4M2PA

Crystal structure of a non-myristoylated c39d recoverin mutant with one calcium ion bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
192
structure length
192
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKEDPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Recoverin
total genus 78
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2pA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2pA01
2MJWB 1V1FA 2AAOA 2M3WA 1K96A 3SG5A 4HREE 2ZRSA 1YRTB 2QACA 4PALA 3DVJA 2MAZA 2MA2A 4N1FA 3TUYC 1FI5A 1JSAA 1TCOB 2OS8C 3O6BA 2CNPA 3NXAA 4PHMA 1XVJA 2HF5A 2JT0A 4UPGA 1PSBA 1OSAA 1NCXA 2LUCA 1BU3A 3TUYB 1RK9A 2L4IA 2F33A 2LUXA 4GUKA 3BOWB 1GGZA 2BCAA 4ICBA 1F4QA 3OHMB 1CMFA 3DVKA 4YI8A 2GGZA 2R2IA 1UUSA 3NSOA 3AAKA 2L5XB 4Q04A 3VGOA 1TOPA 2JNFA 3BUWB 4ZCVA 1F70A 4PHNA 3DD4A 5D7FA 2KI4B 4MN0A 4GNKB 1AJ4A 2M49B 2BE6A 2V53A 2LLUA 1J7RA 3D0YA 4HRGA 2L0PA 1XFWO 3OP0A 1Y1AA 1A75B 1WRKA 1CTRA 1SL9A 2LMVA 2MLFC 2KYCA 4AQJA 2FCDA 1S26D 2F3ZA 3GK1A 3RM1A 1XFYO 1V1GA 4PDZA 3A4UB 1BG1A 1UHJA 1S6JA 1OOJA 3H4SE 3AKAA 4PCWA 1MUXA 1WLMA 1QIVA 1S1EA 1ZFSA 1U5IB 1ZOTB 2LP3A 5HLOA 1QVIY 3I5IC 3QRXA 5DKQA 1ZUZA 3JVTB 1K95A 4DCKA 1NCZA 1KQMC 1KFXS 1JWDA 3GOFA 4WQ2A 3CR2A 4FQOA 3VROA 1CLLA 3LL8B 3VRRA 2F2OA 1BT6A 2HQWA 1W7JB 3EK4A 1UHKA 2ISDA 4NDCA 2CT9A 1N2DA 1DF0B 2EHBA 1NSHA 1XK4C 1JFKA 2E30A 1J1DA 1J7PA 1TNPA 1QXPA 4WQ3A 2ZN9A 2QPTA 2VRGA 2FCEA 2I7AA 4MLWA 4CFRA 1CFPA 1UHIA 3PN7C 3SG7A 1QV0A 3SJSA 2LMUA 1CM1A 2JXLA 4I5JA 5F6TA 1DGVA 2NCOA 2Q91A 4M2QA 4ORAB 5I2LA 1A75A 1Y1XA 2I18A 3ZNIA 2MHHA 5GQQC 2KDHA 4ZCUA 4OVNF 4OCIA 1SCMB 1K94A 3BQ3A 3K21A 3EVRA 1CLBA 1KWOC 2LVKA 2ZRTA 3LK0A 3BYAA 1CNPA 1OQPA 1CDNA 1B8RA 1XO5A 4P2YB 2M8UA 1TIZA 1SRAA 1QASA 5DKRA 2H61C 1Q80A 1F54A 3KF9A 1Y1UA 1WLZA 3CR4X 3IQOA 2I2RE 2Y1NA 2JXCA 3BUNB 2K7CA 1YRUB 3NSLA 1TNWA 2CBLA 1OZSA 1YX7A 4YBHB 1M39A 1KK7Y 1YUUA 1YVHA 2BBNA 1A4PA 4MBEA 1FPWA 3I5GB 5ER5A 2WCFA 2LVIA 3PALA 1J7OA 5HYDA 1AJ5A 4NDDA 2B1UA 2LVJA 1S5GZ 1N0YA 2H2KA 2JRFA 1NX3A 1DJYA 2HPSA 2EC6B 1RROA 3VRNA 1ALWA 1K9PA 3I5FB 4MZLA 1K2HA 4QJ4B 1QLSA 1LXFC 1UWOA 1LA0A 1IGVA 2PVBA 4P5OE 1SY9A 1A29A 1QV1A 1F8HA 3EVUA 4CFQA 1SR6B 1CDPA 2HETA 1DMOA 1YTZC 1XFXO 3CS1A 1M63B 2L50A 2M29A 5HLVA 2KAVA 4CPVA 1DTLA 3BUOB 3PSRA 4ORBB 5DKNA 1MHOA 2NZ0A 3MSEB 3BXKA 1YR5A 1K9KA 1SK6D 2LC5A 3PN7B 1BF5A 3TZ1A 2OS8B 3PLFB 4DIRA 4YI9A 4JPZB 4YGDB 1EL4A 1MXEA 4YRUA 1KK8C 2CCMA 3NSIA 3WHTB 2BL0B 3IF7A 4MZJA 2PALA 1A03A 1NX0A 4GPLB 2DOQA 1OMDA 1QVIZ 1Y6WA 2LM5A 3DVMA 3SG3A 4F0ZB 1DJIA 1YUTA 1AUIB 1JF2A 4C0KA 3C1VA 1M46A 1S6IA 1F4OA 2JTZA 2O5GA 5TNCA 2KAYA 2KHNA 1NYAA 4HRHA 5AERA 1DJXA 1NUBA 1LA3A 1EG3A 1WRZA 2PASA 1SL8A 2BBMA 2GV5A 5FYXA 3VRQA 1BR4B 2KI6D 3EK8A 2G9BA 4M2PA 1UHHA 3DF0A 2KGBC 2LP2A 2K61A 2G2BA 1GGWA 4GBAA 3FWCA 2WNDA 1CMGA 2JOJA 4JWQA 1XA5A 3NSKA 4PE0A 1KFXL 1G8IA 5K89A 2LLTA 4NQGA 2A4JA 2I94A 2LV7A 3CGAA 4NDBA 1UP5A 1AHRA 1UURA 1F55A 3WHUB 4DRWA 3TS5B 2OPOA 5ER4X 1HT9A 1ZMZA 3RLZA 1QATA 1K90D 1B8CA 1CKKA 2P6BB 1SW8A 4GAOA 1F71A 1SYMA 1IQ5A 2ZKMX 2JWWA 2M7NA 1C7WA 4GGFA 4MRYA 1G4YR 1BODA 2M1KB 2JZIA 2K7DA 3SG4A 1SR6C 1K8UA 2LANA 1NP8A 3JVTC 2ZNDA 4XJKB 4C0JA 3D0YB 2K0JA 4JQ0D 1KSOA 1TTXA 1IQ3A 1SPYA 1JF0A 3EK7A 2LMTA 4MSPA 2EC6C 4AQIA 3ICBA 2O60A 3BUMB 1CDLA 5JOLA 1KQVA 1DF0A 3HX4A 2E6WA 4BY4A 1WRLA 1XFZO 2Q4UA 3ZWHA 1SNLA 5D69A 4D1EA 1B4CA 2KBMA 2LLSA 1SBJA 2BCBA 1M45A 3EKHA 1OZOA 4I5KA 1MF8B 2WOSA 3CWGA 4YGEB 1L2OC 5I2OA 3M0WA 1CLMA 1AVSA 1DJHA 4I5NB 1W7IB 4R1EA 4CIDA 1FF1A 1KFUS 1YUSA 3SG6A 1FW4A 2MLEC 3EVVA 1PULA 5G08A 2JNXA 1GJYA 3LK1A 1TNXA 2CTNA 1PRWA 1TN4A 2KYFA 2M1UA 1XFUO 3KEVA 2NCPA 2OTGC 2WCBA 1KK7Z 3IQQA 1XK4A 3WNXB 4HSZA 1CFDA 1DJWA 2KNEA 1KK8B 4BY5A 1NX2A 1WY9A 1ODBA 5AXIA 5J3XA 2KSPA 2KFHA 2LHLA 1JC2A 1PSRA 1DT7B 2NLNA 1YURA 2L98A 1EH2A 1QX7A 2JC2A 4I5LB 1XFVO 4PE1A 2LE9B 4IL1A 1RWYA 1DJZA 1SKTA 2BE4A 3I5HC 1OE9B 2LVVA 2KAXA 1DGUA 2JULA 3TDZA 3KHEA 1CB1A 1FBVA 2D8NA 1N65A 1M31A 2ZFDA 3SIAA 3PATA 2F3YA 1EXRA 1TRFA 3WXAA 5KU1A 5JJGA 3FWBA 1L7ZA 2LNKA 2KFFA 1S3PA 3LCPC 2M97A 3JTDB 1A2XA 4A4CA 4CLNA 3O4YA 5HKWA 1NIWA 2KFGA 3BOWA 1QX2A 3JTDC 1H8BA 5AANA 2Y4QA 4PE4A 3KO0A 1XYDA 3I5HB 1BJFA 2K7OA 3I5GC 1U5IA 5AFPA 5B8IB 4MRXA 5KSZA 1BLQA 3AKBA 3EKJA 4ORCB 1J1EA 2M0RA 1LINA 3PFVA 4YGCB 5PALA 2F2PA 4TNCA 1RTP1 1NX1A 1S5GY 1B8LA 5I2QA 1G33A 1SL7A 2SASA 4OV2A 5IBWA 1JBAA 1L2OB 3GK2A 1VRKA 3O2PA 1KCYA 2COLB 3D10A 1TCFA 1UHNA 1RJVA 2GGMA 1MR8A 4QJ5B 1CDMA 1TNQA 2BECA 1H4BA 3E3RA 3F45A 1Y0VH 5HKZA 3KPXA 4PHKA 1YVLA 1QS7A 1QTXA 1BR1B 1IRJA 1OMVA 3CR5X 1EG4A 2K7BA 1YX8A 4MEWA 1BOCA 2JT3A 1KQMB 2EGDA 2JQ6A 1IH0A 2CXJA 2Y1MA 3BUXB 2LCPA 3OB2B 1R6PA 5CPVA 1B1GA 1FI6A 2JT8A 3FS7A 1ZACA 2BKHB 2WC8A 2AMIA 1B7TZ 2KQ6A 3DF0B 4A4BA 5BPJA 1J7QA 1NCYA 1LKJA 4DS7A 5CSJA 2AUCA 4N5XA 1S6CA 3O78A 5HKYA 1C7VA 1EJ3A 3PM8A 2JTTA 3SIBA 3LLEA 3FIAA 4XYNA 1X02A 2OTGB 2ZNEA 2FOTA 2BKIB 1K9UA 2M9GA 1AK8A 4E68A 1GQMA 4XJKA 5AEQA 2M7LA 1IJ5A 1B9AA 5CSIA 4N1GA 2K8MB 2TN4A 4MVFA 1LVCD 1JFJA 1CFCA 3I5IB 2L2EA 1IG5A 3HCMA 5I8NA 2KQYA 1PALA 4L9MA 2KI6C 1SCMC 3GK4X 1HQVA 2K2FA 3TS5C 4PE7A 5CSNA 2KOTA 2KI4C 1KSMA 4C0LA 4PHJA 2K2AA 2PSRA 4GFTA 1AP4A 2NXQA 4GGNA 1R2UA 1DVIA 1PVBA 3A8RA 4YGAA 1MWNA 3VRPA 3CZTX 3OX6A 2LAPA 1QLKA 2MBXA 1BMOA 1CFFA 2BL0C 1IJ6A 1CM4A 2KBIA 3CLNA 4M2OA 4WRIA 2L51A 1B47A 2WORA 1MXLC 2PRUA 2RGIA 4DUQA 1DJGA 1SMGA 1NWDA 5CSFA 1S36A 4YGBB 2H61A 4ETOA 1E8AA 1PK0D 3OX5A 1JUOA 2IS9A 4USLA 3I5FC 2Y5IA 1QX5B 1K93D 2F8PA 1PVAA 2WCEA 1J55A 3TDIA 3DVEA 3CTNA 5KTYA 2HQ8A 2JPTA 2LHIA 1QIWA 2ZN8A 4QJ3B 4AOMA 3SG2A 3TDUA 4MZKA 2SCPA 1OMRA 4FTGA 1ALVA 2L4HA 4GGFC 1C07A 1KWOB 1KFUL 4OR9B 1B7TY 1QJTA 2KGRA 1IWQA 1WDCC 4OKHA 1D1OA 2MRDA 2PMYA 2BCXA 3OB1B 3AAJA 2FJUB 2JU0A 1SCVA 1WDCB 1IKUA 4U8DA 1MQ1A 1NPQA 1RFJA 1RECA
chains in the Genus database with same CATH superfamily
2MJWB 1V1FA 2AAOA 2M3WA 1K96A 2P71A 3SG5A 4HREE 2ZRSA 1YRTB 2QACA 4PALA 3DVJA 2MAZA 2MA2A 1OOGA 1P28A 3DYEA 4N1FA 1TCOB 3S0BA 2OS8C 3O6BA 2CNPA 3NXAA 4PHMA 1XVJA 2HF5A 2JT0A 4UPGA 1IIOA 3BJHA 1PSBA 1OSAA 1NCXA 2LUCA 1BU3A 3TUYB 1RK9A 2L4IA 2F33A 2LUXA 4GUKA 3BOWB 1GGZA 2BCAA 4ICBA 1F4QA 3OHMB 1CMFA 3DVKA 4YI8A 2GGZA 1ORGA 2R2IA 1UUSA 3NSOA 3AAKA 1DEKA 1LS8A 3CDNA 2L5XB 3D77A 4Q04A 3VGOA 1TOPA 2JNFA 3BUWB 4ZCVA 3S0GA 1F70A 4PHNA 3DD4A 5D7FA 2KI4B 4MN0A 4GNKB 1AJ4A 1DQEA 2M49B 2BE6A 2K60A 2V53A 2LLUA 1J7RA 3D0YA 4HRGA 2L0PA 1XFWO 3OP0A 2WCJA 1Y1AA 1A75B 4KYNA 1WRKA 3D75A 1CTRA 1SL9A 2LMVA 2MLFC 2KYCA 4AQJA 2FCDA 1S26D 2F3ZA 3GK1A 3RM1A 1XFYO 1V1GA 4PDZA 3A4UB 1BG1A 1UHJA 1S6JA 1OOJA 3H4SE 3AKAA 4PCWA 1MUXA 1WLMA 1ZFSA 1QIVA 1S1EA 1ZOTB 1U5IB 1OW4A 2LP3A 4PT1A 5HLOA 1QVIY 3I5IC 3QRXA 5DKQA 1ZUZA 3JVTB 1OOHA 1K95A 4DCKA 1NCZA 1KQMC 1KFXS 3S0AA 1JWDA 3GOFA 4WQ2A 3CR2A 4FQOA 3VROA 1CLLA 2PYQA 3LL8B 3SS5A 3VRRA 2F2OA 1BT6A 2HQWA 1W7JB 3EK4A 1UHKA 2ISDA 4NDCA 2CT9A 1N2DA 1DF0B 2P70A 2EHBA 1NSHA 1XK4C 1JFKA 2E30A 1J1DA 1J7PA 1TNPA 1QXPA 4WQ3A 2ZN9A 2QPTA 2VRGA 2FCEA 2I7AA 4MLWA 4CFRA 2KLEA 1CFPA 1UHIA 3PN7C 3SG7A 1QV0A 3SJSA 2JPOA 2LMUA 3L4LA 1CM1A 2JXLA 4I5JA 5F6TA 3NHIA 1DGVA 2NCOA 2Q91A 4M2QA 4ORAB 5I2LA 5DICA 1A75A 1Y1XA 2I18A 3ZNIA 2MHHA 5GQQC 2KDHA 4ZCUA 4OVNF 4OCIA 1SCMB 1OOFA 1K94A 3BQ3A 3K21A 3EVRA 1CLBA 1KWOC 2LVKA 2ZRTA 3LK0A 3FE9A 3BYAA 1CNPA 1OQPA 1CDNA 1B8RA 1XO5A 4P2YB 3B6XA 2M8UA 1TIZA 1SRAA 1QASA 5DKRA 2H61C 4JKTA 1DC1A 1Q80A 3DY9A 1F54A 3KF9A 5FI2A 1Y1UA 1WLZA 3CR4X 3IQOA 2I2RE 2Y1NA 2JXCA 3BUNB 2K7CA 1YRUB 3V2LA 3NSLA 1TNWA 2CBLA 1OZSA 1YX7A 3NGVA 4YBHB 1M39A 1KK7Y 1YUUA 1YVHA 2BBNA 1A4PA 4MBEA 5FI7A 3I5GB 5ER5A 2WCFA 1FPWA 2LVIA 3BFBA 3PALA 1J7OA 5HYDA 1AJ5A 4NDDA 2B1UA 2LVJA 1S5GZ 1N0YA 3OBVA 2H2KA 2JRFA 1NX3A 1DJYA 1TUJA 2HPSA 2EC6B 1RROA 3VRNA 1ALWA 1K9PA 3I5FB 4MZLA 1K2HA 4QJ4B 1QLSA 1LXFC 1UWOA 1LA0A 1IGVA 2PVBA 2L5YA 4P5OE 1SY9A 1A29A 1QV1A 1F8HA 3EVUA 4CFQA 1SR6B 1CDPA 2HETA 1DMOA 1YTZC 1XFXO 3IVTA 3CS1A 1M63B 2L50A 2M29A 5HLVA 2KAVA 4CPVA 1DTLA 3BUOB 3CZ2A 2WCLA 3O4XA 3PSRA 4ORBB 5DKNA 1MHOA 2NZ0A 5HL1A 3MSEB 3BXKA 1YR5A 1K9KA 1SK6D 2LC5A 3PN7B 1BF5A 3TZ1A 2OS8B 3PLFB 4DIRA 4YI9A 4JPZB 4YGDB 1EL4A 1MXEA 4YRUA 1KK8C 2CCMA 3NSIA 3WHTB 3D78A 2BL0B 3SS4A 3B7AA 3IF7A 4MZJA 2PALA 1A03A 1NX0A 4GPLB 2DOQA 1OMDA 1QVIZ 1Y6WA 2LM5A 3DVMA 3SG3A 4F0ZB 1DJIA 1YUTA 1AUIB 1JF2A 4C0KA 3C1VA 1M46A 1S6IA 1F4OA 2JTZA 2O5GA 5TNCA 2KAYA 2KHNA 1NYAA 4HRHA 5AERA 1DJXA 1NUBA 1LA3A 1EG3A 1WRZA 2BNXA 2PASA 4JD9A 1SL8A 3OGNA 2BBMA 2GV5A 5FYXA 3VRQA 1BR4B 3S0DA 2KI6D 3EK8A 2G9BA 4M2PA 3RZSA 1UHHA 4F7FA 3DF0A 2KGBC 2LP2A 2QEOA 2K61A 2G2BA 3EG5B 1GGWA 3QMEA 3FWCA 4GBAA 2WNDA 1T14A 1CMGA 2JOJA 3PJIA 4JWQA 1XA5A 3NSKA 4PE0A 1KFXL 1G8IA 2ERBA 5K89A 2LLTA 4NQGA 2A4JA 2I94A 2LV7A 3CGAA 4NDBA 1UP5A 1AHRA 1UURA 1F55A 3WHUB 4DRWA 3TS5B 2OPOA 1TUZA 5ER4X 1HT9A 1ZMZA 3RLZA 1QATA 1K90D 1B8CA 1CKKA 2P6BB 1SW8A 4GAOA 1F71A 1SYMA 1IQ5A 2KPHA 1C3YA 2ZKMX 2JWWA 2M7NA 1C7WA 4GGFA 4MRYA 1G4YR 1BODA 1OOIX 1TWOA 2M1KB 2JZIA 2K7DA 3SG4A 1SR6C 1K8UA 2LANA 1NP8A 3JVTC 2ZNDA 4XJKB 4C0JA 2WCKA 3D0YB 2K0JA 4JQ0D 1KSOA 1TTXA 1IQ3A 1SPYA 1JF0A 3EK7A 3UO9A 2LMTA 4MSPA 2EC6C 4AQIA 3ICBA 2O60A 3BUMB 3L4AA 5I94A 1CDLA 5JOLA 1KQVA 1DF0A 3HX4A 2E6WA 4BY4A 1WRLA 1XFZO 2Q4UA 3ZWHA 1SNLA 5D69A 4D1EA 1B4CA 2KBMA 2LLSA 1SBJA 2BCBA 1M45A 3EKHA 1OZOA 4I5KA 1MF8B 2BAPA 5D3OA 2WOSA 3CWGA 4YGEB 1L2OC 5I2OA 3M0WA 3S0EA 1CLMA 1AVSA 1DJHA 4I5NB 1W7IB 4R1EA 4CIDA 1FF1A 1KFUS 1YUSA 3SG6A 1FW4A 2MLEC 1QWVA 1PULA 3EVVA 5G08A 2GTEA 1GJYA 2JNXA 1TNXA 2CTNA 3LK1A 1PRWA 1TN4A 2KYFA 2M1UA 3R1VA 5FI6A 1XFUO 3FE8A 3R1PA 3KEVA 2NCPA 2OTGC 2WCBA 1KK7Z 3IQQA 3NHTA 1XK4A 2QEHA 3R72A 3WNXB 4HSZA 1GM0A 1CFDA 1DJWA 2KNEA 1KK8B 4BY5A 1NX2A 1WY9A 1ODBA 3B86A 5AXIA 2KSPA 2KFHA 2LHLA 5J3XA 1JC2A 1PSRA 1DT7B 2NLNA 1YURA 2L98A 1EH2A 1DELA 1QX7A 2JC2A 4I5LB 1XFVO 1W9ZA 4PE1A 2LE9B 4IL1A 1RWYA 1DJZA 1SKTA 2BE4A 3I5HC 1OE9B 2LVVA 2KAXA 1DGUA 2JULA 3TDZA 3KHEA 1CB1A 1FBVA 2D8NA 1N65A 1M31A 2ZFDA 3SIAA 3PATA 2F3YA 3UNWA 1EXRA 1TRFA 2KLDA 3WXAA 5JJGA 5KU1A 3FWBA 1L7ZA 2LNKA 2KFFA 1S3PA 3LCPC 2M97A 3JTDB 1A2XA 4A4CA 4CLNA 3O4YA 5HKWA 3DXLA 1NIWA 2KFGA 3BOWA 1QX2A 3JTDC 1H8BA 5AANA 1SSEB 2Y4QA 4PE4A 1JSAA 3KO0A 1XYDA 3I5HB 1BJFA 2K7OA 3I5GC 1U5IA 5AFPA 5B8IB 4MRXA 5KSZA 1BLQA 3AKBA 3EKJA 3N7HA 4ORCB 1J1EA 2M0RA 1LINA 3PFVA 4YGCB 5PALA 2F2PA 4TNCA 3FE6A 1RTP1 1NX1A 1S5GY 1B8LA 2QEBA 1G33A 1SL7A 2SASA 4OV2A 3K1EA 5I2QA 5IBWA 1Z4HA 1L2OB 1JBAA 3GK2A 3BFHA 2H8VA 2FJYA 1VRKA 3O2PA 1KCYA 2COLB 3D10A 3SS3A 1TCFA 1UHNA 1RJVA 2GGMA 1MR8A 4QJ5B 1CDMA 1TNQA 3PM2A 2BECA 1H4BA 3E3RA 3F45A 1Y0VH 5HKZA 3KPXA 4PHKA 3R1OA 1YVLA 1QS7A 1QTXA 2L2CA 3Q8IA 3DZTA 4INWA 1BR1B 1IRJA 1OMVA 3CR5X 1EG4A 2K7BA 1YX8A 4MEWA 1C3ZA 1BOCA 2WC6A 2JT3A 1KQMB 2EGDA 2JQ6A 1IH0A 2WC5A 2CXJA 2Y1MA 3D73A 3BUXB 2LCPA 3OB2B 1R6PA 5CPVA 1B1GA 1FI6A 3D76A 2JT8A 1FI5A 2WCMA 3S0FA 3FS7A 1ZACA 2BKHB 3L47A 2WC8A 2AMIA 3D74A 1B7TZ 2KQ6A 3DF0B 4A4BA 5BPJA 1J7QA 1NCYA 1LKJA 2WCHA 5CSJA 2AUCA 4N5XA 1S6CA 4DS7A 4IJ7A 3O78A 5HKYA 1C7VA 1EJ3A 3PM8A 2JTTA 3SIBA 3LLEA 4FQTA 3FIAA 4XYNA 1X02A 2OTGB 2ZNEA 2QDIA 2FOTA 2BKIB 1K9UA 2M9GA 1AK8A 1Z2CB 3TUYC 2PQLA 4E68A 1GQMA 4XJKA 3CZ1A 5AEQA 2M7LA 1IJ5A 1B9AA 5CSIA 4N1GA 2K8MB 2TN4A 4MVFA 1LVCD 1JFJA 1CFCA 3I5IB 2L2EA 2YGUA 1IG5A 3HCMA 5EL2A 5I8NA 2KQYA 1PALA 4L9MA 2KI6C 1SCMC 3GK4X 1HQVA 2K2FA 3TS5C 4PE7A 5CSNA 2KOTA 2KI4C 1KSMA 4C0LA 4PHJA 2K2AA 2PSRA 4GFTA 1AP4A 2NXQA 4GGNA 1R2UA 1DVIA 1PVBA 3A8RA 4INXA 1MWNA 4YGAA 3VRPA 3CZTX 3OX6A 2LAPA 1QLKA 2MBXA 1BMOA 1CFFA 2BL0C 1IJ6A 1CM4A 2KBIA 3CLNA 4M2OA 4WRIA 2L51A 1B47A 2WORA 1MXLC 2PRUA 2RGIA 4DUQA 1DJGA 1SMGA 1NWDA 5CSFA 1S36A 4YGBB 2H61A 4ETOA 1E8AA 1PK0D 3OX5A 1JUOA 2IS9A 4USLA 3I5FC 3VB1A 2Y5IA 1QX5B 1K93D 1XFRA 2F8PA 1PVAA 2WCEA 1J55A 3TDIA 3DVEA 3CTNA 5KTYA 2HQ8A 2JPTA 2LHIA 1QIWA 2ZN8A 4QJ3B 4AOMA 3SG2A 3TDUA 4MZKA 2QEVA 2SCPA 3CABA 1OMRA 3B87A 1ALVA 2L4HA 3CYZA 4FTGA 4GGFC 1C07A 3BFAA 1KWOB 1KFUL 4OR9B 1B7TY 1QJTA 2KGRA 3CZ0A 1IWQA 1WDCC 4OKHA 1D1OA 2MRDA 2PMYA 2BCXA 3OB1B 3AAJA 2FJUB 2JU0A 1SCVA 1WDCB 1IKUA 4U8DA 1MQ1A 1NPQA 1RFJA 4OZDA 1RECA 3B88A
chains in the Genus database with same CATH topology
2MJWB 1V1FA 2AAOA 2M3WA 1K96A 3SG5A 4HREE 2ZRSA 1YRTB 2QACA 4PALA 3DVJA 2MAZA 2MA2A 4N1FA 3TUYC 1FI5A 1JSAA 1TCOB 2OS8C 3O6BA 2CNPA 3NXAA 4PHMA 1XVJA 2HF5A 2JT0A 4UPGA 1PSBA 1OSAA 1NCXA 2LUCA 1BU3A 3TUYB 1RK9A 2L4IA 2F33A 2LUXA 4GUKA 3BOWB 1GGZA 2BCAA 4ICBA 1F4QA 3OHMB 1CMFA 3DVKA 4YI8A 2GGZA 2R2IA 1UUSA 3NSOA 3AAKA 2L5XB 4Q04A 3VGOA 1TOPA 2JNFA 3BUWB 4ZCVA 1F70A 4PHNA 3DD4A 5D7FA 2KI4B 4MN0A 4GNKB 1AJ4A 2M49B 2BE6A 2V53A 2LLUA 1J7RA 3D0YA 4HRGA 2L0PA 1XFWO 3OP0A 1Y1AA 1A75B 1WRKA 1CTRA 1SL9A 2LMVA 2MLFC 2KYCA 4AQJA 2FCDA 1S26D 2F3ZA 3GK1A 3RM1A 1XFYO 1V1GA 4PDZA 3A4UB 1BG1A 1UHJA 1S6JA 1OOJA 3H4SE 3AKAA 4PCWA 1MUXA 1WLMA 1QIVA 1S1EA 1ZFSA 1U5IB 1ZOTB 2LP3A 5HLOA 1QVIY 3I5IC 3QRXA 5DKQA 1ZUZA 3JVTB 1K95A 4DCKA 1NCZA 1KQMC 1KFXS 1JWDA 3GOFA 4WQ2A 3CR2A 4FQOA 3VROA 1CLLA 3LL8B 3VRRA 2F2OA 1BT6A 2HQWA 1W7JB 3EK4A 1UHKA 2ISDA 4NDCA 2CT9A 1N2DA 1DF0B 2EHBA 1NSHA 1XK4C 1JFKA 2E30A 1J1DA 1J7PA 1TNPA 1QXPA 4WQ3A 2ZN9A 2QPTA 2VRGA 2FCEA 2I7AA 4MLWA 4CFRA 1CFPA 1UHIA 3PN7C 3SG7A 1QV0A 3SJSA 2LMUA 1CM1A 2JXLA 4I5JA 5F6TA 1DGVA 2NCOA 2Q91A 4M2QA 4ORAB 5I2LA 1A75A 1Y1XA 2I18A 3ZNIA 2MHHA 5GQQC 2KDHA 4ZCUA 4OVNF 4OCIA 1SCMB 1K94A 3BQ3A 3K21A 3EVRA 1CLBA 1KWOC 2LVKA 2ZRTA 3LK0A 3BYAA 1CNPA 1OQPA 1CDNA 1B8RA 1XO5A 4P2YB 2M8UA 1TIZA 1SRAA 1QASA 5DKRA 2H61C 1Q80A 1F54A 3KF9A 1Y1UA 1WLZA 3CR4X 3IQOA 2I2RE 2Y1NA 2JXCA 3BUNB 2K7CA 1YRUB 3NSLA 1TNWA 2CBLA 1OZSA 1YX7A 4YBHB 1M39A 1KK7Y 1YUUA 1YVHA 2BBNA 1A4PA 4MBEA 1FPWA 3I5GB 5ER5A 2WCFA 2LVIA 3PALA 1J7OA 5HYDA 1AJ5A 4NDDA 2B1UA 2LVJA 1S5GZ 1N0YA 2H2KA 2JRFA 1NX3A 1DJYA 2HPSA 2EC6B 1RROA 3VRNA 1ALWA 1K9PA 3I5FB 4MZLA 1K2HA 4QJ4B 1QLSA 1LXFC 1UWOA 1LA0A 1IGVA 2PVBA 4P5OE 1SY9A 1A29A 1QV1A 1F8HA 3EVUA 4CFQA 1SR6B 1CDPA 2HETA 1DMOA 1YTZC 1XFXO 3CS1A 1M63B 2L50A 2M29A 5HLVA 2KAVA 4CPVA 1DTLA 3BUOB 3PSRA 4ORBB 5DKNA 1MHOA 2NZ0A 3MSEB 3BXKA 1YR5A 1K9KA 1SK6D 2LC5A 3PN7B 1BF5A 3TZ1A 2OS8B 3PLFB 4DIRA 4YI9A 4JPZB 4YGDB 1EL4A 1MXEA 4YRUA 1KK8C 2CCMA 3NSIA 3WHTB 2BL0B 3IF7A 4MZJA 2PALA 1A03A 1NX0A 4GPLB 2DOQA 1OMDA 1QVIZ 1Y6WA 2LM5A 3DVMA 3SG3A 4F0ZB 1DJIA 1YUTA 1AUIB 1JF2A 4C0KA 3C1VA 1M46A 1S6IA 1F4OA 2JTZA 2O5GA 5TNCA 2KAYA 2KHNA 1NYAA 4HRHA 5AERA 1DJXA 1NUBA 1LA3A 1EG3A 1WRZA 2PASA 1SL8A 2BBMA 2GV5A 5FYXA 3VRQA 1BR4B 2KI6D 3EK8A 2G9BA 4M2PA 1UHHA 3DF0A 2KGBC 2LP2A 2K61A 2G2BA 1GGWA 4GBAA 3FWCA 2WNDA 1CMGA 2JOJA 4JWQA 1XA5A 3NSKA 4PE0A 1KFXL 1G8IA 5K89A 2LLTA 4NQGA 2A4JA 2I94A 2LV7A 3CGAA 4NDBA 1UP5A 1AHRA 1UURA 1F55A 3WHUB 4DRWA 3TS5B 2OPOA 5ER4X 1HT9A 1ZMZA 3RLZA 1QATA 1K90D 1B8CA 1CKKA 2P6BB 1SW8A 4GAOA 1F71A 1SYMA 1IQ5A 2ZKMX 2JWWA 2M7NA 1C7WA 4GGFA 4MRYA 1G4YR 1BODA 2M1KB 2JZIA 2K7DA 3SG4A 1SR6C 1K8UA 2LANA 1NP8A 3JVTC 2ZNDA 4XJKB 4C0JA 3D0YB 2K0JA 4JQ0D 1KSOA 1TTXA 1IQ3A 1SPYA 1JF0A 3EK7A 2LMTA 4MSPA 2EC6C 4AQIA 3ICBA 2O60A 3BUMB 1CDLA 5JOLA 1KQVA 1DF0A 3HX4A 2E6WA 4BY4A 1WRLA 1XFZO 2Q4UA 3ZWHA 1SNLA 5D69A 4D1EA 1B4CA 2KBMA 2LLSA 1SBJA 2BCBA 1M45A 3EKHA 1OZOA 4I5KA 1MF8B 2WOSA 3CWGA 4YGEB 1L2OC 5I2OA 3M0WA 1CLMA 1AVSA 1DJHA 4I5NB 1W7IB 4R1EA 4CIDA 1FF1A 1KFUS 1YUSA 3SG6A 1FW4A 2MLEC 3EVVA 1PULA 5G08A 2JNXA 1GJYA 3LK1A 1TNXA 2CTNA 1PRWA 1TN4A 2KYFA 2M1UA 1XFUO 3KEVA 2NCPA 2OTGC 2WCBA 1KK7Z 3IQQA 1XK4A 3WNXB 4HSZA 1CFDA 1DJWA 2KNEA 1KK8B 4BY5A 1NX2A 1WY9A 1ODBA 5AXIA 5J3XA 2KSPA 2KFHA 2LHLA 1JC2A 1PSRA 1DT7B 2NLNA 1YURA 2L98A 1EH2A 1QX7A 2JC2A 4I5LB 1XFVO 4PE1A 2LE9B 4IL1A 1RWYA 1DJZA 1SKTA 2BE4A 3I5HC 1OE9B 2LVVA 2KAXA 1DGUA 2JULA 3TDZA 3KHEA 1CB1A 1FBVA 2D8NA 1N65A 1M31A 2ZFDA 3SIAA 3PATA 2F3YA 1EXRA 1TRFA 3WXAA 5KU1A 5JJGA 3FWBA 1L7ZA 2LNKA 2KFFA 1S3PA 3LCPC 2M97A 3JTDB 1A2XA 4A4CA 4CLNA 3O4YA 5HKWA 1NIWA 2KFGA 3BOWA 1QX2A 3JTDC 1H8BA 5AANA 2Y4QA 4PE4A 3KO0A 1XYDA 3I5HB 1BJFA 2K7OA 3I5GC 1U5IA 5AFPA 5B8IB 4MRXA 5KSZA 1BLQA 3AKBA 3EKJA 4ORCB 1J1EA 2M0RA 1LINA 3PFVA 4YGCB 5PALA 2F2PA 4TNCA 1RTP1 1NX1A 1S5GY 1B8LA 5I2QA 1G33A 1SL7A 2SASA 4OV2A 5IBWA 1JBAA 1L2OB 3GK2A 1VRKA 3O2PA 1KCYA 2COLB 3D10A 1TCFA 1UHNA 1RJVA 2GGMA 1MR8A 4QJ5B 1CDMA 1TNQA 2BECA 1H4BA 3E3RA 3F45A 1Y0VH 5HKZA 3KPXA 4PHKA 1YVLA 1QS7A 1QTXA 1BR1B 1IRJA 1OMVA 3CR5X 1EG4A 2K7BA 1YX8A 4MEWA 1BOCA 2JT3A 1KQMB 2EGDA 2JQ6A 1IH0A 2CXJA 2Y1MA 3BUXB 2LCPA 3OB2B 1R6PA 5CPVA 1B1GA 1FI6A 2JT8A 3FS7A 1ZACA 2BKHB 2WC8A 2AMIA 1B7TZ 2KQ6A 3DF0B 4A4BA 5BPJA 1J7QA 1NCYA 1LKJA 4DS7A 5CSJA 2AUCA 4N5XA 1S6CA 3O78A 5HKYA 1C7VA 1EJ3A 3PM8A 2JTTA 3SIBA 3LLEA 3FIAA 4XYNA 1X02A 2OTGB 2ZNEA 2FOTA 2BKIB 1K9UA 2M9GA 1AK8A 4E68A 1GQMA 4XJKA 5AEQA 2M7LA 1IJ5A 1B9AA 5CSIA 4N1GA 2K8MB 2TN4A 4MVFA 1LVCD 1JFJA 1CFCA 3I5IB 2L2EA 1IG5A 3HCMA 5I8NA 2KQYA 1PALA 4L9MA 2KI6C 1SCMC 3GK4X 1HQVA 2K2FA 3TS5C 4PE7A 5CSNA 2KOTA 2KI4C 1KSMA 4C0LA 4PHJA 2K2AA 2PSRA 4GFTA 1AP4A 2NXQA 4GGNA 1R2UA 1DVIA 1PVBA 3A8RA 4YGAA 1MWNA 3VRPA 3CZTX 3OX6A 2LAPA 1QLKA 2MBXA 1BMOA 1CFFA 2BL0C 1IJ6A 1CM4A 2KBIA 3CLNA 4M2OA 4WRIA 2L51A 1B47A 2WORA 1MXLC 2PRUA 2RGIA 4DUQA 1DJGA 1SMGA 1NWDA 5CSFA 1S36A 4YGBB 2H61A 4ETOA 1E8AA 1PK0D 3OX5A 1JUOA 2IS9A 4USLA 3I5FC 2Y5IA 1QX5B 1K93D 2F8PA 1PVAA 2WCEA 1J55A 3TDIA 3DVEA 3CTNA 5KTYA 2HQ8A 2JPTA 2LHIA 1QIWA 2ZN8A 4QJ3B 4AOMA 3SG2A 3TDUA 4MZKA 2SCPA 1OMRA 4FTGA 1ALVA 2L4HA 4GGFC 1C07A 1KWOB 1KFUL 4OR9B 1B7TY 1QJTA 2KGRA 1IWQA 1WDCC 4OKHA 1D1OA 2MRDA 2PMYA 2BCXA 3OB1B 3AAJA 2FJUB 2JU0A 1SCVA 1WDCB 1IKUA 4U8DA 1MQ1A 1NPQA 1RFJA 1RECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJW B;  1V1F A;  2AAO A;  2M3W A;  1K96 A;  3SG5 A;  4HRE E;  2ZRS A;  1YRT B;  2QAC A;  4PAL A;  3DVJ A;  2MAZ A;  2MA2 A;  4N1F A;  3TUY C;  1FI5 A;  1JSA A;  1TCO B;  2OS8 C;  3O6B A;  2CNP A;  3NXA A;  4PHM A;  1XVJ A;  2HF5 A;  2JT0 A;  4UPG A;  1PSB A;  1OSA A;  1NCX A;  2LUC A;  1BU3 A;  3TUY B;  1RK9 A;  2L4I A;  2F33 A;  2LUX A;  4GUK A;  3BOW B;  1GGZ A;  2BCA A;  4ICB A;  1F4Q A;  3OHM B;  1CMF A;  3DVK A;  4YI8 A;  2GGZ A;  2R2I A;  1UUS A;  3NSO A;  3AAK A;  2L5X B;  4Q04 A;  3VGO A;  1TOP A;  2JNF A;  3BUW B;  4ZCV A;  1F70 A;  4PHN A;  3DD4 A;  5D7F A;  2KI4 B;  4MN0 A;  4GNK B;  1AJ4 A;  2M49 B;  2BE6 A;  2V53 A;  2LLU A;  1J7R A;  3D0Y A;  4HRG A;  2L0P A;  1XFW O;  3OP0 A;  1Y1A A;  1A75 B;  1WRK A;  1CTR A;  1SL9 A;  2LMV A;  2MLF C;  2KYC A;  4AQJ A;  2FCD A;  1S26 D;  2F3Z A;  3GK1 A;  3RM1 A;  1XFY O;  1V1G A;  4PDZ A;  3A4U B;  1BG1 A;  1UHJ A;  1S6J A;  1OOJ A;  3H4S E;  3AKA A;  4PCW A;  1MUX A;  1WLM A;  1QIV A;  1S1E A;  1ZFS A;  1U5I B;  1ZOT B;  2LP3 A;  5HLO A;  1QVI Y;  3I5I C;  3QRX A;  5DKQ A;  1ZUZ A;  3JVT B;  1K95 A;  4DCK A;  1NCZ A;  1KQM C;  1KFX S;  1JWD A;  3GOF A;  4WQ2 A;  3CR2 A;  4FQO A;  3VRO A;  1CLL A;  3LL8 B;  3VRR A;  2F2O A;  1BT6 A;  2HQW A;  1W7J B;  3EK4 A;  1UHK A;  2ISD A;  4NDC A;  2CT9 A;  1N2D A;  1DF0 B;  2EHB A;  1NSH A;  1XK4 C;  1JFK A;  2E30 A;  1J1D A;  1J7P A;  1TNP A;  1QXP A;  4WQ3 A;  2ZN9 A;  2QPT A;  2VRG A;  2FCE A;  2I7A A;  4MLW A;  4CFR A;  1CFP A;  1UHI A;  3PN7 C;  3SG7 A;  1QV0 A;  3SJS A;  2LMU A;  1CM1 A;  2JXL A;  4I5J A;  5F6T A;  1DGV A;  2NCO A;  2Q91 A;  4M2Q A;  4ORA B;  5I2L A;  1A75 A;  1Y1X A;  2I18 A;  3ZNI A;  2MHH A;  5GQQ C;  2KDH A;  4ZCU A;  4OVN F;  4OCI A;  1SCM B;  1K94 A;  3BQ3 A;  3K21 A;  3EVR A;  1CLB A;  1KWO C;  2LVK A;  2ZRT A;  3LK0 A;  3BYA A;  1CNP A;  1OQP A;  1CDN A;  1B8R A;  1XO5 A;  4P2Y B;  2M8U A;  1TIZ A;  1SRA A;  1QAS A;  5DKR A;  2H61 C;  1Q80 A;  1F54 A;  3KF9 A;  1Y1U A;  1WLZ A;  3CR4 X;  3IQO A;  2I2R E;  2Y1N A;  2JXC A;  3BUN B;  2K7C A;  1YRU B;  3NSL A;  1TNW A;  2CBL A;  1OZS A;  1YX7 A;  4YBH B;  1M39 A;  1KK7 Y;  1YUU A;  1YVH A;  2BBN A;  1A4P A;  4MBE A;  1FPW A;  3I5G B;  5ER5 A;  2WCF A;  2LVI A;  3PAL A;  1J7O A;  5HYD A;  1AJ5 A;  4NDD A;  2B1U A;  2LVJ A;  1S5G Z;  1N0Y A;  2H2K A;  2JRF A;  1NX3 A;  1DJY A;  2HPS A;  2EC6 B;  1RRO A;  3VRN A;  1ALW A;  1K9P A;  3I5F B;  4MZL A;  1K2H A;  4QJ4 B;  1QLS A;  1LXF C;  1UWO A;  1LA0 A;  1IGV A;  2PVB A;  4P5O E;  1SY9 A;  1A29 A;  1QV1 A;  1F8H A;  3EVU A;  4CFQ A;  1SR6 B;  1CDP A;  2HET A;  1DMO A;  1YTZ C;  1XFX O;  3CS1 A;  1M63 B;  2L50 A;  2M29 A;  5HLV A;  2KAV A;  4CPV A;  1DTL A;  3BUO B;  3PSR A;  4ORB B;  5DKN A;  1MHO A;  2NZ0 A;  3MSE B;  3BXK A;  1YR5 A;  1K9K A;  1SK6 D;  2LC5 A;  3PN7 B;  1BF5 A;  3TZ1 A;  2OS8 B;  3PLF B;  4DIR A;  4YI9 A;  4JPZ B;  4YGD B;  1EL4 A;  1MXE A;  4YRU A;  1KK8 C;  2CCM A;  3NSI A;  3WHT B;  2BL0 B;  3IF7 A;  4MZJ A;  2PAL A;  1A03 A;  1NX0 A;  4GPL B;  2DOQ A;  1OMD A;  1QVI Z;  1Y6W A;  2LM5 A;  3DVM A;  3SG3 A;  4F0Z B;  1DJI A;  1YUT A;  1AUI B;  1JF2 A;  4C0K A;  3C1V A;  1M46 A;  1S6I A;  1F4O A;  2JTZ A;  2O5G A;  5TNC A;  2KAY A;  2KHN A;  1NYA A;  4HRH A;  5AER A;  1DJX A;  1NUB A;  1LA3 A;  1EG3 A;  1WRZ A;  2PAS A;  1SL8 A;  2BBM A;  2GV5 A;  5FYX A;  3VRQ A;  1BR4 B;  2KI6 D;  3EK8 A;  2G9B A;  4M2P A;  1UHH A;  3DF0 A;  2KGB C;  2LP2 A;  2K61 A;  2G2B A;  1GGW A;  4GBA A;  3FWC A;  2WND A;  1CMG A;  2JOJ A;  4JWQ A;  1XA5 A;  3NSK A;  4PE0 A;  1KFX L;  1G8I A;  5K89 A;  2LLT A;  4NQG A;  2A4J A;  2I94 A;  2LV7 A;  3CGA A;  4NDB A;  1UP5 A;  1AHR A;  1UUR A;  1F55 A;  3WHU B;  4DRW A;  3TS5 B;  2OPO A;  5ER4 X;  1HT9 A;  1ZMZ A;  3RLZ A;  1QAT A;  1K90 D;  1B8C A;  1CKK A;  2P6B B;  1SW8 A;  4GAO A;  1F71 A;  1SYM A;  1IQ5 A;  2ZKM X;  2JWW A;  2M7N A;  1C7W A;  4GGF A;  4MRY A;  1G4Y R;  1BOD A;  2M1K B;  2JZI A;  2K7D A;  3SG4 A;  1SR6 C;  1K8U A;  2LAN A;  1NP8 A;  3JVT C;  2ZND A;  4XJK B;  4C0J A;  3D0Y B;  2K0J A;  4JQ0 D;  1KSO A;  1TTX A;  1IQ3 A;  1SPY A;  1JF0 A;  3EK7 A;  2LMT A;  4MSP A;  2EC6 C;  4AQI A;  3ICB A;  2O60 A;  3BUM B;  1CDL A;  5JOL A;  1KQV A;  1DF0 A;  3HX4 A;  2E6W A;  4BY4 A;  1WRL A;  1XFZ O;  2Q4U A;  3ZWH A;  1SNL A;  5D69 A;  4D1E A;  1B4C A;  2KBM A;  2LLS A;  1SBJ A;  2BCB A;  1M45 A;  3EKH A;  1OZO A;  4I5K A;  1MF8 B;  2WOS A;  3CWG A;  4YGE B;  1L2O C;  5I2O A;  3M0W A;  1CLM A;  1AVS A;  1DJH A;  4I5N B;  1W7I B;  4R1E A;  4CID A;  1FF1 A;  1KFU S;  1YUS A;  3SG6 A;  1FW4 A;  2MLE C;  3EVV A;  1PUL A;  5G08 A;  2JNX A;  1GJY A;  3LK1 A;  1TNX A;  2CTN A;  1PRW A;  1TN4 A;  2KYF A;  2M1U A;  1XFU O;  3KEV A;  2NCP A;  2OTG C;  2WCB A;  1KK7 Z;  3IQQ A;  1XK4 A;  3WNX B;  4HSZ A;  1CFD A;  1DJW A;  2KNE A;  1KK8 B;  4BY5 A;  1NX2 A;  1WY9 A;  1ODB A;  5AXI A;  5J3X A;  2KSP A;  2KFH A;  2LHL A;  1JC2 A;  1PSR A;  1DT7 B;  2NLN A;  1YUR A;  2L98 A;  1EH2 A;  1QX7 A;  2JC2 A;  4I5L B;  1XFV O;  4PE1 A;  2LE9 B;  4IL1 A;  1RWY A;  1DJZ A;  1SKT A;  2BE4 A;  3I5H C;  1OE9 B;  2LVV A;  2KAX A;  1DGU A;  2JUL A;  3TDZ A;  3KHE A;  1CB1 A;  1FBV A;  2D8N A;  1N65 A;  1M31 A;  2ZFD A;  3SIA A;  3PAT A;  2F3Y A;  1EXR A;  1TRF A;  3WXA A;  5KU1 A;  5JJG A;  3FWB A;  1L7Z A;  2LNK A;  2KFF A;  1S3P A;  3LCP C;  2M97 A;  3JTD B;  1A2X A;  4A4C A;  4CLN A;  3O4Y A;  5HKW A;  1NIW A;  2KFG A;  3BOW A;  1QX2 A;  3JTD C;  1H8B A;  5AAN A;  2Y4Q A;  4PE4 A;  3KO0 A;  1XYD A;  3I5H B;  1BJF A;  2K7O A;  3I5G C;  1U5I A;  5AFP A;  5B8I B;  4MRX A;  5KSZ A;  1BLQ A;  3AKB A;  3EKJ A;  4ORC B;  1J1E A;  2M0R A;  1LIN A;  3PFV A;  4YGC B;  5PAL A;  2F2P A;  4TNC A;  1RTP 1;  1NX1 A;  1S5G Y;  1B8L A;  5I2Q A;  1G33 A;  1SL7 A;  2SAS A;  4OV2 A;  5IBW A;  1JBA A;  1L2O B;  3GK2 A;  1VRK A;  3O2P A;  1KCY A;  2COL B;  3D10 A;  1TCF A;  1UHN A;  1RJV A;  2GGM A;  1MR8 A;  4QJ5 B;  1CDM A;  1TNQ A;  2BEC A;  1H4B A;  3E3R A;  3F45 A;  1Y0V H;  5HKZ A;  3KPX A;  4PHK A;  1YVL A;  1QS7 A;  1QTX A;  1BR1 B;  1IRJ A;  1OMV A;  3CR5 X;  1EG4 A;  2K7B A;  1YX8 A;  4MEW A;  1BOC A;  2JT3 A;  1KQM B;  2EGD A;  2JQ6 A;  1IH0 A;  2CXJ A;  2Y1M A;  3BUX B;  2LCP A;  3OB2 B;  1R6P A;  5CPV A;  1B1G A;  1FI6 A;  2JT8 A;  3FS7 A;  1ZAC A;  2BKH B;  2WC8 A;  2AMI A;  1B7T Z;  2KQ6 A;  3DF0 B;  4A4B A;  5BPJ A;  1J7Q A;  1NCY A;  1LKJ A;  4DS7 A;  5CSJ A;  2AUC A;  4N5X A;  1S6C A;  3O78 A;  5HKY A;  1C7V A;  1EJ3 A;  3PM8 A;  2JTT A;  3SIB A;  3LLE A;  3FIA A;  4XYN A;  1X02 A;  2OTG B;  2ZNE A;  2FOT A;  2BKI B;  1K9U A;  2M9G A;  1AK8 A;  4E68 A;  1GQM A;  4XJK A;  5AEQ A;  2M7L A;  1IJ5 A;  1B9A A;  5CSI A;  4N1G A;  2K8M B;  2TN4 A;  4MVF A;  1LVC D;  1JFJ A;  1CFC A;  3I5I B;  2L2E A;  1IG5 A;  3HCM A;  5I8N A;  2KQY A;  1PAL A;  4L9M A;  2KI6 C;  1SCM C;  3GK4 X;  1HQV A;  2K2F A;  3TS5 C;  4PE7 A;  5CSN A;  2KOT A;  2KI4 C;  1KSM A;  4C0L A;  4PHJ A;  2K2A A;  2PSR A;  4GFT A;  1AP4 A;  2NXQ A;  4GGN A;  1R2U A;  1DVI A;  1PVB A;  3A8R A;  4YGA A;  1MWN A;  3VRP A;  3CZT X;  3OX6 A;  2LAP A;  1QLK A;  2MBX A;  1BMO A;  1CFF A;  2BL0 C;  1IJ6 A;  1CM4 A;  2KBI A;  3CLN A;  4M2O A;  4WRI A;  2L51 A;  1B47 A;  2WOR A;  1MXL C;  2PRU A;  2RGI A;  4DUQ A;  1DJG A;  1SMG A;  1NWD A;  5CSF A;  1S36 A;  4YGB B;  2H61 A;  4ETO A;  1E8A A;  1PK0 D;  3OX5 A;  1JUO A;  2IS9 A;  4USL A;  3I5F C;  2Y5I A;  1QX5 B;  1K93 D;  2F8P A;  1PVA A;  2WCE A;  1J55 A;  3TDI A;  3DVE A;  3CTN A;  5KTY A;  2HQ8 A;  2JPT A;  2LHI A;  1QIW A;  2ZN8 A;  4QJ3 B;  4AOM A;  3SG2 A;  3TDU A;  4MZK A;  2SCP A;  1OMR A;  4FTG A;  1ALV A;  2L4H A;  4GGF C;  1C07 A;  1KWO B;  1KFU L;  4OR9 B;  1B7T Y;  1QJT A;  2KGR A;  1IWQ A;  1WDC C;  4OKH A;  1D1O A;  2MRD A;  2PMY A;  2BCX A;  3OB1 B;  3AAJ A;  2FJU B;  2JU0 A;  1SCV A;  1WDC B;  1IKU A;  4U8D A;  1MQ1 A;  1NPQ A;  1RFJ A;  1REC A; 
#chains in the Genus database with same CATH topology
 2MJW B;  1V1F A;  2AAO A;  2M3W A;  1K96 A;  2P71 A;  3SG5 A;  4HRE E;  2ZRS A;  1YRT B;  2QAC A;  4PAL A;  3DVJ A;  2MAZ A;  2MA2 A;  1OOG A;  1P28 A;  3DYE A;  4N1F A;  1TCO B;  3S0B A;  2OS8 C;  3O6B A;  2CNP A;  3NXA A;  4PHM A;  1XVJ A;  2HF5 A;  2JT0 A;  4UPG A;  1IIO A;  3BJH A;  1PSB A;  1OSA A;  1NCX A;  2LUC A;  1BU3 A;  3TUY B;  1RK9 A;  2L4I A;  2F33 A;  2LUX A;  4GUK A;  3BOW B;  1GGZ A;  2BCA A;  4ICB A;  1F4Q A;  3OHM B;  1CMF A;  3DVK A;  4YI8 A;  2GGZ A;  1ORG A;  2R2I A;  1UUS A;  3NSO A;  3AAK A;  1DEK A;  1LS8 A;  3CDN A;  2L5X B;  3D77 A;  4Q04 A;  3VGO A;  1TOP A;  2JNF A;  3BUW B;  4ZCV A;  3S0G A;  1F70 A;  4PHN A;  3DD4 A;  5D7F A;  2KI4 B;  4MN0 A;  4GNK B;  1AJ4 A;  1DQE A;  2M49 B;  2BE6 A;  2K60 A;  2V53 A;  2LLU A;  1J7R A;  3D0Y A;  4HRG A;  2L0P A;  1XFW O;  3OP0 A;  2WCJ A;  1Y1A A;  1A75 B;  4KYN A;  1WRK A;  3D75 A;  1CTR A;  1SL9 A;  2LMV A;  2MLF C;  2KYC A;  4AQJ A;  2FCD A;  1S26 D;  2F3Z A;  3GK1 A;  3RM1 A;  1XFY O;  1V1G A;  4PDZ A;  3A4U B;  1BG1 A;  1UHJ A;  1S6J A;  1OOJ A;  3H4S E;  3AKA A;  4PCW A;  1MUX A;  1WLM A;  1ZFS A;  1QIV A;  1S1E A;  1ZOT B;  1U5I B;  1OW4 A;  2LP3 A;  4PT1 A;  5HLO A;  1QVI Y;  3I5I C;  3QRX A;  5DKQ A;  1ZUZ A;  3JVT B;  1OOH A;  1K95 A;  4DCK A;  1NCZ A;  1KQM C;  1KFX S;  3S0A A;  1JWD A;  3GOF A;  4WQ2 A;  3CR2 A;  4FQO A;  3VRO A;  1CLL A;  2PYQ A;  3LL8 B;  3SS5 A;  3VRR A;  2F2O A;  1BT6 A;  2HQW A;  1W7J B;  3EK4 A;  1UHK A;  2ISD A;  4NDC A;  2CT9 A;  1N2D A;  1DF0 B;  2P70 A;  2EHB A;  1NSH A;  1XK4 C;  1JFK A;  2E30 A;  1J1D A;  1J7P A;  1TNP A;  1QXP A;  4WQ3 A;  2ZN9 A;  2QPT A;  2VRG A;  2FCE A;  2I7A A;  4MLW A;  4CFR A;  2KLE A;  1CFP A;  1UHI A;  3PN7 C;  3SG7 A;  1QV0 A;  3SJS A;  2JPO A;  2LMU A;  3L4L A;  1CM1 A;  2JXL A;  4I5J A;  5F6T A;  3NHI A;  1DGV A;  2NCO A;  2Q91 A;  4M2Q A;  4ORA B;  5I2L A;  5DIC A;  1A75 A;  1Y1X A;  2I18 A;  3ZNI A;  2MHH A;  5GQQ C;  2KDH A;  4ZCU A;  4OVN F;  4OCI A;  1SCM B;  1OOF A;  1K94 A;  3BQ3 A;  3K21 A;  3EVR A;  1CLB A;  1KWO C;  2LVK A;  2ZRT A;  3LK0 A;  3FE9 A;  3BYA A;  1CNP A;  1OQP A;  1CDN A;  1B8R A;  1XO5 A;  4P2Y B;  3B6X A;  2M8U A;  1TIZ A;  1SRA A;  1QAS A;  5DKR A;  2H61 C;  4JKT A;  1DC1 A;  1Q80 A;  3DY9 A;  1F54 A;  3KF9 A;  5FI2 A;  1Y1U A;  1WLZ A;  3CR4 X;  3IQO A;  2I2R E;  2Y1N A;  2JXC A;  3BUN B;  2K7C A;  1YRU B;  3V2L A;  3NSL A;  1TNW A;  2CBL A;  1OZS A;  1YX7 A;  3NGV A;  4YBH B;  1M39 A;  1KK7 Y;  1YUU A;  1YVH A;  2BBN A;  1A4P A;  4MBE A;  5FI7 A;  3I5G B;  5ER5 A;  2WCF A;  1FPW A;  2LVI A;  3BFB A;  3PAL A;  1J7O A;  5HYD A;  1AJ5 A;  4NDD A;  2B1U A;  2LVJ A;  1S5G Z;  1N0Y A;  3OBV A;  2H2K A;  2JRF A;  1NX3 A;  1DJY A;  1TUJ A;  2HPS A;  2EC6 B;  1RRO A;  3VRN A;  1ALW A;  1K9P A;  3I5F B;  4MZL A;  1K2H A;  4QJ4 B;  1QLS A;  1LXF C;  1UWO A;  1LA0 A;  1IGV A;  2PVB A;  2L5Y A;  4P5O E;  1SY9 A;  1A29 A;  1QV1 A;  1F8H A;  3EVU A;  4CFQ A;  1SR6 B;  1CDP A;  2HET A;  1DMO A;  1YTZ C;  1XFX O;  3IVT A;  3CS1 A;  1M63 B;  2L50 A;  2M29 A;  5HLV A;  2KAV A;  4CPV A;  1DTL A;  3BUO B;  3CZ2 A;  2WCL A;  3O4X A;  3PSR A;  4ORB B;  5DKN A;  1MHO A;  2NZ0 A;  5HL1 A;  3MSE B;  3BXK A;  1YR5 A;  1K9K A;  1SK6 D;  2LC5 A;  3PN7 B;  1BF5 A;  3TZ1 A;  2OS8 B;  3PLF B;  4DIR A;  4YI9 A;  4JPZ B;  4YGD B;  1EL4 A;  1MXE A;  4YRU A;  1KK8 C;  2CCM A;  3NSI A;  3WHT B;  3D78 A;  2BL0 B;  3SS4 A;  3B7A A;  3IF7 A;  4MZJ A;  2PAL A;  1A03 A;  1NX0 A;  4GPL B;  2DOQ A;  1OMD A;  1QVI Z;  1Y6W A;  2LM5 A;  3DVM A;  3SG3 A;  4F0Z B;  1DJI A;  1YUT A;  1AUI B;  1JF2 A;  4C0K A;  3C1V A;  1M46 A;  1S6I A;  1F4O A;  2JTZ A;  2O5G A;  5TNC A;  2KAY A;  2KHN A;  1NYA A;  4HRH A;  5AER A;  1DJX A;  1NUB A;  1LA3 A;  1EG3 A;  1WRZ A;  2BNX A;  2PAS A;  4JD9 A;  1SL8 A;  3OGN A;  2BBM A;  2GV5 A;  5FYX A;  3VRQ A;  1BR4 B;  3S0D A;  2KI6 D;  3EK8 A;  2G9B A;  4M2P A;  3RZS A;  1UHH A;  4F7F A;  3DF0 A;  2KGB C;  2LP2 A;  2QEO A;  2K61 A;  2G2B A;  3EG5 B;  1GGW A;  3QME A;  3FWC A;  4GBA A;  2WND A;  1T14 A;  1CMG A;  2JOJ A;  3PJI A;  4JWQ A;  1XA5 A;  3NSK A;  4PE0 A;  1KFX L;  1G8I A;  2ERB A;  5K89 A;  2LLT A;  4NQG A;  2A4J A;  2I94 A;  2LV7 A;  3CGA A;  4NDB A;  1UP5 A;  1AHR A;  1UUR A;  1F55 A;  3WHU B;  4DRW A;  3TS5 B;  2OPO A;  1TUZ A;  5ER4 X;  1HT9 A;  1ZMZ A;  3RLZ A;  1QAT A;  1K90 D;  1B8C A;  1CKK A;  2P6B B;  1SW8 A;  4GAO A;  1F71 A;  1SYM A;  1IQ5 A;  2KPH A;  1C3Y A;  2ZKM X;  2JWW A;  2M7N A;  1C7W A;  4GGF A;  4MRY A;  1G4Y R;  1BOD A;  1OOI X;  1TWO A;  2M1K B;  2JZI A;  2K7D A;  3SG4 A;  1SR6 C;  1K8U A;  2LAN A;  1NP8 A;  3JVT C;  2ZND A;  4XJK B;  4C0J A;  2WCK A;  3D0Y B;  2K0J A;  4JQ0 D;  1KSO A;  1TTX A;  1IQ3 A;  1SPY A;  1JF0 A;  3EK7 A;  3UO9 A;  2LMT A;  4MSP A;  2EC6 C;  4AQI A;  3ICB A;  2O60 A;  3BUM B;  3L4A A;  5I94 A;  1CDL A;  5JOL A;  1KQV A;  1DF0 A;  3HX4 A;  2E6W A;  4BY4 A;  1WRL A;  1XFZ O;  2Q4U A;  3ZWH A;  1SNL A;  5D69 A;  4D1E A;  1B4C A;  2KBM A;  2LLS A;  1SBJ A;  2BCB A;  1M45 A;  3EKH A;  1OZO A;  4I5K A;  1MF8 B;  2BAP A;  5D3O A;  2WOS A;  3CWG A;  4YGE B;  1L2O C;  5I2O A;  3M0W A;  3S0E A;  1CLM A;  1AVS A;  1DJH A;  4I5N B;  1W7I B;  4R1E A;  4CID A;  1FF1 A;  1KFU S;  1YUS A;  3SG6 A;  1FW4 A;  2MLE C;  1QWV A;  1PUL A;  3EVV A;  5G08 A;  2GTE A;  1GJY A;  2JNX A;  1TNX A;  2CTN A;  3LK1 A;  1PRW A;  1TN4 A;  2KYF A;  2M1U A;  3R1V A;  5FI6 A;  1XFU O;  3FE8 A;  3R1P A;  3KEV A;  2NCP A;  2OTG C;  2WCB A;  1KK7 Z;  3IQQ A;  3NHT A;  1XK4 A;  2QEH A;  3R72 A;  3WNX B;  4HSZ A;  1GM0 A;  1CFD A;  1DJW A;  2KNE A;  1KK8 B;  4BY5 A;  1NX2 A;  1WY9 A;  1ODB A;  3B86 A;  5AXI A;  2KSP A;  2KFH A;  2LHL A;  5J3X A;  1JC2 A;  1PSR A;  1DT7 B;  2NLN A;  1YUR A;  2L98 A;  1EH2 A;  1DEL A;  1QX7 A;  2JC2 A;  4I5L B;  1XFV O;  1W9Z A;  4PE1 A;  2LE9 B;  4IL1 A;  1RWY A;  1DJZ A;  1SKT A;  2BE4 A;  3I5H C;  1OE9 B;  2LVV A;  2KAX A;  1DGU A;  2JUL A;  3TDZ A;  3KHE A;  1CB1 A;  1FBV A;  2D8N A;  1N65 A;  1M31 A;  2ZFD A;  3SIA A;  3PAT A;  2F3Y A;  3UNW A;  1EXR A;  1TRF A;  2KLD A;  3WXA A;  5JJG A;  5KU1 A;  3FWB A;  1L7Z A;  2LNK A;  2KFF A;  1S3P A;  3LCP C;  2M97 A;  3JTD B;  1A2X A;  4A4C A;  4CLN A;  3O4Y A;  5HKW A;  3DXL A;  1NIW A;  2KFG A;  3BOW A;  1QX2 A;  3JTD C;  1H8B A;  5AAN A;  1SSE B;  2Y4Q A;  4PE4 A;  1JSA A;  3KO0 A;  1XYD A;  3I5H B;  1BJF A;  2K7O A;  3I5G C;  1U5I A;  5AFP A;  5B8I B;  4MRX A;  5KSZ A;  1BLQ A;  3AKB A;  3EKJ A;  3N7H A;  4ORC B;  1J1E A;  2M0R A;  1LIN A;  3PFV A;  4YGC B;  5PAL A;  2F2P A;  4TNC A;  3FE6 A;  1RTP 1;  1NX1 A;  1S5G Y;  1B8L A;  2QEB A;  1G33 A;  1SL7 A;  2SAS A;  4OV2 A;  3K1E A;  5I2Q A;  5IBW A;  1Z4H A;  1L2O B;  1JBA A;  3GK2 A;  3BFH A;  2H8V A;  2FJY A;  1VRK A;  3O2P A;  1KCY A;  2COL B;  3D10 A;  3SS3 A;  1TCF A;  1UHN A;  1RJV A;  2GGM A;  1MR8 A;  4QJ5 B;  1CDM A;  1TNQ A;  3PM2 A;  2BEC A;  1H4B A;  3E3R A;  3F45 A;  1Y0V H;  5HKZ A;  3KPX A;  4PHK A;  3R1O A;  1YVL A;  1QS7 A;  1QTX A;  2L2C A;  3Q8I A;  3DZT A;  4INW A;  1BR1 B;  1IRJ A;  1OMV A;  3CR5 X;  1EG4 A;  2K7B A;  1YX8 A;  4MEW A;  1C3Z A;  1BOC A;  2WC6 A;  2JT3 A;  1KQM B;  2EGD A;  2JQ6 A;  1IH0 A;  2WC5 A;  2CXJ A;  2Y1M A;  3D73 A;  3BUX B;  2LCP A;  3OB2 B;  1R6P A;  5CPV A;  1B1G A;  1FI6 A;  3D76 A;  2JT8 A;  1FI5 A;  2WCM A;  3S0F A;  3FS7 A;  1ZAC A;  2BKH B;  3L47 A;  2WC8 A;  2AMI A;  3D74 A;  1B7T Z;  2KQ6 A;  3DF0 B;  4A4B A;  5BPJ A;  1J7Q A;  1NCY A;  1LKJ A;  2WCH A;  5CSJ A;  2AUC A;  4N5X A;  1S6C A;  4DS7 A;  4IJ7 A;  3O78 A;  5HKY A;  1C7V A;  1EJ3 A;  3PM8 A;  2JTT A;  3SIB A;  3LLE A;  4FQT A;  3FIA A;  4XYN A;  1X02 A;  2OTG B;  2ZNE A;  2QDI A;  2FOT A;  2BKI B;  1K9U A;  2M9G A;  1AK8 A;  1Z2C B;  3TUY C;  2PQL A;  4E68 A;  1GQM A;  4XJK A;  3CZ1 A;  5AEQ A;  2M7L A;  1IJ5 A;  1B9A A;  5CSI A;  4N1G A;  2K8M B;  2TN4 A;  4MVF A;  1LVC D;  1JFJ A;  1CFC A;  3I5I B;  2L2E A;  2YGU A;  1IG5 A;  3HCM A;  5EL2 A;  5I8N A;  2KQY A;  1PAL A;  4L9M A;  2KI6 C;  1SCM C;  3GK4 X;  1HQV A;  2K2F A;  3TS5 C;  4PE7 A;  5CSN A;  2KOT A;  2KI4 C;  1KSM A;  4C0L A;  4PHJ A;  2K2A A;  2PSR A;  4GFT A;  1AP4 A;  2NXQ A;  4GGN A;  1R2U A;  1DVI A;  1PVB A;  3A8R A;  4INX A;  1MWN A;  4YGA A;  3VRP A;  3CZT X;  3OX6 A;  2LAP A;  1QLK A;  2MBX A;  1BMO A;  1CFF A;  2BL0 C;  1IJ6 A;  1CM4 A;  2KBI A;  3CLN A;  4M2O A;  4WRI A;  2L51 A;  1B47 A;  2WOR A;  1MXL C;  2PRU A;  2RGI A;  4DUQ A;  1DJG A;  1SMG A;  1NWD A;  5CSF A;  1S36 A;  4YGB B;  2H61 A;  4ETO A;  1E8A A;  1PK0 D;  3OX5 A;  1JUO A;  2IS9 A;  4USL A;  3I5F C;  3VB1 A;  2Y5I A;  1QX5 B;  1K93 D;  1XFR A;  2F8P A;  1PVA A;  2WCE A;  1J55 A;  3TDI A;  3DVE A;  3CTN A;  5KTY A;  2HQ8 A;  2JPT A;  2LHI A;  1QIW A;  2ZN8 A;  4QJ3 B;  4AOM A;  3SG2 A;  3TDU A;  4MZK A;  2QEV A;  2SCP A;  3CAB A;  1OMR A;  3B87 A;  1ALV A;  2L4H A;  3CYZ A;  4FTG A;  4GGF C;  1C07 A;  3BFA A;  1KWO B;  1KFU L;  4OR9 B;  1B7T Y;  1QJT A;  2KGR A;  3CZ0 A;  1IWQ A;  1WDC C;  4OKH A;  1D1O A;  2MRD A;  2PMY A;  2BCX A;  3OB1 B;  3AAJ A;  2FJU B;  2JU0 A;  1SCV A;  1WDC B;  1IKU A;  4U8D A;  1MQ1 A;  1NPQ A;  1RFJ A;  4OZD A;  1REC A;  3B88 A; 
#chains in the Genus database with same CATH homology
 2MJW B;  1V1F A;  2AAO A;  2M3W A;  1K96 A;  3SG5 A;  4HRE E;  2ZRS A;  1YRT B;  2QAC A;  4PAL A;  3DVJ A;  2MAZ A;  2MA2 A;  4N1F A;  3TUY C;  1FI5 A;  1JSA A;  1TCO B;  2OS8 C;  3O6B A;  2CNP A;  3NXA A;  4PHM A;  1XVJ A;  2HF5 A;  2JT0 A;  4UPG A;  1PSB A;  1OSA A;  1NCX A;  2LUC A;  1BU3 A;  3TUY B;  1RK9 A;  2L4I A;  2F33 A;  2LUX A;  4GUK A;  3BOW B;  1GGZ A;  2BCA A;  4ICB A;  1F4Q A;  3OHM B;  1CMF A;  3DVK A;  4YI8 A;  2GGZ A;  2R2I A;  1UUS A;  3NSO A;  3AAK A;  2L5X B;  4Q04 A;  3VGO A;  1TOP A;  2JNF A;  3BUW B;  4ZCV A;  1F70 A;  4PHN A;  3DD4 A;  5D7F A;  2KI4 B;  4MN0 A;  4GNK B;  1AJ4 A;  2M49 B;  2BE6 A;  2V53 A;  2LLU A;  1J7R A;  3D0Y A;  4HRG A;  2L0P A;  1XFW O;  3OP0 A;  1Y1A A;  1A75 B;  1WRK A;  1CTR A;  1SL9 A;  2LMV A;  2MLF C;  2KYC A;  4AQJ A;  2FCD A;  1S26 D;  2F3Z A;  3GK1 A;  3RM1 A;  1XFY O;  1V1G A;  4PDZ A;  3A4U B;  1BG1 A;  1UHJ A;  1S6J A;  1OOJ A;  3H4S E;  3AKA A;  4PCW A;  1MUX A;  1WLM A;  1QIV A;  1S1E A;  1ZFS A;  1U5I B;  1ZOT B;  2LP3 A;  5HLO A;  1QVI Y;  3I5I C;  3QRX A;  5DKQ A;  1ZUZ A;  3JVT B;  1K95 A;  4DCK A;  1NCZ A;  1KQM C;  1KFX S;  1JWD A;  3GOF A;  4WQ2 A;  3CR2 A;  4FQO A;  3VRO A;  1CLL A;  3LL8 B;  3VRR A;  2F2O A;  1BT6 A;  2HQW A;  1W7J B;  3EK4 A;  1UHK A;  2ISD A;  4NDC A;  2CT9 A;  1N2D A;  1DF0 B;  2EHB A;  1NSH A;  1XK4 C;  1JFK A;  2E30 A;  1J1D A;  1J7P A;  1TNP A;  1QXP A;  4WQ3 A;  2ZN9 A;  2QPT A;  2VRG A;  2FCE A;  2I7A A;  4MLW A;  4CFR A;  1CFP A;  1UHI A;  3PN7 C;  3SG7 A;  1QV0 A;  3SJS A;  2LMU A;  1CM1 A;  2JXL A;  4I5J A;  5F6T A;  1DGV A;  2NCO A;  2Q91 A;  4M2Q A;  4ORA B;  5I2L A;  1A75 A;  1Y1X A;  2I18 A;  3ZNI A;  2MHH A;  5GQQ C;  2KDH A;  4ZCU A;  4OVN F;  4OCI A;  1SCM B;  1K94 A;  3BQ3 A;  3K21 A;  3EVR A;  1CLB A;  1KWO C;  2LVK A;  2ZRT A;  3LK0 A;  3BYA A;  1CNP A;  1OQP A;  1CDN A;  1B8R A;  1XO5 A;  4P2Y B;  2M8U A;  1TIZ A;  1SRA A;  1QAS A;  5DKR A;  2H61 C;  1Q80 A;  1F54 A;  3KF9 A;  1Y1U A;  1WLZ A;  3CR4 X;  3IQO A;  2I2R E;  2Y1N A;  2JXC A;  3BUN B;  2K7C A;  1YRU B;  3NSL A;  1TNW A;  2CBL A;  1OZS A;  1YX7 A;  4YBH B;  1M39 A;  1KK7 Y;  1YUU A;  1YVH A;  2BBN A;  1A4P A;  4MBE A;  1FPW A;  3I5G B;  5ER5 A;  2WCF A;  2LVI A;  3PAL A;  1J7O A;  5HYD A;  1AJ5 A;  4NDD A;  2B1U A;  2LVJ A;  1S5G Z;  1N0Y A;  2H2K A;  2JRF A;  1NX3 A;  1DJY A;  2HPS A;  2EC6 B;  1RRO A;  3VRN A;  1ALW A;  1K9P A;  3I5F B;  4MZL A;  1K2H A;  4QJ4 B;  1QLS A;  1LXF C;  1UWO A;  1LA0 A;  1IGV A;  2PVB A;  4P5O E;  1SY9 A;  1A29 A;  1QV1 A;  1F8H A;  3EVU A;  4CFQ A;  1SR6 B;  1CDP A;  2HET A;  1DMO A;  1YTZ C;  1XFX O;  3CS1 A;  1M63 B;  2L50 A;  2M29 A;  5HLV A;  2KAV A;  4CPV A;  1DTL A;  3BUO B;  3PSR A;  4ORB B;  5DKN A;  1MHO A;  2NZ0 A;  3MSE B;  3BXK A;  1YR5 A;  1K9K A;  1SK6 D;  2LC5 A;  3PN7 B;  1BF5 A;  3TZ1 A;  2OS8 B;  3PLF B;  4DIR A;  4YI9 A;  4JPZ B;  4YGD B;  1EL4 A;  1MXE A;  4YRU A;  1KK8 C;  2CCM A;  3NSI A;  3WHT B;  2BL0 B;  3IF7 A;  4MZJ A;  2PAL A;  1A03 A;  1NX0 A;  4GPL B;  2DOQ A;  1OMD A;  1QVI Z;  1Y6W A;  2LM5 A;  3DVM A;  3SG3 A;  4F0Z B;  1DJI A;  1YUT A;  1AUI B;  1JF2 A;  4C0K A;  3C1V A;  1M46 A;  1S6I A;  1F4O A;  2JTZ A;  2O5G A;  5TNC A;  2KAY A;  2KHN A;  1NYA A;  4HRH A;  5AER A;  1DJX A;  1NUB A;  1LA3 A;  1EG3 A;  1WRZ A;  2PAS A;  1SL8 A;  2BBM A;  2GV5 A;  5FYX A;  3VRQ A;  1BR4 B;  2KI6 D;  3EK8 A;  2G9B A;  4M2P A;  1UHH A;  3DF0 A;  2KGB C;  2LP2 A;  2K61 A;  2G2B A;  1GGW A;  4GBA A;  3FWC A;  2WND A;  1CMG A;  2JOJ A;  4JWQ A;  1XA5 A;  3NSK A;  4PE0 A;  1KFX L;  1G8I A;  5K89 A;  2LLT A;  4NQG A;  2A4J A;  2I94 A;  2LV7 A;  3CGA A;  4NDB A;  1UP5 A;  1AHR A;  1UUR A;  1F55 A;  3WHU B;  4DRW A;  3TS5 B;  2OPO A;  5ER4 X;  1HT9 A;  1ZMZ A;  3RLZ A;  1QAT A;  1K90 D;  1B8C A;  1CKK A;  2P6B B;  1SW8 A;  4GAO A;  1F71 A;  1SYM A;  1IQ5 A;  2ZKM X;  2JWW A;  2M7N A;  1C7W A;  4GGF A;  4MRY A;  1G4Y R;  1BOD A;  2M1K B;  2JZI A;  2K7D A;  3SG4 A;  1SR6 C;  1K8U A;  2LAN A;  1NP8 A;  3JVT C;  2ZND A;  4XJK B;  4C0J A;  3D0Y B;  2K0J A;  4JQ0 D;  1KSO A;  1TTX A;  1IQ3 A;  1SPY A;  1JF0 A;  3EK7 A;  2LMT A;  4MSP A;  2EC6 C;  4AQI A;  3ICB A;  2O60 A;  3BUM B;  1CDL A;  5JOL A;  1KQV A;  1DF0 A;  3HX4 A;  2E6W A;  4BY4 A;  1WRL A;  1XFZ O;  2Q4U A;  3ZWH A;  1SNL A;  5D69 A;  4D1E A;  1B4C A;  2KBM A;  2LLS A;  1SBJ A;  2BCB A;  1M45 A;  3EKH A;  1OZO A;  4I5K A;  1MF8 B;  2WOS A;  3CWG A;  4YGE B;  1L2O C;  5I2O A;  3M0W A;  1CLM A;  1AVS A;  1DJH A;  4I5N B;  1W7I B;  4R1E A;  4CID A;  1FF1 A;  1KFU S;  1YUS A;  3SG6 A;  1FW4 A;  2MLE C;  3EVV A;  1PUL A;  5G08 A;  2JNX A;  1GJY A;  3LK1 A;  1TNX A;  2CTN A;  1PRW A;  1TN4 A;  2KYF A;  2M1U A;  1XFU O;  3KEV A;  2NCP A;  2OTG C;  2WCB A;  1KK7 Z;  3IQQ A;  1XK4 A;  3WNX B;  4HSZ A;  1CFD A;  1DJW A;  2KNE A;  1KK8 B;  4BY5 A;  1NX2 A;  1WY9 A;  1ODB A;  5AXI A;  5J3X A;  2KSP A;  2KFH A;  2LHL A;  1JC2 A;  1PSR A;  1DT7 B;  2NLN A;  1YUR A;  2L98 A;  1EH2 A;  1QX7 A;  2JC2 A;  4I5L B;  1XFV O;  4PE1 A;  2LE9 B;  4IL1 A;  1RWY A;  1DJZ A;  1SKT A;  2BE4 A;  3I5H C;  1OE9 B;  2LVV A;  2KAX A;  1DGU A;  2JUL A;  3TDZ A;  3KHE A;  1CB1 A;  1FBV A;  2D8N A;  1N65 A;  1M31 A;  2ZFD A;  3SIA A;  3PAT A;  2F3Y A;  1EXR A;  1TRF A;  3WXA A;  5KU1 A;  5JJG A;  3FWB A;  1L7Z A;  2LNK A;  2KFF A;  1S3P A;  3LCP C;  2M97 A;  3JTD B;  1A2X A;  4A4C A;  4CLN A;  3O4Y A;  5HKW A;  1NIW A;  2KFG A;  3BOW A;  1QX2 A;  3JTD C;  1H8B A;  5AAN A;  2Y4Q A;  4PE4 A;  3KO0 A;  1XYD A;  3I5H B;  1BJF A;  2K7O A;  3I5G C;  1U5I A;  5AFP A;  5B8I B;  4MRX A;  5KSZ A;  1BLQ A;  3AKB A;  3EKJ A;  4ORC B;  1J1E A;  2M0R A;  1LIN A;  3PFV A;  4YGC B;  5PAL A;  2F2P A;  4TNC A;  1RTP 1;  1NX1 A;  1S5G Y;  1B8L A;  5I2Q A;  1G33 A;  1SL7 A;  2SAS A;  4OV2 A;  5IBW A;  1JBA A;  1L2O B;  3GK2 A;  1VRK A;  3O2P A;  1KCY A;  2COL B;  3D10 A;  1TCF A;  1UHN A;  1RJV A;  2GGM A;  1MR8 A;  4QJ5 B;  1CDM A;  1TNQ A;  2BEC A;  1H4B A;  3E3R A;  3F45 A;  1Y0V H;  5HKZ A;  3KPX A;  4PHK A;  1YVL A;  1QS7 A;  1QTX A;  1BR1 B;  1IRJ A;  1OMV A;  3CR5 X;  1EG4 A;  2K7B A;  1YX8 A;  4MEW A;  1BOC A;  2JT3 A;  1KQM B;  2EGD A;  2JQ6 A;  1IH0 A;  2CXJ A;  2Y1M A;  3BUX B;  2LCP A;  3OB2 B;  1R6P A;  5CPV A;  1B1G A;  1FI6 A;  2JT8 A;  3FS7 A;  1ZAC A;  2BKH B;  2WC8 A;  2AMI A;  1B7T Z;  2KQ6 A;  3DF0 B;  4A4B A;  5BPJ A;  1J7Q A;  1NCY A;  1LKJ A;  4DS7 A;  5CSJ A;  2AUC A;  4N5X A;  1S6C A;  3O78 A;  5HKY A;  1C7V A;  1EJ3 A;  3PM8 A;  2JTT A;  3SIB A;  3LLE A;  3FIA A;  4XYN A;  1X02 A;  2OTG B;  2ZNE A;  2FOT A;  2BKI B;  1K9U A;  2M9G A;  1AK8 A;  4E68 A;  1GQM A;  4XJK A;  5AEQ A;  2M7L A;  1IJ5 A;  1B9A A;  5CSI A;  4N1G A;  2K8M B;  2TN4 A;  4MVF A;  1LVC D;  1JFJ A;  1CFC A;  3I5I B;  2L2E A;  1IG5 A;  3HCM A;  5I8N A;  2KQY A;  1PAL A;  4L9M A;  2KI6 C;  1SCM C;  3GK4 X;  1HQV A;  2K2F A;  3TS5 C;  4PE7 A;  5CSN A;  2KOT A;  2KI4 C;  1KSM A;  4C0L A;  4PHJ A;  2K2A A;  2PSR A;  4GFT A;  1AP4 A;  2NXQ A;  4GGN A;  1R2U A;  1DVI A;  1PVB A;  3A8R A;  4YGA A;  1MWN A;  3VRP A;  3CZT X;  3OX6 A;  2LAP A;  1QLK A;  2MBX A;  1BMO A;  1CFF A;  2BL0 C;  1IJ6 A;  1CM4 A;  2KBI A;  3CLN A;  4M2O A;  4WRI A;  2L51 A;  1B47 A;  2WOR A;  1MXL C;  2PRU A;  2RGI A;  4DUQ A;  1DJG A;  1SMG A;  1NWD A;  5CSF A;  1S36 A;  4YGB B;  2H61 A;  4ETO A;  1E8A A;  1PK0 D;  3OX5 A;  1JUO A;  2IS9 A;  4USL A;  3I5F C;  2Y5I A;  1QX5 B;  1K93 D;  2F8P A;  1PVA A;  2WCE A;  1J55 A;  3TDI A;  3DVE A;  3CTN A;  5KTY A;  2HQ8 A;  2JPT A;  2LHI A;  1QIW A;  2ZN8 A;  4QJ3 B;  4AOM A;  3SG2 A;  3TDU A;  4MZK A;  2SCP A;  1OMR A;  4FTG A;  1ALV A;  2L4H A;  4GGF C;  1C07 A;  1KWO B;  1KFU L;  4OR9 B;  1B7T Y;  1QJT A;  2KGR A;  1IWQ A;  1WDC C;  4OKH A;  1D1O A;  2MRD A;  2PMY A;  2BCX A;  3OB1 B;  3AAJ A;  2FJU B;  2JU0 A;  1SCV A;  1WDC B;  1IKU A;  4U8D A;  1MQ1 A;  1NPQ A;  1RFJ A;  1REC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...