4M2PA

Crystal structure of a non-myristoylated c39d recoverin mutant with one calcium ion bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
192
structure length
192
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKEDPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Recoverin
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
total genus 78
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2pA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2pA01
3LCPC 4P2YB 4YBHB 1DJIA 1OSAA 3SJSA 1K94A 1JC2A 4NDCA 2JT8A 1CTRA 1XFUO 3E3RA 3LK0A 2SCPA 2SASA 1FI6A 1PULA 3KHEA 1NWDA 1KWOB 1G4YR 1HT9A 2QACA 3TDIA 1IG5A 2LVJA 1Y1XA 2LP3A 1MWNA 2PASA 3I5GB 5AANA 2LHIA 4I5JA 3KEVA 1JF2A 3DVEA 1QXPA 1M31A 5HYDA 3CR4X 3OX6A 2COLB 5GQQC 1A03A 3CTNA 2M8UA 3DVMA 5K89A 1U5IA 2PMYA 1SCMB 1MHOA 1AVSA 4HRHA 1PSRA 4M2PA 2AUCA 4GGFC 1DGVA 2MRDA 1CMGA 3BQ3A 5CPVA 2FCEA 2ZNEA 2BBMA 3AAKA 2BCAA 3TUYC 2LUCA 1FW4A 1AJ5A 3JTDC 4MRXA 1IH0A 1NSHA 4QJ4B 2LLTA 4PE0A 1K95A 1Y1UA 2JXCA 2EGDA 1F54A 1CLMA 3RLZA 3NSKA 4MZJA 4PE4A 1DF0A 5HLOA 1YVHA 1CNPA 3QRXA 3CZTX 1ZACA 1YUTA 4ICBA 1ALWA 1SRAA 3TS5C 5IBWA 1IQ5A 1NX3A 2M7LA 4F0ZB 1TNWA 1SR6C 5HLVA 1B7TZ 3SIAA 1RECA 2L4IA 4CFRA 2GGMA 2KFHA 1KCYA 1OZSA 1XFVO 2WCFA 2K7CA 2KAYA 1ZUZA 2WORA 3OP0A 2JQ6A 2JT3A 1IJ6A 1KQVA 1E8AA 4WQ2A 1KK8B 2PSRA 1G8IA 3DF0B 1PALA 1AUIB 1ZFSA 4N5XA 1J7RA 1VRKA 1J1DA 2OTGB 1F4QA 1EJ3A 1S5GZ 2LMVA 4MEWA 3OX5A 1NYAA 1H8BA 1SNLA 1A2XA 1TCOB 1KQMB 1SY9A 2JULA 3KPXA 4JQ0D 3JVTC 2ISDA 2ZRTA 2LHLA 1ALVA 2KI6C 4PHNA 2H61A 2M1KB 4QJ5B 3I5HB 3D10A 3ZNIA 2OS8B 3TZ1A 3O6BA 2CTNA 4MZKA 1TOPA 1UHNA 3VROA 5I2OA 2BE4A 5I2LA 2JPTA 3BUWB 2LNKA 1S1EA 3WHUB 1ODBA 1CFDA 1OMDA 3BYAA 1S6JA 1KFXS 3DVKA 2ZN9A 2HF5A 1QX7A 3NXAA 4DCKA 2Y1NA 1K9KA 3PALA 1NX1A 1C7VA 1JF0A 3BUMB 1B9AA 4XJKB 1RK9A 2K7BA 3DF0A 1MXEA 1B47A 2BKIB 3BUXB 2Y4QA 2LLSA 4MSPA 1TIZA 5CSJA 3TDUA 1EG3A 3O4YA 2BBNA 4CLNA 2Q4UA 2O60A 1XFXO 2KYCA 1K2HA 3RM1A 1OOJA 3KO0A 4L9MA 1HQVA 1XK4A 1SKTA 4GNKB 3CLNA 1YRTB 2KYFA 1CLBA 1BJFA 1XO5A 3I5IC 3ICBA 1QIVA 3VGOA 4ZCUA 1N0YA 2BCBA 2EC6C 2JTZA 5HKWA 4MVFA 4FTGA 3TUYB 1EL4A 3JTDB 2HETA 2CCMA 2I2RE 5DKRA 3SG4A 3D0YB 2LMUA 1TN4A 2P6BB 1MXLC 1QLKA 3WNXB 4D1EA 1IRJA 3AAJA 1S3PA 4DIRA 2GV5A 3VRNA 2LM5A 2WCEA 1BODA 2KI4C 4OCIA 3VRRA 2CBLA 5CSFA 1YX8A 1DF0B 1NCYA 1QIWA 2BCXA 2EHBA 4XJKA 5BPJA 2L0PA 3EKHA 4GBAA 2L51A 1DVIA 1N2DA 4HREE 1TNQA 4MRYA 3TS5B 2G9BA 2KFGA 1KSMA 2MHHA 2JNXA 1AHRA 2KAVA 3BUNB 1SR6B 1D1OA 3O78A 1DMOA 3SG3A 1FI5A 2K7OA 1BT6A 3I5FB 1K8UA 1WDCC 2BL0B 1YUUA 4USLA 5ER5A 1R6PA 2AMIA 4CPVA 4ETOA 1GQMA 1SCVA 1XA5A 3WXAA 1YUSA 4GGFA 3NSIA 1F4OA 1NP8A 3LL8B 4MZLA 2QPTA 4YGCB 3BUOB 4MLWA 1L2OB 1IWQA 2BE6A 2ZKMX 1JFKA 4P5OE 3SG2A 1F71A 1F70A 2F3YA 1QLSA 3D0YA 2HPSA 1YTZC 1EXRA 3DD4A 3GK2A 2WOSA 4C0LA 1MF8B 2KQ6A 3CGAA 1OMVA 1QTXA 3IF7A 5J3XA 1RWYA 2K0JA 4IL1A 4AOMA 3JVTB 2LANA 2Q91A 1MUXA 1F8HA 2CT9A 2KI6D 1XFWO 4YGDB 1RFJA 1QASA 1TTXA 1NIWA 1CDPA 1KK7Y 2JT0A 1SK6D 2L50A 2KDHA 3SG5A 1CKKA 1BR4B 1UWOA 3AKAA 1LA0A 5JJGA 2Y5IA 1K93D 5F6TA 2FCDA 4A4BA 1CFPA 1UHHA 4PHJA 1H4BA 4BY5A 3VRPA 1YRUB 2L4HA 2MAZA 4WRIA 1CMFA 2KSPA 4GAOA 5DKNA 3SG7A 1W7IB 1PVBA 2LV7A 1DGUA 1KSOA 1QV1A 4XYNA 3CR2A 1EG4A 1WRKA 2BECA 1B8RA 5KTYA 1S6CA 2KBMA 1XFYO 2F8PA 4ORBB 4JWQA 1M63B 1UUSA 2LE9B 1YURA 1QVIY 4YGAA 4YGBB 2M9GA 3H4SE 2TN4A 3IQOA 5D7FA 3OB2B 2F2OA 3FWCA 4NDDA 2FJUB 2JC2A 4TNCA 1QATA 1DTLA 2KGBC 2M0RA 3EVVA 1SCMC 3F45A 1RROA 1FF1A 2F3ZA 3VRQA 2JWWA 1NCZA 3A8RA 3I5IB 3C1VA 1B1GA 3OHMB 2K61A 3PN7C 4Q04A 4M2QA 1BG1A 1B7TY 1TRFA 2K2FA 2NCOA 4M2OA 1BF5A 1AK8A 4C0KA 3BXKA 3WHTB 1UHKA 2KFFA 4R1EA 1TCFA 2M7NA 1DJHA 1KFUL 4AQIA 2PVBA 1A75A 1DT7B 1CB1A 1GJYA 2LVIA 1BMOA 2WCBA 1CLLA 2MLEC 3EVRA 1YR5A 2JNFA 3TDZA 1G33A 1R2UA 1IQ3A 1PSBA 2KNEA 2L5XB 1B8LA 1K9UA 2LCPA 4HSZA 4PDZA 2JU0A 4PE1A 2GGZA 1SPYA 2JXLA 1RJVA 3EK8A 1QV0A 5AXIA 3SG6A 1S36A 2L98A 4PHKA 4N1FA 2OPOA 1NPQA 1XVJA 1K9PA 2PRUA 2RGIA 1DJZA 3EKJA 2M49B 2ZRSA 1KFUS 1XYDA 3GK4X 2R2IA 2KHNA 3EK7A 4QJ3B 1B8CA 1S6IA 2OTGC 1DJWA 4PE7A 1S26D 1CDNA 2AAOA 1J1EA 1KQMC 5PALA 2CNPA 4U8DA 3FS7A 3O2PA 1X02A 5HKYA 4GFTA 3PFVA 5CSNA 5KSZA 1J7OA 5FYXA 2JTTA 2H2KA 2OS8C 1SMGA 2KQYA 1DJGA 1V1FA 1ZMZA 2KAXA 3IQQA 4GPLB 1N65A 2M1UA 2V53A 1LA3A 3CR5X 4YI8A 1WRLA 5B8IB 4A4CA 1NUBA 1W7JB 3NSLA 1YVLA 4PCWA 2JOJA 2LC5A 2MLFC 1L7ZA 5ER4X 3KF9A 4MN0A 1DJYA 1OMRA 2L2EA 4DS7A 1M46A 3BOWB 1K90D 1DJXA 1CM4A 1IJ5A 2BKHB 2FOTA 1ZOTB 3PM8A 4I5KA 2LUXA 2WC8A 1PK0D 4BY4A 1KK7Z 1NCXA 2K7DA 3FIAA 4OR9B 1J7QA 2D8NA 2DOQA 4I5LB 2G2BA 1YX7A 1OE9B 4JPZB 4NQGA 2MBXA 1J55A 3ZWHA 1JWDA 4ORCB 5CSIA 1BU3A 1LINA 2B1UA 2LP2A 1F55A 1SL9A 2KBIA 1AP4A 1CFFA 1UHIA 3PN7B 2IS9A 1JFJA 1TNXA 1FPWA 1UURA 1M45A 1QX5B 1QVIZ 2LLUA 1UP5A 1MQ1A 1EH2A 4DUQA 1BLQA 1A75B 3SIBA 3EVUA 1AJ4A 1NX2A 3BOWA 3FWBA 1BOCA 1LKJA 2O5GA 3M0WA 1KWOC 1JUOA 3NSOA 4E68A 2WNDA 3I5GC 1CFCA 2A4JA 4MBEA 2MA2A 5G08A 3K21A 5JOLA 1UHJA 4C0JA 2HQWA 1LXFC 5AERA 2NLNA 4YI9A 2I18A 4YGEB 1WY9A 3I5FC 2BL0C 2ZN8A 4I5NB 4NDBA 2KOTA 2E6WA 2K2AA 1J7PA 5I8NA 4AQJA 1QX2A 1WLMA 1XFZO 2EC6B 1SL8A 3PLFB 1KFXL 1L2OC 2I94A 2NZ0A 3PSRA 1Q80A 4GUKA 5DKQA 2M97A 3OB1B 2MJWB 5TNCA 1PVAA 1NX0A 1QJTA 3GOFA 2K8MB 2KI4B 2M29A 1BR1B 4HRGA 4OVNF 1WLZA 1B4CA 2E30A 3EK4A 2H61C 2M3WA 1Y1AA 1WRZA 3HCMA 4ORAB 1S5GY 3DVJA 4DRWA 2VRGA 5I2QA 1IKUA 1PRWA 1M39A 4OKHA 1CM1A 2LVVA 4GGNA 3CS1A 3GK1A 4CFQA 1CDMA 1SBJA 2NXQA 1SW8A 1GGZA 2Y1MA 2ZNDA 2JZIA 4WQ3A 1Y6WA 5AEQA 1SYMA 3AKBA 4PHMA 2CXJA 1Y0VH 4OV2A 1WDCB 4ZCVA 1SL7A 2F2PA 1C7WA 4YRUA 2ZFDA 5D69A 1KK8C 5KU1A 1V1GA 1OQPA 3HX4A 1RTP1 2LVKA 4PALA 2I7AA 2PALA 2JRFA 2NCPA 4CIDA 1A29A 1QS7A 2KGRA 1MR8A 2F33A 1LVCD 1XK4C 4FQOA 3LLEA 1C07A 1U5IB 3MSEB 5AFPA 3I5HC 1OZOA 2LAPA 1GGWA 1CDLA 2LMTA 2HQ8A 4UPGA 1IGVA 1JBAA 5HKZA 1K96A 3LK1A 3PATA 1A4PA 1TNPA 3CWGA 1JSAA 1FBVA 3A4UB 4N1GA
chains in the Genus database with same CATH superfamily
3LCPC 4P2YB 4YBHB 1DJIA 1OSAA 3SJSA 1K94A 1JC2A 4NDCA 2JT8A 1CTRA 1DQEA 1XFUO 3E3RA 3LK0A 2SCPA 2SASA 1FI6A 1PULA 3KHEA 1NWDA 1KWOB 1G4YR 1HT9A 2QACA 3DZTA 3TDIA 1IG5A 2LVJA 1Y1XA 2LP3A 1MWNA 2PASA 2WC6A 3I5GB 5AANA 2LHIA 4I5JA 3KEVA 3NGVA 3D78A 3DXLA 1JF2A 3DVEA 1QXPA 1M31A 5FI6A 5HYDA 3CR4X 3OX6A 3BFBA 2COLB 5GQQC 1A03A 3CTNA 2M8UA 3DVMA 5K89A 1U5IA 2BNXA 1SCMB 2PMYA 2ERBA 1MHOA 1AVSA 4HRHA 1PSRA 4M2PA 2AUCA 4GGFC 1DGVA 2MRDA 1CMGA 3BQ3A 5CPVA 1W9ZA 2FCEA 2ZNEA 2BBMA 3AAKA 2BCAA 5D3OA 3TUYC 2LUCA 1FW4A 1AJ5A 3JTDC 4MRXA 1IH0A 1NSHA 4QJ4B 2LLTA 4PE0A 4INXA 3OBVA 1K95A 1Y1UA 2JXCA 2EGDA 1F54A 1CLMA 3RLZA 3NSKA 3VB1A 4MZJA 5EL2A 4PE4A 1DF0A 5HLOA 1YVHA 1CNPA 3QRXA 3CZTX 1ZACA 1YUTA 3FE8A 3SS5A 4ICBA 1ALWA 1SRAA 3PJIA 3TS5C 5IBWA 1IQ5A 3CZ0A 1SSEB 1NX3A 2M7LA 4F0ZB 1TNWA 1SR6C 5HLVA 1B7TZ 3SIAA 1RECA 2L4IA 4CFRA 2GGMA 2KFHA 1KCYA 1OZSA 1XFVO 2WCFA 2K7CA 2KAYA 1ZUZA 2WORA 3OP0A 5FI7A 2JQ6A 2JT3A 1IJ6A 1KQVA 1E8AA 4WQ2A 1KK8B 2PSRA 1G8IA 3DF0B 1PALA 1AUIB 1ZFSA 3D77A 1J7RA 4N5XA 1VRKA 1J1DA 2L2CA 2OTGB 1F4QA 1EJ3A 1S5GZ 2LMVA 4MEWA 3D74A 3B6XA 3OX5A 1NYAA 1H8BA 1SNLA 1A2XA 1TCOB 1KQMB 1SY9A 2JULA 3KPXA 4JQ0D 3JVTC 2ISDA 2ZRTA 2LHLA 1ALVA 2KI6C 3SS4A 4PHNA 2H61A 2M1KB 3UO9A 4QJ5B 3I5HB 3D10A 3ZNIA 2OS8B 3TZ1A 1QWVA 3O6BA 2CTNA 4MZKA 3B88A 1TUJA 1TOPA 1UHNA 3VROA 5I2OA 2BE4A 5I2LA 2JPTA 3BUWB 2LNKA 3DYEA 1S1EA 3WHUB 1ODBA 1CFDA 1OMDA 3BYAA 3S0BA 1S6JA 3CABA 1OOGA 3CYZA 1KFXS 3DVKA 2ZN9A 2HF5A 1QX7A 3NXAA 4DCKA 2PQLA 2Y1NA 1K9KA 1T14A 1NX1A 3PALA 1C7VA 1JF0A 3BUMB 1B9AA 2H8VA 1Z2CB 1RK9A 2K7BA 4XJKB 3DF0A 1MXEA 1B47A 1XFRA 2BKIB 3BUXB 2Y4QA 2LLSA 4MSPA 1TIZA 5CSJA 3TDUA 1EG3A 3O4YA 2BBNA 4CLNA 2Q4UA 2O60A 1XFXO 2KYCA 3N7HA 2P70A 1K2HA 3RM1A 1OOJA 3KO0A 4L9MA 1HQVA 1XK4A 2QEHA 1SKTA 4GNKB 3CLNA 1YRTB 2KYFA 1CLBA 1BJFA 1XO5A 3I5IC 3ICBA 1QIVA 3VGOA 4ZCUA 1N0YA 2BCBA 2EC6C 3R72A 2JTZA 5HKWA 4MVFA 4FTGA 3TUYB 1EL4A 3JTDB 2HETA 1Z4HA 2CCMA 2I2RE 3L47A 5DKRA 3SG4A 3D0YB 2LMUA 1TN4A 2P6BB 1MXLC 1QLKA 2KLDA 3WNXB 4D1EA 1IRJA 3AAJA 1S3PA 4DIRA 2GV5A 3B87A 2LM5A 2WCEA 3VRNA 2KI4C 1BODA 4OCIA 3VRRA 1OOHA 2CBLA 5CSFA 5I94A 2WCHA 1YX8A 1DF0B 1NCYA 1QIWA 2BCXA 2EHBA 4XJKA 4FQTA 5BPJA 2L0PA 3EKHA 4GBAA 2L51A 1DVIA 1N2DA 4HREE 1TNQA 1LS8A 4MRYA 3TS5B 2G9BA 2KFGA 1KSMA 2MHHA 2JNXA 1AHRA 2KAVA 3BUNB 1SR6B 3D73A 1D1OA 3O78A 3BJHA 3SG3A 1DMOA 1FI5A 2K7OA 2YGUA 1BT6A 3I5FB 1K8UA 1WDCC 2BL0B 1YUUA 3OGNA 4USLA 1R6PA 2AMIA 5ER5A 4CPVA 4ETOA 1GQMA 1SCVA 1XA5A 3QMEA 3WXAA 1YUSA 4GGFA 3NSIA 1F4OA 1NP8A 2WCJA 3LL8B 4MZLA 2WCLA 2QPTA 4YGCB 3BUOB 5HL1A 4MLWA 1L2OB 1IWQA 2P71A 2BE6A 2ZKMX 1JFKA 4P5OE 3SG2A 1F71A 1F70A 2F3YA 1QLSA 3D0YA 2HPSA 1YTZC 1EXRA 3DD4A 3CDNA 2WOSA 3GK2A 4C0LA 1MF8B 1TUZA 2KQ6A 3CGAA 1OMVA 1QTXA 3IF7A 5J3XA 1RWYA 2K0JA 3R1VA 4IL1A 4AOMA 3JVTB 2KPHA 2LANA 2Q91A 1MUXA 1F8HA 2CT9A 2KI6D 3D76A 1XFWO 4YGDB 1RFJA 1QASA 1TTXA 1NIWA 1CDPA 1KK7Y 2JT0A 1SK6D 2L50A 2KDHA 3SG5A 1CKKA 1BR4B 1UWOA 3AKAA 1LA0A 5JJGA 2Y5IA 1K93D 5F6TA 2FCDA 4A4BA 1CFPA 1UHHA 4PHJA 1H4BA 4BY5A 3VRPA 1YRUB 2L4HA 2MAZA 4WRIA 1CMFA 2KSPA 4GAOA 5DKNA 2KLEA 1W7IB 3S0EA 1PVBA 2LV7A 3SG7A 1DGUA 1KSOA 1QV1A 4XYNA 3CR2A 1WRKA 1EG4A 2BECA 1B8RA 3NHIA 5KTYA 1S6CA 2KBMA 1XFYO 1OOFA 2F8PA 4ORBB 4JWQA 1M63B 1UUSA 2LE9B 1YURA 1QVIY 4YGAA 1TWOA 4YGBB 2M9GA 2WCMA 3H4SE 2TN4A 3IQOA 5D7FA 3OB2B 2F2OA 3FWCA 4NDDA 3O4XA 2FJUB 2JC2A 4TNCA 3D75A 1QATA 1DTLA 2KGBC 2M0RA 3EVVA 1SCMC 3F45A 1RROA 1FF1A 2F3ZA 4INWA 3VRQA 2JWWA 1NCZA 3A8RA 3I5IB 3S0GA 3C1VA 1B1GA 3OHMB 2K61A 3PN7C 3R1PA 4M2QA 4Q04A 1B7TY 1TRFA 2K2FA 2NCOA 4M2OA 1BF5A 1BG1A 1AK8A 4C0KA 3BXKA 3WHTB 3Q8IA 3R1OA 1UHKA 2KFFA 4R1EA 1TCFA 2M7NA 1DJHA 1KFUL 1OW4A 4AQIA 2PVBA 1OOIX 1A75A 1DT7B 1CB1A 1GJYA 2LVIA 1BMOA 2WCBA 1CLLA 2MLEC 3EVRA 1YR5A 2JNFA 2K60A 3TDZA 1G33A 1R2UA 3L4LA 1IQ3A 1PSBA 2KNEA 2L5XB 1B8LA 1K9UA 2LCPA 4HSZA 4PDZA 2JU0A 4PE1A 2GGZA 2QEBA 2QEVA 1SPYA 1IIOA 2JXLA 1DELA 1RJVA 3EK8A 3B86A 1QV0A 5AXIA 3SG6A 1S36A 2L98A 3SS3A 4PHKA 4N1FA 2OPOA 3NHTA 1NPQA 1XVJA 1K9PA 2PRUA 2RGIA 1DJZA 3EKJA 2M49B 2ZRSA 1KFUS 1XYDA 3FE9A 2R2IA 3GK4X 3DY9A 1DC1A 2KHNA 3EK7A 4QJ3B 1B8CA 1S6IA 2OTGC 3S0FA 1DJWA 4PE7A 1S26D 1CDNA 2AAOA 1J1EA 1KQMC 5PALA 2CNPA 4U8DA 3FS7A 1C3ZA 3O2PA 1X02A 5HKYA 3FE6A 4GFTA 3PFVA 5CSNA 5KSZA 1J7OA 5FYXA 2JTTA 2H2KA 2OS8C 1SMGA 2KQYA 1DJGA 1V1FA 1ZMZA 2KAXA 3IQQA 4GPLB 1N65A 2M1UA 2V53A 1LA3A 2BAPA 3CR5X 1WRLA 4YI8A 4A4CA 1NUBA 5B8IB 1W7JB 1GM0A 3NSLA 1YVLA 4PCWA 2JOJA 1C3YA 3EG5B 2LC5A 2MLFC 1L7ZA 5ER4X 3KF9A 4MN0A 1DJYA 1OMRA 2L2EA 4DS7A 1M46A 3BOWB 1K90D 1DJXA 1CM4A 4F7FA 1IJ5A 2BKHB 2FOTA 1ZOTB 3PM8A 4I5KA 2LUXA 2WC8A 1PK0D 2JPOA 4BY4A 1KK7Z 1NCXA 2K7DA 3FIAA 3L4AA 4OR9B 1J7QA 2D8NA 2DOQA 4I5LB 2G2BA 1YX7A 1OE9B 4JPZB 4NQGA 2MBXA 1J55A 3ZWHA 1JWDA 4ORCB 5CSIA 1BU3A 5FI2A 1LINA 2B1UA 3B7AA 3S0DA 2LP2A 2WCKA 1SL9A 2KBIA 1AP4A 1F55A 1CFFA 1UHIA 3PN7B 2IS9A 1JFJA 1TNXA 2L5YA 1FPWA 1UURA 1M45A 1QX5B 1QVIZ 2LLUA 1UP5A 1MQ1A 1EH2A 4DUQA 1BLQA 1A75B 3SIBA 2QDIA 3EVUA 1AJ4A 1NX2A 3BOWA 3FWBA 3S0AA 1BOCA 1LKJA 2O5GA 3M0WA 1KWOC 1JUOA 3NSOA 4E68A 2WNDA 3RZSA 3I5GC 1CFCA 2A4JA 4MBEA 2MA2A 5G08A 3K21A 5DICA 3V2LA 5JOLA 1UHJA 4C0JA 2HQWA 1LXFC 5AERA 2NLNA 4YI9A 2QEOA 2I18A 4YGEB 2WC5A 1WY9A 3I5FC 2BL0C 2ZN8A 1ORGA 4I5NB 4NDBA 2KOTA 2E6WA 2K2AA 1J7PA 5I8NA 4AQJA 1QX2A 1WLMA 1XFZO 3CZ2A 2EC6B 1SL8A 3PLFB 1KFXL 1L2OC 2I94A 2NZ0A 3PSRA 4JD9A 1Q80A 3IVTA 3PM2A 3UNWA 4GUKA 5DKQA 2M97A 2FJYA 3OB1B 2MJWB 5TNCA 1PVAA 1NX0A 1QJTA 3GOFA 2K8MB 2KI4B 2M29A 1BR1B 4HRGA 4OVNF 1WLZA 2PYQA 1B4CA 2E30A 3EK4A 2H61C 2M3WA 1Y1AA 1WRZA 3HCMA 4ORAB 4IJ7A 3BFAA 1S5GY 3DVJA 4DRWA 1DEKA 2VRGA 5I2QA 1IKUA 1PRWA 1M39A 4OKHA 1CM1A 2LVVA 4KYNA 4GGNA 3CS1A 3GK1A 4CFQA 1CDMA 1SBJA 2GTEA 1SW8A 1GGZA 2NXQA 2Y1MA 2JZIA 2ZNDA 4WQ3A 1Y6WA 5AEQA 1SYMA 3AKBA 3CZ1A 2CXJA 4PHMA 1Y0VH 4OV2A 1WDCB 4JKTA 4ZCVA 1SL7A 2F2PA 1C7WA 4YRUA 2ZFDA 4OZDA 5D69A 1KK8C 5KU1A 1V1GA 1OQPA 3HX4A 3BFHA 1RTP1 2LVKA 4PALA 2I7AA 2PALA 4PT1A 2JRFA 2NCPA 4CIDA 1A29A 1QS7A 2KGRA 1MR8A 2F33A 3K1EA 1LVCD 1XK4C 4FQOA 3LLEA 1C07A 1U5IB 3MSEB 5AFPA 3I5HC 1OZOA 2LAPA 1GGWA 1CDLA 2LMTA 2HQ8A 4UPGA 1IGVA 1P28A 1JBAA 5HKZA 1K96A 3LK1A 3PATA 1A4PA 1TNPA 3CWGA 1JSAA 1FBVA 3A4UB 4N1GA
chains in the Genus database with same CATH topology
3LCPC 4P2YB 4YBHB 1DJIA 1OSAA 3SJSA 1K94A 1JC2A 4NDCA 2JT8A 1CTRA 1XFUO 3E3RA 3LK0A 2SCPA 2SASA 1FI6A 1PULA 3KHEA 1NWDA 1KWOB 1G4YR 1HT9A 2QACA 3TDIA 1IG5A 2LVJA 1Y1XA 2LP3A 1MWNA 2PASA 3I5GB 5AANA 2LHIA 4I5JA 3KEVA 1JF2A 3DVEA 1QXPA 1M31A 5HYDA 3CR4X 3OX6A 2COLB 5GQQC 1A03A 3CTNA 2M8UA 3DVMA 5K89A 1U5IA 2PMYA 1SCMB 1MHOA 1AVSA 4HRHA 1PSRA 4M2PA 2AUCA 4GGFC 1DGVA 2MRDA 1CMGA 3BQ3A 5CPVA 2FCEA 2ZNEA 2BBMA 3AAKA 2BCAA 3TUYC 2LUCA 1FW4A 1AJ5A 3JTDC 4MRXA 1IH0A 1NSHA 4QJ4B 2LLTA 4PE0A 1K95A 1Y1UA 2JXCA 2EGDA 1F54A 1CLMA 3RLZA 3NSKA 4MZJA 4PE4A 1DF0A 5HLOA 1YVHA 1CNPA 3QRXA 3CZTX 1ZACA 1YUTA 4ICBA 1ALWA 1SRAA 3TS5C 5IBWA 1IQ5A 1NX3A 2M7LA 4F0ZB 1TNWA 1SR6C 5HLVA 1B7TZ 3SIAA 1RECA 2L4IA 4CFRA 2GGMA 2KFHA 1KCYA 1OZSA 1XFVO 2WCFA 2K7CA 2KAYA 1ZUZA 2WORA 3OP0A 2JQ6A 2JT3A 1IJ6A 1KQVA 1E8AA 4WQ2A 1KK8B 2PSRA 1G8IA 3DF0B 1PALA 1AUIB 1ZFSA 4N5XA 1J7RA 1VRKA 1J1DA 2OTGB 1F4QA 1EJ3A 1S5GZ 2LMVA 4MEWA 3OX5A 1NYAA 1H8BA 1SNLA 1A2XA 1TCOB 1KQMB 1SY9A 2JULA 3KPXA 4JQ0D 3JVTC 2ISDA 2ZRTA 2LHLA 1ALVA 2KI6C 4PHNA 2H61A 2M1KB 4QJ5B 3I5HB 3D10A 3ZNIA 2OS8B 3TZ1A 3O6BA 2CTNA 4MZKA 1TOPA 1UHNA 3VROA 5I2OA 2BE4A 5I2LA 2JPTA 3BUWB 2LNKA 1S1EA 3WHUB 1ODBA 1CFDA 1OMDA 3BYAA 1S6JA 1KFXS 3DVKA 2ZN9A 2HF5A 1QX7A 3NXAA 4DCKA 2Y1NA 1K9KA 3PALA 1NX1A 1C7VA 1JF0A 3BUMB 1B9AA 4XJKB 1RK9A 2K7BA 3DF0A 1MXEA 1B47A 2BKIB 3BUXB 2Y4QA 2LLSA 4MSPA 1TIZA 5CSJA 3TDUA 1EG3A 3O4YA 2BBNA 4CLNA 2Q4UA 2O60A 1XFXO 2KYCA 1K2HA 3RM1A 1OOJA 3KO0A 4L9MA 1HQVA 1XK4A 1SKTA 4GNKB 3CLNA 1YRTB 2KYFA 1CLBA 1BJFA 1XO5A 3I5IC 3ICBA 1QIVA 3VGOA 4ZCUA 1N0YA 2BCBA 2EC6C 2JTZA 5HKWA 4MVFA 4FTGA 3TUYB 1EL4A 3JTDB 2HETA 2CCMA 2I2RE 5DKRA 3SG4A 3D0YB 2LMUA 1TN4A 2P6BB 1MXLC 1QLKA 3WNXB 4D1EA 1IRJA 3AAJA 1S3PA 4DIRA 2GV5A 3VRNA 2LM5A 2WCEA 1BODA 2KI4C 4OCIA 3VRRA 2CBLA 5CSFA 1YX8A 1DF0B 1NCYA 1QIWA 2BCXA 2EHBA 4XJKA 5BPJA 2L0PA 3EKHA 4GBAA 2L51A 1DVIA 1N2DA 4HREE 1TNQA 4MRYA 3TS5B 2G9BA 2KFGA 1KSMA 2MHHA 2JNXA 1AHRA 2KAVA 3BUNB 1SR6B 1D1OA 3O78A 1DMOA 3SG3A 1FI5A 2K7OA 1BT6A 3I5FB 1K8UA 1WDCC 2BL0B 1YUUA 4USLA 5ER5A 1R6PA 2AMIA 4CPVA 4ETOA 1GQMA 1SCVA 1XA5A 3WXAA 1YUSA 4GGFA 3NSIA 1F4OA 1NP8A 3LL8B 4MZLA 2QPTA 4YGCB 3BUOB 4MLWA 1L2OB 1IWQA 2BE6A 2ZKMX 1JFKA 4P5OE 3SG2A 1F71A 1F70A 2F3YA 1QLSA 3D0YA 2HPSA 1YTZC 1EXRA 3DD4A 3GK2A 2WOSA 4C0LA 1MF8B 2KQ6A 3CGAA 1OMVA 1QTXA 3IF7A 5J3XA 1RWYA 2K0JA 4IL1A 4AOMA 3JVTB 2LANA 2Q91A 1MUXA 1F8HA 2CT9A 2KI6D 1XFWO 4YGDB 1RFJA 1QASA 1TTXA 1NIWA 1CDPA 1KK7Y 2JT0A 1SK6D 2L50A 2KDHA 3SG5A 1CKKA 1BR4B 1UWOA 3AKAA 1LA0A 5JJGA 2Y5IA 1K93D 5F6TA 2FCDA 4A4BA 1CFPA 1UHHA 4PHJA 1H4BA 4BY5A 3VRPA 1YRUB 2L4HA 2MAZA 4WRIA 1CMFA 2KSPA 4GAOA 5DKNA 3SG7A 1W7IB 1PVBA 2LV7A 1DGUA 1KSOA 1QV1A 4XYNA 3CR2A 1EG4A 1WRKA 2BECA 1B8RA 5KTYA 1S6CA 2KBMA 1XFYO 2F8PA 4ORBB 4JWQA 1M63B 1UUSA 2LE9B 1YURA 1QVIY 4YGAA 4YGBB 2M9GA 3H4SE 2TN4A 3IQOA 5D7FA 3OB2B 2F2OA 3FWCA 4NDDA 2FJUB 2JC2A 4TNCA 1QATA 1DTLA 2KGBC 2M0RA 3EVVA 1SCMC 3F45A 1RROA 1FF1A 2F3ZA 3VRQA 2JWWA 1NCZA 3A8RA 3I5IB 3C1VA 1B1GA 3OHMB 2K61A 3PN7C 4Q04A 4M2QA 1BG1A 1B7TY 1TRFA 2K2FA 2NCOA 4M2OA 1BF5A 1AK8A 4C0KA 3BXKA 3WHTB 1UHKA 2KFFA 4R1EA 1TCFA 2M7NA 1DJHA 1KFUL 4AQIA 2PVBA 1A75A 1DT7B 1CB1A 1GJYA 2LVIA 1BMOA 2WCBA 1CLLA 2MLEC 3EVRA 1YR5A 2JNFA 3TDZA 1G33A 1R2UA 1IQ3A 1PSBA 2KNEA 2L5XB 1B8LA 1K9UA 2LCPA 4HSZA 4PDZA 2JU0A 4PE1A 2GGZA 1SPYA 2JXLA 1RJVA 3EK8A 1QV0A 5AXIA 3SG6A 1S36A 2L98A 4PHKA 4N1FA 2OPOA 1NPQA 1XVJA 1K9PA 2PRUA 2RGIA 1DJZA 3EKJA 2M49B 2ZRSA 1KFUS 1XYDA 3GK4X 2R2IA 2KHNA 3EK7A 4QJ3B 1B8CA 1S6IA 2OTGC 1DJWA 4PE7A 1S26D 1CDNA 2AAOA 1J1EA 1KQMC 5PALA 2CNPA 4U8DA 3FS7A 3O2PA 1X02A 5HKYA 4GFTA 3PFVA 5CSNA 5KSZA 1J7OA 5FYXA 2JTTA 2H2KA 2OS8C 1SMGA 2KQYA 1DJGA 1V1FA 1ZMZA 2KAXA 3IQQA 4GPLB 1N65A 2M1UA 2V53A 1LA3A 3CR5X 4YI8A 1WRLA 5B8IB 4A4CA 1NUBA 1W7JB 3NSLA 1YVLA 4PCWA 2JOJA 2LC5A 2MLFC 1L7ZA 5ER4X 3KF9A 4MN0A 1DJYA 1OMRA 2L2EA 4DS7A 1M46A 3BOWB 1K90D 1DJXA 1CM4A 1IJ5A 2BKHB 2FOTA 1ZOTB 3PM8A 4I5KA 2LUXA 2WC8A 1PK0D 4BY4A 1KK7Z 1NCXA 2K7DA 3FIAA 4OR9B 1J7QA 2D8NA 2DOQA 4I5LB 2G2BA 1YX7A 1OE9B 4JPZB 4NQGA 2MBXA 1J55A 3ZWHA 1JWDA 4ORCB 5CSIA 1BU3A 1LINA 2B1UA 2LP2A 1F55A 1SL9A 2KBIA 1AP4A 1CFFA 1UHIA 3PN7B 2IS9A 1JFJA 1TNXA 1FPWA 1UURA 1M45A 1QX5B 1QVIZ 2LLUA 1UP5A 1MQ1A 1EH2A 4DUQA 1BLQA 1A75B 3SIBA 3EVUA 1AJ4A 1NX2A 3BOWA 3FWBA 1BOCA 1LKJA 2O5GA 3M0WA 1KWOC 1JUOA 3NSOA 4E68A 2WNDA 3I5GC 1CFCA 2A4JA 4MBEA 2MA2A 5G08A 3K21A 5JOLA 1UHJA 4C0JA 2HQWA 1LXFC 5AERA 2NLNA 4YI9A 2I18A 4YGEB 1WY9A 3I5FC 2BL0C 2ZN8A 4I5NB 4NDBA 2KOTA 2E6WA 2K2AA 1J7PA 5I8NA 4AQJA 1QX2A 1WLMA 1XFZO 2EC6B 1SL8A 3PLFB 1KFXL 1L2OC 2I94A 2NZ0A 3PSRA 1Q80A 4GUKA 5DKQA 2M97A 3OB1B 2MJWB 5TNCA 1PVAA 1NX0A 1QJTA 3GOFA 2K8MB 2KI4B 2M29A 1BR1B 4HRGA 4OVNF 1WLZA 1B4CA 2E30A 3EK4A 2H61C 2M3WA 1Y1AA 1WRZA 3HCMA 4ORAB 1S5GY 3DVJA 4DRWA 2VRGA 5I2QA 1IKUA 1PRWA 1M39A 4OKHA 1CM1A 2LVVA 4GGNA 3CS1A 3GK1A 4CFQA 1CDMA 1SBJA 2NXQA 1SW8A 1GGZA 2Y1MA 2ZNDA 2JZIA 4WQ3A 1Y6WA 5AEQA 1SYMA 3AKBA 4PHMA 2CXJA 1Y0VH 4OV2A 1WDCB 4ZCVA 1SL7A 2F2PA 1C7WA 4YRUA 2ZFDA 5D69A 1KK8C 5KU1A 1V1GA 1OQPA 3HX4A 1RTP1 2LVKA 4PALA 2I7AA 2PALA 2JRFA 2NCPA 4CIDA 1A29A 1QS7A 2KGRA 1MR8A 2F33A 1LVCD 1XK4C 4FQOA 3LLEA 1C07A 1U5IB 3MSEB 5AFPA 3I5HC 1OZOA 2LAPA 1GGWA 1CDLA 2LMTA 2HQ8A 4UPGA 1IGVA 1JBAA 5HKZA 1K96A 3LK1A 3PATA 1A4PA 1TNPA 3CWGA 1JSAA 1FBVA 3A4UB 4N1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCP C;  4P2Y B;  4YBH B;  1DJI A;  1OSA A;  3SJS A;  1K94 A;  1JC2 A;  4NDC A;  2JT8 A;  1CTR A;  1XFU O;  3E3R A;  3LK0 A;  2SCP A;  2SAS A;  1FI6 A;  1PUL A;  3KHE A;  1NWD A;  1KWO B;  1G4Y R;  1HT9 A;  2QAC A;  3TDI A;  1IG5 A;  2LVJ A;  1Y1X A;  2LP3 A;  1MWN A;  2PAS A;  3I5G B;  5AAN A;  2LHI A;  4I5J A;  3KEV A;  1JF2 A;  3DVE A;  1QXP A;  1M31 A;  5HYD A;  3CR4 X;  3OX6 A;  2COL B;  5GQQ C;  1A03 A;  3CTN A;  2M8U A;  3DVM A;  5K89 A;  1U5I A;  2PMY A;  1SCM B;  1MHO A;  1AVS A;  4HRH A;  1PSR A;  4M2P A;  2AUC A;  4GGF C;  1DGV A;  2MRD A;  1CMG A;  3BQ3 A;  5CPV A;  2FCE A;  2ZNE A;  2BBM A;  3AAK A;  2BCA A;  3TUY C;  2LUC A;  1FW4 A;  1AJ5 A;  3JTD C;  4MRX A;  1IH0 A;  1NSH A;  4QJ4 B;  2LLT A;  4PE0 A;  1K95 A;  1Y1U A;  2JXC A;  2EGD A;  1F54 A;  1CLM A;  3RLZ A;  3NSK A;  4MZJ A;  4PE4 A;  1DF0 A;  5HLO A;  1YVH A;  1CNP A;  3QRX A;  3CZT X;  1ZAC A;  1YUT A;  4ICB A;  1ALW A;  1SRA A;  3TS5 C;  5IBW A;  1IQ5 A;  1NX3 A;  2M7L A;  4F0Z B;  1TNW A;  1SR6 C;  5HLV A;  1B7T Z;  3SIA A;  1REC A;  2L4I A;  4CFR A;  2GGM A;  2KFH A;  1KCY A;  1OZS A;  1XFV O;  2WCF A;  2K7C A;  2KAY A;  1ZUZ A;  2WOR A;  3OP0 A;  2JQ6 A;  2JT3 A;  1IJ6 A;  1KQV A;  1E8A A;  4WQ2 A;  1KK8 B;  2PSR A;  1G8I A;  3DF0 B;  1PAL A;  1AUI B;  1ZFS A;  4N5X A;  1J7R A;  1VRK A;  1J1D A;  2OTG B;  1F4Q A;  1EJ3 A;  1S5G Z;  2LMV A;  4MEW A;  3OX5 A;  1NYA A;  1H8B A;  1SNL A;  1A2X A;  1TCO B;  1KQM B;  1SY9 A;  2JUL A;  3KPX A;  4JQ0 D;  3JVT C;  2ISD A;  2ZRT A;  2LHL A;  1ALV A;  2KI6 C;  4PHN A;  2H61 A;  2M1K B;  4QJ5 B;  3I5H B;  3D10 A;  3ZNI A;  2OS8 B;  3TZ1 A;  3O6B A;  2CTN A;  4MZK A;  1TOP A;  1UHN A;  3VRO A;  5I2O A;  2BE4 A;  5I2L A;  2JPT A;  3BUW B;  2LNK A;  1S1E A;  3WHU B;  1ODB A;  1CFD A;  1OMD A;  3BYA A;  1S6J A;  1KFX S;  3DVK A;  2ZN9 A;  2HF5 A;  1QX7 A;  3NXA A;  4DCK A;  2Y1N A;  1K9K A;  3PAL A;  1NX1 A;  1C7V A;  1JF0 A;  3BUM B;  1B9A A;  4XJK B;  1RK9 A;  2K7B A;  3DF0 A;  1MXE A;  1B47 A;  2BKI B;  3BUX B;  2Y4Q A;  2LLS A;  4MSP A;  1TIZ A;  5CSJ A;  3TDU A;  1EG3 A;  3O4Y A;  2BBN A;  4CLN A;  2Q4U A;  2O60 A;  1XFX O;  2KYC A;  1K2H A;  3RM1 A;  1OOJ A;  3KO0 A;  4L9M A;  1HQV A;  1XK4 A;  1SKT A;  4GNK B;  3CLN A;  1YRT B;  2KYF A;  1CLB A;  1BJF A;  1XO5 A;  3I5I C;  3ICB A;  1QIV A;  3VGO A;  4ZCU A;  1N0Y A;  2BCB A;  2EC6 C;  2JTZ A;  5HKW A;  4MVF A;  4FTG A;  3TUY B;  1EL4 A;  3JTD B;  2HET A;  2CCM A;  2I2R E;  5DKR A;  3SG4 A;  3D0Y B;  2LMU A;  1TN4 A;  2P6B B;  1MXL C;  1QLK A;  3WNX B;  4D1E A;  1IRJ A;  3AAJ A;  1S3P A;  4DIR A;  2GV5 A;  3VRN A;  2LM5 A;  2WCE A;  1BOD A;  2KI4 C;  4OCI A;  3VRR A;  2CBL A;  5CSF A;  1YX8 A;  1DF0 B;  1NCY A;  1QIW A;  2BCX A;  2EHB A;  4XJK A;  5BPJ A;  2L0P A;  3EKH A;  4GBA A;  2L51 A;  1DVI A;  1N2D A;  4HRE E;  1TNQ A;  4MRY A;  3TS5 B;  2G9B A;  2KFG A;  1KSM A;  2MHH A;  2JNX A;  1AHR A;  2KAV A;  3BUN B;  1SR6 B;  1D1O A;  3O78 A;  1DMO A;  3SG3 A;  1FI5 A;  2K7O A;  1BT6 A;  3I5F B;  1K8U A;  1WDC C;  2BL0 B;  1YUU A;  4USL A;  5ER5 A;  1R6P A;  2AMI A;  4CPV A;  4ETO A;  1GQM A;  1SCV A;  1XA5 A;  3WXA A;  1YUS A;  4GGF A;  3NSI A;  1F4O A;  1NP8 A;  3LL8 B;  4MZL A;  2QPT A;  4YGC B;  3BUO B;  4MLW A;  1L2O B;  1IWQ A;  2BE6 A;  2ZKM X;  1JFK A;  4P5O E;  3SG2 A;  1F71 A;  1F70 A;  2F3Y A;  1QLS A;  3D0Y A;  2HPS A;  1YTZ C;  1EXR A;  3DD4 A;  3GK2 A;  2WOS A;  4C0L A;  1MF8 B;  2KQ6 A;  3CGA A;  1OMV A;  1QTX A;  3IF7 A;  5J3X A;  1RWY A;  2K0J A;  4IL1 A;  4AOM A;  3JVT B;  2LAN A;  2Q91 A;  1MUX A;  1F8H A;  2CT9 A;  2KI6 D;  1XFW O;  4YGD B;  1RFJ A;  1QAS A;  1TTX A;  1NIW A;  1CDP A;  1KK7 Y;  2JT0 A;  1SK6 D;  2L50 A;  2KDH A;  3SG5 A;  1CKK A;  1BR4 B;  1UWO A;  3AKA A;  1LA0 A;  5JJG A;  2Y5I A;  1K93 D;  5F6T A;  2FCD A;  4A4B A;  1CFP A;  1UHH A;  4PHJ A;  1H4B A;  4BY5 A;  3VRP A;  1YRU B;  2L4H A;  2MAZ A;  4WRI A;  1CMF A;  2KSP A;  4GAO A;  5DKN A;  3SG7 A;  1W7I B;  1PVB A;  2LV7 A;  1DGU A;  1KSO A;  1QV1 A;  4XYN A;  3CR2 A;  1EG4 A;  1WRK A;  2BEC A;  1B8R A;  5KTY A;  1S6C A;  2KBM A;  1XFY O;  2F8P A;  4ORB B;  4JWQ A;  1M63 B;  1UUS A;  2LE9 B;  1YUR A;  1QVI Y;  4YGA A;  4YGB B;  2M9G A;  3H4S E;  2TN4 A;  3IQO A;  5D7F A;  3OB2 B;  2F2O A;  3FWC A;  4NDD A;  2FJU B;  2JC2 A;  4TNC A;  1QAT A;  1DTL A;  2KGB C;  2M0R A;  3EVV A;  1SCM C;  3F45 A;  1RRO A;  1FF1 A;  2F3Z A;  3VRQ A;  2JWW A;  1NCZ A;  3A8R A;  3I5I B;  3C1V A;  1B1G A;  3OHM B;  2K61 A;  3PN7 C;  4Q04 A;  4M2Q A;  1BG1 A;  1B7T Y;  1TRF A;  2K2F A;  2NCO A;  4M2O A;  1BF5 A;  1AK8 A;  4C0K A;  3BXK A;  3WHT B;  1UHK A;  2KFF A;  4R1E A;  1TCF A;  2M7N A;  1DJH A;  1KFU L;  4AQI A;  2PVB A;  1A75 A;  1DT7 B;  1CB1 A;  1GJY A;  2LVI A;  1BMO A;  2WCB A;  1CLL A;  2MLE C;  3EVR A;  1YR5 A;  2JNF A;  3TDZ A;  1G33 A;  1R2U A;  1IQ3 A;  1PSB A;  2KNE A;  2L5X B;  1B8L A;  1K9U A;  2LCP A;  4HSZ A;  4PDZ A;  2JU0 A;  4PE1 A;  2GGZ A;  1SPY A;  2JXL A;  1RJV A;  3EK8 A;  1QV0 A;  5AXI A;  3SG6 A;  1S36 A;  2L98 A;  4PHK A;  4N1F A;  2OPO A;  1NPQ A;  1XVJ A;  1K9P A;  2PRU A;  2RGI A;  1DJZ A;  3EKJ A;  2M49 B;  2ZRS A;  1KFU S;  1XYD A;  3GK4 X;  2R2I A;  2KHN A;  3EK7 A;  4QJ3 B;  1B8C A;  1S6I A;  2OTG C;  1DJW A;  4PE7 A;  1S26 D;  1CDN A;  2AAO A;  1J1E A;  1KQM C;  5PAL A;  2CNP A;  4U8D A;  3FS7 A;  3O2P A;  1X02 A;  5HKY A;  4GFT A;  3PFV A;  5CSN A;  5KSZ A;  1J7O A;  5FYX A;  2JTT A;  2H2K A;  2OS8 C;  1SMG A;  2KQY A;  1DJG A;  1V1F A;  1ZMZ A;  2KAX A;  3IQQ A;  4GPL B;  1N65 A;  2M1U A;  2V53 A;  1LA3 A;  3CR5 X;  4YI8 A;  1WRL A;  5B8I B;  4A4C A;  1NUB A;  1W7J B;  3NSL A;  1YVL A;  4PCW A;  2JOJ A;  2LC5 A;  2MLF C;  1L7Z A;  5ER4 X;  3KF9 A;  4MN0 A;  1DJY A;  1OMR A;  2L2E A;  4DS7 A;  1M46 A;  3BOW B;  1K90 D;  1DJX A;  1CM4 A;  1IJ5 A;  2BKH B;  2FOT A;  1ZOT B;  3PM8 A;  4I5K A;  2LUX A;  2WC8 A;  1PK0 D;  4BY4 A;  1KK7 Z;  1NCX A;  2K7D A;  3FIA A;  4OR9 B;  1J7Q A;  2D8N A;  2DOQ A;  4I5L B;  2G2B A;  1YX7 A;  1OE9 B;  4JPZ B;  4NQG A;  2MBX A;  1J55 A;  3ZWH A;  1JWD A;  4ORC B;  5CSI A;  1BU3 A;  1LIN A;  2B1U A;  2LP2 A;  1F55 A;  1SL9 A;  2KBI A;  1AP4 A;  1CFF A;  1UHI A;  3PN7 B;  2IS9 A;  1JFJ A;  1TNX A;  1FPW A;  1UUR A;  1M45 A;  1QX5 B;  1QVI Z;  2LLU A;  1UP5 A;  1MQ1 A;  1EH2 A;  4DUQ A;  1BLQ A;  1A75 B;  3SIB A;  3EVU A;  1AJ4 A;  1NX2 A;  3BOW A;  3FWB A;  1BOC A;  1LKJ A;  2O5G A;  3M0W A;  1KWO C;  1JUO A;  3NSO A;  4E68 A;  2WND A;  3I5G C;  1CFC A;  2A4J A;  4MBE A;  2MA2 A;  5G08 A;  3K21 A;  5JOL A;  1UHJ A;  4C0J A;  2HQW A;  1LXF C;  5AER A;  2NLN A;  4YI9 A;  2I18 A;  4YGE B;  1WY9 A;  3I5F C;  2BL0 C;  2ZN8 A;  4I5N B;  4NDB A;  2KOT A;  2E6W A;  2K2A A;  1J7P A;  5I8N A;  4AQJ A;  1QX2 A;  1WLM A;  1XFZ O;  2EC6 B;  1SL8 A;  3PLF B;  1KFX L;  1L2O C;  2I94 A;  2NZ0 A;  3PSR A;  1Q80 A;  4GUK A;  5DKQ A;  2M97 A;  3OB1 B;  2MJW B;  5TNC A;  1PVA A;  1NX0 A;  1QJT A;  3GOF A;  2K8M B;  2KI4 B;  2M29 A;  1BR1 B;  4HRG A;  4OVN F;  1WLZ A;  1B4C A;  2E30 A;  3EK4 A;  2H61 C;  2M3W A;  1Y1A A;  1WRZ A;  3HCM A;  4ORA B;  1S5G Y;  3DVJ A;  4DRW A;  2VRG A;  5I2Q A;  1IKU A;  1PRW A;  1M39 A;  4OKH A;  1CM1 A;  2LVV A;  4GGN A;  3CS1 A;  3GK1 A;  4CFQ A;  1CDM A;  1SBJ A;  2NXQ A;  1SW8 A;  1GGZ A;  2Y1M A;  2ZND A;  2JZI A;  4WQ3 A;  1Y6W A;  5AEQ A;  1SYM A;  3AKB A;  4PHM A;  2CXJ A;  1Y0V H;  4OV2 A;  1WDC B;  4ZCV A;  1SL7 A;  2F2P A;  1C7W A;  4YRU A;  2ZFD A;  5D69 A;  1KK8 C;  5KU1 A;  1V1G A;  1OQP A;  3HX4 A;  1RTP 1;  2LVK A;  4PAL A;  2I7A A;  2PAL A;  2JRF A;  2NCP A;  4CID A;  1A29 A;  1QS7 A;  2KGR A;  1MR8 A;  2F33 A;  1LVC D;  1XK4 C;  4FQO A;  3LLE A;  1C07 A;  1U5I B;  3MSE B;  5AFP A;  3I5H C;  1OZO A;  2LAP A;  1GGW A;  1CDL A;  2LMT A;  2HQ8 A;  4UPG A;  1IGV A;  1JBA A;  5HKZ A;  1K96 A;  3LK1 A;  3PAT A;  1A4P A;  1TNP A;  3CWG A;  1JSA A;  1FBV A;  3A4U B;  4N1G A; 
#chains in the Genus database with same CATH topology
 3LCP C;  4P2Y B;  4YBH B;  1DJI A;  1OSA A;  3SJS A;  1K94 A;  1JC2 A;  4NDC A;  2JT8 A;  1CTR A;  1DQE A;  1XFU O;  3E3R A;  3LK0 A;  2SCP A;  2SAS A;  1FI6 A;  1PUL A;  3KHE A;  1NWD A;  1KWO B;  1G4Y R;  1HT9 A;  2QAC A;  3DZT A;  3TDI A;  1IG5 A;  2LVJ A;  1Y1X A;  2LP3 A;  1MWN A;  2PAS A;  2WC6 A;  3I5G B;  5AAN A;  2LHI A;  4I5J A;  3KEV A;  3NGV A;  3D78 A;  3DXL A;  1JF2 A;  3DVE A;  1QXP A;  1M31 A;  5FI6 A;  5HYD A;  3CR4 X;  3OX6 A;  3BFB A;  2COL B;  5GQQ C;  1A03 A;  3CTN A;  2M8U A;  3DVM A;  5K89 A;  1U5I A;  2BNX A;  1SCM B;  2PMY A;  2ERB A;  1MHO A;  1AVS A;  4HRH A;  1PSR A;  4M2P A;  2AUC A;  4GGF C;  1DGV A;  2MRD A;  1CMG A;  3BQ3 A;  5CPV A;  1W9Z A;  2FCE A;  2ZNE A;  2BBM A;  3AAK A;  2BCA A;  5D3O A;  3TUY C;  2LUC A;  1FW4 A;  1AJ5 A;  3JTD C;  4MRX A;  1IH0 A;  1NSH A;  4QJ4 B;  2LLT A;  4PE0 A;  4INX A;  3OBV A;  1K95 A;  1Y1U A;  2JXC A;  2EGD A;  1F54 A;  1CLM A;  3RLZ A;  3NSK A;  3VB1 A;  4MZJ A;  5EL2 A;  4PE4 A;  1DF0 A;  5HLO A;  1YVH A;  1CNP A;  3QRX A;  3CZT X;  1ZAC A;  1YUT A;  3FE8 A;  3SS5 A;  4ICB A;  1ALW A;  1SRA A;  3PJI A;  3TS5 C;  5IBW A;  1IQ5 A;  3CZ0 A;  1SSE B;  1NX3 A;  2M7L A;  4F0Z B;  1TNW A;  1SR6 C;  5HLV A;  1B7T Z;  3SIA A;  1REC A;  2L4I A;  4CFR A;  2GGM A;  2KFH A;  1KCY A;  1OZS A;  1XFV O;  2WCF A;  2K7C A;  2KAY A;  1ZUZ A;  2WOR A;  3OP0 A;  5FI7 A;  2JQ6 A;  2JT3 A;  1IJ6 A;  1KQV A;  1E8A A;  4WQ2 A;  1KK8 B;  2PSR A;  1G8I A;  3DF0 B;  1PAL A;  1AUI B;  1ZFS A;  3D77 A;  1J7R A;  4N5X A;  1VRK A;  1J1D A;  2L2C A;  2OTG B;  1F4Q A;  1EJ3 A;  1S5G Z;  2LMV A;  4MEW A;  3D74 A;  3B6X A;  3OX5 A;  1NYA A;  1H8B A;  1SNL A;  1A2X A;  1TCO B;  1KQM B;  1SY9 A;  2JUL A;  3KPX A;  4JQ0 D;  3JVT C;  2ISD A;  2ZRT A;  2LHL A;  1ALV A;  2KI6 C;  3SS4 A;  4PHN A;  2H61 A;  2M1K B;  3UO9 A;  4QJ5 B;  3I5H B;  3D10 A;  3ZNI A;  2OS8 B;  3TZ1 A;  1QWV A;  3O6B A;  2CTN A;  4MZK A;  3B88 A;  1TUJ A;  1TOP A;  1UHN A;  3VRO A;  5I2O A;  2BE4 A;  5I2L A;  2JPT A;  3BUW B;  2LNK A;  3DYE A;  1S1E A;  3WHU B;  1ODB A;  1CFD A;  1OMD A;  3BYA A;  3S0B A;  1S6J A;  3CAB A;  1OOG A;  3CYZ A;  1KFX S;  3DVK A;  2ZN9 A;  2HF5 A;  1QX7 A;  3NXA A;  4DCK A;  2PQL A;  2Y1N A;  1K9K A;  1T14 A;  1NX1 A;  3PAL A;  1C7V A;  1JF0 A;  3BUM B;  1B9A A;  2H8V A;  1Z2C B;  1RK9 A;  2K7B A;  4XJK B;  3DF0 A;  1MXE A;  1B47 A;  1XFR A;  2BKI B;  3BUX B;  2Y4Q A;  2LLS A;  4MSP A;  1TIZ A;  5CSJ A;  3TDU A;  1EG3 A;  3O4Y A;  2BBN A;  4CLN A;  2Q4U A;  2O60 A;  1XFX O;  2KYC A;  3N7H A;  2P70 A;  1K2H A;  3RM1 A;  1OOJ A;  3KO0 A;  4L9M A;  1HQV A;  1XK4 A;  2QEH A;  1SKT A;  4GNK B;  3CLN A;  1YRT B;  2KYF A;  1CLB A;  1BJF A;  1XO5 A;  3I5I C;  3ICB A;  1QIV A;  3VGO A;  4ZCU A;  1N0Y A;  2BCB A;  2EC6 C;  3R72 A;  2JTZ A;  5HKW A;  4MVF A;  4FTG A;  3TUY B;  1EL4 A;  3JTD B;  2HET A;  1Z4H A;  2CCM A;  2I2R E;  3L47 A;  5DKR A;  3SG4 A;  3D0Y B;  2LMU A;  1TN4 A;  2P6B B;  1MXL C;  1QLK A;  2KLD A;  3WNX B;  4D1E A;  1IRJ A;  3AAJ A;  1S3P A;  4DIR A;  2GV5 A;  3B87 A;  2LM5 A;  2WCE A;  3VRN A;  2KI4 C;  1BOD A;  4OCI A;  3VRR A;  1OOH A;  2CBL A;  5CSF A;  5I94 A;  2WCH A;  1YX8 A;  1DF0 B;  1NCY A;  1QIW A;  2BCX A;  2EHB A;  4XJK A;  4FQT A;  5BPJ A;  2L0P A;  3EKH A;  4GBA A;  2L51 A;  1DVI A;  1N2D A;  4HRE E;  1TNQ A;  1LS8 A;  4MRY A;  3TS5 B;  2G9B A;  2KFG A;  1KSM A;  2MHH A;  2JNX A;  1AHR A;  2KAV A;  3BUN B;  1SR6 B;  3D73 A;  1D1O A;  3O78 A;  3BJH A;  3SG3 A;  1DMO A;  1FI5 A;  2K7O A;  2YGU A;  1BT6 A;  3I5F B;  1K8U A;  1WDC C;  2BL0 B;  1YUU A;  3OGN A;  4USL A;  1R6P A;  2AMI A;  5ER5 A;  4CPV A;  4ETO A;  1GQM A;  1SCV A;  1XA5 A;  3QME A;  3WXA A;  1YUS A;  4GGF A;  3NSI A;  1F4O A;  1NP8 A;  2WCJ A;  3LL8 B;  4MZL A;  2WCL A;  2QPT A;  4YGC B;  3BUO B;  5HL1 A;  4MLW A;  1L2O B;  1IWQ A;  2P71 A;  2BE6 A;  2ZKM X;  1JFK A;  4P5O E;  3SG2 A;  1F71 A;  1F70 A;  2F3Y A;  1QLS A;  3D0Y A;  2HPS A;  1YTZ C;  1EXR A;  3DD4 A;  3CDN A;  2WOS A;  3GK2 A;  4C0L A;  1MF8 B;  1TUZ A;  2KQ6 A;  3CGA A;  1OMV A;  1QTX A;  3IF7 A;  5J3X A;  1RWY A;  2K0J A;  3R1V A;  4IL1 A;  4AOM A;  3JVT B;  2KPH A;  2LAN A;  2Q91 A;  1MUX A;  1F8H A;  2CT9 A;  2KI6 D;  3D76 A;  1XFW O;  4YGD B;  1RFJ A;  1QAS A;  1TTX A;  1NIW A;  1CDP A;  1KK7 Y;  2JT0 A;  1SK6 D;  2L50 A;  2KDH A;  3SG5 A;  1CKK A;  1BR4 B;  1UWO A;  3AKA A;  1LA0 A;  5JJG A;  2Y5I A;  1K93 D;  5F6T A;  2FCD A;  4A4B A;  1CFP A;  1UHH A;  4PHJ A;  1H4B A;  4BY5 A;  3VRP A;  1YRU B;  2L4H A;  2MAZ A;  4WRI A;  1CMF A;  2KSP A;  4GAO A;  5DKN A;  2KLE A;  1W7I B;  3S0E A;  1PVB A;  2LV7 A;  3SG7 A;  1DGU A;  1KSO A;  1QV1 A;  4XYN A;  3CR2 A;  1WRK A;  1EG4 A;  2BEC A;  1B8R A;  3NHI A;  5KTY A;  1S6C A;  2KBM A;  1XFY O;  1OOF A;  2F8P A;  4ORB B;  4JWQ A;  1M63 B;  1UUS A;  2LE9 B;  1YUR A;  1QVI Y;  4YGA A;  1TWO A;  4YGB B;  2M9G A;  2WCM A;  3H4S E;  2TN4 A;  3IQO A;  5D7F A;  3OB2 B;  2F2O A;  3FWC A;  4NDD A;  3O4X A;  2FJU B;  2JC2 A;  4TNC A;  3D75 A;  1QAT A;  1DTL A;  2KGB C;  2M0R A;  3EVV A;  1SCM C;  3F45 A;  1RRO A;  1FF1 A;  2F3Z A;  4INW A;  3VRQ A;  2JWW A;  1NCZ A;  3A8R A;  3I5I B;  3S0G A;  3C1V A;  1B1G A;  3OHM B;  2K61 A;  3PN7 C;  3R1P A;  4M2Q A;  4Q04 A;  1B7T Y;  1TRF A;  2K2F A;  2NCO A;  4M2O A;  1BF5 A;  1BG1 A;  1AK8 A;  4C0K A;  3BXK A;  3WHT B;  3Q8I A;  3R1O A;  1UHK A;  2KFF A;  4R1E A;  1TCF A;  2M7N A;  1DJH A;  1KFU L;  1OW4 A;  4AQI A;  2PVB A;  1OOI X;  1A75 A;  1DT7 B;  1CB1 A;  1GJY A;  2LVI A;  1BMO A;  2WCB A;  1CLL A;  2MLE C;  3EVR A;  1YR5 A;  2JNF A;  2K60 A;  3TDZ A;  1G33 A;  1R2U A;  3L4L A;  1IQ3 A;  1PSB A;  2KNE A;  2L5X B;  1B8L A;  1K9U A;  2LCP A;  4HSZ A;  4PDZ A;  2JU0 A;  4PE1 A;  2GGZ A;  2QEB A;  2QEV A;  1SPY A;  1IIO A;  2JXL A;  1DEL A;  1RJV A;  3EK8 A;  3B86 A;  1QV0 A;  5AXI A;  3SG6 A;  1S36 A;  2L98 A;  3SS3 A;  4PHK A;  4N1F A;  2OPO A;  3NHT A;  1NPQ A;  1XVJ A;  1K9P A;  2PRU A;  2RGI A;  1DJZ A;  3EKJ A;  2M49 B;  2ZRS A;  1KFU S;  1XYD A;  3FE9 A;  2R2I A;  3GK4 X;  3DY9 A;  1DC1 A;  2KHN A;  3EK7 A;  4QJ3 B;  1B8C A;  1S6I A;  2OTG C;  3S0F A;  1DJW A;  4PE7 A;  1S26 D;  1CDN A;  2AAO A;  1J1E A;  1KQM C;  5PAL A;  2CNP A;  4U8D A;  3FS7 A;  1C3Z A;  3O2P A;  1X02 A;  5HKY A;  3FE6 A;  4GFT A;  3PFV A;  5CSN A;  5KSZ A;  1J7O A;  5FYX A;  2JTT A;  2H2K A;  2OS8 C;  1SMG A;  2KQY A;  1DJG A;  1V1F A;  1ZMZ A;  2KAX A;  3IQQ A;  4GPL B;  1N65 A;  2M1U A;  2V53 A;  1LA3 A;  2BAP A;  3CR5 X;  1WRL A;  4YI8 A;  4A4C A;  1NUB A;  5B8I B;  1W7J B;  1GM0 A;  3NSL A;  1YVL A;  4PCW A;  2JOJ A;  1C3Y A;  3EG5 B;  2LC5 A;  2MLF C;  1L7Z A;  5ER4 X;  3KF9 A;  4MN0 A;  1DJY A;  1OMR A;  2L2E A;  4DS7 A;  1M46 A;  3BOW B;  1K90 D;  1DJX A;  1CM4 A;  4F7F A;  1IJ5 A;  2BKH B;  2FOT A;  1ZOT B;  3PM8 A;  4I5K A;  2LUX A;  2WC8 A;  1PK0 D;  2JPO A;  4BY4 A;  1KK7 Z;  1NCX A;  2K7D A;  3FIA A;  3L4A A;  4OR9 B;  1J7Q A;  2D8N A;  2DOQ A;  4I5L B;  2G2B A;  1YX7 A;  1OE9 B;  4JPZ B;  4NQG A;  2MBX A;  1J55 A;  3ZWH A;  1JWD A;  4ORC B;  5CSI A;  1BU3 A;  5FI2 A;  1LIN A;  2B1U A;  3B7A A;  3S0D A;  2LP2 A;  2WCK A;  1SL9 A;  2KBI A;  1AP4 A;  1F55 A;  1CFF A;  1UHI A;  3PN7 B;  2IS9 A;  1JFJ A;  1TNX A;  2L5Y A;  1FPW A;  1UUR A;  1M45 A;  1QX5 B;  1QVI Z;  2LLU A;  1UP5 A;  1MQ1 A;  1EH2 A;  4DUQ A;  1BLQ A;  1A75 B;  3SIB A;  2QDI A;  3EVU A;  1AJ4 A;  1NX2 A;  3BOW A;  3FWB A;  3S0A A;  1BOC A;  1LKJ A;  2O5G A;  3M0W A;  1KWO C;  1JUO A;  3NSO A;  4E68 A;  2WND A;  3RZS A;  3I5G C;  1CFC A;  2A4J A;  4MBE A;  2MA2 A;  5G08 A;  3K21 A;  5DIC A;  3V2L A;  5JOL A;  1UHJ A;  4C0J A;  2HQW A;  1LXF C;  5AER A;  2NLN A;  4YI9 A;  2QEO A;  2I18 A;  4YGE B;  2WC5 A;  1WY9 A;  3I5F C;  2BL0 C;  2ZN8 A;  1ORG A;  4I5N B;  4NDB A;  2KOT A;  2E6W A;  2K2A A;  1J7P A;  5I8N A;  4AQJ A;  1QX2 A;  1WLM A;  1XFZ O;  3CZ2 A;  2EC6 B;  1SL8 A;  3PLF B;  1KFX L;  1L2O C;  2I94 A;  2NZ0 A;  3PSR A;  4JD9 A;  1Q80 A;  3IVT A;  3PM2 A;  3UNW A;  4GUK A;  5DKQ A;  2M97 A;  2FJY A;  3OB1 B;  2MJW B;  5TNC A;  1PVA A;  1NX0 A;  1QJT A;  3GOF A;  2K8M B;  2KI4 B;  2M29 A;  1BR1 B;  4HRG A;  4OVN F;  1WLZ A;  2PYQ A;  1B4C A;  2E30 A;  3EK4 A;  2H61 C;  2M3W A;  1Y1A A;  1WRZ A;  3HCM A;  4ORA B;  4IJ7 A;  3BFA A;  1S5G Y;  3DVJ A;  4DRW A;  1DEK A;  2VRG A;  5I2Q A;  1IKU A;  1PRW A;  1M39 A;  4OKH A;  1CM1 A;  2LVV A;  4KYN A;  4GGN A;  3CS1 A;  3GK1 A;  4CFQ A;  1CDM A;  1SBJ A;  2GTE A;  1SW8 A;  1GGZ A;  2NXQ A;  2Y1M A;  2JZI A;  2ZND A;  4WQ3 A;  1Y6W A;  5AEQ A;  1SYM A;  3AKB A;  3CZ1 A;  2CXJ A;  4PHM A;  1Y0V H;  4OV2 A;  1WDC B;  4JKT A;  4ZCV A;  1SL7 A;  2F2P A;  1C7W A;  4YRU A;  2ZFD A;  4OZD A;  5D69 A;  1KK8 C;  5KU1 A;  1V1G A;  1OQP A;  3HX4 A;  3BFH A;  1RTP 1;  2LVK A;  4PAL A;  2I7A A;  2PAL A;  4PT1 A;  2JRF A;  2NCP A;  4CID A;  1A29 A;  1QS7 A;  2KGR A;  1MR8 A;  2F33 A;  3K1E A;  1LVC D;  1XK4 C;  4FQO A;  3LLE A;  1C07 A;  1U5I B;  3MSE B;  5AFP A;  3I5H C;  1OZO A;  2LAP A;  1GGW A;  1CDL A;  2LMT A;  2HQ8 A;  4UPG A;  1IGV A;  1P28 A;  1JBA A;  5HKZ A;  1K96 A;  3LK1 A;  3PAT A;  1A4P A;  1TNP A;  3CWG A;  1JSA A;  1FBV A;  3A4U B;  4N1G A; 
#chains in the Genus database with same CATH homology
 3LCP C;  4P2Y B;  4YBH B;  1DJI A;  1OSA A;  3SJS A;  1K94 A;  1JC2 A;  4NDC A;  2JT8 A;  1CTR A;  1XFU O;  3E3R A;  3LK0 A;  2SCP A;  2SAS A;  1FI6 A;  1PUL A;  3KHE A;  1NWD A;  1KWO B;  1G4Y R;  1HT9 A;  2QAC A;  3TDI A;  1IG5 A;  2LVJ A;  1Y1X A;  2LP3 A;  1MWN A;  2PAS A;  3I5G B;  5AAN A;  2LHI A;  4I5J A;  3KEV A;  1JF2 A;  3DVE A;  1QXP A;  1M31 A;  5HYD A;  3CR4 X;  3OX6 A;  2COL B;  5GQQ C;  1A03 A;  3CTN A;  2M8U A;  3DVM A;  5K89 A;  1U5I A;  2PMY A;  1SCM B;  1MHO A;  1AVS A;  4HRH A;  1PSR A;  4M2P A;  2AUC A;  4GGF C;  1DGV A;  2MRD A;  1CMG A;  3BQ3 A;  5CPV A;  2FCE A;  2ZNE A;  2BBM A;  3AAK A;  2BCA A;  3TUY C;  2LUC A;  1FW4 A;  1AJ5 A;  3JTD C;  4MRX A;  1IH0 A;  1NSH A;  4QJ4 B;  2LLT A;  4PE0 A;  1K95 A;  1Y1U A;  2JXC A;  2EGD A;  1F54 A;  1CLM A;  3RLZ A;  3NSK A;  4MZJ A;  4PE4 A;  1DF0 A;  5HLO A;  1YVH A;  1CNP A;  3QRX A;  3CZT X;  1ZAC A;  1YUT A;  4ICB A;  1ALW A;  1SRA A;  3TS5 C;  5IBW A;  1IQ5 A;  1NX3 A;  2M7L A;  4F0Z B;  1TNW A;  1SR6 C;  5HLV A;  1B7T Z;  3SIA A;  1REC A;  2L4I A;  4CFR A;  2GGM A;  2KFH A;  1KCY A;  1OZS A;  1XFV O;  2WCF A;  2K7C A;  2KAY A;  1ZUZ A;  2WOR A;  3OP0 A;  2JQ6 A;  2JT3 A;  1IJ6 A;  1KQV A;  1E8A A;  4WQ2 A;  1KK8 B;  2PSR A;  1G8I A;  3DF0 B;  1PAL A;  1AUI B;  1ZFS A;  4N5X A;  1J7R A;  1VRK A;  1J1D A;  2OTG B;  1F4Q A;  1EJ3 A;  1S5G Z;  2LMV A;  4MEW A;  3OX5 A;  1NYA A;  1H8B A;  1SNL A;  1A2X A;  1TCO B;  1KQM B;  1SY9 A;  2JUL A;  3KPX A;  4JQ0 D;  3JVT C;  2ISD A;  2ZRT A;  2LHL A;  1ALV A;  2KI6 C;  4PHN A;  2H61 A;  2M1K B;  4QJ5 B;  3I5H B;  3D10 A;  3ZNI A;  2OS8 B;  3TZ1 A;  3O6B A;  2CTN A;  4MZK A;  1TOP A;  1UHN A;  3VRO A;  5I2O A;  2BE4 A;  5I2L A;  2JPT A;  3BUW B;  2LNK A;  1S1E A;  3WHU B;  1ODB A;  1CFD A;  1OMD A;  3BYA A;  1S6J A;  1KFX S;  3DVK A;  2ZN9 A;  2HF5 A;  1QX7 A;  3NXA A;  4DCK A;  2Y1N A;  1K9K A;  3PAL A;  1NX1 A;  1C7V A;  1JF0 A;  3BUM B;  1B9A A;  4XJK B;  1RK9 A;  2K7B A;  3DF0 A;  1MXE A;  1B47 A;  2BKI B;  3BUX B;  2Y4Q A;  2LLS A;  4MSP A;  1TIZ A;  5CSJ A;  3TDU A;  1EG3 A;  3O4Y A;  2BBN A;  4CLN A;  2Q4U A;  2O60 A;  1XFX O;  2KYC A;  1K2H A;  3RM1 A;  1OOJ A;  3KO0 A;  4L9M A;  1HQV A;  1XK4 A;  1SKT A;  4GNK B;  3CLN A;  1YRT B;  2KYF A;  1CLB A;  1BJF A;  1XO5 A;  3I5I C;  3ICB A;  1QIV A;  3VGO A;  4ZCU A;  1N0Y A;  2BCB A;  2EC6 C;  2JTZ A;  5HKW A;  4MVF A;  4FTG A;  3TUY B;  1EL4 A;  3JTD B;  2HET A;  2CCM A;  2I2R E;  5DKR A;  3SG4 A;  3D0Y B;  2LMU A;  1TN4 A;  2P6B B;  1MXL C;  1QLK A;  3WNX B;  4D1E A;  1IRJ A;  3AAJ A;  1S3P A;  4DIR A;  2GV5 A;  3VRN A;  2LM5 A;  2WCE A;  1BOD A;  2KI4 C;  4OCI A;  3VRR A;  2CBL A;  5CSF A;  1YX8 A;  1DF0 B;  1NCY A;  1QIW A;  2BCX A;  2EHB A;  4XJK A;  5BPJ A;  2L0P A;  3EKH A;  4GBA A;  2L51 A;  1DVI A;  1N2D A;  4HRE E;  1TNQ A;  4MRY A;  3TS5 B;  2G9B A;  2KFG A;  1KSM A;  2MHH A;  2JNX A;  1AHR A;  2KAV A;  3BUN B;  1SR6 B;  1D1O A;  3O78 A;  1DMO A;  3SG3 A;  1FI5 A;  2K7O A;  1BT6 A;  3I5F B;  1K8U A;  1WDC C;  2BL0 B;  1YUU A;  4USL A;  5ER5 A;  1R6P A;  2AMI A;  4CPV A;  4ETO A;  1GQM A;  1SCV A;  1XA5 A;  3WXA A;  1YUS A;  4GGF A;  3NSI A;  1F4O A;  1NP8 A;  3LL8 B;  4MZL A;  2QPT A;  4YGC B;  3BUO B;  4MLW A;  1L2O B;  1IWQ A;  2BE6 A;  2ZKM X;  1JFK A;  4P5O E;  3SG2 A;  1F71 A;  1F70 A;  2F3Y A;  1QLS A;  3D0Y A;  2HPS A;  1YTZ C;  1EXR A;  3DD4 A;  3GK2 A;  2WOS A;  4C0L A;  1MF8 B;  2KQ6 A;  3CGA A;  1OMV A;  1QTX A;  3IF7 A;  5J3X A;  1RWY A;  2K0J A;  4IL1 A;  4AOM A;  3JVT B;  2LAN A;  2Q91 A;  1MUX A;  1F8H A;  2CT9 A;  2KI6 D;  1XFW O;  4YGD B;  1RFJ A;  1QAS A;  1TTX A;  1NIW A;  1CDP A;  1KK7 Y;  2JT0 A;  1SK6 D;  2L50 A;  2KDH A;  3SG5 A;  1CKK A;  1BR4 B;  1UWO A;  3AKA A;  1LA0 A;  5JJG A;  2Y5I A;  1K93 D;  5F6T A;  2FCD A;  4A4B A;  1CFP A;  1UHH A;  4PHJ A;  1H4B A;  4BY5 A;  3VRP A;  1YRU B;  2L4H A;  2MAZ A;  4WRI A;  1CMF A;  2KSP A;  4GAO A;  5DKN A;  3SG7 A;  1W7I B;  1PVB A;  2LV7 A;  1DGU A;  1KSO A;  1QV1 A;  4XYN A;  3CR2 A;  1EG4 A;  1WRK A;  2BEC A;  1B8R A;  5KTY A;  1S6C A;  2KBM A;  1XFY O;  2F8P A;  4ORB B;  4JWQ A;  1M63 B;  1UUS A;  2LE9 B;  1YUR A;  1QVI Y;  4YGA A;  4YGB B;  2M9G A;  3H4S E;  2TN4 A;  3IQO A;  5D7F A;  3OB2 B;  2F2O A;  3FWC A;  4NDD A;  2FJU B;  2JC2 A;  4TNC A;  1QAT A;  1DTL A;  2KGB C;  2M0R A;  3EVV A;  1SCM C;  3F45 A;  1RRO A;  1FF1 A;  2F3Z A;  3VRQ A;  2JWW A;  1NCZ A;  3A8R A;  3I5I B;  3C1V A;  1B1G A;  3OHM B;  2K61 A;  3PN7 C;  4Q04 A;  4M2Q A;  1BG1 A;  1B7T Y;  1TRF A;  2K2F A;  2NCO A;  4M2O A;  1BF5 A;  1AK8 A;  4C0K A;  3BXK A;  3WHT B;  1UHK A;  2KFF A;  4R1E A;  1TCF A;  2M7N A;  1DJH A;  1KFU L;  4AQI A;  2PVB A;  1A75 A;  1DT7 B;  1CB1 A;  1GJY A;  2LVI A;  1BMO A;  2WCB A;  1CLL A;  2MLE C;  3EVR A;  1YR5 A;  2JNF A;  3TDZ A;  1G33 A;  1R2U A;  1IQ3 A;  1PSB A;  2KNE A;  2L5X B;  1B8L A;  1K9U A;  2LCP A;  4HSZ A;  4PDZ A;  2JU0 A;  4PE1 A;  2GGZ A;  1SPY A;  2JXL A;  1RJV A;  3EK8 A;  1QV0 A;  5AXI A;  3SG6 A;  1S36 A;  2L98 A;  4PHK A;  4N1F A;  2OPO A;  1NPQ A;  1XVJ A;  1K9P A;  2PRU A;  2RGI A;  1DJZ A;  3EKJ A;  2M49 B;  2ZRS A;  1KFU S;  1XYD A;  3GK4 X;  2R2I A;  2KHN A;  3EK7 A;  4QJ3 B;  1B8C A;  1S6I A;  2OTG C;  1DJW A;  4PE7 A;  1S26 D;  1CDN A;  2AAO A;  1J1E A;  1KQM C;  5PAL A;  2CNP A;  4U8D A;  3FS7 A;  3O2P A;  1X02 A;  5HKY A;  4GFT A;  3PFV A;  5CSN A;  5KSZ A;  1J7O A;  5FYX A;  2JTT A;  2H2K A;  2OS8 C;  1SMG A;  2KQY A;  1DJG A;  1V1F A;  1ZMZ A;  2KAX A;  3IQQ A;  4GPL B;  1N65 A;  2M1U A;  2V53 A;  1LA3 A;  3CR5 X;  4YI8 A;  1WRL A;  5B8I B;  4A4C A;  1NUB A;  1W7J B;  3NSL A;  1YVL A;  4PCW A;  2JOJ A;  2LC5 A;  2MLF C;  1L7Z A;  5ER4 X;  3KF9 A;  4MN0 A;  1DJY A;  1OMR A;  2L2E A;  4DS7 A;  1M46 A;  3BOW B;  1K90 D;  1DJX A;  1CM4 A;  1IJ5 A;  2BKH B;  2FOT A;  1ZOT B;  3PM8 A;  4I5K A;  2LUX A;  2WC8 A;  1PK0 D;  4BY4 A;  1KK7 Z;  1NCX A;  2K7D A;  3FIA A;  4OR9 B;  1J7Q A;  2D8N A;  2DOQ A;  4I5L B;  2G2B A;  1YX7 A;  1OE9 B;  4JPZ B;  4NQG A;  2MBX A;  1J55 A;  3ZWH A;  1JWD A;  4ORC B;  5CSI A;  1BU3 A;  1LIN A;  2B1U A;  2LP2 A;  1F55 A;  1SL9 A;  2KBI A;  1AP4 A;  1CFF A;  1UHI A;  3PN7 B;  2IS9 A;  1JFJ A;  1TNX A;  1FPW A;  1UUR A;  1M45 A;  1QX5 B;  1QVI Z;  2LLU A;  1UP5 A;  1MQ1 A;  1EH2 A;  4DUQ A;  1BLQ A;  1A75 B;  3SIB A;  3EVU A;  1AJ4 A;  1NX2 A;  3BOW A;  3FWB A;  1BOC A;  1LKJ A;  2O5G A;  3M0W A;  1KWO C;  1JUO A;  3NSO A;  4E68 A;  2WND A;  3I5G C;  1CFC A;  2A4J A;  4MBE A;  2MA2 A;  5G08 A;  3K21 A;  5JOL A;  1UHJ A;  4C0J A;  2HQW A;  1LXF C;  5AER A;  2NLN A;  4YI9 A;  2I18 A;  4YGE B;  1WY9 A;  3I5F C;  2BL0 C;  2ZN8 A;  4I5N B;  4NDB A;  2KOT A;  2E6W A;  2K2A A;  1J7P A;  5I8N A;  4AQJ A;  1QX2 A;  1WLM A;  1XFZ O;  2EC6 B;  1SL8 A;  3PLF B;  1KFX L;  1L2O C;  2I94 A;  2NZ0 A;  3PSR A;  1Q80 A;  4GUK A;  5DKQ A;  2M97 A;  3OB1 B;  2MJW B;  5TNC A;  1PVA A;  1NX0 A;  1QJT A;  3GOF A;  2K8M B;  2KI4 B;  2M29 A;  1BR1 B;  4HRG A;  4OVN F;  1WLZ A;  1B4C A;  2E30 A;  3EK4 A;  2H61 C;  2M3W A;  1Y1A A;  1WRZ A;  3HCM A;  4ORA B;  1S5G Y;  3DVJ A;  4DRW A;  2VRG A;  5I2Q A;  1IKU A;  1PRW A;  1M39 A;  4OKH A;  1CM1 A;  2LVV A;  4GGN A;  3CS1 A;  3GK1 A;  4CFQ A;  1CDM A;  1SBJ A;  2NXQ A;  1SW8 A;  1GGZ A;  2Y1M A;  2ZND A;  2JZI A;  4WQ3 A;  1Y6W A;  5AEQ A;  1SYM A;  3AKB A;  4PHM A;  2CXJ A;  1Y0V H;  4OV2 A;  1WDC B;  4ZCV A;  1SL7 A;  2F2P A;  1C7W A;  4YRU A;  2ZFD A;  5D69 A;  1KK8 C;  5KU1 A;  1V1G A;  1OQP A;  3HX4 A;  1RTP 1;  2LVK A;  4PAL A;  2I7A A;  2PAL A;  2JRF A;  2NCP A;  4CID A;  1A29 A;  1QS7 A;  2KGR A;  1MR8 A;  2F33 A;  1LVC D;  1XK4 C;  4FQO A;  3LLE A;  1C07 A;  1U5I B;  3MSE B;  5AFP A;  3I5H C;  1OZO A;  2LAP A;  1GGW A;  1CDL A;  2LMT A;  2HQ8 A;  4UPG A;  1IGV A;  1JBA A;  5HKZ A;  1K96 A;  3LK1 A;  3PAT A;  1A4P A;  1TNP A;  3CWG A;  1JSA A;  1FBV A;  3A4U B;  4N1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...