3S0EA

Apis mellifera obp14 in complex with the odorant eugenol (2-methoxy-4(2-propenyl)-phenol)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
total genus 48
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0eA00
2P71A 3S0AA 3QMEA 2WCMA 3D77A 1OW4A 3DXLA 3D75A 1XFRA 3CZ2A 1OOFA 3L4LA 3NHIA 1OOIX 3S0BA 2QEHA 4FQTA 4INWA 3D74A 2JPOA 2PQLA 3K1EA 3L4AA 2QEOA 3B88A 3VB1A 1T14A 3FE9A 1ORGA 3CZ1A 3Q8IA 1TUJA 3CABA 3V2LA 2KPHA 3S0EA 2QEBA 4OZDA 3NHTA 1TWOA 2WC5A 3L47A 3B86A 4PT1A 1DQEA 3S0FA 3RZSA 3B7AA 1QWVA 1P28A 3CYZA 2QDIA 2WCJA 3PJIA 3BFAA 3R1VA 2L2CA 1C3YA 2WC6A 3BFHA 5EL2A 3D73A 1OOGA 3S0DA 2QEVA 4JD9A 1C3ZA 2WCLA 3R1PA 2FJYA 3D76A 3D78A 1LS8A 3CZ0A 3CDNA 3FE8A 3BFBA 2P70A 3DY9A 5DICA 3BJHA 3S0GA 3N7HA 4INXA 3FE6A 2H8VA 3DZTA 1OOHA 2WCHA 3B6XA 1GM0A 3DYEA 3R72A 3B87A 2WCKA 2ERBA 4F7FA 2GTEA 3OGNA 3NGVA 3R1OA
chains in the Genus database with same CATH superfamily
1CMFA 1OZOA 2F3YA 3BUWB 3FIAA 4PHMA 4N1GA 2WNDA 1OE9B 3JTDB 1K95A 2MAZA 2LE9B 3I5FC 4ZCUA 3DVJA 2ZN9A 1YUSA 3BYAA 2K7BA 1DF0B 1OMRA 4TNCA 3CZ2A 5HKWA 1OOFA 5J3XA 1WRZA 2MRDA 2F33A 1QJTA 2ZNEA 2LLUA 3NHIA 2QEHA 4FQTA 1DJIA 5CSJA 4DUQA 1CB1A 2JQ6A 3CTNA 2OTGC 4PE7A 2KHNA 4YI9A 1NP8A 1NX1A 1YUTA 1SCMB 3UNWA 3AAJA 4U8DA 1AP4A 3KHEA 5F6TA 1SRAA 1OQPA 3L4AA 2QEOA 5HLOA 1JSAA 3KEVA 1K9KA 4ETOA 1KSMA 1QTXA 1OSAA 3SG5A 1XYDA 2OS8C 2BCXA 3HX4A 1XFYO 2ZN8A 3LCPC 1SL7A 3TDIA 3NSKA 2MHHA 4E68A 4MZLA 1JF0A 2QPTA 1QXPA 1NCXA 3CZ1A 2L2EA 4D1EA 1PULA 2O5GA 2AUCA 3CWGA 2LLTA 2WC8A 3BUOB 3O4XA 1TUJA 3V2LA 2KPHA 3S0EA 1QVIZ 3BQ3A 3NSOA 4PHJA 1M45A 1TWOA 5G08A 2K7DA 4I5KA 5D7FA 1XFUO 1YVHA 1JFJA 4XJKA 1XFXO 3O6BA 3EVVA 2CT9A 3WHTB 5HL1A 3LK0A 1A4PA 1QX2A 2KAYA 1QWVA 2LP3A 1U5IA 5CSIA 1LXFC 2QDIA 2VRGA 1UWOA 3F45A 2K2FA 5DKQA 1CDLA 5I94A 3BFAA 1YX7A 1JF2A 2L2CA 1VRKA 1NX0A 2L0PA 3OB1B 4BY5A 1ALVA 1FI5A 1MQ1A 1AJ4A 2KFHA 2KI6D 3S0DA 5GQQC 1M31A 1QV1A 2K60A 1SYMA 1F8HA 2LVIA 1XO5A 2L50A 1RWYA 2LM5A 2QEVA 3BOWA 3FWBA 2WCLA 4ORAB 4AQJA 1KFUS 1D1OA 1AJ5A 1KK7Z 3D78A 2OPOA 4YRUA 1YX8A 1SMGA 1BOCA 3VRRA 3WHUB 1YTZC 1KQMB 1AHRA 4YI8A 2Y1MA 3CZ0A 2SCPA 3I5FB 3OB2B 4OCIA 2K0JA 1CDMA 3SG7A 3WNXB 3CDNA 1Q80A 4F0ZB 2KAVA 1SPYA 3DVMA 1B7TZ 1XA5A 1ZUZA 1K90D 1XFVO 3TUYC 3CR5X 2ZKMX 3A8RA 3BUMB 5DICA 2MA2A 1C7WA 2JU0A 2BCBA 1XFZO 3I5HB 1TRFA 3N7HA 1CDNA 1QX7A 2LHLA 2HQ8A 2FCEA 1QLKA 2CTNA 1TNPA 1EH2A 1F54A 2M1UA 2M7LA 2LVVA 1SL8A 1NUBA 2ISDA 1CLMA 1F4OA 2KSPA 2I94A 2WCKA 3WXAA 2GTEA 2HQWA 2LV7A 3BUNB 3NGVA 3R1OA 3VGOA 5FYXA 1CLBA 3DF0B 2WOSA 1A75B 1KFXS 1S6JA 1CM4A 1WRKA 1Y0VH 1RROA 1J7QA 4ZCVA 2QACA 1JFKA 1SR6C 5BPJA 1IKUA 2ZNDA 2JC2A 2KOTA 3NSLA 1IRJA 1UURA 3LK1A 4GAOA 1DJZA 1UHNA 1OW4A 2V53A 4YGBB 2BCAA 4AOMA 2JT0A 3ZWHA 2O60A 3L4LA 1UHHA 1OOIX 2BKHB 4N1FA 3EK8A 3S0BA 2B1UA 4OV2A 1J7PA 3D74A 2L51A 3O4YA 3UO9A 2M49B 1DGUA 2CNPA 1MUXA 2KI6C 2M8UA 2BE4A 3CZTX 2L5YA 3K1EA 3O78A 2JULA 2K61A 2M1KB 2L98A 2Y4QA 4JKTA 2BNXA 4C0JA 4DCKA 2ZRTA 1UP5A 1W7IB 3VB1A 1SL9A 4L9MA 1R2UA 3EVUA 3GK2A 4IL1A 1FW4A 1DGVA 2EC6B 2FCDA 1EJ3A 1ORGA 1FBVA 1OMDA 3PLFB 1V1FA 1BG1A 3D10A 3Q8IA 4C0KA 3PM2A 1W7JB 1K2HA 1TNQA 5I2LA 1S6CA 4CLNA 3CABA 2JNXA 4QJ3B 5CPVA 3VROA 3EG5B 3SG2A 1L2OB 3TS5C 4PHNA 1MR8A 1QX5B 2LNKA 4NDDA 1EG3A 1OZSA 1PK0D 2JWWA 2KQYA 1N2DA 3B86A 3I5IB 3RZSA 1B4CA 3I5GC 1H8BA 2LCPA 2BKIB 3BXKA 1B8RA 2HF5A 3ICBA 2WCEA 3CYZA 4NDBA 2M3WA 1ZFSA 3CGAA 5I2QA 3HCMA 2DOQA 3AKBA 3FS7A 1GM0A 2LC5A 1WDCC 1NSHA 4WRIA 1DJWA 3BFHA 1S5GZ 4GNKB 1WRLA 3GK4X 2Y1NA 1SY9A 1TCFA 3IQQA 1V1GA 1OOGA 1SK6D 1TN4A 2SASA 4P5OE 1Z4HA 4YGDB 5AXIA 2BE6A 2KNEA 4QJ4B 1SKTA 1IQ5A 4ORCB 2A4JA 1YVLA 1S1EA 4MZJA 3SG4A 5I2OA 1Y1XA 1B8CA 5D3OA 3PN7C 2PALA 4HRGA 2KAXA 1SR6B 2KGRA 5FI6A 1RK9A 2PYQA 1EG4A 1KK8C 3BFBA 3IF7A 2K2AA 4JWQA 1S26D 5CSNA 3LLEA 2L4HA 1PVBA 2CBLA 4DIRA 3CR4X 1KFUL 2MJWB 4USLA 4YBHB 3S0GA 1F55A 2JT8A 4INXA 1FF1A 1K93D 3D0YA 2F8PA 3FE6A 4OKHA 5TNCA 1CMGA 1NX2A 2NCOA 2E30A 1H4BA 1YRUB 1UHJA 4MRYA 2PASA 3RM1A 1A2XA 2JZIA 1BT6A 4MEWA 5FI2A 1J7OA 2KQ6A 1SBJA 3JVTC 2BL0C 2CXJA 2KFGA 2KI4B 4OR9B 2JXLA 2AAOA 1IJ6A 3AKAA 5ER5A 3H4SE 3VRPA 3B87A 1BLQA 1YR5A 3NSIA 2ERBA 4GPLB 2I2RE 4F7FA 1JBAA 4PE1A 1M46A 2NLNA 2LMVA 4IJ7A 3O2PA 5I8NA 2F3ZA 1IJ5A 2LMTA 3S0AA 1XFWO 2KYCA 2WCBA 3QMEA 2TN4A 1CFDA 1QS7A 1ODBA 1DELA 4DS7A 3D77A 1KWOC 1LKJA 1S3PA 2HPSA 1IGVA 2OTGB 3DXLA 1B1GA 3D75A 4N5XA 1XFRA 3PATA 3JTDC 1HQVA 3SG3A 1TOPA 4GGFC 1NYAA 2JPOA 4YGEB 4I5NB 1KFXL 4YGAA 3M0WA 4XJKB 4MN0A 3SG6A 2OS8B 1J1DA 2JPTA 1GGWA 1TUZA 1AK8A 1AUIB 4YGCB 1CFFA 2AMIA 2BECA 1U5IB 4NDCA 1SCMC 1QIVA 2Q91A 3B88A 5KTYA 2PVBA 1DMOA 2PSRA 2LANA 3KO0A 1N65A 1MF8B 1J55A 4PHKA 3EKHA 1IG5A 1GGZA 1B9AA 1J1EA 3PSRA 1N0YA 2G2BA 4GGFA 1BF5A 4WQ2A 2LUXA 5AFPA 1DF0A 1MXEA 3IVTA 3OP0A 4UPGA 3CS1A 4HREE 2QEBA 3NHTA 4P2YB 1RJVA 1IQ3A 1K9UA 3BOWB 5FI7A 2WC5A 4C0LA 2CCMA 1WLZA 1R6PA 5CSFA 1Y6WA 1B47A 4GUKA 4NQGA 1KK7Y 1DQEA 2P6BB 3TDZA 3B7AA 1TTXA 2JT3A 5ER4X 1Y1UA 1P28A 3EVRA 1XVJA 2BAPA 2WORA 5KU1A 4KYNA 3BUXB 3R1VA 1K9PA 1WLMA 4HRHA 2HETA 1B7TY 3IQOA 1NIWA 5EL2A 1ZACA 3OX6A 1WY9A 2BL0B 2FOTA 1NX3A 3SS5A 3EK7A 2Y5IA 2JRFA 1W9ZA 2RGIA 4JD9A 3SS3A 1B8LA 1DJGA 4OVNF 3R1PA 1RTP1 2F2PA 2L4IA 2LHIA 1DEKA 4I5JA 2LLSA 4JQ0D 5KSZA 1IWQA 5IBWA 2WCFA 3TUYB 1PALA 5HKZA 1S6IA 2K8MB 1OMVA 1A03A 3GK1A 4A4CA 1BODA 1DC1A 3PFVA 1KQMC 1UUSA 3E3RA 4WQ3A 3BJHA 1YURA 1TNWA 1S36A 2JTZA 1ALWA 4GBAA 2M7NA 2H8VA 3DZTA 1GJYA 4FQOA 1RFJA 2K7CA 2JTTA 5HLVA 1HT9A 1QLSA 2D8NA 2LVJA 3I5HC 3CLNA 4JPZB 1NPQA 1RECA 3B6XA 1A29A 1G4YR 1PSBA 1TNXA 4MSPA 3SJSA 1DTLA 1E8AA 4BY4A 1F70A 1EL4A 2E6WA 1XK4C 2PMYA 1BR1B 1PRWA 4GGNA 3KF9A 1J7RA 1DT7B 4MRXA 4M2PA 2P71A 1UHIA 2BBMA 4QJ5B 2G9BA 1NCZA 3VRNA 2NXQA 1CM1A 2KLEA 2EGDA 2M0RA 3AAKA 1C07A 2F2OA 2WCMA 2MBXA 1DJYA 1G8IA 2LVKA 1FPWA 1M63B 1NWDA 1SNLA 1G33A 2GV5A 4R1EA 3TZ1A 2NCPA 4A4BA 4M2OA 1ZOTB 4INWA 4MLWA 4AQIA 3ZNIA 1XK4A 1CDPA 1SW8A 1YUUA 1K94A 4I5LB 1IH0A 2LMUA 1JUOA 5PALA 4MZKA 2KFFA 2M97A 2JOJA 2KBMA 2IS9A 2PQLA 5B8IB 3OBVA 1MHOA 1C7VA 2H2KA 1OOJA 2Q4UA 5AERA 1AVSA 2R2IA 5JOLA 2K7OA 5AEQA 5HYDA 3DF0A 1EXRA 1MWNA 1T14A 1A75A 2KYFA 1F71A 1LA3A 1F4QA 1QATA 5JJGA 2KDHA 3FE9A 3VRQA 2ZFDA 2L5XB 1K8UA 1S5GY 1JC2A 5DKNA 1CTRA 3SS4A 3TS5B 3LL8B 1KSOA 2BBNA 3QRXA 2ZRSA 4ICBA 4MVFA 1NCYA 4HSZA 2I18A 2EC6C 3FWCA 4OZDA 2LAPA 3I5GB 3DVKA 3OHMB 1QVIY 3L47A 3PM8A 2FJUB 1LVCD 2MLEC 3K21A 1Z2CB 2H61C 1L2OC 2LP2A 4PT1A 1BR4B 3S0FA 1WDCB 3DVEA 4CFRA 2JNFA 3GOFA 2KGBC 1LINA 4PDZA 4Q04A 2WCJA 2JXCA 3PJIA 3I5IC 1IIOA 1JWDA 3C1VA 2LUCA 1CLLA 1K96A 2KBIA 4MBEA 4DRWA 2WC6A 1SCVA 1C3YA 4XYNA 5DKRA 2EHBA 5D69A 2MLFC 3D0YB 3D73A 1TCOB 1QASA 4PCWA 4PE4A 5HKYA 1UHKA 3PN7B 3MSEB 2NZ0A 2PRUA 1QIWA 2H61A 1M39A 2KLDA 1C3ZA 5AANA 5K89A 1DVIA 2FJYA 3D76A 4GFTA 1CFPA 1DJXA 1KK8B 4FTGA 3SIAA 1FI6A 1BMOA 1PSRA 1LS8A 1L7ZA 2COLB 4PALA 1BJFA 3EKJA 1X02A 3FE8A 2I7AA 4CFQA 1KCYA 3TDUA 1Y1AA 2P70A 2GGZA 3DY9A 3RLZA 3CR2A 4PE0A 1CNPA 3OX5A 2GGMA 1QV0A 3PALA 1CFCA 3JVTB 4CIDA 1DJHA 1TIZA 1OOHA 1CKKA 1ZMZA 2WCHA 4M2QA 2M9GA 1BU3A 3DD4A 3EK4A 1MXLC 3NXAA 3KPXA 1GQMA 1LA0A 3SIBA 3DYEA 2YGUA 4CPVA 3R72A 4ORBB 1KQVA 3OGNA 1YRTB 3A4UB 2M29A 1SSEB 2KI4C 1PVAA 1KWOB
chains in the Genus database with same CATH topology
2P71A 3S0AA 3QMEA 2WCMA 3D77A 1OW4A 3DXLA 3D75A 1XFRA 3CZ2A 1OOFA 3L4LA 3NHIA 1OOIX 3S0BA 2QEHA 4FQTA 4INWA 3D74A 2JPOA 2PQLA 3K1EA 3L4AA 2QEOA 3B88A 3VB1A 1T14A 3FE9A 1ORGA 3CZ1A 3Q8IA 1TUJA 3CABA 3V2LA 2KPHA 3S0EA 2QEBA 4OZDA 3NHTA 1TWOA 2WC5A 3L47A 3B86A 4PT1A 1DQEA 3S0FA 3RZSA 3B7AA 1QWVA 1P28A 3CYZA 2QDIA 2WCJA 3PJIA 3BFAA 3R1VA 2L2CA 1C3YA 2WC6A 3BFHA 5EL2A 3D73A 1OOGA 3S0DA 2QEVA 4JD9A 1C3ZA 2WCLA 3R1PA 2FJYA 3D76A 3D78A 1LS8A 3CZ0A 3CDNA 3FE8A 3BFBA 2P70A 3DY9A 5DICA 3BJHA 3S0GA 3N7HA 4INXA 3FE6A 2H8VA 3DZTA 1OOHA 2WCHA 3B6XA 1GM0A 3DYEA 3R72A 3B87A 2WCKA 2ERBA 4F7FA 2GTEA 3OGNA 3NGVA 3R1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P71 A;  3S0A A;  3QME A;  2WCM A;  3D77 A;  1OW4 A;  3DXL A;  3D75 A;  1XFR A;  3CZ2 A;  1OOF A;  3L4L A;  3NHI A;  1OOI X;  3S0B A;  2QEH A;  4FQT A;  4INW A;  3D74 A;  2JPO A;  2PQL A;  3K1E A;  3L4A A;  2QEO A;  3B88 A;  3VB1 A;  1T14 A;  3FE9 A;  1ORG A;  3CZ1 A;  3Q8I A;  1TUJ A;  3CAB A;  3V2L A;  2KPH A;  3S0E A;  2QEB A;  4OZD A;  3NHT A;  1TWO A;  2WC5 A;  3L47 A;  3B86 A;  4PT1 A;  1DQE A;  3S0F A;  3RZS A;  3B7A A;  1QWV A;  1P28 A;  3CYZ A;  2QDI A;  2WCJ A;  3PJI A;  3BFA A;  3R1V A;  2L2C A;  1C3Y A;  2WC6 A;  3BFH A;  5EL2 A;  3D73 A;  1OOG A;  3S0D A;  2QEV A;  4JD9 A;  1C3Z A;  2WCL A;  3R1P A;  2FJY A;  3D76 A;  3D78 A;  1LS8 A;  3CZ0 A;  3CDN A;  3FE8 A;  3BFB A;  2P70 A;  3DY9 A;  5DIC A;  3BJH A;  3S0G A;  3N7H A;  4INX A;  3FE6 A;  2H8V A;  3DZT A;  1OOH A;  2WCH A;  3B6X A;  1GM0 A;  3DYE A;  3R72 A;  3B87 A;  2WCK A;  2ERB A;  4F7F A;  2GTE A;  3OGN A;  3NGV A;  3R1O A; 
#chains in the Genus database with same CATH topology
 1CMF A;  1OZO A;  2F3Y A;  3BUW B;  3FIA A;  4PHM A;  4N1G A;  2WND A;  1OE9 B;  3JTD B;  1K95 A;  2MAZ A;  2LE9 B;  3I5F C;  4ZCU A;  3DVJ A;  2ZN9 A;  1YUS A;  3BYA A;  2K7B A;  1DF0 B;  1OMR A;  4TNC A;  3CZ2 A;  5HKW A;  1OOF A;  5J3X A;  1WRZ A;  2MRD A;  2F33 A;  1QJT A;  2ZNE A;  2LLU A;  3NHI A;  2QEH A;  4FQT A;  1DJI A;  5CSJ A;  4DUQ A;  1CB1 A;  2JQ6 A;  3CTN A;  2OTG C;  4PE7 A;  2KHN A;  4YI9 A;  1NP8 A;  1NX1 A;  1YUT A;  1SCM B;  3UNW A;  3AAJ A;  4U8D A;  1AP4 A;  3KHE A;  5F6T A;  1SRA A;  1OQP A;  3L4A A;  2QEO A;  5HLO A;  1JSA A;  3KEV A;  1K9K A;  4ETO A;  1KSM A;  1QTX A;  1OSA A;  3SG5 A;  1XYD A;  2OS8 C;  2BCX A;  3HX4 A;  1XFY O;  2ZN8 A;  3LCP C;  1SL7 A;  3TDI A;  3NSK A;  2MHH A;  4E68 A;  4MZL A;  1JF0 A;  2QPT A;  1QXP A;  1NCX A;  3CZ1 A;  2L2E A;  4D1E A;  1PUL A;  2O5G A;  2AUC A;  3CWG A;  2LLT A;  2WC8 A;  3BUO B;  3O4X A;  1TUJ A;  3V2L A;  2KPH A;  3S0E A;  1QVI Z;  3BQ3 A;  3NSO A;  4PHJ A;  1M45 A;  1TWO A;  5G08 A;  2K7D A;  4I5K A;  5D7F A;  1XFU O;  1YVH A;  1JFJ A;  4XJK A;  1XFX O;  3O6B A;  3EVV A;  2CT9 A;  3WHT B;  5HL1 A;  3LK0 A;  1A4P A;  1QX2 A;  2KAY A;  1QWV A;  2LP3 A;  1U5I A;  5CSI A;  1LXF C;  2QDI A;  2VRG A;  1UWO A;  3F45 A;  2K2F A;  5DKQ A;  1CDL A;  5I94 A;  3BFA A;  1YX7 A;  1JF2 A;  2L2C A;  1VRK A;  1NX0 A;  2L0P A;  3OB1 B;  4BY5 A;  1ALV A;  1FI5 A;  1MQ1 A;  1AJ4 A;  2KFH A;  2KI6 D;  3S0D A;  5GQQ C;  1M31 A;  1QV1 A;  2K60 A;  1SYM A;  1F8H A;  2LVI A;  1XO5 A;  2L50 A;  1RWY A;  2LM5 A;  2QEV A;  3BOW A;  3FWB A;  2WCL A;  4ORA B;  4AQJ A;  1KFU S;  1D1O A;  1AJ5 A;  1KK7 Z;  3D78 A;  2OPO A;  4YRU A;  1YX8 A;  1SMG A;  1BOC A;  3VRR A;  3WHU B;  1YTZ C;  1KQM B;  1AHR A;  4YI8 A;  2Y1M A;  3CZ0 A;  2SCP A;  3I5F B;  3OB2 B;  4OCI A;  2K0J A;  1CDM A;  3SG7 A;  3WNX B;  3CDN A;  1Q80 A;  4F0Z B;  2KAV A;  1SPY A;  3DVM A;  1B7T Z;  1XA5 A;  1ZUZ A;  1K90 D;  1XFV O;  3TUY C;  3CR5 X;  2ZKM X;  3A8R A;  3BUM B;  5DIC A;  2MA2 A;  1C7W A;  2JU0 A;  2BCB A;  1XFZ O;  3I5H B;  1TRF A;  3N7H A;  1CDN A;  1QX7 A;  2LHL A;  2HQ8 A;  2FCE A;  1QLK A;  2CTN A;  1TNP A;  1EH2 A;  1F54 A;  2M1U A;  2M7L A;  2LVV A;  1SL8 A;  1NUB A;  2ISD A;  1CLM A;  1F4O A;  2KSP A;  2I94 A;  2WCK A;  3WXA A;  2GTE A;  2HQW A;  2LV7 A;  3BUN B;  3NGV A;  3R1O A;  3VGO A;  5FYX A;  1CLB A;  3DF0 B;  2WOS A;  1A75 B;  1KFX S;  1S6J A;  1CM4 A;  1WRK A;  1Y0V H;  1RRO A;  1J7Q A;  4ZCV A;  2QAC A;  1JFK A;  1SR6 C;  5BPJ A;  1IKU A;  2ZND A;  2JC2 A;  2KOT A;  3NSL A;  1IRJ A;  1UUR A;  3LK1 A;  4GAO A;  1DJZ A;  1UHN A;  1OW4 A;  2V53 A;  4YGB B;  2BCA A;  4AOM A;  2JT0 A;  3ZWH A;  2O60 A;  3L4L A;  1UHH A;  1OOI X;  2BKH B;  4N1F A;  3EK8 A;  3S0B A;  2B1U A;  4OV2 A;  1J7P A;  3D74 A;  2L51 A;  3O4Y A;  3UO9 A;  2M49 B;  1DGU A;  2CNP A;  1MUX A;  2KI6 C;  2M8U A;  2BE4 A;  3CZT X;  2L5Y A;  3K1E A;  3O78 A;  2JUL A;  2K61 A;  2M1K B;  2L98 A;  2Y4Q A;  4JKT A;  2BNX A;  4C0J A;  4DCK A;  2ZRT A;  1UP5 A;  1W7I B;  3VB1 A;  1SL9 A;  4L9M A;  1R2U A;  3EVU A;  3GK2 A;  4IL1 A;  1FW4 A;  1DGV A;  2EC6 B;  2FCD A;  1EJ3 A;  1ORG A;  1FBV A;  1OMD A;  3PLF B;  1V1F A;  1BG1 A;  3D10 A;  3Q8I A;  4C0K A;  3PM2 A;  1W7J B;  1K2H A;  1TNQ A;  5I2L A;  1S6C A;  4CLN A;  3CAB A;  2JNX A;  4QJ3 B;  5CPV A;  3VRO A;  3EG5 B;  3SG2 A;  1L2O B;  3TS5 C;  4PHN A;  1MR8 A;  1QX5 B;  2LNK A;  4NDD A;  1EG3 A;  1OZS A;  1PK0 D;  2JWW A;  2KQY A;  1N2D A;  3B86 A;  3I5I B;  3RZS A;  1B4C A;  3I5G C;  1H8B A;  2LCP A;  2BKI B;  3BXK A;  1B8R A;  2HF5 A;  3ICB A;  2WCE A;  3CYZ A;  4NDB A;  2M3W A;  1ZFS A;  3CGA A;  5I2Q A;  3HCM A;  2DOQ A;  3AKB A;  3FS7 A;  1GM0 A;  2LC5 A;  1WDC C;  1NSH A;  4WRI A;  1DJW A;  3BFH A;  1S5G Z;  4GNK B;  1WRL A;  3GK4 X;  2Y1N A;  1SY9 A;  1TCF A;  3IQQ A;  1V1G A;  1OOG A;  1SK6 D;  1TN4 A;  2SAS A;  4P5O E;  1Z4H A;  4YGD B;  5AXI A;  2BE6 A;  2KNE A;  4QJ4 B;  1SKT A;  1IQ5 A;  4ORC B;  2A4J A;  1YVL A;  1S1E A;  4MZJ A;  3SG4 A;  5I2O A;  1Y1X A;  1B8C A;  5D3O A;  3PN7 C;  2PAL A;  4HRG A;  2KAX A;  1SR6 B;  2KGR A;  5FI6 A;  1RK9 A;  2PYQ A;  1EG4 A;  1KK8 C;  3BFB A;  3IF7 A;  2K2A A;  4JWQ A;  1S26 D;  5CSN A;  3LLE A;  2L4H A;  1PVB A;  2CBL A;  4DIR A;  3CR4 X;  1KFU L;  2MJW B;  4USL A;  4YBH B;  3S0G A;  1F55 A;  2JT8 A;  4INX A;  1FF1 A;  1K93 D;  3D0Y A;  2F8P A;  3FE6 A;  4OKH A;  5TNC A;  1CMG A;  1NX2 A;  2NCO A;  2E30 A;  1H4B A;  1YRU B;  1UHJ A;  4MRY A;  2PAS A;  3RM1 A;  1A2X A;  2JZI A;  1BT6 A;  4MEW A;  5FI2 A;  1J7O A;  2KQ6 A;  1SBJ A;  3JVT C;  2BL0 C;  2CXJ A;  2KFG A;  2KI4 B;  4OR9 B;  2JXL A;  2AAO A;  1IJ6 A;  3AKA A;  5ER5 A;  3H4S E;  3VRP A;  3B87 A;  1BLQ A;  1YR5 A;  3NSI A;  2ERB A;  4GPL B;  2I2R E;  4F7F A;  1JBA A;  4PE1 A;  1M46 A;  2NLN A;  2LMV A;  4IJ7 A;  3O2P A;  5I8N A;  2F3Z A;  1IJ5 A;  2LMT A;  3S0A A;  1XFW O;  2KYC A;  2WCB A;  3QME A;  2TN4 A;  1CFD A;  1QS7 A;  1ODB A;  1DEL A;  4DS7 A;  3D77 A;  1KWO C;  1LKJ A;  1S3P A;  2HPS A;  1IGV A;  2OTG B;  3DXL A;  1B1G A;  3D75 A;  4N5X A;  1XFR A;  3PAT A;  3JTD C;  1HQV A;  3SG3 A;  1TOP A;  4GGF C;  1NYA A;  2JPO A;  4YGE B;  4I5N B;  1KFX L;  4YGA A;  3M0W A;  4XJK B;  4MN0 A;  3SG6 A;  2OS8 B;  1J1D A;  2JPT A;  1GGW A;  1TUZ A;  1AK8 A;  1AUI B;  4YGC B;  1CFF A;  2AMI A;  2BEC A;  1U5I B;  4NDC A;  1SCM C;  1QIV A;  2Q91 A;  3B88 A;  5KTY A;  2PVB A;  1DMO A;  2PSR A;  2LAN A;  3KO0 A;  1N65 A;  1MF8 B;  1J55 A;  4PHK A;  3EKH A;  1IG5 A;  1GGZ A;  1B9A A;  1J1E A;  3PSR A;  1N0Y A;  2G2B A;  4GGF A;  1BF5 A;  4WQ2 A;  2LUX A;  5AFP A;  1DF0 A;  1MXE A;  3IVT A;  3OP0 A;  4UPG A;  3CS1 A;  4HRE E;  2QEB A;  3NHT A;  4P2Y B;  1RJV A;  1IQ3 A;  1K9U A;  3BOW B;  5FI7 A;  2WC5 A;  4C0L A;  2CCM A;  1WLZ A;  1R6P A;  5CSF A;  1Y6W A;  1B47 A;  4GUK A;  4NQG A;  1KK7 Y;  1DQE A;  2P6B B;  3TDZ A;  3B7A A;  1TTX A;  2JT3 A;  5ER4 X;  1Y1U A;  1P28 A;  3EVR A;  1XVJ A;  2BAP A;  2WOR A;  5KU1 A;  4KYN A;  3BUX B;  3R1V A;  1K9P A;  1WLM A;  4HRH A;  2HET A;  1B7T Y;  3IQO A;  1NIW A;  5EL2 A;  1ZAC A;  3OX6 A;  1WY9 A;  2BL0 B;  2FOT A;  1NX3 A;  3SS5 A;  3EK7 A;  2Y5I A;  2JRF A;  1W9Z A;  2RGI A;  4JD9 A;  3SS3 A;  1B8L A;  1DJG A;  4OVN F;  3R1P A;  1RTP 1;  2F2P A;  2L4I A;  2LHI A;  1DEK A;  4I5J A;  2LLS A;  4JQ0 D;  5KSZ A;  1IWQ A;  5IBW A;  2WCF A;  3TUY B;  1PAL A;  5HKZ A;  1S6I A;  2K8M B;  1OMV A;  1A03 A;  3GK1 A;  4A4C A;  1BOD A;  1DC1 A;  3PFV A;  1KQM C;  1UUS A;  3E3R A;  4WQ3 A;  3BJH A;  1YUR A;  1TNW A;  1S36 A;  2JTZ A;  1ALW A;  4GBA A;  2M7N A;  2H8V A;  3DZT A;  1GJY A;  4FQO A;  1RFJ A;  2K7C A;  2JTT A;  5HLV A;  1HT9 A;  1QLS A;  2D8N A;  2LVJ A;  3I5H C;  3CLN A;  4JPZ B;  1NPQ A;  1REC A;  3B6X A;  1A29 A;  1G4Y R;  1PSB A;  1TNX A;  4MSP A;  3SJS A;  1DTL A;  1E8A A;  4BY4 A;  1F70 A;  1EL4 A;  2E6W A;  1XK4 C;  2PMY A;  1BR1 B;  1PRW A;  4GGN A;  3KF9 A;  1J7R A;  1DT7 B;  4MRX A;  4M2P A;  2P71 A;  1UHI A;  2BBM A;  4QJ5 B;  2G9B A;  1NCZ A;  3VRN A;  2NXQ A;  1CM1 A;  2KLE A;  2EGD A;  2M0R A;  3AAK A;  1C07 A;  2F2O A;  2WCM A;  2MBX A;  1DJY A;  1G8I A;  2LVK A;  1FPW A;  1M63 B;  1NWD A;  1SNL A;  1G33 A;  2GV5 A;  4R1E A;  3TZ1 A;  2NCP A;  4A4B A;  4M2O A;  1ZOT B;  4INW A;  4MLW A;  4AQI A;  3ZNI A;  1XK4 A;  1CDP A;  1SW8 A;  1YUU A;  1K94 A;  4I5L B;  1IH0 A;  2LMU A;  1JUO A;  5PAL A;  4MZK A;  2KFF A;  2M97 A;  2JOJ A;  2KBM A;  2IS9 A;  2PQL A;  5B8I B;  3OBV A;  1MHO A;  1C7V A;  2H2K A;  1OOJ A;  2Q4U A;  5AER A;  1AVS A;  2R2I A;  5JOL A;  2K7O A;  5AEQ A;  5HYD A;  3DF0 A;  1EXR A;  1MWN A;  1T14 A;  1A75 A;  2KYF A;  1F71 A;  1LA3 A;  1F4Q A;  1QAT A;  5JJG A;  2KDH A;  3FE9 A;  3VRQ A;  2ZFD A;  2L5X B;  1K8U A;  1S5G Y;  1JC2 A;  5DKN A;  1CTR A;  3SS4 A;  3TS5 B;  3LL8 B;  1KSO A;  2BBN A;  3QRX A;  2ZRS A;  4ICB A;  4MVF A;  1NCY A;  4HSZ A;  2I18 A;  2EC6 C;  3FWC A;  4OZD A;  2LAP A;  3I5G B;  3DVK A;  3OHM B;  1QVI Y;  3L47 A;  3PM8 A;  2FJU B;  1LVC D;  2MLE C;  3K21 A;  1Z2C B;  2H61 C;  1L2O C;  2LP2 A;  4PT1 A;  1BR4 B;  3S0F A;  1WDC B;  3DVE A;  4CFR A;  2JNF A;  3GOF A;  2KGB C;  1LIN A;  4PDZ A;  4Q04 A;  2WCJ A;  2JXC A;  3PJI A;  3I5I C;  1IIO A;  1JWD A;  3C1V A;  2LUC A;  1CLL A;  1K96 A;  2KBI A;  4MBE A;  4DRW A;  2WC6 A;  1SCV A;  1C3Y A;  4XYN A;  5DKR A;  2EHB A;  5D69 A;  2MLF C;  3D0Y B;  3D73 A;  1TCO B;  1QAS A;  4PCW A;  4PE4 A;  5HKY A;  1UHK A;  3PN7 B;  3MSE B;  2NZ0 A;  2PRU A;  1QIW A;  2H61 A;  1M39 A;  2KLD A;  1C3Z A;  5AAN A;  5K89 A;  1DVI A;  2FJY A;  3D76 A;  4GFT A;  1CFP A;  1DJX A;  1KK8 B;  4FTG A;  3SIA A;  1FI6 A;  1BMO A;  1PSR A;  1LS8 A;  1L7Z A;  2COL B;  4PAL A;  1BJF A;  3EKJ A;  1X02 A;  3FE8 A;  2I7A A;  4CFQ A;  1KCY A;  3TDU A;  1Y1A A;  2P70 A;  2GGZ A;  3DY9 A;  3RLZ A;  3CR2 A;  4PE0 A;  1CNP A;  3OX5 A;  2GGM A;  1QV0 A;  3PAL A;  1CFC A;  3JVT B;  4CID A;  1DJH A;  1TIZ A;  1OOH A;  1CKK A;  1ZMZ A;  2WCH A;  4M2Q A;  2M9G A;  1BU3 A;  3DD4 A;  3EK4 A;  1MXL C;  3NXA A;  3KPX A;  1GQM A;  1LA0 A;  3SIB A;  3DYE A;  2YGU A;  4CPV A;  3R72 A;  4ORB B;  1KQV A;  3OGN A;  1YRT B;  3A4U B;  2M29 A;  1SSE B;  2KI4 C;  1PVA A;  1KWO B; 
#chains in the Genus database with same CATH homology
 2P71 A;  3S0A A;  3QME A;  2WCM A;  3D77 A;  1OW4 A;  3DXL A;  3D75 A;  1XFR A;  3CZ2 A;  1OOF A;  3L4L A;  3NHI A;  1OOI X;  3S0B A;  2QEH A;  4FQT A;  4INW A;  3D74 A;  2JPO A;  2PQL A;  3K1E A;  3L4A A;  2QEO A;  3B88 A;  3VB1 A;  1T14 A;  3FE9 A;  1ORG A;  3CZ1 A;  3Q8I A;  1TUJ A;  3CAB A;  3V2L A;  2KPH A;  3S0E A;  2QEB A;  4OZD A;  3NHT A;  1TWO A;  2WC5 A;  3L47 A;  3B86 A;  4PT1 A;  1DQE A;  3S0F A;  3RZS A;  3B7A A;  1QWV A;  1P28 A;  3CYZ A;  2QDI A;  2WCJ A;  3PJI A;  3BFA A;  3R1V A;  2L2C A;  1C3Y A;  2WC6 A;  3BFH A;  5EL2 A;  3D73 A;  1OOG A;  3S0D A;  2QEV A;  4JD9 A;  1C3Z A;  2WCL A;  3R1P A;  2FJY A;  3D76 A;  3D78 A;  1LS8 A;  3CZ0 A;  3CDN A;  3FE8 A;  3BFB A;  2P70 A;  3DY9 A;  5DIC A;  3BJH A;  3S0G A;  3N7H A;  4INX A;  3FE6 A;  2H8V A;  3DZT A;  1OOH A;  2WCH A;  3B6X A;  1GM0 A;  3DYE A;  3R72 A;  3B87 A;  2WCK A;  2ERB A;  4F7F A;  2GTE A;  3OGN A;  3NGV A;  3R1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...