4M2PA

Crystal structure of a non-myristoylated c39d recoverin mutant with one calcium ion bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
192
structure length
192
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKEDPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Recoverin
total genus 78
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2pA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2pA01
5AFPA 2OPOA 5HKZA 1SYMA 1R6PA 1RECA 1KFXL 1KFUL 1DVIA 3EVRA 1NX3A 3H4SE 1WRLA 2VRGA 4N5XA 1M46A 1CFPA 2F33A 3SIAA 3I5FC 4HREE 5AXIA 3WHUB 1S3PA 3EVVA 1WY9A 1ZACA 3O6BA 2JXCA 1LINA 2B1UA 1QJTA 2MRDA 2ZN8A 4AQJA 2F3YA 4DRWA 1L2OB 1K8UA 3CGAA 2LCPA 3SG2A 5AERA 2L5XB 5HLVA 2M1UA 3PATA 3PFVA 1YVLA 2LC5A 2JU0A 2GV5A 1F4QA 2JZIA 1JBAA 2WOSA 3E3RA 2WCEA 1JUOA 2KQ6A 3AKBA 3O4YA 3DVEA 2HQWA 2KAYA 1M63B 3OHMB 1GQMA 1QX5B 1K2HA 1S6JA 3BUMB 1NYAA 1DJIA 1EL4A 4HSZA 4ORBB 2ZNDA 5FYXA 1A2XA 2KFFA 1DF0A 1LA0A 4DCKA 4GGFA 3DF0B 2LAPA 5JOLA 1AP4A 4XJKB 2A4JA 3I5FB 2LMUA 1JFJA 4YGAA 1QVIZ 2LMTA 4OV2A 2F3ZA 2GGZA 5AANA 3I5IB 1B8CA 3OB2B 2BE4A 5HYDA 2BL0C 5AEQA 1TTXA 1RJVA 1PSRA 4C0KA 3SG5A 3GK2A 1EG3A 4ETOA 1Y6WA 1J1EA 1G4YR 3CR4X 3ZNIA 4JQ0D 1NX0A 3KPXA 5CSFA 4GPLB 1FPWA 1XFYO 3KEVA 2MLEC 2EHBA 4I5KA 1QIWA 1BMOA 1EJ3A 1NWDA 3I5GB 3ICBA 1K9KA 1BU3A 2F2OA 2K61A 2BKHB 2JT3A 3TDUA 1JWDA 4JWQA 1SK6D 2FCDA 2ZNEA 2CNPA 4MBEA 3K21A 5HKYA 4MRXA 1AUIB 1XK4A 1Y0VH 4PALA 4PE4A 2KAXA 3LK0A 1DF0B 3EVUA 2PALA 2WCFA 2G9BA 3JVTB 3PN7C 1CM4A 1DJGA 3IF7A 3VRRA 1J1DA 1OMRA 2KOTA 1TN4A 4PDZA 1BF5A 3I5HB 1DGUA 3MSEB 1OMDA 1MF8B 2O5GA 1QS7A 2PVBA 2JNXA 5DKRA 1FI5A 3CR2A 2K0JA 1XFZO 4M2OA 2NCOA 3TS5C 1V1GA 4GGFC 1YRTB 2AAOA 3TUYC 2M49B 1B7TZ 1K94A 2CXJA 3OX6A 4QJ5B 1IJ5A 1CKKA 1F8HA 1SPYA 2NXQA 1SNLA 3DVJA 5TNCA 1SCVA 1XO5A 2L98A 4ZCVA 1F70A 1XVJA 4GUKA 1ALVA 2FJUB 2PSRA 5D69A 1SL7A 2CBLA 2MA2A 1NUBA 3FIAA 5HLOA 2K7BA 2KGRA 3HX4A 1W7JB 3GOFA 2IS9A 1KWOB 2LVKA 1YX7A 1Q80A 3LK1A 2PASA 2KFGA 1YR5A 1A75B 3BUNB 5I2LA 1WLMA 1BG1A 1PRWA 2NLNA 2K7OA 2LUXA 1NX1A 4C0JA 1B8LA 4FTGA 1OOJA 2BCAA 1UUSA 5BPJA 1L2OC 1S1EA 3EK8A 1SL8A 3KO0A 1NCYA 1FBVA 2KI6D 2NCPA 1DMOA 4A4BA 3FWBA 1F4OA 2QACA 3D10A 3PALA 1W7IB 1R2UA 2L2EA 3SJSA 1J7RA 1SW8A 4MLWA 5KTYA 2M7NA 3M0WA 2HF5A 1F71A 1UWOA 2E6WA 3AAKA 1A03A 1D1OA 2I7AA 3SG3A 1QTXA 2RGIA 2K2FA 1SL9A 1DJXA 1IGVA 1MUXA 1H4BA 1CNPA 1A4PA 4PHNA 1YUTA 2M7LA 1PULA 4MN0A 2MJWB 4PHKA 1DJHA 4Q04A 1OZSA 3BUXB 3JVTC 4A4CA 2JTTA 4CIDA 3PN7B 2WCBA 1CDNA 2Y1MA 2P6BB 3SIBA 1WLZA 4PCWA 2EC6C 5CSJA 1DT7B 1N65A 4QJ4B 3CWGA 1KQMB 1CM1A 1TRFA 1MXLC 2KBMA 2LV7A 5PALA 4DS7A 2HPSA 1TNWA 1TNQA 1K9UA 1NIWA 1QV0A 2KDHA 2OS8B 1UP5A 3JTDB 2LHLA 1MWNA 1SKTA 3GK4X 3WHTB 4NQGA 3TUYB 1CMGA 2ZFDA 2OTGB 3FWCA 1NP8A 2KAVA 1CLLA 3BXKA 1XFVO 1B7TY 1SBJA 2KGBC 2I18A 2BCBA 1DTLA 2H2KA 5CPVA 2ZN9A 1CFFA 1JC2A 1SY9A 4OCIA 1QATA 1WRZA 3EK7A 1OE9B 1FI6A 4GAOA 4DUQA 1J7OA 4I5LB 2DOQA 2KYCA 1KK7Y 4N1GA 1F54A 1C7WA 1PSBA 3ZWHA 1EG4A 1KWOC 1C07A 3TZ1A 1RFJA 1ALWA 1A29A 3HCMA 4JPZB 2WC8A 1CDLA 2SCPA 2M0RA 3IQOA 2KI4C 2K7CA 1IKUA 1BR1B 3O2PA 4MSPA 3DVKA 1YUUA 4P2YB 3QRXA 2TN4A 1LVCD 4YGEB 1TCOB 1L7ZA 2LVIA 2COLB 2KSPA 3PSRA 4CFRA 1UHNA 4PE1A 3CTNA 4MVFA 4QJ3B 1SRAA 3A8RA 2L4HA 1UHHA 3D0YB 1GGWA 4I5NB 2M1KB 4XYNA 1CMFA 1MXEA 4NDDA 3OB1B 1OMVA 1LKJA 1XFXO 1G8IA 2BBMA 5K89A 4WQ3A 3RLZA 1YRUB 5G08A 1Y1XA 1S26D 4IL1A 1S36A 2HQ8A 1WDCC 1AJ5A 2MHHA 3SG4A 5I2OA 3NSOA 1IG5A 4GNKB 2K2AA 2Y1NA 2FOTA 3EKJA 4GGNA 1IQ3A 1QX7A 2LANA 1CTRA 1U5IB 2JT8A 2JRFA 4FQOA 1HT9A 4NDCA 2JXLA 4OR9B 2Y4QA 4ORCB 3BUWB 4P5OE 4ZCUA 2E30A 2JWWA 1S6IA 1Y1UA 5ER5A 3KHEA 1XA5A 2MLFC 4ORAB 2JPTA 1QVIY 1OQPA 2Y5IA 4F0ZB 1FF1A 4PE7A 1MR8A 2BECA 2Q4UA 3WXAA 1ZUZA 3C1VA 4YGCB 1XFWO 4HRGA 2M9GA 3NXAA 1EH2A 2L51A 1CLMA 1NSHA 3A4UB 1S6CA 1LXFC 3LLEA 4YRUA 2M8UA 1KFXS 1KFUS 4WQ2A 4C0LA 1BLQA 2JOJA 4PHJA 2MAZA 4BY5A 1UHIA 3VRQA 1CB1A 5KSZA 1WDCB 1SMGA 5DKQA 1EXRA 3NSIA 4L9MA 4AOMA 3BYAA 5I2QA 4MRYA 2ZKMX 1AVSA 1PVAA 1PVBA 3BOWA 2L50A 2F8PA 2LM5A 1FW4A 3IQQA 4MZJA 1SCMC 1XK4C 2LMVA 4M2QA 4M2PA 3NSLA 2LNKA 1XYDA 3PM8A 5IBWA 1BJFA 2NZ0A 4D1EA 4DIRA 1G33A 1E8AA 2JTZA 1YUSA 1J7PA 2KBIA 1ODBA 2M3WA 2K8MB 5CSNA 2BCXA 2BE6A 2KNEA 5ER4X 1GGZA 1IRJA 1PALA 1X02A 2AMIA 4CFQA 1TOPA 2LLUA 2M29A 1RTP1 4YBHB 1QLSA 1GJYA 1K93D 1TCFA 3JTDC 4YI8A 2JC2A 1BR4B 3TDZA 1DGVA 2PRUA 3BUOB 4MZKA 3OX5A 4PE0A 5J3XA 1DJZA 1K96A 1RROA 2H61C 1V1FA 1JSAA 1UURA 1JF2A 2EGDA 1ZMZA 2KFHA 1DJYA 3BOWB 3VRPA 1M31A 1AK8A 3I5GC 3DVMA 3OP0A 1CFCA 2JULA 2F2PA 1JFKA 1SCMB 3TDIA 2R2IA 1ZFSA 3F45A 1NPQA 1TNPA 1QIVA 1PK0D 5DKNA 2BBNA 1IH0A 5I8NA 1C7VA 4MEWA 4CPVA 2ZRTA 1IQ5A 1BT6A 2L4IA 3D0YA 1K90D 4N1FA 1IJ6A 1S5GY 2KI4B 4NDBA 1AJ4A 1LA3A 2M97A 1SR6C 1VRKA 5HKWA 1QX2A 2LVJA 5KU1A 1BODA 1B47A 3I5HC 2PMYA 3CR5X 1N2DA 1QV1A 1UHJA 1TIZA 1HQVA 1U5IA 2I2RE 1DJWA 2AUCA 1KK8B 1YURA 1CFDA 1YX8A 1XFUO 1J55A 4MZLA 4ICBA 1NCXA 3TS5B 1AHRA 2KHNA 5F6TA 2SASA 3O78A 3VRNA 4HRHA 1F55A 5JJGA 1QASA 3DD4A 2ISDA 2LUCA 1CLBA 3VGOA 1RWYA 2LE9B 1JF0A 4GFTA 1H8BA 2H61A 3EK4A 2CTNA 1CDMA 4YGBB 1QLKA 5B8IB 3AAJA 2BL0B 4R1EA 3DF0A 4WRIA 3EKHA 1B4CA 1YVHA 1KCYA 1KSOA 1ZOTB 4E68A 3CS1A 1OZOA 1MQ1A 1SR6B 3GK1A 1J7QA 2ZRSA 3AKAA 2JQ6A 2QPTA 3PLFB 2OTGC 2CCMA 2LHIA 1MHOA 2WNDA 2MBXA 1KK8C 4UPGA 1B8RA 2LVVA 2K7DA 2L0PA 4TNCA 4PHMA 4U8DA 2LLTA 3KF9A 1QXPA 2WORA 3RM1A 1CDPA 4YI9A 2LLSA 5GQQC 1NX2A 4I5JA 4OKHA 1B9AA 2D8NA 2G2BA 3SG6A 3VROA 1BOCA 1OSAA 3CLNA 2LP3A 3BQ3A 4GBAA 2KYFA 1B1GA 1K95A 4BY4A 4YGDB 1S5GZ 1WRKA 2JT0A 4AQIA 4USLA 3CZTX 2KQYA 2CT9A 3LL8B 2V53A 1KQVA 4OVNF 2EC6B 1KSMA 1A75A 1NCZA 2HETA 1KQMC 1N0YA 2LP2A 4CLNA 1RK9A 1Y1AA 2KI6C 2OS8C 2Q91A 1M45A 2I94A 1IWQA 1YTZC 1UHKA 2GGMA 3NSKA 5CSIA 4XJKA 3LCPC 3I5IC 1M39A 1K9PA 5D7FA 3FS7A 3SG7A 2BKIB 2O60A 1KK7Z 1TNXA 2FCEA 2JNFA 3WNXB
chains in the Genus database with same CATH superfamily
5AFPA 2OPOA 5HKZA 1SYMA 1R6PA 1RECA 2PYQA 3IVTA 1KFXL 1KFUL 1DVIA 1QWVA 1NX3A 3EVRA 2QEHA 3H4SE 1WRLA 2VRGA 4N5XA 1M46A 1CFPA 2F33A 3SIAA 3I5FC 4HREE 5AXIA 3WHUB 1S3PA 3EVVA 1WY9A 1ZACA 3O6BA 2JXCA 1LINA 2B1UA 1QJTA 2MRDA 2ZN8A 4AQJA 2F3YA 4DRWA 1L2OB 1K8UA 3CGAA 2LCPA 3SG2A 5AERA 2L5XB 5HLVA 1LS8A 2M1UA 3PATA 3PFVA 1YVLA 2LC5A 2JU0A 2GV5A 3SS5A 1F4QA 2JZIA 1OOHA 1JBAA 2WOSA 3E3RA 2WCEA 1JUOA 2KQ6A 3AKBA 3O4YA 3DVEA 2HQWA 2KAYA 1M63B 3OHMB 1GQMA 1QX5B 1K2HA 1S6JA 3BUMB 1NYAA 1DJIA 1EL4A 3CZ1A 4HSZA 4ORBB 2ZNDA 1C3ZA 5FYXA 1A2XA 2KFFA 1DF0A 5I94A 1LA0A 4DCKA 4GGFA 3DF0B 2LAPA 5JOLA 1AP4A 4XJKB 2A4JA 3I5FB 2KLDA 2LMUA 3CABA 3S0DA 5D3OA 1JFJA 4YGAA 1QVIZ 2LMTA 3BFBA 4OV2A 2F3ZA 1DC1A 3D75A 1DQEA 2GGZA 5AANA 3I5IB 2KLEA 1B8CA 3OB2B 2BE4A 5HYDA 2BL0C 5AEQA 1TTXA 1RJVA 1PSRA 3S0GA 4C0KA 3SG5A 3GK2A 1EG3A 1ORGA 1Y6WA 4ETOA 2GTEA 1J1EA 1G4YR 3L47A 3CR4X 3ZNIA 4JQ0D 4INWA 1NX0A 3KPXA 5CSFA 4GPLB 3B87A 1T14A 1FPWA 1XFYO 3B86A 3N7HA 3KEVA 2MLEC 2EHBA 4I5KA 1QIWA 1BMOA 1EJ3A 1NWDA 3I5GB 3ICBA 1K9KA 1BU3A 2F2OA 2K61A 2BKHB 2JPOA 2JT3A 3TDUA 2H8VA 2L5YA 1JWDA 4JWQA 1SK6D 2FCDA 3SS4A 2ZNEA 3OBVA 3UO9A 2CNPA 4MBEA 3K21A 5HKYA 4MRXA 1AUIB 1XK4A 1Y0VH 4PALA 4PE4A 2KAXA 3LK0A 3V2LA 1DF0B 3EVUA 2PALA 2WCFA 2G9BA 3JVTB 3PN7C 1CM4A 1DJGA 3IF7A 3VRRA 1J1DA 1OMRA 2KOTA 1TN4A 4PDZA 1BF5A 3I5HB 1DGUA 3MSEB 1OMDA 1MF8B 2O5GA 1Z2CB 1QS7A 2PVBA 2JNXA 5DKRA 1FI5A 3CR2A 2K0JA 1XFZO 4M2OA 2NCOA 3TS5C 1V1GA 4GGFC 1YRTB 2AAOA 3TUYC 2M49B 1B7TZ 1K94A 2CXJA 3OX6A 4QJ5B 1IJ5A 1CKKA 1F8HA 1TWOA 1SPYA 2NXQA 1SNLA 3DVJA 5TNCA 1SCVA 1XO5A 2L98A 4ZCVA 1F70A 1XVJA 4GUKA 1ALVA 2FJUB 2PSRA 5D69A 1SL7A 2CBLA 3EG5B 2MA2A 3PJIA 1NUBA 3FIAA 5HLOA 2K7BA 2KGRA 3HX4A 1W7JB 3BJHA 3GOFA 2IS9A 1KWOB 2LVKA 1YX7A 1Q80A 3LK1A 2PASA 2KFGA 1YR5A 1A75B 3BUNB 3FE8A 5I2LA 1WLMA 3L4LA 1PRWA 2NLNA 4OZDA 1BG1A 2K7OA 2LUXA 3D73A 1NX1A 4C0JA 1B8LA 4FTGA 1OOJA 2BCAA 1OOIX 1UUSA 5BPJA 1L2OC 1S1EA 3B7AA 2WCHA 1SL8A 3EK8A 3KO0A 1NCYA 1FBVA 2KI6D 2NCPA 1DMOA 4A4BA 3FWBA 1F4OA 3FE9A 2QACA 3D10A 3PALA 3S0BA 2QEBA 1W7IB 1R2UA 2L2EA 3SJSA 1J7RA 1SW8A 4MLWA 5KTYA 5FI6A 2M7NA 2WCJA 3M0WA 2HF5A 1F71A 1UWOA 2E6WA 3AAKA 1A03A 1D1OA 2I7AA 3SG3A 3DXLA 1QTXA 2RGIA 2K2FA 1SL9A 1DJXA 1IGVA 4KYNA 1MUXA 3DZTA 1H4BA 1CNPA 1A4PA 4PHNA 1YUTA 1TUJA 2P71A 2M7LA 1PULA 4MN0A 2MJWB 4PHKA 1DJHA 4Q04A 1OZSA 3BUXB 3JVTC 4A4CA 2JTTA 4CIDA 3PN7B 2WCBA 1CDNA 2Y1MA 2P6BB 3B6XA 1WLZA 4PCWA 2EC6C 5CSJA 2FJYA 1P28A 3SIBA 1DT7B 1N65A 4QJ4B 3CWGA 1KQMB 1CM1A 2WCKA 3UNWA 1TRFA 1MXLC 2KBMA 2LV7A 5PALA 4DS7A 2HPSA 1TNWA 1TNQA 1K9UA 1NIWA 1QV0A 2KDHA 2OS8B 1UP5A 3JTDB 2LHLA 1MWNA 1SKTA 3GK4X 3WHTB 4NQGA 3TUYB 3CYZA 2ZFDA 2OTGB 3FWCA 1CMGA 1NP8A 2KAVA 1CLLA 3BXKA 1XFVO 1B7TY 1SBJA 2KGBC 2I18A 2BCBA 1DTLA 2H2KA 5CPVA 2ZN9A 1CFFA 1JC2A 1SY9A 3R1PA 4OCIA 1QATA 1WRZA 3FE6A 3EK7A 1OE9B 1FI6A 4GAOA 4DUQA 1J7OA 4I5LB 2DOQA 2KYCA 1KK7Y 4N1GA 1F54A 1C7WA 1PSBA 3ZWHA 1EG4A 1KWOC 1C07A 3TZ1A 1RFJA 1ALWA 1A29A 3K1EA 3HCMA 4JPZB 2WC8A 1CDLA 2SCPA 2M0RA 3IQOA 2KI4C 2K7CA 1IKUA 3D76A 1BR1B 3O2PA 4INXA 3DVKA 4MSPA 1YUUA 4P2YB 3QRXA 2TN4A 1LVCD 4YGEB 1TCOB 1L7ZA 2LVIA 2COLB 2KSPA 2PQLA 3PSRA 4CFRA 1UHNA 4PE1A 3CTNA 4MVFA 4QJ3B 1SRAA 3A8RA 2L4HA 1UHHA 3D0YB 1GGWA 4I5NB 2M1KB 4XYNA 1CMFA 1GM0A 1MXEA 4NDDA 3OB1B 1OMVA 1LKJA 1XFXO 1G8IA 2BBMA 4IJ7A 5K89A 4WQ3A 3RLZA 3D74A 1YRUB 5G08A 1Y1XA 1S26D 4IL1A 1S36A 2HQ8A 1WDCC 1AJ5A 2MHHA 3SG4A 5I2OA 3NSOA 1IG5A 5DICA 4GNKB 2K2AA 2Y1NA 2FOTA 3EKJA 4GGNA 1IQ3A 1QX7A 2LANA 1CTRA 1U5IB 2JT8A 2JRFA 2ERBA 4FQOA 4FQTA 1HT9A 4NDCA 2JXLA 4OR9B 2Y4QA 2BAPA 3BUWB 4ORCB 4P5OE 2E30A 2JWWA 4ZCUA 1S6IA 1Y1UA 5ER5A 3KHEA 1XA5A 2MLFC 1XFRA 4ORAB 2JPTA 1QVIY 1OQPA 2Y5IA 4F0ZB 3S0AA 4PE7A 1FF1A 1MR8A 3NHTA 3RZSA 2BECA 2Q4UA 3WXAA 1ZUZA 3C1VA 4YGCB 1XFWO 4HRGA 2M9GA 3NXAA 1DEKA 4PT1A 3DY9A 2L51A 3D77A 1EH2A 1CLMA 1NSHA 3A4UB 3B88A 1S6CA 1LXFC 3LLEA 4YRUA 2M8UA 1KFXS 1KFUS 2QEVA 4WQ2A 4C0LA 1BLQA 2JOJA 4PHJA 2MAZA 4BY5A 1UHIA 3VRQA 1CB1A 5KSZA 1WDCB 1SMGA 5DKQA 1EXRA 3NSIA 3CDNA 4L9MA 4AOMA 3BYAA 5I2QA 4MRYA 2ZKMX 1AVSA 1PVAA 1PVBA 1OOGA 3BOWA 2L50A 3OGNA 2F8PA 2LM5A 3BFAA 1FW4A 3IQQA 3VB1A 2QEOA 4MZJA 1SCMC 1XK4C 2LMVA 4M2QA 4M2PA 3NSLA 2LNKA 5EL2A 1XYDA 3PM8A 5IBWA 1BJFA 2NZ0A 3CZ0A 4D1EA 3R1VA 4DIRA 1G33A 1E8AA 2JTZA 1YUSA 3L4AA 1J7PA 5FI7A 2KBIA 1ODBA 2M3WA 1IIOA 2K8MB 3QMEA 5CSNA 2BCXA 2BE6A 2KNEA 5ER4X 1GGZA 1IRJA 1PALA 1X02A 2AMIA 4CFQA 1TOPA 2LLUA 2M29A 1RTP1 4YBHB 1QLSA 1GJYA 1K93D 1TCFA 3JTDC 4YI8A 2JC2A 1BR4B 3TDZA 1DGVA 2PRUA 3BUOB 4MZKA 3OX5A 4PE0A 5J3XA 1DJZA 1K96A 1RROA 2H61C 1V1FA 3R1OA 3NHIA 1JSAA 1UURA 2BNXA 1JF2A 2EGDA 2K60A 1ZMZA 2KFHA 1DJYA 3BOWB 3VRPA 1M31A 1AK8A 3I5GC 3DVMA 3OP0A 1CFCA 2JULA 2F2PA 1JFKA 1SCMB 3TDIA 2R2IA 1ZFSA 3F45A 1NPQA 1TNPA 1QIVA 1PK0D 5DKNA 2BBNA 1IH0A 5I8NA 3PM2A 4MEWA 4CPVA 1C7VA 2ZRTA 1IQ5A 1BT6A 2L4IA 3D0YA 1K90D 4N1FA 3BFHA 1IJ6A 1S5GY 3NGVA 2KI4B 4NDBA 1AJ4A 1LA3A 2M97A 4JD9A 1SR6C 1VRKA 5HKWA 1QX2A 2LVJA 3O4XA 3SS3A 5KU1A 1BODA 1B47A 3I5HC 3S0FA 2PMYA 3CR5X 1N2DA 1QV1A 1UHJA 1TIZA 1HQVA 1U5IA 2I2RE 1DJWA 2AUCA 1KK8B 1YURA 1CFDA 1YX8A 1XFUO 1J55A 4MZLA 4ICBA 1NCXA 2KPHA 3R72A 3TS5B 1AHRA 2KHNA 5F6TA 2SASA 3O78A 3S0EA 2QDIA 3VRNA 4HRHA 1F55A 5JJGA 1QASA 3DD4A 2ISDA 2LUCA 1CLBA 3VGOA 1RWYA 2LE9B 3CZ2A 1JF0A 4GFTA 1H8BA 2H61A 1SSEB 3EK4A 2CTNA 1CDMA 4YGBB 1QLKA 5B8IB 3AAJA 2BL0B 1Z4HA 4R1EA 3DF0A 4WRIA 3EKHA 1B4CA 1YVHA 1KCYA 1KSOA 1ZOTB 1TUZA 4E68A 3CS1A 1OZOA 1MQ1A 1SR6B 3GK1A 1J7QA 2ZRSA 3AKAA 2JQ6A 2WC6A 2QPTA 3PLFB 2OTGC 2CCMA 1OW4A 2LHIA 1MHOA 5FI2A 2WNDA 2MBXA 1KK8C 4UPGA 1B8RA 2LVVA 2K7DA 2WC5A 3D78A 2L0PA 4TNCA 4PHMA 4U8DA 2LLTA 3KF9A 1QXPA 2WORA 3RM1A 1CDPA 4YI9A 2LLSA 5GQQC 5HL1A 1NX2A 4I5JA 4OKHA 1B9AA 2D8NA 2G2BA 3SG6A 3VROA 1BOCA 1OSAA 3CLNA 2LP3A 3BQ3A 1W9ZA 1C3YA 4GBAA 2KYFA 1B1GA 1K95A 4BY4A 4YGDB 1S5GZ 1WRKA 2JT0A 4AQIA 4USLA 3CZTX 2KQYA 3Q8IA 2CT9A 3LL8B 2V53A 1KQVA 4OVNF 2EC6B 1KSMA 1A75A 1NCZA 1KQMC 2HETA 1N0YA 2LP2A 3DYEA 4CLNA 1RK9A 1Y1AA 2KI6C 4JKTA 1DELA 1OOFA 2OS8C 2Q91A 1M45A 2I94A 1IWQA 1YTZC 1UHKA 2GGMA 3NSKA 5CSIA 2L2CA 2P70A 4XJKA 3LCPC 2YGUA 2WCLA 4F7FA 3I5IC 1M39A 1K9PA 5D7FA 3FS7A 3SG7A 2BKIB 2O60A 1KK7Z 1TNXA 2FCEA 2JNFA 2WCMA 3WNXB
chains in the Genus database with same CATH topology
5AFPA 2OPOA 5HKZA 1SYMA 1R6PA 1RECA 1KFXL 1KFUL 1DVIA 3EVRA 1NX3A 3H4SE 1WRLA 2VRGA 4N5XA 1M46A 1CFPA 2F33A 3SIAA 3I5FC 4HREE 5AXIA 3WHUB 1S3PA 3EVVA 1WY9A 1ZACA 3O6BA 2JXCA 1LINA 2B1UA 1QJTA 2MRDA 2ZN8A 4AQJA 2F3YA 4DRWA 1L2OB 1K8UA 3CGAA 2LCPA 3SG2A 5AERA 2L5XB 5HLVA 2M1UA 3PATA 3PFVA 1YVLA 2LC5A 2JU0A 2GV5A 1F4QA 2JZIA 1JBAA 2WOSA 3E3RA 2WCEA 1JUOA 2KQ6A 3AKBA 3O4YA 3DVEA 2HQWA 2KAYA 1M63B 3OHMB 1GQMA 1QX5B 1K2HA 1S6JA 3BUMB 1NYAA 1DJIA 1EL4A 4HSZA 4ORBB 2ZNDA 5FYXA 1A2XA 2KFFA 1DF0A 1LA0A 4DCKA 4GGFA 3DF0B 2LAPA 5JOLA 1AP4A 4XJKB 2A4JA 3I5FB 2LMUA 1JFJA 4YGAA 1QVIZ 2LMTA 4OV2A 2F3ZA 2GGZA 5AANA 3I5IB 1B8CA 3OB2B 2BE4A 5HYDA 2BL0C 5AEQA 1TTXA 1RJVA 1PSRA 4C0KA 3SG5A 3GK2A 1EG3A 4ETOA 1Y6WA 1J1EA 1G4YR 3CR4X 3ZNIA 4JQ0D 1NX0A 3KPXA 5CSFA 4GPLB 1FPWA 1XFYO 3KEVA 2MLEC 2EHBA 4I5KA 1QIWA 1BMOA 1EJ3A 1NWDA 3I5GB 3ICBA 1K9KA 1BU3A 2F2OA 2K61A 2BKHB 2JT3A 3TDUA 1JWDA 4JWQA 1SK6D 2FCDA 2ZNEA 2CNPA 4MBEA 3K21A 5HKYA 4MRXA 1AUIB 1XK4A 1Y0VH 4PALA 4PE4A 2KAXA 3LK0A 1DF0B 3EVUA 2PALA 2WCFA 2G9BA 3JVTB 3PN7C 1CM4A 1DJGA 3IF7A 3VRRA 1J1DA 1OMRA 2KOTA 1TN4A 4PDZA 1BF5A 3I5HB 1DGUA 3MSEB 1OMDA 1MF8B 2O5GA 1QS7A 2PVBA 2JNXA 5DKRA 1FI5A 3CR2A 2K0JA 1XFZO 4M2OA 2NCOA 3TS5C 1V1GA 4GGFC 1YRTB 2AAOA 3TUYC 2M49B 1B7TZ 1K94A 2CXJA 3OX6A 4QJ5B 1IJ5A 1CKKA 1F8HA 1SPYA 2NXQA 1SNLA 3DVJA 5TNCA 1SCVA 1XO5A 2L98A 4ZCVA 1F70A 1XVJA 4GUKA 1ALVA 2FJUB 2PSRA 5D69A 1SL7A 2CBLA 2MA2A 1NUBA 3FIAA 5HLOA 2K7BA 2KGRA 3HX4A 1W7JB 3GOFA 2IS9A 1KWOB 2LVKA 1YX7A 1Q80A 3LK1A 2PASA 2KFGA 1YR5A 1A75B 3BUNB 5I2LA 1WLMA 1BG1A 1PRWA 2NLNA 2K7OA 2LUXA 1NX1A 4C0JA 1B8LA 4FTGA 1OOJA 2BCAA 1UUSA 5BPJA 1L2OC 1S1EA 3EK8A 1SL8A 3KO0A 1NCYA 1FBVA 2KI6D 2NCPA 1DMOA 4A4BA 3FWBA 1F4OA 2QACA 3D10A 3PALA 1W7IB 1R2UA 2L2EA 3SJSA 1J7RA 1SW8A 4MLWA 5KTYA 2M7NA 3M0WA 2HF5A 1F71A 1UWOA 2E6WA 3AAKA 1A03A 1D1OA 2I7AA 3SG3A 1QTXA 2RGIA 2K2FA 1SL9A 1DJXA 1IGVA 1MUXA 1H4BA 1CNPA 1A4PA 4PHNA 1YUTA 2M7LA 1PULA 4MN0A 2MJWB 4PHKA 1DJHA 4Q04A 1OZSA 3BUXB 3JVTC 4A4CA 2JTTA 4CIDA 3PN7B 2WCBA 1CDNA 2Y1MA 2P6BB 3SIBA 1WLZA 4PCWA 2EC6C 5CSJA 1DT7B 1N65A 4QJ4B 3CWGA 1KQMB 1CM1A 1TRFA 1MXLC 2KBMA 2LV7A 5PALA 4DS7A 2HPSA 1TNWA 1TNQA 1K9UA 1NIWA 1QV0A 2KDHA 2OS8B 1UP5A 3JTDB 2LHLA 1MWNA 1SKTA 3GK4X 3WHTB 4NQGA 3TUYB 1CMGA 2ZFDA 2OTGB 3FWCA 1NP8A 2KAVA 1CLLA 3BXKA 1XFVO 1B7TY 1SBJA 2KGBC 2I18A 2BCBA 1DTLA 2H2KA 5CPVA 2ZN9A 1CFFA 1JC2A 1SY9A 4OCIA 1QATA 1WRZA 3EK7A 1OE9B 1FI6A 4GAOA 4DUQA 1J7OA 4I5LB 2DOQA 2KYCA 1KK7Y 4N1GA 1F54A 1C7WA 1PSBA 3ZWHA 1EG4A 1KWOC 1C07A 3TZ1A 1RFJA 1ALWA 1A29A 3HCMA 4JPZB 2WC8A 1CDLA 2SCPA 2M0RA 3IQOA 2KI4C 2K7CA 1IKUA 1BR1B 3O2PA 4MSPA 3DVKA 1YUUA 4P2YB 3QRXA 2TN4A 1LVCD 4YGEB 1TCOB 1L7ZA 2LVIA 2COLB 2KSPA 3PSRA 4CFRA 1UHNA 4PE1A 3CTNA 4MVFA 4QJ3B 1SRAA 3A8RA 2L4HA 1UHHA 3D0YB 1GGWA 4I5NB 2M1KB 4XYNA 1CMFA 1MXEA 4NDDA 3OB1B 1OMVA 1LKJA 1XFXO 1G8IA 2BBMA 5K89A 4WQ3A 3RLZA 1YRUB 5G08A 1Y1XA 1S26D 4IL1A 1S36A 2HQ8A 1WDCC 1AJ5A 2MHHA 3SG4A 5I2OA 3NSOA 1IG5A 4GNKB 2K2AA 2Y1NA 2FOTA 3EKJA 4GGNA 1IQ3A 1QX7A 2LANA 1CTRA 1U5IB 2JT8A 2JRFA 4FQOA 1HT9A 4NDCA 2JXLA 4OR9B 2Y4QA 4ORCB 3BUWB 4P5OE 4ZCUA 2E30A 2JWWA 1S6IA 1Y1UA 5ER5A 3KHEA 1XA5A 2MLFC 4ORAB 2JPTA 1QVIY 1OQPA 2Y5IA 4F0ZB 1FF1A 4PE7A 1MR8A 2BECA 2Q4UA 3WXAA 1ZUZA 3C1VA 4YGCB 1XFWO 4HRGA 2M9GA 3NXAA 1EH2A 2L51A 1CLMA 1NSHA 3A4UB 1S6CA 1LXFC 3LLEA 4YRUA 2M8UA 1KFXS 1KFUS 4WQ2A 4C0LA 1BLQA 2JOJA 4PHJA 2MAZA 4BY5A 1UHIA 3VRQA 1CB1A 5KSZA 1WDCB 1SMGA 5DKQA 1EXRA 3NSIA 4L9MA 4AOMA 3BYAA 5I2QA 4MRYA 2ZKMX 1AVSA 1PVAA 1PVBA 3BOWA 2L50A 2F8PA 2LM5A 1FW4A 3IQQA 4MZJA 1SCMC 1XK4C 2LMVA 4M2QA 4M2PA 3NSLA 2LNKA 1XYDA 3PM8A 5IBWA 1BJFA 2NZ0A 4D1EA 4DIRA 1G33A 1E8AA 2JTZA 1YUSA 1J7PA 2KBIA 1ODBA 2M3WA 2K8MB 5CSNA 2BCXA 2BE6A 2KNEA 5ER4X 1GGZA 1IRJA 1PALA 1X02A 2AMIA 4CFQA 1TOPA 2LLUA 2M29A 1RTP1 4YBHB 1QLSA 1GJYA 1K93D 1TCFA 3JTDC 4YI8A 2JC2A 1BR4B 3TDZA 1DGVA 2PRUA 3BUOB 4MZKA 3OX5A 4PE0A 5J3XA 1DJZA 1K96A 1RROA 2H61C 1V1FA 1JSAA 1UURA 1JF2A 2EGDA 1ZMZA 2KFHA 1DJYA 3BOWB 3VRPA 1M31A 1AK8A 3I5GC 3DVMA 3OP0A 1CFCA 2JULA 2F2PA 1JFKA 1SCMB 3TDIA 2R2IA 1ZFSA 3F45A 1NPQA 1TNPA 1QIVA 1PK0D 5DKNA 2BBNA 1IH0A 5I8NA 1C7VA 4MEWA 4CPVA 2ZRTA 1IQ5A 1BT6A 2L4IA 3D0YA 1K90D 4N1FA 1IJ6A 1S5GY 2KI4B 4NDBA 1AJ4A 1LA3A 2M97A 1SR6C 1VRKA 5HKWA 1QX2A 2LVJA 5KU1A 1BODA 1B47A 3I5HC 2PMYA 3CR5X 1N2DA 1QV1A 1UHJA 1TIZA 1HQVA 1U5IA 2I2RE 1DJWA 2AUCA 1KK8B 1YURA 1CFDA 1YX8A 1XFUO 1J55A 4MZLA 4ICBA 1NCXA 3TS5B 1AHRA 2KHNA 5F6TA 2SASA 3O78A 3VRNA 4HRHA 1F55A 5JJGA 1QASA 3DD4A 2ISDA 2LUCA 1CLBA 3VGOA 1RWYA 2LE9B 1JF0A 4GFTA 1H8BA 2H61A 3EK4A 2CTNA 1CDMA 4YGBB 1QLKA 5B8IB 3AAJA 2BL0B 4R1EA 3DF0A 4WRIA 3EKHA 1B4CA 1YVHA 1KCYA 1KSOA 1ZOTB 4E68A 3CS1A 1OZOA 1MQ1A 1SR6B 3GK1A 1J7QA 2ZRSA 3AKAA 2JQ6A 2QPTA 3PLFB 2OTGC 2CCMA 2LHIA 1MHOA 2WNDA 2MBXA 1KK8C 4UPGA 1B8RA 2LVVA 2K7DA 2L0PA 4TNCA 4PHMA 4U8DA 2LLTA 3KF9A 1QXPA 2WORA 3RM1A 1CDPA 4YI9A 2LLSA 5GQQC 1NX2A 4I5JA 4OKHA 1B9AA 2D8NA 2G2BA 3SG6A 3VROA 1BOCA 1OSAA 3CLNA 2LP3A 3BQ3A 4GBAA 2KYFA 1B1GA 1K95A 4BY4A 4YGDB 1S5GZ 1WRKA 2JT0A 4AQIA 4USLA 3CZTX 2KQYA 2CT9A 3LL8B 2V53A 1KQVA 4OVNF 2EC6B 1KSMA 1A75A 1NCZA 2HETA 1KQMC 1N0YA 2LP2A 4CLNA 1RK9A 1Y1AA 2KI6C 2OS8C 2Q91A 1M45A 2I94A 1IWQA 1YTZC 1UHKA 2GGMA 3NSKA 5CSIA 4XJKA 3LCPC 3I5IC 1M39A 1K9PA 5D7FA 3FS7A 3SG7A 2BKIB 2O60A 1KK7Z 1TNXA 2FCEA 2JNFA 3WNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFP A;  2OPO A;  5HKZ A;  1SYM A;  1R6P A;  1REC A;  1KFX L;  1KFU L;  1DVI A;  3EVR A;  1NX3 A;  3H4S E;  1WRL A;  2VRG A;  4N5X A;  1M46 A;  1CFP A;  2F33 A;  3SIA A;  3I5F C;  4HRE E;  5AXI A;  3WHU B;  1S3P A;  3EVV A;  1WY9 A;  1ZAC A;  3O6B A;  2JXC A;  1LIN A;  2B1U A;  1QJT A;  2MRD A;  2ZN8 A;  4AQJ A;  2F3Y A;  4DRW A;  1L2O B;  1K8U A;  3CGA A;  2LCP A;  3SG2 A;  5AER A;  2L5X B;  5HLV A;  2M1U A;  3PAT A;  3PFV A;  1YVL A;  2LC5 A;  2JU0 A;  2GV5 A;  1F4Q A;  2JZI A;  1JBA A;  2WOS A;  3E3R A;  2WCE A;  1JUO A;  2KQ6 A;  3AKB A;  3O4Y A;  3DVE A;  2HQW A;  2KAY A;  1M63 B;  3OHM B;  1GQM A;  1QX5 B;  1K2H A;  1S6J A;  3BUM B;  1NYA A;  1DJI A;  1EL4 A;  4HSZ A;  4ORB B;  2ZND A;  5FYX A;  1A2X A;  2KFF A;  1DF0 A;  1LA0 A;  4DCK A;  4GGF A;  3DF0 B;  2LAP A;  5JOL A;  1AP4 A;  4XJK B;  2A4J A;  3I5F B;  2LMU A;  1JFJ A;  4YGA A;  1QVI Z;  2LMT A;  4OV2 A;  2F3Z A;  2GGZ A;  5AAN A;  3I5I B;  1B8C A;  3OB2 B;  2BE4 A;  5HYD A;  2BL0 C;  5AEQ A;  1TTX A;  1RJV A;  1PSR A;  4C0K A;  3SG5 A;  3GK2 A;  1EG3 A;  4ETO A;  1Y6W A;  1J1E A;  1G4Y R;  3CR4 X;  3ZNI A;  4JQ0 D;  1NX0 A;  3KPX A;  5CSF A;  4GPL B;  1FPW A;  1XFY O;  3KEV A;  2MLE C;  2EHB A;  4I5K A;  1QIW A;  1BMO A;  1EJ3 A;  1NWD A;  3I5G B;  3ICB A;  1K9K A;  1BU3 A;  2F2O A;  2K61 A;  2BKH B;  2JT3 A;  3TDU A;  1JWD A;  4JWQ A;  1SK6 D;  2FCD A;  2ZNE A;  2CNP A;  4MBE A;  3K21 A;  5HKY A;  4MRX A;  1AUI B;  1XK4 A;  1Y0V H;  4PAL A;  4PE4 A;  2KAX A;  3LK0 A;  1DF0 B;  3EVU A;  2PAL A;  2WCF A;  2G9B A;  3JVT B;  3PN7 C;  1CM4 A;  1DJG A;  3IF7 A;  3VRR A;  1J1D A;  1OMR A;  2KOT A;  1TN4 A;  4PDZ A;  1BF5 A;  3I5H B;  1DGU A;  3MSE B;  1OMD A;  1MF8 B;  2O5G A;  1QS7 A;  2PVB A;  2JNX A;  5DKR A;  1FI5 A;  3CR2 A;  2K0J A;  1XFZ O;  4M2O A;  2NCO A;  3TS5 C;  1V1G A;  4GGF C;  1YRT B;  2AAO A;  3TUY C;  2M49 B;  1B7T Z;  1K94 A;  2CXJ A;  3OX6 A;  4QJ5 B;  1IJ5 A;  1CKK A;  1F8H A;  1SPY A;  2NXQ A;  1SNL A;  3DVJ A;  5TNC A;  1SCV A;  1XO5 A;  2L98 A;  4ZCV A;  1F70 A;  1XVJ A;  4GUK A;  1ALV A;  2FJU B;  2PSR A;  5D69 A;  1SL7 A;  2CBL A;  2MA2 A;  1NUB A;  3FIA A;  5HLO A;  2K7B A;  2KGR A;  3HX4 A;  1W7J B;  3GOF A;  2IS9 A;  1KWO B;  2LVK A;  1YX7 A;  1Q80 A;  3LK1 A;  2PAS A;  2KFG A;  1YR5 A;  1A75 B;  3BUN B;  5I2L A;  1WLM A;  1BG1 A;  1PRW A;  2NLN A;  2K7O A;  2LUX A;  1NX1 A;  4C0J A;  1B8L A;  4FTG A;  1OOJ A;  2BCA A;  1UUS A;  5BPJ A;  1L2O C;  1S1E A;  3EK8 A;  1SL8 A;  3KO0 A;  1NCY A;  1FBV A;  2KI6 D;  2NCP A;  1DMO A;  4A4B A;  3FWB A;  1F4O A;  2QAC A;  3D10 A;  3PAL A;  1W7I B;  1R2U A;  2L2E A;  3SJS A;  1J7R A;  1SW8 A;  4MLW A;  5KTY A;  2M7N A;  3M0W A;  2HF5 A;  1F71 A;  1UWO A;  2E6W A;  3AAK A;  1A03 A;  1D1O A;  2I7A A;  3SG3 A;  1QTX A;  2RGI A;  2K2F A;  1SL9 A;  1DJX A;  1IGV A;  1MUX A;  1H4B A;  1CNP A;  1A4P A;  4PHN A;  1YUT A;  2M7L A;  1PUL A;  4MN0 A;  2MJW B;  4PHK A;  1DJH A;  4Q04 A;  1OZS A;  3BUX B;  3JVT C;  4A4C A;  2JTT A;  4CID A;  3PN7 B;  2WCB A;  1CDN A;  2Y1M A;  2P6B B;  3SIB A;  1WLZ A;  4PCW A;  2EC6 C;  5CSJ A;  1DT7 B;  1N65 A;  4QJ4 B;  3CWG A;  1KQM B;  1CM1 A;  1TRF A;  1MXL C;  2KBM A;  2LV7 A;  5PAL A;  4DS7 A;  2HPS A;  1TNW A;  1TNQ A;  1K9U A;  1NIW A;  1QV0 A;  2KDH A;  2OS8 B;  1UP5 A;  3JTD B;  2LHL A;  1MWN A;  1SKT A;  3GK4 X;  3WHT B;  4NQG A;  3TUY B;  1CMG A;  2ZFD A;  2OTG B;  3FWC A;  1NP8 A;  2KAV A;  1CLL A;  3BXK A;  1XFV O;  1B7T Y;  1SBJ A;  2KGB C;  2I18 A;  2BCB A;  1DTL A;  2H2K A;  5CPV A;  2ZN9 A;  1CFF A;  1JC2 A;  1SY9 A;  4OCI A;  1QAT A;  1WRZ A;  3EK7 A;  1OE9 B;  1FI6 A;  4GAO A;  4DUQ A;  1J7O A;  4I5L B;  2DOQ A;  2KYC A;  1KK7 Y;  4N1G A;  1F54 A;  1C7W A;  1PSB A;  3ZWH A;  1EG4 A;  1KWO C;  1C07 A;  3TZ1 A;  1RFJ A;  1ALW A;  1A29 A;  3HCM A;  4JPZ B;  2WC8 A;  1CDL A;  2SCP A;  2M0R A;  3IQO A;  2KI4 C;  2K7C A;  1IKU A;  1BR1 B;  3O2P A;  4MSP A;  3DVK A;  1YUU A;  4P2Y B;  3QRX A;  2TN4 A;  1LVC D;  4YGE B;  1TCO B;  1L7Z A;  2LVI A;  2COL B;  2KSP A;  3PSR A;  4CFR A;  1UHN A;  4PE1 A;  3CTN A;  4MVF A;  4QJ3 B;  1SRA A;  3A8R A;  2L4H A;  1UHH A;  3D0Y B;  1GGW A;  4I5N B;  2M1K B;  4XYN A;  1CMF A;  1MXE A;  4NDD A;  3OB1 B;  1OMV A;  1LKJ A;  1XFX O;  1G8I A;  2BBM A;  5K89 A;  4WQ3 A;  3RLZ A;  1YRU B;  5G08 A;  1Y1X A;  1S26 D;  4IL1 A;  1S36 A;  2HQ8 A;  1WDC C;  1AJ5 A;  2MHH A;  3SG4 A;  5I2O A;  3NSO A;  1IG5 A;  4GNK B;  2K2A A;  2Y1N A;  2FOT A;  3EKJ A;  4GGN A;  1IQ3 A;  1QX7 A;  2LAN A;  1CTR A;  1U5I B;  2JT8 A;  2JRF A;  4FQO A;  1HT9 A;  4NDC A;  2JXL A;  4OR9 B;  2Y4Q A;  4ORC B;  3BUW B;  4P5O E;  4ZCU A;  2E30 A;  2JWW A;  1S6I A;  1Y1U A;  5ER5 A;  3KHE A;  1XA5 A;  2MLF C;  4ORA B;  2JPT A;  1QVI Y;  1OQP A;  2Y5I A;  4F0Z B;  1FF1 A;  4PE7 A;  1MR8 A;  2BEC A;  2Q4U A;  3WXA A;  1ZUZ A;  3C1V A;  4YGC B;  1XFW O;  4HRG A;  2M9G A;  3NXA A;  1EH2 A;  2L51 A;  1CLM A;  1NSH A;  3A4U B;  1S6C A;  1LXF C;  3LLE A;  4YRU A;  2M8U A;  1KFX S;  1KFU S;  4WQ2 A;  4C0L A;  1BLQ A;  2JOJ A;  4PHJ A;  2MAZ A;  4BY5 A;  1UHI A;  3VRQ A;  1CB1 A;  5KSZ A;  1WDC B;  1SMG A;  5DKQ A;  1EXR A;  3NSI A;  4L9M A;  4AOM A;  3BYA A;  5I2Q A;  4MRY A;  2ZKM X;  1AVS A;  1PVA A;  1PVB A;  3BOW A;  2L50 A;  2F8P A;  2LM5 A;  1FW4 A;  3IQQ A;  4MZJ A;  1SCM C;  1XK4 C;  2LMV A;  4M2Q A;  4M2P A;  3NSL A;  2LNK A;  1XYD A;  3PM8 A;  5IBW A;  1BJF A;  2NZ0 A;  4D1E A;  4DIR A;  1G33 A;  1E8A A;  2JTZ A;  1YUS A;  1J7P A;  2KBI A;  1ODB A;  2M3W A;  2K8M B;  5CSN A;  2BCX A;  2BE6 A;  2KNE A;  5ER4 X;  1GGZ A;  1IRJ A;  1PAL A;  1X02 A;  2AMI A;  4CFQ A;  1TOP A;  2LLU A;  2M29 A;  1RTP 1;  4YBH B;  1QLS A;  1GJY A;  1K93 D;  1TCF A;  3JTD C;  4YI8 A;  2JC2 A;  1BR4 B;  3TDZ A;  1DGV A;  2PRU A;  3BUO B;  4MZK A;  3OX5 A;  4PE0 A;  5J3X A;  1DJZ A;  1K96 A;  1RRO A;  2H61 C;  1V1F A;  1JSA A;  1UUR A;  1JF2 A;  2EGD A;  1ZMZ A;  2KFH A;  1DJY A;  3BOW B;  3VRP A;  1M31 A;  1AK8 A;  3I5G C;  3DVM A;  3OP0 A;  1CFC A;  2JUL A;  2F2P A;  1JFK A;  1SCM B;  3TDI A;  2R2I A;  1ZFS A;  3F45 A;  1NPQ A;  1TNP A;  1QIV A;  1PK0 D;  5DKN A;  2BBN A;  1IH0 A;  5I8N A;  1C7V A;  4MEW A;  4CPV A;  2ZRT A;  1IQ5 A;  1BT6 A;  2L4I A;  3D0Y A;  1K90 D;  4N1F A;  1IJ6 A;  1S5G Y;  2KI4 B;  4NDB A;  1AJ4 A;  1LA3 A;  2M97 A;  1SR6 C;  1VRK A;  5HKW A;  1QX2 A;  2LVJ A;  5KU1 A;  1BOD A;  1B47 A;  3I5H C;  2PMY A;  3CR5 X;  1N2D A;  1QV1 A;  1UHJ A;  1TIZ A;  1HQV A;  1U5I A;  2I2R E;  1DJW A;  2AUC A;  1KK8 B;  1YUR A;  1CFD A;  1YX8 A;  1XFU O;  1J55 A;  4MZL A;  4ICB A;  1NCX A;  3TS5 B;  1AHR A;  2KHN A;  5F6T A;  2SAS A;  3O78 A;  3VRN A;  4HRH A;  1F55 A;  5JJG A;  1QAS A;  3DD4 A;  2ISD A;  2LUC A;  1CLB A;  3VGO A;  1RWY A;  2LE9 B;  1JF0 A;  4GFT A;  1H8B A;  2H61 A;  3EK4 A;  2CTN A;  1CDM A;  4YGB B;  1QLK A;  5B8I B;  3AAJ A;  2BL0 B;  4R1E A;  3DF0 A;  4WRI A;  3EKH A;  1B4C A;  1YVH A;  1KCY A;  1KSO A;  1ZOT B;  4E68 A;  3CS1 A;  1OZO A;  1MQ1 A;  1SR6 B;  3GK1 A;  1J7Q A;  2ZRS A;  3AKA A;  2JQ6 A;  2QPT A;  3PLF B;  2OTG C;  2CCM A;  2LHI A;  1MHO A;  2WND A;  2MBX A;  1KK8 C;  4UPG A;  1B8R A;  2LVV A;  2K7D A;  2L0P A;  4TNC A;  4PHM A;  4U8D A;  2LLT A;  3KF9 A;  1QXP A;  2WOR A;  3RM1 A;  1CDP A;  4YI9 A;  2LLS A;  5GQQ C;  1NX2 A;  4I5J A;  4OKH A;  1B9A A;  2D8N A;  2G2B A;  3SG6 A;  3VRO A;  1BOC A;  1OSA A;  3CLN A;  2LP3 A;  3BQ3 A;  4GBA A;  2KYF A;  1B1G A;  1K95 A;  4BY4 A;  4YGD B;  1S5G Z;  1WRK A;  2JT0 A;  4AQI A;  4USL A;  3CZT X;  2KQY A;  2CT9 A;  3LL8 B;  2V53 A;  1KQV A;  4OVN F;  2EC6 B;  1KSM A;  1A75 A;  1NCZ A;  2HET A;  1KQM C;  1N0Y A;  2LP2 A;  4CLN A;  1RK9 A;  1Y1A A;  2KI6 C;  2OS8 C;  2Q91 A;  1M45 A;  2I94 A;  1IWQ A;  1YTZ C;  1UHK A;  2GGM A;  3NSK A;  5CSI A;  4XJK A;  3LCP C;  3I5I C;  1M39 A;  1K9P A;  5D7F A;  3FS7 A;  3SG7 A;  2BKI B;  2O60 A;  1KK7 Z;  1TNX A;  2FCE A;  2JNF A;  3WNX B; 
#chains in the Genus database with same CATH topology
 5AFP A;  2OPO A;  5HKZ A;  1SYM A;  1R6P A;  1REC A;  2PYQ A;  3IVT A;  1KFX L;  1KFU L;  1DVI A;  1QWV A;  1NX3 A;  3EVR A;  2QEH A;  3H4S E;  1WRL A;  2VRG A;  4N5X A;  1M46 A;  1CFP A;  2F33 A;  3SIA A;  3I5F C;  4HRE E;  5AXI A;  3WHU B;  1S3P A;  3EVV A;  1WY9 A;  1ZAC A;  3O6B A;  2JXC A;  1LIN A;  2B1U A;  1QJT A;  2MRD A;  2ZN8 A;  4AQJ A;  2F3Y A;  4DRW A;  1L2O B;  1K8U A;  3CGA A;  2LCP A;  3SG2 A;  5AER A;  2L5X B;  5HLV A;  1LS8 A;  2M1U A;  3PAT A;  3PFV A;  1YVL A;  2LC5 A;  2JU0 A;  2GV5 A;  3SS5 A;  1F4Q A;  2JZI A;  1OOH A;  1JBA A;  2WOS A;  3E3R A;  2WCE A;  1JUO A;  2KQ6 A;  3AKB A;  3O4Y A;  3DVE A;  2HQW A;  2KAY A;  1M63 B;  3OHM B;  1GQM A;  1QX5 B;  1K2H A;  1S6J A;  3BUM B;  1NYA A;  1DJI A;  1EL4 A;  3CZ1 A;  4HSZ A;  4ORB B;  2ZND A;  1C3Z A;  5FYX A;  1A2X A;  2KFF A;  1DF0 A;  5I94 A;  1LA0 A;  4DCK A;  4GGF A;  3DF0 B;  2LAP A;  5JOL A;  1AP4 A;  4XJK B;  2A4J A;  3I5F B;  2KLD A;  2LMU A;  3CAB A;  3S0D A;  5D3O A;  1JFJ A;  4YGA A;  1QVI Z;  2LMT A;  3BFB A;  4OV2 A;  2F3Z A;  1DC1 A;  3D75 A;  1DQE A;  2GGZ A;  5AAN A;  3I5I B;  2KLE A;  1B8C A;  3OB2 B;  2BE4 A;  5HYD A;  2BL0 C;  5AEQ A;  1TTX A;  1RJV A;  1PSR A;  3S0G A;  4C0K A;  3SG5 A;  3GK2 A;  1EG3 A;  1ORG A;  1Y6W A;  4ETO A;  2GTE A;  1J1E A;  1G4Y R;  3L47 A;  3CR4 X;  3ZNI A;  4JQ0 D;  4INW A;  1NX0 A;  3KPX A;  5CSF A;  4GPL B;  3B87 A;  1T14 A;  1FPW A;  1XFY O;  3B86 A;  3N7H A;  3KEV A;  2MLE C;  2EHB A;  4I5K A;  1QIW A;  1BMO A;  1EJ3 A;  1NWD A;  3I5G B;  3ICB A;  1K9K A;  1BU3 A;  2F2O A;  2K61 A;  2BKH B;  2JPO A;  2JT3 A;  3TDU A;  2H8V A;  2L5Y A;  1JWD A;  4JWQ A;  1SK6 D;  2FCD A;  3SS4 A;  2ZNE A;  3OBV A;  3UO9 A;  2CNP A;  4MBE A;  3K21 A;  5HKY A;  4MRX A;  1AUI B;  1XK4 A;  1Y0V H;  4PAL A;  4PE4 A;  2KAX A;  3LK0 A;  3V2L A;  1DF0 B;  3EVU A;  2PAL A;  2WCF A;  2G9B A;  3JVT B;  3PN7 C;  1CM4 A;  1DJG A;  3IF7 A;  3VRR A;  1J1D A;  1OMR A;  2KOT A;  1TN4 A;  4PDZ A;  1BF5 A;  3I5H B;  1DGU A;  3MSE B;  1OMD A;  1MF8 B;  2O5G A;  1Z2C B;  1QS7 A;  2PVB A;  2JNX A;  5DKR A;  1FI5 A;  3CR2 A;  2K0J A;  1XFZ O;  4M2O A;  2NCO A;  3TS5 C;  1V1G A;  4GGF C;  1YRT B;  2AAO A;  3TUY C;  2M49 B;  1B7T Z;  1K94 A;  2CXJ A;  3OX6 A;  4QJ5 B;  1IJ5 A;  1CKK A;  1F8H A;  1TWO A;  1SPY A;  2NXQ A;  1SNL A;  3DVJ A;  5TNC A;  1SCV A;  1XO5 A;  2L98 A;  4ZCV A;  1F70 A;  1XVJ A;  4GUK A;  1ALV A;  2FJU B;  2PSR A;  5D69 A;  1SL7 A;  2CBL A;  3EG5 B;  2MA2 A;  3PJI A;  1NUB A;  3FIA A;  5HLO A;  2K7B A;  2KGR A;  3HX4 A;  1W7J B;  3BJH A;  3GOF A;  2IS9 A;  1KWO B;  2LVK A;  1YX7 A;  1Q80 A;  3LK1 A;  2PAS A;  2KFG A;  1YR5 A;  1A75 B;  3BUN B;  3FE8 A;  5I2L A;  1WLM A;  3L4L A;  1PRW A;  2NLN A;  4OZD A;  1BG1 A;  2K7O A;  2LUX A;  3D73 A;  1NX1 A;  4C0J A;  1B8L A;  4FTG A;  1OOJ A;  2BCA A;  1OOI X;  1UUS A;  5BPJ A;  1L2O C;  1S1E A;  3B7A A;  2WCH A;  1SL8 A;  3EK8 A;  3KO0 A;  1NCY A;  1FBV A;  2KI6 D;  2NCP A;  1DMO A;  4A4B A;  3FWB A;  1F4O A;  3FE9 A;  2QAC A;  3D10 A;  3PAL A;  3S0B A;  2QEB A;  1W7I B;  1R2U A;  2L2E A;  3SJS A;  1J7R A;  1SW8 A;  4MLW A;  5KTY A;  5FI6 A;  2M7N A;  2WCJ A;  3M0W A;  2HF5 A;  1F71 A;  1UWO A;  2E6W A;  3AAK A;  1A03 A;  1D1O A;  2I7A A;  3SG3 A;  3DXL A;  1QTX A;  2RGI A;  2K2F A;  1SL9 A;  1DJX A;  1IGV A;  4KYN A;  1MUX A;  3DZT A;  1H4B A;  1CNP A;  1A4P A;  4PHN A;  1YUT A;  1TUJ A;  2P71 A;  2M7L A;  1PUL A;  4MN0 A;  2MJW B;  4PHK A;  1DJH A;  4Q04 A;  1OZS A;  3BUX B;  3JVT C;  4A4C A;  2JTT A;  4CID A;  3PN7 B;  2WCB A;  1CDN A;  2Y1M A;  2P6B B;  3B6X A;  1WLZ A;  4PCW A;  2EC6 C;  5CSJ A;  2FJY A;  1P28 A;  3SIB A;  1DT7 B;  1N65 A;  4QJ4 B;  3CWG A;  1KQM B;  1CM1 A;  2WCK A;  3UNW A;  1TRF A;  1MXL C;  2KBM A;  2LV7 A;  5PAL A;  4DS7 A;  2HPS A;  1TNW A;  1TNQ A;  1K9U A;  1NIW A;  1QV0 A;  2KDH A;  2OS8 B;  1UP5 A;  3JTD B;  2LHL A;  1MWN A;  1SKT A;  3GK4 X;  3WHT B;  4NQG A;  3TUY B;  3CYZ A;  2ZFD A;  2OTG B;  3FWC A;  1CMG A;  1NP8 A;  2KAV A;  1CLL A;  3BXK A;  1XFV O;  1B7T Y;  1SBJ A;  2KGB C;  2I18 A;  2BCB A;  1DTL A;  2H2K A;  5CPV A;  2ZN9 A;  1CFF A;  1JC2 A;  1SY9 A;  3R1P A;  4OCI A;  1QAT A;  1WRZ A;  3FE6 A;  3EK7 A;  1OE9 B;  1FI6 A;  4GAO A;  4DUQ A;  1J7O A;  4I5L B;  2DOQ A;  2KYC A;  1KK7 Y;  4N1G A;  1F54 A;  1C7W A;  1PSB A;  3ZWH A;  1EG4 A;  1KWO C;  1C07 A;  3TZ1 A;  1RFJ A;  1ALW A;  1A29 A;  3K1E A;  3HCM A;  4JPZ B;  2WC8 A;  1CDL A;  2SCP A;  2M0R A;  3IQO A;  2KI4 C;  2K7C A;  1IKU A;  3D76 A;  1BR1 B;  3O2P A;  4INX A;  3DVK A;  4MSP A;  1YUU A;  4P2Y B;  3QRX A;  2TN4 A;  1LVC D;  4YGE B;  1TCO B;  1L7Z A;  2LVI A;  2COL B;  2KSP A;  2PQL A;  3PSR A;  4CFR A;  1UHN A;  4PE1 A;  3CTN A;  4MVF A;  4QJ3 B;  1SRA A;  3A8R A;  2L4H A;  1UHH A;  3D0Y B;  1GGW A;  4I5N B;  2M1K B;  4XYN A;  1CMF A;  1GM0 A;  1MXE A;  4NDD A;  3OB1 B;  1OMV A;  1LKJ A;  1XFX O;  1G8I A;  2BBM A;  4IJ7 A;  5K89 A;  4WQ3 A;  3RLZ A;  3D74 A;  1YRU B;  5G08 A;  1Y1X A;  1S26 D;  4IL1 A;  1S36 A;  2HQ8 A;  1WDC C;  1AJ5 A;  2MHH A;  3SG4 A;  5I2O A;  3NSO A;  1IG5 A;  5DIC A;  4GNK B;  2K2A A;  2Y1N A;  2FOT A;  3EKJ A;  4GGN A;  1IQ3 A;  1QX7 A;  2LAN A;  1CTR A;  1U5I B;  2JT8 A;  2JRF A;  2ERB A;  4FQO A;  4FQT A;  1HT9 A;  4NDC A;  2JXL A;  4OR9 B;  2Y4Q A;  2BAP A;  3BUW B;  4ORC B;  4P5O E;  2E30 A;  2JWW A;  4ZCU A;  1S6I A;  1Y1U A;  5ER5 A;  3KHE A;  1XA5 A;  2MLF C;  1XFR A;  4ORA B;  2JPT A;  1QVI Y;  1OQP A;  2Y5I A;  4F0Z B;  3S0A A;  4PE7 A;  1FF1 A;  1MR8 A;  3NHT A;  3RZS A;  2BEC A;  2Q4U A;  3WXA A;  1ZUZ A;  3C1V A;  4YGC B;  1XFW O;  4HRG A;  2M9G A;  3NXA A;  1DEK A;  4PT1 A;  3DY9 A;  2L51 A;  3D77 A;  1EH2 A;  1CLM A;  1NSH A;  3A4U B;  3B88 A;  1S6C A;  1LXF C;  3LLE A;  4YRU A;  2M8U A;  1KFX S;  1KFU S;  2QEV A;  4WQ2 A;  4C0L A;  1BLQ A;  2JOJ A;  4PHJ A;  2MAZ A;  4BY5 A;  1UHI A;  3VRQ A;  1CB1 A;  5KSZ A;  1WDC B;  1SMG A;  5DKQ A;  1EXR A;  3NSI A;  3CDN A;  4L9M A;  4AOM A;  3BYA A;  5I2Q A;  4MRY A;  2ZKM X;  1AVS A;  1PVA A;  1PVB A;  1OOG A;  3BOW A;  2L50 A;  3OGN A;  2F8P A;  2LM5 A;  3BFA A;  1FW4 A;  3IQQ A;  3VB1 A;  2QEO A;  4MZJ A;  1SCM C;  1XK4 C;  2LMV A;  4M2Q A;  4M2P A;  3NSL A;  2LNK A;  5EL2 A;  1XYD A;  3PM8 A;  5IBW A;  1BJF A;  2NZ0 A;  3CZ0 A;  4D1E A;  3R1V A;  4DIR A;  1G33 A;  1E8A A;  2JTZ A;  1YUS A;  3L4A A;  1J7P A;  5FI7 A;  2KBI A;  1ODB A;  2M3W A;  1IIO A;  2K8M B;  3QME A;  5CSN A;  2BCX A;  2BE6 A;  2KNE A;  5ER4 X;  1GGZ A;  1IRJ A;  1PAL A;  1X02 A;  2AMI A;  4CFQ A;  1TOP A;  2LLU A;  2M29 A;  1RTP 1;  4YBH B;  1QLS A;  1GJY A;  1K93 D;  1TCF A;  3JTD C;  4YI8 A;  2JC2 A;  1BR4 B;  3TDZ A;  1DGV A;  2PRU A;  3BUO B;  4MZK A;  3OX5 A;  4PE0 A;  5J3X A;  1DJZ A;  1K96 A;  1RRO A;  2H61 C;  1V1F A;  3R1O A;  3NHI A;  1JSA A;  1UUR A;  2BNX A;  1JF2 A;  2EGD A;  2K60 A;  1ZMZ A;  2KFH A;  1DJY A;  3BOW B;  3VRP A;  1M31 A;  1AK8 A;  3I5G C;  3DVM A;  3OP0 A;  1CFC A;  2JUL A;  2F2P A;  1JFK A;  1SCM B;  3TDI A;  2R2I A;  1ZFS A;  3F45 A;  1NPQ A;  1TNP A;  1QIV A;  1PK0 D;  5DKN A;  2BBN A;  1IH0 A;  5I8N A;  3PM2 A;  4MEW A;  4CPV A;  1C7V A;  2ZRT A;  1IQ5 A;  1BT6 A;  2L4I A;  3D0Y A;  1K90 D;  4N1F A;  3BFH A;  1IJ6 A;  1S5G Y;  3NGV A;  2KI4 B;  4NDB A;  1AJ4 A;  1LA3 A;  2M97 A;  4JD9 A;  1SR6 C;  1VRK A;  5HKW A;  1QX2 A;  2LVJ A;  3O4X A;  3SS3 A;  5KU1 A;  1BOD A;  1B47 A;  3I5H C;  3S0F A;  2PMY A;  3CR5 X;  1N2D A;  1QV1 A;  1UHJ A;  1TIZ A;  1HQV A;  1U5I A;  2I2R E;  1DJW A;  2AUC A;  1KK8 B;  1YUR A;  1CFD A;  1YX8 A;  1XFU O;  1J55 A;  4MZL A;  4ICB A;  1NCX A;  2KPH A;  3R72 A;  3TS5 B;  1AHR A;  2KHN A;  5F6T A;  2SAS A;  3O78 A;  3S0E A;  2QDI A;  3VRN A;  4HRH A;  1F55 A;  5JJG A;  1QAS A;  3DD4 A;  2ISD A;  2LUC A;  1CLB A;  3VGO A;  1RWY A;  2LE9 B;  3CZ2 A;  1JF0 A;  4GFT A;  1H8B A;  2H61 A;  1SSE B;  3EK4 A;  2CTN A;  1CDM A;  4YGB B;  1QLK A;  5B8I B;  3AAJ A;  2BL0 B;  1Z4H A;  4R1E A;  3DF0 A;  4WRI A;  3EKH A;  1B4C A;  1YVH A;  1KCY A;  1KSO A;  1ZOT B;  1TUZ A;  4E68 A;  3CS1 A;  1OZO A;  1MQ1 A;  1SR6 B;  3GK1 A;  1J7Q A;  2ZRS A;  3AKA A;  2JQ6 A;  2WC6 A;  2QPT A;  3PLF B;  2OTG C;  2CCM A;  1OW4 A;  2LHI A;  1MHO A;  5FI2 A;  2WND A;  2MBX A;  1KK8 C;  4UPG A;  1B8R A;  2LVV A;  2K7D A;  2WC5 A;  3D78 A;  2L0P A;  4TNC A;  4PHM A;  4U8D A;  2LLT A;  3KF9 A;  1QXP A;  2WOR A;  3RM1 A;  1CDP A;  4YI9 A;  2LLS A;  5GQQ C;  5HL1 A;  1NX2 A;  4I5J A;  4OKH A;  1B9A A;  2D8N A;  2G2B A;  3SG6 A;  3VRO A;  1BOC A;  1OSA A;  3CLN A;  2LP3 A;  3BQ3 A;  1W9Z A;  1C3Y A;  4GBA A;  2KYF A;  1B1G A;  1K95 A;  4BY4 A;  4YGD B;  1S5G Z;  1WRK A;  2JT0 A;  4AQI A;  4USL A;  3CZT X;  2KQY A;  3Q8I A;  2CT9 A;  3LL8 B;  2V53 A;  1KQV A;  4OVN F;  2EC6 B;  1KSM A;  1A75 A;  1NCZ A;  1KQM C;  2HET A;  1N0Y A;  2LP2 A;  3DYE A;  4CLN A;  1RK9 A;  1Y1A A;  2KI6 C;  4JKT A;  1DEL A;  1OOF A;  2OS8 C;  2Q91 A;  1M45 A;  2I94 A;  1IWQ A;  1YTZ C;  1UHK A;  2GGM A;  3NSK A;  5CSI A;  2L2C A;  2P70 A;  4XJK A;  3LCP C;  2YGU A;  2WCL A;  4F7F A;  3I5I C;  1M39 A;  1K9P A;  5D7F A;  3FS7 A;  3SG7 A;  2BKI B;  2O60 A;  1KK7 Z;  1TNX A;  2FCE A;  2JNF A;  2WCM A;  3WNX B; 
#chains in the Genus database with same CATH homology
 5AFP A;  2OPO A;  5HKZ A;  1SYM A;  1R6P A;  1REC A;  1KFX L;  1KFU L;  1DVI A;  3EVR A;  1NX3 A;  3H4S E;  1WRL A;  2VRG A;  4N5X A;  1M46 A;  1CFP A;  2F33 A;  3SIA A;  3I5F C;  4HRE E;  5AXI A;  3WHU B;  1S3P A;  3EVV A;  1WY9 A;  1ZAC A;  3O6B A;  2JXC A;  1LIN A;  2B1U A;  1QJT A;  2MRD A;  2ZN8 A;  4AQJ A;  2F3Y A;  4DRW A;  1L2O B;  1K8U A;  3CGA A;  2LCP A;  3SG2 A;  5AER A;  2L5X B;  5HLV A;  2M1U A;  3PAT A;  3PFV A;  1YVL A;  2LC5 A;  2JU0 A;  2GV5 A;  1F4Q A;  2JZI A;  1JBA A;  2WOS A;  3E3R A;  2WCE A;  1JUO A;  2KQ6 A;  3AKB A;  3O4Y A;  3DVE A;  2HQW A;  2KAY A;  1M63 B;  3OHM B;  1GQM A;  1QX5 B;  1K2H A;  1S6J A;  3BUM B;  1NYA A;  1DJI A;  1EL4 A;  4HSZ A;  4ORB B;  2ZND A;  5FYX A;  1A2X A;  2KFF A;  1DF0 A;  1LA0 A;  4DCK A;  4GGF A;  3DF0 B;  2LAP A;  5JOL A;  1AP4 A;  4XJK B;  2A4J A;  3I5F B;  2LMU A;  1JFJ A;  4YGA A;  1QVI Z;  2LMT A;  4OV2 A;  2F3Z A;  2GGZ A;  5AAN A;  3I5I B;  1B8C A;  3OB2 B;  2BE4 A;  5HYD A;  2BL0 C;  5AEQ A;  1TTX A;  1RJV A;  1PSR A;  4C0K A;  3SG5 A;  3GK2 A;  1EG3 A;  4ETO A;  1Y6W A;  1J1E A;  1G4Y R;  3CR4 X;  3ZNI A;  4JQ0 D;  1NX0 A;  3KPX A;  5CSF A;  4GPL B;  1FPW A;  1XFY O;  3KEV A;  2MLE C;  2EHB A;  4I5K A;  1QIW A;  1BMO A;  1EJ3 A;  1NWD A;  3I5G B;  3ICB A;  1K9K A;  1BU3 A;  2F2O A;  2K61 A;  2BKH B;  2JT3 A;  3TDU A;  1JWD A;  4JWQ A;  1SK6 D;  2FCD A;  2ZNE A;  2CNP A;  4MBE A;  3K21 A;  5HKY A;  4MRX A;  1AUI B;  1XK4 A;  1Y0V H;  4PAL A;  4PE4 A;  2KAX A;  3LK0 A;  1DF0 B;  3EVU A;  2PAL A;  2WCF A;  2G9B A;  3JVT B;  3PN7 C;  1CM4 A;  1DJG A;  3IF7 A;  3VRR A;  1J1D A;  1OMR A;  2KOT A;  1TN4 A;  4PDZ A;  1BF5 A;  3I5H B;  1DGU A;  3MSE B;  1OMD A;  1MF8 B;  2O5G A;  1QS7 A;  2PVB A;  2JNX A;  5DKR A;  1FI5 A;  3CR2 A;  2K0J A;  1XFZ O;  4M2O A;  2NCO A;  3TS5 C;  1V1G A;  4GGF C;  1YRT B;  2AAO A;  3TUY C;  2M49 B;  1B7T Z;  1K94 A;  2CXJ A;  3OX6 A;  4QJ5 B;  1IJ5 A;  1CKK A;  1F8H A;  1SPY A;  2NXQ A;  1SNL A;  3DVJ A;  5TNC A;  1SCV A;  1XO5 A;  2L98 A;  4ZCV A;  1F70 A;  1XVJ A;  4GUK A;  1ALV A;  2FJU B;  2PSR A;  5D69 A;  1SL7 A;  2CBL A;  2MA2 A;  1NUB A;  3FIA A;  5HLO A;  2K7B A;  2KGR A;  3HX4 A;  1W7J B;  3GOF A;  2IS9 A;  1KWO B;  2LVK A;  1YX7 A;  1Q80 A;  3LK1 A;  2PAS A;  2KFG A;  1YR5 A;  1A75 B;  3BUN B;  5I2L A;  1WLM A;  1BG1 A;  1PRW A;  2NLN A;  2K7O A;  2LUX A;  1NX1 A;  4C0J A;  1B8L A;  4FTG A;  1OOJ A;  2BCA A;  1UUS A;  5BPJ A;  1L2O C;  1S1E A;  3EK8 A;  1SL8 A;  3KO0 A;  1NCY A;  1FBV A;  2KI6 D;  2NCP A;  1DMO A;  4A4B A;  3FWB A;  1F4O A;  2QAC A;  3D10 A;  3PAL A;  1W7I B;  1R2U A;  2L2E A;  3SJS A;  1J7R A;  1SW8 A;  4MLW A;  5KTY A;  2M7N A;  3M0W A;  2HF5 A;  1F71 A;  1UWO A;  2E6W A;  3AAK A;  1A03 A;  1D1O A;  2I7A A;  3SG3 A;  1QTX A;  2RGI A;  2K2F A;  1SL9 A;  1DJX A;  1IGV A;  1MUX A;  1H4B A;  1CNP A;  1A4P A;  4PHN A;  1YUT A;  2M7L A;  1PUL A;  4MN0 A;  2MJW B;  4PHK A;  1DJH A;  4Q04 A;  1OZS A;  3BUX B;  3JVT C;  4A4C A;  2JTT A;  4CID A;  3PN7 B;  2WCB A;  1CDN A;  2Y1M A;  2P6B B;  3SIB A;  1WLZ A;  4PCW A;  2EC6 C;  5CSJ A;  1DT7 B;  1N65 A;  4QJ4 B;  3CWG A;  1KQM B;  1CM1 A;  1TRF A;  1MXL C;  2KBM A;  2LV7 A;  5PAL A;  4DS7 A;  2HPS A;  1TNW A;  1TNQ A;  1K9U A;  1NIW A;  1QV0 A;  2KDH A;  2OS8 B;  1UP5 A;  3JTD B;  2LHL A;  1MWN A;  1SKT A;  3GK4 X;  3WHT B;  4NQG A;  3TUY B;  1CMG A;  2ZFD A;  2OTG B;  3FWC A;  1NP8 A;  2KAV A;  1CLL A;  3BXK A;  1XFV O;  1B7T Y;  1SBJ A;  2KGB C;  2I18 A;  2BCB A;  1DTL A;  2H2K A;  5CPV A;  2ZN9 A;  1CFF A;  1JC2 A;  1SY9 A;  4OCI A;  1QAT A;  1WRZ A;  3EK7 A;  1OE9 B;  1FI6 A;  4GAO A;  4DUQ A;  1J7O A;  4I5L B;  2DOQ A;  2KYC A;  1KK7 Y;  4N1G A;  1F54 A;  1C7W A;  1PSB A;  3ZWH A;  1EG4 A;  1KWO C;  1C07 A;  3TZ1 A;  1RFJ A;  1ALW A;  1A29 A;  3HCM A;  4JPZ B;  2WC8 A;  1CDL A;  2SCP A;  2M0R A;  3IQO A;  2KI4 C;  2K7C A;  1IKU A;  1BR1 B;  3O2P A;  4MSP A;  3DVK A;  1YUU A;  4P2Y B;  3QRX A;  2TN4 A;  1LVC D;  4YGE B;  1TCO B;  1L7Z A;  2LVI A;  2COL B;  2KSP A;  3PSR A;  4CFR A;  1UHN A;  4PE1 A;  3CTN A;  4MVF A;  4QJ3 B;  1SRA A;  3A8R A;  2L4H A;  1UHH A;  3D0Y B;  1GGW A;  4I5N B;  2M1K B;  4XYN A;  1CMF A;  1MXE A;  4NDD A;  3OB1 B;  1OMV A;  1LKJ A;  1XFX O;  1G8I A;  2BBM A;  5K89 A;  4WQ3 A;  3RLZ A;  1YRU B;  5G08 A;  1Y1X A;  1S26 D;  4IL1 A;  1S36 A;  2HQ8 A;  1WDC C;  1AJ5 A;  2MHH A;  3SG4 A;  5I2O A;  3NSO A;  1IG5 A;  4GNK B;  2K2A A;  2Y1N A;  2FOT A;  3EKJ A;  4GGN A;  1IQ3 A;  1QX7 A;  2LAN A;  1CTR A;  1U5I B;  2JT8 A;  2JRF A;  4FQO A;  1HT9 A;  4NDC A;  2JXL A;  4OR9 B;  2Y4Q A;  4ORC B;  3BUW B;  4P5O E;  4ZCU A;  2E30 A;  2JWW A;  1S6I A;  1Y1U A;  5ER5 A;  3KHE A;  1XA5 A;  2MLF C;  4ORA B;  2JPT A;  1QVI Y;  1OQP A;  2Y5I A;  4F0Z B;  1FF1 A;  4PE7 A;  1MR8 A;  2BEC A;  2Q4U A;  3WXA A;  1ZUZ A;  3C1V A;  4YGC B;  1XFW O;  4HRG A;  2M9G A;  3NXA A;  1EH2 A;  2L51 A;  1CLM A;  1NSH A;  3A4U B;  1S6C A;  1LXF C;  3LLE A;  4YRU A;  2M8U A;  1KFX S;  1KFU S;  4WQ2 A;  4C0L A;  1BLQ A;  2JOJ A;  4PHJ A;  2MAZ A;  4BY5 A;  1UHI A;  3VRQ A;  1CB1 A;  5KSZ A;  1WDC B;  1SMG A;  5DKQ A;  1EXR A;  3NSI A;  4L9M A;  4AOM A;  3BYA A;  5I2Q A;  4MRY A;  2ZKM X;  1AVS A;  1PVA A;  1PVB A;  3BOW A;  2L50 A;  2F8P A;  2LM5 A;  1FW4 A;  3IQQ A;  4MZJ A;  1SCM C;  1XK4 C;  2LMV A;  4M2Q A;  4M2P A;  3NSL A;  2LNK A;  1XYD A;  3PM8 A;  5IBW A;  1BJF A;  2NZ0 A;  4D1E A;  4DIR A;  1G33 A;  1E8A A;  2JTZ A;  1YUS A;  1J7P A;  2KBI A;  1ODB A;  2M3W A;  2K8M B;  5CSN A;  2BCX A;  2BE6 A;  2KNE A;  5ER4 X;  1GGZ A;  1IRJ A;  1PAL A;  1X02 A;  2AMI A;  4CFQ A;  1TOP A;  2LLU A;  2M29 A;  1RTP 1;  4YBH B;  1QLS A;  1GJY A;  1K93 D;  1TCF A;  3JTD C;  4YI8 A;  2JC2 A;  1BR4 B;  3TDZ A;  1DGV A;  2PRU A;  3BUO B;  4MZK A;  3OX5 A;  4PE0 A;  5J3X A;  1DJZ A;  1K96 A;  1RRO A;  2H61 C;  1V1F A;  1JSA A;  1UUR A;  1JF2 A;  2EGD A;  1ZMZ A;  2KFH A;  1DJY A;  3BOW B;  3VRP A;  1M31 A;  1AK8 A;  3I5G C;  3DVM A;  3OP0 A;  1CFC A;  2JUL A;  2F2P A;  1JFK A;  1SCM B;  3TDI A;  2R2I A;  1ZFS A;  3F45 A;  1NPQ A;  1TNP A;  1QIV A;  1PK0 D;  5DKN A;  2BBN A;  1IH0 A;  5I8N A;  1C7V A;  4MEW A;  4CPV A;  2ZRT A;  1IQ5 A;  1BT6 A;  2L4I A;  3D0Y A;  1K90 D;  4N1F A;  1IJ6 A;  1S5G Y;  2KI4 B;  4NDB A;  1AJ4 A;  1LA3 A;  2M97 A;  1SR6 C;  1VRK A;  5HKW A;  1QX2 A;  2LVJ A;  5KU1 A;  1BOD A;  1B47 A;  3I5H C;  2PMY A;  3CR5 X;  1N2D A;  1QV1 A;  1UHJ A;  1TIZ A;  1HQV A;  1U5I A;  2I2R E;  1DJW A;  2AUC A;  1KK8 B;  1YUR A;  1CFD A;  1YX8 A;  1XFU O;  1J55 A;  4MZL A;  4ICB A;  1NCX A;  3TS5 B;  1AHR A;  2KHN A;  5F6T A;  2SAS A;  3O78 A;  3VRN A;  4HRH A;  1F55 A;  5JJG A;  1QAS A;  3DD4 A;  2ISD A;  2LUC A;  1CLB A;  3VGO A;  1RWY A;  2LE9 B;  1JF0 A;  4GFT A;  1H8B A;  2H61 A;  3EK4 A;  2CTN A;  1CDM A;  4YGB B;  1QLK A;  5B8I B;  3AAJ A;  2BL0 B;  4R1E A;  3DF0 A;  4WRI A;  3EKH A;  1B4C A;  1YVH A;  1KCY A;  1KSO A;  1ZOT B;  4E68 A;  3CS1 A;  1OZO A;  1MQ1 A;  1SR6 B;  3GK1 A;  1J7Q A;  2ZRS A;  3AKA A;  2JQ6 A;  2QPT A;  3PLF B;  2OTG C;  2CCM A;  2LHI A;  1MHO A;  2WND A;  2MBX A;  1KK8 C;  4UPG A;  1B8R A;  2LVV A;  2K7D A;  2L0P A;  4TNC A;  4PHM A;  4U8D A;  2LLT A;  3KF9 A;  1QXP A;  2WOR A;  3RM1 A;  1CDP A;  4YI9 A;  2LLS A;  5GQQ C;  1NX2 A;  4I5J A;  4OKH A;  1B9A A;  2D8N A;  2G2B A;  3SG6 A;  3VRO A;  1BOC A;  1OSA A;  3CLN A;  2LP3 A;  3BQ3 A;  4GBA A;  2KYF A;  1B1G A;  1K95 A;  4BY4 A;  4YGD B;  1S5G Z;  1WRK A;  2JT0 A;  4AQI A;  4USL A;  3CZT X;  2KQY A;  2CT9 A;  3LL8 B;  2V53 A;  1KQV A;  4OVN F;  2EC6 B;  1KSM A;  1A75 A;  1NCZ A;  2HET A;  1KQM C;  1N0Y A;  2LP2 A;  4CLN A;  1RK9 A;  1Y1A A;  2KI6 C;  2OS8 C;  2Q91 A;  1M45 A;  2I94 A;  1IWQ A;  1YTZ C;  1UHK A;  2GGM A;  3NSK A;  5CSI A;  4XJK A;  3LCP C;  3I5I C;  1M39 A;  1K9P A;  5D7F A;  3FS7 A;  3SG7 A;  2BKI B;  2O60 A;  1KK7 Z;  1TNX A;  2FCE A;  2JNF A;  3WNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...