4 A;  1CKK A;  2KYC A;  2WOR A;  3EK4 A;  1SW8 A;  4M2O A;  2LNK A;  4PE4 A;  1DF0 A;  5D7F A;  3TS5 C;  1XVJ A;  2MHH A;  3TDZ A;  1NX0 A;  1BU3 A;  3I5G B;  1CFC A;  1R6P A;  1U5I A;  2AUC A;  3H4S E;  2EC6 C;  1GQM A;  2I94 A;  2O60 A;  2SAS A;  1IH0 A;  2I2R E;  5CSI A;  2BEC A;  1RWY A;  2BCX A;  2M0R A;  2NLN A;  3BQ3 A;  3BUM B;  4N5X A;  3DF0 B;  1CM1 A;  4PDZ A;  4A4C A;  2WCB A;  1ZOT B;  2MJW B;  1D1O A;  2WOS A;  3EVV A;  3WNX B;  4MVF A;  1Y1U A;  1DVI A;  5KTY A;  1C7W A;  1DJH A;  1K94 A;  2KOT A;  3KO0 A;  1CFP A;  2Q91 A;  1G33 A;  2M9G A;  4HRH A;  3EVU A;  2LE9 B;  4JPZ B;  3D0Y A;  2JUL A;  1K9K A;  3ZNI A;  1LA3 A;  1DJZ A;  1SCV A;  1UHI A;  4YGE B;  1QLK A;  3IQO A;  2F3Y A;  3OX5 A;  1K2H A;  5F6T A;  2BE4 A;  2K7D A;  1YVL A;  1Y1A A;  1K9P A;  1CLM A;  1QX7 A;  4ORB B;  1RTP 1;  1TNQ A;  2MLE C;  1UHJ A;  5TNC A;  2CTN A;  4PAL A;  4PHN A;  4U8D A;  4D1E A;  2KFG A;  3LLE A;  2MBX A;  1JFJ A;  2NXQ A;  3GK4 X;  1SMG A;  3VRN A;  5G08 A;  1KK7 Z;  2L4H A;  1AJ5 A;  1K93 D;  1PVB A;  2KI6 C;  5KSZ A;  2CT9 A;  2RGI A;  3AKB A;  3FWB A;  3SG5 A;  1YRU B;  2KHN A;  1TCO B;  1J7P A;  4GNK B;  1XYD A;  1JBA A;  2F2O A;  2Y4Q A;  5IBW A;  1F70 A;  4C0L A;  1ZMZ A;  1DTL A;  1ODB A;  2PMY A;  1SR6 C;  1DJI A;  1F55 A;  3ICB A;  3GOF A;  1B7T Z;  1EJ3 A;  1JF2 A;  2M97 A;  2I7A A;  4QJ4 B;  1J7Q A;  2JT3 A;  3AKA A;  1RK9 A;  2H2K A;  2L50 A;  3M0W A;  1PRW A;  2CBL A;  3EKH A;  1OMV A;  1IQ3 A;  1UHN A;  2M1K B;  2P6B B;  1N0Y A;  2Q4U A;  1DJX A;  1BMO A;  3A8R A;  1CNP A;  1R2U A;  1MF8 B;  1DT7 B;  4M2Q A;  4IL1 A;  1RRO A;  2KGB C;  2M7N A;  2COL B;  2OTG C;  2L98 A;  2Y5I A;  3I5I C;  1TCF A;  2ZND A;  3PM8 A;  2LUC A;  2JT0 A;  2FCD A;  2ZNE A;  5ER4 X;  2Y1M A;  5JJG A;  4YGB B;  1MUX A;  5I2O A;  1V1F A;  1SL8 A;  1SY9 A;  2KFH A;  2KDH A;  2F2P A;  1DJG A;  1MQ1 A;  2FCE A;  4MZJ A;  4ETO A;  5HYD A;  3WHU B;  3DF0 A;  1KQM C;  2ZN9 A;  2KI4 B;  1KQV A;  1E8A A;  1MHO A;  4XJK B;  1M45 A;  2ZFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...