1ALWA

Inhibitor and calcium bound domain vi of porcine calpain
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALPAIN
publication title Crystal structure of calcium bound domain VI of calpain at 1.9 A resolution and its role in enzyme assembly, regulation, and inhibitor binding.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Calcium binding
total genus 62
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1alwA00
1UP5A 1BG1A 1M39A 1TN4A 1IQ5A 1NCZA 1UHJA 1PULA 4PHNA 4Q04A 4HSZA 1K90D 2M97A 1QX7A 2D8NA 2MLEC 3GK2A 3I5HC 1J55A 3LK1A 5I2QA 2KAXA 2BCXA 1PVBA 1SR6B 4ORAB 5AEQA 2BBMA 2TN4A 2L51A 3WHTB 4U8DA 2K2FA 3GOFA 1NCXA 2LNKA 4XYNA 3JTDB 5KTYA 3D0YA 5HKYA 1XFXO 2L0PA 1TNPA 4TNCA 1K95A 3EVVA 1MF8B 4R1EA 3RM1A 1G4YR 3CR2A 1GGWA 5CSIA 2WCEA 3HCMA 1OZSA 1OMDA 3OB2B 4GFTA 1TTXA 3LCPC 4I5JA 1V1FA 3TS5C 1XO5A 5K89A 3AAJA 2PSRA 1KQMB 3I5IC 2WCFA 4MZLA 3CR4X 5DKNA 3DF0A 3DF0B 1H4BA 2FOTA 3A4UB 1SKTA 2F2PA 2M7NA 1KWOB 2ZN8A 4M2QA 3TUYC 2A4JA 2KI6C 1RJVA 2LHLA 3AAKA 1DT7B 2KYFA 2M7LA 1PSBA 4PE7A 2PVBA 3CWGA 2PALA 3KO0A 1KK8C 3CGAA 2OS8B 4MRYA 1L7ZA 1SYMA 3EKHA 3PATA 1IJ6A 3PN7B 1CFDA 4MLWA 2H61C 3EK4A 1DJXA 1QJTA 4C0JA 1S6JA 3DVKA 1J7QA 2NXQA 4M2PA 2WC8A 4FQOA 1FF1A 2JXCA 2BKIB 2LLTA 1J1EA 5HLOA 3PFVA 2EGDA 2JT3A 3M0WA 2FCDA 1D1OA 1TIZA 2LMUA 2ZKMX 5CSJA 1ZFSA 1WRLA 2E6WA 1F54A 2AUCA 3SG4A 1TNWA 1AJ5A 3K21A 2OPOA 2Y5IA 4DRWA 5HYDA 2LE9B 3VROA 1SR6C 5HLVA 4FTGA 4NDBA 3O4YA 4CLNA 4PE0A 2KQYA 1NX2A 4MRXA 2F8PA 3I5GB 1A4PA 2KQ6A 3JTDC 4ORCB 1ZUZA 4I5NB 1IKUA 1IGVA 2MBXA 1J1DA 1BLQA 1IG5A 1S26D 4L9MA 1NP8A 1QV0A 1LA0A 5CPVA 1QTXA 1CNPA 1FW4A 1ODBA 2ZNEA 1QXPA 4GGFA 1F71A 3BUNB 2JRFA 1CB1A 2JTTA 3EVRA 1OOJA 2F3ZA 2JXLA 1ZOTB 2LLUA 3JVTB 1SL8A 4MSPA 1CDLA 1KQMC 3SG2A 2HETA 1LXFC 4PE4A 1CMFA 1WRZA 2BCBA 1A29A 4BY5A 3AKBA 1SRAA 3NSLA 1KWOC 1K93D 1NCYA 3NSIA 1EL4A 2GGZA 1B8CA 3IF7A 4QJ3B 2GV5A 1AK8A 1OSAA 2JT0A 1RTP1 4NDCA 1FPWA 1MR8A 4YI9A 1F4OA 1QATA 2ZRTA 2BL0B 2OS8C 1K2HA 2MAZA 2L98A 3TDZA 2COLB 1N2DA 4BY4A 2LMVA 3PN7C 1RWYA 2WOSA 2R2IA 1CFPA 1CLBA 1SMGA 1WY9A 2JTZA 1XFZO 1KCYA 3BUMB 2LVVA 3RLZA 4F0ZB 3I5FB 1JWDA 1QV1A 3OHMB 2CNPA 4YGCB 3BXKA 1XFUO 3FIAA 4IL1A 4YGEB 3WXAA 1TNXA 1XFYO 1MWNA 2F2OA 2L50A 1YX7A 2O60A 3DVMA 1A75A 1A75B 4JWQA 1QLKA 4MEWA 1YTZC 5JJGA 2F33A 5IBWA 5PALA 2KAYA 3CZTX 3D10A 2ZNDA 2KI4B 1JF2A 1E8AA 1CDNA 1YUUA 1N65A 1WRKA 2JZIA 1PVAA 1XK4A 4AQJA 3KEVA 1PK0D 1DGVA 2MA2A 3D0YB 4GBAA 5TNCA 2CTNA 1F4QA 1LA3A 1YVHA 1K96A 1EJ3A 1B9AA 1UURA 1XVJA 1ZACA 2NZ0A 2JULA 1VRKA 1CFCA 3NXAA 1NYAA 2V53A 1GQMA 3JVTC 5I2OA 1Y0VH 1M63B 3LLEA 1QASA 1EXRA 1OMRA 2ZN9A 1Q80A 1M46A 2VRGA 2QACA 3WNXB 1CMGA 2EHBA 2KAVA 4ORBB 1K8UA 2GGMA 5D69A 2JWWA 4P5OE 3TDUA 2BECA 3OX6A 3SG7A 1EH2A 4DS7A 2M8UA 1F70A 3O2PA 4NDDA 1DJIA 1WLMA 3SIAA 1UHIA 4OV2A 4UPGA 1H8BA 5I2LA 1J7OA 5I8NA 1S5GY 4DIRA 1NX3A 2JQ6A 2ZRSA 2M9GA 4A4BA 2NCOA 2Y1NA 2K61A 3I5FC 2KYCA 1TCFA 2OTGC 1S5GZ 4I5LB 2MHHA 2SCPA 2LV7A 2KSPA 3GK1A 5AERA 4YGBB 4AOMA 1XYDA 1Y1AA 2G9BA 4YGDB 2JT8A 1SCVA 3ICBA 4YI8A 2G2BA 3EK8A 1DF0A 2KI4C 1YUTA 4MN0A 3KPXA 5ER5A 1B4CA 2Y1MA 2LANA 3VRNA 4HRGA 3KHEA 1B8LA 2SASA 1WDCB 1C07A 4WRIA 2JOJA 1PSRA 1NPQA 3BYAA 1UHHA 3ZWHA 2L4IA 3LL8B 1GGZA 1S6CA 4CPVA 2M1UA 1B7TY 2I94A 1JFKA 4D1EA 5HKWA 2KGBC 5F6TA 1Y1UA 5DKRA 2PMYA 4PALA 1YRUB 1F55A 1B7TZ 1NX1A 1CM4A 1EG3A 2KHNA 1Y1XA 3TDIA 4A4CA 1MHOA 2I2RE 1OMVA 2KGRA 2BE6A 1XFVO 3NSOA 3VRPA 1XA5A 1KFXS 3HX4A 1B47A 4AQIA 3DVEA 4MZKA 3CTNA 4WQ2A 2HQ8A 2M0RA 1NX0A 4CFRA 1SCMB 4CIDA 2LCPA 2LVJA 2F3YA 1YRTB 4OVNF 4N1FA 2Q4UA 4C0LA 2JNXA 1YX8A 2PASA 1MUXA 1N0YA 3CR5X 2M1KB 2BKHB 2Q91A 1DJWA 1IQ3A 4ICBA 4WQ3A 3TS5B 1XFWO 3I5IB 3OP0A 3IQQA 1SPYA 2CBLA 2P6BB 1QS7A 2K7BA 3BOWA 3EVUA 1CKKA 2KFHA 2IS9A 1DTLA 3TUYB 5HKZA 4DUQA 5G08A 1UUSA 1LVCD 1TCOB 3PALA 2LP2A 1NIWA 2PRUA 5BPJA 2O5GA 3O6BA 1C7VA 4I5KA 1W7IB 3I5GC 2LC5A 2WORA 1WDCC 4JPZB 1NWDA 1KFUS 1AVSA 2H61A 2KDHA 2WNDA 1GJYA 1MXLC 4XJKB 1UHKA 4XJKA 5DKQA 3BUWB 5FYXA 1IH0A 2JC2A 2CT9A 1QX2A 2DOQA 2E30A 3PM8A 1FBVA 5JOLA 1CTRA 3H4SE 2CCMA 3EKJA 4E68A 2KBIA 5KSZA 4CFQA 2FCEA 1QX5B 4MBEA 1WLZA 4PHKA 3TZ1A 1M31A 1BR1B 2MJWB 1TRFA 1S6IA 1S3PA 2KFFA 2L4HA 2LVKA 1IJ5A 3WHUB 2QPTA 4ZCUA 1KSMA 2AMIA 1BODA 2K2AA 2ZFDA 1SCMC 5AANA 2HPSA 1K94A 2AAOA 4MVFA 2BL0C 1BT6A 2FJUB 2KOTA 1B1GA 1TOPA 2JU0A 1YR5A 2JPTA 2M29A 2LMTA 1LINA 1R2UA 2ISDA 1S36A 1L2OB 4GUKA 1SL7A 1C7WA 1KFXL 2HF5A 4NQGA 4QJ5B 1KQVA 1BOCA 2MLFC 2K7OA 1SK6D 2EC6B 4USLA 1BR4B 2K0JA 5D7FA 1BF5A 3LK0A 3VRQA 4C0KA 1BMOA 5AFPA 1AJ4A 5J3XA 1TNQA 4GPLB 1MQ1A 2M49B 3MSEB 1G8IA 3DVJA 4OKHA 1QIWA 4ETOA 1BU3A 4JQ0D 2K8MB 4N1GA 1F8HA 1SW8A 1J7RA 2Y4QA 5KU1A 4DCKA 1PRWA 1LKJA 5AXIA 2KNEA 1DF0B 3E3RA 1R6PA 2KFGA 5CSFA 1QIVA 1DJHA 1PALA 3NSKA 4PE1A 1XK4C 1RECA 1DMOA 4P2YB 3SJSA 1SL9A 4OR9B 1BJFA 4HREE 3VRRA 1EG4A 1ALWA 2NLNA 3FWBA 4YBHB 5ER4X 2LP3A 2I18A 2L5XB 1RROA 2LHIA 4GNKB 3SIBA 1FI5A 1NUBA 1ZMZA 2BBNA 3FWCA 2HQWA 1Y6WA 1KFUL 1JC2A 4PCWA 1S1EA 1YURA 2KBMA 3VGOA 1A2XA 1IWQA 3OX5A 1SNLA 3SG3A 2BE4A 5GQQC 1HQVA 1SY9A 3PLFB 2M3WA 1IRJA 3PSRA 2LAPA 3SG6A 2JNFA 1UHNA 2MRDA 3FS7A 5CSNA 1CLLA 1UWOA 2KI6D 1B8RA 3CS1A 3DD4A 3I5HB 1RK9A 3ZNIA 1W7JB 1QVIY 1AUIB 1OZOA 2LUCA 4HRHA 1M45A 1DJGA 4ZCVA 1J7PA 1DJYA 3O78A 2CXJA 3SG5A 1U5IA 1U5IB 1JUOA 1A03A 1KK7Y 2LLSA 3KF9A 1QVIZ 2I7AA 1L2OC 2K7CA 4PHJA 3OB1B 1QLSA 2K7DA 4GAOA 1G33A 2EC6C 2LUXA 3GK4X 1K9KA 1AHRA 1KSOA 4OCIA 1CM1A 1KK7Z 1X02A 2LVIA 3C1VA 1OE9B 4PDZA 1JBAA 1SBJA 4YGAA 1HT9A 1DVIA 2WCBA 2BCAA 2B1UA 1JFJA 1CLMA 1MXEA 1K9PA 1AP4A 1OQPA 5B8IB 3AKAA 1ALVA 3QRXA 4MZJA 3IQOA 1CFFA 4QJ4B 3A8RA 2H2KA 1JSAA 3BOWB 4PHMA 3F45A 4N5XA 1DGUA 1JF0A 3EK7A 1RFJA 4M2OA 1DJZA 1CDMA 3BUXB 1NSHA 1K9UA 2LM5A 1KK8B 1V1GA 1YUSA 2L2EA 3BQ3A 1FI6A 3BUOB 2NCPA 2RGIA 1YVLA 1CDPA 4GGNA 2OTGB 4YRUA 3CLNA 4GGFC
chains in the Genus database with same CATH superfamily
3N7HA 1UP5A 1BG1A 1M39A 2PYQA 1TN4A 1IQ5A 1NCZA 1UHJA 1PULA 4PHNA 4Q04A 4HSZA 1K90D 2M97A 3NGVA 1QX7A 2D8NA 2MLEC 3GK2A 3I5HC 1J55A 3BFHA 3LK1A 3S0EA 2KAXA 5I2QA 3DZTA 2BCXA 1PVBA 1SR6B 4ORAB 5AEQA 2BBMA 2TN4A 2L51A 3WHTB 4U8DA 2K2FA 3GOFA 1NCXA 2LNKA 4XYNA 3JTDB 5KTYA 1TUJA 3D0YA 5HKYA 1XFXO 5D3OA 2L0PA 3S0BA 1TNPA 4TNCA 1K95A 3EVVA 1MF8B 4R1EA 3RM1A 1G4YR 3CR2A 1GGWA 3B87A 5CSIA 2WCEA 3HCMA 1OZSA 1OMDA 3OB2B 4GFTA 1TTXA 3LCPC 5FI7A 4I5JA 1V1FA 3TS5C 1DQEA 1XO5A 5K89A 3AAJA 2PSRA 1KQMB 3I5IC 2WCFA 4MZLA 3CR4X 5DKNA 3DF0A 3DF0B 1H4BA 2FOTA 3A4UB 1SKTA 2F2PA 2M7NA 1KWOB 2ERBA 2ZN8A 4M2QA 2PQLA 3TUYC 2A4JA 2KI6C 1RJVA 2LHLA 3AAKA 1DT7B 2KYFA 2M7LA 3S0FA 2YGUA 1PSBA 4PE7A 3FE9A 2PVBA 3CWGA 3L4AA 2PALA 3KO0A 1KK8C 3NHTA 1Z2CB 3CGAA 2OS8B 4MRYA 1L7ZA 1SYMA 3EKHA 3PATA 1IJ6A 3PJIA 1XFRA 1CFDA 3PN7B 4MLWA 2H61C 3EK4A 1DJXA 1QJTA 4C0JA 1S6JA 3DVKA 1J7QA 2NXQA 4M2PA 2WC8A 4FQOA 1FF1A 2JXCA 1P28A 2BKIB 1J1EA 2LLTA 5HLOA 3PFVA 3EG5B 2EGDA 2JT3A 3M0WA 3DXLA 2FCDA 1D1OA 1T14A 3K1EA 1TIZA 3R1VA 5I94A 2LMUA 2QEBA 2QEVA 2ZKMX 5CSJA 1ZFSA 1WRLA 2E6WA 1F54A 2AUCA 3SG4A 1TNWA 1AJ5A 3K21A 2OPOA 2Y5IA 4DRWA 5HYDA 2LE9B 3VROA 1SR6C 5HLVA 4FTGA 2QDIA 3O4YA 4NDBA 4CLNA 4PE0A 2KQYA 1NX2A 4MRXA 2F8PA 3I5GB 1A4PA 2KQ6A 3JTDC 4ORCB 1ZUZA 4I5NB 1IKUA 1IGVA 2MBXA 3B7AA 1J1DA 1BLQA 1IG5A 1S26D 2FJYA 4L9MA 1NP8A 1QV0A 1LA0A 5CPVA 1QTXA 3B6XA 1FW4A 1ODBA 2ZNEA 1QXPA 4GGFA 1CNPA 1F71A 3BUNB 2JRFA 1CB1A 2JTTA 3L47A 3BFBA 3EVRA 1OOJA 3UNWA 2F3ZA 2JXLA 1ZOTB 2LLUA 3JVTB 1SL8A 4MSPA 2WCHA 1CDLA 1KQMC 3SG2A 2HETA 1LXFC 4PE4A 1CMFA 1WRZA 2BCBA 1A29A 4BY5A 3AKBA 1SRAA 3NSLA 1KWOC 1K93D 1NCYA 3NSIA 1EL4A 2GGZA 1B8CA 3IF7A 4QJ3B 1ORGA 2GV5A 1AK8A 1OSAA 2JT0A 1RTP1 3OBVA 4NDCA 1FPWA 1MR8A 4YI9A 1F4OA 1QATA 2ZRTA 3CDNA 2BL0B 2OS8C 1K2HA 2MAZA 2L98A 3TDZA 2COLB 1N2DA 4BY4A 2LMVA 3PN7C 1RWYA 2WOSA 2R2IA 1CFPA 1CLBA 1SMGA 1WY9A 2JTZA 1XFZO 3DYEA 1KCYA 3BUMB 2LVVA 3RLZA 4F0ZB 3I5FB 1JWDA 1QV1A 3OHMB 2WC6A 1W9ZA 2CNPA 3BXKA 4YGCB 1XFUO 3FIAA 4IL1A 4YGEB 3WXAA 1TNXA 1XFYO 1MWNA 2F2OA 2L50A 1YX7A 2O60A 3DVMA 1A75A 1A75B 4JWQA 1QLKA 4MEWA 1YTZC 5JJGA 2F33A 2WCJA 5IBWA 5PALA 2KAYA 3CZTX 3D10A 2ZNDA 3UO9A 2KI4B 1JF2A 1E8AA 1CDNA 1YUUA 1N65A 1WRKA 2JZIA 1TUZA 1PVAA 1XK4A 4AQJA 3RZSA 3KEVA 1PK0D 1DGVA 2MA2A 3D0YB 4GBAA 5TNCA 2CTNA 3D73A 1F4QA 1LA3A 1YVHA 1K96A 1EJ3A 1B9AA 1UURA 1XVJA 1ZACA 2NZ0A 2WCLA 2JULA 1VRKA 1CFCA 3NXAA 1NYAA 2V53A 1GQMA 3JVTC 3QMEA 1Y0VH 5I2OA 1M63B 3LLEA 1QASA 1EXRA 1OMRA 5FI2A 2ZN9A 1Q80A 1M46A 1OOHA 2QACA 2VRGA 3WNXB 1CMGA 2EHBA 3NHIA 2KAVA 4ORBB 4PT1A 1K8UA 2GGMA 5D69A 2JWWA 3S0DA 4P5OE 3TDUA 2WCKA 2BECA 3OX6A 3SG7A 3CYZA 1EH2A 4DS7A 2M8UA 1F70A 3O2PA 4JD9A 4NDDA 1DJIA 1WLMA 3SIAA 1UHIA 4OV2A 4UPGA 1H8BA 5I2LA 1J7OA 1C3ZA 2KLDA 1QWVA 1S5GY 5I8NA 4DIRA 1NX3A 2JQ6A 2ZRSA 2M9GA 4A4BA 2NCOA 2Y1NA 2K61A 3I5FC 2KYCA 1TCFA 2OTGC 1S5GZ 4I5LB 2MHHA 2SCPA 2LV7A 2P71A 2KSPA 3GK1A 5AERA 4YGBB 2P70A 4AOMA 1XYDA 1Y1AA 1TWOA 5FI6A 2G9BA 4YGDB 2JT8A 1DC1A 1SCVA 3ICBA 4YI8A 2G2BA 3EK8A 1DF0A 3V2LA 2KI4C 1YUTA 4MN0A 3KPXA 5ER5A 1B4CA 1OOIX 2Y1MA 2LANA 3VRNA 4HRGA 3KHEA 1B8LA 1DEKA 2SASA 1WDCB 3O4XA 1C07A 4WRIA 2JOJA 1PSRA 1NPQA 3BYAA 1UHHA 3ZWHA 2L4IA 3LL8B 1GGZA 1S6CA 4CPVA 2M1UA 1B7TY 2I94A 3BJHA 1JFKA 4D1EA 5HKWA 3CZ0A 2KGBC 5F6TA 1Y1UA 5DKRA 2PMYA 4PALA 1YRUB 1F55A 1B7TZ 1NX1A 1CM4A 1EG3A 2KHNA 1Y1XA 3TDIA 4A4CA 1SSEB 3CABA 1MHOA 2I2RE 1OMVA 2BNXA 2KGRA 1OOFA 1XFVO 2BE6A 3NSOA 3VRPA 5DICA 1XA5A 1KFXS 3HX4A 3VB1A 1B47A 4AQIA 2KPHA 3DVEA 2H8VA 4MZKA 3CTNA 4WQ2A 2HQ8A 3CZ1A 2M0RA 1NX0A 4CFRA 1SCMB 3R1PA 4CIDA 2LCPA 2LVJA 2F3YA 1YRTB 4OVNF 2GTEA 2Q4UA 4N1FA 4C0LA 2JNXA 1YX8A 2PASA 1MUXA 1N0YA 3CR5X 2M1KB 2BKHB 2Q91A 1DJWA 1IQ3A 4ICBA 4WQ3A 3TS5B 1XFWO 3I5IB 3FE6A 3OP0A 3IQQA 1SPYA 2JPOA 3IVTA 2CBLA 2P6BB 1QS7A 2K7BA 3BOWA 3EVUA 1CKKA 2KFHA 2IS9A 1DTLA 3TUYB 1GM0A 5HKZA 4DUQA 3S0GA 4INXA 5G08A 1UUSA 1LVCD 1TCOB 3PALA 2LP2A 1NIWA 2PRUA 5BPJA 2O5GA 3O6BA 1C7VA 4I5KA 1W7IB 3I5GC 2LC5A 2WORA 1WDCC 4JPZB 1NWDA 1KFUS 1AVSA 2H61A 2KDHA 2WNDA 1GJYA 1MXLC 4XJKB 1UHKA 4XJKA 5DKQA 3BUWB 5FYXA 1IH0A 2JC2A 2CT9A 1QX2A 2DOQA 2E30A 3PM8A 1FBVA 5JOLA 1CTRA 3H4SE 2CCMA 3EKJA 4E68A 2KBIA 5KSZA 4FQTA 4CFQA 3SS4A 2FCEA 1QX5B 4MBEA 1WLZA 4PHKA 3TZ1A 1M31A 1BR1B 2MJWB 1TRFA 1S6IA 1S3PA 2KFFA 2L4HA 2LVKA 1IJ5A 3WHUB 2QPTA 4ZCUA 1KSMA 2AMIA 1BODA 2K2AA 2ZFDA 1SCMC 5AANA 2HPSA 1K94A 2AAOA 4MVFA 2BL0C 3D77A 1BT6A 2FJUB 2KOTA 5HL1A 1B1GA 1TOPA 2JU0A 1YR5A 2JPTA 2M29A 2LMTA 1LINA 1R2UA 2ISDA 1S36A 2L5YA 1L2OB 4GUKA 1SL7A 1C7WA 1KFXL 2HF5A 4NQGA 4QJ5B 1KQVA 1BOCA 2MLFC 2K7OA 1SK6D 2EC6B 4USLA 1BR4B 2K0JA 5D7FA 4OZDA 4F7FA 1BF5A 3LK0A 1C3YA 3VRQA 4C0KA 1BMOA 3D78A 5AFPA 1AJ4A 5J3XA 1TNQA 3SS5A 4GPLB 1MQ1A 2M49B 3MSEB 1G8IA 3DVJA 4OKHA 1QIWA 4ETOA 1BU3A 4JQ0D 2K8MB 4N1GA 1F8HA 3D74A 3B86A 1SW8A 1J7RA 2Y4QA 5KU1A 4DCKA 1PRWA 1LKJA 5AXIA 2KNEA 3L4LA 1DF0B 3E3RA 1R6PA 2KFGA 5CSFA 1QIVA 1DJHA 1PALA 3NSKA 4PE1A 1XK4C 1RECA 1DMOA 4P2YB 3SJSA 1SL9A 4OR9B 1BJFA 4HREE 3VRRA 1EG4A 1ALWA 2NLNA 3FWBA 4YBHB 5ER4X 2LP3A 2I18A 2L5XB 1RROA 2LHIA 4GNKB 4IJ7A 3SIBA 1NUBA 1ZMZA 2BBNA 3FWCA 1FI5A 2BAPA 2HQWA 1Y6WA 1KFUL 1JC2A 4PCWA 1S1EA 1YURA 2KBMA 3VGOA 1OOGA 1A2XA 1IWQA 3OX5A 1SNLA 3SG3A 2BE4A 5GQQC 1HQVA 1DELA 1SY9A 3PLFB 2M3WA 1IRJA 3PSRA 2LAPA 3SG6A 2JNFA 3B88A 1UHNA 2MRDA 3FS7A 3R72A 5CSNA 1CLLA 1UWOA 2KI6D 1B8RA 3CS1A 3DD4A 3DY9A 1RK9A 3I5HB 2QEOA 3ZNIA 4JKTA 1W7JB 1QVIY 1AUIB 1OZOA 2LUCA 4HRHA 1M45A 1DJGA 4ZCVA 1J7PA 1DJYA 3O78A 2CXJA 3SG5A 1U5IA 1U5IB 1JUOA 1A03A 3R1OA 1KK7Y 2LLSA 3KF9A 1QVIZ 2I7AA 1L2OC 2K7CA 2QEHA 4PHJA 3OB1B 1QLSA 2K7DA 4GAOA 1G33A 2EC6C 2LUXA 3GK4X 1K9KA 3PM2A 1AHRA 1KSOA 4OCIA 1CM1A 1KK7Z 1X02A 2LVIA 3C1VA 1OE9B 1Z4HA 4PDZA 1SBJA 4YGAA 1JBAA 1HT9A 1DVIA 2K60A 2WCBA 4INWA 2BCAA 2B1UA 1JFJA 1CLMA 1MXEA 1K9PA 3FE8A 1AP4A 1OQPA 5B8IB 3AKAA 1ALVA 3QRXA 4MZJA 3IQOA 1CFFA 3BFAA 4QJ4B 3A8RA 2H2KA 1JSAA 3BOWB 1OW4A 3D75A 4PHMA 3F45A 5EL2A 3S0AA 4N5XA 3D76A 1DGUA 1JF0A 3EK7A 1RFJA 4M2OA 3SS3A 1IIOA 1DJZA 1CDMA 3BUXB 3Q8IA 3CZ2A 1NSHA 1K9UA 3OGNA 2LM5A 1KK8B 1V1GA 1YUSA 2L2EA 3BQ3A 2WCMA 3BUOB 1FI6A 2NCPA 1LS8A 2L2CA 2RGIA 1YVLA 1CDPA 2WC5A 4GGNA 2OTGB 4YRUA 3CLNA 2KLEA 4GGFC 4KYNA
chains in the Genus database with same CATH topology
1UP5A 1BG1A 1M39A 1TN4A 1IQ5A 1NCZA 1UHJA 1PULA 4PHNA 4Q04A 4HSZA 1K90D 2M97A 1QX7A 2D8NA 2MLEC 3GK2A 3I5HC 1J55A 3LK1A 5I2QA 2KAXA 2BCXA 1PVBA 1SR6B 4ORAB 5AEQA 2BBMA 2TN4A 2L51A 3WHTB 4U8DA 2K2FA 3GOFA 1NCXA 2LNKA 4XYNA 3JTDB 5KTYA 3D0YA 5HKYA 1XFXO 2L0PA 1TNPA 4TNCA 1K95A 3EVVA 1MF8B 4R1EA 3RM1A 1G4YR 3CR2A 1GGWA 5CSIA 2WCEA 3HCMA 1OZSA 1OMDA 3OB2B 4GFTA 1TTXA 3LCPC 4I5JA 1V1FA 3TS5C 1XO5A 5K89A 3AAJA 2PSRA 1KQMB 3I5IC 2WCFA 4MZLA 3CR4X 5DKNA 3DF0A 3DF0B 1H4BA 2FOTA 3A4UB 1SKTA 2F2PA 2M7NA 1KWOB 2ZN8A 4M2QA 3TUYC 2A4JA 2KI6C 1RJVA 2LHLA 3AAKA 1DT7B 2KYFA 2M7LA 1PSBA 4PE7A 2PVBA 3CWGA 2PALA 3KO0A 1KK8C 3CGAA 2OS8B 4MRYA 1L7ZA 1SYMA 3EKHA 3PATA 1IJ6A 3PN7B 1CFDA 4MLWA 2H61C 3EK4A 1DJXA 1QJTA 4C0JA 1S6JA 3DVKA 1J7QA 2NXQA 4M2PA 2WC8A 4FQOA 1FF1A 2JXCA 2BKIB 2LLTA 1J1EA 5HLOA 3PFVA 2EGDA 2JT3A 3M0WA 2FCDA 1D1OA 1TIZA 2LMUA 2ZKMX 5CSJA 1ZFSA 1WRLA 2E6WA 1F54A 2AUCA 3SG4A 1TNWA 1AJ5A 3K21A 2OPOA 2Y5IA 4DRWA 5HYDA 2LE9B 3VROA 1SR6C 5HLVA 4FTGA 4NDBA 3O4YA 4CLNA 4PE0A 2KQYA 1NX2A 4MRXA 2F8PA 3I5GB 1A4PA 2KQ6A 3JTDC 4ORCB 1ZUZA 4I5NB 1IKUA 1IGVA 2MBXA 1J1DA 1BLQA 1IG5A 1S26D 4L9MA 1NP8A 1QV0A 1LA0A 5CPVA 1QTXA 1CNPA 1FW4A 1ODBA 2ZNEA 1QXPA 4GGFA 1F71A 3BUNB 2JRFA 1CB1A 2JTTA 3EVRA 1OOJA 2F3ZA 2JXLA 1ZOTB 2LLUA 3JVTB 1SL8A 4MSPA 1CDLA 1KQMC 3SG2A 2HETA 1LXFC 4PE4A 1CMFA 1WRZA 2BCBA 1A29A 4BY5A 3AKBA 1SRAA 3NSLA 1KWOC 1K93D 1NCYA 3NSIA 1EL4A 2GGZA 1B8CA 3IF7A 4QJ3B 2GV5A 1AK8A 1OSAA 2JT0A 1RTP1 4NDCA 1FPWA 1MR8A 4YI9A 1F4OA 1QATA 2ZRTA 2BL0B 2OS8C 1K2HA 2MAZA 2L98A 3TDZA 2COLB 1N2DA 4BY4A 2LMVA 3PN7C 1RWYA 2WOSA 2R2IA 1CFPA 1CLBA 1SMGA 1WY9A 2JTZA 1XFZO 1KCYA 3BUMB 2LVVA 3RLZA 4F0ZB 3I5FB 1JWDA 1QV1A 3OHMB 2CNPA 4YGCB 3BXKA 1XFUO 3FIAA 4IL1A 4YGEB 3WXAA 1TNXA 1XFYO 1MWNA 2F2OA 2L50A 1YX7A 2O60A 3DVMA 1A75A 1A75B 4JWQA 1QLKA 4MEWA 1YTZC 5JJGA 2F33A 5IBWA 5PALA 2KAYA 3CZTX 3D10A 2ZNDA 2KI4B 1JF2A 1E8AA 1CDNA 1YUUA 1N65A 1WRKA 2JZIA 1PVAA 1XK4A 4AQJA 3KEVA 1PK0D 1DGVA 2MA2A 3D0YB 4GBAA 5TNCA 2CTNA 1F4QA 1LA3A 1YVHA 1K96A 1EJ3A 1B9AA 1UURA 1XVJA 1ZACA 2NZ0A 2JULA 1VRKA 1CFCA 3NXAA 1NYAA 2V53A 1GQMA 3JVTC 5I2OA 1Y0VH 1M63B 3LLEA 1QASA 1EXRA 1OMRA 2ZN9A 1Q80A 1M46A 2VRGA 2QACA 3WNXB 1CMGA 2EHBA 2KAVA 4ORBB 1K8UA 2GGMA 5D69A 2JWWA 4P5OE 3TDUA 2BECA 3OX6A 3SG7A 1EH2A 4DS7A 2M8UA 1F70A 3O2PA 4NDDA 1DJIA 1WLMA 3SIAA 1UHIA 4OV2A 4UPGA 1H8BA 5I2LA 1J7OA 5I8NA 1S5GY 4DIRA 1NX3A 2JQ6A 2ZRSA 2M9GA 4A4BA 2NCOA 2Y1NA 2K61A 3I5FC 2KYCA 1TCFA 2OTGC 1S5GZ 4I5LB 2MHHA 2SCPA 2LV7A 2KSPA 3GK1A 5AERA 4YGBB 4AOMA 1XYDA 1Y1AA 2G9BA 4YGDB 2JT8A 1SCVA 3ICBA 4YI8A 2G2BA 3EK8A 1DF0A 2KI4C 1YUTA 4MN0A 3KPXA 5ER5A 1B4CA 2Y1MA 2LANA 3VRNA 4HRGA 3KHEA 1B8LA 2SASA 1WDCB 1C07A 4WRIA 2JOJA 1PSRA 1NPQA 3BYAA 1UHHA 3ZWHA 2L4IA 3LL8B 1GGZA 1S6CA 4CPVA 2M1UA 1B7TY 2I94A 1JFKA 4D1EA 5HKWA 2KGBC 5F6TA 1Y1UA 5DKRA 2PMYA 4PALA 1YRUB 1F55A 1B7TZ 1NX1A 1CM4A 1EG3A 2KHNA 1Y1XA 3TDIA 4A4CA 1MHOA 2I2RE 1OMVA 2KGRA 2BE6A 1XFVO 3NSOA 3VRPA 1XA5A 1KFXS 3HX4A 1B47A 4AQIA 3DVEA 4MZKA 3CTNA 4WQ2A 2HQ8A 2M0RA 1NX0A 4CFRA 1SCMB 4CIDA 2LCPA 2LVJA 2F3YA 1YRTB 4OVNF 4N1FA 2Q4UA 4C0LA 2JNXA 1YX8A 2PASA 1MUXA 1N0YA 3CR5X 2M1KB 2BKHB 2Q91A 1DJWA 1IQ3A 4ICBA 4WQ3A 3TS5B 1XFWO 3I5IB 3OP0A 3IQQA 1SPYA 2CBLA 2P6BB 1QS7A 2K7BA 3BOWA 3EVUA 1CKKA 2KFHA 2IS9A 1DTLA 3TUYB 5HKZA 4DUQA 5G08A 1UUSA 1LVCD 1TCOB 3PALA 2LP2A 1NIWA 2PRUA 5BPJA 2O5GA 3O6BA 1C7VA 4I5KA 1W7IB 3I5GC 2LC5A 2WORA 1WDCC 4JPZB 1NWDA 1KFUS 1AVSA 2H61A 2KDHA 2WNDA 1GJYA 1MXLC 4XJKB 1UHKA 4XJKA 5DKQA 3BUWB 5FYXA 1IH0A 2JC2A 2CT9A 1QX2A 2DOQA 2E30A 3PM8A 1FBVA 5JOLA 1CTRA 3H4SE 2CCMA 3EKJA 4E68A 2KBIA 5KSZA 4CFQA 2FCEA 1QX5B 4MBEA 1WLZA 4PHKA 3TZ1A 1M31A 1BR1B 2MJWB 1TRFA 1S6IA 1S3PA 2KFFA 2L4HA 2LVKA 1IJ5A 3WHUB 2QPTA 4ZCUA 1KSMA 2AMIA 1BODA 2K2AA 2ZFDA 1SCMC 5AANA 2HPSA 1K94A 2AAOA 4MVFA 2BL0C 1BT6A 2FJUB 2KOTA 1B1GA 1TOPA 2JU0A 1YR5A 2JPTA 2M29A 2LMTA 1LINA 1R2UA 2ISDA 1S36A 1L2OB 4GUKA 1SL7A 1C7WA 1KFXL 2HF5A 4NQGA 4QJ5B 1KQVA 1BOCA 2MLFC 2K7OA 1SK6D 2EC6B 4USLA 1BR4B 2K0JA 5D7FA 1BF5A 3LK0A 3VRQA 4C0KA 1BMOA 5AFPA 1AJ4A 5J3XA 1TNQA 4GPLB 1MQ1A 2M49B 3MSEB 1G8IA 3DVJA 4OKHA 1QIWA 4ETOA 1BU3A 4JQ0D 2K8MB 4N1GA 1F8HA 1SW8A 1J7RA 2Y4QA 5KU1A 4DCKA 1PRWA 1LKJA 5AXIA 2KNEA 1DF0B 3E3RA 1R6PA 2KFGA 5CSFA 1QIVA 1DJHA 1PALA 3NSKA 4PE1A 1XK4C 1RECA 1DMOA 4P2YB 3SJSA 1SL9A 4OR9B 1BJFA 4HREE 3VRRA 1EG4A 1ALWA 2NLNA 3FWBA 4YBHB 5ER4X 2LP3A 2I18A 2L5XB 1RROA 2LHIA 4GNKB 3SIBA 1FI5A 1NUBA 1ZMZA 2BBNA 3FWCA 2HQWA 1Y6WA 1KFUL 1JC2A 4PCWA 1S1EA 1YURA 2KBMA 3VGOA 1A2XA 1IWQA 3OX5A 1SNLA 3SG3A 2BE4A 5GQQC 1HQVA 1SY9A 3PLFB 2M3WA 1IRJA 3PSRA 2LAPA 3SG6A 2JNFA 1UHNA 2MRDA 3FS7A 5CSNA 1CLLA 1UWOA 2KI6D 1B8RA 3CS1A 3DD4A 3I5HB 1RK9A 3ZNIA 1W7JB 1QVIY 1AUIB 1OZOA 2LUCA 4HRHA 1M45A 1DJGA 4ZCVA 1J7PA 1DJYA 3O78A 2CXJA 3SG5A 1U5IA 1U5IB 1JUOA 1A03A 1KK7Y 2LLSA 3KF9A 1QVIZ 2I7AA 1L2OC 2K7CA 4PHJA 3OB1B 1QLSA 2K7DA 4GAOA 1G33A 2EC6C 2LUXA 3GK4X 1K9KA 1AHRA 1KSOA 4OCIA 1CM1A 1KK7Z 1X02A 2LVIA 3C1VA 1OE9B 4PDZA 1JBAA 1SBJA 4YGAA 1HT9A 1DVIA 2WCBA 2BCAA 2B1UA 1JFJA 1CLMA 1MXEA 1K9PA 1AP4A 1OQPA 5B8IB 3AKAA 1ALVA 3QRXA 4MZJA 3IQOA 1CFFA 4QJ4B 3A8RA 2H2KA 1JSAA 3BOWB 4PHMA 3F45A 4N5XA 1DGUA 1JF0A 3EK7A 1RFJA 4M2OA 1DJZA 1CDMA 3BUXB 1NSHA 1K9UA 2LM5A 1KK8B 1V1GA 1YUSA 2L2EA 3BQ3A 1FI6A 3BUOB 2NCPA 2RGIA 1YVLA 1CDPA 4GGNA 2OTGB 4YRUA 3CLNA 4GGFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UP5 A;  1BG1 A;  1M39 A;  1TN4 A;  1IQ5 A;  1NCZ A;  1UHJ A;  1PUL A;  4PHN A;  4Q04 A;  4HSZ A;  1K90 D;  2M97 A;  1QX7 A;  2D8N A;  2MLE C;  3GK2 A;  3I5H C;  1J55 A;  3LK1 A;  5I2Q A;  2KAX A;  2BCX A;  1PVB A;  1SR6 B;  4ORA B;  5AEQ A;  2BBM A;  2TN4 A;  2L51 A;  3WHT B;  4U8D A;  2K2F A;  3GOF A;  1NCX A;  2LNK A;  4XYN A;  3JTD B;  5KTY A;  3D0Y A;  5HKY A;  1XFX O;  2L0P A;  1TNP A;  4TNC A;  1K95 A;  3EVV A;  1MF8 B;  4R1E A;  3RM1 A;  1G4Y R;  3CR2 A;  1GGW A;  5CSI A;  2WCE A;  3HCM A;  1OZS A;  1OMD A;  3OB2 B;  4GFT A;  1TTX A;  3LCP C;  4I5J A;  1V1F A;  3TS5 C;  1XO5 A;  5K89 A;  3AAJ A;  2PSR A;  1KQM B;  3I5I C;  2WCF A;  4MZL A;  3CR4 X;  5DKN A;  3DF0 A;  3DF0 B;  1H4B A;  2FOT A;  3A4U B;  1SKT A;  2F2P A;  2M7N A;  1KWO B;  2ZN8 A;  4M2Q A;  3TUY C;  2A4J A;  2KI6 C;  1RJV A;  2LHL A;  3AAK A;  1DT7 B;  2KYF A;  2M7L A;  1PSB A;  4PE7 A;  2PVB A;  3CWG A;  2PAL A;  3KO0 A;  1KK8 C;  3CGA A;  2OS8 B;  4MRY A;  1L7Z A;  1SYM A;  3EKH A;  3PAT A;  1IJ6 A;  3PN7 B;  1CFD A;  4MLW A;  2H61 C;  3EK4 A;  1DJX A;  1QJT A;  4C0J A;  1S6J A;  3DVK A;  1J7Q A;  2NXQ A;  4M2P A;  2WC8 A;  4FQO A;  1FF1 A;  2JXC A;  2BKI B;  2LLT A;  1J1E A;  5HLO A;  3PFV A;  2EGD A;  2JT3 A;  3M0W A;  2FCD A;  1D1O A;  1TIZ A;  2LMU A;  2ZKM X;  5CSJ A;  1ZFS A;  1WRL A;  2E6W A;  1F54 A;  2AUC A;  3SG4 A;  1TNW A;  1AJ5 A;  3K21 A;  2OPO A;  2Y5I A;  4DRW A;  5HYD A;  2LE9 B;  3VRO A;  1SR6 C;  5HLV A;  4FTG A;  4NDB A;  3O4Y A;  4CLN A;  4PE0 A;  2KQY A;  1NX2 A;  4MRX A;  2F8P A;  3I5G B;  1A4P A;  2KQ6 A;  3JTD C;  4ORC B;  1ZUZ A;  4I5N B;  1IKU A;  1IGV A;  2MBX A;  1J1D A;  1BLQ A;  1IG5 A;  1S26 D;  4L9M A;  1NP8 A;  1QV0 A;  1LA0 A;  5CPV A;  1QTX A;  1CNP A;  1FW4 A;  1ODB A;  2ZNE A;  1QXP A;  4GGF A;  1F71 A;  3BUN B;  2JRF A;  1CB1 A;  2JTT A;  3EVR A;  1OOJ A;  2F3Z A;  2JXL A;  1ZOT B;  2LLU A;  3JVT B;  1SL8 A;  4MSP A;  1CDL A;  1KQM C;  3SG2 A;  2HET A;  1LXF C;  4PE4 A;  1CMF A;  1WRZ A;  2BCB A;  1A29 A;  4BY5 A;  3AKB A;  1SRA A;  3NSL A;  1KWO C;  1K93 D;  1NCY A;  3NSI A;  1EL4 A;  2GGZ A;  1B8C A;  3IF7 A;  4QJ3 B;  2GV5 A;  1AK8 A;  1OSA A;  2JT0 A;  1RTP 1;  4NDC A;  1FPW A;  1MR8 A;  4YI9 A;  1F4O A;  1QAT A;  2ZRT A;  2BL0 B;  2OS8 C;  1K2H A;  2MAZ A;  2L98 A;  3TDZ A;  2COL B;  1N2D A;  4BY4 A;  2LMV A;  3PN7 C;  1RWY A;  2WOS A;  2R2I A;  1CFP A;  1CLB A;  1SMG A;  1WY9 A;  2JTZ A;  1XFZ O;  1KCY A;  3BUM B;  2LVV A;  3RLZ A;  4F0Z B;  3I5F B;  1JWD A;  1QV1 A;  3OHM B;  2CNP A;  4YGC B;  3BXK A;  1XFU O;  3FIA A;  4IL1 A;  4YGE B;  3WXA A;  1TNX A;  1XFY O;  1MWN A;  2F2O A;  2L50 A;  1YX7 A;  2O60 A;  3DVM A;  1A75 A;  1A75 B;  4JWQ A;  1QLK A;  4MEW A;  1YTZ C;  5JJG A;  2F33 A;  5IBW A;  5PAL A;  2KAY A;  3CZT X;  3D10 A;  2ZND A;  2KI4 B;  1JF2 A;  1E8A A;  1CDN A;  1YUU A;  1N65 A;  1WRK A;  2JZI A;  1PVA A;  1XK4 A;  4AQJ A;  3KEV A;  1PK0 D;  1DGV A;  2MA2 A;  3D0Y B;  4GBA A;  5TNC A;  2CTN A;  1F4Q A;  1LA3 A;  1YVH A;  1K96 A;  1EJ3 A;  1B9A A;  1UUR A;  1XVJ A;  1ZAC A;  2NZ0 A;  2JUL A;  1VRK A;  1CFC A;  3NXA A;  1NYA A;  2V53 A;  1GQM A;  3JVT C;  5I2O A;  1Y0V H;  1M63 B;  3LLE A;  1QAS A;  1EXR A;  1OMR A;  2ZN9 A;  1Q80 A;  1M46 A;  2VRG A;  2QAC A;  3WNX B;  1CMG A;  2EHB A;  2KAV A;  4ORB B;  1K8U A;  2GGM A;  5D69 A;  2JWW A;  4P5O E;  3TDU A;  2BEC A;  3OX6 A;  3SG7 A;  1EH2 A;  4DS7 A;  2M8U A;  1F70 A;  3O2P A;  4NDD A;  1DJI A;  1WLM A;  3SIA A;  1UHI A;  4OV2 A;  4UPG A;  1H8B A;  5I2L A;  1J7O A;  5I8N A;  1S5G Y;  4DIR A;  1NX3 A;  2JQ6 A;  2ZRS A;  2M9G A;  4A4B A;  2NCO A;  2Y1N A;  2K61 A;  3I5F C;  2KYC A;  1TCF A;  2OTG C;  1S5G Z;  4I5L B;  2MHH A;  2SCP A;  2LV7 A;  2KSP A;  3GK1 A;  5AER A;  4YGB B;  4AOM A;  1XYD A;  1Y1A A;  2G9B A;  4YGD B;  2JT8 A;  1SCV A;  3ICB A;  4YI8 A;  2G2B A;  3EK8 A;  1DF0 A;  2KI4 C;  1YUT A;  4MN0 A;  3KPX A;  5ER5 A;  1B4C A;  2Y1M A;  2LAN A;  3VRN A;  4HRG A;  3KHE A;  1B8L A;  2SAS A;  1WDC B;  1C07 A;  4WRI A;  2JOJ A;  1PSR A;  1NPQ A;  3BYA A;  1UHH A;  3ZWH A;  2L4I A;  3LL8 B;  1GGZ A;  1S6C A;  4CPV A;  2M1U A;  1B7T Y;  2I94 A;  1JFK A;  4D1E A;  5HKW A;  2KGB C;  5F6T A;  1Y1U A;  5DKR A;  2PMY A;  4PAL A;  1YRU B;  1F55 A;  1B7T Z;  1NX1 A;  1CM4 A;  1EG3 A;  2KHN A;  1Y1X A;  3TDI A;  4A4C A;  1MHO A;  2I2R E;  1OMV A;  2KGR A;  2BE6 A;  1XFV O;  3NSO A;  3VRP A;  1XA5 A;  1KFX S;  3HX4 A;  1B47 A;  4AQI A;  3DVE A;  4MZK A;  3CTN A;  4WQ2 A;  2HQ8 A;  2M0R A;  1NX0 A;  4CFR A;  1SCM B;  4CID A;  2LCP A;  2LVJ A;  2F3Y A;  1YRT B;  4OVN F;  4N1F A;  2Q4U A;  4C0L A;  2JNX A;  1YX8 A;  2PAS A;  1MUX A;  1N0Y A;  3CR5 X;  2M1K B;  2BKH B;  2Q91 A;  1DJW A;  1IQ3 A;  4ICB A;  4WQ3 A;  3TS5 B;  1XFW O;  3I5I B;  3OP0 A;  3IQQ A;  1SPY A;  2CBL A;  2P6B B;  1QS7 A;  2K7B A;  3BOW A;  3EVU A;  1CKK A;  2KFH A;  2IS9 A;  1DTL A;  3TUY B;  5HKZ A;  4DUQ A;  5G08 A;  1UUS A;  1LVC D;  1TCO B;  3PAL A;  2LP2 A;  1NIW A;  2PRU A;  5BPJ A;  2O5G A;  3O6B A;  1C7V A;  4I5K A;  1W7I B;  3I5G C;  2LC5 A;  2WOR A;  1WDC C;  4JPZ B;  1NWD A;  1KFU S;  1AVS A;  2H61 A;  2KDH A;  2WND A;  1GJY A;  1MXL C;  4XJK B;  1UHK A;  4XJK A;  5DKQ A;  3BUW B;  5FYX A;  1IH0 A;  2JC2 A;  2CT9 A;  1QX2 A;  2DOQ A;  2E30 A;  3PM8 A;  1FBV A;  5JOL A;  1CTR A;  3H4S E;  2CCM A;  3EKJ A;  4E68 A;  2KBI A;  5KSZ A;  4CFQ A;  2FCE A;  1QX5 B;  4MBE A;  1WLZ A;  4PHK A;  3TZ1 A;  1M31 A;  1BR1 B;  2MJW B;  1TRF A;  1S6I A;  1S3P A;  2KFF A;  2L4H A;  2LVK A;  1IJ5 A;  3WHU B;  2QPT A;  4ZCU A;  1KSM A;  2AMI A;  1BOD A;  2K2A A;  2ZFD A;  1SCM C;  5AAN A;  2HPS A;  1K94 A;  2AAO A;  4MVF A;  2BL0 C;  1BT6 A;  2FJU B;  2KOT A;  1B1G A;  1TOP A;  2JU0 A;  1YR5 A;  2JPT A;  2M29 A;  2LMT A;  1LIN A;  1R2U A;  2ISD A;  1S36 A;  1L2O B;  4GUK A;  1SL7 A;  1C7W A;  1KFX L;  2HF5 A;  4NQG A;  4QJ5 B;  1KQV A;  1BOC A;  2MLF C;  2K7O A;  1SK6 D;  2EC6 B;  4USL A;  1BR4 B;  2K0J A;  5D7F A;  1BF5 A;  3LK0 A;  3VRQ A;  4C0K A;  1BMO A;  5AFP A;  1AJ4 A;  5J3X A;  1TNQ A;  4GPL B;  1MQ1 A;  2M49 B;  3MSE B;  1G8I A;  3DVJ A;  4OKH A;  1QIW A;  4ETO A;  1BU3 A;  4JQ0 D;  2K8M B;  4N1G A;  1F8H A;  1SW8 A;  1J7R A;  2Y4Q A;  5KU1 A;  4DCK A;  1PRW A;  1LKJ A;  5AXI A;  2KNE A;  1DF0 B;  3E3R A;  1R6P A;  2KFG A;  5CSF A;  1QIV A;  1DJH A;  1PAL A;  3NSK A;  4PE1 A;  1XK4 C;  1REC A;  1DMO A;  4P2Y B;  3SJS A;  1SL9 A;  4OR9 B;  1BJF A;  4HRE E;  3VRR A;  1EG4 A;  1ALW A;  2NLN A;  3FWB A;  4YBH B;  5ER4 X;  2LP3 A;  2I18 A;  2L5X B;  1RRO A;  2LHI A;  4GNK B;  3SIB A;  1FI5 A;  1NUB A;  1ZMZ A;  2BBN A;  3FWC A;  2HQW A;  1Y6W A;  1KFU L;  1JC2 A;  4PCW A;  1S1E A;  1YUR A;  2KBM A;  3VGO A;  1A2X A;  1IWQ A;  3OX5 A;  1SNL A;  3SG3 A;  2BE4 A;  5GQQ C;  1HQV A;  1SY9 A;  3PLF B;  2M3W A;  1IRJ A;  3PSR A;  2LAP A;  3SG6 A;  2JNF A;  1UHN A;  2MRD A;  3FS7 A;  5CSN A;  1CLL A;  1UWO A;  2KI6 D;  1B8R A;  3CS1 A;  3DD4 A;  3I5H B;  1RK9 A;  3ZNI A;  1W7J B;  1QVI Y;  1AUI B;  1OZO A;  2LUC A;  4HRH A;  1M45 A;  1DJG A;  4ZCV A;  1J7P A;  1DJY A;  3O78 A;  2CXJ A;  3SG5 A;  1U5I A;  1U5I B;  1JUO A;  1A03 A;  1KK7 Y;  2LLS A;  3KF9 A;  1QVI Z;  2I7A A;  1L2O C;  2K7C A;  4PHJ A;  3OB1 B;  1QLS A;  2K7D A;  4GAO A;  1G33 A;  2EC6 C;  2LUX A;  3GK4 X;  1K9K A;  1AHR A;  1KSO A;  4OCI A;  1CM1 A;  1KK7 Z;  1X02 A;  2LVI A;  3C1V A;  1OE9 B;  4PDZ A;  1JBA A;  1SBJ A;  4YGA A;  1HT9 A;  1DVI A;  2WCB A;  2BCA A;  2B1U A;  1JFJ A;  1CLM A;  1MXE A;  1K9P A;  1AP4 A;  1OQP A;  5B8I B;  3AKA A;  1ALV A;  3QRX A;  4MZJ A;  3IQO A;  1CFF A;  4QJ4 B;  3A8R A;  2H2K A;  1JSA A;  3BOW B;  4PHM A;  3F45 A;  4N5X A;  1DGU A;  1JF0 A;  3EK7 A;  1RFJ A;  4M2O A;  1DJZ A;  1CDM A;  3BUX B;  1NSH A;  1K9U A;  2LM5 A;  1KK8 B;  1V1G A;  1YUS A;  2L2E A;  3BQ3 A;  1FI6 A;  3BUO B;  2NCP A;  2RGI A;  1YVL A;  1CDP A;  4GGN A;  2OTG B;  4YRU A;  3CLN A;  4GGF C; 
#chains in the Genus database with same CATH topology
 3N7H A;  1UP5 A;  1BG1 A;  1M39 A;  2PYQ A;  1TN4 A;  1IQ5 A;  1NCZ A;  1UHJ A;  1PUL A;  4PHN A;  4Q04 A;  4HSZ A;  1K90 D;  2M97 A;  3NGV A;  1QX7 A;  2D8N A;  2MLE C;  3GK2 A;  3I5H C;  1J55 A;  3BFH A;  3LK1 A;  3S0E A;  2KAX A;  5I2Q A;  3DZT A;  2BCX A;  1PVB A;  1SR6 B;  4ORA B;  5AEQ A;  2BBM A;  2TN4 A;  2L51 A;  3WHT B;  4U8D A;  2K2F A;  3GOF A;  1NCX A;  2LNK A;  4XYN A;  3JTD B;  5KTY A;  1TUJ A;  3D0Y A;  5HKY A;  1XFX O;  5D3O A;  2L0P A;  3S0B A;  1TNP A;  4TNC A;  1K95 A;  3EVV A;  1MF8 B;  4R1E A;  3RM1 A;  1G4Y R;  3CR2 A;  1GGW A;  3B87 A;  5CSI A;  2WCE A;  3HCM A;  1OZS A;  1OMD A;  3OB2 B;  4GFT A;  1TTX A;  3LCP C;  5FI7 A;  4I5J A;  1V1F A;  3TS5 C;  1DQE A;  1XO5 A;  5K89 A;  3AAJ A;  2PSR A;  1KQM B;  3I5I C;  2WCF A;  4MZL A;  3CR4 X;  5DKN A;  3DF0 A;  3DF0 B;  1H4B A;  2FOT A;  3A4U B;  1SKT A;  2F2P A;  2M7N A;  1KWO B;  2ERB A;  2ZN8 A;  4M2Q A;  2PQL A;  3TUY C;  2A4J A;  2KI6 C;  1RJV A;  2LHL A;  3AAK A;  1DT7 B;  2KYF A;  2M7L A;  3S0F A;  2YGU A;  1PSB A;  4PE7 A;  3FE9 A;  2PVB A;  3CWG A;  3L4A A;  2PAL A;  3KO0 A;  1KK8 C;  3NHT A;  1Z2C B;  3CGA A;  2OS8 B;  4MRY A;  1L7Z A;  1SYM A;  3EKH A;  3PAT A;  1IJ6 A;  3PJI A;  1XFR A;  1CFD A;  3PN7 B;  4MLW A;  2H61 C;  3EK4 A;  1DJX A;  1QJT A;  4C0J A;  1S6J A;  3DVK A;  1J7Q A;  2NXQ A;  4M2P A;  2WC8 A;  4FQO A;  1FF1 A;  2JXC A;  1P28 A;  2BKI B;  1J1E A;  2LLT A;  5HLO A;  3PFV A;  3EG5 B;  2EGD A;  2JT3 A;  3M0W A;  3DXL A;  2FCD A;  1D1O A;  1T14 A;  3K1E A;  1TIZ A;  3R1V A;  5I94 A;  2LMU A;  2QEB A;  2QEV A;  2ZKM X;  5CSJ A;  1ZFS A;  1WRL A;  2E6W A;  1F54 A;  2AUC A;  3SG4 A;  1TNW A;  1AJ5 A;  3K21 A;  2OPO A;  2Y5I A;  4DRW A;  5HYD A;  2LE9 B;  3VRO A;  1SR6 C;  5HLV A;  4FTG A;  2QDI A;  3O4Y A;  4NDB A;  4CLN A;  4PE0 A;  2KQY A;  1NX2 A;  4MRX A;  2F8P A;  3I5G B;  1A4P A;  2KQ6 A;  3JTD C;  4ORC B;  1ZUZ A;  4I5N B;  1IKU A;  1IGV A;  2MBX A;  3B7A A;  1J1D A;  1BLQ A;  1IG5 A;  1S26 D;  2FJY A;  4L9M A;  1NP8 A;  1QV0 A;  1LA0 A;  5CPV A;  1QTX A;  3B6X A;  1FW4 A;  1ODB A;  2ZNE A;  1QXP A;  4GGF A;  1CNP A;  1F71 A;  3BUN B;  2JRF A;  1CB1 A;  2JTT A;  3L47 A;  3BFB A;  3EVR A;  1OOJ A;  3UNW A;  2F3Z A;  2JXL A;  1ZOT B;  2LLU A;  3JVT B;  1SL8 A;  4MSP A;  2WCH A;  1CDL A;  1KQM C;  3SG2 A;  2HET A;  1LXF C;  4PE4 A;  1CMF A;  1WRZ A;  2BCB A;  1A29 A;  4BY5 A;  3AKB A;  1SRA A;  3NSL A;  1KWO C;  1K93 D;  1NCY A;  3NSI A;  1EL4 A;  2GGZ A;  1B8C A;  3IF7 A;  4QJ3 B;  1ORG A;  2GV5 A;  1AK8 A;  1OSA A;  2JT0 A;  1RTP 1;  3OBV A;  4NDC A;  1FPW A;  1MR8 A;  4YI9 A;  1F4O A;  1QAT A;  2ZRT A;  3CDN A;  2BL0 B;  2OS8 C;  1K2H A;  2MAZ A;  2L98 A;  3TDZ A;  2COL B;  1N2D A;  4BY4 A;  2LMV A;  3PN7 C;  1RWY A;  2WOS A;  2R2I A;  1CFP A;  1CLB A;  1SMG A;  1WY9 A;  2JTZ A;  1XFZ O;  3DYE A;  1KCY A;  3BUM B;  2LVV A;  3RLZ A;  4F0Z B;  3I5F B;  1JWD A;  1QV1 A;  3OHM B;  2WC6 A;  1W9Z A;  2CNP A;  3BXK A;  4YGC B;  1XFU O;  3FIA A;  4IL1 A;  4YGE B;  3WXA A;  1TNX A;  1XFY O;  1MWN A;  2F2O A;  2L50 A;  1YX7 A;  2O60 A;  3DVM A;  1A75 A;  1A75 B;  4JWQ A;  1QLK A;  4MEW A;  1YTZ C;  5JJG A;  2F33 A;  2WCJ A;  5IBW A;  5PAL A;  2KAY A;  3CZT X;  3D10 A;  2ZND A;  3UO9 A;  2KI4 B;  1JF2 A;  1E8A A;  1CDN A;  1YUU A;  1N65 A;  1WRK A;  2JZI A;  1TUZ A;  1PVA A;  1XK4 A;  4AQJ A;  3RZS A;  3KEV A;  1PK0 D;  1DGV A;  2MA2 A;  3D0Y B;  4GBA A;  5TNC A;  2CTN A;  3D73 A;  1F4Q A;  1LA3 A;  1YVH A;  1K96 A;  1EJ3 A;  1B9A A;  1UUR A;  1XVJ A;  1ZAC A;  2NZ0 A;  2WCL A;  2JUL A;  1VRK A;  1CFC A;  3NXA A;  1NYA A;  2V53 A;  1GQM A;  3JVT C;  3QME A;  1Y0V H;  5I2O A;  1M63 B;  3LLE A;  1QAS A;  1EXR A;  1OMR A;  5FI2 A;  2ZN9 A;  1Q80 A;  1M46 A;  1OOH A;  2QAC A;  2VRG A;  3WNX B;  1CMG A;  2EHB A;  3NHI A;  2KAV A;  4ORB B;  4PT1 A;  1K8U A;  2GGM A;  5D69 A;  2JWW A;  3S0D A;  4P5O E;  3TDU A;  2WCK A;  2BEC A;  3OX6 A;  3SG7 A;  3CYZ A;  1EH2 A;  4DS7 A;  2M8U A;  1F70 A;  3O2P A;  4JD9 A;  4NDD A;  1DJI A;  1WLM A;  3SIA A;  1UHI A;  4OV2 A;  4UPG A;  1H8B A;  5I2L A;  1J7O A;  1C3Z A;  2KLD A;  1QWV A;  1S5G Y;  5I8N A;  4DIR A;  1NX3 A;  2JQ6 A;  2ZRS A;  2M9G A;  4A4B A;  2NCO A;  2Y1N A;  2K61 A;  3I5F C;  2KYC A;  1TCF A;  2OTG C;  1S5G Z;  4I5L B;  2MHH A;  2SCP A;  2LV7 A;  2P71 A;  2KSP A;  3GK1 A;  5AER A;  4YGB B;  2P70 A;  4AOM A;  1XYD A;  1Y1A A;  1TWO A;  5FI6 A;  2G9B A;  4YGD B;  2JT8 A;  1DC1 A;  1SCV A;  3ICB A;  4YI8 A;  2G2B A;  3EK8 A;  1DF0 A;  3V2L A;  2KI4 C;  1YUT A;  4MN0 A;  3KPX A;  5ER5 A;  1B4C A;  1OOI X;  2Y1M A;  2LAN A;  3VRN A;  4HRG A;  3KHE A;  1B8L A;  1DEK A;  2SAS A;  1WDC B;  3O4X A;  1C07 A;  4WRI A;  2JOJ A;  1PSR A;  1NPQ A;  3BYA A;  1UHH A;  3ZWH A;  2L4I A;  3LL8 B;  1GGZ A;  1S6C A;  4CPV A;  2M1U A;  1B7T Y;  2I94 A;  3BJH A;  1JFK A;  4D1E A;  5HKW A;  3CZ0 A;  2KGB C;  5F6T A;  1Y1U A;  5DKR A;  2PMY A;  4PAL A;  1YRU B;  1F55 A;  1B7T Z;  1NX1 A;  1CM4 A;  1EG3 A;  2KHN A;  1Y1X A;  3TDI A;  4A4C A;  1SSE B;  3CAB A;  1MHO A;  2I2R E;  1OMV A;  2BNX A;  2KGR A;  1OOF A;  1XFV O;  2BE6 A;  3NSO A;  3VRP A;  5DIC A;  1XA5 A;  1KFX S;  3HX4 A;  3VB1 A;  1B47 A;  4AQI A;  2KPH A;  3DVE A;  2H8V A;  4MZK A;  3CTN A;  4WQ2 A;  2HQ8 A;  3CZ1 A;  2M0R A;  1NX0 A;  4CFR A;  1SCM B;  3R1P A;  4CID A;  2LCP A;  2LVJ A;  2F3Y A;  1YRT B;  4OVN F;  2GTE A;  2Q4U A;  4N1F A;  4C0L A;  2JNX A;  1YX8 A;  2PAS A;  1MUX A;  1N0Y A;  3CR5 X;  2M1K B;  2BKH B;  2Q91 A;  1DJW A;  1IQ3 A;  4ICB A;  4WQ3 A;  3TS5 B;  1XFW O;  3I5I B;  3FE6 A;  3OP0 A;  3IQQ A;  1SPY A;  2JPO A;  3IVT A;  2CBL A;  2P6B B;  1QS7 A;  2K7B A;  3BOW A;  3EVU A;  1CKK A;  2KFH A;  2IS9 A;  1DTL A;  3TUY B;  1GM0 A;  5HKZ A;  4DUQ A;  3S0G A;  4INX A;  5G08 A;  1UUS A;  1LVC D;  1TCO B;  3PAL A;  2LP2 A;  1NIW A;  2PRU A;  5BPJ A;  2O5G A;  3O6B A;  1C7V A;  4I5K A;  1W7I B;  3I5G C;  2LC5 A;  2WOR A;  1WDC C;  4JPZ B;  1NWD A;  1KFU S;  1AVS A;  2H61 A;  2KDH A;  2WND A;  1GJY A;  1MXL C;  4XJK B;  1UHK A;  4XJK A;  5DKQ A;  3BUW B;  5FYX A;  1IH0 A;  2JC2 A;  2CT9 A;  1QX2 A;  2DOQ A;  2E30 A;  3PM8 A;  1FBV A;  5JOL A;  1CTR A;  3H4S E;  2CCM A;  3EKJ A;  4E68 A;  2KBI A;  5KSZ A;  4FQT A;  4CFQ A;  3SS4 A;  2FCE A;  1QX5 B;  4MBE A;  1WLZ A;  4PHK A;  3TZ1 A;  1M31 A;  1BR1 B;  2MJW B;  1TRF A;  1S6I A;  1S3P A;  2KFF A;  2L4H A;  2LVK A;  1IJ5 A;  3WHU B;  2QPT A;  4ZCU A;  1KSM A;  2AMI A;  1BOD A;  2K2A A;  2ZFD A;  1SCM C;  5AAN A;  2HPS A;  1K94 A;  2AAO A;  4MVF A;  2BL0 C;  3D77 A;  1BT6 A;  2FJU B;  2KOT A;  5HL1 A;  1B1G A;  1TOP A;  2JU0 A;  1YR5 A;  2JPT A;  2M29 A;  2LMT A;  1LIN A;  1R2U A;  2ISD A;  1S36 A;  2L5Y A;  1L2O B;  4GUK A;  1SL7 A;  1C7W A;  1KFX L;  2HF5 A;  4NQG A;  4QJ5 B;  1KQV A;  1BOC A;  2MLF C;  2K7O A;  1SK6 D;  2EC6 B;  4USL A;  1BR4 B;  2K0J A;  5D7F A;  4OZD A;  4F7F A;  1BF5 A;  3LK0 A;  1C3Y A;  3VRQ A;  4C0K A;  1BMO A;  3D78 A;  5AFP A;  1AJ4 A;  5J3X A;  1TNQ A;  3SS5 A;  4GPL B;  1MQ1 A;  2M49 B;  3MSE B;  1G8I A;  3DVJ A;  4OKH A;  1QIW A;  4ETO A;  1BU3 A;  4JQ0 D;  2K8M B;  4N1G A;  1F8H A;  3D74 A;  3B86 A;  1SW8 A;  1J7R A;  2Y4Q A;  5KU1 A;  4DCK A;  1PRW A;  1LKJ A;  5AXI A;  2KNE A;  3L4L A;  1DF0 B;  3E3R A;  1R6P A;  2KFG A;  5CSF A;  1QIV A;  1DJH A;  1PAL A;  3NSK A;  4PE1 A;  1XK4 C;  1REC A;  1DMO A;  4P2Y B;  3SJS A;  1SL9 A;  4OR9 B;  1BJF A;  4HRE E;  3VRR A;  1EG4 A;  1ALW A;  2NLN A;  3FWB A;  4YBH B;  5ER4 X;  2LP3 A;  2I18 A;  2L5X B;  1RRO A;  2LHI A;  4GNK B;  4IJ7 A;  3SIB A;  1NUB A;  1ZMZ A;  2BBN A;  3FWC A;  1FI5 A;  2BAP A;  2HQW A;  1Y6W A;  1KFU L;  1JC2 A;  4PCW A;  1S1E A;  1YUR A;  2KBM A;  3VGO A;  1OOG A;  1A2X A;  1IWQ A;  3OX5 A;  1SNL A;  3SG3 A;  2BE4 A;  5GQQ C;  1HQV A;  1DEL A;  1SY9 A;  3PLF B;  2M3W A;  1IRJ A;  3PSR A;  2LAP A;  3SG6 A;  2JNF A;  3B88 A;  1UHN A;  2MRD A;  3FS7 A;  3R72 A;  5CSN A;  1CLL A;  1UWO A;  2KI6 D;  1B8R A;  3CS1 A;  3DD4 A;  3DY9 A;  1RK9 A;  3I5H B;  2QEO A;  3ZNI A;  4JKT A;  1W7J B;  1QVI Y;  1AUI B;  1OZO A;  2LUC A;  4HRH A;  1M45 A;  1DJG A;  4ZCV A;  1J7P A;  1DJY A;  3O78 A;  2CXJ A;  3SG5 A;  1U5I A;  1U5I B;  1JUO A;  1A03 A;  3R1O A;  1KK7 Y;  2LLS A;  3KF9 A;  1QVI Z;  2I7A A;  1L2O C;  2K7C A;  2QEH A;  4PHJ A;  3OB1 B;  1QLS A;  2K7D A;  4GAO A;  1G33 A;  2EC6 C;  2LUX A;  3GK4 X;  1K9K A;  3PM2 A;  1AHR A;  1KSO A;  4OCI A;  1CM1 A;  1KK7 Z;  1X02 A;  2LVI A;  3C1V A;  1OE9 B;  1Z4H A;  4PDZ A;  1SBJ A;  4YGA A;  1JBA A;  1HT9 A;  1DVI A;  2K60 A;  2WCB A;  4INW A;  2BCA A;  2B1U A;  1JFJ A;  1CLM A;  1MXE A;  1K9P A;  3FE8 A;  1AP4 A;  1OQP A;  5B8I B;  3AKA A;  1ALV A;  3QRX A;  4MZJ A;  3IQO A;  1CFF A;  3BFA A;  4QJ4 B;  3A8R A;  2H2K A;  1JSA A;  3BOW B;  1OW4 A;  3D75 A;  4PHM A;  3F45 A;  5EL2 A;  3S0A A;  4N5X A;  3D76 A;  1DGU A;  1JF0 A;  3EK7 A;  1RFJ A;  4M2O A;  3SS3 A;  1IIO A;  1DJZ A;  1CDM A;  3BUX B;  3Q8I A;  3CZ2 A;  1NSH A;  1K9U A;  3OGN A;  2LM5 A;  1KK8 B;  1V1G A;  1YUS A;  2L2E A;  3BQ3 A;  2WCM A;  3BUO B;  1FI6 A;  2NCP A;  1LS8 A;  2L2C A;  2RGI A;  1YVL A;  1CDP A;  2WC5 A;  4GGN A;  2OTG B;  4YRU A;  3CLN A;  2KLE A;  4GGF C;  4KYN A; 
#chains in the Genus database with same CATH homology
 1UP5 A;  1BG1 A;  1M39 A;  1TN4 A;  1IQ5 A;  1NCZ A;  1UHJ A;  1PUL A;  4PHN A;  4Q04 A;  4HSZ A;  1K90 D;  2M97 A;  1QX7 A;  2D8N A;  2MLE C;  3GK2 A;  3I5H C;  1J55 A;  3LK1 A;  5I2Q A;  2KAX A;  2BCX A;  1PVB A;  1SR6 B;  4ORA B;  5AEQ A;  2BBM A;  2TN4 A;  2L51 A;  3WHT B;  4U8D A;  2K2F A;  3GOF A;  1NCX A;  2LNK A;  4XYN A;  3JTD B;  5KTY A;  3D0Y A;  5HKY A;  1XFX O;  2L0P A;  1TNP A;  4TNC A;  1K95 A;  3EVV A;  1MF8 B;  4R1E A;  3RM1 A;  1G4Y R;  3CR2 A;  1GGW A;  5CSI A;  2WCE A;  3HCM A;  1OZS A;  1OMD A;  3OB2 B;  4GFT A;  1TTX A;  3LCP C;  4I5J A;  1V1F A;  3TS5 C;  1XO5 A;  5K89 A;  3AAJ A;  2PSR A;  1KQM B;  3I5I C;  2WCF A;  4MZL A;  3CR4 X;  5DKN A;  3DF0 A;  3DF0 B;  1H4B A;  2FOT A;  3A4U B;  1SKT A;  2F2P A;  2M7N A;  1KWO B;  2ZN8 A;  4M2Q A;  3TUY C;  2A4J A;  2KI6 C;  1RJV A;  2LHL A;  3AAK A;  1DT7 B;  2KYF A;  2M7L A;  1PSB A;  4PE7 A;  2PVB A;  3CWG A;  2PAL A;  3KO0 A;  1KK8 C;  3CGA A;  2OS8 B;  4MRY A;  1L7Z A;  1SYM A;  3EKH A;  3PAT A;  1IJ6 A;  3PN7 B;  1CFD A;  4MLW A;  2H61 C;  3EK4 A;  1DJX A;  1QJT A;  4C0J A;  1S6J A;  3DVK A;  1J7Q A;  2NXQ A;  4M2P A;  2WC8 A;  4FQO A;  1FF1 A;  2JXC A;  2BKI B;  2LLT A;  1J1E A;  5HLO A;  3PFV A;  2EGD A;  2JT3 A;  3M0W A;  2FCD A;  1D1O A;  1TIZ A;  2LMU A;  2ZKM X;  5CSJ A;  1ZFS A;  1WRL A;  2E6W A;  1F54 A;  2AUC A;  3SG4 A;  1TNW A;  1AJ5 A;  3K21 A;  2OPO A;  2Y5I A;  4DRW A;  5HYD A;  2LE9 B;  3VRO A;  1SR6 C;  5HLV A;  4FTG A;  4NDB A;  3O4Y A;  4CLN A;  4PE0 A;  2KQY A;  1NX2 A;  4MRX A;  2F8P A;  3I5G B;  1A4P A;  2KQ6 A;  3JTD C;  4ORC B;  1ZUZ A;  4I5N B;  1IKU A;  1IGV A;  2MBX A;  1J1D A;  1BLQ A;  1IG5 A;  1S26 D;  4L9M A;  1NP8 A;  1QV0 A;  1LA0 A;  5CPV A;  1QTX A;  1CNP A;  1FW4 A;  1ODB A;  2ZNE A;  1QXP A;  4GGF A;  1F71 A;  3BUN B;  2JRF A;  1CB1 A;  2JTT A;  3EVR A;  1OOJ A;  2F3Z A;  2JXL A;  1ZOT B;  2LLU A;  3JVT B;  1SL8 A;  4MSP A;  1CDL A;  1KQM C;  3SG2 A;  2HET A;  1LXF C;  4PE4 A;  1CMF A;  1WRZ A;  2BCB A;  1A29 A;  4BY5 A;  3AKB A;  1SRA A;  3NSL A;  1KWO C;  1K93 D;  1NCY A;  3NSI A;  1EL4 A;  2GGZ A;  1B8C A;  3IF7 A;  4QJ3 B;  2GV5 A;  1AK8 A;  1OSA A;  2JT0 A;  1RTP 1;  4NDC A;  1FPW A;  1MR8 A;  4YI9 A;  1F4O A;  1QAT A;  2ZRT A;  2BL0 B;  2OS8 C;  1K2H A;  2MAZ A;  2L98 A;  3TDZ A;  2COL B;  1N2D A;  4BY4 A;  2LMV A;  3PN7 C;  1RWY A;  2WOS A;  2R2I A;  1CFP A;  1CLB A;  1SMG A;  1WY9 A;  2JTZ A;  1XFZ O;  1KCY A;  3BUM B;  2LVV A;  3RLZ A;  4F0Z B;  3I5F B;  1JWD A;  1QV1 A;  3OHM B;  2CNP A;  4YGC B;  3BXK A;  1XFU O;  3FIA A;  4IL1 A;  4YGE B;  3WXA A;  1TNX A;  1XFY O;  1MWN A;  2F2O A;  2L50 A;  1YX7 A;  2O60 A;  3DVM A;  1A75 A;  1A75 B;  4JWQ A;  1QLK A;  4MEW A;  1YTZ C;  5JJG A;  2F33 A;  5IBW A;  5PAL A;  2KAY A;  3CZT X;  3D10 A;  2ZND A;  2KI4 B;  1JF2 A;  1E8A A;  1CDN A;  1YUU A;  1N65 A;  1WRK A;  2JZI A;  1PVA A;  1XK4 A;  4AQJ A;  3KEV A;  1PK0 D;  1DGV A;  2MA2 A;  3D0Y B;  4GBA A;  5TNC A;  2CTN A;  1F4Q A;  1LA3 A;  1YVH A;  1K96 A;  1EJ3 A;  1B9A A;  1UUR A;  1XVJ A;  1ZAC A;  2NZ0 A;  2JUL A;  1VRK A;  1CFC A;  3NXA A;  1NYA A;  2V53 A;  1GQM A;  3JVT C;  5I2O A;  1Y0V H;  1M63 B;  3LLE A;  1QAS A;  1EXR A;  1OMR A;  2ZN9 A;  1Q80 A;  1M46 A;  2VRG A;  2QAC A;  3WNX B;  1CMG A;  2EHB A;  2KAV A;  4ORB B;  1K8U A;  2GGM A;  5D69 A;  2JWW A;  4P5O E;  3TDU A;  2BEC A;  3OX6 A;  3SG7 A;  1EH2 A;  4DS7 A;  2M8U A;  1F70 A;  3O2P A;  4NDD A;  1DJI A;  1WLM A;  3SIA A;  1UHI A;  4OV2 A;  4UPG A;  1H8B A;  5I2L A;  1J7O A;  5I8N A;  1S5G Y;  4DIR A;  1NX3 A;  2JQ6 A;  2ZRS A;  2M9G A;  4A4B A;  2NCO A;  2Y1N A;  2K61 A;  3I5F C;  2KYC A;  1TCF A;  2OTG C;  1S5G Z;  4I5L B;  2MHH A;  2SCP A;  2LV7 A;  2KSP A;  3GK1 A;  5AER A;  4YGB B;  4AOM A;  1XYD A;  1Y1A A;  2G9B A;  4YGD B;  2JT8 A;  1SCV A;  3ICB A;  4YI8 A;  2G2B A;  3EK8 A;  1DF0 A;  2KI4 C;  1YUT A;  4MN0 A;  3KPX A;  5ER5 A;  1B4C A;  2Y1M A;  2LAN A;  3VRN A;  4HRG A;  3KHE A;  1B8L A;  2SAS A;  1WDC B;  1C07 A;  4WRI A;  2JOJ A;  1PSR A;  1NPQ A;  3BYA A;  1UHH A;  3ZWH A;  2L4I A;  3LL8 B;  1GGZ A;  1S6C A;  4CPV A;  2M1U A;  1B7T Y;  2I94 A;  1JFK A;  4D1E A;  5HKW A;  2KGB C;  5F6T A;  1Y1U A;  5DKR A;  2PMY A;  4PAL A;  1YRU B;  1F55 A;  1B7T Z;  1NX1 A;  1CM4 A;  1EG3 A;  2KHN A;  1Y1X A;  3TDI A;  4A4C A;  1MHO A;  2I2R E;  1OMV A;  2KGR A;  2BE6 A;  1XFV O;  3NSO A;  3VRP A;  1XA5 A;  1KFX S;  3HX4 A;  1B47 A;  4AQI A;  3DVE A;  4MZK A;  3CTN A;  4WQ2 A;  2HQ8 A;  2M0R A;  1NX0 A;  4CFR A;  1SCM B;  4CID A;  2LCP A;  2LVJ A;  2F3Y A;  1YRT B;  4OVN F;  4N1F A;  2Q4U A;  4C0L A;  2JNX A;  1YX8 A;  2PAS A;  1MUX A;  1N0Y A;  3CR5 X;  2M1K B;  2BKH B;  2Q91 A;  1DJW A;  1IQ3 A;  4ICB A;  4WQ3 A;  3TS5 B;  1XFW O;  3I5I B;  3OP0 A;  3IQQ A;  1SPY A;  2CBL A;  2P6B B;  1QS7 A;  2K7B A;  3BOW A;  3EVU A;  1CKK A;  2KFH A;  2IS9 A;  1DTL A;  3TUY B;  5HKZ A;  4DUQ A;  5G08 A;  1UUS A;  1LVC D;  1TCO B;  3PAL A;  2LP2 A;  1NIW A;  2PRU A;  5BPJ A;  2O5G A;  3O6B A;  1C7V A;  4I5K A;  1W7I B;  3I5G C;  2LC5 A;  2WOR A;  1WDC C;  4JPZ B;  1NWD A;  1KFU S;  1AVS A;  2H61 A;  2KDH A;  2WND A;  1GJY A;  1MXL C;  4XJK B;  1UHK A;  4XJK A;  5DKQ A;  3BUW B;  5FYX A;  1IH0 A;  2JC2 A;  2CT9 A;  1QX2 A;  2DOQ A;  2E30 A;  3PM8 A;  1FBV A;  5JOL A;  1CTR A;  3H4S E;  2CCM A;  3EKJ A;  4E68 A;  2KBI A;  5KSZ A;  4CFQ A;  2FCE A;  1QX5 B;  4MBE A;  1WLZ A;  4PHK A;  3TZ1 A;  1M31 A;  1BR1 B;  2MJW B;  1TRF A;  1S6I A;  1S3P A;  2KFF A;  2L4H A;  2LVK A;  1IJ5 A;  3WHU B;  2QPT A;  4ZCU A;  1KSM A;  2AMI A;  1BOD A;  2K2A A;  2ZFD A;  1SCM C;  5AAN A;  2HPS A;  1K94 A;  2AAO A;  4MVF A;  2BL0 C;  1BT6 A;  2FJU B;  2KOT A;  1B1G A;  1TOP A;  2JU0 A;  1YR5 A;  2JPT A;  2M29 A;  2LMT A;  1LIN A;  1R2U A;  2ISD A;  1S36 A;  1L2O B;  4GUK A;  1SL7 A;  1C7W A;  1KFX L;  2HF5 A;  4NQG A;  4QJ5 B;  1KQV A;  1BOC A;  2MLF C;  2K7O A;  1SK6 D;  2EC6 B;  4USL A;  1BR4 B;  2K0J A;  5D7F A;  1BF5 A;  3LK0 A;  3VRQ A;  4C0K A;  1BMO A;  5AFP A;  1AJ4 A;  5J3X A;  1TNQ A;  4GPL B;  1MQ1 A;  2M49 B;  3MSE B;  1G8I A;  3DVJ A;  4OKH A;  1QIW A;  4ETO A;  1BU3 A;  4JQ0 D;  2K8M B;  4N1G A;  1F8H A;  1SW8 A;  1J7R A;  2Y4Q A;  5KU1 A;  4DCK A;  1PRW A;  1LKJ A;  5AXI A;  2KNE A;  1DF0 B;  3E3R A;  1R6P A;  2KFG A;  5CSF A;  1QIV A;  1DJH A;  1PAL A;  3NSK A;  4PE1 A;  1XK4 C;  1REC A;  1DMO A;  4P2Y B;  3SJS A;  1SL9 A;  4OR9 B;  1BJF A;  4HRE E;  3VRR A;  1EG4 A;  1ALW A;  2NLN A;  3FWB A;  4YBH B;  5ER4 X;  2LP3 A;  2I18 A;  2L5X B;  1RRO A;  2LHI A;  4GNK B;  3SIB A;  1FI5 A;  1NUB A;  1ZMZ A;  2BBN A;  3FWC A;  2HQW A;  1Y6W A;  1KFU L;  1JC2 A;  4PCW A;  1S1E A;  1YUR A;  2KBM A;  3VGO A;  1A2X A;  1IWQ A;  3OX5 A;  1SNL A;  3SG3 A;  2BE4 A;  5GQQ C;  1HQV A;  1SY9 A;  3PLF B;  2M3W A;  1IRJ A;  3PSR A;  2LAP A;  3SG6 A;  2JNF A;  1UHN A;  2MRD A;  3FS7 A;  5CSN A;  1CLL A;  1UWO A;  2KI6 D;  1B8R A;  3CS1 A;  3DD4 A;  3I5H B;  1RK9 A;  3ZNI A;  1W7J B;  1QVI Y;  1AUI B;  1OZO A;  2LUC A;  4HRH A;  1M45 A;  1DJG A;  4ZCV A;  1J7P A;  1DJY A;  3O78 A;  2CXJ A;  3SG5 A;  1U5I A;  1U5I B;  1JUO A;  1A03 A;  1KK7 Y;  2LLS A;  3KF9 A;  1QVI Z;  2I7A A;  1L2O C;  2K7C A;  4PHJ A;  3OB1 B;  1QLS A;  2K7D A;  4GAO A;  1G33 A;  2EC6 C;  2LUX A;  3GK4 X;  1K9K A;  1AHR A;  1KSO A;  4OCI A;  1CM1 A;  1KK7 Z;  1X02 A;  2LVI A;  3C1V A;  1OE9 B;  4PDZ A;  1JBA A;  1SBJ A;  4YGA A;  1HT9 A;  1DVI A;  2WCB A;  2BCA A;  2B1U A;  1JFJ A;  1CLM A;  1MXE A;  1K9P A;  1AP4 A;  1OQP A;  5B8I B;  3AKA A;  1ALV A;  3QRX A;  4MZJ A;  3IQO A;  1CFF A;  4QJ4 B;  3A8R A;  2H2K A;  1JSA A;  3BOW B;  4PHM A;  3F45 A;  4N5X A;  1DGU A;  1JF0 A;  3EK7 A;  1RFJ A;  4M2O A;  1DJZ A;  1CDM A;  3BUX B;  1NSH A;  1K9U A;  2LM5 A;  1KK8 B;  1V1G A;  1YUS A;  2L2E A;  3BQ3 A;  1FI6 A;  3BUO B;  2NCP A;  2RGI A;  1YVL A;  1CDP A;  4GGN A;  2OTG B;  4YRU A;  3CLN A;  4GGF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...