4M2PA

Crystal structure of a non-myristoylated c39d recoverin mutant with one calcium ion bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
192
structure length
192
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKEDPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 78
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2pA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2pA01
3GK1A 1B7TY 3DVKA 2L2EA 3E3RA 1K9PA 5KSZA 1Y0VH 3SG2A 1B9AA 1W7IB 3GOFA 1OMDA 4C0LA 1DF0B 2LP2A 3D0YB 1CLLA 1GJYA 1J1EA 5CPVA 2Y1MA 3IQQA 4GGFC 2Q4UA 3BUMB 2M29A 2E6WA 4QJ3B 1ZUZA 4JPZB 1J1DA 4Q04A 1A75B 1CM4A 2ZRTA 3BUWB 4PHKA 2RGIA 4DS7A 4MRXA 4PHMA 1N2DA 2JOJA 1OZSA 2ZNDA 4JQ0D 1B8RA 2LANA 2NXQA 1K93D 2GGZA 2LUCA 3PN7C 1NCYA 1Y1XA 3OB1B 1JSAA 1B4CA 1J55A 4F0ZB 5AFPA 3F45A 1NX1A 2JXLA 2F8PA 2CCMA 1AHRA 4JWQA 1LINA 3MSEB 1PSBA 4YGAA 1GGWA 3PALA 3BUNB 2LVKA 2MBXA 1NPQA 1SRAA 3VRNA 3I5FC 3DF0A 1DGVA 2PVBA 1FBVA 4ZCVA 1RROA 4PDZA 4NQGA 2L0PA 1QV1A 1JUOA 1YUUA 3NSKA 1V1GA 3BOWA 2PASA 1KK8B 1IGVA 2K0JA 2KBMA 5F6TA 1C7WA 1XYDA 1QLKA 5HKZA 1BOCA 1JBAA 1QX7A 1TN4A 1CTRA 4DUQA 4M2QA 1TTXA 2V53A 1RECA 3KHEA 3TDUA 1CM1A 2JXCA 5J3XA 2LLSA 3ICBA 4ORCB 1QX2A 2PALA 2CT9A 1RTP1 2L51A 2NCPA 1DF0A 2LVJA 3AAKA 3D0YA 1BLQA 1UHNA 2KGBC 2WC8A 1LKJA 1MXLC 1UHHA 2ZKMX 4N1FA 2H61A 1QIVA 3EK7A 1A75A 1KK7Z 1KWOB 1RFJA 1Y1UA 2AAOA 2I7AA 4P2YB 1UHIA 2D8NA 1WRKA 1J7QA 3SG4A 1FI5A 2EC6C 4YGBB 2HF5A 2HQWA 2PMYA 1IRJA 1PALA 1JWDA 4HRGA 2GGMA 1TRFA 1YUSA 1IKUA 1M39A 2B1UA 2L4HA 2A4JA 4AQJA 4CFQA 2SASA 1TNXA 1SW8A 3GK4X 1ZFSA 2M7LA 4PE1A 1KFXS 1NX0A 1CMFA 1NX3A 2HPSA 5CSNA 1L2OC 1KQVA 1G4YR 1QLSA 1PVBA 1PULA 2CBLA 4D1EA 1WRZA 1XK4A 3ZNIA 1XFWO 5AERA 1JC2A 2MA2A 3I5GB 1XO5A 1NWDA 4ICBA 1B47A 4NDBA 1DGUA 3WHTB 2AUCA 1KFUL 2EHBA 3I5HC 1XFVO 1TCFA 1B8CA 2H61C 3KF9A 4I5LB 1LVCD 5D69A 3BXKA 4C0KA 3AAJA 2O60A 1MF8B 5AXIA 1IJ6A 5AANA 1S26D 1XFUO 4E68A 1L7ZA 2I2RE 2CNPA 1QX5B 1YVLA 3OP0A 4OR9B 1OQPA 3DVEA 3WNXB 4QJ5B 5I2OA 2JQ6A 2K7CA 4DIRA 1NIWA 2KFGA 3IF7A 5KTYA 2KAYA 4GBAA 1K94A 2K2AA 1F55A 1S3PA 2JNXA 2LLTA 1G8IA 2SCPA 4MRYA 4PCWA 2ISDA 2BL0C 2ZN8A 1SNLA 3HX4A 5CSIA 2O5GA 3JVTB 2NLNA 1N65A 5ER5A 4I5JA 1XFYO 1CLMA 1VRKA 1QASA 1FF1A 2JULA 2OTGC 1XK4C 3DVJA 1D1OA 1C07A 3TDIA 1FI6A 3VRRA 1A4PA 1EL4A 4OCIA 1JFJA 2LC5A 3SG3A 1M31A 1EXRA 2HQ8A 2BKHB 3CGAA 3ZWHA 2R2IA 4MEWA 1BU3A 4CFRA 4XJKB 2PRUA 4MVFA 5ER4X 1IG5A 2DOQA 1B8LA 4L9MA 4YI9A 1QJTA 2JT8A 4YGEB 1E8AA 3A4UB 3EK8A 1IWQA 2LP3A 2MRDA 2TN4A 1AK8A 3CLNA 2M9GA 1YTZC 4MLWA 3TUYC 3TS5C 1U5IB 1UHKA 2LAPA 2K2FA 3KEVA 3CS1A 3KPXA 3NXAA 4YGDB 2G9BA 1B1GA 2I94A 4YRUA 1CDPA 1V1FA 3BUOB 1CFDA 2OS8B 1A2XA 5I8NA 1WDCB 1R6PA 3BYAA 1J7OA 2LHIA 2QPTA 2Y5IA 4XYNA 1OMVA 4GNKB 3SG5A 1EJ3A 1SL7A 2KI4C 2BKIB 3O4YA 1M63B 2ZRSA 1MHOA 1Y1AA 2JWWA 2IS9A 3NSOA 1K90D 1BJFA 4M2PA 4ORBB 1ZOTB 2HETA 1N0YA 1JF2A 2JNFA 3I5IB 1CB1A 2LCPA 4OV2A 4MSPA 1LA0A 4GAOA 2WNDA 1F54A 1PRWA 2OPOA 4TNCA 4A4CA 1S6IA 1QXPA 2BE6A 1SK6D 2LVVA 4PE7A 4FQOA 1TNQA 1DTLA 1Q80A 4NDDA 1UURA 2Q91A 3K21A 1YUTA 1S5GZ 3OHMB 3I5GC 2JT0A 2KAVA 2K61A 2BCBA 4GPLB 2ZFDA 2L50A 5GQQC 4HRHA 5HLVA 1K95A 3EKHA 3FIAA 1TCOB 1KK7Y 3QRXA 2JZIA 1Y6WA 3CWGA 2M8UA 2NCOA 1OSAA 1OMRA 1JF0A 3PN7B 1AVSA 1K96A 2KI6D 4R1EA 1BF5A 2K8MB 1KQMC 1R2UA 1KSMA 3JTDB 3FS7A 1CNPA 1S6JA 1AP4A 1BR1B 3M0WA 4ZCUA 1YR5A 4MZLA 1U5IA 1YRUB 1MR8A 2LV7A 5HYDA 4USLA 4YI8A 1F4QA 3JVTC 4PE0A 1WRLA 2LM5A 3EVRA 4MBEA 4NDCA 2F33A 3EK4A 3A8RA 1IQ5A 3PLFB 1XA5A 5HLOA 3VRPA 2BBMA 2Y1NA 2K7BA 5JJGA 4AQIA 4I5NB 1PVAA 1ALWA 1UWOA 1IJ5A 1CFPA 2M1KB 1FW4A 4C0JA 1KFXL 3DVMA 1CDMA 3TZ1A 1SMGA 4WRIA 3EVVA 3O6BA 4GGNA 2JTZA 1DT7B 1NYAA 1RJVA 1SL8A 2BECA 1SR6B 1M45A 1M46A 2L98A 3CR2A 4BY4A 2LVIA 5CSJA 1EH2A 1SKTA 3KO0A 1LA3A 4GGFA 4PALA 4YBHB 1GGZA 3VRQA 2MLFC 4I5KA 2WCBA 3PATA 3TDZA 3SIAA 2CXJA 1K2HA 2E30A 2KAXA 1DJWA 1AJ4A 3LL8B 5BPJA 3OB2B 1KSOA 2EC6B 4N5XA 4DCKA 3OX6A 3PFVA 4FTGA 2EGDA 2OS8C 2K7DA 4BY5A 4UPGA 1WDCC 4ORAB 1X02A 4PHJA 1CKKA 1H4BA 3OX5A 2LMVA 1NCZA 1ALVA 2H2KA 1K9UA 1F4OA 3H4SE 3BOWB 1TOPA 2F2OA 3FWCA 1J7RA 3HCMA 1KK8C 4WQ3A 1OOJA 2KYFA 4PE4A 1HQVA 1OE9B 2M1UA 3I5IC 1B7TZ 2M0RA 1CFCA 1L2OB 1K8UA 3BUXB 1BODA 4YGCB 3SJSA 1BMOA 1XFZO 2KFHA 1NCXA 2WORA 1G33A 1IH0A 1UHJA 2LMUA 1RK9A 4P5OE 3AKAA 5CSFA 1QS7A 2LMTA 1DMOA 2AMIA 2FJUB 1KCYA 3WXAA 1AJ5A 3I5HB 2L5XB 2QACA 2NZ0A 2MLEC 3PM8A 1QVIZ 1KWOC 1A29A 5FYXA 1NSHA 1QVIY 3GK2A 1JFKA 1CDNA 2KQ6A 3FWBA 2L4IA 1ZMZA 1PK0D 5D7FA 1SCMB 3SIBA 4OVNF 1F71A 2KSPA 1GQMA 1C7VA 2Y4QA 1ODBA 3RM1A 2KNEA 3JTDC 1NUBA 1MWNA 1S6CA 2MJWB 3RLZA 1RWYA 3VGOA 4DRWA 2BL0B 1DJYA 1TNWA 2FCEA 3BQ3A 3O78A 2PSRA 2M97A 1SPYA 2OTGB 2KI6C 1DJZA 1ZACA 3D10A 3LLEA 5IBWA 2I18A 1EG4A 2M49B 3LCPC 4AOMA 1OZOA 4ETOA 4N1GA 1S5GY 1CDLA 1UP5A 2WCFA 2JT3A 5AEQA 1QV0A 2ZNEA 1TIZA 2KHNA 2JPTA 1BR4B 3NSIA 4A4BA 2MHHA 1TNPA 2CTNA 2LUXA 4MZKA 1XFXO 1DJIA 2FOTA 1QTXA 2LE9B 4XJKA 4GUKA 2LHLA 5TNCA 1J7PA 3LK0A 2COLB 1WY9A 1HT9A 1UUSA 1MUXA 3EKJA 1NP8A 3O2PA 1F8HA 1YVHA 2FCDA 4CLNA 2BE4A 2KYCA 5HKYA 1SR6C 1MQ1A 5KU1A 5DKRA 4M2OA 4OKHA 4CIDA 1YRTB 4MZJA 2KQYA 1AUIB 1EG3A 2K7OA 2M3WA 2P6BB 3TUYB 3CR5X 3TS5B 1IQ3A 1YURA 2KFFA 3CR4X 2F2PA 1YX8A 4PHNA 2BBNA 3SG7A 1S36A 2M7NA 5B8IB 1FPWA 1DVIA 5PALA 3I5FB 3CZTX 3AKBA 2KI4B 1SL9A 1DJHA 1YX7A 3WHUB 2KGRA 1BG1A 2KBIA 1A03A 1WLMA 1DJGA 2G2BA 4U8DA 4MN0A 1KFUS 2LNKA 1SYMA 4HSZA 3VROA 3C1VA 3LK1A 2VRGA 1QIWA 2JU0A 3CTNA 1XVJA 1WLZA 5K89A 5I2LA 2ZN9A 1QATA 4IL1A 2JTTA 1H8BA 2JRFA 2KOTA 2LLUA 2GV5A 1MXEA 1LXFC 1DJXA 3DD4A 1BT6A 1CMGA 2F3YA 1CFFA 3DF0B 3NSLA 5DKQA 1NX2A 3IQOA 4GFTA 2KDHA 1KQMB 1SBJA 1W7JB 4QJ4B 4CPVA 3EVUA 2BCXA 1SCMC 5HKWA 2MAZA 5JOLA 1SCVA 5G08A 2WCEA 1K9KA 5DKNA 2BCAA 1PSRA 4HREE 5I2QA 2F3ZA 3PSRA 2JC2A 1CLBA 1F70A 2WOSA 1S1EA 4WQ2A 3SG6A 1SY9A
chains in the Genus database with same CATH superfamily
3GK1A 1B7TY 3DVKA 2L2EA 3Q8IA 3E3RA 1K9PA 5KSZA 1Y0VH 5EL2A 1DEKA 1B9AA 1W7IB 3GOFA 3SG2A 1OMDA 4C0LA 1DF0B 2LP2A 3D0YB 3DYEA 3L47A 1DC1A 1CLLA 1GJYA 1J1EA 5CPVA 2Y1MA 3IQQA 4GGFC 2Q4UA 3BUMB 2M29A 2E6WA 4QJ3B 1ZUZA 3VB1A 4JPZB 1J1DA 4Q04A 1A75B 1CM4A 2ZRTA 3BUWB 4PHKA 2RGIA 2K60A 2FJYA 4MRXA 4DS7A 4PHMA 1N2DA 2JOJA 1OZSA 2ZNDA 4JKTA 1B8RA 2LANA 2NXQA 4JQ0D 1C3YA 1K93D 2GGZA 2LUCA 3PN7C 1NCYA 1Y1XA 2KPHA 2WC6A 3OB1B 1JSAA 1B4CA 1J55A 4F0ZB 5AFPA 3CZ0A 3F45A 1NX1A 2JXLA 2F8PA 2CCMA 1AHRA 4JWQA 1LINA 3MSEB 1PSBA 4YGAA 1GGWA 1T14A 1W9ZA 3PALA 3BUNB 3FE6A 2LVKA 2MBXA 1NPQA 1SRAA 3VRNA 3I5FC 3DF0A 1DGVA 1OW4A 2PVBA 1FBVA 4ZCVA 1RROA 1XFRA 4PDZA 4NQGA 2L0PA 1QV1A 1JUOA 1YUUA 2QEVA 3NSKA 1V1GA 3BOWA 2PASA 1KK8B 1IGVA 2K0JA 2KBMA 5F6TA 1C7WA 1XYDA 1QLKA 3L4AA 5HKZA 1BOCA 1JBAA 1QX7A 1TN4A 1CTRA 4DUQA 4M2QA 3D73A 1TTXA 2V53A 1RECA 3KHEA 3TDUA 1CM1A 2JXCA 5J3XA 2LLSA 3ICBA 4ORCB 1QX2A 2PALA 2CT9A 1RTP1 2L51A 1C3ZA 3FE9A 2NCPA 3V2LA 1DF0A 2LVJA 3AAKA 3D0YA 1BLQA 1UHNA 2KGBC 2WC8A 1P28A 1LKJA 1MXLC 1UHHA 2ZKMX 4N1FA 2H61A 1QIVA 3EK7A 1A75A 2WCMA 3D74A 1KK7Z 1KWOB 2KLDA 1RFJA 1Y1UA 2AAOA 2I7AA 3D76A 4P2YB 1UHIA 2D8NA 1WRKA 1J7QA 3SG4A 1FI5A 2EC6C 4YGBB 2HF5A 2HQWA 3NHIA 2PMYA 1IRJA 1PALA 1JWDA 4HRGA 2GGMA 1TRFA 1YUSA 1IKUA 1M39A 2B1UA 2L4HA 2A4JA 3NGVA 4AQJA 1LS8A 4CFQA 2SASA 1TNXA 1SW8A 3GK4X 1ZFSA 4INWA 2M7LA 4PE1A 1KFXS 1NX0A 1CMFA 2WCJA 3B7AA 1NX3A 2HPSA 5CSNA 1L2OC 1KQVA 1G4YR 1QLSA 1PVBA 1PULA 2CBLA 3OGNA 1WRZA 1XK4A 2WCLA 1XFWO 3ZNIA 4D1EA 5AERA 1JC2A 2MA2A 3I5GB 1XO5A 1NWDA 4ICBA 1B47A 3R72A 4NDBA 1DGUA 3WHTB 2AUCA 1KFUL 2EHBA 3I5HC 1XFVO 1TCFA 1B8CA 2H61C 3KF9A 4I5LB 1LVCD 5D69A 3BXKA 2H8VA 4C0KA 3AAJA 2O60A 1MF8B 2P70A 5AXIA 1IJ6A 3UNWA 5AANA 1S26D 1XFUO 4IJ7A 4E68A 1L7ZA 2I2RE 2CNPA 1QX5B 1YVLA 3OP0A 4JD9A 1OQPA 3DVEA 4OR9B 3WNXB 4QJ5B 2JQ6A 2K7CA 4INXA 1NIWA 2KFGA 3IF7A 4DIRA 5KTYA 2KAYA 4GBAA 1K94A 5HL1A 2K2AA 1F55A 1S3PA 2JNXA 2LLTA 1G8IA 2SCPA 4MRYA 4PCWA 2ISDA 2BL0C 2ZN8A 1SNLA 3HX4A 5CSIA 2O5GA 3JVTB 2NLNA 1N65A 5ER5A 4I5JA 1XFYO 1CLMA 1VRKA 1QASA 1FF1A 2JULA 2OTGC 1XK4C 3DVJA 3S0BA 1D1OA 1C07A 3TDIA 1FI6A 3VRRA 1A4PA 1EL4A 4OCIA 1JFJA 2LC5A 3SG3A 1M31A 1EXRA 2HQ8A 2BKHB 3CGAA 3ZWHA 1OOHA 2R2IA 3D77A 1BU3A 4MEWA 4CFRA 4XJKB 2PRUA 4MVFA 5ER4X 1IG5A 2DOQA 1B8LA 4L9MA 4YI9A 1QJTA 2JT8A 4YGEB 1E8AA 3A4UB 3EK8A 1IWQA 2LP3A 2MRDA 2TN4A 1AK8A 3CLNA 2M9GA 1YTZC 2P71A 3K1EA 1OOGA 4MLWA 4KYNA 3TUYC 3TS5C 5DICA 1U5IB 1UHKA 2LAPA 2K2FA 3KEVA 3CS1A 3KPXA 3NXAA 4YGDB 2G9BA 1B1GA 2I94A 4YRUA 1CDPA 1V1FA 3BUOB 1CFDA 2OS8B 3DXLA 1A2XA 5I8NA 1WDCB 1R6PA 3BYAA 1J7OA 2LHIA 2QPTA 2Y5IA 4XYNA 1OMVA 1QWVA 4GNKB 3SG5A 1EJ3A 1SL7A 2KI4C 3CDNA 2BKIB 4PT1A 3O4YA 5FI6A 1M63B 2ZRSA 1MHOA 1Y1AA 2JWWA 2IS9A 3NSOA 1K90D 3L4LA 1BJFA 4M2PA 4ORBB 1ZOTB 2HETA 1N0YA 1JF2A 2JNFA 2YGUA 3I5IB 1CB1A 1Z4HA 2LCPA 4OV2A 4MSPA 1LA0A 3R1PA 4GAOA 2WNDA 1F54A 1PRWA 2OPOA 4TNCA 4A4CA 1S6IA 1QXPA 2BE6A 1SK6D 2LVVA 4PE7A 4FQOA 1TNQA 1DTLA 1Q80A 4NDDA 3S0FA 2GTEA 1UURA 2Q91A 3K21A 1YUTA 1S5GZ 2L2CA 3I5GC 3OHMB 2JT0A 2KAVA 3B88A 2K61A 2BCBA 2PQLA 4GPLB 2ZFDA 2L50A 5GQQC 4HRHA 5HLVA 1K95A 3EKHA 3FIAA 1TCOB 2WCHA 1KK7Y 3QRXA 2QEHA 3PJIA 2JZIA 1Y6WA 3CWGA 2M8UA 2NCOA 1OSAA 1OMRA 1JF0A 3S0GA 3UO9A 3PN7B 1AVSA 1K96A 2KI6D 2L5YA 4R1EA 2K8MB 1BF5A 1KQMC 1R2UA 1KSMA 3JTDB 3FS7A 1CNPA 1S6JA 2KLEA 3PM2A 1BR1B 1OOIX 3M0WA 1AP4A 3IVTA 1TWOA 4ZCUA 3S0DA 2BAPA 1YR5A 4MZLA 1U5IA 1YRUB 1MR8A 2LV7A 5HYDA 4USLA 4YI8A 1F4QA 3JVTC 2QEOA 4PE0A 1WRLA 2LM5A 3EVRA 4MBEA 4NDCA 2F33A 3EK4A 3A8RA 1IQ5A 3PLFB 4F7FA 1XA5A 5HLOA 3VRPA 2BBMA 2Y1NA 2K7BA 2JPOA 4AQIA 5JJGA 4I5NB 1PVAA 1ALWA 1UWOA 1IJ5A 1CFPA 2M1KB 1FW4A 2BNXA 1KFXL 3B87A 1CDMA 3DVMA 3NHTA 1SMGA 3O4XA 3TZ1A 4C0JA 4WRIA 3EVVA 3O6BA 4GGNA 2JTZA 1DT7B 3BFAA 1NYAA 1RJVA 1SL8A 1OOFA 1SR6B 1M45A 1M46A 2BECA 2L98A 3CR2A 4BY4A 2LVIA 5CSJA 1EH2A 1SKTA 3KO0A 1LA3A 4GGFA 4PALA 4YBHB 1GGZA 3VRQA 2MLFC 1DQEA 4I5KA 2WCBA 3PATA 3TDZA 3SIAA 3S0EA 2CXJA 3B6XA 1K2HA 2E30A 2KAXA 1DJWA 1AJ4A 3LL8B 3DY9A 5BPJA 3BFBA 3OB2B 1KSOA 2EC6B 4N5XA 4DCKA 3OX6A 3PFVA 4FTGA 3N7HA 2EGDA 2OS8C 2K7DA 4BY5A 4UPGA 1WDCC 4ORAB 1X02A 4PHJA 1CKKA 1H4BA 3OX5A 2LMVA 1NCZA 1ALVA 2H2KA 1K9UA 1F4OA 3H4SE 3BOWB 1TOPA 2F2OA 3FWCA 1J7RA 3HCMA 1KK8C 4WQ3A 1OOJA 2KYFA 4PE4A 1HQVA 1OE9B 2M1UA 3I5IC 1B7TZ 2M0RA 1CFCA 1L2OB 1K8UA 3BUXB 1BODA 4YGCB 3SJSA 1BMOA 1XFZO 2PYQA 2KFHA 1NCXA 2WORA 1G33A 1IH0A 1UHJA 2LMUA 3DZTA 1RK9A 4P5OE 3AKAA 3S0AA 5CSFA 1QS7A 2LMTA 1DMOA 2AMIA 2FJUB 3BFHA 3QMEA 1KCYA 3WXAA 1GM0A 1AJ5A 3I5HB 2L5XB 2QACA 2NZ0A 2MLEC 3PM8A 1QVIZ 1KWOC 1A29A 5FYXA 1NSHA 1QVIY 3GK2A 1JFKA 3FE8A 1CDNA 2KQ6A 3FWBA 2L4IA 1ZMZA 1PK0D 5D7FA 1ORGA 1SCMB 3SIBA 4OVNF 1F71A 2KSPA 3D78A 1GQMA 1C7VA 2Y4QA 1ODBA 3EG5B 3RM1A 2KNEA 3JTDC 1NUBA 1MWNA 1S6CA 2WCKA 2MJWB 3RLZA 1RWYA 3VGOA 4DRWA 2BL0B 1DJYA 1TNWA 2FCEA 3BQ3A 1DELA 3O78A 2PSRA 2M97A 1SPYA 1TUJA 2OTGB 2KI6C 1DJZA 1ZACA 3D10A 3LLEA 3SS3A 5IBWA 2I18A 1EG4A 2M49B 3LCPC 4AOMA 1OZOA 4ETOA 4N1GA 1S5GY 1CDLA 1UP5A 2WCFA 2JT3A 5AEQA 1QV0A 2ERBA 2ZNEA 1TIZA 2KHNA 2JPTA 1BR4B 3NSIA 4A4BA 2MHHA 1TNPA 2CTNA 2LUXA 4MZKA 1XFXO 1DJIA 2FOTA 1QTXA 2LE9B 3D75A 4GUKA 2LHLA 3BJHA 4XJKA 5TNCA 4FQTA 1J7PA 3LK0A 2COLB 1WY9A 1HT9A 1UUSA 1MUXA 3EKJA 1NP8A 3O2PA 1F8HA 1YVHA 2FCDA 4CLNA 2BE4A 2KYCA 5HKYA 1SR6C 5I2OA 1MQ1A 5I94A 5DKRA 5KU1A 4M2OA 4OKHA 4CIDA 1YRTB 4MZJA 2KQYA 1AUIB 1EG3A 2K7OA 2M3WA 2P6BB 3TUYB 3RZSA 3CR5X 3TS5B 1IQ3A 1YURA 2KFFA 3CR4X 2F2PA 1YX8A 4PHNA 2BBNA 3SG7A 1S36A 2M7NA 5B8IB 3CZ2A 1FPWA 1DVIA 5PALA 3I5FB 3CZ1A 3CZTX 1Z2CB 3AKBA 2KI4B 1SL9A 1DJHA 1YX7A 3WHUB 2KGRA 2WC5A 1BG1A 2KBIA 1A03A 1WLMA 1DJGA 2G2BA 4U8DA 4MN0A 1KFUS 2LNKA 1SYMA 3R1OA 4HSZA 3B86A 3VROA 3R1VA 3C1VA 3LK1A 2VRGA 1QIWA 5D3OA 3SS5A 2JU0A 5FI2A 3CTNA 1XVJA 1WLZA 5K89A 5I2LA 2ZN9A 1QATA 4IL1A 2JTTA 1H8BA 4OZDA 2JRFA 2KOTA 2LLUA 2GV5A 2QEBA 1MXEA 1LXFC 1TUZA 3CABA 3CYZA 1IIOA 5FI7A 1DJXA 3DD4A 1SSEB 3OBVA 1BT6A 1CMGA 2F3YA 1CFFA 2QDIA 3DF0B 3NSLA 5DKQA 1NX2A 3IQOA 4GFTA 2KDHA 1KQMB 1SBJA 1W7JB 4QJ4B 4CPVA 3EVUA 2BCXA 1SCMC 5HKWA 2MAZA 5JOLA 1SCVA 5G08A 2WCEA 1K9KA 5DKNA 2BCAA 1PSRA 4HREE 3SS4A 5I2QA 2F3ZA 3PSRA 2JC2A 1CLBA 1F70A 2WOSA 1S1EA 4WQ2A 3SG6A 1SY9A
chains in the Genus database with same CATH topology
3GK1A 1B7TY 3DVKA 2L2EA 3E3RA 1K9PA 5KSZA 1Y0VH 3SG2A 1B9AA 1W7IB 3GOFA 1OMDA 4C0LA 1DF0B 2LP2A 3D0YB 1CLLA 1GJYA 1J1EA 5CPVA 2Y1MA 3IQQA 4GGFC 2Q4UA 3BUMB 2M29A 2E6WA 4QJ3B 1ZUZA 4JPZB 1J1DA 4Q04A 1A75B 1CM4A 2ZRTA 3BUWB 4PHKA 2RGIA 4DS7A 4MRXA 4PHMA 1N2DA 2JOJA 1OZSA 2ZNDA 4JQ0D 1B8RA 2LANA 2NXQA 1K93D 2GGZA 2LUCA 3PN7C 1NCYA 1Y1XA 3OB1B 1JSAA 1B4CA 1J55A 4F0ZB 5AFPA 3F45A 1NX1A 2JXLA 2F8PA 2CCMA 1AHRA 4JWQA 1LINA 3MSEB 1PSBA 4YGAA 1GGWA 3PALA 3BUNB 2LVKA 2MBXA 1NPQA 1SRAA 3VRNA 3I5FC 3DF0A 1DGVA 2PVBA 1FBVA 4ZCVA 1RROA 4PDZA 4NQGA 2L0PA 1QV1A 1JUOA 1YUUA 3NSKA 1V1GA 3BOWA 2PASA 1KK8B 1IGVA 2K0JA 2KBMA 5F6TA 1C7WA 1XYDA 1QLKA 5HKZA 1BOCA 1JBAA 1QX7A 1TN4A 1CTRA 4DUQA 4M2QA 1TTXA 2V53A 1RECA 3KHEA 3TDUA 1CM1A 2JXCA 5J3XA 2LLSA 3ICBA 4ORCB 1QX2A 2PALA 2CT9A 1RTP1 2L51A 2NCPA 1DF0A 2LVJA 3AAKA 3D0YA 1BLQA 1UHNA 2KGBC 2WC8A 1LKJA 1MXLC 1UHHA 2ZKMX 4N1FA 2H61A 1QIVA 3EK7A 1A75A 1KK7Z 1KWOB 1RFJA 1Y1UA 2AAOA 2I7AA 4P2YB 1UHIA 2D8NA 1WRKA 1J7QA 3SG4A 1FI5A 2EC6C 4YGBB 2HF5A 2HQWA 2PMYA 1IRJA 1PALA 1JWDA 4HRGA 2GGMA 1TRFA 1YUSA 1IKUA 1M39A 2B1UA 2L4HA 2A4JA 4AQJA 4CFQA 2SASA 1TNXA 1SW8A 3GK4X 1ZFSA 2M7LA 4PE1A 1KFXS 1NX0A 1CMFA 1NX3A 2HPSA 5CSNA 1L2OC 1KQVA 1G4YR 1QLSA 1PVBA 1PULA 2CBLA 4D1EA 1WRZA 1XK4A 3ZNIA 1XFWO 5AERA 1JC2A 2MA2A 3I5GB 1XO5A 1NWDA 4ICBA 1B47A 4NDBA 1DGUA 3WHTB 2AUCA 1KFUL 2EHBA 3I5HC 1XFVO 1TCFA 1B8CA 2H61C 3KF9A 4I5LB 1LVCD 5D69A 3BXKA 4C0KA 3AAJA 2O60A 1MF8B 5AXIA 1IJ6A 5AANA 1S26D 1XFUO 4E68A 1L7ZA 2I2RE 2CNPA 1QX5B 1YVLA 3OP0A 4OR9B 1OQPA 3DVEA 3WNXB 4QJ5B 5I2OA 2JQ6A 2K7CA 4DIRA 1NIWA 2KFGA 3IF7A 5KTYA 2KAYA 4GBAA 1K94A 2K2AA 1F55A 1S3PA 2JNXA 2LLTA 1G8IA 2SCPA 4MRYA 4PCWA 2ISDA 2BL0C 2ZN8A 1SNLA 3HX4A 5CSIA 2O5GA 3JVTB 2NLNA 1N65A 5ER5A 4I5JA 1XFYO 1CLMA 1VRKA 1QASA 1FF1A 2JULA 2OTGC 1XK4C 3DVJA 1D1OA 1C07A 3TDIA 1FI6A 3VRRA 1A4PA 1EL4A 4OCIA 1JFJA 2LC5A 3SG3A 1M31A 1EXRA 2HQ8A 2BKHB 3CGAA 3ZWHA 2R2IA 4MEWA 1BU3A 4CFRA 4XJKB 2PRUA 4MVFA 5ER4X 1IG5A 2DOQA 1B8LA 4L9MA 4YI9A 1QJTA 2JT8A 4YGEB 1E8AA 3A4UB 3EK8A 1IWQA 2LP3A 2MRDA 2TN4A 1AK8A 3CLNA 2M9GA 1YTZC 4MLWA 3TUYC 3TS5C 1U5IB 1UHKA 2LAPA 2K2FA 3KEVA 3CS1A 3KPXA 3NXAA 4YGDB 2G9BA 1B1GA 2I94A 4YRUA 1CDPA 1V1FA 3BUOB 1CFDA 2OS8B 1A2XA 5I8NA 1WDCB 1R6PA 3BYAA 1J7OA 2LHIA 2QPTA 2Y5IA 4XYNA 1OMVA 4GNKB 3SG5A 1EJ3A 1SL7A 2KI4C 2BKIB 3O4YA 1M63B 2ZRSA 1MHOA 1Y1AA 2JWWA 2IS9A 3NSOA 1K90D 1BJFA 4M2PA 4ORBB 1ZOTB 2HETA 1N0YA 1JF2A 2JNFA 3I5IB 1CB1A 2LCPA 4OV2A 4MSPA 1LA0A 4GAOA 2WNDA 1F54A 1PRWA 2OPOA 4TNCA 4A4CA 1S6IA 1QXPA 2BE6A 1SK6D 2LVVA 4PE7A 4FQOA 1TNQA 1DTLA 1Q80A 4NDDA 1UURA 2Q91A 3K21A 1YUTA 1S5GZ 3OHMB 3I5GC 2JT0A 2KAVA 2K61A 2BCBA 4GPLB 2ZFDA 2L50A 5GQQC 4HRHA 5HLVA 1K95A 3EKHA 3FIAA 1TCOB 1KK7Y 3QRXA 2JZIA 1Y6WA 3CWGA 2M8UA 2NCOA 1OSAA 1OMRA 1JF0A 3PN7B 1AVSA 1K96A 2KI6D 4R1EA 1BF5A 2K8MB 1KQMC 1R2UA 1KSMA 3JTDB 3FS7A 1CNPA 1S6JA 1AP4A 1BR1B 3M0WA 4ZCUA 1YR5A 4MZLA 1U5IA 1YRUB 1MR8A 2LV7A 5HYDA 4USLA 4YI8A 1F4QA 3JVTC 4PE0A 1WRLA 2LM5A 3EVRA 4MBEA 4NDCA 2F33A 3EK4A 3A8RA 1IQ5A 3PLFB 1XA5A 5HLOA 3VRPA 2BBMA 2Y1NA 2K7BA 5JJGA 4AQIA 4I5NB 1PVAA 1ALWA 1UWOA 1IJ5A 1CFPA 2M1KB 1FW4A 4C0JA 1KFXL 3DVMA 1CDMA 3TZ1A 1SMGA 4WRIA 3EVVA 3O6BA 4GGNA 2JTZA 1DT7B 1NYAA 1RJVA 1SL8A 2BECA 1SR6B 1M45A 1M46A 2L98A 3CR2A 4BY4A 2LVIA 5CSJA 1EH2A 1SKTA 3KO0A 1LA3A 4GGFA 4PALA 4YBHB 1GGZA 3VRQA 2MLFC 4I5KA 2WCBA 3PATA 3TDZA 3SIAA 2CXJA 1K2HA 2E30A 2KAXA 1DJWA 1AJ4A 3LL8B 5BPJA 3OB2B 1KSOA 2EC6B 4N5XA 4DCKA 3OX6A 3PFVA 4FTGA 2EGDA 2OS8C 2K7DA 4BY5A 4UPGA 1WDCC 4ORAB 1X02A 4PHJA 1CKKA 1H4BA 3OX5A 2LMVA 1NCZA 1ALVA 2H2KA 1K9UA 1F4OA 3H4SE 3BOWB 1TOPA 2F2OA 3FWCA 1J7RA 3HCMA 1KK8C 4WQ3A 1OOJA 2KYFA 4PE4A 1HQVA 1OE9B 2M1UA 3I5IC 1B7TZ 2M0RA 1CFCA 1L2OB 1K8UA 3BUXB 1BODA 4YGCB 3SJSA 1BMOA 1XFZO 2KFHA 1NCXA 2WORA 1G33A 1IH0A 1UHJA 2LMUA 1RK9A 4P5OE 3AKAA 5CSFA 1QS7A 2LMTA 1DMOA 2AMIA 2FJUB 1KCYA 3WXAA 1AJ5A 3I5HB 2L5XB 2QACA 2NZ0A 2MLEC 3PM8A 1QVIZ 1KWOC 1A29A 5FYXA 1NSHA 1QVIY 3GK2A 1JFKA 1CDNA 2KQ6A 3FWBA 2L4IA 1ZMZA 1PK0D 5D7FA 1SCMB 3SIBA 4OVNF 1F71A 2KSPA 1GQMA 1C7VA 2Y4QA 1ODBA 3RM1A 2KNEA 3JTDC 1NUBA 1MWNA 1S6CA 2MJWB 3RLZA 1RWYA 3VGOA 4DRWA 2BL0B 1DJYA 1TNWA 2FCEA 3BQ3A 3O78A 2PSRA 2M97A 1SPYA 2OTGB 2KI6C 1DJZA 1ZACA 3D10A 3LLEA 5IBWA 2I18A 1EG4A 2M49B 3LCPC 4AOMA 1OZOA 4ETOA 4N1GA 1S5GY 1CDLA 1UP5A 2WCFA 2JT3A 5AEQA 1QV0A 2ZNEA 1TIZA 2KHNA 2JPTA 1BR4B 3NSIA 4A4BA 2MHHA 1TNPA 2CTNA 2LUXA 4MZKA 1XFXO 1DJIA 2FOTA 1QTXA 2LE9B 4XJKA 4GUKA 2LHLA 5TNCA 1J7PA 3LK0A 2COLB 1WY9A 1HT9A 1UUSA 1MUXA 3EKJA 1NP8A 3O2PA 1F8HA 1YVHA 2FCDA 4CLNA 2BE4A 2KYCA 5HKYA 1SR6C 1MQ1A 5KU1A 5DKRA 4M2OA 4OKHA 4CIDA 1YRTB 4MZJA 2KQYA 1AUIB 1EG3A 2K7OA 2M3WA 2P6BB 3TUYB 3CR5X 3TS5B 1IQ3A 1YURA 2KFFA 3CR4X 2F2PA 1YX8A 4PHNA 2BBNA 3SG7A 1S36A 2M7NA 5B8IB 1FPWA 1DVIA 5PALA 3I5FB 3CZTX 3AKBA 2KI4B 1SL9A 1DJHA 1YX7A 3WHUB 2KGRA 1BG1A 2KBIA 1A03A 1WLMA 1DJGA 2G2BA 4U8DA 4MN0A 1KFUS 2LNKA 1SYMA 4HSZA 3VROA 3C1VA 3LK1A 2VRGA 1QIWA 2JU0A 3CTNA 1XVJA 1WLZA 5K89A 5I2LA 2ZN9A 1QATA 4IL1A 2JTTA 1H8BA 2JRFA 2KOTA 2LLUA 2GV5A 1MXEA 1LXFC 1DJXA 3DD4A 1BT6A 1CMGA 2F3YA 1CFFA 3DF0B 3NSLA 5DKQA 1NX2A 3IQOA 4GFTA 2KDHA 1KQMB 1SBJA 1W7JB 4QJ4B 4CPVA 3EVUA 2BCXA 1SCMC 5HKWA 2MAZA 5JOLA 1SCVA 5G08A 2WCEA 1K9KA 5DKNA 2BCAA 1PSRA 4HREE 5I2QA 2F3ZA 3PSRA 2JC2A 1CLBA 1F70A 2WOSA 1S1EA 4WQ2A 3SG6A 1SY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GK1 A;  1B7T Y;  3DVK A;  2L2E A;  3E3R A;  1K9P A;  5KSZ A;  1Y0V H;  3SG2 A;  1B9A A;  1W7I B;  3GOF A;  1OMD A;  4C0L A;  1DF0 B;  2LP2 A;  3D0Y B;  1CLL A;  1GJY A;  1J1E A;  5CPV A;  2Y1M A;  3IQQ A;  4GGF C;  2Q4U A;  3BUM B;  2M29 A;  2E6W A;  4QJ3 B;  1ZUZ A;  4JPZ B;  1J1D A;  4Q04 A;  1A75 B;  1CM4 A;  2ZRT A;  3BUW B;  4PHK A;  2RGI A;  4DS7 A;  4MRX A;  4PHM A;  1N2D A;  2JOJ A;  1OZS A;  2ZND A;  4JQ0 D;  1B8R A;  2LAN A;  2NXQ A;  1K93 D;  2GGZ A;  2LUC A;  3PN7 C;  1NCY A;  1Y1X A;  3OB1 B;  1JSA A;  1B4C A;  1J55 A;  4F0Z B;  5AFP A;  3F45 A;  1NX1 A;  2JXL A;  2F8P A;  2CCM A;  1AHR A;  4JWQ A;  1LIN A;  3MSE B;  1PSB A;  4YGA A;  1GGW A;  3PAL A;  3BUN B;  2LVK A;  2MBX A;  1NPQ A;  1SRA A;  3VRN A;  3I5F C;  3DF0 A;  1DGV A;  2PVB A;  1FBV A;  4ZCV A;  1RRO A;  4PDZ A;  4NQG A;  2L0P A;  1QV1 A;  1JUO A;  1YUU A;  3NSK A;  1V1G A;  3BOW A;  2PAS A;  1KK8 B;  1IGV A;  2K0J A;  2KBM A;  5F6T A;  1C7W A;  1XYD A;  1QLK A;  5HKZ A;  1BOC A;  1JBA A;  1QX7 A;  1TN4 A;  1CTR A;  4DUQ A;  4M2Q A;  1TTX A;  2V53 A;  1REC A;  3KHE A;  3TDU A;  1CM1 A;  2JXC A;  5J3X A;  2LLS A;  3ICB A;  4ORC B;  1QX2 A;  2PAL A;  2CT9 A;  1RTP 1;  2L51 A;  2NCP A;  1DF0 A;  2LVJ A;  3AAK A;  3D0Y A;  1BLQ A;  1UHN A;  2KGB C;  2WC8 A;  1LKJ A;  1MXL C;  1UHH A;  2ZKM X;  4N1F A;  2H61 A;  1QIV A;  3EK7 A;  1A75 A;  1KK7 Z;  1KWO B;  1RFJ A;  1Y1U A;  2AAO A;  2I7A A;  4P2Y B;  1UHI A;  2D8N A;  1WRK A;  1J7Q A;  3SG4 A;  1FI5 A;  2EC6 C;  4YGB B;  2HF5 A;  2HQW A;  2PMY A;  1IRJ A;  1PAL A;  1JWD A;  4HRG A;  2GGM A;  1TRF A;  1YUS A;  1IKU A;  1M39 A;  2B1U A;  2L4H A;  2A4J A;  4AQJ A;  4CFQ A;  2SAS A;  1TNX A;  1SW8 A;  3GK4 X;  1ZFS A;  2M7L A;  4PE1 A;  1KFX S;  1NX0 A;  1CMF A;  1NX3 A;  2HPS A;  5CSN A;  1L2O C;  1KQV A;  1G4Y R;  1QLS A;  1PVB A;  1PUL A;  2CBL A;  4D1E A;  1WRZ A;  1XK4 A;  3ZNI A;  1XFW O;  5AER A;  1JC2 A;  2MA2 A;  3I5G B;  1XO5 A;  1NWD A;  4ICB A;  1B47 A;  4NDB A;  1DGU A;  3WHT B;  2AUC A;  1KFU L;  2EHB A;  3I5H C;  1XFV O;  1TCF A;  1B8C A;  2H61 C;  3KF9 A;  4I5L B;  1LVC D;  5D69 A;  3BXK A;  4C0K A;  3AAJ A;  2O60 A;  1MF8 B;  5AXI A;  1IJ6 A;  5AAN A;  1S26 D;  1XFU O;  4E68 A;  1L7Z A;  2I2R E;  2CNP A;  1QX5 B;  1YVL A;  3OP0 A;  4OR9 B;  1OQP A;  3DVE A;  3WNX B;  4QJ5 B;  5I2O A;  2JQ6 A;  2K7C A;  4DIR A;  1NIW A;  2KFG A;  3IF7 A;  5KTY A;  2KAY A;  4GBA A;  1K94 A;  2K2A A;  1F55 A;  1S3P A;  2JNX A;  2LLT A;  1G8I A;  2SCP A;  4MRY A;  4PCW A;  2ISD A;  2BL0 C;  2ZN8 A;  1SNL A;  3HX4 A;  5CSI A;  2O5G A;  3JVT B;  2NLN A;  1N65 A;  5ER5 A;  4I5J A;  1XFY O;  1CLM A;  1VRK A;  1QAS A;  1FF1 A;  2JUL A;  2OTG C;  1XK4 C;  3DVJ A;  1D1O A;  1C07 A;  3TDI A;  1FI6 A;  3VRR A;  1A4P A;  1EL4 A;  4OCI A;  1JFJ A;  2LC5 A;  3SG3 A;  1M31 A;  1EXR A;  2HQ8 A;  2BKH B;  3CGA A;  3ZWH A;  2R2I A;  4MEW A;  1BU3 A;  4CFR A;  4XJK B;  2PRU A;  4MVF A;  5ER4 X;  1IG5 A;  2DOQ A;  1B8L A;  4L9M A;  4YI9 A;  1QJT A;  2JT8 A;  4YGE B;  1E8A A;  3A4U B;  3EK8 A;  1IWQ A;  2LP3 A;  2MRD A;  2TN4 A;  1AK8 A;  3CLN A;  2M9G A;  1YTZ C;  4MLW A;  3TUY C;  3TS5 C;  1U5I B;  1UHK A;  2LAP A;  2K2F A;  3KEV A;  3CS1 A;  3KPX A;  3NXA A;  4YGD B;  2G9B A;  1B1G A;  2I94 A;  4YRU A;  1CDP A;  1V1F A;  3BUO B;  1CFD A;  2OS8 B;  1A2X A;  5I8N A;  1WDC B;  1R6P A;  3BYA A;  1J7O A;  2LHI A;  2QPT A;  2Y5I A;  4XYN A;  1OMV A;  4GNK B;  3SG5 A;  1EJ3 A;  1SL7 A;  2KI4 C;  2BKI B;  3O4Y A;  1M63 B;  2ZRS A;  1MHO A;  1Y1A A;  2JWW A;  2IS9 A;  3NSO A;  1K90 D;  1BJF A;  4M2P A;  4ORB B;  1ZOT B;  2HET A;  1N0Y A;  1JF2 A;  2JNF A;  3I5I B;  1CB1 A;  2LCP A;  4OV2 A;  4MSP A;  1LA0 A;  4GAO A;  2WND A;  1F54 A;  1PRW A;  2OPO A;  4TNC A;  4A4C A;  1S6I A;  1QXP A;  2BE6 A;  1SK6 D;  2LVV A;  4PE7 A;  4FQO A;  1TNQ A;  1DTL A;  1Q80 A;  4NDD A;  1UUR A;  2Q91 A;  3K21 A;  1YUT A;  1S5G Z;  3OHM B;  3I5G C;  2JT0 A;  2KAV A;  2K61 A;  2BCB A;  4GPL B;  2ZFD A;  2L50 A;  5GQQ C;  4HRH A;  5HLV A;  1K95 A;  3EKH A;  3FIA A;  1TCO B;  1KK7 Y;  3QRX A;  2JZI A;  1Y6W A;  3CWG A;  2M8U A;  2NCO A;  1OSA A;  1OMR A;  1JF0 A;  3PN7 B;  1AVS A;  1K96 A;  2KI6 D;  4R1E A;  1BF5 A;  2K8M B;  1KQM C;  1R2U A;  1KSM A;  3JTD B;  3FS7 A;  1CNP A;  1S6J A;  1AP4 A;  1BR1 B;  3M0W A;  4ZCU A;  1YR5 A;  4MZL A;  1U5I A;  1YRU B;  1MR8 A;  2LV7 A;  5HYD A;  4USL A;  4YI8 A;  1F4Q A;  3JVT C;  4PE0 A;  1WRL A;  2LM5 A;  3EVR A;  4MBE A;  4NDC A;  2F33 A;  3EK4 A;  3A8R A;  1IQ5 A;  3PLF B;  1XA5 A;  5HLO A;  3VRP A;  2BBM A;  2Y1N A;  2K7B A;  5JJG A;  4AQI A;  4I5N B;  1PVA A;  1ALW A;  1UWO A;  1IJ5 A;  1CFP A;  2M1K B;  1FW4 A;  4C0J A;  1KFX L;  3DVM A;  1CDM A;  3TZ1 A;  1SMG A;  4WRI A;  3EVV A;  3O6B A;  4GGN A;  2JTZ A;  1DT7 B;  1NYA A;  1RJV A;  1SL8 A;  2BEC A;  1SR6 B;  1M45 A;  1M46 A;  2L98 A;  3CR2 A;  4BY4 A;  2LVI A;  5CSJ A;  1EH2 A;  1SKT A;  3KO0 A;  1LA3 A;  4GGF A;  4PAL A;  4YBH B;  1GGZ A;  3VRQ A;  2MLF C;  4I5K A;  2WCB A;  3PAT A;  3TDZ A;  3SIA A;  2CXJ A;  1K2H A;  2E30 A;  2KAX A;  1DJW A;  1AJ4 A;  3LL8 B;  5BPJ A;  3OB2 B;  1KSO A;  2EC6 B;  4N5X A;  4DCK A;  3OX6 A;  3PFV A;  4FTG A;  2EGD A;  2OS8 C;  2K7D A;  4BY5 A;  4UPG A;  1WDC C;  4ORA B;  1X02 A;  4PHJ A;  1CKK A;  1H4B A;  3OX5 A;  2LMV A;  1NCZ A;  1ALV A;  2H2K A;  1K9U A;  1F4O A;  3H4S E;  3BOW B;  1TOP A;  2F2O A;  3FWC A;  1J7R A;  3HCM A;  1KK8 C;  4WQ3 A;  1OOJ A;  2KYF A;  4PE4 A;  1HQV A;  1OE9 B;  2M1U A;  3I5I C;  1B7T Z;  2M0R A;  1CFC A;  1L2O B;  1K8U A;  3BUX B;  1BOD A;  4YGC B;  3SJS A;  1BMO A;  1XFZ O;  2KFH A;  1NCX A;  2WOR A;  1G33 A;  1IH0 A;  1UHJ A;  2LMU A;  1RK9 A;  4P5O E;  3AKA A;  5CSF A;  1QS7 A;  2LMT A;  1DMO A;  2AMI A;  2FJU B;  1KCY A;  3WXA A;  1AJ5 A;  3I5H B;  2L5X B;  2QAC A;  2NZ0 A;  2MLE C;  3PM8 A;  1QVI Z;  1KWO C;  1A29 A;  5FYX A;  1NSH A;  1QVI Y;  3GK2 A;  1JFK A;  1CDN A;  2KQ6 A;  3FWB A;  2L4I A;  1ZMZ A;  1PK0 D;  5D7F A;  1SCM B;  3SIB A;  4OVN F;  1F71 A;  2KSP A;  1GQM A;  1C7V A;  2Y4Q A;  1ODB A;  3RM1 A;  2KNE A;  3JTD C;  1NUB A;  1MWN A;  1S6C A;  2MJW B;  3RLZ A;  1RWY A;  3VGO A;  4DRW A;  2BL0 B;  1DJY A;  1TNW A;  2FCE A;  3BQ3 A;  3O78 A;  2PSR A;  2M97 A;  1SPY A;  2OTG B;  2KI6 C;  1DJZ A;  1ZAC A;  3D10 A;  3LLE A;  5IBW A;  2I18 A;  1EG4 A;  2M49 B;  3LCP C;  4AOM A;  1OZO A;  4ETO A;  4N1G A;  1S5G Y;  1CDL A;  1UP5 A;  2WCF A;  2JT3 A;  5AEQ A;  1QV0 A;  2ZNE A;  1TIZ A;  2KHN A;  2JPT A;  1BR4 B;  3NSI A;  4A4B A;  2MHH A;  1TNP A;  2CTN A;  2LUX A;  4MZK A;  1XFX O;  1DJI A;  2FOT A;  1QTX A;  2LE9 B;  4XJK A;  4GUK A;  2LHL A;  5TNC A;  1J7P A;  3LK0 A;  2COL B;  1WY9 A;  1HT9 A;  1UUS A;  1MUX A;  3EKJ A;  1NP8 A;  3O2P A;  1F8H A;  1YVH A;  2FCD A;  4CLN A;  2BE4 A;  2KYC A;  5HKY A;  1SR6 C;  1MQ1 A;  5KU1 A;  5DKR A;  4M2O A;  4OKH A;  4CID A;  1YRT B;  4MZJ A;  2KQY A;  1AUI B;  1EG3 A;  2K7O A;  2M3W A;  2P6B B;  3TUY B;  3CR5 X;  3TS5 B;  1IQ3 A;  1YUR A;  2KFF A;  3CR4 X;  2F2P A;  1YX8 A;  4PHN A;  2BBN A;  3SG7 A;  1S36 A;  2M7N A;  5B8I B;  1FPW A;  1DVI A;  5PAL A;  3I5F B;  3CZT X;  3AKB A;  2KI4 B;  1SL9 A;  1DJH A;  1YX7 A;  3WHU B;  2KGR A;  1BG1 A;  2KBI A;  1A03 A;  1WLM A;  1DJG A;  2G2B A;  4U8D A;  4MN0 A;  1KFU S;  2LNK A;  1SYM A;  4HSZ A;  3VRO A;  3C1V A;  3LK1 A;  2VRG A;  1QIW A;  2JU0 A;  3CTN A;  1XVJ A;  1WLZ A;  5K89 A;  5I2L A;  2ZN9 A;  1QAT A;  4IL1 A;  2JTT A;  1H8B A;  2JRF A;  2KOT A;  2LLU A;  2GV5 A;  1MXE A;  1LXF C;  1DJX A;  3DD4 A;  1BT6 A;  1CMG A;  2F3Y A;  1CFF A;  3DF0 B;  3NSL A;  5DKQ A;  1NX2 A;  3IQO A;  4GFT A;  2KDH A;  1KQM B;  1SBJ A;  1W7J B;  4QJ4 B;  4CPV A;  3EVU A;  2BCX A;  1SCM C;  5HKW A;  2MAZ A;  5JOL A;  1SCV A;  5G08 A;  2WCE A;  1K9K A;  5DKN A;  2BCA A;  1PSR A;  4HRE E;  5I2Q A;  2F3Z A;  3PSR A;  2JC2 A;  1CLB A;  1F70 A;  2WOS A;  1S1E A;  4WQ2 A;  3SG6 A;  1SY9 A; 
#chains in the Genus database with same CATH topology
 3GK1 A;  1B7T Y;  3DVK A;  2L2E A;  3Q8I A;  3E3R A;  1K9P A;  5KSZ A;  1Y0V H;  5EL2 A;  1DEK A;  1B9A A;  1W7I B;  3GOF A;  3SG2 A;  1OMD A;  4C0L A;  1DF0 B;  2LP2 A;  3D0Y B;  3DYE A;  3L47 A;  1DC1 A;  1CLL A;  1GJY A;  1J1E A;  5CPV A;  2Y1M A;  3IQQ A;  4GGF C;  2Q4U A;  3BUM B;  2M29 A;  2E6W A;  4QJ3 B;  1ZUZ A;  3VB1 A;  4JPZ B;  1J1D A;  4Q04 A;  1A75 B;  1CM4 A;  2ZRT A;  3BUW B;  4PHK A;  2RGI A;  2K60 A;  2FJY A;  4MRX A;  4DS7 A;  4PHM A;  1N2D A;  2JOJ A;  1OZS A;  2ZND A;  4JKT A;  1B8R A;  2LAN A;  2NXQ A;  4JQ0 D;  1C3Y A;  1K93 D;  2GGZ A;  2LUC A;  3PN7 C;  1NCY A;  1Y1X A;  2KPH A;  2WC6 A;  3OB1 B;  1JSA A;  1B4C A;  1J55 A;  4F0Z B;  5AFP A;  3CZ0 A;  3F45 A;  1NX1 A;  2JXL A;  2F8P A;  2CCM A;  1AHR A;  4JWQ A;  1LIN A;  3MSE B;  1PSB A;  4YGA A;  1GGW A;  1T14 A;  1W9Z A;  3PAL A;  3BUN B;  3FE6 A;  2LVK A;  2MBX A;  1NPQ A;  1SRA A;  3VRN A;  3I5F C;  3DF0 A;  1DGV A;  1OW4 A;  2PVB A;  1FBV A;  4ZCV A;  1RRO A;  1XFR A;  4PDZ A;  4NQG A;  2L0P A;  1QV1 A;  1JUO A;  1YUU A;  2QEV A;  3NSK A;  1V1G A;  3BOW A;  2PAS A;  1KK8 B;  1IGV A;  2K0J A;  2KBM A;  5F6T A;  1C7W A;  1XYD A;  1QLK A;  3L4A A;  5HKZ A;  1BOC A;  1JBA A;  1QX7 A;  1TN4 A;  1CTR A;  4DUQ A;  4M2Q A;  3D73 A;  1TTX A;  2V53 A;  1REC A;  3KHE A;  3TDU A;  1CM1 A;  2JXC A;  5J3X A;  2LLS A;  3ICB A;  4ORC B;  1QX2 A;  2PAL A;  2CT9 A;  1RTP 1;  2L51 A;  1C3Z A;  3FE9 A;  2NCP A;  3V2L A;  1DF0 A;  2LVJ A;  3AAK A;  3D0Y A;  1BLQ A;  1UHN A;  2KGB C;  2WC8 A;  1P28 A;  1LKJ A;  1MXL C;  1UHH A;  2ZKM X;  4N1F A;  2H61 A;  1QIV A;  3EK7 A;  1A75 A;  2WCM A;  3D74 A;  1KK7 Z;  1KWO B;  2KLD A;  1RFJ A;  1Y1U A;  2AAO A;  2I7A A;  3D76 A;  4P2Y B;  1UHI A;  2D8N A;  1WRK A;  1J7Q A;  3SG4 A;  1FI5 A;  2EC6 C;  4YGB B;  2HF5 A;  2HQW A;  3NHI A;  2PMY A;  1IRJ A;  1PAL A;  1JWD A;  4HRG A;  2GGM A;  1TRF A;  1YUS A;  1IKU A;  1M39 A;  2B1U A;  2L4H A;  2A4J A;  3NGV A;  4AQJ A;  1LS8 A;  4CFQ A;  2SAS A;  1TNX A;  1SW8 A;  3GK4 X;  1ZFS A;  4INW A;  2M7L A;  4PE1 A;  1KFX S;  1NX0 A;  1CMF A;  2WCJ A;  3B7A A;  1NX3 A;  2HPS A;  5CSN A;  1L2O C;  1KQV A;  1G4Y R;  1QLS A;  1PVB A;  1PUL A;  2CBL A;  3OGN A;  1WRZ A;  1XK4 A;  2WCL A;  1XFW O;  3ZNI A;  4D1E A;  5AER A;  1JC2 A;  2MA2 A;  3I5G B;  1XO5 A;  1NWD A;  4ICB A;  1B47 A;  3R72 A;  4NDB A;  1DGU A;  3WHT B;  2AUC A;  1KFU L;  2EHB A;  3I5H C;  1XFV O;  1TCF A;  1B8C A;  2H61 C;  3KF9 A;  4I5L B;  1LVC D;  5D69 A;  3BXK A;  2H8V A;  4C0K A;  3AAJ A;  2O60 A;  1MF8 B;  2P70 A;  5AXI A;  1IJ6 A;  3UNW A;  5AAN A;  1S26 D;  1XFU O;  4IJ7 A;  4E68 A;  1L7Z A;  2I2R E;  2CNP A;  1QX5 B;  1YVL A;  3OP0 A;  4JD9 A;  1OQP A;  3DVE A;  4OR9 B;  3WNX B;  4QJ5 B;  2JQ6 A;  2K7C A;  4INX A;  1NIW A;  2KFG A;  3IF7 A;  4DIR A;  5KTY A;  2KAY A;  4GBA A;  1K94 A;  5HL1 A;  2K2A A;  1F55 A;  1S3P A;  2JNX A;  2LLT A;  1G8I A;  2SCP A;  4MRY A;  4PCW A;  2ISD A;  2BL0 C;  2ZN8 A;  1SNL A;  3HX4 A;  5CSI A;  2O5G A;  3JVT B;  2NLN A;  1N65 A;  5ER5 A;  4I5J A;  1XFY O;  1CLM A;  1VRK A;  1QAS A;  1FF1 A;  2JUL A;  2OTG C;  1XK4 C;  3DVJ A;  3S0B A;  1D1O A;  1C07 A;  3TDI A;  1FI6 A;  3VRR A;  1A4P A;  1EL4 A;  4OCI A;  1JFJ A;  2LC5 A;  3SG3 A;  1M31 A;  1EXR A;  2HQ8 A;  2BKH B;  3CGA A;  3ZWH A;  1OOH A;  2R2I A;  3D77 A;  1BU3 A;  4MEW A;  4CFR A;  4XJK B;  2PRU A;  4MVF A;  5ER4 X;  1IG5 A;  2DOQ A;  1B8L A;  4L9M A;  4YI9 A;  1QJT A;  2JT8 A;  4YGE B;  1E8A A;  3A4U B;  3EK8 A;  1IWQ A;  2LP3 A;  2MRD A;  2TN4 A;  1AK8 A;  3CLN A;  2M9G A;  1YTZ C;  2P71 A;  3K1E A;  1OOG A;  4MLW A;  4KYN A;  3TUY C;  3TS5 C;  5DIC A;  1U5I B;  1UHK A;  2LAP A;  2K2F A;  3KEV A;  3CS1 A;  3KPX A;  3NXA A;  4YGD B;  2G9B A;  1B1G A;  2I94 A;  4YRU A;  1CDP A;  1V1F A;  3BUO B;  1CFD A;  2OS8 B;  3DXL A;  1A2X A;  5I8N A;  1WDC B;  1R6P A;  3BYA A;  1J7O A;  2LHI A;  2QPT A;  2Y5I A;  4XYN A;  1OMV A;  1QWV A;  4GNK B;  3SG5 A;  1EJ3 A;  1SL7 A;  2KI4 C;  3CDN A;  2BKI B;  4PT1 A;  3O4Y A;  5FI6 A;  1M63 B;  2ZRS A;  1MHO A;  1Y1A A;  2JWW A;  2IS9 A;  3NSO A;  1K90 D;  3L4L A;  1BJF A;  4M2P A;  4ORB B;  1ZOT B;  2HET A;  1N0Y A;  1JF2 A;  2JNF A;  2YGU A;  3I5I B;  1CB1 A;  1Z4H A;  2LCP A;  4OV2 A;  4MSP A;  1LA0 A;  3R1P A;  4GAO A;  2WND A;  1F54 A;  1PRW A;  2OPO A;  4TNC A;  4A4C A;  1S6I A;  1QXP A;  2BE6 A;  1SK6 D;  2LVV A;  4PE7 A;  4FQO A;  1TNQ A;  1DTL A;  1Q80 A;  4NDD A;  3S0F A;  2GTE A;  1UUR A;  2Q91 A;  3K21 A;  1YUT A;  1S5G Z;  2L2C A;  3I5G C;  3OHM B;  2JT0 A;  2KAV A;  3B88 A;  2K61 A;  2BCB A;  2PQL A;  4GPL B;  2ZFD A;  2L50 A;  5GQQ C;  4HRH A;  5HLV A;  1K95 A;  3EKH A;  3FIA A;  1TCO B;  2WCH A;  1KK7 Y;  3QRX A;  2QEH A;  3PJI A;  2JZI A;  1Y6W A;  3CWG A;  2M8U A;  2NCO A;  1OSA A;  1OMR A;  1JF0 A;  3S0G A;  3UO9 A;  3PN7 B;  1AVS A;  1K96 A;  2KI6 D;  2L5Y A;  4R1E A;  2K8M B;  1BF5 A;  1KQM C;  1R2U A;  1KSM A;  3JTD B;  3FS7 A;  1CNP A;  1S6J A;  2KLE A;  3PM2 A;  1BR1 B;  1OOI X;  3M0W A;  1AP4 A;  3IVT A;  1TWO A;  4ZCU A;  3S0D A;  2BAP A;  1YR5 A;  4MZL A;  1U5I A;  1YRU B;  1MR8 A;  2LV7 A;  5HYD A;  4USL A;  4YI8 A;  1F4Q A;  3JVT C;  2QEO A;  4PE0 A;  1WRL A;  2LM5 A;  3EVR A;  4MBE A;  4NDC A;  2F33 A;  3EK4 A;  3A8R A;  1IQ5 A;  3PLF B;  4F7F A;  1XA5 A;  5HLO A;  3VRP A;  2BBM A;  2Y1N A;  2K7B A;  2JPO A;  4AQI A;  5JJG A;  4I5N B;  1PVA A;  1ALW A;  1UWO A;  1IJ5 A;  1CFP A;  2M1K B;  1FW4 A;  2BNX A;  1KFX L;  3B87 A;  1CDM A;  3DVM A;  3NHT A;  1SMG A;  3O4X A;  3TZ1 A;  4C0J A;  4WRI A;  3EVV A;  3O6B A;  4GGN A;  2JTZ A;  1DT7 B;  3BFA A;  1NYA A;  1RJV A;  1SL8 A;  1OOF A;  1SR6 B;  1M45 A;  1M46 A;  2BEC A;  2L98 A;  3CR2 A;  4BY4 A;  2LVI A;  5CSJ A;  1EH2 A;  1SKT A;  3KO0 A;  1LA3 A;  4GGF A;  4PAL A;  4YBH B;  1GGZ A;  3VRQ A;  2MLF C;  1DQE A;  4I5K A;  2WCB A;  3PAT A;  3TDZ A;  3SIA A;  3S0E A;  2CXJ A;  3B6X A;  1K2H A;  2E30 A;  2KAX A;  1DJW A;  1AJ4 A;  3LL8 B;  3DY9 A;  5BPJ A;  3BFB A;  3OB2 B;  1KSO A;  2EC6 B;  4N5X A;  4DCK A;  3OX6 A;  3PFV A;  4FTG A;  3N7H A;  2EGD A;  2OS8 C;  2K7D A;  4BY5 A;  4UPG A;  1WDC C;  4ORA B;  1X02 A;  4PHJ A;  1CKK A;  1H4B A;  3OX5 A;  2LMV A;  1NCZ A;  1ALV A;  2H2K A;  1K9U A;  1F4O A;  3H4S E;  3BOW B;  1TOP A;  2F2O A;  3FWC A;  1J7R A;  3HCM A;  1KK8 C;  4WQ3 A;  1OOJ A;  2KYF A;  4PE4 A;  1HQV A;  1OE9 B;  2M1U A;  3I5I C;  1B7T Z;  2M0R A;  1CFC A;  1L2O B;  1K8U A;  3BUX B;  1BOD A;  4YGC B;  3SJS A;  1BMO A;  1XFZ O;  2PYQ A;  2KFH A;  1NCX A;  2WOR A;  1G33 A;  1IH0 A;  1UHJ A;  2LMU A;  3DZT A;  1RK9 A;  4P5O E;  3AKA A;  3S0A A;  5CSF A;  1QS7 A;  2LMT A;  1DMO A;  2AMI A;  2FJU B;  3BFH A;  3QME A;  1KCY A;  3WXA A;  1GM0 A;  1AJ5 A;  3I5H B;  2L5X B;  2QAC A;  2NZ0 A;  2MLE C;  3PM8 A;  1QVI Z;  1KWO C;  1A29 A;  5FYX A;  1NSH A;  1QVI Y;  3GK2 A;  1JFK A;  3FE8 A;  1CDN A;  2KQ6 A;  3FWB A;  2L4I A;  1ZMZ A;  1PK0 D;  5D7F A;  1ORG A;  1SCM B;  3SIB A;  4OVN F;  1F71 A;  2KSP A;  3D78 A;  1GQM A;  1C7V A;  2Y4Q A;  1ODB A;  3EG5 B;  3RM1 A;  2KNE A;  3JTD C;  1NUB A;  1MWN A;  1S6C A;  2WCK A;  2MJW B;  3RLZ A;  1RWY A;  3VGO A;  4DRW A;  2BL0 B;  1DJY A;  1TNW A;  2FCE A;  3BQ3 A;  1DEL A;  3O78 A;  2PSR A;  2M97 A;  1SPY A;  1TUJ A;  2OTG B;  2KI6 C;  1DJZ A;  1ZAC A;  3D10 A;  3LLE A;  3SS3 A;  5IBW A;  2I18 A;  1EG4 A;  2M49 B;  3LCP C;  4AOM A;  1OZO A;  4ETO A;  4N1G A;  1S5G Y;  1CDL A;  1UP5 A;  2WCF A;  2JT3 A;  5AEQ A;  1QV0 A;  2ERB A;  2ZNE A;  1TIZ A;  2KHN A;  2JPT A;  1BR4 B;  3NSI A;  4A4B A;  2MHH A;  1TNP A;  2CTN A;  2LUX A;  4MZK A;  1XFX O;  1DJI A;  2FOT A;  1QTX A;  2LE9 B;  3D75 A;  4GUK A;  2LHL A;  3BJH A;  4XJK A;  5TNC A;  4FQT A;  1J7P A;  3LK0 A;  2COL B;  1WY9 A;  1HT9 A;  1UUS A;  1MUX A;  3EKJ A;  1NP8 A;  3O2P A;  1F8H A;  1YVH A;  2FCD A;  4CLN A;  2BE4 A;  2KYC A;  5HKY A;  1SR6 C;  5I2O A;  1MQ1 A;  5I94 A;  5DKR A;  5KU1 A;  4M2O A;  4OKH A;  4CID A;  1YRT B;  4MZJ A;  2KQY A;  1AUI B;  1EG3 A;  2K7O A;  2M3W A;  2P6B B;  3TUY B;  3RZS A;  3CR5 X;  3TS5 B;  1IQ3 A;  1YUR A;  2KFF A;  3CR4 X;  2F2P A;  1YX8 A;  4PHN A;  2BBN A;  3SG7 A;  1S36 A;  2M7N A;  5B8I B;  3CZ2 A;  1FPW A;  1DVI A;  5PAL A;  3I5F B;  3CZ1 A;  3CZT X;  1Z2C B;  3AKB A;  2KI4 B;  1SL9 A;  1DJH A;  1YX7 A;  3WHU B;  2KGR A;  2WC5 A;  1BG1 A;  2KBI A;  1A03 A;  1WLM A;  1DJG A;  2G2B A;  4U8D A;  4MN0 A;  1KFU S;  2LNK A;  1SYM A;  3R1O A;  4HSZ A;  3B86 A;  3VRO A;  3R1V A;  3C1V A;  3LK1 A;  2VRG A;  1QIW A;  5D3O A;  3SS5 A;  2JU0 A;  5FI2 A;  3CTN A;  1XVJ A;  1WLZ A;  5K89 A;  5I2L A;  2ZN9 A;  1QAT A;  4IL1 A;  2JTT A;  1H8B A;  4OZD A;  2JRF A;  2KOT A;  2LLU A;  2GV5 A;  2QEB A;  1MXE A;  1LXF C;  1TUZ A;  3CAB A;  3CYZ A;  1IIO A;  5FI7 A;  1DJX A;  3DD4 A;  1SSE B;  3OBV A;  1BT6 A;  1CMG A;  2F3Y A;  1CFF A;  2QDI A;  3DF0 B;  3NSL A;  5DKQ A;  1NX2 A;  3IQO A;  4GFT A;  2KDH A;  1KQM B;  1SBJ A;  1W7J B;  4QJ4 B;  4CPV A;  3EVU A;  2BCX A;  1SCM C;  5HKW A;  2MAZ A;  5JOL A;  1SCV A;  5G08 A;  2WCE A;  1K9K A;  5DKN A;  2BCA A;  1PSR A;  4HRE E;  3SS4 A;  5I2Q A;  2F3Z A;  3PSR A;  2JC2 A;  1CLB A;  1F70 A;  2WOS A;  1S1E A;  4WQ2 A;  3SG6 A;  1SY9 A; 
#chains in the Genus database with same CATH homology
 3GK1 A;  1B7T Y;  3DVK A;  2L2E A;  3E3R A;  1K9P A;  5KSZ A;  1Y0V H;  3SG2 A;  1B9A A;  1W7I B;  3GOF A;  1OMD A;  4C0L A;  1DF0 B;  2LP2 A;  3D0Y B;  1CLL A;  1GJY A;  1J1E A;  5CPV A;  2Y1M A;  3IQQ A;  4GGF C;  2Q4U A;  3BUM B;  2M29 A;  2E6W A;  4QJ3 B;  1ZUZ A;  4JPZ B;  1J1D A;  4Q04 A;  1A75 B;  1CM4 A;  2ZRT A;  3BUW B;  4PHK A;  2RGI A;  4DS7 A;  4MRX A;  4PHM A;  1N2D A;  2JOJ A;  1OZS A;  2ZND A;  4JQ0 D;  1B8R A;  2LAN A;  2NXQ A;  1K93 D;  2GGZ A;  2LUC A;  3PN7 C;  1NCY A;  1Y1X A;  3OB1 B;  1JSA A;  1B4C A;  1J55 A;  4F0Z B;  5AFP A;  3F45 A;  1NX1 A;  2JXL A;  2F8P A;  2CCM A;  1AHR A;  4JWQ A;  1LIN A;  3MSE B;  1PSB A;  4YGA A;  1GGW A;  3PAL A;  3BUN B;  2LVK A;  2MBX A;  1NPQ A;  1SRA A;  3VRN A;  3I5F C;  3DF0 A;  1DGV A;  2PVB A;  1FBV A;  4ZCV A;  1RRO A;  4PDZ A;  4NQG A;  2L0P A;  1QV1 A;  1JUO A;  1YUU A;  3NSK A;  1V1G A;  3BOW A;  2PAS A;  1KK8 B;  1IGV A;  2K0J A;  2KBM A;  5F6T A;  1C7W A;  1XYD A;  1QLK A;  5HKZ A;  1BOC A;  1JBA A;  1QX7 A;  1TN4 A;  1CTR A;  4DUQ A;  4M2Q A;  1TTX A;  2V53 A;  1REC A;  3KHE A;  3TDU A;  1CM1 A;  2JXC A;  5J3X A;  2LLS A;  3ICB A;  4ORC B;  1QX2 A;  2PAL A;  2CT9 A;  1RTP 1;  2L51 A;  2NCP A;  1DF0 A;  2LVJ A;  3AAK A;  3D0Y A;  1BLQ A;  1UHN A;  2KGB C;  2WC8 A;  1LKJ A;  1MXL C;  1UHH A;  2ZKM X;  4N1F A;  2H61 A;  1QIV A;  3EK7 A;  1A75 A;  1KK7 Z;  1KWO B;  1RFJ A;  1Y1U A;  2AAO A;  2I7A A;  4P2Y B;  1UHI A;  2D8N A;  1WRK A;  1J7Q A;  3SG4 A;  1FI5 A;  2EC6 C;  4YGB B;  2HF5 A;  2HQW A;  2PMY A;  1IRJ A;  1PAL A;  1JWD A;  4HRG A;  2GGM A;  1TRF A;  1YUS A;  1IKU A;  1M39 A;  2B1U A;  2L4H A;  2A4J A;  4AQJ A;  4CFQ A;  2SAS A;  1TNX A;  1SW8 A;  3GK4 X;  1ZFS A;  2M7L A;  4PE1 A;  1KFX S;  1NX0 A;  1CMF A;  1NX3 A;  2HPS A;  5CSN A;  1L2O C;  1KQV A;  1G4Y R;  1QLS A;  1PVB A;  1PUL A;  2CBL A;  4D1E A;  1WRZ A;  1XK4 A;  3ZNI A;  1XFW O;  5AER A;  1JC2 A;  2MA2 A;  3I5G B;  1XO5 A;  1NWD A;  4ICB A;  1B47 A;  4NDB A;  1DGU A;  3WHT B;  2AUC A;  1KFU L;  2EHB A;  3I5H C;  1XFV O;  1TCF A;  1B8C A;  2H61 C;  3KF9 A;  4I5L B;  1LVC D;  5D69 A;  3BXK A;  4C0K A;  3AAJ A;  2O60 A;  1MF8 B;  5AXI A;  1IJ6 A;  5AAN A;  1S26 D;  1XFU O;  4E68 A;  1L7Z A;  2I2R E;  2CNP A;  1QX5 B;  1YVL A;  3OP0 A;  4OR9 B;  1OQP A;  3DVE A;  3WNX B;  4QJ5 B;  5I2O A;  2JQ6 A;  2K7C A;  4DIR A;  1NIW A;  2KFG A;  3IF7 A;  5KTY A;  2KAY A;  4GBA A;  1K94 A;  2K2A A;  1F55 A;  1S3P A;  2JNX A;  2LLT A;  1G8I A;  2SCP A;  4MRY A;  4PCW A;  2ISD A;  2BL0 C;  2ZN8 A;  1SNL A;  3HX4 A;  5CSI A;  2O5G A;  3JVT B;  2NLN A;  1N65 A;  5ER5 A;  4I5J A;  1XFY O;  1CLM A;  1VRK A;  1QAS A;  1FF1 A;  2JUL A;  2OTG C;  1XK4 C;  3DVJ A;  1D1O A;  1C07 A;  3TDI A;  1FI6 A;  3VRR A;  1A4P A;  1EL4 A;  4OCI A;  1JFJ A;  2LC5 A;  3SG3 A;  1M31 A;  1EXR A;  2HQ8 A;  2BKH B;  3CGA A;  3ZWH A;  2R2I A;  4MEW A;  1BU3 A;  4CFR A;  4XJK B;  2PRU A;  4MVF A;  5ER4 X;  1IG5 A;  2DOQ A;  1B8L A;  4L9M A;  4YI9 A;  1QJT A;  2JT8 A;  4YGE B;  1E8A A;  3A4U B;  3EK8 A;  1IWQ A;  2LP3 A;  2MRD A;  2TN4 A;  1AK8 A;  3CLN A;  2M9G A;  1YTZ C;  4MLW A;  3TUY C;  3TS5 C;  1U5I B;  1UHK A;  2LAP A;  2K2F A;  3KEV A;  3CS1 A;  3KPX A;  3NXA A;  4YGD B;  2G9B A;  1B1G A;  2I94 A;  4YRU A;  1CDP A;  1V1F A;  3BUO B;  1CFD A;  2OS8 B;  1A2X A;  5I8N A;  1WDC B;  1R6P A;  3BYA A;  1J7O A;  2LHI A;  2QPT A;  2Y5I A;  4XYN A;  1OMV A;  4GNK B;  3SG5 A;  1EJ3 A;  1SL7 A;  2KI4 C;  2BKI B;  3O4Y A;  1M63 B;  2ZRS A;  1MHO A;  1Y1A A;  2JWW A;  2IS9 A;  3NSO A;  1K90 D;  1BJF A;  4M2P A;  4ORB B;  1ZOT B;  2HET A;  1N0Y A;  1JF2 A;  2JNF A;  3I5I B;  1CB1 A;  2LCP A;  4OV2 A;  4MSP A;  1LA0 A;  4GAO A;  2WND A;  1F54 A;  1PRW A;  2OPO A;  4TNC A;  4A4C A;  1S6I A;  1QXP A;  2BE6 A;  1SK6 D;  2LVV A;  4PE7 A;  4FQO A;  1TNQ A;  1DTL A;  1Q80 A;  4NDD A;  1UUR A;  2Q91 A;  3K21 A;  1YUT A;  1S5G Z;  3OHM B;  3I5G C;  2JT0 A;  2KAV A;  2K61 A;  2BCB A;  4GPL B;  2ZFD A;  2L50 A;  5GQQ C;  4HRH A;  5HLV A;  1K95 A;  3EKH A;  3FIA A;  1TCO B;  1KK7 Y;  3QRX A;  2JZI A;  1Y6W A;  3CWG A;  2M8U A;  2NCO A;  1OSA A;  1OMR A;  1JF0 A;  3PN7 B;  1AVS A;  1K96 A;  2KI6 D;  4R1E A;  1BF5 A;  2K8M B;  1KQM C;  1R2U A;  1KSM A;  3JTD B;  3FS7 A;  1CNP A;  1S6J A;  1AP4 A;  1BR1 B;  3M0W A;  4ZCU A;  1YR5 A;  4MZL A;  1U5I A;  1YRU B;  1MR8 A;  2LV7 A;  5HYD A;  4USL A;  4YI8 A;  1F4Q A;  3JVT C;  4PE0 A;  1WRL A;  2LM5 A;  3EVR A;  4MBE A;  4NDC A;  2F33 A;  3EK4 A;  3A8R A;  1IQ5 A;  3PLF B;  1XA5 A;  5HLO A;  3VRP A;  2BBM A;  2Y1N A;  2K7B A;  5JJG A;  4AQI A;  4I5N B;  1PVA A;  1ALW A;  1UWO A;  1IJ5 A;  1CFP A;  2M1K B;  1FW4 A;  4C0J A;  1KFX L;  3DVM A;  1CDM A;  3TZ1 A;  1SMG A;  4WRI A;  3EVV A;  3O6B A;  4GGN A;  2JTZ A;  1DT7 B;  1NYA A;  1RJV A;  1SL8 A;  2BEC A;  1SR6 B;  1M45 A;  1M46 A;  2L98 A;  3CR2 A;  4BY4 A;  2LVI A;  5CSJ A;  1EH2 A;  1SKT A;  3KO0 A;  1LA3 A;  4GGF A;  4PAL A;  4YBH B;  1GGZ A;  3VRQ A;  2MLF C;  4I5K A;  2WCB A;  3PAT A;  3TDZ A;  3SIA A;  2CXJ A;  1K2H A;  2E30 A;  2KAX A;  1DJW A;  1AJ4 A;  3LL8 B;  5BPJ A;  3OB2 B;  1KSO A;  2EC6 B;  4N5X A;  4DCK A;  3OX6 A;  3PFV A;  4FTG A;  2EGD A;  2OS8 C;  2K7D A;  4BY5 A;  4UPG A;  1WDC C;  4ORA B;  1X02 A;  4PHJ A;  1CKK A;  1H4B A;  3OX5 A;  2LMV A;  1NCZ A;  1ALV A;  2H2K A;  1K9U A;  1F4O A;  3H4S E;  3BOW B;  1TOP A;  2F2O A;  3FWC A;  1J7R A;  3HCM A;  1KK8 C;  4WQ3 A;  1OOJ A;  2KYF A;  4PE4 A;  1HQV A;  1OE9 B;  2M1U A;  3I5I C;  1B7T Z;  2M0R A;  1CFC A;  1L2O B;  1K8U A;  3BUX B;  1BOD A;  4YGC B;  3SJS A;  1BMO A;  1XFZ O;  2KFH A;  1NCX A;  2WOR A;  1G33 A;  1IH0 A;  1UHJ A;  2LMU A;  1RK9 A;  4P5O E;  3AKA A;  5CSF A;  1QS7 A;  2LMT A;  1DMO A;  2AMI A;  2FJU B;  1KCY A;  3WXA A;  1AJ5 A;  3I5H B;  2L5X B;  2QAC A;  2NZ0 A;  2MLE C;  3PM8 A;  1QVI Z;  1KWO C;  1A29 A;  5FYX A;  1NSH A;  1QVI Y;  3GK2 A;  1JFK A;  1CDN A;  2KQ6 A;  3FWB A;  2L4I A;  1ZMZ A;  1PK0 D;  5D7F A;  1SCM B;  3SIB A;  4OVN F;  1F71 A;  2KSP A;  1GQM A;  1C7V A;  2Y4Q A;  1ODB A;  3RM1 A;  2KNE A;  3JTD C;  1NUB A;  1MWN A;  1S6C A;  2MJW B;  3RLZ A;  1RWY A;  3VGO A;  4DRW A;  2BL0 B;  1DJY A;  1TNW A;  2FCE A;  3BQ3 A;  3O78 A;  2PSR A;  2M97 A;  1SPY A;  2OTG B;  2KI6 C;  1DJZ A;  1ZAC A;  3D10 A;  3LLE A;  5IBW A;  2I18 A;  1EG4 A;  2M49 B;  3LCP C;  4AOM A;  1OZO A;  4ETO A;  4N1G A;  1S5G Y;  1CDL A;  1UP5 A;  2WCF A;  2JT3 A;  5AEQ A;  1QV0 A;  2ZNE A;  1TIZ A;  2KHN A;  2JPT A;  1BR4 B;  3NSI A;  4A4B A;  2MHH A;  1TNP A;  2CTN A;  2LUX A;  4MZK A;  1XFX O;  1DJI A;  2FOT A;  1QTX A;  2LE9 B;  4XJK A;  4GUK A;  2LHL A;  5TNC A;  1J7P A;  3LK0 A;  2COL B;  1WY9 A;  1HT9 A;  1UUS A;  1MUX A;  3EKJ A;  1NP8 A;  3O2P A;  1F8H A;  1YVH A;  2FCD A;  4CLN A;  2BE4 A;  2KYC A;  5HKY A;  1SR6 C;  1MQ1 A;  5KU1 A;  5DKR A;  4M2O A;  4OKH A;  4CID A;  1YRT B;  4MZJ A;  2KQY A;  1AUI B;  1EG3 A;  2K7O A;  2M3W A;  2P6B B;  3TUY B;  3CR5 X;  3TS5 B;  1IQ3 A;  1YUR A;  2KFF A;  3CR4 X;  2F2P A;  1YX8 A;  4PHN A;  2BBN A;  3SG7 A;  1S36 A;  2M7N A;  5B8I B;  1FPW A;  1DVI A;  5PAL A;  3I5F B;  3CZT X;  3AKB A;  2KI4 B;  1SL9 A;  1DJH A;  1YX7 A;  3WHU B;  2KGR A;  1BG1 A;  2KBI A;  1A03 A;  1WLM A;  1DJG A;  2G2B A;  4U8D A;  4MN0 A;  1KFU S;  2LNK A;  1SYM A;  4HSZ A;  3VRO A;  3C1V A;  3LK1 A;  2VRG A;  1QIW A;  2JU0 A;  3CTN A;  1XVJ A;  1WLZ A;  5K89 A;  5I2L A;  2ZN9 A;  1QAT A;  4IL1 A;  2JTT A;  1H8B A;  2JRF A;  2KOT A;  2LLU A;  2GV5 A;  1MXE A;  1LXF C;  1DJX A;  3DD4 A;  1BT6 A;  1CMG A;  2F3Y A;  1CFF A;  3DF0 B;  3NSL A;  5DKQ A;  1NX2 A;  3IQO A;  4GFT A;  2KDH A;  1KQM B;  1SBJ A;  1W7J B;  4QJ4 B;  4CPV A;  3EVU A;  2BCX A;  1SCM C;  5HKW A;  2MAZ A;  5JOL A;  1SCV A;  5G08 A;  2WCE A;  1K9K A;  5DKN A;  2BCA A;  1PSR A;  4HRE E;  5I2Q A;  2F3Z A;  3PSR A;  2JC2 A;  1CLB A;  1F70 A;  2WOS A;  1S1E A;  4WQ2 A;  3SG6 A;  1SY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...