4M2PA

Crystal structure of a non-myristoylated c39d recoverin mutant with one calcium ion bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
192
structure length
192
Chain Sequence
b'GALSKEILEELQLNTKFTEEELSSWYQSFLKEDPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 78
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2pA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2pA01
4D1EA 2F33A 1H4BA 3TZ1A 2PASA 1QV1A 3PFVA 2NCOA 2LVIA 4A4CA 3VGOA 3KO0A 3DF0B 2LV7A 1EJ3A 1S3PA 1YTZC 1CFPA 2MRDA 4YGAA 4PE7A 3CWGA 4HRGA 2MJWB 1KFXL 1LINA 1J1EA 3BQ3A 1PSRA 2M7NA 2G9BA 3DVKA 5ER4X 4ZCVA 5JOLA 1BLQA 1KQVA 2L4HA 3SG2A 2HPSA 1F55A 1S5GZ 3SG3A 2CCMA 1OZOA 2K7DA 3AAKA 1Y6WA 3NXAA 2KFHA 1SCMC 2HQ8A 2JC2A 1A75A 3I5GB 4F0ZB 1AJ4A 1SBJA 1OOJA 1SKTA 2BE4A 2M97A 2K7CA 1YVHA 1B4CA 2ZN8A 4I5LB 2Y1MA 1RWYA 2M1KB 5CSNA 2ISDA 2LMTA 2BL0B 1NYAA 3BUMB 1QIWA 1RK9A 2HF5A 3JVTB 3EK7A 2JNFA 2G2BA 2JQ6A 3KHEA 1M46A 1R6PA 2Q91A 4XYNA 1JFJA 2L51A 3IQOA 1CMGA 1UUSA 4PE4A 1NX3A 1NWDA 2LVJA 2OS8C 2L0PA 1FI5A 2KI4B 1XA5A 3A8RA 1KFUL 2L50A 3OHMB 3RLZA 1NP8A 1CLLA 1YX7A 1ZMZA 3D0YA 1NUBA 1XFVO 4YGBB 1NIWA 5CSFA 2GV5A 1CFDA 1BR1B 1CDMA 1B7TY 1GQMA 2D8NA 1TNQA 1X02A 4OV2A 4YBHB 5I2LA 1PRWA 1BU3A 3GOFA 1S6JA 3EVRA 2KAYA 1TTXA 2ZRTA 3PLFB 4MSPA 1CLBA 4AOMA 3AKAA 1UWOA 2F8PA 3LK1A 1MQ1A 4PALA 1RTP1 1XFZO 4C0LA 1PULA 2KOTA 4GBAA 4JPZB 3CLNA 3TDUA 3TS5C 1K9KA 1UHIA 1BR4B 5I8NA 3BYAA 2LHLA 2KQYA 3D10A 2BCAA 2M8UA 2MLEC 2LVVA 4C0KA 2M9GA 3BUOB 2AMIA 2SASA 2JT8A 5AFPA 5KTYA 3E3RA 2B1UA 1EL4A 5AERA 1YUTA 1N65A 4YGDB 2EGDA 5HYDA 4OCIA 1S1EA 1WY9A 3I5IB 1IWQA 2ZFDA 2I18A 4NQGA 1BOCA 1CKKA 1MHOA 1AUIB 1LA0A 1FBVA 1F71A 4R1EA 3FWBA 5HLVA 1JF2A 1W7JB 1AJ5A 2NZ0A 1MXEA 2M29A 1CDNA 3VRPA 1JBAA 4MEWA 1F4OA 1UHHA 1M39A 5AANA 1S26D 2OPOA 4DIRA 3CR2A 1S6CA 2WCEA 1QX7A 2H61C 3HX4A 4TNCA 2JOJA 1SL9A 1XK4A 1GGZA 4GUKA 2K7OA 4CIDA 1CDLA 3I5HB 5K89A 1LXFC 2KBIA 4GFTA 1G8IA 2BKHB 3PSRA 1ALWA 1SL8A 1FI6A 1WDCB 1XK4C 1IQ5A 1XO5A 2WORA 2WCFA 1D1OA 3OX6A 5FYXA 1BMOA 2LCPA 2KAXA 1M45A 2IS9A 5F6TA 2K8MB 1NX0A 3SIAA 2R2IA 3TDZA 3LLEA 1C07A 1DJGA 1OSAA 3ZWHA 2K2FA 2CXJA 1QIVA 5I2QA 3ZNIA 1KCYA 3H4SE 3O4YA 1L2OB 1DJZA 2EC6B 1BODA 1DF0B 3C1VA 1ZACA 3ICBA 1SL7A 4DUQA 4MZJA 4IL1A 1Y1XA 3OP0A 1QVIY 2Y5IA 2M7LA 1XFYO 1PVBA 1GGWA 2KI6D 3CS1A 2LHIA 4QJ5B 1IJ6A 4BY5A 1WLMA 3MSEB 1SR6B 2LNKA 1YX8A 4ORCB 1OMDA 3SJSA 3I5GC 2BBNA 3VROA 5J3XA 3PN7B 2BECA 1KK8C 2ZRSA 2BCBA 3PALA 4GGNA 1H8BA 3SG5A 1DTLA 1JUOA 1SY9A 4NDCA 1Q80A 1MWNA 2MBXA 1K95A 4WQ3A 2OTGB 1PALA 4N1GA 2ZN9A 2L98A 2FCEA 4YI8A 4ZCUA 2I7AA 1YUUA 2KFFA 2A4JA 3DVMA 1UHJA 1SW8A 1Y0VH 2JXCA 3JVTC 4ORBB 1M31A 2P6BB 1KFUS 1TNPA 3KPXA 1NCXA 5IBWA 4JQ0D 2FJUB 1JFKA 1CNPA 2K7BA 4MLWA 2KI4C 2JTZA 4C0JA 1GJYA 1QTXA 1UURA 1CDPA 1QXPA 2CBLA 1IKUA 2KYFA 5G08A 1QLSA 4USLA 1AK8A 4AQJA 1JSAA 3O78A 1CMFA 3NSKA 3AKBA 3RM1A 1K2HA 1ODBA 2LC5A 4ICBA 4YGEB 1QX2A 4DCKA 1E8AA 2Y4QA 1DJXA 2PRUA 2I94A 4PDZA 3EVVA 2FCDA 1U5IA 1DMOA 3FS7A 4M2QA 1YVLA 2PALA 1XVJA 3O6BA 1QATA 2K2AA 1OMRA 1C7VA 1Y1UA 1TOPA 3WHTB 1QJTA 1CTRA 2V53A 2WCBA 4PE0A 2JXLA 1WRKA 2LP2A 3GK4X 4Q04A 2M3WA 3I5FB 3JTDB 2WC8A 1V1GA 1TNXA 5I2OA 2LVKA 2NLNA 1EG3A 1KK7Z 2E6WA 4P5OE 1N0YA 2F3YA 4I5JA 1BF5A 2JULA 2LMVA 1KWOB 1K9UA 1VRKA 2COLB 2JU0A 3BXKA 2LM5A 3FIAA 1B8CA 3DVJA 5PALA 2KI6C 1AHRA 4MZKA 1J7QA 3I5IC 1YR5A 5CSJA 1MF8B 2KYCA 2NCPA 4PHJA 1A4PA 2H61A 2M49B 2I2RE 4N1FA 1V1FA 2MHHA 2AAOA 1B8LA 1C7WA 1UP5A 1NCZA 4PE1A 4YRUA 1CLMA 4I5KA 3OB2B 5KSZA 3LK0A 2F2OA 5AXIA 5DKRA 5B8IB 2M1UA 3QRXA 3TDIA 2KGRA 3DVEA 3SG6A 1BG1A 1LKJA 4XJKB 5D7FA 4GGFA 2LUXA 1DGUA 2M0RA 3EK8A 3GK1A 2MAZA 1ZOTB 2ZNEA 3BUXB 3VRRA 2ZKMX 2K61A 5D69A 1TIZA 4GPLB 2NXQA 2LAPA 2WNDA 3SG4A 3I5HC 3EVUA 3KF9A 4PHMA 1FW4A 1J55A 3DF0A 1PSBA 2KFGA 2LANA 1RFJA 4GGFC 1WDCC 1LA3A 2RGIA 3BOWB 3K21A 3IF7A 4PHKA 3LL8B 1WRZA 1K8UA 5JJGA 2JPTA 1JF0A 1OQPA 1KQMB 2FOTA 2KNEA 3GK2A 2KQ6A 4NDDA 5GQQC 2Q4UA 2KAVA 3PATA 2WOSA 1KFXS 3PM8A 1IGVA 5CPVA 1TNWA 2F3ZA 5HKZA 3TUYB 1DVIA 2QPTA 2EC6C 4WRIA 1AVSA 3OX5A 1N2DA 1DJYA 1IG5A 2KHNA 2JWWA 2KSPA 2MLFC 1DT7B 2L4IA 2CT9A 1AP4A 3SG7A 3CGAA 1QLKA 2TN4A 3CR5X 2KGBC 2PSRA 1SYMA 3WHUB 1B7TZ 1K9PA 2VRGA 1QASA 1SR6C 1CM4A 3VRNA 1F70A 4HSZA 1NPQA 4MVFA 1IRJA 2H2KA 4ETOA 1SCVA 1QV0A 3NSOA 3FWCA 1F4QA 5DKNA 3PN7C 1G33A 4L9MA 1FPWA 1BJFA 4MRYA 2LP3A 4FQOA 1YRTB 5AEQA 1SK6D 2PMYA 5KU1A 1TCOB 4OVNF 1B8RA 1UHNA 2BL0C 1QS7A 1OMVA 4YI9A 2OTGC 4HRHA 4YGCB 4MN0A 1SCMB 2GGMA 2HETA 2BKIB 1FF1A 1DJIA 2L2EA 1TRFA 2SCPA 4OR9B 4N5XA 1KK8B 2CNPA 1KSOA 2CTNA 4WQ2A 2AUCA 1CFCA 1F8HA 1WLZA 4GAOA 1IH0A 1ZUZA 1G4YR 2BCXA 3HCMA 1A03A 1OZSA 2JZIA 4UPGA 2BE6A 4JWQA 1PK0D 4M2OA 1A75B 1XFUO 3BUNB 1K96A 4MZLA 2LLUA 1J7RA 1CM1A 5HKWA 1R2UA 1WRLA 3DD4A 3WNXB 1J7PA 1DGVA 4CPVA 1K94A 1L7ZA 1NCYA 2LUCA 1S36A 1B1GA 2OS8B 1EH2A 2LLSA 1SRAA 2JNXA 2ZNDA 1OE9B 4P2YB 3LCPC 1S5GY 3CR4X 1XFXO 1MXLC 4HREE 3WXAA 5TNCA 4QJ4B 1JWDA 1A2XA 1M63B 3IQQA 2MA2A 1SMGA 3I5FC 3JTDC 1RECA 4AQIA 4CFRA 1JC2A 1YRUB 4E68A 2KDHA 3CZTX 4ORAB 3D0YB 1EG4A 1KWOC 3KEVA 2KBMA 1CB1A 1NX2A 2LMUA 3TS5B 1BT6A 4M2PA 2LLTA 1RJVA 3M0WA 4NDBA 3VRQA 4XJKA 1MUXA 1U5IB 2L5XB 3OB1B 1TN4A 4MRXA 3EKHA 1B47A 1SNLA 4A4BA 1KSMA 5BPJA 3NSLA 2HQWA 2QACA 4I5NB 1MR8A 2JRFA 4FTGA 1YURA 3BUWB 3SIBA 1EXRA 1PVAA 1DJHA 1IQ3A 2O5GA 1QVIZ 2E30A 2K0JA 1IJ5A 1TCFA 1YUSA 1UHKA 3BOWA 1LVCD 5HKYA 1K90D 1CFFA 2Y1NA 1HT9A 4CFQA 1J7OA 3NSIA 1ALVA 4DS7A 2JT0A 1QX5B 3AAJA 4DRWA 1SPYA 4MBEA 3EK4A 3O2PA 2PVBA 4OKHA 4PHNA 4CLNA 1A29A 1RROA 2BBMA 5DKQA 2DOQA 2JTTA 1K93D 1DF0A 2F2PA 1KQMC 4U8DA 4PCWA 3CTNA 1S6IA 5ER5A 4QJ3B 1HQVA 1Y1AA 4GNKB 1DJWA 5HLOA 2EHBA 1XYDA 1J1DA 3EKJA 3TUYC 5CSIA 1B9AA 1L2OC 1NX1A 2O60A 1XFWO 2JT3A 2LE9B 3A4UB 1NSHA 1W7IB 1KK7Y 4BY4A 1ZFSA 1F54A 3F45A 2GGZA
chains in the Genus database with same CATH superfamily
4D1EA 2F33A 1H4BA 3TZ1A 2PASA 1QV1A 3PFVA 2NCOA 2LVIA 4A4CA 3VGOA 3KO0A 3DF0B 2LV7A 1EJ3A 1S3PA 1YTZC 1CFPA 2MRDA 4YGAA 4PE7A 3CWGA 4HRGA 2MJWB 3NHIA 1KFXL 1LINA 1J1EA 3BQ3A 1PSRA 2M7NA 2G9BA 3DVKA 5ER4X 4ZCVA 5JOLA 1BLQA 4INXA 2L4HA 3SG2A 1KQVA 2HPSA 1F55A 1S5GZ 3K1EA 3SG3A 2CCMA 1OZOA 2K7DA 3AAKA 2L5YA 1Y6WA 3D76A 3NXAA 2KFHA 1SCMC 2HQ8A 2JC2A 1A75A 3I5GB 4F0ZB 1AJ4A 1SBJA 1OOJA 1SKTA 2BE4A 2M97A 2L2CA 2K7CA 1YVHA 1B4CA 2ZN8A 3PM2A 4I5LB 2Y1MA 3D74A 1RWYA 2M1KB 5CSNA 2ISDA 2LMTA 2BL0B 3L47A 1NYAA 2WCKA 3R72A 3S0FA 3BUMB 1QIWA 1RK9A 3D75A 2HF5A 3JVTB 3EK7A 2JNFA 2G2BA 2JQ6A 3KHEA 1M46A 1R6PA 2Q91A 4XYNA 1JFJA 2L51A 3IQOA 1CMGA 2QEBA 1UUSA 4PE4A 1NX3A 1NWDA 2LVJA 2OS8C 2L0PA 3DZTA 2WC5A 3V2LA 1C3ZA 2KI4B 1XA5A 3A8RA 1KFUL 1FI5A 2L50A 3OHMB 3RLZA 3NHTA 1NP8A 1CLLA 1YX7A 1ZMZA 3D0YA 1NUBA 1XFVO 4YGBB 1NIWA 5CSFA 2GV5A 1CFDA 1BR1B 1CDMA 1B7TY 1GQMA 2D8NA 1TNQA 1X02A 3R1OA 4OV2A 4YBHB 5I2LA 1PRWA 1BU3A 3GOFA 1S6JA 3EVRA 2KAYA 1TTXA 2ZRTA 3PLFB 4MSPA 1CLBA 4AOMA 1OOIX 3AKAA 1UWOA 2F8PA 3LK1A 1MQ1A 4PALA 3D78A 1RTP1 1XFZO 4C0LA 1PULA 2KOTA 4GBAA 4JPZB 3CLNA 3TDUA 3TS5C 1K9KA 1UHIA 1BR4B 5I8NA 3BYAA 2LHLA 2KQYA 3D10A 2BCAA 2M8UA 2MLEC 2LVVA 4C0KA 2M9GA 3BUOB 2AMIA 2SASA 2JT8A 2QEHA 5AFPA 5KTYA 3E3RA 2B1UA 2H8VA 1EL4A 5AERA 1YUTA 1N65A 4YGDB 1OOFA 2EGDA 2PQLA 5HYDA 4OCIA 5EL2A 1S1EA 1WY9A 3I5IB 1IWQA 2ZFDA 1P28A 2I18A 4NQGA 1BOCA 1CKKA 1MHOA 1AUIB 2GTEA 1LA0A 1FBVA 1F71A 4R1EA 3FWBA 5HLVA 1JF2A 1W7JB 1AJ5A 2NZ0A 1MXEA 2M29A 1CDNA 3VRPA 3SS4A 4MEWA 1JBAA 1F4OA 1UHHA 1M39A 5AANA 1S26D 2OPOA 4DIRA 3CR2A 1S6CA 2WCEA 1QX7A 2H61C 3HX4A 4TNCA 3VB1A 2QDIA 2JOJA 1SL9A 1XK4A 3R1PA 1GGZA 4GUKA 2K7OA 3BJHA 4CIDA 1CDLA 3I5HB 5K89A 1LXFC 2KBIA 4GFTA 2K60A 1G8IA 2BKHB 3PSRA 3SS3A 1ALWA 1SL8A 1FI6A 1WDCB 1XK4C 1IQ5A 1XO5A 2WORA 2WCFA 1D1OA 3OX6A 5FYXA 1BMOA 2LCPA 2KAXA 1M45A 2IS9A 3FE6A 5F6TA 2K8MB 2KLDA 1NX0A 3SIAA 2R2IA 3TDZA 3LLEA 1C07A 1DJGA 1OSAA 3ZWHA 2K2FA 2CXJA 1QIVA 3B88A 3ZNIA 5I2QA 3H4SE 1KCYA 3O4YA 1L2OB 1DJZA 2EC6B 1BODA 1DF0B 3C1VA 1ZACA 3ICBA 1SL7A 4DUQA 4MZJA 4IL1A 1Y1XA 3OP0A 1QVIY 2Y5IA 2M7LA 1XFYO 1PVBA 1GGWA 2KI6D 3CS1A 2LHIA 4QJ5B 1IJ6A 4BY5A 1WLMA 3MSEB 1SR6B 2LNKA 1YX8A 4ORCB 1OMDA 5FI6A 3SJSA 3I5GC 2BBNA 3VROA 5J3XA 3PN7B 2BECA 1KK8C 2ZRSA 2BNXA 2BCBA 3PALA 4GGNA 1H8BA 1TUZA 3SG5A 1DTLA 1JUOA 1SY9A 4NDCA 2WCMA 1Q80A 1MWNA 2MBXA 1K95A 3B6XA 4WQ3A 2OTGB 1PALA 4N1GA 2ZN9A 2L98A 2FCEA 4YI8A 1Z2CB 4ZCUA 2I7AA 1YUUA 2KFFA 4FQTA 1W9ZA 2A4JA 1UHJA 1SW8A 1Y0VH 2JXCA 3DVMA 1QWVA 1M31A 2P6BB 3JVTC 4ORBB 5DICA 1KFUS 1TNPA 3KPXA 1NCXA 5IBWA 4JQ0D 2FJUB 5D3OA 1JFKA 2YGUA 1CNPA 2K7BA 4MLWA 2KI4C 2JTZA 3CYZA 4C0JA 1GJYA 1QTXA 1UURA 1CDPA 1QXPA 1XFRA 5FI7A 2CBLA 1IKUA 2KYFA 5G08A 1QLSA 4USLA 1AK8A 3CABA 4AQJA 3CZ1A 1JSAA 3O78A 1CMFA 3CZ2A 3AKBA 3NSKA 3RM1A 1ODBA 1ORGA 1K2HA 2LC5A 4ICBA 4YGEB 1QX2A 4DCKA 1E8AA 2Y4QA 1DJXA 1OW4A 2PRUA 2I94A 4PDZA 3UO9A 3EVVA 2FCDA 1U5IA 3B87A 3FS7A 4M2QA 1YVLA 2PALA 1DMOA 1XVJA 1T14A 3O6BA 2WC6A 1QATA 2K2AA 1OMRA 1C7VA 1Y1UA 1TOPA 3B86A 3WHTB 1QJTA 3B7AA 1CTRA 2V53A 2WCBA 4PE0A 2JXLA 1WRKA 2LP2A 3GK4X 4Q04A 3CDNA 2M3WA 3I5FB 3JTDB 2WC8A 1V1GA 3S0BA 1TNXA 5I2OA 2LVKA 2NLNA 1EG3A 1KK7Z 2E6WA 4P5OE 1N0YA 2F3YA 4I5JA 4YRUA 1BF5A 2JULA 2LMVA 1KWOB 1K9UA 1VRKA 2COLB 2JU0A 3BXKA 2LM5A 3FIAA 1B8CA 3DVJA 5PALA 2KI6C 1AHRA 4MZKA 1J7QA 3I5IC 1YR5A 5CSJA 1MF8B 2KYCA 2NCPA 4PHJA 1A4PA 2H61A 2JPOA 3L4LA 2M49B 2I2RE 4N1FA 1V1FA 2MHHA 2AAOA 1B8LA 1C7WA 1UP5A 1NCZA 3O4XA 4PE1A 1CLMA 4I5KA 1DQEA 3OB2B 3LK0A 2F2OA 5AXIA 5DKRA 3FE8A 5KSZA 5B8IB 2M1UA 3QRXA 3TDIA 2KGRA 3DVEA 3SG6A 1BG1A 1LKJA 4XJKB 5D7FA 4GGFA 2LUXA 1DGUA 2M0RA 3EK8A 3GK1A 3BFHA 2MAZA 1ZOTB 2ZNEA 3BUXB 3VRRA 2ZKMX 4F7FA 2K61A 5D69A 1TIZA 4GPLB 1TWOA 2LAPA 2NXQA 2WNDA 3I5HC 3OBVA 3Q8IA 3SG4A 3EVUA 3KF9A 4PHMA 1FW4A 1J55A 1IIOA 3CZ0A 1PSBA 3DF0A 2KFGA 2LANA 1RFJA 3DY9A 4GGFC 4IJ7A 1WDCC 1LA3A 2RGIA 3BOWB 3K21A 3IF7A 4PHKA 3LL8B 1WRZA 1K8UA 5JJGA 2JPTA 1JF0A 1OQPA 1KQMB 2FOTA 2KNEA 3GK2A 2KQ6A 3RZSA 2ERBA 2KLEA 4NDDA 5GQQC 2Q4UA 2KAVA 3PATA 2WOSA 3QMEA 1KFXS 3PM8A 1IGVA 5CPVA 1TNWA 2F3ZA 3D77A 5HKZA 3TUYB 1DVIA 2QPTA 1DELA 2EC6C 4WRIA 3R1VA 1AVSA 3OX5A 1N2DA 1DJYA 1IG5A 2KHNA 2JWWA 2KSPA 2MLFC 1DT7B 2L4IA 2CT9A 1AP4A 3SG7A 3CGAA 1QLKA 2TN4A 3S0DA 3CR5X 2KGBC 2PSRA 1SYMA 2WCHA 3WHUB 1B7TZ 1K9PA 3N7HA 2VRGA 1QASA 1SR6C 2QEVA 1CM4A 3VRNA 1F70A 4HSZA 1NPQA 4MVFA 1IRJA 2H2KA 4ETOA 1SCVA 1QV0A 3NSOA 3FWCA 1F4QA 5DKNA 3PN7C 1G33A 4L9MA 1FPWA 1TUJA 1BJFA 4MRYA 2LP3A 3FE9A 4FQOA 1YRTB 5AEQA 1SK6D 2PMYA 5I94A 2FJYA 5KU1A 1TCOB 2WCJA 1B8RA 4OVNF 1UHNA 2BL0C 1QS7A 1OMVA 4OZDA 4YI9A 1LS8A 2OTGC 4HRHA 4YGCB 4MN0A 3S0GA 1SCMB 1C3YA 2GGMA 2HETA 2BKIB 1FF1A 1DJIA 2L2EA 1TRFA 2SCPA 4OR9B 1GM0A 4N5XA 1KK8B 2CNPA 1KSOA 2CTNA 4WQ2A 2AUCA 1CFCA 1F8HA 1DEKA 1WLZA 2P71A 4GAOA 1IH0A 1ZUZA 1G4YR 2BCXA 3HCMA 1A03A 1OZSA 2JZIA 4UPGA 2BE6A 4JWQA 1PK0D 4M2OA 1A75B 1XFUO 3BUNB 1K96A 4MZLA 3BFAA 2LLUA 1J7RA 2QEOA 3PJIA 1CM1A 5HKWA 1R2UA 1WRLA 3S0AA 3DD4A 3WNXB 2BAPA 1J7PA 1DGVA 4CPVA 1K94A 1L7ZA 1NCYA 2LUCA 1S36A 3NGVA 2OS8B 1B1GA 1EH2A 2LLSA 1SRAA 2JNXA 2ZNDA 1OE9B 2PYQA 4P2YB 3LCPC 1S5GY 3CR4X 1XFXO 1MXLC 4HREE 3WXAA 5TNCA 4QJ4B 1JWDA 1A2XA 1M63B 3IQQA 2MA2A 4PT1A 1SMGA 3I5FC 3JTDC 1RECA 4AQIA 4CFRA 1JC2A 1YRUB 4E68A 2KDHA 3CZTX 3IVTA 4ORAB 3D0YB 1EG4A 3UNWA 1KWOC 3KEVA 1Z4HA 2KBMA 1CB1A 2P70A 1NX2A 2LMUA 3TS5B 1BT6A 4M2PA 3BFBA 2LLTA 1RJVA 3DYEA 4INWA 3M0WA 4NDBA 4KYNA 4XJKA 3VRQA 1MUXA 1U5IB 2L5XB 3L4AA 1TN4A 3OB1B 4MRXA 3EKHA 2WCLA 1B47A 1OOHA 1SNLA 1KSMA 4A4BA 3NSLA 5BPJA 1SSEB 2HQWA 2QACA 4I5NB 1MR8A 2JRFA 4FTGA 5FI2A 1YURA 3BUWB 3SIBA 1EXRA 3S0EA 1PVAA 1DJHA 1IQ3A 2O5GA 1QVIZ 2E30A 2K0JA 1IJ5A 1TCFA 5HL1A 1YUSA 1UHKA 3BOWA 1LVCD 5HKYA 3EG5B 1OOGA 1K90D 1CFFA 3DXLA 2Y1NA 1DC1A 3OGNA 1HT9A 4CFQA 3D73A 1J7OA 3NSIA 1ALVA 4DS7A 2JT0A 1QX5B 3AAJA 4DRWA 1SPYA 4MBEA 3EK4A 3O2PA 2PVBA 4OKHA 4PHNA 4CLNA 1A29A 1RROA 2BBMA 5DKQA 2DOQA 2JTTA 1K93D 1DF0A 2F2PA 1KQMC 4JD9A 4JKTA 4U8DA 3SS5A 4PCWA 3CTNA 1S6IA 5ER5A 4QJ3B 1HQVA 1Y1AA 4GNKB 1DJWA 5HLOA 2EHBA 1XYDA 1J1DA 3EKJA 3TUYC 5CSIA 1B9AA 1L2OC 1NX1A 2KPHA 2O60A 1XFWO 2JT3A 2LE9B 3A4UB 1NSHA 1W7IB 1KK7Y 4BY4A 1ZFSA 1F54A 3F45A 2GGZA
chains in the Genus database with same CATH topology
4D1EA 2F33A 1H4BA 3TZ1A 2PASA 1QV1A 3PFVA 2NCOA 2LVIA 4A4CA 3VGOA 3KO0A 3DF0B 2LV7A 1EJ3A 1S3PA 1YTZC 1CFPA 2MRDA 4YGAA 4PE7A 3CWGA 4HRGA 2MJWB 1KFXL 1LINA 1J1EA 3BQ3A 1PSRA 2M7NA 2G9BA 3DVKA 5ER4X 4ZCVA 5JOLA 1BLQA 1KQVA 2L4HA 3SG2A 2HPSA 1F55A 1S5GZ 3SG3A 2CCMA 1OZOA 2K7DA 3AAKA 1Y6WA 3NXAA 2KFHA 1SCMC 2HQ8A 2JC2A 1A75A 3I5GB 4F0ZB 1AJ4A 1SBJA 1OOJA 1SKTA 2BE4A 2M97A 2K7CA 1YVHA 1B4CA 2ZN8A 4I5LB 2Y1MA 1RWYA 2M1KB 5CSNA 2ISDA 2LMTA 2BL0B 1NYAA 3BUMB 1QIWA 1RK9A 2HF5A 3JVTB 3EK7A 2JNFA 2G2BA 2JQ6A 3KHEA 1M46A 1R6PA 2Q91A 4XYNA 1JFJA 2L51A 3IQOA 1CMGA 1UUSA 4PE4A 1NX3A 1NWDA 2LVJA 2OS8C 2L0PA 1FI5A 2KI4B 1XA5A 3A8RA 1KFUL 2L50A 3OHMB 3RLZA 1NP8A 1CLLA 1YX7A 1ZMZA 3D0YA 1NUBA 1XFVO 4YGBB 1NIWA 5CSFA 2GV5A 1CFDA 1BR1B 1CDMA 1B7TY 1GQMA 2D8NA 1TNQA 1X02A 4OV2A 4YBHB 5I2LA 1PRWA 1BU3A 3GOFA 1S6JA 3EVRA 2KAYA 1TTXA 2ZRTA 3PLFB 4MSPA 1CLBA 4AOMA 3AKAA 1UWOA 2F8PA 3LK1A 1MQ1A 4PALA 1RTP1 1XFZO 4C0LA 1PULA 2KOTA 4GBAA 4JPZB 3CLNA 3TDUA 3TS5C 1K9KA 1UHIA 1BR4B 5I8NA 3BYAA 2LHLA 2KQYA 3D10A 2BCAA 2M8UA 2MLEC 2LVVA 4C0KA 2M9GA 3BUOB 2AMIA 2SASA 2JT8A 5AFPA 5KTYA 3E3RA 2B1UA 1EL4A 5AERA 1YUTA 1N65A 4YGDB 2EGDA 5HYDA 4OCIA 1S1EA 1WY9A 3I5IB 1IWQA 2ZFDA 2I18A 4NQGA 1BOCA 1CKKA 1MHOA 1AUIB 1LA0A 1FBVA 1F71A 4R1EA 3FWBA 5HLVA 1JF2A 1W7JB 1AJ5A 2NZ0A 1MXEA 2M29A 1CDNA 3VRPA 1JBAA 4MEWA 1F4OA 1UHHA 1M39A 5AANA 1S26D 2OPOA 4DIRA 3CR2A 1S6CA 2WCEA 1QX7A 2H61C 3HX4A 4TNCA 2JOJA 1SL9A 1XK4A 1GGZA 4GUKA 2K7OA 4CIDA 1CDLA 3I5HB 5K89A 1LXFC 2KBIA 4GFTA 1G8IA 2BKHB 3PSRA 1ALWA 1SL8A 1FI6A 1WDCB 1XK4C 1IQ5A 1XO5A 2WORA 2WCFA 1D1OA 3OX6A 5FYXA 1BMOA 2LCPA 2KAXA 1M45A 2IS9A 5F6TA 2K8MB 1NX0A 3SIAA 2R2IA 3TDZA 3LLEA 1C07A 1DJGA 1OSAA 3ZWHA 2K2FA 2CXJA 1QIVA 5I2QA 3ZNIA 1KCYA 3H4SE 3O4YA 1L2OB 1DJZA 2EC6B 1BODA 1DF0B 3C1VA 1ZACA 3ICBA 1SL7A 4DUQA 4MZJA 4IL1A 1Y1XA 3OP0A 1QVIY 2Y5IA 2M7LA 1XFYO 1PVBA 1GGWA 2KI6D 3CS1A 2LHIA 4QJ5B 1IJ6A 4BY5A 1WLMA 3MSEB 1SR6B 2LNKA 1YX8A 4ORCB 1OMDA 3SJSA 3I5GC 2BBNA 3VROA 5J3XA 3PN7B 2BECA 1KK8C 2ZRSA 2BCBA 3PALA 4GGNA 1H8BA 3SG5A 1DTLA 1JUOA 1SY9A 4NDCA 1Q80A 1MWNA 2MBXA 1K95A 4WQ3A 2OTGB 1PALA 4N1GA 2ZN9A 2L98A 2FCEA 4YI8A 4ZCUA 2I7AA 1YUUA 2KFFA 2A4JA 3DVMA 1UHJA 1SW8A 1Y0VH 2JXCA 3JVTC 4ORBB 1M31A 2P6BB 1KFUS 1TNPA 3KPXA 1NCXA 5IBWA 4JQ0D 2FJUB 1JFKA 1CNPA 2K7BA 4MLWA 2KI4C 2JTZA 4C0JA 1GJYA 1QTXA 1UURA 1CDPA 1QXPA 2CBLA 1IKUA 2KYFA 5G08A 1QLSA 4USLA 1AK8A 4AQJA 1JSAA 3O78A 1CMFA 3NSKA 3AKBA 3RM1A 1K2HA 1ODBA 2LC5A 4ICBA 4YGEB 1QX2A 4DCKA 1E8AA 2Y4QA 1DJXA 2PRUA 2I94A 4PDZA 3EVVA 2FCDA 1U5IA 1DMOA 3FS7A 4M2QA 1YVLA 2PALA 1XVJA 3O6BA 1QATA 2K2AA 1OMRA 1C7VA 1Y1UA 1TOPA 3WHTB 1QJTA 1CTRA 2V53A 2WCBA 4PE0A 2JXLA 1WRKA 2LP2A 3GK4X 4Q04A 2M3WA 3I5FB 3JTDB 2WC8A 1V1GA 1TNXA 5I2OA 2LVKA 2NLNA 1EG3A 1KK7Z 2E6WA 4P5OE 1N0YA 2F3YA 4I5JA 1BF5A 2JULA 2LMVA 1KWOB 1K9UA 1VRKA 2COLB 2JU0A 3BXKA 2LM5A 3FIAA 1B8CA 3DVJA 5PALA 2KI6C 1AHRA 4MZKA 1J7QA 3I5IC 1YR5A 5CSJA 1MF8B 2KYCA 2NCPA 4PHJA 1A4PA 2H61A 2M49B 2I2RE 4N1FA 1V1FA 2MHHA 2AAOA 1B8LA 1C7WA 1UP5A 1NCZA 4PE1A 4YRUA 1CLMA 4I5KA 3OB2B 5KSZA 3LK0A 2F2OA 5AXIA 5DKRA 5B8IB 2M1UA 3QRXA 3TDIA 2KGRA 3DVEA 3SG6A 1BG1A 1LKJA 4XJKB 5D7FA 4GGFA 2LUXA 1DGUA 2M0RA 3EK8A 3GK1A 2MAZA 1ZOTB 2ZNEA 3BUXB 3VRRA 2ZKMX 2K61A 5D69A 1TIZA 4GPLB 2NXQA 2LAPA 2WNDA 3SG4A 3I5HC 3EVUA 3KF9A 4PHMA 1FW4A 1J55A 3DF0A 1PSBA 2KFGA 2LANA 1RFJA 4GGFC 1WDCC 1LA3A 2RGIA 3BOWB 3K21A 3IF7A 4PHKA 3LL8B 1WRZA 1K8UA 5JJGA 2JPTA 1JF0A 1OQPA 1KQMB 2FOTA 2KNEA 3GK2A 2KQ6A 4NDDA 5GQQC 2Q4UA 2KAVA 3PATA 2WOSA 1KFXS 3PM8A 1IGVA 5CPVA 1TNWA 2F3ZA 5HKZA 3TUYB 1DVIA 2QPTA 2EC6C 4WRIA 1AVSA 3OX5A 1N2DA 1DJYA 1IG5A 2KHNA 2JWWA 2KSPA 2MLFC 1DT7B 2L4IA 2CT9A 1AP4A 3SG7A 3CGAA 1QLKA 2TN4A 3CR5X 2KGBC 2PSRA 1SYMA 3WHUB 1B7TZ 1K9PA 2VRGA 1QASA 1SR6C 1CM4A 3VRNA 1F70A 4HSZA 1NPQA 4MVFA 1IRJA 2H2KA 4ETOA 1SCVA 1QV0A 3NSOA 3FWCA 1F4QA 5DKNA 3PN7C 1G33A 4L9MA 1FPWA 1BJFA 4MRYA 2LP3A 4FQOA 1YRTB 5AEQA 1SK6D 2PMYA 5KU1A 1TCOB 4OVNF 1B8RA 1UHNA 2BL0C 1QS7A 1OMVA 4YI9A 2OTGC 4HRHA 4YGCB 4MN0A 1SCMB 2GGMA 2HETA 2BKIB 1FF1A 1DJIA 2L2EA 1TRFA 2SCPA 4OR9B 4N5XA 1KK8B 2CNPA 1KSOA 2CTNA 4WQ2A 2AUCA 1CFCA 1F8HA 1WLZA 4GAOA 1IH0A 1ZUZA 1G4YR 2BCXA 3HCMA 1A03A 1OZSA 2JZIA 4UPGA 2BE6A 4JWQA 1PK0D 4M2OA 1A75B 1XFUO 3BUNB 1K96A 4MZLA 2LLUA 1J7RA 1CM1A 5HKWA 1R2UA 1WRLA 3DD4A 3WNXB 1J7PA 1DGVA 4CPVA 1K94A 1L7ZA 1NCYA 2LUCA 1S36A 1B1GA 2OS8B 1EH2A 2LLSA 1SRAA 2JNXA 2ZNDA 1OE9B 4P2YB 3LCPC 1S5GY 3CR4X 1XFXO 1MXLC 4HREE 3WXAA 5TNCA 4QJ4B 1JWDA 1A2XA 1M63B 3IQQA 2MA2A 1SMGA 3I5FC 3JTDC 1RECA 4AQIA 4CFRA 1JC2A 1YRUB 4E68A 2KDHA 3CZTX 4ORAB 3D0YB 1EG4A 1KWOC 3KEVA 2KBMA 1CB1A 1NX2A 2LMUA 3TS5B 1BT6A 4M2PA 2LLTA 1RJVA 3M0WA 4NDBA 3VRQA 4XJKA 1MUXA 1U5IB 2L5XB 3OB1B 1TN4A 4MRXA 3EKHA 1B47A 1SNLA 4A4BA 1KSMA 5BPJA 3NSLA 2HQWA 2QACA 4I5NB 1MR8A 2JRFA 4FTGA 1YURA 3BUWB 3SIBA 1EXRA 1PVAA 1DJHA 1IQ3A 2O5GA 1QVIZ 2E30A 2K0JA 1IJ5A 1TCFA 1YUSA 1UHKA 3BOWA 1LVCD 5HKYA 1K90D 1CFFA 2Y1NA 1HT9A 4CFQA 1J7OA 3NSIA 1ALVA 4DS7A 2JT0A 1QX5B 3AAJA 4DRWA 1SPYA 4MBEA 3EK4A 3O2PA 2PVBA 4OKHA 4PHNA 4CLNA 1A29A 1RROA 2BBMA 5DKQA 2DOQA 2JTTA 1K93D 1DF0A 2F2PA 1KQMC 4U8DA 4PCWA 3CTNA 1S6IA 5ER5A 4QJ3B 1HQVA 1Y1AA 4GNKB 1DJWA 5HLOA 2EHBA 1XYDA 1J1DA 3EKJA 3TUYC 5CSIA 1B9AA 1L2OC 1NX1A 2O60A 1XFWO 2JT3A 2LE9B 3A4UB 1NSHA 1W7IB 1KK7Y 4BY4A 1ZFSA 1F54A 3F45A 2GGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1E A;  2F33 A;  1H4B A;  3TZ1 A;  2PAS A;  1QV1 A;  3PFV A;  2NCO A;  2LVI A;  4A4C A;  3VGO A;  3KO0 A;  3DF0 B;  2LV7 A;  1EJ3 A;  1S3P A;  1YTZ C;  1CFP A;  2MRD A;  4YGA A;  4PE7 A;  3CWG A;  4HRG A;  2MJW B;  1KFX L;  1LIN A;  1J1E A;  3BQ3 A;  1PSR A;  2M7N A;  2G9B A;  3DVK A;  5ER4 X;  4ZCV A;  5JOL A;  1BLQ A;  1KQV A;  2L4H A;  3SG2 A;  2HPS A;  1F55 A;  1S5G Z;  3SG3 A;  2CCM A;  1OZO A;  2K7D A;  3AAK A;  1Y6W A;  3NXA A;  2KFH A;  1SCM C;  2HQ8 A;  2JC2 A;  1A75 A;  3I5G B;  4F0Z B;  1AJ4 A;  1SBJ A;  1OOJ A;  1SKT A;  2BE4 A;  2M97 A;  2K7C A;  1YVH A;  1B4C A;  2ZN8 A;  4I5L B;  2Y1M A;  1RWY A;  2M1K B;  5CSN A;  2ISD A;  2LMT A;  2BL0 B;  1NYA A;  3BUM B;  1QIW A;  1RK9 A;  2HF5 A;  3JVT B;  3EK7 A;  2JNF A;  2G2B A;  2JQ6 A;  3KHE A;  1M46 A;  1R6P A;  2Q91 A;  4XYN A;  1JFJ A;  2L51 A;  3IQO A;  1CMG A;  1UUS A;  4PE4 A;  1NX3 A;  1NWD A;  2LVJ A;  2OS8 C;  2L0P A;  1FI5 A;  2KI4 B;  1XA5 A;  3A8R A;  1KFU L;  2L50 A;  3OHM B;  3RLZ A;  1NP8 A;  1CLL A;  1YX7 A;  1ZMZ A;  3D0Y A;  1NUB A;  1XFV O;  4YGB B;  1NIW A;  5CSF A;  2GV5 A;  1CFD A;  1BR1 B;  1CDM A;  1B7T Y;  1GQM A;  2D8N A;  1TNQ A;  1X02 A;  4OV2 A;  4YBH B;  5I2L A;  1PRW A;  1BU3 A;  3GOF A;  1S6J A;  3EVR A;  2KAY A;  1TTX A;  2ZRT A;  3PLF B;  4MSP A;  1CLB A;  4AOM A;  3AKA A;  1UWO A;  2F8P A;  3LK1 A;  1MQ1 A;  4PAL A;  1RTP 1;  1XFZ O;  4C0L A;  1PUL A;  2KOT A;  4GBA A;  4JPZ B;  3CLN A;  3TDU A;  3TS5 C;  1K9K A;  1UHI A;  1BR4 B;  5I8N A;  3BYA A;  2LHL A;  2KQY A;  3D10 A;  2BCA A;  2M8U A;  2MLE C;  2LVV A;  4C0K A;  2M9G A;  3BUO B;  2AMI A;  2SAS A;  2JT8 A;  5AFP A;  5KTY A;  3E3R A;  2B1U A;  1EL4 A;  5AER A;  1YUT A;  1N65 A;  4YGD B;  2EGD A;  5HYD A;  4OCI A;  1S1E A;  1WY9 A;  3I5I B;  1IWQ A;  2ZFD A;  2I18 A;  4NQG A;  1BOC A;  1CKK A;  1MHO A;  1AUI B;  1LA0 A;  1FBV A;  1F71 A;  4R1E A;  3FWB A;  5HLV A;  1JF2 A;  1W7J B;  1AJ5 A;  2NZ0 A;  1MXE A;  2M29 A;  1CDN A;  3VRP A;  1JBA A;  4MEW A;  1F4O A;  1UHH A;  1M39 A;  5AAN A;  1S26 D;  2OPO A;  4DIR A;  3CR2 A;  1S6C A;  2WCE A;  1QX7 A;  2H61 C;  3HX4 A;  4TNC A;  2JOJ A;  1SL9 A;  1XK4 A;  1GGZ A;  4GUK A;  2K7O A;  4CID A;  1CDL A;  3I5H B;  5K89 A;  1LXF C;  2KBI A;  4GFT A;  1G8I A;  2BKH B;  3PSR A;  1ALW A;  1SL8 A;  1FI6 A;  1WDC B;  1XK4 C;  1IQ5 A;  1XO5 A;  2WOR A;  2WCF A;  1D1O A;  3OX6 A;  5FYX A;  1BMO A;  2LCP A;  2KAX A;  1M45 A;  2IS9 A;  5F6T A;  2K8M B;  1NX0 A;  3SIA A;  2R2I A;  3TDZ A;  3LLE A;  1C07 A;  1DJG A;  1OSA A;  3ZWH A;  2K2F A;  2CXJ A;  1QIV A;  5I2Q A;  3ZNI A;  1KCY A;  3H4S E;  3O4Y A;  1L2O B;  1DJZ A;  2EC6 B;  1BOD A;  1DF0 B;  3C1V A;  1ZAC A;  3ICB A;  1SL7 A;  4DUQ A;  4MZJ A;  4IL1 A;  1Y1X A;  3OP0 A;  1QVI Y;  2Y5I A;  2M7L A;  1XFY O;  1PVB A;  1GGW A;  2KI6 D;  3CS1 A;  2LHI A;  4QJ5 B;  1IJ6 A;  4BY5 A;  1WLM A;  3MSE B;  1SR6 B;  2LNK A;  1YX8 A;  4ORC B;  1OMD A;  3SJS A;  3I5G C;  2BBN A;  3VRO A;  5J3X A;  3PN7 B;  2BEC A;  1KK8 C;  2ZRS A;  2BCB A;  3PAL A;  4GGN A;  1H8B A;  3SG5 A;  1DTL A;  1JUO A;  1SY9 A;  4NDC A;  1Q80 A;  1MWN A;  2MBX A;  1K95 A;  4WQ3 A;  2OTG B;  1PAL A;  4N1G A;  2ZN9 A;  2L98 A;  2FCE A;  4YI8 A;  4ZCU A;  2I7A A;  1YUU A;  2KFF A;  2A4J A;  3DVM A;  1UHJ A;  1SW8 A;  1Y0V H;  2JXC A;  3JVT C;  4ORB B;  1M31 A;  2P6B B;  1KFU S;  1TNP A;  3KPX A;  1NCX A;  5IBW A;  4JQ0 D;  2FJU B;  1JFK A;  1CNP A;  2K7B A;  4MLW A;  2KI4 C;  2JTZ A;  4C0J A;  1GJY A;  1QTX A;  1UUR A;  1CDP A;  1QXP A;  2CBL A;  1IKU A;  2KYF A;  5G08 A;  1QLS A;  4USL A;  1AK8 A;  4AQJ A;  1JSA A;  3O78 A;  1CMF A;  3NSK A;  3AKB A;  3RM1 A;  1K2H A;  1ODB A;  2LC5 A;  4ICB A;  4YGE B;  1QX2 A;  4DCK A;  1E8A A;  2Y4Q A;  1DJX A;  2PRU A;  2I94 A;  4PDZ A;  3EVV A;  2FCD A;  1U5I A;  1DMO A;  3FS7 A;  4M2Q A;  1YVL A;  2PAL A;  1XVJ A;  3O6B A;  1QAT A;  2K2A A;  1OMR A;  1C7V A;  1Y1U A;  1TOP A;  3WHT B;  1QJT A;  1CTR A;  2V53 A;  2WCB A;  4PE0 A;  2JXL A;  1WRK A;  2LP2 A;  3GK4 X;  4Q04 A;  2M3W A;  3I5F B;  3JTD B;  2WC8 A;  1V1G A;  1TNX A;  5I2O A;  2LVK A;  2NLN A;  1EG3 A;  1KK7 Z;  2E6W A;  4P5O E;  1N0Y A;  2F3Y A;  4I5J A;  1BF5 A;  2JUL A;  2LMV A;  1KWO B;  1K9U A;  1VRK A;  2COL B;  2JU0 A;  3BXK A;  2LM5 A;  3FIA A;  1B8C A;  3DVJ A;  5PAL A;  2KI6 C;  1AHR A;  4MZK A;  1J7Q A;  3I5I C;  1YR5 A;  5CSJ A;  1MF8 B;  2KYC A;  2NCP A;  4PHJ A;  1A4P A;  2H61 A;  2M49 B;  2I2R E;  4N1F A;  1V1F A;  2MHH A;  2AAO A;  1B8L A;  1C7W A;  1UP5 A;  1NCZ A;  4PE1 A;  4YRU A;  1CLM A;  4I5K A;  3OB2 B;  5KSZ A;  3LK0 A;  2F2O A;  5AXI A;  5DKR A;  5B8I B;  2M1U A;  3QRX A;  3TDI A;  2KGR A;  3DVE A;  3SG6 A;  1BG1 A;  1LKJ A;  4XJK B;  5D7F A;  4GGF A;  2LUX A;  1DGU A;  2M0R A;  3EK8 A;  3GK1 A;  2MAZ A;  1ZOT B;  2ZNE A;  3BUX B;  3VRR A;  2ZKM X;  2K61 A;  5D69 A;  1TIZ A;  4GPL B;  2NXQ A;  2LAP A;  2WND A;  3SG4 A;  3I5H C;  3EVU A;  3KF9 A;  4PHM A;  1FW4 A;  1J55 A;  3DF0 A;  1PSB A;  2KFG A;  2LAN A;  1RFJ A;  4GGF C;  1WDC C;  1LA3 A;  2RGI A;  3BOW B;  3K21 A;  3IF7 A;  4PHK A;  3LL8 B;  1WRZ A;  1K8U A;  5JJG A;  2JPT A;  1JF0 A;  1OQP A;  1KQM B;  2FOT A;  2KNE A;  3GK2 A;  2KQ6 A;  4NDD A;  5GQQ C;  2Q4U A;  2KAV A;  3PAT A;  2WOS A;  1KFX S;  3PM8 A;  1IGV A;  5CPV A;  1TNW A;  2F3Z A;  5HKZ A;  3TUY B;  1DVI A;  2QPT A;  2EC6 C;  4WRI A;  1AVS A;  3OX5 A;  1N2D A;  1DJY A;  1IG5 A;  2KHN A;  2JWW A;  2KSP A;  2MLF C;  1DT7 B;  2L4I A;  2CT9 A;  1AP4 A;  3SG7 A;  3CGA A;  1QLK A;  2TN4 A;  3CR5 X;  2KGB C;  2PSR A;  1SYM A;  3WHU B;  1B7T Z;  1K9P A;  2VRG A;  1QAS A;  1SR6 C;  1CM4 A;  3VRN A;  1F70 A;  4HSZ A;  1NPQ A;  4MVF A;  1IRJ A;  2H2K A;  4ETO A;  1SCV A;  1QV0 A;  3NSO A;  3FWC A;  1F4Q A;  5DKN A;  3PN7 C;  1G33 A;  4L9M A;  1FPW A;  1BJF A;  4MRY A;  2LP3 A;  4FQO A;  1YRT B;  5AEQ A;  1SK6 D;  2PMY A;  5KU1 A;  1TCO B;  4OVN F;  1B8R A;  1UHN A;  2BL0 C;  1QS7 A;  1OMV A;  4YI9 A;  2OTG C;  4HRH A;  4YGC B;  4MN0 A;  1SCM B;  2GGM A;  2HET A;  2BKI B;  1FF1 A;  1DJI A;  2L2E A;  1TRF A;  2SCP A;  4OR9 B;  4N5X A;  1KK8 B;  2CNP A;  1KSO A;  2CTN A;  4WQ2 A;  2AUC A;  1CFC A;  1F8H A;  1WLZ A;  4GAO A;  1IH0 A;  1ZUZ A;  1G4Y R;  2BCX A;  3HCM A;  1A03 A;  1OZS A;  2JZI A;  4UPG A;  2BE6 A;  4JWQ A;  1PK0 D;  4M2O A;  1A75 B;  1XFU O;  3BUN B;  1K96 A;  4MZL A;  2LLU A;  1J7R A;  1CM1 A;  5HKW A;  1R2U A;  1WRL A;  3DD4 A;  3WNX B;  1J7P A;  1DGV A;  4CPV A;  1K94 A;  1L7Z A;  1NCY A;  2LUC A;  1S36 A;  1B1G A;  2OS8 B;  1EH2 A;  2LLS A;  1SRA A;  2JNX A;  2ZND A;  1OE9 B;  4P2Y B;  3LCP C;  1S5G Y;  3CR4 X;  1XFX O;  1MXL C;  4HRE E;  3WXA A;  5TNC A;  4QJ4 B;  1JWD A;  1A2X A;  1M63 B;  3IQQ A;  2MA2 A;  1SMG A;  3I5F C;  3JTD C;  1REC A;  4AQI A;  4CFR A;  1JC2 A;  1YRU B;  4E68 A;  2KDH A;  3CZT X;  4ORA B;  3D0Y B;  1EG4 A;  1KWO C;  3KEV A;  2KBM A;  1CB1 A;  1NX2 A;  2LMU A;  3TS5 B;  1BT6 A;  4M2P A;  2LLT A;  1RJV A;  3M0W A;  4NDB A;  3VRQ A;  4XJK A;  1MUX A;  1U5I B;  2L5X B;  3OB1 B;  1TN4 A;  4MRX A;  3EKH A;  1B47 A;  1SNL A;  4A4B A;  1KSM A;  5BPJ A;  3NSL A;  2HQW A;  2QAC A;  4I5N B;  1MR8 A;  2JRF A;  4FTG A;  1YUR A;  3BUW B;  3SIB A;  1EXR A;  1PVA A;  1DJH A;  1IQ3 A;  2O5G A;  1QVI Z;  2E30 A;  2K0J A;  1IJ5 A;  1TCF A;  1YUS A;  1UHK A;  3BOW A;  1LVC D;  5HKY A;  1K90 D;  1CFF A;  2Y1N A;  1HT9 A;  4CFQ A;  1J7O A;  3NSI A;  1ALV A;  4DS7 A;  2JT0 A;  1QX5 B;  3AAJ A;  4DRW A;  1SPY A;  4MBE A;  3EK4 A;  3O2P A;  2PVB A;  4OKH A;  4PHN A;  4CLN A;  1A29 A;  1RRO A;  2BBM A;  5DKQ A;  2DOQ A;  2JTT A;  1K93 D;  1DF0 A;  2F2P A;  1KQM C;  4U8D A;  4PCW A;  3CTN A;  1S6I A;  5ER5 A;  4QJ3 B;  1HQV A;  1Y1A A;  4GNK B;  1DJW A;  5HLO A;  2EHB A;  1XYD A;  1J1D A;  3EKJ A;  3TUY C;  5CSI A;  1B9A A;  1L2O C;  1NX1 A;  2O60 A;  1XFW O;  2JT3 A;  2LE9 B;  3A4U B;  1NSH A;  1W7I B;  1KK7 Y;  4BY4 A;  1ZFS A;  1F54 A;  3F45 A;  2GGZ A; 
#chains in the Genus database with same CATH topology
 4D1E A;  2F33 A;  1H4B A;  3TZ1 A;  2PAS A;  1QV1 A;  3PFV A;  2NCO A;  2LVI A;  4A4C A;  3VGO A;  3KO0 A;  3DF0 B;  2LV7 A;  1EJ3 A;  1S3P A;  1YTZ C;  1CFP A;  2MRD A;  4YGA A;  4PE7 A;  3CWG A;  4HRG A;  2MJW B;  3NHI A;  1KFX L;  1LIN A;  1J1E A;  3BQ3 A;  1PSR A;  2M7N A;  2G9B A;  3DVK A;  5ER4 X;  4ZCV A;  5JOL A;  1BLQ A;  4INX A;  2L4H A;  3SG2 A;  1KQV A;  2HPS A;  1F55 A;  1S5G Z;  3K1E A;  3SG3 A;  2CCM A;  1OZO A;  2K7D A;  3AAK A;  2L5Y A;  1Y6W A;  3D76 A;  3NXA A;  2KFH A;  1SCM C;  2HQ8 A;  2JC2 A;  1A75 A;  3I5G B;  4F0Z B;  1AJ4 A;  1SBJ A;  1OOJ A;  1SKT A;  2BE4 A;  2M97 A;  2L2C A;  2K7C A;  1YVH A;  1B4C A;  2ZN8 A;  3PM2 A;  4I5L B;  2Y1M A;  3D74 A;  1RWY A;  2M1K B;  5CSN A;  2ISD A;  2LMT A;  2BL0 B;  3L47 A;  1NYA A;  2WCK A;  3R72 A;  3S0F A;  3BUM B;  1QIW A;  1RK9 A;  3D75 A;  2HF5 A;  3JVT B;  3EK7 A;  2JNF A;  2G2B A;  2JQ6 A;  3KHE A;  1M46 A;  1R6P A;  2Q91 A;  4XYN A;  1JFJ A;  2L51 A;  3IQO A;  1CMG A;  2QEB A;  1UUS A;  4PE4 A;  1NX3 A;  1NWD A;  2LVJ A;  2OS8 C;  2L0P A;  3DZT A;  2WC5 A;  3V2L A;  1C3Z A;  2KI4 B;  1XA5 A;  3A8R A;  1KFU L;  1FI5 A;  2L50 A;  3OHM B;  3RLZ A;  3NHT A;  1NP8 A;  1CLL A;  1YX7 A;  1ZMZ A;  3D0Y A;  1NUB A;  1XFV O;  4YGB B;  1NIW A;  5CSF A;  2GV5 A;  1CFD A;  1BR1 B;  1CDM A;  1B7T Y;  1GQM A;  2D8N A;  1TNQ A;  1X02 A;  3R1O A;  4OV2 A;  4YBH B;  5I2L A;  1PRW A;  1BU3 A;  3GOF A;  1S6J A;  3EVR A;  2KAY A;  1TTX A;  2ZRT A;  3PLF B;  4MSP A;  1CLB A;  4AOM A;  1OOI X;  3AKA A;  1UWO A;  2F8P A;  3LK1 A;  1MQ1 A;  4PAL A;  3D78 A;  1RTP 1;  1XFZ O;  4C0L A;  1PUL A;  2KOT A;  4GBA A;  4JPZ B;  3CLN A;  3TDU A;  3TS5 C;  1K9K A;  1UHI A;  1BR4 B;  5I8N A;  3BYA A;  2LHL A;  2KQY A;  3D10 A;  2BCA A;  2M8U A;  2MLE C;  2LVV A;  4C0K A;  2M9G A;  3BUO B;  2AMI A;  2SAS A;  2JT8 A;  2QEH A;  5AFP A;  5KTY A;  3E3R A;  2B1U A;  2H8V A;  1EL4 A;  5AER A;  1YUT A;  1N65 A;  4YGD B;  1OOF A;  2EGD A;  2PQL A;  5HYD A;  4OCI A;  5EL2 A;  1S1E A;  1WY9 A;  3I5I B;  1IWQ A;  2ZFD A;  1P28 A;  2I18 A;  4NQG A;  1BOC A;  1CKK A;  1MHO A;  1AUI B;  2GTE A;  1LA0 A;  1FBV A;  1F71 A;  4R1E A;  3FWB A;  5HLV A;  1JF2 A;  1W7J B;  1AJ5 A;  2NZ0 A;  1MXE A;  2M29 A;  1CDN A;  3VRP A;  3SS4 A;  4MEW A;  1JBA A;  1F4O A;  1UHH A;  1M39 A;  5AAN A;  1S26 D;  2OPO A;  4DIR A;  3CR2 A;  1S6C A;  2WCE A;  1QX7 A;  2H61 C;  3HX4 A;  4TNC A;  3VB1 A;  2QDI A;  2JOJ A;  1SL9 A;  1XK4 A;  3R1P A;  1GGZ A;  4GUK A;  2K7O A;  3BJH A;  4CID A;  1CDL A;  3I5H B;  5K89 A;  1LXF C;  2KBI A;  4GFT A;  2K60 A;  1G8I A;  2BKH B;  3PSR A;  3SS3 A;  1ALW A;  1SL8 A;  1FI6 A;  1WDC B;  1XK4 C;  1IQ5 A;  1XO5 A;  2WOR A;  2WCF A;  1D1O A;  3OX6 A;  5FYX A;  1BMO A;  2LCP A;  2KAX A;  1M45 A;  2IS9 A;  3FE6 A;  5F6T A;  2K8M B;  2KLD A;  1NX0 A;  3SIA A;  2R2I A;  3TDZ A;  3LLE A;  1C07 A;  1DJG A;  1OSA A;  3ZWH A;  2K2F A;  2CXJ A;  1QIV A;  3B88 A;  3ZNI A;  5I2Q A;  3H4S E;  1KCY A;  3O4Y A;  1L2O B;  1DJZ A;  2EC6 B;  1BOD A;  1DF0 B;  3C1V A;  1ZAC A;  3ICB A;  1SL7 A;  4DUQ A;  4MZJ A;  4IL1 A;  1Y1X A;  3OP0 A;  1QVI Y;  2Y5I A;  2M7L A;  1XFY O;  1PVB A;  1GGW A;  2KI6 D;  3CS1 A;  2LHI A;  4QJ5 B;  1IJ6 A;  4BY5 A;  1WLM A;  3MSE B;  1SR6 B;  2LNK A;  1YX8 A;  4ORC B;  1OMD A;  5FI6 A;  3SJS A;  3I5G C;  2BBN A;  3VRO A;  5J3X A;  3PN7 B;  2BEC A;  1KK8 C;  2ZRS A;  2BNX A;  2BCB A;  3PAL A;  4GGN A;  1H8B A;  1TUZ A;  3SG5 A;  1DTL A;  1JUO A;  1SY9 A;  4NDC A;  2WCM A;  1Q80 A;  1MWN A;  2MBX A;  1K95 A;  3B6X A;  4WQ3 A;  2OTG B;  1PAL A;  4N1G A;  2ZN9 A;  2L98 A;  2FCE A;  4YI8 A;  1Z2C B;  4ZCU A;  2I7A A;  1YUU A;  2KFF A;  4FQT A;  1W9Z A;  2A4J A;  1UHJ A;  1SW8 A;  1Y0V H;  2JXC A;  3DVM A;  1QWV A;  1M31 A;  2P6B B;  3JVT C;  4ORB B;  5DIC A;  1KFU S;  1TNP A;  3KPX A;  1NCX A;  5IBW A;  4JQ0 D;  2FJU B;  5D3O A;  1JFK A;  2YGU A;  1CNP A;  2K7B A;  4MLW A;  2KI4 C;  2JTZ A;  3CYZ A;  4C0J A;  1GJY A;  1QTX A;  1UUR A;  1CDP A;  1QXP A;  1XFR A;  5FI7 A;  2CBL A;  1IKU A;  2KYF A;  5G08 A;  1QLS A;  4USL A;  1AK8 A;  3CAB A;  4AQJ A;  3CZ1 A;  1JSA A;  3O78 A;  1CMF A;  3CZ2 A;  3AKB A;  3NSK A;  3RM1 A;  1ODB A;  1ORG A;  1K2H A;  2LC5 A;  4ICB A;  4YGE B;  1QX2 A;  4DCK A;  1E8A A;  2Y4Q A;  1DJX A;  1OW4 A;  2PRU A;  2I94 A;  4PDZ A;  3UO9 A;  3EVV A;  2FCD A;  1U5I A;  3B87 A;  3FS7 A;  4M2Q A;  1YVL A;  2PAL A;  1DMO A;  1XVJ A;  1T14 A;  3O6B A;  2WC6 A;  1QAT A;  2K2A A;  1OMR A;  1C7V A;  1Y1U A;  1TOP A;  3B86 A;  3WHT B;  1QJT A;  3B7A A;  1CTR A;  2V53 A;  2WCB A;  4PE0 A;  2JXL A;  1WRK A;  2LP2 A;  3GK4 X;  4Q04 A;  3CDN A;  2M3W A;  3I5F B;  3JTD B;  2WC8 A;  1V1G A;  3S0B A;  1TNX A;  5I2O A;  2LVK A;  2NLN A;  1EG3 A;  1KK7 Z;  2E6W A;  4P5O E;  1N0Y A;  2F3Y A;  4I5J A;  4YRU A;  1BF5 A;  2JUL A;  2LMV A;  1KWO B;  1K9U A;  1VRK A;  2COL B;  2JU0 A;  3BXK A;  2LM5 A;  3FIA A;  1B8C A;  3DVJ A;  5PAL A;  2KI6 C;  1AHR A;  4MZK A;  1J7Q A;  3I5I C;  1YR5 A;  5CSJ A;  1MF8 B;  2KYC A;  2NCP A;  4PHJ A;  1A4P A;  2H61 A;  2JPO A;  3L4L A;  2M49 B;  2I2R E;  4N1F A;  1V1F A;  2MHH A;  2AAO A;  1B8L A;  1C7W A;  1UP5 A;  1NCZ A;  3O4X A;  4PE1 A;  1CLM A;  4I5K A;  1DQE A;  3OB2 B;  3LK0 A;  2F2O A;  5AXI A;  5DKR A;  3FE8 A;  5KSZ A;  5B8I B;  2M1U A;  3QRX A;  3TDI A;  2KGR A;  3DVE A;  3SG6 A;  1BG1 A;  1LKJ A;  4XJK B;  5D7F A;  4GGF A;  2LUX A;  1DGU A;  2M0R A;  3EK8 A;  3GK1 A;  3BFH A;  2MAZ A;  1ZOT B;  2ZNE A;  3BUX B;  3VRR A;  2ZKM X;  4F7F A;  2K61 A;  5D69 A;  1TIZ A;  4GPL B;  1TWO A;  2LAP A;  2NXQ A;  2WND A;  3I5H C;  3OBV A;  3Q8I A;  3SG4 A;  3EVU A;  3KF9 A;  4PHM A;  1FW4 A;  1J55 A;  1IIO A;  3CZ0 A;  1PSB A;  3DF0 A;  2KFG A;  2LAN A;  1RFJ A;  3DY9 A;  4GGF C;  4IJ7 A;  1WDC C;  1LA3 A;  2RGI A;  3BOW B;  3K21 A;  3IF7 A;  4PHK A;  3LL8 B;  1WRZ A;  1K8U A;  5JJG A;  2JPT A;  1JF0 A;  1OQP A;  1KQM B;  2FOT A;  2KNE A;  3GK2 A;  2KQ6 A;  3RZS A;  2ERB A;  2KLE A;  4NDD A;  5GQQ C;  2Q4U A;  2KAV A;  3PAT A;  2WOS A;  3QME A;  1KFX S;  3PM8 A;  1IGV A;  5CPV A;  1TNW A;  2F3Z A;  3D77 A;  5HKZ A;  3TUY B;  1DVI A;  2QPT A;  1DEL A;  2EC6 C;  4WRI A;  3R1V A;  1AVS A;  3OX5 A;  1N2D A;  1DJY A;  1IG5 A;  2KHN A;  2JWW A;  2KSP A;  2MLF C;  1DT7 B;  2L4I A;  2CT9 A;  1AP4 A;  3SG7 A;  3CGA A;  1QLK A;  2TN4 A;  3S0D A;  3CR5 X;  2KGB C;  2PSR A;  1SYM A;  2WCH A;  3WHU B;  1B7T Z;  1K9P A;  3N7H A;  2VRG A;  1QAS A;  1SR6 C;  2QEV A;  1CM4 A;  3VRN A;  1F70 A;  4HSZ A;  1NPQ A;  4MVF A;  1IRJ A;  2H2K A;  4ETO A;  1SCV A;  1QV0 A;  3NSO A;  3FWC A;  1F4Q A;  5DKN A;  3PN7 C;  1G33 A;  4L9M A;  1FPW A;  1TUJ A;  1BJF A;  4MRY A;  2LP3 A;  3FE9 A;  4FQO A;  1YRT B;  5AEQ A;  1SK6 D;  2PMY A;  5I94 A;  2FJY A;  5KU1 A;  1TCO B;  2WCJ A;  1B8R A;  4OVN F;  1UHN A;  2BL0 C;  1QS7 A;  1OMV A;  4OZD A;  4YI9 A;  1LS8 A;  2OTG C;  4HRH A;  4YGC B;  4MN0 A;  3S0G A;  1SCM B;  1C3Y A;  2GGM A;  2HET A;  2BKI B;  1FF1 A;  1DJI A;  2L2E A;  1TRF A;  2SCP A;  4OR9 B;  1GM0 A;  4N5X A;  1KK8 B;  2CNP A;  1KSO A;  2CTN A;  4WQ2 A;  2AUC A;  1CFC A;  1F8H A;  1DEK A;  1WLZ A;  2P71 A;  4GAO A;  1IH0 A;  1ZUZ A;  1G4Y R;  2BCX A;  3HCM A;  1A03 A;  1OZS A;  2JZI A;  4UPG A;  2BE6 A;  4JWQ A;  1PK0 D;  4M2O A;  1A75 B;  1XFU O;  3BUN B;  1K96 A;  4MZL A;  3BFA A;  2LLU A;  1J7R A;  2QEO A;  3PJI A;  1CM1 A;  5HKW A;  1R2U A;  1WRL A;  3S0A A;  3DD4 A;  3WNX B;  2BAP A;  1J7P A;  1DGV A;  4CPV A;  1K94 A;  1L7Z A;  1NCY A;  2LUC A;  1S36 A;  3NGV A;  2OS8 B;  1B1G A;  1EH2 A;  2LLS A;  1SRA A;  2JNX A;  2ZND A;  1OE9 B;  2PYQ A;  4P2Y B;  3LCP C;  1S5G Y;  3CR4 X;  1XFX O;  1MXL C;  4HRE E;  3WXA A;  5TNC A;  4QJ4 B;  1JWD A;  1A2X A;  1M63 B;  3IQQ A;  2MA2 A;  4PT1 A;  1SMG A;  3I5F C;  3JTD C;  1REC A;  4AQI A;  4CFR A;  1JC2 A;  1YRU B;  4E68 A;  2KDH A;  3CZT X;  3IVT A;  4ORA B;  3D0Y B;  1EG4 A;  3UNW A;  1KWO C;  3KEV A;  1Z4H A;  2KBM A;  1CB1 A;  2P70 A;  1NX2 A;  2LMU A;  3TS5 B;  1BT6 A;  4M2P A;  3BFB A;  2LLT A;  1RJV A;  3DYE A;  4INW A;  3M0W A;  4NDB A;  4KYN A;  4XJK A;  3VRQ A;  1MUX A;  1U5I B;  2L5X B;  3L4A A;  1TN4 A;  3OB1 B;  4MRX A;  3EKH A;  2WCL A;  1B47 A;  1OOH A;  1SNL A;  1KSM A;  4A4B A;  3NSL A;  5BPJ A;  1SSE B;  2HQW A;  2QAC A;  4I5N B;  1MR8 A;  2JRF A;  4FTG A;  5FI2 A;  1YUR A;  3BUW B;  3SIB A;  1EXR A;  3S0E A;  1PVA A;  1DJH A;  1IQ3 A;  2O5G A;  1QVI Z;  2E30 A;  2K0J A;  1IJ5 A;  1TCF A;  5HL1 A;  1YUS A;  1UHK A;  3BOW A;  1LVC D;  5HKY A;  3EG5 B;  1OOG A;  1K90 D;  1CFF A;  3DXL A;  2Y1N A;  1DC1 A;  3OGN A;  1HT9 A;  4CFQ A;  3D73 A;  1J7O A;  3NSI A;  1ALV A;  4DS7 A;  2JT0 A;  1QX5 B;  3AAJ A;  4DRW A;  1SPY A;  4MBE A;  3EK4 A;  3O2P A;  2PVB A;  4OKH A;  4PHN A;  4CLN A;  1A29 A;  1RRO A;  2BBM A;  5DKQ A;  2DOQ A;  2JTT A;  1K93 D;  1DF0 A;  2F2P A;  1KQM C;  4JD9 A;  4JKT A;  4U8D A;  3SS5 A;  4PCW A;  3CTN A;  1S6I A;  5ER5 A;  4QJ3 B;  1HQV A;  1Y1A A;  4GNK B;  1DJW A;  5HLO A;  2EHB A;  1XYD A;  1J1D A;  3EKJ A;  3TUY C;  5CSI A;  1B9A A;  1L2O C;  1NX1 A;  2KPH A;  2O60 A;  1XFW O;  2JT3 A;  2LE9 B;  3A4U B;  1NSH A;  1W7I B;  1KK7 Y;  4BY4 A;  1ZFS A;  1F54 A;  3F45 A;  2GGZ A; 
#chains in the Genus database with same CATH homology
 4D1E A;  2F33 A;  1H4B A;  3TZ1 A;  2PAS A;  1QV1 A;  3PFV A;  2NCO A;  2LVI A;  4A4C A;  3VGO A;  3KO0 A;  3DF0 B;  2LV7 A;  1EJ3 A;  1S3P A;  1YTZ C;  1CFP A;  2MRD A;  4YGA A;  4PE7 A;  3CWG A;  4HRG A;  2MJW B;  1KFX L;  1LIN A;  1J1E A;  3BQ3 A;  1PSR A;  2M7N A;  2G9B A;  3DVK A;  5ER4 X;  4ZCV A;  5JOL A;  1BLQ A;  1KQV A;  2L4H A;  3SG2 A;  2HPS A;  1F55 A;  1S5G Z;  3SG3 A;  2CCM A;  1OZO A;  2K7D A;  3AAK A;  1Y6W A;  3NXA A;  2KFH A;  1SCM C;  2HQ8 A;  2JC2 A;  1A75 A;  3I5G B;  4F0Z B;  1AJ4 A;  1SBJ A;  1OOJ A;  1SKT A;  2BE4 A;  2M97 A;  2K7C A;  1YVH A;  1B4C A;  2ZN8 A;  4I5L B;  2Y1M A;  1RWY A;  2M1K B;  5CSN A;  2ISD A;  2LMT A;  2BL0 B;  1NYA A;  3BUM B;  1QIW A;  1RK9 A;  2HF5 A;  3JVT B;  3EK7 A;  2JNF A;  2G2B A;  2JQ6 A;  3KHE A;  1M46 A;  1R6P A;  2Q91 A;  4XYN A;  1JFJ A;  2L51 A;  3IQO A;  1CMG A;  1UUS A;  4PE4 A;  1NX3 A;  1NWD A;  2LVJ A;  2OS8 C;  2L0P A;  1FI5 A;  2KI4 B;  1XA5 A;  3A8R A;  1KFU L;  2L50 A;  3OHM B;  3RLZ A;  1NP8 A;  1CLL A;  1YX7 A;  1ZMZ A;  3D0Y A;  1NUB A;  1XFV O;  4YGB B;  1NIW A;  5CSF A;  2GV5 A;  1CFD A;  1BR1 B;  1CDM A;  1B7T Y;  1GQM A;  2D8N A;  1TNQ A;  1X02 A;  4OV2 A;  4YBH B;  5I2L A;  1PRW A;  1BU3 A;  3GOF A;  1S6J A;  3EVR A;  2KAY A;  1TTX A;  2ZRT A;  3PLF B;  4MSP A;  1CLB A;  4AOM A;  3AKA A;  1UWO A;  2F8P A;  3LK1 A;  1MQ1 A;  4PAL A;  1RTP 1;  1XFZ O;  4C0L A;  1PUL A;  2KOT A;  4GBA A;  4JPZ B;  3CLN A;  3TDU A;  3TS5 C;  1K9K A;  1UHI A;  1BR4 B;  5I8N A;  3BYA A;  2LHL A;  2KQY A;  3D10 A;  2BCA A;  2M8U A;  2MLE C;  2LVV A;  4C0K A;  2M9G A;  3BUO B;  2AMI A;  2SAS A;  2JT8 A;  5AFP A;  5KTY A;  3E3R A;  2B1U A;  1EL4 A;  5AER A;  1YUT A;  1N65 A;  4YGD B;  2EGD A;  5HYD A;  4OCI A;  1S1E A;  1WY9 A;  3I5I B;  1IWQ A;  2ZFD A;  2I18 A;  4NQG A;  1BOC A;  1CKK A;  1MHO A;  1AUI B;  1LA0 A;  1FBV A;  1F71 A;  4R1E A;  3FWB A;  5HLV A;  1JF2 A;  1W7J B;  1AJ5 A;  2NZ0 A;  1MXE A;  2M29 A;  1CDN A;  3VRP A;  1JBA A;  4MEW A;  1F4O A;  1UHH A;  1M39 A;  5AAN A;  1S26 D;  2OPO A;  4DIR A;  3CR2 A;  1S6C A;  2WCE A;  1QX7 A;  2H61 C;  3HX4 A;  4TNC A;  2JOJ A;  1SL9 A;  1XK4 A;  1GGZ A;  4GUK A;  2K7O A;  4CID A;  1CDL A;  3I5H B;  5K89 A;  1LXF C;  2KBI A;  4GFT A;  1G8I A;  2BKH B;  3PSR A;  1ALW A;  1SL8 A;  1FI6 A;  1WDC B;  1XK4 C;  1IQ5 A;  1XO5 A;  2WOR A;  2WCF A;  1D1O A;  3OX6 A;  5FYX A;  1BMO A;  2LCP A;  2KAX A;  1M45 A;  2IS9 A;  5F6T A;  2K8M B;  1NX0 A;  3SIA A;  2R2I A;  3TDZ A;  3LLE A;  1C07 A;  1DJG A;  1OSA A;  3ZWH A;  2K2F A;  2CXJ A;  1QIV A;  5I2Q A;  3ZNI A;  1KCY A;  3H4S E;  3O4Y A;  1L2O B;  1DJZ A;  2EC6 B;  1BOD A;  1DF0 B;  3C1V A;  1ZAC A;  3ICB A;  1SL7 A;  4DUQ A;  4MZJ A;  4IL1 A;  1Y1X A;  3OP0 A;  1QVI Y;  2Y5I A;  2M7L A;  1XFY O;  1PVB A;  1GGW A;  2KI6 D;  3CS1 A;  2LHI A;  4QJ5 B;  1IJ6 A;  4BY5 A;  1WLM A;  3MSE B;  1SR6 B;  2LNK A;  1YX8 A;  4ORC B;  1OMD A;  3SJS A;  3I5G C;  2BBN A;  3VRO A;  5J3X A;  3PN7 B;  2BEC A;  1KK8 C;  2ZRS A;  2BCB A;  3PAL A;  4GGN A;  1H8B A;  3SG5 A;  1DTL A;  1JUO A;  1SY9 A;  4NDC A;  1Q80 A;  1MWN A;  2MBX A;  1K95 A;  4WQ3 A;  2OTG B;  1PAL A;  4N1G A;  2ZN9 A;  2L98 A;  2FCE A;  4YI8 A;  4ZCU A;  2I7A A;  1YUU A;  2KFF A;  2A4J A;  3DVM A;  1UHJ A;  1SW8 A;  1Y0V H;  2JXC A;  3JVT C;  4ORB B;  1M31 A;  2P6B B;  1KFU S;  1TNP A;  3KPX A;  1NCX A;  5IBW A;  4JQ0 D;  2FJU B;  1JFK A;  1CNP A;  2K7B A;  4MLW A;  2KI4 C;  2JTZ A;  4C0J A;  1GJY A;  1QTX A;  1UUR A;  1CDP A;  1QXP A;  2CBL A;  1IKU A;  2KYF A;  5G08 A;  1QLS A;  4USL A;  1AK8 A;  4AQJ A;  1JSA A;  3O78 A;  1CMF A;  3NSK A;  3AKB A;  3RM1 A;  1K2H A;  1ODB A;  2LC5 A;  4ICB A;  4YGE B;  1QX2 A;  4DCK A;  1E8A A;  2Y4Q A;  1DJX A;  2PRU A;  2I94 A;  4PDZ A;  3EVV A;  2FCD A;  1U5I A;  1DMO A;  3FS7 A;  4M2Q A;  1YVL A;  2PAL A;  1XVJ A;  3O6B A;  1QAT A;  2K2A A;  1OMR A;  1C7V A;  1Y1U A;  1TOP A;  3WHT B;  1QJT A;  1CTR A;  2V53 A;  2WCB A;  4PE0 A;  2JXL A;  1WRK A;  2LP2 A;  3GK4 X;  4Q04 A;  2M3W A;  3I5F B;  3JTD B;  2WC8 A;  1V1G A;  1TNX A;  5I2O A;  2LVK A;  2NLN A;  1EG3 A;  1KK7 Z;  2E6W A;  4P5O E;  1N0Y A;  2F3Y A;  4I5J A;  1BF5 A;  2JUL A;  2LMV A;  1KWO B;  1K9U A;  1VRK A;  2COL B;  2JU0 A;  3BXK A;  2LM5 A;  3FIA A;  1B8C A;  3DVJ A;  5PAL A;  2KI6 C;  1AHR A;  4MZK A;  1J7Q A;  3I5I C;  1YR5 A;  5CSJ A;  1MF8 B;  2KYC A;  2NCP A;  4PHJ A;  1A4P A;  2H61 A;  2M49 B;  2I2R E;  4N1F A;  1V1F A;  2MHH A;  2AAO A;  1B8L A;  1C7W A;  1UP5 A;  1NCZ A;  4PE1 A;  4YRU A;  1CLM A;  4I5K A;  3OB2 B;  5KSZ A;  3LK0 A;  2F2O A;  5AXI A;  5DKR A;  5B8I B;  2M1U A;  3QRX A;  3TDI A;  2KGR A;  3DVE A;  3SG6 A;  1BG1 A;  1LKJ A;  4XJK B;  5D7F A;  4GGF A;  2LUX A;  1DGU A;  2M0R A;  3EK8 A;  3GK1 A;  2MAZ A;  1ZOT B;  2ZNE A;  3BUX B;  3VRR A;  2ZKM X;  2K61 A;  5D69 A;  1TIZ A;  4GPL B;  2NXQ A;  2LAP A;  2WND A;  3SG4 A;  3I5H C;  3EVU A;  3KF9 A;  4PHM A;  1FW4 A;  1J55 A;  3DF0 A;  1PSB A;  2KFG A;  2LAN A;  1RFJ A;  4GGF C;  1WDC C;  1LA3 A;  2RGI A;  3BOW B;  3K21 A;  3IF7 A;  4PHK A;  3LL8 B;  1WRZ A;  1K8U A;  5JJG A;  2JPT A;  1JF0 A;  1OQP A;  1KQM B;  2FOT A;  2KNE A;  3GK2 A;  2KQ6 A;  4NDD A;  5GQQ C;  2Q4U A;  2KAV A;  3PAT A;  2WOS A;  1KFX S;  3PM8 A;  1IGV A;  5CPV A;  1TNW A;  2F3Z A;  5HKZ A;  3TUY B;  1DVI A;  2QPT A;  2EC6 C;  4WRI A;  1AVS A;  3OX5 A;  1N2D A;  1DJY A;  1IG5 A;  2KHN A;  2JWW A;  2KSP A;  2MLF C;  1DT7 B;  2L4I A;  2CT9 A;  1AP4 A;  3SG7 A;  3CGA A;  1QLK A;  2TN4 A;  3CR5 X;  2KGB C;  2PSR A;  1SYM A;  3WHU B;  1B7T Z;  1K9P A;  2VRG A;  1QAS A;  1SR6 C;  1CM4 A;  3VRN A;  1F70 A;  4HSZ A;  1NPQ A;  4MVF A;  1IRJ A;  2H2K A;  4ETO A;  1SCV A;  1QV0 A;  3NSO A;  3FWC A;  1F4Q A;  5DKN A;  3PN7 C;  1G33 A;  4L9M A;  1FPW A;  1BJF A;  4MRY A;  2LP3 A;  4FQO A;  1YRT B;  5AEQ A;  1SK6 D;  2PMY A;  5KU1 A;  1TCO B;  4OVN F;  1B8R A;  1UHN A;  2BL0 C;  1QS7 A;  1OMV A;  4YI9 A;  2OTG C;  4HRH A;  4YGC B;  4MN0 A;  1SCM B;  2GGM A;  2HET A;  2BKI B;  1FF1 A;  1DJI A;  2L2E A;  1TRF A;  2SCP A;  4OR9 B;  4N5X A;  1KK8 B;  2CNP A;  1KSO A;  2CTN A;  4WQ2 A;  2AUC A;  1CFC A;  1F8H A;  1WLZ A;  4GAO A;  1IH0 A;  1ZUZ A;  1G4Y R;  2BCX A;  3HCM A;  1A03 A;  1OZS A;  2JZI A;  4UPG A;  2BE6 A;  4JWQ A;  1PK0 D;  4M2O A;  1A75 B;  1XFU O;  3BUN B;  1K96 A;  4MZL A;  2LLU A;  1J7R A;  1CM1 A;  5HKW A;  1R2U A;  1WRL A;  3DD4 A;  3WNX B;  1J7P A;  1DGV A;  4CPV A;  1K94 A;  1L7Z A;  1NCY A;  2LUC A;  1S36 A;  1B1G A;  2OS8 B;  1EH2 A;  2LLS A;  1SRA A;  2JNX A;  2ZND A;  1OE9 B;  4P2Y B;  3LCP C;  1S5G Y;  3CR4 X;  1XFX O;  1MXL C;  4HRE E;  3WXA A;  5TNC A;  4QJ4 B;  1JWD A;  1A2X A;  1M63 B;  3IQQ A;  2MA2 A;  1SMG A;  3I5F C;  3JTD C;  1REC A;  4AQI A;  4CFR A;  1JC2 A;  1YRU B;  4E68 A;  2KDH A;  3CZT X;  4ORA B;  3D0Y B;  1EG4 A;  1KWO C;  3KEV A;  2KBM A;  1CB1 A;  1NX2 A;  2LMU A;  3TS5 B;  1BT6 A;  4M2P A;  2LLT A;  1RJV A;  3M0W A;  4NDB A;  3VRQ A;  4XJK A;  1MUX A;  1U5I B;  2L5X B;  3OB1 B;  1TN4 A;  4MRX A;  3EKH A;  1B47 A;  1SNL A;  4A4B A;  1KSM A;  5BPJ A;  3NSL A;  2HQW A;  2QAC A;  4I5N B;  1MR8 A;  2JRF A;  4FTG A;  1YUR A;  3BUW B;  3SIB A;  1EXR A;  1PVA A;  1DJH A;  1IQ3 A;  2O5G A;  1QVI Z;  2E30 A;  2K0J A;  1IJ5 A;  1TCF A;  1YUS A;  1UHK A;  3BOW A;  1LVC D;  5HKY A;  1K90 D;  1CFF A;  2Y1N A;  1HT9 A;  4CFQ A;  1J7O A;  3NSI A;  1ALV A;  4DS7 A;  2JT0 A;  1QX5 B;  3AAJ A;  4DRW A;  1SPY A;  4MBE A;  3EK4 A;  3O2P A;  2PVB A;  4OKH A;  4PHN A;  4CLN A;  1A29 A;  1RRO A;  2BBM A;  5DKQ A;  2DOQ A;  2JTT A;  1K93 D;  1DF0 A;  2F2P A;  1KQM C;  4U8D A;  4PCW A;  3CTN A;  1S6I A;  5ER5 A;  4QJ3 B;  1HQV A;  1Y1A A;  4GNK B;  1DJW A;  5HLO A;  2EHB A;  1XYD A;  1J1D A;  3EKJ A;  3TUY C;  5CSI A;  1B9A A;  1L2O C;  1NX1 A;  2O60 A;  1XFW O;  2JT3 A;  2LE9 B;  3A4U B;  1NSH A;  1W7I B;  1KK7 Y;  4BY4 A;  1ZFS A;  1F54 A;  3F45 A;  2GGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...